BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig11775

Length=1388
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009616023.1|  PREDICTED: uncharacterized protein LOC104108647    388   0.0      Nicotiana tomentosiformis
ref|XP_009783972.1|  PREDICTED: uncharacterized protein LOC104232454    382   0.0      Nicotiana sylvestris
ref|XP_004230310.1|  PREDICTED: uncharacterized protein LOC101249681    388   0.0      
ref|XP_006344767.1|  PREDICTED: uncharacterized protein LOC102580046    385   0.0      Solanum tuberosum [potatoes]
ref|XP_007208429.1|  hypothetical protein PRUPE_ppa000798mg             369   1e-175   Prunus persica
ref|XP_008246002.1|  PREDICTED: uncharacterized protein LOC103344152    368   3e-175   Prunus mume [ume]
ref|XP_008370375.1|  PREDICTED: uncharacterized protein LOC103433867    359   5e-174   Malus domestica [apple tree]
ref|XP_009373286.1|  PREDICTED: uncharacterized protein LOC103962316    359   2e-171   Pyrus x bretschneideri [bai li]
ref|XP_008359849.1|  PREDICTED: uncharacterized protein LOC103423542    354   2e-171   
ref|XP_002318950.2|  hypothetical protein POPTR_0013s00990g             364   2e-170   
emb|CDP18254.1|  unnamed protein product                                355   3e-170   Coffea canephora [robusta coffee]
ref|XP_002282109.1|  PREDICTED: uncharacterized protein LOC100264846    348   5e-170   Vitis vinifera
gb|EYU40497.1|  hypothetical protein MIMGU_mgv1a000785mg                357   1e-169   Erythranthe guttata [common monkey flower]
ref|XP_011023781.1|  PREDICTED: uncharacterized protein LOC105125162    359   1e-167   Populus euphratica
ref|XP_007031155.1|  Uncharacterized protein isoform 1                  360   2e-167   
ref|XP_007031156.1|  Uncharacterized protein isoform 2                  360   2e-167   
ref|XP_011092150.1|  PREDICTED: uncharacterized protein LOC105172430    356   3e-167   Sesamum indicum [beniseed]
ref|XP_011466140.1|  PREDICTED: uncharacterized protein LOC101313...    356   8e-166   Fragaria vesca subsp. vesca
ref|XP_012088883.1|  PREDICTED: uncharacterized protein LOC105647...    353   1e-165   Jatropha curcas
ref|XP_004302237.1|  PREDICTED: uncharacterized protein LOC101313...    356   1e-165   Fragaria vesca subsp. vesca
ref|XP_012088889.1|  PREDICTED: uncharacterized protein LOC105647...    352   1e-165   Jatropha curcas
ref|XP_006433539.1|  hypothetical protein CICLE_v10000144mg             341   1e-165   Citrus clementina [clementine]
gb|KJB81104.1|  hypothetical protein B456_013G129500                    353   2e-164   Gossypium raimondii
gb|KJB81106.1|  hypothetical protein B456_013G129500                    353   3e-164   Gossypium raimondii
gb|KJB81105.1|  hypothetical protein B456_013G129500                    353   4e-164   Gossypium raimondii
ref|XP_006472204.1|  PREDICTED: uncharacterized protein LOC102623618    337   5e-164   Citrus sinensis [apfelsine]
gb|KHG26706.1|  Protein EFR3 B                                          355   1e-163   Gossypium arboreum [tree cotton]
gb|KHG26707.1|  Efr3b                                                   355   1e-163   Gossypium arboreum [tree cotton]
ref|XP_010092978.1|  hypothetical protein L484_018915                   334   1e-163   
ref|XP_002512512.1|  conserved hypothetical protein                     348   2e-163   
gb|KJB45453.1|  hypothetical protein B456_007G306600                    353   1e-162   Gossypium raimondii
gb|KHG02153.1|  Protein EFR3                                            352   3e-162   Gossypium arboreum [tree cotton]
ref|XP_010267985.1|  PREDICTED: uncharacterized protein LOC104605...    340   1e-161   Nelumbo nucifera [Indian lotus]
ref|XP_010267987.1|  PREDICTED: uncharacterized protein LOC104605...    339   1e-161   Nelumbo nucifera [Indian lotus]
gb|KEH43106.1|  cyclin-like protein                                     343   2e-161   Medicago truncatula
ref|XP_004495652.1|  PREDICTED: uncharacterized protein LOC101508...    337   2e-160   
emb|CAN82509.1|  hypothetical protein VITISV_012725                     315   4e-160   Vitis vinifera
ref|XP_003555181.1|  PREDICTED: uncharacterized protein LOC100788290    335   2e-159   
ref|XP_003536043.1|  PREDICTED: uncharacterized protein LOC100785...    333   3e-159   Glycine max [soybeans]
ref|XP_006589118.1|  PREDICTED: uncharacterized protein LOC100785...    333   3e-159   
ref|XP_010024133.1|  PREDICTED: uncharacterized protein LOC104414673    335   4e-159   Eucalyptus grandis [rose gum]
ref|XP_010546763.1|  PREDICTED: uncharacterized protein LOC104818746    353   2e-157   Tarenaya hassleriana [spider flower]
ref|XP_007145003.1|  hypothetical protein PHAVU_007G201500g             327   2e-156   Phaseolus vulgaris [French bean]
ref|NP_198037.3|  uncharacterized protein                               347   3e-154   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002872241.1|  hypothetical protein ARALYDRAFT_489516             346   7e-154   
ref|XP_010421542.1|  PREDICTED: uncharacterized protein LOC104706...    342   1e-153   Camelina sativa [gold-of-pleasure]
ref|XP_006394915.1|  hypothetical protein EUTSA_v10003593mg             348   1e-153   Eutrema salsugineum [saltwater cress]
ref|XP_006394914.1|  hypothetical protein EUTSA_v10003593mg             348   2e-153   Eutrema salsugineum [saltwater cress]
ref|XP_010493942.1|  PREDICTED: protein EFR3 homolog B-like isofo...    342   2e-153   Camelina sativa [gold-of-pleasure]
ref|XP_010455044.1|  PREDICTED: uncharacterized protein LOC104736707    343   2e-153   Camelina sativa [gold-of-pleasure]
ref|XP_004144747.1|  PREDICTED: uncharacterized protein LOC101202927    317   1e-152   Cucumis sativus [cucumbers]
ref|XP_008453377.1|  PREDICTED: uncharacterized protein LOC103494111    318   1e-152   Cucumis melo [Oriental melon]
ref|XP_010493940.1|  PREDICTED: protein EFR3 homolog B-like isofo...    337   4e-152   Camelina sativa [gold-of-pleasure]
ref|XP_009111721.1|  PREDICTED: protein EFR3 homolog B-like             339   6e-152   Brassica rapa
emb|CDX87029.1|  BnaC09g03440D                                          341   6e-152   
emb|CDY19753.1|  BnaA09g04060D                                          337   2e-151   Brassica napus [oilseed rape]
dbj|BAC41892.1|  unknown protein                                        333   4e-150   Arabidopsis thaliana [mouse-ear cress]
gb|AAB61061.1|  Hypothetical protein F2P16.24                           335   5e-149   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006840435.1|  PREDICTED: uncharacterized protein LOC18430213     324   1e-146   Amborella trichopoda
ref|XP_010674649.1|  PREDICTED: protein EFR3 homolog A                  318   6e-140   Beta vulgaris subsp. vulgaris [field beet]
emb|CDX80597.1|  BnaC07g28470D                                          306   8e-140   
ref|XP_009384437.1|  PREDICTED: uncharacterized protein LOC103971...    306   2e-138   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009384434.1|  PREDICTED: uncharacterized protein LOC103971...    305   2e-138   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008781115.1|  PREDICTED: uncharacterized protein LOC103700...    308   8e-138   Phoenix dactylifera
ref|XP_008781114.1|  PREDICTED: protein EFR3 homolog cmp44E-like ...    308   1e-137   
gb|ABF95548.1|  cyclin, putative, expressed                             295   2e-137   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010921489.1|  PREDICTED: uncharacterized protein LOC105045026    304   2e-137   Elaeis guineensis
ref|XP_008808672.1|  PREDICTED: uncharacterized protein LOC103720...    305   2e-137   Phoenix dactylifera
ref|XP_008808671.1|  PREDICTED: uncharacterized protein LOC103720...    304   3e-137   Phoenix dactylifera
ref|NP_001049903.1|  Os03g0308200                                       295   6e-137   
ref|XP_006649970.1|  PREDICTED: uncharacterized protein LOC102701065    297   2e-136   Oryza brachyantha
ref|XP_004984608.1|  PREDICTED: uncharacterized protein LOC101782956    297   1e-135   Setaria italica
ref|XP_010938251.1|  PREDICTED: uncharacterized protein LOC105057...    307   4e-135   Elaeis guineensis
ref|XP_010938250.1|  PREDICTED: uncharacterized protein LOC105057...    306   5e-135   
ref|XP_010228707.1|  PREDICTED: uncharacterized protein LOC100831...    291   4e-134   Brachypodium distachyon [annual false brome]
ref|XP_003558072.1|  PREDICTED: uncharacterized protein LOC100831...    291   4e-134   Brachypodium distachyon [annual false brome]
ref|XP_002465372.1|  hypothetical protein SORBIDRAFT_01g037420          296   7e-134   Sorghum bicolor [broomcorn]
emb|CDX88246.1|  BnaA06g28370D                                          301   8e-134   
ref|XP_008646153.1|  PREDICTED: uncharacterized protein LOC100384...    296   6e-133   
ref|XP_009151505.1|  PREDICTED: uncharacterized protein LOC103874824    299   6e-133   
ref|XP_008646145.1|  PREDICTED: uncharacterized protein LOC100384...    292   1e-131   Zea mays [maize]
gb|EAZ26671.1|  hypothetical protein OsJ_10574                          236   2e-119   Oryza sativa Japonica Group [Japonica rice]
gb|EMS54754.1|  Protein EFR3-like protein A                             232   1e-116   Triticum urartu
gb|EMT28557.1|  Protein EFR3-like protein                               231   2e-115   
ref|XP_008778937.1|  PREDICTED: protein EFR3 homolog cmp44E-like        305   9e-112   
ref|XP_006287016.1|  hypothetical protein CARUB_v10000164mg             227   1e-108   
dbj|BAH57285.1|  AT5G26850                                              228   6e-108   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006838291.1|  PREDICTED: uncharacterized protein LOC18428932     265   5e-100   Amborella trichopoda
ref|XP_008798151.1|  PREDICTED: uncharacterized protein LOC103713119    267   3e-98    Phoenix dactylifera
ref|XP_008784320.1|  PREDICTED: uncharacterized protein LOC103703...    263   1e-97    Phoenix dactylifera
ref|XP_008784316.1|  PREDICTED: protein EFR3 homolog isoform X1         263   1e-97    
ref|XP_008784321.1|  PREDICTED: uncharacterized protein LOC103703...    263   1e-97    Phoenix dactylifera
ref|XP_009405043.1|  PREDICTED: uncharacterized protein LOC103988214    264   8e-96    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011048039.1|  PREDICTED: uncharacterized protein LOC105142218    247   1e-95    Populus euphratica
ref|XP_009401306.1|  PREDICTED: uncharacterized protein LOC103985362    259   2e-95    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010257179.1|  PREDICTED: uncharacterized protein LOC104597...    257   2e-95    Nelumbo nucifera [Indian lotus]
ref|XP_009391228.1|  PREDICTED: uncharacterized protein LOC103977445    260   3e-95    Musa acuminata subsp. malaccensis [pisang utan]
gb|KDO81672.1|  hypothetical protein CISIN_1g0461821mg                  270   4e-95    Citrus sinensis [apfelsine]
ref|XP_008443197.1|  PREDICTED: uncharacterized protein LOC103486...    253   5e-95    Cucumis melo [Oriental melon]
ref|XP_002322714.1|  cyclin-related family protein                      251   2e-94    
ref|XP_009393518.1|  PREDICTED: uncharacterized protein LOC103979184    260   2e-94    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002277870.1|  PREDICTED: uncharacterized protein LOC100255...    249   2e-94    Vitis vinifera
ref|XP_010653791.1|  PREDICTED: uncharacterized protein LOC100255...    249   2e-94    Vitis vinifera
ref|XP_004309822.1|  PREDICTED: uncharacterized protein LOC101313...    257   2e-94    Fragaria vesca subsp. vesca
ref|XP_011457274.1|  PREDICTED: uncharacterized protein LOC101313...    257   2e-94    Fragaria vesca subsp. vesca
ref|XP_011652158.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    249   5e-94    Cucumis sativus [cucumbers]
ref|XP_007203221.1|  hypothetical protein PRUPE_ppa000725mg             254   6e-94    
gb|EPS68493.1|  hypothetical protein M569_06272                         258   7e-94    Genlisea aurea
ref|XP_011078902.1|  PREDICTED: uncharacterized protein LOC105162543    256   9e-94    Sesamum indicum [beniseed]
gb|KGN59399.1|  hypothetical protein Csa_3G816120                       249   9e-94    Cucumis sativus [cucumbers]
ref|XP_002529611.1|  conserved hypothetical protein                     246   2e-93    
ref|XP_011033324.1|  PREDICTED: protein EFR3 homolog B-like isofo...    247   6e-93    Populus euphratica
ref|XP_011033323.1|  PREDICTED: uncharacterized protein LOC105131...    247   6e-93    Populus euphratica
ref|XP_010057214.1|  PREDICTED: uncharacterized protein LOC104445...    249   7e-93    Eucalyptus grandis [rose gum]
ref|XP_010057221.1|  PREDICTED: uncharacterized protein LOC104445...    249   7e-93    Eucalyptus grandis [rose gum]
gb|KCW90195.1|  hypothetical protein EUGRSUZ_A02368                     249   7e-93    Eucalyptus grandis [rose gum]
ref|XP_010241506.1|  PREDICTED: uncharacterized protein LOC104586...    252   1e-92    Nelumbo nucifera [Indian lotus]
ref|XP_010241507.1|  PREDICTED: uncharacterized protein LOC104586...    251   1e-92    Nelumbo nucifera [Indian lotus]
ref|XP_002264735.1|  PREDICTED: uncharacterized protein LOC100264...    256   4e-92    Vitis vinifera
ref|XP_004304390.1|  PREDICTED: uncharacterized protein LOC101298629    251   5e-92    Fragaria vesca subsp. vesca
ref|XP_004250744.1|  PREDICTED: uncharacterized protein LOC101250...    259   5e-92    Solanum lycopersicum
ref|XP_012086147.1|  PREDICTED: uncharacterized protein LOC105645...    242   5e-92    Jatropha curcas
ref|XP_010313082.1|  PREDICTED: uncharacterized protein LOC101250...    259   5e-92    Solanum lycopersicum
ref|XP_004951914.1|  PREDICTED: uncharacterized protein LOC101783...    246   5e-92    Setaria italica
emb|CDP18636.1|  unnamed protein product                                247   8e-92    Coffea canephora [robusta coffee]
ref|XP_006352098.1|  PREDICTED: uncharacterized protein LOC102584...    259   8e-92    Solanum tuberosum [potatoes]
ref|XP_006352099.1|  PREDICTED: uncharacterized protein LOC102584...    259   1e-91    Solanum tuberosum [potatoes]
ref|XP_009355500.1|  PREDICTED: uncharacterized protein LOC103946512    254   3e-91    Pyrus x bretschneideri [bai li]
ref|XP_009789122.1|  PREDICTED: protein EFR3 homolog B isoform X2       251   1e-90    Nicotiana sylvestris
ref|XP_009789124.1|  PREDICTED: protein EFR3 homolog B isoform X3       251   1e-90    Nicotiana sylvestris
ref|XP_009789120.1|  PREDICTED: protein EFR3 homolog B isoform X1       251   1e-90    Nicotiana sylvestris
ref|XP_009610937.1|  PREDICTED: protein EFR3 homolog B isoform X2       248   1e-90    Nicotiana tomentosiformis
ref|XP_009610949.1|  PREDICTED: protein EFR3 homolog B isoform X4       248   1e-90    Nicotiana tomentosiformis
ref|XP_009610919.1|  PREDICTED: protein EFR3 homolog B isoform X1       248   1e-90    Nicotiana tomentosiformis
ref|XP_009610943.1|  PREDICTED: protein EFR3 homolog B isoform X3       248   1e-90    Nicotiana tomentosiformis
ref|XP_009379627.1|  PREDICTED: uncharacterized protein LOC103968...    250   1e-90    
ref|XP_009379628.1|  PREDICTED: uncharacterized protein LOC103968...    249   2e-90    Pyrus x bretschneideri [bai li]
ref|XP_008222533.1|  PREDICTED: uncharacterized protein LOC103322398    248   2e-90    Prunus mume [ume]
ref|XP_009789125.1|  PREDICTED: protein EFR3 homolog B isoform X4       251   5e-90    Nicotiana sylvestris
ref|XP_009610957.1|  PREDICTED: protein EFR3 homolog B isoform X5       249   7e-90    Nicotiana tomentosiformis
ref|XP_006350204.1|  PREDICTED: protein EFR3 homolog B-like isofo...    248   1e-89    Solanum tuberosum [potatoes]
ref|XP_004236620.1|  PREDICTED: protein EFR3 homolog B isoform X2       249   1e-89    Solanum lycopersicum
ref|XP_010319191.1|  PREDICTED: protein EFR3 homolog B isoform X1       249   1e-89    Solanum lycopersicum
gb|KEH23652.1|  cyclin-like protein                                     247   1e-89    Medicago truncatula
ref|XP_007225374.1|  hypothetical protein PRUPE_ppa000810mg             248   2e-89    Prunus persica
ref|XP_007028781.1|  Uncharacterized protein isoform 1                  241   2e-89    
ref|XP_006648302.1|  PREDICTED: uncharacterized protein LOC102704216    244   2e-89    Oryza brachyantha
ref|XP_010319193.1|  PREDICTED: protein EFR3 homolog B isoform X3       249   2e-89    Solanum lycopersicum
ref|XP_007028783.1|  Uncharacterized protein isoform 3                  241   3e-89    
dbj|BAK01387.1|  predicted protein                                      263   3e-89    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006350206.1|  PREDICTED: protein EFR3 homolog B-like isofo...    248   3e-89    
ref|XP_009363645.1|  PREDICTED: uncharacterized protein LOC103953608    244   4e-89    Pyrus x bretschneideri [bai li]
ref|XP_010666756.1|  PREDICTED: uncharacterized protein LOC104883885    245   7e-89    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006421414.1|  hypothetical protein CICLE_v10006843mg             247   9e-89    
dbj|BAK04246.1|  predicted protein                                      242   1e-88    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_001770437.1|  predicted protein                                  204   1e-88    
gb|EEE56284.1|  hypothetical protein OsJ_05346                          239   2e-88    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004493504.1|  PREDICTED: uncharacterized protein LOC101511...    243   2e-88    Cicer arietinum [garbanzo]
ref|XP_004493505.1|  PREDICTED: uncharacterized protein LOC101511...    243   2e-88    Cicer arietinum [garbanzo]
ref|NP_001045867.1|  Os02g0143200                                       239   2e-88    
gb|EEC72466.1|  hypothetical protein OsI_05818                          239   5e-88    Oryza sativa Indica Group [Indian rice]
ref|XP_006489936.1|  PREDICTED: uncharacterized protein LOC102624456    244   5e-88    Citrus sinensis [apfelsine]
ref|NP_001048304.1|  Os02g0780500                                       241   7e-88    
ref|XP_010930207.1|  PREDICTED: uncharacterized protein LOC105051451    250   8e-88    Elaeis guineensis
ref|XP_010546486.1|  PREDICTED: uncharacterized protein LOC104818...    241   9e-88    
gb|EYU20743.1|  hypothetical protein MIMGU_mgv1a000711mg                240   2e-87    Erythranthe guttata [common monkey flower]
ref|XP_010546363.1|  PREDICTED: uncharacterized protein LOC104818...    238   5e-87    
ref|XP_006648006.1|  PREDICTED: protein EFR3 homolog B-like isofo...    241   1e-86    Oryza brachyantha
ref|XP_010555004.1|  PREDICTED: uncharacterized protein LOC104824606    249   1e-86    
tpg|DAA53702.1|  TPA: hypothetical protein ZEAMMB73_302622              233   2e-85    
ref|XP_009142010.1|  PREDICTED: uncharacterized protein LOC103865...    237   3e-85    
ref|XP_008655586.1|  PREDICTED: uncharacterized protein LOC103634...    231   3e-85    Zea mays [maize]
ref|XP_009142011.1|  PREDICTED: uncharacterized protein LOC103865...    237   3e-85    Brassica rapa
ref|XP_009142012.1|  PREDICTED: uncharacterized protein LOC103865...    237   3e-85    Brassica rapa
ref|XP_009142008.1|  PREDICTED: uncharacterized protein LOC103865...    237   3e-85    
ref|XP_008673097.1|  PREDICTED: uncharacterized protein LOC100381...    233   4e-85    
emb|CDY14788.1|  BnaC04g47850D                                          238   6e-85    Brassica napus [oilseed rape]
ref|XP_002457472.1|  hypothetical protein SORBIDRAFT_03g007790          237   7e-85    
emb|CDY06905.1|  BnaA04g24100D                                          238   1e-84    
ref|XP_010257180.1|  PREDICTED: uncharacterized protein LOC104597...    221   1e-84    
ref|XP_006293443.1|  hypothetical protein CARUB_v10022560mg             242   1e-84    Capsella rubella
ref|XP_010505973.1|  PREDICTED: uncharacterized protein LOC104782671    239   2e-84    Camelina sativa [gold-of-pleasure]
ref|XP_002533049.1|  conserved hypothetical protein                     224   2e-84    Ricinus communis
ref|XP_006411452.1|  hypothetical protein EUTSA_v10016171mg             239   3e-84    Eutrema salsugineum [saltwater cress]
ref|XP_007162228.1|  hypothetical protein PHAVU_001G134800g             238   6e-84    Phaseolus vulgaris [French bean]
ref|XP_007162229.1|  hypothetical protein PHAVU_001G134800g             237   8e-84    Phaseolus vulgaris [French bean]
ref|XP_011033325.1|  PREDICTED: uncharacterized protein LOC105131...    216   1e-83    Populus euphratica
ref|XP_010508669.1|  PREDICTED: uncharacterized protein LOC104785...    238   1e-83    Camelina sativa [gold-of-pleasure]
ref|XP_002309810.1|  hypothetical protein POPTR_0007s02020g             232   1e-83    
ref|XP_011026408.1|  PREDICTED: uncharacterized protein LOC105127...    232   3e-83    Populus euphratica
ref|XP_011026411.1|  PREDICTED: uncharacterized protein LOC105127...    232   3e-83    Populus euphratica
gb|KHN23227.1|  Protein EFR3 like cmp44E                                286   4e-83    Glycine soja [wild soybean]
ref|XP_004954123.1|  PREDICTED: protein EFR3 homolog B-like             233   4e-83    Setaria italica
ref|XP_002881801.1|  hypothetical protein ARALYDRAFT_483264             234   1e-82    
ref|XP_008655589.1|  PREDICTED: uncharacterized protein LOC103634...    221   3e-82    Zea mays [maize]
gb|KJB16447.1|  hypothetical protein B456_002G230500                    228   4e-82    Gossypium raimondii
ref|XP_008240995.1|  PREDICTED: uncharacterized protein LOC103339476    220   4e-82    Prunus mume [ume]
ref|XP_003570918.1|  PREDICTED: uncharacterized protein LOC100821...    225   7e-82    Brachypodium distachyon [annual false brome]
dbj|BAF00551.1|  hypothetical protein                                   232   2e-81    Arabidopsis thaliana [mouse-ear cress]
ref|NP_181714.3|  uncharacterized protein                               232   2e-81    Arabidopsis thaliana [mouse-ear cress]
ref|XP_012066154.1|  PREDICTED: uncharacterized protein LOC105629221    217   7e-81    Jatropha curcas
ref|XP_008647477.1|  PREDICTED: uncharacterized protein LOC100217...    218   2e-80    Zea mays [maize]
ref|XP_010094723.1|  hypothetical protein L484_003597                   271   3e-80    
ref|XP_008647478.1|  PREDICTED: uncharacterized protein LOC100217...    218   3e-80    
ref|XP_010413002.1|  PREDICTED: uncharacterized protein LOC104699388    225   3e-80    
ref|XP_006417969.1|  hypothetical protein EUTSA_v10006704mg             223   2e-79    
emb|CDX79909.1|  BnaA05g02470D                                          228   3e-79    
ref|NP_563755.1|  ARM repeat superfamily protein                        221   1e-77    Arabidopsis thaliana [mouse-ear cress]
gb|AAK56279.1|AF367291_1  At1g05960/T21E18_20                           221   2e-77    Arabidopsis thaliana [mouse-ear cress]
gb|AAF80120.1|AC024174_2  Contains similarity to an unknown prote...    220   3e-77    Arabidopsis thaliana [mouse-ear cress]
gb|KHG08769.1|  Protein EFR3 B                                          201   1e-76    Gossypium arboreum [tree cotton]
ref|XP_010932401.1|  PREDICTED: uncharacterized protein LOC105053...    266   2e-76    
gb|KJB46322.1|  hypothetical protein B456_007G360200                    196   8e-76    Gossypium raimondii
ref|XP_003591099.1|  EFR3-like protein                                  247   1e-75    
ref|XP_007031157.1|  Uncharacterized protein isoform 3                  259   2e-74    
ref|NP_001154308.1|  ARM repeat superfamily protein                     208   1e-73    Arabidopsis thaliana [mouse-ear cress]
ref|XP_012065587.1|  PREDICTED: uncharacterized protein LOC105628722    260   2e-73    Jatropha curcas
ref|XP_010241226.1|  PREDICTED: uncharacterized protein LOC104585...    259   5e-73    Nelumbo nucifera [Indian lotus]
ref|XP_006858684.1|  PREDICTED: uncharacterized protein LOC18448561     259   7e-73    Amborella trichopoda
ref|XP_008231409.1|  PREDICTED: uncharacterized protein LOC103330592    259   9e-73    Prunus mume [ume]
ref|XP_007218911.1|  hypothetical protein PRUPE_ppa000649mg             258   1e-72    
ref|XP_002968494.1|  hypothetical protein SELMODRAFT_90004              254   7e-72    
ref|XP_002975992.1|  hypothetical protein SELMODRAFT_443103             255   1e-71    
ref|XP_010523668.1|  PREDICTED: protein EFR3 homolog isoform X2         254   2e-71    Tarenaya hassleriana [spider flower]
ref|XP_010523667.1|  PREDICTED: protein EFR3 homolog isoform X1         254   2e-71    Tarenaya hassleriana [spider flower]
ref|XP_004308677.1|  PREDICTED: uncharacterized protein LOC101307642    254   5e-71    Fragaria vesca subsp. vesca
ref|XP_006657548.1|  PREDICTED: uncharacterized protein LOC102712271    253   6e-71    Oryza brachyantha
gb|EMS53000.1|  Protein EFR3-like protein B                             253   6e-71    Triticum urartu
ref|XP_011075240.1|  PREDICTED: uncharacterized protein LOC105159...    252   2e-70    Sesamum indicum [beniseed]
ref|XP_011075238.1|  PREDICTED: uncharacterized protein LOC105159...    252   2e-70    Sesamum indicum [beniseed]
gb|EMT11310.1|  hypothetical protein F775_16040                         252   2e-70    
ref|XP_009625867.1|  PREDICTED: protein EFR3 homolog isoform X2         251   2e-70    Nicotiana tomentosiformis
ref|XP_009625862.1|  PREDICTED: protein EFR3 homolog isoform X1         251   3e-70    
gb|EAY92960.1|  hypothetical protein OsI_14753                          236   4e-70    Oryza sativa Indica Group [Indian rice]
ref|NP_197607.5|  uncharacterized protein                               250   7e-70    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002874031.1|  hypothetical protein ARALYDRAFT_489019             250   8e-70    
ref|XP_003605757.1|  EFR3-like protein                                  249   1e-69    Medicago truncatula
ref|XP_006286974.1|  hypothetical protein CARUB_v10000121mg             249   1e-69    Capsella rubella
ref|XP_010420957.1|  PREDICTED: uncharacterized protein LOC104706460    249   1e-69    Camelina sativa [gold-of-pleasure]
ref|XP_003540587.1|  PREDICTED: uncharacterized protein LOC100816475    249   1e-69    Glycine max [soybeans]
ref|XP_010493228.1|  PREDICTED: uncharacterized protein LOC104770495    249   1e-69    Camelina sativa [gold-of-pleasure]
ref|XP_002517810.1|  conserved hypothetical protein                     249   2e-69    
emb|CDP16550.1|  unnamed protein product                                247   6e-69    Coffea canephora [robusta coffee]
ref|XP_006587694.1|  PREDICTED: uncharacterized protein LOC100808352    247   1e-68    Glycine max [soybeans]
ref|XP_009124331.1|  PREDICTED: uncharacterized protein LOC103849280    247   1e-68    Brassica rapa
emb|CDY09095.1|  BnaA02g05210D                                          246   1e-68    Brassica napus [oilseed rape]
gb|KFK26320.1|  hypothetical protein AALP_AA8G232400                    246   1e-68    Arabis alpina [alpine rockcress]
ref|XP_007131432.1|  hypothetical protein PHAVU_011G013000g             246   3e-68    Phaseolus vulgaris [French bean]
gb|KHN11694.1|  Protein EFR3 like B                                     245   3e-68    Glycine soja [wild soybean]
emb|CDY48767.1|  BnaC04g02200D                                          188   3e-68    Brassica napus [oilseed rape]
ref|XP_007033975.1|  ARM repeat superfamily protein isoform 5           245   4e-68    
ref|XP_007033971.1|  ARM repeat superfamily protein isoform 1           245   4e-68    
ref|XP_002277709.2|  PREDICTED: uncharacterized protein LOC100265428    244   1e-67    Vitis vinifera
ref|XP_002308951.2|  cyclin-related family protein                      243   1e-67    
ref|XP_006400678.1|  hypothetical protein EUTSA_v10012553mg             243   2e-67    Eutrema salsugineum [saltwater cress]
ref|XP_004506319.1|  PREDICTED: uncharacterized protein LOC101489771    243   3e-67    Cicer arietinum [garbanzo]
ref|XP_011653815.1|  PREDICTED: uncharacterized protein LOC101219...    243   4e-67    Cucumis sativus [cucumbers]
ref|XP_004147289.1|  PREDICTED: uncharacterized protein LOC101219...    243   4e-67    Cucumis sativus [cucumbers]
ref|XP_008799995.1|  PREDICTED: uncharacterized protein LOC103714...    242   4e-67    Phoenix dactylifera
gb|KGN64805.1|  hypothetical protein Csa_1G108300                       242   4e-67    Cucumis sativus [cucumbers]
gb|KJB37960.1|  hypothetical protein B456_006G228200                    240   5e-67    Gossypium raimondii
gb|KJB49179.1|  hypothetical protein B456_008G105100                    241   7e-67    Gossypium raimondii
ref|XP_006597228.1|  PREDICTED: uncharacterized protein LOC100811...    241   8e-67    Glycine max [soybeans]
gb|KHG10450.1|  Protein EFR3                                            241   9e-67    Gossypium arboreum [tree cotton]
gb|KJB49180.1|  hypothetical protein B456_008G105100                    241   1e-66    Gossypium raimondii
gb|KJB71806.1|  hypothetical protein B456_011G143200                    239   1e-66    Gossypium raimondii
gb|KJB49178.1|  hypothetical protein B456_008G105100                    241   1e-66    Gossypium raimondii
ref|XP_010069300.1|  PREDICTED: protein EFR3 homolog B isoform X1       240   2e-66    Eucalyptus grandis [rose gum]
gb|KJB37959.1|  hypothetical protein B456_006G228200                    240   2e-66    Gossypium raimondii
ref|XP_008463083.1|  PREDICTED: uncharacterized protein LOC103501...    240   2e-66    Cucumis melo [Oriental melon]
ref|XP_008463075.1|  PREDICTED: uncharacterized protein LOC103501...    240   2e-66    Cucumis melo [Oriental melon]
gb|KCW57602.1|  hypothetical protein EUGRSUZ_H00374                     240   3e-66    Eucalyptus grandis [rose gum]
gb|KJB71809.1|  hypothetical protein B456_011G143200                    239   5e-66    Gossypium raimondii
ref|XP_010236037.1|  PREDICTED: uncharacterized protein LOC100837488    165   5e-66    
gb|KJB71808.1|  hypothetical protein B456_011G143200                    239   6e-66    Gossypium raimondii
gb|KJB71804.1|  hypothetical protein B456_011G143200                    239   6e-66    Gossypium raimondii
gb|KDO47320.1|  hypothetical protein CISIN_1g001882mg                   239   7e-66    Citrus sinensis [apfelsine]
gb|KDO47318.1|  hypothetical protein CISIN_1g001882mg                   238   7e-66    Citrus sinensis [apfelsine]
ref|XP_006345431.1|  PREDICTED: uncharacterized protein LOC102584593    239   7e-66    Solanum tuberosum [potatoes]
ref|XP_009789840.1|  PREDICTED: protein EFR3 homolog B-like isofo...    239   8e-66    
ref|XP_004229640.1|  PREDICTED: protein EFR3 homolog B-like             239   8e-66    
ref|XP_009789839.1|  PREDICTED: protein EFR3 homolog B-like isofo...    239   8e-66    
gb|KDO47319.1|  hypothetical protein CISIN_1g001882mg                   238   8e-66    
ref|XP_008461314.1|  PREDICTED: uncharacterized protein LOC103499...    238   1e-65    
gb|EEC81712.1|  hypothetical protein OsI_25322                          238   1e-65    
ref|NP_001059150.1|  Os07g0205900                                       238   1e-65    
ref|XP_003520520.1|  PREDICTED: uncharacterized protein LOC100817...    238   1e-65    
ref|XP_006576825.1|  PREDICTED: uncharacterized protein LOC100817...    238   2e-65    
gb|EYU27043.1|  hypothetical protein MIMGU_mgv1a000818mg                237   2e-65    
ref|XP_006595061.1|  PREDICTED: uncharacterized protein LOC100806...    237   3e-65    
ref|XP_009765963.1|  PREDICTED: protein EFR3 homolog cmp44E-like        221   3e-65    
ref|XP_004136123.2|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    236   5e-65    
gb|KEH39475.1|  cyclin-like protein                                     236   6e-65    
ref|XP_003597513.1|  EFR3-like protein                                  236   6e-65    
ref|XP_006478683.1|  PREDICTED: uncharacterized protein LOC102614...    236   7e-65    
gb|KHN30101.1|  Protein EFR3 like B                                     235   1e-64    
ref|XP_010421541.1|  PREDICTED: uncharacterized protein LOC104706...    230   1e-64    
ref|XP_004486920.1|  PREDICTED: uncharacterized protein LOC101509...    235   1e-64    
ref|XP_011087843.1|  PREDICTED: uncharacterized protein LOC105169196    234   2e-64    
gb|AFW70121.1|  hypothetical protein ZEAMMB73_889435                    234   2e-64    
ref|XP_008644196.1|  PREDICTED: uncharacterized protein LOC100501...    234   2e-64    
ref|XP_008644199.1|  PREDICTED: uncharacterized protein LOC100501...    234   2e-64    
ref|XP_008644200.1|  PREDICTED: uncharacterized protein LOC100501...    234   2e-64    
ref|XP_008644195.1|  PREDICTED: uncharacterized protein LOC100501...    234   2e-64    
ref|XP_008644198.1|  PREDICTED: uncharacterized protein LOC100501...    234   2e-64    
ref|XP_008644197.1|  PREDICTED: uncharacterized protein LOC100501...    234   2e-64    
ref|XP_008790619.1|  PREDICTED: uncharacterized protein LOC103707...    234   3e-64    
ref|XP_002451526.1|  hypothetical protein SORBIDRAFT_04g003310          233   5e-64    
ref|XP_010907685.1|  PREDICTED: uncharacterized protein LOC105034...    232   8e-64    
gb|EPS68833.1|  hypothetical protein M569_05934                         228   9e-64    
ref|XP_010907684.1|  PREDICTED: uncharacterized protein LOC105034...    232   1e-63    
ref|XP_010907683.1|  PREDICTED: uncharacterized protein LOC105034...    232   1e-63    
ref|XP_008673100.1|  PREDICTED: uncharacterized protein LOC100381...    232   1e-63    
ref|XP_008673099.1|  PREDICTED: uncharacterized protein LOC100381...    232   1e-63    
ref|XP_010907681.1|  PREDICTED: uncharacterized protein LOC105034...    232   1e-63    
ref|XP_010907682.1|  PREDICTED: uncharacterized protein LOC105034...    232   1e-63    
ref|XP_010454428.1|  PREDICTED: uncharacterized protein LOC104736187    232   1e-63    
ref|XP_010672158.1|  PREDICTED: uncharacterized protein LOC104888...    232   2e-63    
ref|XP_010672159.1|  PREDICTED: uncharacterized protein LOC104888...    232   2e-63    
ref|XP_004140882.1|  PREDICTED: uncharacterized protein LOC101203...    231   2e-63    
ref|XP_006592150.1|  PREDICTED: uncharacterized protein LOC100799...    231   2e-63    
ref|XP_008445732.1|  PREDICTED: uncharacterized protein LOC103488...    231   2e-63    
ref|XP_011656551.1|  PREDICTED: uncharacterized protein LOC101203...    231   2e-63    
ref|XP_008445731.1|  PREDICTED: uncharacterized protein LOC103488...    231   3e-63    
gb|KEH30318.1|  cyclin-like protein                                     231   3e-63    
gb|KHN25286.1|  Protein EFR3 like B                                     229   1e-62    
gb|KHN06209.1|  Protein EFR3 like B                                     229   2e-62    
ref|XP_003539042.1|  PREDICTED: uncharacterized protein LOC100817...    228   2e-62    
ref|XP_007150426.1|  hypothetical protein PHAVU_005G152600g             228   3e-62    
gb|EAY89716.1|  hypothetical protein OsI_11254                          227   5e-62    
ref|XP_012086148.1|  PREDICTED: uncharacterized protein LOC105645...    141   7e-62    
gb|KDO53678.1|  hypothetical protein CISIN_1g0359231mg                  211   8e-62    
ref|XP_004507331.1|  PREDICTED: uncharacterized protein LOC101496...    225   3e-61    
ref|XP_007131956.1|  hypothetical protein PHAVU_011G054800g             224   6e-61    
ref|XP_010457707.1|  PREDICTED: uncharacterized protein LOC104739144    223   2e-60    
ref|XP_010485557.1|  PREDICTED: uncharacterized protein LOC104763859    223   2e-60    
emb|CDY09999.1|  BnaC08g44520D                                          223   2e-60    
emb|CDY06190.1|  BnaA09g50130D                                          223   2e-60    
ref|XP_009118564.1|  PREDICTED: protein EFR3 homolog                    223   2e-60    
gb|KHG30683.1|  Protein EFR3 cmp44E                                     223   2e-60    
ref|XP_001767624.1|  predicted protein                                  221   3e-60    
ref|XP_010522184.1|  PREDICTED: uncharacterized protein LOC104800...    222   4e-60    
ref|XP_010522186.1|  PREDICTED: uncharacterized protein LOC104800...    222   4e-60    
ref|XP_009626575.1|  PREDICTED: protein EFR3 homolog B-like             206   8e-60    
ref|XP_006303900.1|  hypothetical protein CARUB_v10008206mg             220   1e-59    
emb|CDY63789.1|  BnaA08g31700D                                          220   2e-59    
ref|XP_006303899.1|  hypothetical protein CARUB_v10008206mg             220   2e-59    
emb|CDX86545.1|  BnaC08g01580D                                          219   3e-59    
ref|XP_010475319.1|  PREDICTED: uncharacterized protein LOC104754751    219   4e-59    
gb|EEE55815.1|  hypothetical protein OsJ_04415                          217   3e-58    
ref|NP_001045092.1|  Os01g0898300                                       217   3e-58    
ref|XP_009111018.1|  PREDICTED: protein EFR3 homolog isoform X3         216   4e-58    
ref|XP_009111016.1|  PREDICTED: protein EFR3 homolog isoform X1         216   4e-58    
ref|XP_006443048.1|  hypothetical protein CICLE_v100186802mg            201   4e-58    
ref|XP_004966105.1|  PREDICTED: uncharacterized protein LOC101758656    216   5e-58    
ref|XP_002892313.1|  predicted protein                                  219   5e-58    
gb|AFW69349.1|  hypothetical protein ZEAMMB73_015704                    215   1e-57    
ref|XP_008645036.1|  PREDICTED: uncharacterized protein LOC103626...    216   1e-57    
ref|XP_008645035.1|  PREDICTED: uncharacterized protein LOC103626...    216   1e-57    
emb|CDY10165.1|  BnaC05g04080D                                          214   1e-57    
ref|XP_008790620.1|  PREDICTED: uncharacterized protein LOC103707...    215   1e-57    
ref|XP_008790616.1|  PREDICTED: uncharacterized protein LOC103707...    215   2e-57    
gb|AFW84297.1|  hypothetical protein ZEAMMB73_469985                    213   2e-57    
ref|XP_009119100.1|  PREDICTED: uncharacterized protein LOC103844080    214   2e-57    
emb|CDY47707.1|  BnaA10g03960D                                          214   2e-57    
ref|XP_010557094.1|  PREDICTED: uncharacterized protein LOC104826...    214   3e-57    
ref|XP_004970911.1|  PREDICTED: uncharacterized protein LOC101769...    214   4e-57    
ref|XP_004970908.1|  PREDICTED: uncharacterized protein LOC101769...    213   4e-57    
ref|XP_007052501.1|  Uncharacterized protein TCM_005862                 213   4e-57    
gb|EMT12879.1|  hypothetical protein F775_15212                         213   4e-57    
ref|XP_010927191.1|  PREDICTED: uncharacterized protein LOC105049285    132   5e-57    
gb|AFW84299.1|  hypothetical protein ZEAMMB73_469985                    213   5e-57    
gb|AFW84298.1|  hypothetical protein ZEAMMB73_469985                    213   6e-57    
ref|XP_006350205.1|  PREDICTED: protein EFR3 homolog B-like isofo...    137   1e-56    
gb|KGN45115.1|  hypothetical protein Csa_7G426560                       212   2e-56    
ref|XP_006645172.1|  PREDICTED: uncharacterized protein LOC102710074    210   5e-56    
ref|XP_008443202.1|  PREDICTED: uncharacterized protein LOC103486...    124   6e-56    
ref|XP_010232688.1|  PREDICTED: uncharacterized protein LOC100842...    210   8e-56    
ref|XP_003564842.1|  PREDICTED: uncharacterized protein LOC100842...    209   9e-56    
ref|XP_010232687.1|  PREDICTED: uncharacterized protein LOC100842...    209   9e-56    
gb|EMS60662.1|  Protein EFR3-like protein                               208   2e-55    
emb|CDM85315.1|  unnamed protein product                                207   4e-55    
ref|XP_002456786.1|  hypothetical protein SORBIDRAFT_03g042720          207   4e-55    
gb|EMT06694.1|  Putative mitochondrial protein                          207   2e-54    
ref|XP_008644201.1|  PREDICTED: uncharacterized protein LOC100501...    206   2e-54    
ref|XP_008784322.1|  PREDICTED: uncharacterized protein LOC103703...    122   3e-54    
emb|CBI29857.3|  unnamed protein product                                125   2e-52    
ref|XP_010313083.1|  PREDICTED: uncharacterized protein LOC101250...    126   4e-52    
gb|KJB16446.1|  hypothetical protein B456_002G230500                    126   1e-51    
gb|KHN32414.1|  Protein EFR3 like B                                     198   1e-51    
ref|XP_008443203.1|  PREDICTED: uncharacterized protein LOC103486...    124   2e-51    
ref|XP_009610963.1|  PREDICTED: uncharacterized protein LOC104104...    117   3e-51    
gb|AAC02765.1|  hypothetical protein                                    196   4e-51    
ref|XP_008655590.1|  PREDICTED: uncharacterized protein LOC103634...    117   4e-51    
ref|XP_010319194.1|  PREDICTED: uncharacterized protein LOC101246...    117   3e-50    
ref|XP_006648008.1|  PREDICTED: protein EFR3 homolog B-like isofo...    120   3e-50    
ref|XP_010650558.1|  PREDICTED: uncharacterized protein LOC100264...    113   3e-49    
ref|XP_010523669.1|  PREDICTED: uncharacterized protein LOC104801...    190   1e-48    
ref|XP_010653792.1|  PREDICTED: uncharacterized protein LOC100255...    125   1e-47    
ref|XP_010313084.1|  PREDICTED: uncharacterized protein LOC101250...    110   1e-47    
ref|XP_008369216.1|  PREDICTED: uncharacterized protein LOC103432787    113   1e-47    
ref|XP_008461315.1|  PREDICTED: uncharacterized protein LOC103499...    186   2e-47    
ref|XP_004951915.1|  PREDICTED: uncharacterized protein LOC101783...    120   4e-47    
gb|AFW70125.1|  hypothetical protein ZEAMMB73_889435                    109   6e-47    
gb|KJB37958.1|  hypothetical protein B456_006G228200                    182   4e-46    
gb|KDP26045.1|  hypothetical protein JCGZ_21078                         125   7e-46    
gb|EYU18743.1|  hypothetical protein MIMGU_mgv1a0012531mg               166   2e-45    
ref|XP_008463089.1|  PREDICTED: uncharacterized protein LOC103501...    179   6e-45    
gb|KHN33312.1|  Protein EFR3 like B                                     177   1e-44    
gb|KHN25508.1|  RNA polymerase II-associated protein 3                  175   5e-44    
ref|XP_007028782.1|  Uncharacterized protein isoform 2                  117   1e-43    
ref|XP_010233799.1|  PREDICTED: uncharacterized protein LOC100821...    109   8e-43    
ref|XP_009142014.1|  PREDICTED: uncharacterized protein LOC103865...    108   1e-41    
ref|XP_010557096.1|  PREDICTED: uncharacterized protein LOC104826...    166   9e-41    
ref|XP_010092918.1|  hypothetical protein L484_004959                   130   9e-41    
gb|EPS74671.1|  hypothetical protein M569_00084                         151   1e-40    
ref|XP_011457275.1|  PREDICTED: uncharacterized protein LOC101313...    118   7e-40    
ref|XP_008354962.1|  PREDICTED: protein EFR3 homolog A-like             146   2e-38    
gb|KHN11423.1|  hypothetical protein glysoja_015318                     152   3e-36    
ref|XP_008355520.1|  PREDICTED: uncharacterized protein LOC103419180    139   9e-36    
ref|XP_006648007.1|  PREDICTED: protein EFR3 homolog B-like isofo...    108   2e-35    
emb|CAJ44368.1|  putative cyclin-related protein                        150   3e-35    
ref|XP_010097525.1|  hypothetical protein L484_024736                   137   1e-34    
ref|XP_006595062.1|  PREDICTED: uncharacterized protein LOC100806...    107   3e-34    
ref|XP_008350293.1|  PREDICTED: polygalacturonase ADPG2-like            136   3e-33    
gb|AFK33385.1|  unknown                                                 132   4e-33    
gb|KJB46323.1|  hypothetical protein B456_007G360200                    117   4e-33    
ref|XP_011653822.1|  PREDICTED: uncharacterized protein LOC101219...    142   1e-32    
emb|CBI24919.3|  unnamed protein product                                142   2e-32    
ref|XP_008463098.1|  PREDICTED: uncharacterized protein LOC103501...    141   2e-32    
ref|XP_008387322.1|  PREDICTED: uncharacterized protein LOC103449776    135   3e-32    
gb|EEC74114.1|  hypothetical protein OsI_09170                          135   4e-32    
gb|EEE57911.1|  hypothetical protein OsJ_08605                          140   5e-32    
gb|AES61350.2|  cyclin-like protein                                     127   1e-31    
gb|AAZ32853.1|  unknown                                                 127   1e-30    
gb|KJB46324.1|  hypothetical protein B456_007G360200                    117   2e-29    
ref|XP_010932402.1|  PREDICTED: uncharacterized protein LOC105053...    123   1e-26    
gb|KDO83457.1|  hypothetical protein CISIN_1g035569mg                   122   2e-26    
gb|EYU18742.1|  hypothetical protein MIMGU_mgv1a0012533mg               120   3e-26    
gb|AFK46351.1|  unknown                                                 116   4e-26    
ref|XP_008347368.1|  PREDICTED: uncharacterized protein LOC103410445    117   9e-26    
ref|XP_008350700.1|  PREDICTED: uncharacterized protein LOC103414060    120   1e-25    
ref|XP_009620064.1|  PREDICTED: uncharacterized protein LOC104111...    120   2e-25    
ref|XP_009620063.1|  PREDICTED: uncharacterized protein LOC104111...    120   2e-25    
gb|KHG10001.1|  hypothetical protein F383_03012                         114   3e-25    
gb|KHG10000.1|  hypothetical protein F383_03012                         114   3e-25    
ref|XP_008655591.1|  PREDICTED: uncharacterized protein LOC103634...    114   7e-25    
ref|XP_008790621.1|  PREDICTED: uncharacterized protein LOC103707...    114   1e-23    
ref|XP_010092917.1|  hypothetical protein L484_004958                   104   2e-23    
ref|XP_008800011.1|  PREDICTED: uncharacterized protein LOC103714...    113   4e-23    
gb|KHN07377.1|  hypothetical protein glysoja_012675                     112   6e-23    
ref|XP_009412884.1|  PREDICTED: uncharacterized protein LOC103994280    110   2e-22    
ref|XP_006443049.1|  hypothetical protein CICLE_v100186801mg            110   3e-22    
ref|XP_006478686.1|  PREDICTED: uncharacterized protein LOC102614...    110   3e-22    
ref|XP_004486921.1|  PREDICTED: uncharacterized protein LOC101509...    109   3e-22    
ref|XP_008350294.1|  PREDICTED: uncharacterized protein LOC103413615    109   4e-22    
ref|XP_010097526.1|  hypothetical protein L484_024737                   110   4e-22    
gb|AFW70122.1|  hypothetical protein ZEAMMB73_889435                    109   5e-22    
gb|AFW70124.1|  hypothetical protein ZEAMMB73_889435                    109   5e-22    
gb|AFW70123.1|  hypothetical protein ZEAMMB73_889435                    109   6e-22    
ref|XP_008644202.1|  PREDICTED: uncharacterized protein LOC100501...    108   6e-22    
ref|XP_008461316.1|  PREDICTED: uncharacterized protein LOC103499...    108   7e-22    
gb|ACN33230.1|  unknown                                                 107   1e-21    
gb|KEH43075.1|  cyclin, putative                                      97.4    4e-21    
ref|XP_006597231.1|  PREDICTED: uncharacterized protein LOC100811...    106   4e-21    
ref|XP_006597230.1|  PREDICTED: uncharacterized protein LOC100811...    106   4e-21    
gb|KDO53677.1|  hypothetical protein CISIN_1g0359232mg                  106   6e-21    
ref|XP_010241227.1|  PREDICTED: uncharacterized protein LOC104585...    105   9e-21    
ref|XP_010069302.1|  PREDICTED: uncharacterized protein LOC104456...    105   1e-20    
ref|XP_006590941.1|  PREDICTED: uncharacterized protein LOC100817...    105   1e-20    
ref|XP_009784840.1|  PREDICTED: uncharacterized protein LOC104233...    105   1e-20    
ref|XP_009784839.1|  PREDICTED: uncharacterized protein LOC104233...    105   1e-20    
ref|XP_009784842.1|  PREDICTED: uncharacterized protein LOC104233...    104   2e-20    
ref|XP_010557097.1|  PREDICTED: uncharacterized protein LOC104826...    104   2e-20    
ref|XP_010522187.1|  PREDICTED: uncharacterized protein LOC104800...    104   2e-20    
ref|XP_003636946.1|  Mitogen-activated protein kinase                   103   3e-20    
gb|KJB71812.1|  hypothetical protein B456_011G143200                    101   2e-19    
ref|XP_010672160.1|  PREDICTED: uncharacterized protein LOC104888...    100   4e-19    
ref|XP_006303898.1|  hypothetical protein CARUB_v10008206mg           99.8    7e-19    
ref|XP_007033976.1|  ARM repeat superfamily protein isoform 6         99.0    1e-18    
ref|XP_010102566.1|  hypothetical protein L484_018038                 96.7    7e-18    
gb|KJB71039.1|  hypothetical protein B456_011G101600                  89.4    2e-17    
ref|XP_009111017.1|  PREDICTED: protein EFR3 homolog isoform X2       95.5    2e-17    
gb|KJB71038.1|  hypothetical protein B456_011G101600                  87.0    1e-16    
gb|KDO81671.1|  hypothetical protein CISIN_1g0461822mg                84.0    2e-16    
gb|KCW57606.1|  hypothetical protein EUGRSUZ_H00374                   92.0    2e-16    
ref|XP_006482855.1|  PREDICTED: uncharacterized protein LOC102612183  85.1    4e-16    
ref|XP_006439087.1|  hypothetical protein CICLE_v10033334mg           84.7    6e-14    
ref|XP_005846281.1|  hypothetical protein CHLNCDRAFT_135622           73.2    3e-11    
gb|EAZ45073.1|  hypothetical protein OsJ_29714                        71.2    7e-11    
ref|XP_001689991.1|  predicted protein                                70.9    8e-10    
ref|XP_002405516.1|  transmembrane protein cmp44E, putative           69.7    4e-09    
gb|EPS66114.1|  hypothetical protein M569_08663                       65.5    1e-08    
ref|XP_005457730.1|  PREDICTED: protein EFR3 homolog A-like isofo...  65.1    2e-08    
ref|XP_002585860.1|  hypothetical protein BRAFLDRAFT_256891           65.9    2e-08    
ref|XP_005457731.1|  PREDICTED: protein EFR3 homolog A-like isofo...  64.3    3e-08    
ref|XP_004359079.1|  hypothetical protein DFA_01104                   66.2    4e-08    
ref|XP_003744820.1|  PREDICTED: protein EFR3 homolog B-like           66.2    4e-08    
ref|XP_008286006.1|  PREDICTED: protein EFR3 homolog A                65.5    7e-08    
ref|XP_008333292.1|  PREDICTED: protein EFR3 homolog A isoform X1     65.5    7e-08    



>ref|XP_009616023.1| PREDICTED: uncharacterized protein LOC104108647 [Nicotiana tomentosiformis]
Length=993

 Score =   388 bits (996),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 181/220 (82%), Positives = 200/220 (91%), Gaps = 0/220 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG +SRKLFPAC +MCICCPA+RSRSRQPVKRYKKLLA+IFPK+PDGS N RKI+KLCEY
Sbjct  1    MGFISRKLFPACGNMCICCPAMRSRSRQPVKRYKKLLAEIFPKTPDGSPNDRKIVKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            AAKNPFRIPKIAK LEERC+KELRS H K +NVIAEVYN+LLCMCKEQMACFA +LL++V
Sbjct  61   AAKNPFRIPKIAKYLEERCHKELRSEHIKFINVIAEVYNKLLCMCKEQMACFAASLLDMV  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
            VE+LD +K DA++ IGC T T+FIYSQVDGTYTYNIE LV KVCSLARETGEE QK  LR
Sbjct  121  VELLDDSKRDAIRIIGCQTLTRFIYSQVDGTYTYNIETLVPKVCSLARETGEEHQKCSLR  180

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNYEPDAH  804
            ASSL+CLSAMVWFMAEFSHIFADFDEIVHVTLDNYEP+ H
Sbjct  181  ASSLQCLSAMVWFMAEFSHIFADFDEIVHVTLDNYEPEIH  220


 Score =   294 bits (753),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 142/195 (73%), Positives = 159/195 (82%), Gaps = 1/195 (1%)
 Frame = +2

Query  806   NEDDERGEAHHNWVDEVIRSEGRDVGNENRPGYLIRKRPDKKDISLLTSEEIEMPKIWAH  985
             NED ERGEAHHNWVDEV+RSEGR VG E  P ++IR RPDKKD SLLT EEIE PK+WA 
Sbjct  221   NEDFERGEAHHNWVDEVVRSEGRAVGTEYGPCHIIRPRPDKKDPSLLTREEIETPKVWAQ  280

Query  986   ICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSGNHQLI  1165
             IC+++MADLAKESSTMRRVLDPMF+HFD+ +HW   HGLA + LSD+ Y VESSGN QLI
Sbjct  281   ICLEKMADLAKESSTMRRVLDPMFVHFDHGRHWASPHGLAVMALSDMIYLVESSGNQQLI  340

Query  1166  LTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKSLQAT  1345
             LTGV+RHLDHKNVA D Q  S+VIQTATALAR IR G   SD+ FVSDLCRHLRKSLQAT
Sbjct  341   LTGVIRHLDHKNVAHDPQTMSYVIQTATALARLIRLGARLSDVRFVSDLCRHLRKSLQAT  400

Query  1346  VDLAGE-EINLNLTL  1387
             V+   E E+N NL L
Sbjct  401   VESVQEQELNFNLAL  415



>ref|XP_009783972.1| PREDICTED: uncharacterized protein LOC104232454 [Nicotiana sylvestris]
Length=991

 Score =   382 bits (982),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 179/220 (81%), Positives = 198/220 (90%), Gaps = 2/220 (1%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG +SRKLFPAC +MCICCPA+RSRSRQPVKRYKKLLA+IFPK+PDGS N RKI+KLCEY
Sbjct  1    MGFISRKLFPACGNMCICCPAMRSRSRQPVKRYKKLLAEIFPKTPDGSPNDRKIVKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            AAKNPFRIPKIAK LEERC+KELRS H K +NVIAEVYN+LLCMCKEQMACFA +LL++V
Sbjct  61   AAKNPFRIPKIAKYLEERCHKELRSEHIKFINVIAEVYNKLLCMCKEQMACFAASLLDMV  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
            VE+LD +K DA++ IGC T T+FIYSQVDGTYTYNIE LV KVCSLARETGEE Q   LR
Sbjct  121  VELLDDSKRDAIRIIGCQTLTRFIYSQVDGTYTYNIETLVPKVCSLARETGEEHQN--LR  178

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNYEPDAH  804
            ASSL+CLSAMVWFMAEFSHIF DFDEIVHVTLDNYEP+ H
Sbjct  179  ASSLQCLSAMVWFMAEFSHIFVDFDEIVHVTLDNYEPEIH  218


 Score =   291 bits (746),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 140/195 (72%), Positives = 160/195 (82%), Gaps = 1/195 (1%)
 Frame = +2

Query  806   NEDDERGEAHHNWVDEVIRSEGRDVGNENRPGYLIRKRPDKKDISLLTSEEIEMPKIWAH  985
             NED ERGEAHHNWVDEV+RSEGR VG+E  P ++ R RPDKKD SLLT EE E PK+WA 
Sbjct  219   NEDFERGEAHHNWVDEVVRSEGRAVGSEYGPCHITRPRPDKKDPSLLTREETETPKVWAQ  278

Query  986   ICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSGNHQLI  1165
             IC+++MADLAKESSTMRRVLDPMF+HFD+ +HW   HGLA +VLSD+ Y VESSGN +LI
Sbjct  279   ICLEKMADLAKESSTMRRVLDPMFVHFDHGRHWASLHGLAVMVLSDMIYLVESSGNQELI  338

Query  1166  LTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKSLQAT  1345
             LTGV+RHLDHKNVA D Q+ S+VIQTATALAR IR G   SD+ FVSDLCRHLRKSLQAT
Sbjct  339   LTGVIRHLDHKNVAHDPQMMSYVIQTATALARLIRLGARLSDVRFVSDLCRHLRKSLQAT  398

Query  1346  VDLAGE-EINLNLTL  1387
             V+   E E+N NL L
Sbjct  399   VESVQEQELNFNLAL  413



>ref|XP_004230310.1| PREDICTED: uncharacterized protein LOC101249681 [Solanum lycopersicum]
Length=988

 Score =   388 bits (997),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 181/220 (82%), Positives = 198/220 (90%), Gaps = 0/220 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG +SRKLFPAC +MCICCPA+RSRSRQPVKRYKKLLA+IFPKSPDGS N RKI+KLCEY
Sbjct  1    MGFISRKLFPACGNMCICCPAMRSRSRQPVKRYKKLLAEIFPKSPDGSPNERKIVKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            AAKNPFRIPKIAK LEERCYKELRS H K +NVIAEVYN+LLCMCKEQMA FA +LL++V
Sbjct  61   AAKNPFRIPKIAKYLEERCYKELRSEHIKFINVIAEVYNKLLCMCKEQMAYFAASLLDMV  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
            VE+LD +K DAV+  GC T T+FIYSQVDGTYTYNIE LV KVCSLARETGEE +KR LR
Sbjct  121  VELLDDSKKDAVRITGCQTLTRFIYSQVDGTYTYNIETLVPKVCSLARETGEEHEKRSLR  180

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNYEPDAH  804
            ASSL+CLSAMVWFMAEFSHIF DFDEIVHVTLDNYEP+ H
Sbjct  181  ASSLQCLSAMVWFMAEFSHIFVDFDEIVHVTLDNYEPEMH  220


 Score =   284 bits (727),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 141/195 (72%), Positives = 158/195 (81%), Gaps = 2/195 (1%)
 Frame = +2

Query  806   NEDDERGEAHHNWVDEVIRSEGRDVGNENRPGYLIRKRPDKKDISLLTSEEIEMPKIWAH  985
             NED ERGEAHHNWVDEV+RSEGR VG+E  P   IR RPDKKD S LT EEIE PK+WA 
Sbjct  221   NEDFERGEAHHNWVDEVVRSEGRAVGSEFGPRQ-IRPRPDKKDPSSLTREEIETPKVWAQ  279

Query  986   ICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSGNHQLI  1165
             IC++RMADLA+ESSTMRRVL+PMF+HFD+ +HWV  HG A +VLSD+ YFVESSGN QLI
Sbjct  280   ICLERMADLAEESSTMRRVLEPMFVHFDHGRHWVSPHGSAVMVLSDMIYFVESSGNQQLI  339

Query  1166  LTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKSLQAT  1345
             LTGV+RHLDHKNVA D Q KS+VIQTATALAR IR     SD+ FV DLCRHLRKSLQAT
Sbjct  340   LTGVIRHLDHKNVAHDPQTKSYVIQTATALARLIRLEASLSDVRFVGDLCRHLRKSLQAT  399

Query  1346  VDLAGE-EINLNLTL  1387
             V+   E E+N NL L
Sbjct  400   VESVQEQELNFNLAL  414



>ref|XP_006344767.1| PREDICTED: uncharacterized protein LOC102580046 [Solanum tuberosum]
Length=993

 Score =   385 bits (989),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 180/220 (82%), Positives = 197/220 (90%), Gaps = 0/220 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG +SRKLFPAC +MCICCPA+RSRSRQPVKRYKKLLA+IFPKSPDGS N RKI+KLCEY
Sbjct  1    MGFISRKLFPACGNMCICCPAMRSRSRQPVKRYKKLLAEIFPKSPDGSPNERKIVKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            AAKNPFRIPKIAK LEERCYKELRS H K +NVIAEVYN+LLCMCKEQMA FA +LL++V
Sbjct  61   AAKNPFRIPKIAKYLEERCYKELRSEHIKFINVIAEVYNKLLCMCKEQMAYFAASLLDMV  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
            VE+LD +K DAV+  GC T T+FIYSQVDGTYTYNIE LV KVCSLARETGEE +KR LR
Sbjct  121  VELLDDSKKDAVRITGCQTLTRFIYSQVDGTYTYNIETLVPKVCSLARETGEEHEKRSLR  180

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNYEPDAH  804
            ASSL+CLSAMVWFMAE SHIF DFDEIVHVTLDNYEP+ H
Sbjct  181  ASSLQCLSAMVWFMAEVSHIFVDFDEIVHVTLDNYEPEMH  220


 Score =   281 bits (718),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 141/196 (72%), Positives = 160/196 (82%), Gaps = 3/196 (2%)
 Frame = +2

Query  806   NEDDERGEAHHNWVDEVIRSEGRDVGNENRPGYLIRKRPDKKDISLLTSEEIEMPKIWAH  985
             NED ERGEAHHNWVDEV+RSEGR VG+E  P   IR RPDKKD S LT EEIE PK+WA 
Sbjct  221   NEDFERGEAHHNWVDEVVRSEGRAVGSEFGPCQ-IRPRPDKKDPSSLTREEIETPKVWAQ  279

Query  986   ICIQRMADLAKESSTMRRVLDPMFIHFDNNK-HWVPRHGLAFVVLSDLSYFVESSGNHQL  1162
             IC++RMADLA+ESSTMRRVL+PMF+HFD+ + HWV  HGLA +VLSD+ YFVESSGN QL
Sbjct  280   ICLERMADLAEESSTMRRVLEPMFVHFDHGRQHWVSPHGLAVMVLSDMIYFVESSGNQQL  339

Query  1163  ILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKSLQA  1342
             ILTGV+RHLD+KNVA D Q+KS+VIQTATALAR IR     SD+ FV DLCRHLRKSLQA
Sbjct  340   ILTGVIRHLDNKNVAHDPQMKSYVIQTATALARLIRLEASLSDVRFVGDLCRHLRKSLQA  399

Query  1343  TVDLAGE-EINLNLTL  1387
             TV+   E E+N NL L
Sbjct  400   TVESVQEQELNFNLAL  415



>ref|XP_007208429.1| hypothetical protein PRUPE_ppa000798mg [Prunus persica]
 gb|EMJ09628.1| hypothetical protein PRUPE_ppa000798mg [Prunus persica]
Length=1000

 Score =   369 bits (946),  Expect(2) = 1e-175, Method: Compositional matrix adjust.
 Identities = 168/220 (76%), Positives = 194/220 (88%), Gaps = 0/220 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG++SRKLFPACESMCICCPA+RSRSRQPVKRYKKLLA+IFPKSPDG  N RKI+KLCEY
Sbjct  1    MGIISRKLFPACESMCICCPAMRSRSRQPVKRYKKLLAEIFPKSPDGPPNERKIVKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            AAKNPFRIPKIAK LE+RCYKELR  H K +N++AE YN+LLC+CKEQMA FAV+LL+VV
Sbjct  61   AAKNPFRIPKIAKYLEDRCYKELRLEHVKFINIVAEAYNKLLCLCKEQMAYFAVSLLSVV  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
             E+LD  K D ++ +GC T T+FI+SQ DGTYT+ IE+LV +VC LARE+GE+ QKRCLR
Sbjct  121  TELLDNPKQDPLRILGCQTLTRFIFSQTDGTYTHTIESLVHRVCKLARESGEDHQKRCLR  180

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNYEPDAH  804
            ASSL+CLSAMV FMAEFS+IF DFDEIVHVTLDNYEPD H
Sbjct  181  ASSLQCLSAMVQFMAEFSYIFVDFDEIVHVTLDNYEPDTH  220


 Score =   277 bits (708),  Expect(2) = 1e-175, Method: Compositional matrix adjust.
 Identities = 133/197 (68%), Positives = 160/197 (81%), Gaps = 4/197 (2%)
 Frame = +2

Query  809   EDDERGEAHHNWVDEVIRSEGRD--VGNENRPGY-LIRKRPDKKDISLLTSEEIEMPKIW  979
             EDDERGE HHNWVDEV+RSEGR   VG +  P   +IR RP+KKD SLLT EEIE PK+W
Sbjct  222   EDDERGEPHHNWVDEVVRSEGRVGVVGADASPSCKIIRPRPEKKDPSLLTREEIETPKVW  281

Query  980   AHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSGNHQ  1159
             A ICIQRM +LAKES+TMRRVLDPMF++FD+  HWVP  GLA +VLSD+SYF+E+SGN +
Sbjct  282   AQICIQRMIELAKESTTMRRVLDPMFVYFDSGHHWVPCQGLAMLVLSDMSYFMEASGNQK  341

Query  1160  LILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKSLQ  1339
             LIL  V+RHLDHKN++ D Q+KS+V+Q A+ALA QIRSG   ++IGFVSDLCRHLRKSLQ
Sbjct  342   LILAYVIRHLDHKNISHDPQLKSYVVQVASALASQIRSGAVLAEIGFVSDLCRHLRKSLQ  401

Query  1340  ATVDLAGE-EINLNLTL  1387
             AT +  GE E N+N+ L
Sbjct  402   ATAESVGEQESNINIML  418



>ref|XP_008246002.1| PREDICTED: uncharacterized protein LOC103344152 [Prunus mume]
Length=999

 Score =   368 bits (944),  Expect(2) = 3e-175, Method: Compositional matrix adjust.
 Identities = 168/220 (76%), Positives = 193/220 (88%), Gaps = 0/220 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG++SRKLFPACESMCICCPA+RSRSRQPVKRYKKLLA+IFPKSPDG  N RKI+KLCEY
Sbjct  1    MGIISRKLFPACESMCICCPAMRSRSRQPVKRYKKLLAEIFPKSPDGPPNERKIVKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            AAKNPFRIPKIAK LE+RCYKELR  H K +N++AE YN+LLC+CKEQMA FAV+LL+VV
Sbjct  61   AAKNPFRIPKIAKYLEDRCYKELRLEHIKFINIVAEAYNKLLCLCKEQMAYFAVSLLSVV  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
             E+LD  K D +  +GC T T+FIYSQ DGTYT+ IE+LV +VC LARE+GE+ Q+RCLR
Sbjct  121  TELLDNPKQDPLGILGCQTLTRFIYSQTDGTYTHTIESLVHRVCKLARESGEDHQRRCLR  180

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNYEPDAH  804
            ASSL+CLSAMV FMAEFS+IF DFDEIVHVTLDNYEPD H
Sbjct  181  ASSLQCLSAMVQFMAEFSYIFVDFDEIVHVTLDNYEPDTH  220


 Score =   277 bits (708),  Expect(2) = 3e-175, Method: Compositional matrix adjust.
 Identities = 132/197 (67%), Positives = 160/197 (81%), Gaps = 4/197 (2%)
 Frame = +2

Query  809   EDDERGEAHHNWVDEVIRSEGRD--VGNENRPGY-LIRKRPDKKDISLLTSEEIEMPKIW  979
             EDDERGE HHNWVDEV+RSEGR   VG +  P   +IR RP+K+D SLLT EEIE PK+W
Sbjct  222   EDDERGEPHHNWVDEVVRSEGRVGVVGTDASPSCKIIRPRPEKRDPSLLTREEIETPKVW  281

Query  980   AHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSGNHQ  1159
             A ICIQRM +LAKES+TMRRVLDPMF++FD+  HWVP  GLA +VLSD+SYF+E+SGN +
Sbjct  282   AQICIQRMIELAKESTTMRRVLDPMFVYFDSGHHWVPCQGLAMLVLSDMSYFMEASGNQK  341

Query  1160  LILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKSLQ  1339
             LIL  V+RHLDHKN++ D Q+KS+V+Q A+ALA QIRSG   ++IGFVSDLCRHLRKSLQ
Sbjct  342   LILAYVIRHLDHKNISHDPQLKSYVVQVASALASQIRSGAVLAEIGFVSDLCRHLRKSLQ  401

Query  1340  ATVDLAGE-EINLNLTL  1387
             AT +  GE E N+N+ L
Sbjct  402   ATAESVGEQESNINIML  418



>ref|XP_008370375.1| PREDICTED: uncharacterized protein LOC103433867 [Malus domestica]
Length=997

 Score =   359 bits (921),  Expect(2) = 5e-174, Method: Compositional matrix adjust.
 Identities = 165/220 (75%), Positives = 192/220 (87%), Gaps = 2/220 (1%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MGL+SRKLFPACESMCICCPA+RSRSRQPVKRYKKLLA+IFPK+PDG  N RKI+KLCEY
Sbjct  1    MGLISRKLFPACESMCICCPAMRSRSRQPVKRYKKLLAEIFPKAPDGPPNERKIVKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            AAKNPFRIPKIAK LE+RCYKELR GH K +N++A+ YN+LLC+CKEQMACFAV+L++VV
Sbjct  61   AAKNPFRIPKIAKYLEDRCYKELRLGHIKFINIVADTYNKLLCLCKEQMACFAVSLVSVV  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
             E+LD +K D V+ +GC T T FIYSQ D TYT+ IE+LV KVC LAR++GE+ Q   LR
Sbjct  121  TELLDNSKQDTVRILGCQTLTNFIYSQTDCTYTHTIESLVHKVCKLARQSGEDQQ--SLR  178

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNYEPDAH  804
            ASSL+CLSAMV FMAEFS+IF DFDEI+HVTLDNYEPD H
Sbjct  179  ASSLQCLSAMVKFMAEFSYIFVDFDEIIHVTLDNYEPDTH  218


 Score =   281 bits (720),  Expect(2) = 5e-174, Method: Compositional matrix adjust.
 Identities = 134/198 (68%), Positives = 163/198 (82%), Gaps = 4/198 (2%)
 Frame = +2

Query  806   NEDDERGEAHHNWVDEVIRSEGRD--VGNENRPGY-LIRKRPDKKDISLLTSEEIEMPKI  976
             NEDDERG+ HHNWVDEV+RSE R   VG++  P + +IR RP+KKD +LLT EEIE PK+
Sbjct  219   NEDDERGQLHHNWVDEVVRSESRVGVVGDDASPRFKIIRPRPEKKDPALLTREEIETPKV  278

Query  977   WAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSGNH  1156
             WA ICIQRM +L+KES+TMRRVLDPMF++FD+  HWVPR GLA +VLSD+SYF+E+SGN 
Sbjct  279   WAQICIQRMIELSKESTTMRRVLDPMFVYFDSGHHWVPRQGLAMLVLSDMSYFMEASGNQ  338

Query  1157  QLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKSL  1336
             QLILT V+RHLDHKN++ D Q+KS VIQ A+ALA QIRSG   ++IGFVSDLCRHLRKSL
Sbjct  339   QLILTYVIRHLDHKNISQDPQLKSSVIQVASALASQIRSGAVLAEIGFVSDLCRHLRKSL  398

Query  1337  QATVDLAGE-EINLNLTL  1387
             QAT +  GE E N+N+ L
Sbjct  399   QATAESVGEQESNINIML  416



>ref|XP_009373286.1| PREDICTED: uncharacterized protein LOC103962316 [Pyrus x bretschneideri]
Length=997

 Score =   359 bits (922),  Expect(2) = 2e-171, Method: Compositional matrix adjust.
 Identities = 166/220 (75%), Positives = 191/220 (87%), Gaps = 2/220 (1%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG++SRKLFPACESMCICCPA+RSRSRQPVKRYKKLLA+IFPKSPDG  N RKI+KLCEY
Sbjct  1    MGVISRKLFPACESMCICCPAMRSRSRQPVKRYKKLLAEIFPKSPDGPPNERKIVKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            AAKNPFRIPKIAK LE+RCYKELR  H K +N++ E YN+LLC+CKEQMACFAV+L++VV
Sbjct  61   AAKNPFRIPKIAKYLEDRCYKELRLEHIKFINIVVEAYNKLLCLCKEQMACFAVSLVHVV  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
             E+LD +K DA++ +GC T T FIYSQ DGTYT+ IE+LV KVC LAR++GE  Q   LR
Sbjct  121  TELLDNSKQDAMRILGCQTLTNFIYSQTDGTYTHTIESLVHKVCKLARQSGEVHQ--SLR  178

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNYEPDAH  804
            ASSL+CLSAMV FMAEFS+IF DFDEIVHVTLDNYEPD H
Sbjct  179  ASSLQCLSAMVRFMAEFSYIFVDFDEIVHVTLDNYEPDTH  218


 Score =   273 bits (697),  Expect(2) = 2e-171, Method: Compositional matrix adjust.
 Identities = 130/198 (66%), Positives = 161/198 (81%), Gaps = 4/198 (2%)
 Frame = +2

Query  806   NEDDERGEAHHNWVDEVIRSEGRD--VGNENRPGY-LIRKRPDKKDISLLTSEEIEMPKI  976
             NEDDERG+ +HNWVDEV+RSE R   VG++  P   +IR RP+KKD +LLT EE+E PK+
Sbjct  219   NEDDERGQPYHNWVDEVVRSESRVGVVGDDASPSCKIIRPRPEKKDPALLTREEMETPKV  278

Query  977   WAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSGNH  1156
             WA ICIQRM +L+KES+T+RRVLDPMF++FD+  HWVPR GLA +VLSD+SYF+E+SGN 
Sbjct  279   WAQICIQRMIELSKESTTLRRVLDPMFVYFDSGHHWVPRQGLAMLVLSDMSYFMEASGNQ  338

Query  1157  QLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKSL  1336
             QLIL  V+RHLDHKN++ D Q+KS VIQ A+ALA QIRSG   ++IGFVSDLCRHLRKSL
Sbjct  339   QLILAHVIRHLDHKNISHDPQLKSSVIQVASALASQIRSGAVLAEIGFVSDLCRHLRKSL  398

Query  1337  QATVDLAGE-EINLNLTL  1387
             QAT +  GE E N+N+ L
Sbjct  399   QATAESDGEQESNINIML  416



>ref|XP_008359849.1| PREDICTED: uncharacterized protein LOC103423542 [Malus domestica]
 ref|XP_008359850.1| PREDICTED: uncharacterized protein LOC103423542 [Malus domestica]
Length=997

 Score =   354 bits (908),  Expect(2) = 2e-171, Method: Compositional matrix adjust.
 Identities = 165/220 (75%), Positives = 190/220 (86%), Gaps = 2/220 (1%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG++SRKLFPACESMCICCPA+RSRSRQPVKRYKKLLA+IFPKSPD   N RKI+KLCEY
Sbjct  1    MGVISRKLFPACESMCICCPAMRSRSRQPVKRYKKLLAEIFPKSPDCPPNERKIVKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            AAKNPFRIPKIAK LE+RCYKELR  H K +N++ E YN+LLC+CKEQMACFAV+L++VV
Sbjct  61   AAKNPFRIPKIAKYLEDRCYKELRLEHIKFINIVVEAYNKLLCLCKEQMACFAVSLVHVV  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
             E+LD +K DA++ +GC T T FIYSQ DGTYT+ IE+LV KVC LAR++GE  Q   LR
Sbjct  121  TELLDNSKQDAMRILGCQTLTNFIYSQTDGTYTHTIESLVHKVCKLARQSGEVHQ--SLR  178

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNYEPDAH  804
            ASSL+CLSAMV FMAEFS+IF DFDEIVHVTLDNYEPD H
Sbjct  179  ASSLQCLSAMVRFMAEFSYIFVDFDEIVHVTLDNYEPDTH  218


 Score =   278 bits (710),  Expect(2) = 2e-171, Method: Compositional matrix adjust.
 Identities = 133/198 (67%), Positives = 161/198 (81%), Gaps = 4/198 (2%)
 Frame = +2

Query  806   NEDDERGEAHHNWVDEVIRSEGRD--VGNENRPGY-LIRKRPDKKDISLLTSEEIEMPKI  976
             NEDDERG+ HHNWVDEV+RSE R   VG++  P   +IR RP+KKD +LLT EEIE PK+
Sbjct  219   NEDDERGQPHHNWVDEVVRSESRVGVVGDDASPSCKIIRPRPEKKDPALLTREEIETPKV  278

Query  977   WAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSGNH  1156
             WA ICIQRM +L+KES+TMRRVLDPMF++FD+  HWVPR GLA +VLSD+SYF+E+SGN 
Sbjct  279   WAQICIQRMIELSKESTTMRRVLDPMFVYFDSGHHWVPRQGLAMLVLSDMSYFMEASGNQ  338

Query  1157  QLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKSL  1336
             QLIL  V+RHLDHKN++ D Q+KS VIQ A+ALA QIRSG   ++IGFVSDLCRHLRKSL
Sbjct  339   QLILAYVIRHLDHKNISHDPQLKSSVIQVASALASQIRSGAVLAEIGFVSDLCRHLRKSL  398

Query  1337  QATVDLAGE-EINLNLTL  1387
             QAT +  GE E N+N+ L
Sbjct  399   QATAESVGEQESNINIML  416



>ref|XP_002318950.2| hypothetical protein POPTR_0013s00990g [Populus trichocarpa]
 gb|EEE94873.2| hypothetical protein POPTR_0013s00990g [Populus trichocarpa]
Length=994

 Score =   364 bits (935),  Expect(2) = 2e-170, Method: Compositional matrix adjust.
 Identities = 166/218 (76%), Positives = 190/218 (87%), Gaps = 0/218 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MGL+SR +FPACESMC+CCPALRSRSRQPVKRYKKLLA+IFPKS DG  N RKI+KLCEY
Sbjct  1    MGLISRNIFPACESMCVCCPALRSRSRQPVKRYKKLLAEIFPKSLDGHPNERKIVKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            AAKNPFRIPKIAK LEERCYKELRSGH K +N++ E YN+LLCMCK+QMA FA++LLNVV
Sbjct  61   AAKNPFRIPKIAKYLEERCYKELRSGHVKFINIVTEAYNKLLCMCKDQMAYFAISLLNVV  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
             E+L+ +K D +  +GC T T+FIYSQ DGTY++NIE  V KVC+LARE G E+ K CLR
Sbjct  121  NELLEKSKQDPLMILGCQTLTRFIYSQADGTYSHNIEKFVHKVCNLARENGNENNKSCLR  180

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNYEPD  798
            ASSL+CLSAMVWFMAEFS+IFA FDEIVHVTLDNYEPD
Sbjct  181  ASSLQCLSAMVWFMAEFSYIFAAFDEIVHVTLDNYEPD  218


 Score =   264 bits (675),  Expect(2) = 2e-170, Method: Compositional matrix adjust.
 Identities = 127/197 (64%), Positives = 156/197 (79%), Gaps = 3/197 (2%)
 Frame = +2

Query  800   PINEDDERGEAHHNWVDEVIRSEGRDVGNENRPGYLIRKRPDKKDISLLTSEEIEMPKIW  979
             P  EDD R +AHHNW+D V+R EGR V +       IR RP+KKD SLLT EEI+ P +W
Sbjct  217   PDEEDDGREDAHHNWLD-VVRCEGR-VADMGSSCMAIRPRPEKKDPSLLTREEIDTPGVW  274

Query  980   AHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSGNHQ  1159
             A ICIQRMA+LAKES+TMR VLDPM ++FD+  HWVPR GLA +VLSD+SY +ES+G+HQ
Sbjct  275   AQICIQRMAELAKESTTMRHVLDPMLVYFDSGHHWVPRQGLAMIVLSDMSYLLESAGHHQ  334

Query  1160  LILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKSLQ  1339
             L+L  V+RHLDHKNVA D Q+KS+VI+ A ALA+QIRSG   ++IG+VSDLCRHLRKSLQ
Sbjct  335   LVLAAVIRHLDHKNVALDPQVKSYVIEVAAALAQQIRSGAVLTEIGYVSDLCRHLRKSLQ  394

Query  1340  ATVDLAGE-EINLNLTL  1387
             A V+ AGE E NLN++L
Sbjct  395   AAVESAGEQESNLNISL  411



>emb|CDP18254.1| unnamed protein product [Coffea canephora]
Length=1034

 Score =   355 bits (912),  Expect(2) = 3e-170, Method: Compositional matrix adjust.
 Identities = 168/238 (71%), Positives = 196/238 (82%), Gaps = 1/238 (0%)
 Frame = +1

Query  94   SRFCGSSSSPDLSLQG-KMGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFP  270
            S FCGS  SP L  Q  KMG +SRK+FPAC +MC+CCPALRSRSRQPVKRYKKLLADIFP
Sbjct  29   SSFCGSFYSPYLVSQARKMGFISRKVFPACGNMCVCCPALRSRSRQPVKRYKKLLADIFP  88

Query  271  KSPDGSANGRKIMKLCEYAAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELL  450
            KSPD  +N RK++KLCEYAAKNPFRIPKI K LE+RCYKELRS + K V ++ E YN+LL
Sbjct  89   KSPDSPSNERKVVKLCEYAAKNPFRIPKITKYLEDRCYKELRSQNIKFVEIVVEAYNKLL  148

Query  451  CMCKEQMACFAVNLLNVVVEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQK  630
             +CK+QMA FA+NLL++VVE+LD +K DAV+ IGC   T+FIYSQVDGTY+YN+E+LV K
Sbjct  149  SICKDQMAYFAINLLSLVVELLDESKQDAVRIIGCQMLTQFIYSQVDGTYSYNLESLVHK  208

Query  631  VCSLARETGEEDQKRCLRASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNYEPDAH  804
            V  +A ETGEE QK  LRASSL+ LSAMVWFM EFSHIFA FD+IVH TL NY+PD H
Sbjct  209  VSIIAHETGEEPQKHRLRASSLQSLSAMVWFMGEFSHIFAAFDKIVHSTLVNYDPDRH  266


 Score =   272 bits (696),  Expect(2) = 3e-170, Method: Compositional matrix adjust.
 Identities = 132/196 (67%), Positives = 155/196 (79%), Gaps = 2/196 (1%)
 Frame = +2

Query  806   NEDDERG-EAHHNWVDEVIRSEGRDVGNENRPGYLIRKRPDKKDISLLTSEEIEMPKIWA  982
             NE+DE G EAHHNWVDEVIR EGR VG  +     IR RPD KD S L  EE+E P IWA
Sbjct  267   NENDEDGGEAHHNWVDEVIRCEGRGVGEFSPSSINIRPRPDWKDPSQLVREEVEKPNIWA  326

Query  983   HICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSGNHQL  1162
              IC+QRM +LAKES+T+RRVLDPMF++FD+ +HWVP HGLA VVLSD+ YF+ESSGN  +
Sbjct  327   QICVQRMMELAKESTTIRRVLDPMFVYFDSGRHWVPPHGLALVVLSDMCYFMESSGNQVV  386

Query  1163  ILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKSLQA  1342
             IL  VVRHLDHKN+  D QIKSFV+QTATALA+QIRSG    D+GFVSD+CRHLRK LQA
Sbjct  387   ILASVVRHLDHKNIVHDPQIKSFVVQTATALAQQIRSGTVLLDVGFVSDICRHLRKCLQA  446

Query  1343  TVDLAGE-EINLNLTL  1387
             T +  GE E+++NLTL
Sbjct  447   TFESDGEKEVDMNLTL  462



>ref|XP_002282109.1| PREDICTED: uncharacterized protein LOC100264846 [Vitis vinifera]
 ref|XP_010659702.1| PREDICTED: uncharacterized protein LOC100264846 [Vitis vinifera]
 emb|CBI39597.3| unnamed protein product [Vitis vinifera]
Length=1002

 Score =   348 bits (893),  Expect(2) = 5e-170, Method: Compositional matrix adjust.
 Identities = 162/220 (74%), Positives = 185/220 (84%), Gaps = 0/220 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG +SR++FPAC SMC+CCPALRSRSRQPVKRYKKLLA+IFPKS DG  N RKI+KLCEY
Sbjct  1    MGFISRRIFPACGSMCVCCPALRSRSRQPVKRYKKLLAEIFPKSIDGPPNERKIVKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            AAKNPFRIPKIAK LEERCYKELR  H K + ++ E YN+LLCMCK+QMA FAV+LLNVV
Sbjct  61   AAKNPFRIPKIAKYLEERCYKELRCEHIKFIAIVTEAYNKLLCMCKDQMAYFAVSLLNVV  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
             E+LD  K DA++ +GC T T+FIY Q D TYT+NIEN V+KVC LARE G+E Q   L+
Sbjct  121  SELLDKPKKDAMRILGCQTLTRFIYCQADSTYTHNIENFVRKVCMLAREAGDEQQTSTLK  180

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNYEPDAH  804
            ASSL+CLSAMVWFMAEFS IF+DFDEIVHVTLDNYE D H
Sbjct  181  ASSLQCLSAMVWFMAEFSLIFSDFDEIVHVTLDNYERDTH  220


 Score =   279 bits (713),  Expect(2) = 5e-170, Method: Compositional matrix adjust.
 Identities = 135/198 (68%), Positives = 160/198 (81%), Gaps = 5/198 (3%)
 Frame = +2

Query  809   EDDERGEAHHNWVDEVIRSEGRD---VGNENRPGY-LIRKRPDKKDISLLTSEEIEMPKI  976
             EDDERGE HHNWVDEV+R EGR    VG+E  P   +IR + +KKD SLLT EEIE PK+
Sbjct  223   EDDERGEPHHNWVDEVVRCEGRGGAGVGSEISPSCPVIRPQTEKKDPSLLTREEIETPKV  282

Query  977   WAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSGNH  1156
             WA ICIQRM +LAKES+TMRRVLDPMF++FD  +HWVPR GLA VVLSD+SYFVES G+ 
Sbjct  283   WAQICIQRMVELAKESTTMRRVLDPMFVYFDTGRHWVPRQGLALVVLSDMSYFVESMGDQ  342

Query  1157  QLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKSL  1336
             ++IL  V+RHLDHKNVA D Q KS+VIQ ATAL  Q+RSG   ++IGFVSDLCRHLRKSL
Sbjct  343   KMILAAVIRHLDHKNVAHDPQTKSYVIQVATALVHQVRSGAILAEIGFVSDLCRHLRKSL  402

Query  1337  QATVDLAG-EEINLNLTL  1387
             QATV+ AG +E +LN++L
Sbjct  403   QATVESAGQQESDLNISL  420



>gb|EYU40497.1| hypothetical protein MIMGU_mgv1a000785mg [Erythranthe guttata]
 gb|EYU40498.1| hypothetical protein MIMGU_mgv1a000785mg [Erythranthe guttata]
Length=987

 Score =   357 bits (915),  Expect(2) = 1e-169, Method: Compositional matrix adjust.
 Identities = 161/219 (74%), Positives = 192/219 (88%), Gaps = 0/219 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG++SR +FPACESMC+CCPALRSRSRQPVKRYKKLLA+IFPK+PDG  N RKI+KLCEY
Sbjct  1    MGVISRNIFPACESMCVCCPALRSRSRQPVKRYKKLLAEIFPKTPDGHPNDRKIVKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            A+KNPFRIPKIAK LEE+CYKELRSG+ KLV ++AE YN+LLC CK+Q A FAV+L+NVV
Sbjct  61   ASKNPFRIPKIAKYLEEKCYKELRSGNIKLVGIVAEAYNKLLCSCKDQTAYFAVSLVNVV  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
            +E+LD +K D+V+ +GC T T F+Y QVDGTYT+NIEN V KVC LAR+T +E QKR LR
Sbjct  121  IELLDESKQDSVQKMGCDTLTTFVYCQVDGTYTHNIENFVHKVCMLARKTEDEHQKRGLR  180

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNYEPDA  801
            ASSLRCLSAMVWFMAEFSH+F DF++IVH TLDNYE ++
Sbjct  181  ASSLRCLSAMVWFMAEFSHVFDDFEKIVHATLDNYETES  219


 Score =   269 bits (687),  Expect(2) = 1e-169, Method: Compositional matrix adjust.
 Identities = 134/199 (67%), Positives = 158/199 (79%), Gaps = 6/199 (3%)
 Frame = +2

Query  809   EDDERGEAHHNWVDEVIRSEGRDV----GNENRPGYLI-RKRPDKKDISLLTSEEIEMPK  973
             ED+ER EAHHNWVDEV RSEGR V    G E  P ++I R +P+K+D SLLT EEIE PK
Sbjct  223   EDEERREAHHNWVDEVARSEGRGVMTGVGGEFSPSHMIVRFQPEKRDPSLLTREEIETPK  282

Query  974   IWAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSGN  1153
             IWA ICIQRM DLAKES+TMRR+L+PMF++FD  +HWVP+HGLA VVLSD+S FVE+ G+
Sbjct  283   IWAQICIQRMVDLAKESTTMRRILEPMFVYFDMRRHWVPQHGLAHVVLSDMSSFVENPGH  342

Query  1154  HQLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKS  1333
              QLIL GVVRHLDHKNVA D Q+K  +IQTA+ LARQIRS    SD+GFVSDL RHLRKS
Sbjct  343   QQLILAGVVRHLDHKNVAHDPQMKCHIIQTASCLARQIRSEAVISDMGFVSDLFRHLRKS  402

Query  1334  LQATVDLAG-EEINLNLTL  1387
              QAT +  G +E+NLN +L
Sbjct  403   FQATAESVGDQELNLNASL  421



>ref|XP_011023781.1| PREDICTED: uncharacterized protein LOC105125162 [Populus euphratica]
 ref|XP_011023783.1| PREDICTED: uncharacterized protein LOC105125162 [Populus euphratica]
 ref|XP_011023784.1| PREDICTED: uncharacterized protein LOC105125162 [Populus euphratica]
Length=994

 Score =   359 bits (921),  Expect(2) = 1e-167, Method: Compositional matrix adjust.
 Identities = 164/218 (75%), Positives = 189/218 (87%), Gaps = 0/218 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MGL+SR +FPACESMC+CCPALRSRSRQPVKRYKKLLA+IFPKS DG  N RKI+KLCEY
Sbjct  1    MGLISRNIFPACESMCVCCPALRSRSRQPVKRYKKLLAEIFPKSLDGHPNERKIVKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            AAKNPFRIPKIAK LEERC+KELRSGH K +N++ E YN+LLCMCK+QMA FA++LLNVV
Sbjct  61   AAKNPFRIPKIAKYLEERCFKELRSGHVKFINIVTEAYNKLLCMCKDQMAYFAISLLNVV  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
             E+LD +K D +  +GC T T+FIYSQ DGTY++NIE  V KVC+LA E G E+ + CLR
Sbjct  121  NELLDKSKQDPLMILGCQTLTRFIYSQADGTYSHNIEKFVHKVCNLACENGNENNRSCLR  180

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNYEPD  798
            ASSL+CLSAMVWFMAEFS+IFA FDEIVHVTLDNYEPD
Sbjct  181  ASSLQCLSAMVWFMAEFSYIFAAFDEIVHVTLDNYEPD  218


 Score =   260 bits (664),  Expect(2) = 1e-167, Method: Compositional matrix adjust.
 Identities = 126/197 (64%), Positives = 155/197 (79%), Gaps = 3/197 (2%)
 Frame = +2

Query  800   PINEDDERGEAHHNWVDEVIRSEGRDVGNENRPGYLIRKRPDKKDISLLTSEEIEMPKIW  979
             P  EDD R +A HNW+D V+R EGR V +       IR RP+KKD SLLT EEI+ P++W
Sbjct  217   PDEEDDGREDARHNWLD-VVRCEGR-VADMGSSCMAIRPRPEKKDPSLLTREEIDTPRVW  274

Query  980   AHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSGNHQ  1159
             A ICIQRMA+LAKES+TMR VLDPM ++FD+  HWVPR GLA +VLSD+SY +ES+G+HQ
Sbjct  275   AQICIQRMAELAKESTTMRHVLDPMLVYFDSGHHWVPRQGLAMIVLSDMSYLLESAGHHQ  334

Query  1160  LILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKSLQ  1339
             L+L  V+RHLDHKNVA D Q+KS VI+ A ALA+QIRSG   ++IG+VSDLCRHLRKSLQ
Sbjct  335   LVLAAVIRHLDHKNVALDPQVKSHVIEVAAALAQQIRSGAVLTEIGYVSDLCRHLRKSLQ  394

Query  1340  ATVDLAGE-EINLNLTL  1387
             A V+ AGE E NLN++L
Sbjct  395   AAVESAGEQESNLNISL  411



>ref|XP_007031155.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY11657.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=1019

 Score =   360 bits (925),  Expect(2) = 2e-167, Method: Compositional matrix adjust.
 Identities = 164/220 (75%), Positives = 187/220 (85%), Gaps = 0/220 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG +SRK+FPAC SMC+CCPALRSRSRQPVKRYKKLL++IFPKSPD   N RKI KLCEY
Sbjct  1    MGFISRKIFPACGSMCVCCPALRSRSRQPVKRYKKLLSEIFPKSPDAPPNERKIAKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            AAKNPFRIPKIAK LEERCYKELR  H K +N++ E Y++LLCMCKEQMA FAVNLLNVV
Sbjct  61   AAKNPFRIPKIAKYLEERCYKELRHEHIKFINIVTEAYHKLLCMCKEQMAYFAVNLLNVV  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
             E+LD +K DA++ +GC T TKFIYSQ DGTYT+NIE  V KVC L+RE GEE Q+RCLR
Sbjct  121  GELLDNSKQDAMRILGCQTLTKFIYSQADGTYTHNIEKFVPKVCKLSREDGEEHQRRCLR  180

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNYEPDAH  804
            ASSL+CLSAMVWFMA++S+IFA  DE+VH TLDNYE D H
Sbjct  181  ASSLQCLSAMVWFMAQYSYIFATLDEMVHATLDNYELDTH  220


 Score =   258 bits (659),  Expect(2) = 2e-167, Method: Compositional matrix adjust.
 Identities = 123/197 (62%), Positives = 157/197 (80%), Gaps = 5/197 (3%)
 Frame = +2

Query  809   EDDERGEAHHNWVDEVIRSEGRD--VGNENRPG-YLIRKRPDKKDISLLTSEEIEMPKIW  979
             +D+ERGE HHNWVDEV+R EGR   V  +  P   +IR +P+KKD SLLT EE E PK+W
Sbjct  223   DDNERGEPHHNWVDEVVRCEGRGAIVARDASPSNMIIRPQPEKKDPSLLTREETETPKVW  282

Query  980   AHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSGNHQ  1159
             A ICIQRM +LAKES+T+R++LDPMF++FD+ +HWV + GLA VVLSD+SY+ E+SG+ Q
Sbjct  283   AQICIQRMVELAKESTTLRQILDPMFVYFDSRQHWVSQQGLAMVVLSDMSYW-EASGDQQ  341

Query  1160  LILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKSLQ  1339
             LIL  V+RHLDHKNVA D Q+KS+++Q A ALARQIRS G  ++IGFVSDLCRHLRKS Q
Sbjct  342   LILAAVIRHLDHKNVAHDPQLKSYIVQVAAALARQIRSRGVLAEIGFVSDLCRHLRKSFQ  401

Query  1340  ATVDLAGE-EINLNLTL  1387
             A ++  GE E++LN+ L
Sbjct  402   ANLESVGEQELDLNILL  418



>ref|XP_007031156.1| Uncharacterized protein isoform 2 [Theobroma cacao]
 gb|EOY11658.1| Uncharacterized protein isoform 2 [Theobroma cacao]
Length=1000

 Score =   360 bits (925),  Expect(2) = 2e-167, Method: Compositional matrix adjust.
 Identities = 164/220 (75%), Positives = 187/220 (85%), Gaps = 0/220 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG +SRK+FPAC SMC+CCPALRSRSRQPVKRYKKLL++IFPKSPD   N RKI KLCEY
Sbjct  1    MGFISRKIFPACGSMCVCCPALRSRSRQPVKRYKKLLSEIFPKSPDAPPNERKIAKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            AAKNPFRIPKIAK LEERCYKELR  H K +N++ E Y++LLCMCKEQMA FAVNLLNVV
Sbjct  61   AAKNPFRIPKIAKYLEERCYKELRHEHIKFINIVTEAYHKLLCMCKEQMAYFAVNLLNVV  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
             E+LD +K DA++ +GC T TKFIYSQ DGTYT+NIE  V KVC L+RE GEE Q+RCLR
Sbjct  121  GELLDNSKQDAMRILGCQTLTKFIYSQADGTYTHNIEKFVPKVCKLSREDGEEHQRRCLR  180

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNYEPDAH  804
            ASSL+CLSAMVWFMA++S+IFA  DE+VH TLDNYE D H
Sbjct  181  ASSLQCLSAMVWFMAQYSYIFATLDEMVHATLDNYELDTH  220


 Score =   258 bits (659),  Expect(2) = 2e-167, Method: Compositional matrix adjust.
 Identities = 123/197 (62%), Positives = 157/197 (80%), Gaps = 5/197 (3%)
 Frame = +2

Query  809   EDDERGEAHHNWVDEVIRSEGRD--VGNENRPG-YLIRKRPDKKDISLLTSEEIEMPKIW  979
             +D+ERGE HHNWVDEV+R EGR   V  +  P   +IR +P+KKD SLLT EE E PK+W
Sbjct  223   DDNERGEPHHNWVDEVVRCEGRGAIVARDASPSNMIIRPQPEKKDPSLLTREETETPKVW  282

Query  980   AHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSGNHQ  1159
             A ICIQRM +LAKES+T+R++LDPMF++FD+ +HWV + GLA VVLSD+SY+ E+SG+ Q
Sbjct  283   AQICIQRMVELAKESTTLRQILDPMFVYFDSRQHWVSQQGLAMVVLSDMSYW-EASGDQQ  341

Query  1160  LILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKSLQ  1339
             LIL  V+RHLDHKNVA D Q+KS+++Q A ALARQIRS G  ++IGFVSDLCRHLRKS Q
Sbjct  342   LILAAVIRHLDHKNVAHDPQLKSYIVQVAAALARQIRSRGVLAEIGFVSDLCRHLRKSFQ  401

Query  1340  ATVDLAGE-EINLNLTL  1387
             A ++  GE E++LN+ L
Sbjct  402   ANLESVGEQELDLNILL  418



>ref|XP_011092150.1| PREDICTED: uncharacterized protein LOC105172430 [Sesamum indicum]
Length=995

 Score =   356 bits (914),  Expect(2) = 3e-167, Method: Compositional matrix adjust.
 Identities = 164/216 (76%), Positives = 190/216 (88%), Gaps = 0/216 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG++SRK+FPACESMC+CCPALRSRSRQPVKRYKKLLA+IFPKS DG +N RKI+KLCEY
Sbjct  1    MGVISRKIFPACESMCVCCPALRSRSRQPVKRYKKLLAEIFPKSHDGQSNERKIVKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            A+KNP RIPKIAK LEERCYKELRSG+ + V+++AE YN+LLC+CKEQMA F+ NLLN+V
Sbjct  61   ASKNPLRIPKIAKYLEERCYKELRSGNIRFVSIVAETYNKLLCICKEQMAYFSFNLLNMV  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
            +E+LD +K DA+  IGC T T FIY Q+DGTYT NIEN V KVC LAR+T +E QKR LR
Sbjct  121  IELLDDSKQDALLIIGCDTLTTFIYCQMDGTYTRNIENFVDKVCMLARKTEDEHQKRGLR  180

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNYE  792
            ASSLRCLSAMVWFMAEFSHIFADF++IVH TLDNYE
Sbjct  181  ASSLRCLSAMVWFMAEFSHIFADFEKIVHATLDNYE  216


 Score =   261 bits (668),  Expect(2) = 3e-167, Method: Compositional matrix adjust.
 Identities = 128/198 (65%), Positives = 153/198 (77%), Gaps = 5/198 (3%)
 Frame = +2

Query  809   EDDERGEAHHNWVDEVIRSEGRD---VGNENRPGYLI-RKRPDKKDISLLTSEEIEMPKI  976
             ED+ER EAHHNWVDEV R EGR    VG E  P ++I R RP+KKD SLLT +EIE PK+
Sbjct  223   EDEERREAHHNWVDEVARCEGRGTPGVGGEFSPSHMIIRLRPEKKDPSLLTRDEIETPKV  282

Query  977   WAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSGNH  1156
             WA ICIQRM DLAKES+TMRRVLDPMF++FD  +HWVP+HGLA +VLSD+  FVE+ G  
Sbjct  283   WAQICIQRMVDLAKESTTMRRVLDPMFVYFDTGRHWVPQHGLAPLVLSDMQSFVENPGYQ  342

Query  1157  QLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKSL  1336
             QLIL GVVRHLDHKNV  D+++K  ++QTA+ LARQ+R     SD+GFVSDL RHLRKS 
Sbjct  343   QLILAGVVRHLDHKNVVHDAEMKCHIVQTASYLARQVRLEAVISDMGFVSDLFRHLRKSF  402

Query  1337  QATVDLAGE-EINLNLTL  1387
             QAT +  GE E+N+N  L
Sbjct  403   QATAEPVGEQELNMNAAL  420



>ref|XP_011466140.1| PREDICTED: uncharacterized protein LOC101313033 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=1004

 Score =   356 bits (913),  Expect(2) = 8e-166, Method: Compositional matrix adjust.
 Identities = 160/220 (73%), Positives = 190/220 (86%), Gaps = 0/220 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG++SRK+FPAC +MC+CCPA+RSRSRQPVKRYKKLLA+IFPKSPDG +N RKI+KLCEY
Sbjct  1    MGIISRKIFPACGNMCVCCPAMRSRSRQPVKRYKKLLAEIFPKSPDGPSNERKIVKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            AAKNPFRIPKIAK LE+RCYKELR  H K +N++AE YN+LLC+CK QMA FA ++LNVV
Sbjct  61   AAKNPFRIPKIAKHLEDRCYKELRLEHVKFINIVAEAYNKLLCLCKNQMAYFAGSVLNVV  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
             E+LD +K DA++ IGC T T+FI SQ DGTYT+NIE+LV KVC LA E+GE+ QKRCLR
Sbjct  121  TELLDNSKQDALRIIGCQTLTRFISSQTDGTYTHNIESLVHKVCELAHESGEDIQKRCLR  180

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNYEPDAH  804
            ASSL+CLSAM+ FM E S+IF DFDEIVH TLDNY+PD H
Sbjct  181  ASSLQCLSAMIQFMTEVSYIFVDFDEIVHATLDNYQPDTH  220


 Score =   257 bits (656),  Expect(2) = 8e-166, Method: Compositional matrix adjust.
 Identities = 123/191 (64%), Positives = 147/191 (77%), Gaps = 4/191 (2%)
 Frame = +2

Query  806   NEDDERGEAHHNWVDEVIRSEGRD---VGNENRPGY-LIRKRPDKKDISLLTSEEIEMPK  973
             NE+ E  E+HHNWVDEV+RSE R     G  + P   +IR RP+KKD SLLT EE E P 
Sbjct  221   NENGEGAESHHNWVDEVVRSESRVGAIAGGYSSPSCKVIRPRPEKKDPSLLTREETETPN  280

Query  974   IWAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSGN  1153
              WA ICIQRM +LAKES+TMRRVLDPMF++FD+  HWVPR GLA +VLSD+SYF+E+SGN
Sbjct  281   TWAQICIQRMIELAKESTTMRRVLDPMFVYFDSRHHWVPRQGLAMMVLSDMSYFLETSGN  340

Query  1154  HQLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKS  1333
              Q+IL   +RHLDHKNV+ D Q+KS +IQ A+ALA QIRSG    +IGFVSDLCRHLRKS
Sbjct  341   QQMILAYAIRHLDHKNVSHDPQLKSHIIQVASALACQIRSGTVLEEIGFVSDLCRHLRKS  400

Query  1334  LQATVDLAGEE  1366
             LQAT +  GE+
Sbjct  401   LQATAESVGEQ  411



>ref|XP_012088883.1| PREDICTED: uncharacterized protein LOC105647425 isoform X1 [Jatropha 
curcas]
 ref|XP_012088884.1| PREDICTED: uncharacterized protein LOC105647425 isoform X1 [Jatropha 
curcas]
 ref|XP_012088885.1| PREDICTED: uncharacterized protein LOC105647425 isoform X1 [Jatropha 
curcas]
 ref|XP_012088887.1| PREDICTED: uncharacterized protein LOC105647425 isoform X1 [Jatropha 
curcas]
 ref|XP_012088888.1| PREDICTED: uncharacterized protein LOC105647425 isoform X1 [Jatropha 
curcas]
 gb|KDP23388.1| hypothetical protein JCGZ_23221 [Jatropha curcas]
Length=997

 Score =   353 bits (905),  Expect(2) = 1e-165, Method: Compositional matrix adjust.
 Identities = 164/220 (75%), Positives = 188/220 (85%), Gaps = 1/220 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MGL+SRK+FPACESMC+CCPALRSRSRQPVKRYKKLLA+IFPKS DG  N RKI+KLCEY
Sbjct  1    MGLISRKIFPACESMCVCCPALRSRSRQPVKRYKKLLAEIFPKS-DGPPNERKIVKLCEY  59

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            AAKNPFRIPKIAK LEERCYKELRS H K +N++ E Y++LLCMCKEQM  FA++LLNVV
Sbjct  60   AAKNPFRIPKIAKYLEERCYKELRSEHIKFINIVTETYDKLLCMCKEQMVYFAISLLNVV  119

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
             E+LD  + DA+  +GC T T+FI+SQ DGTYT+NIE  V KVC LARE G+E QK  LR
Sbjct  120  SELLDKPRQDALLILGCQTLTRFIFSQTDGTYTHNIEKFVHKVCKLAREHGDEHQKNRLR  179

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNYEPDAH  804
            ASSL+CLSAMVWFMA+FS+IFA FDEI+ VTLDNYEPD H
Sbjct  180  ASSLQCLSAMVWFMAQFSYIFAAFDEIMQVTLDNYEPDVH  219


 Score =   260 bits (664),  Expect(2) = 1e-165, Method: Compositional matrix adjust.
 Identities = 124/196 (63%), Positives = 152/196 (78%), Gaps = 4/196 (2%)
 Frame = +2

Query  812   DDERGEAHHNWVDEVIRSEGRDVGNENRP---GYLIRKRPDKKDISLLTSEEIEMPKIWA  982
             +DERGE HHNWVDEV+RSEGR       P      IR RP+KKD SLLT EEI+MP +WA
Sbjct  220   NDERGEPHHNWVDEVVRSEGRGALVSCDPISSCTSIRPRPEKKDPSLLTREEIDMPNVWA  279

Query  983   HICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSGNHQL  1162
              ICIQRM +LAKES+TMR+VLDPMF++FD+ +HWVPR GL+  VLSD+ Y +ESSG+ QL
Sbjct  280   RICIQRMVELAKESTTMRQVLDPMFVYFDSGRHWVPRQGLSMAVLSDMCYLLESSGHQQL  339

Query  1163  ILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKSLQA  1342
             +L  V+RHLDHKNV  D ++KS+V+Q A ALA QIRS    ++IGFVSDLCRHLRKSLQA
Sbjct  340   VLAAVIRHLDHKNVMHDPRLKSYVVQVAAALATQIRSEAVLTEIGFVSDLCRHLRKSLQA  399

Query  1343  TVDLAG-EEINLNLTL  1387
             TV+  G +E N+N+ L
Sbjct  400   TVESEGQQESNMNVLL  415



>ref|XP_004302237.1| PREDICTED: uncharacterized protein LOC101313033 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=1003

 Score =   356 bits (913),  Expect(2) = 1e-165, Method: Compositional matrix adjust.
 Identities = 160/220 (73%), Positives = 190/220 (86%), Gaps = 0/220 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG++SRK+FPAC +MC+CCPA+RSRSRQPVKRYKKLLA+IFPKSPDG +N RKI+KLCEY
Sbjct  1    MGIISRKIFPACGNMCVCCPAMRSRSRQPVKRYKKLLAEIFPKSPDGPSNERKIVKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            AAKNPFRIPKIAK LE+RCYKELR  H K +N++AE YN+LLC+CK QMA FA ++LNVV
Sbjct  61   AAKNPFRIPKIAKHLEDRCYKELRLEHVKFINIVAEAYNKLLCLCKNQMAYFAGSVLNVV  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
             E+LD +K DA++ IGC T T+FI SQ DGTYT+NIE+LV KVC LA E+GE+ QKRCLR
Sbjct  121  TELLDNSKQDALRIIGCQTLTRFISSQTDGTYTHNIESLVHKVCELAHESGEDIQKRCLR  180

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNYEPDAH  804
            ASSL+CLSAM+ FM E S+IF DFDEIVH TLDNY+PD H
Sbjct  181  ASSLQCLSAMIQFMTEVSYIFVDFDEIVHATLDNYQPDTH  220


 Score =   257 bits (656),  Expect(2) = 1e-165, Method: Compositional matrix adjust.
 Identities = 123/191 (64%), Positives = 147/191 (77%), Gaps = 4/191 (2%)
 Frame = +2

Query  806   NEDDERGEAHHNWVDEVIRSEGRD---VGNENRPGY-LIRKRPDKKDISLLTSEEIEMPK  973
             NE+ E  E+HHNWVDEV+RSE R     G  + P   +IR RP+KKD SLLT EE E P 
Sbjct  221   NENGEGAESHHNWVDEVVRSESRVGAIAGGYSSPSCKVIRPRPEKKDPSLLTREETETPN  280

Query  974   IWAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSGN  1153
              WA ICIQRM +LAKES+TMRRVLDPMF++FD+  HWVPR GLA +VLSD+SYF+E+SGN
Sbjct  281   TWAQICIQRMIELAKESTTMRRVLDPMFVYFDSRHHWVPRQGLAMMVLSDMSYFLETSGN  340

Query  1154  HQLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKS  1333
              Q+IL   +RHLDHKNV+ D Q+KS +IQ A+ALA QIRSG    +IGFVSDLCRHLRKS
Sbjct  341   QQMILAYAIRHLDHKNVSHDPQLKSHIIQVASALACQIRSGTVLEEIGFVSDLCRHLRKS  400

Query  1334  LQATVDLAGEE  1366
             LQAT +  GE+
Sbjct  401   LQATAESVGEQ  411



>ref|XP_012088889.1| PREDICTED: uncharacterized protein LOC105647425 isoform X2 [Jatropha 
curcas]
Length=979

 Score =   352 bits (904),  Expect(2) = 1e-165, Method: Compositional matrix adjust.
 Identities = 164/220 (75%), Positives = 188/220 (85%), Gaps = 1/220 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MGL+SRK+FPACESMC+CCPALRSRSRQPVKRYKKLLA+IFPKS DG  N RKI+KLCEY
Sbjct  1    MGLISRKIFPACESMCVCCPALRSRSRQPVKRYKKLLAEIFPKS-DGPPNERKIVKLCEY  59

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            AAKNPFRIPKIAK LEERCYKELRS H K +N++ E Y++LLCMCKEQM  FA++LLNVV
Sbjct  60   AAKNPFRIPKIAKYLEERCYKELRSEHIKFINIVTETYDKLLCMCKEQMVYFAISLLNVV  119

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
             E+LD  + DA+  +GC T T+FI+SQ DGTYT+NIE  V KVC LARE G+E QK  LR
Sbjct  120  SELLDKPRQDALLILGCQTLTRFIFSQTDGTYTHNIEKFVHKVCKLAREHGDEHQKNRLR  179

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNYEPDAH  804
            ASSL+CLSAMVWFMA+FS+IFA FDEI+ VTLDNYEPD H
Sbjct  180  ASSLQCLSAMVWFMAQFSYIFAAFDEIMQVTLDNYEPDVH  219


 Score =   260 bits (664),  Expect(2) = 1e-165, Method: Compositional matrix adjust.
 Identities = 124/196 (63%), Positives = 152/196 (78%), Gaps = 4/196 (2%)
 Frame = +2

Query  812   DDERGEAHHNWVDEVIRSEGRDVGNENRP---GYLIRKRPDKKDISLLTSEEIEMPKIWA  982
             +DERGE HHNWVDEV+RSEGR       P      IR RP+KKD SLLT EEI+MP +WA
Sbjct  220   NDERGEPHHNWVDEVVRSEGRGALVSCDPISSCTSIRPRPEKKDPSLLTREEIDMPNVWA  279

Query  983   HICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSGNHQL  1162
              ICIQRM +LAKES+TMR+VLDPMF++FD+ +HWVPR GL+  VLSD+ Y +ESSG+ QL
Sbjct  280   RICIQRMVELAKESTTMRQVLDPMFVYFDSGRHWVPRQGLSMAVLSDMCYLLESSGHQQL  339

Query  1163  ILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKSLQA  1342
             +L  V+RHLDHKNV  D ++KS+V+Q A ALA QIRS    ++IGFVSDLCRHLRKSLQA
Sbjct  340   VLAAVIRHLDHKNVMHDPRLKSYVVQVAAALATQIRSEAVLTEIGFVSDLCRHLRKSLQA  399

Query  1343  TVDLAG-EEINLNLTL  1387
             TV+  G +E N+N+ L
Sbjct  400   TVESEGQQESNMNVLL  415



>ref|XP_006433539.1| hypothetical protein CICLE_v10000144mg [Citrus clementina]
 gb|ESR46779.1| hypothetical protein CICLE_v10000144mg [Citrus clementina]
Length=999

 Score =   341 bits (875),  Expect(2) = 1e-165, Method: Compositional matrix adjust.
 Identities = 162/218 (74%), Positives = 183/218 (84%), Gaps = 1/218 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG +SRK+FPAC SMC+CCPALRSRSRQPVKRYKKLLA+IFPKS DG  N RKI+KLCEY
Sbjct  1    MGFISRKIFPACGSMCVCCPALRSRSRQPVKRYKKLLAEIFPKSIDGPPNERKIVKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            AAKNPFRIPKIAK LEERCYKELR  H KL+N++ E YN++LCMCK QMA FAV+LLNV 
Sbjct  61   AAKNPFRIPKIAKYLEERCYKELRCEHIKLINIVTEAYNKMLCMCKVQMAYFAVSLLNVA  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
             E+LD +K + V+ +GC T ++FIYSQ DGTYT+NIE  V+KVC LA E G E Q R LR
Sbjct  121  TELLDNSKQETVQILGCQTLSRFIYSQADGTYTHNIEKFVKKVCKLACENGVEHQ-RSLR  179

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNYEPD  798
            ASSL+CLSAMVWFMAEFS IFADFDEIV  TLDNYEPD
Sbjct  180  ASSLQCLSAMVWFMAEFSCIFADFDEIVSATLDNYEPD  217


 Score =   271 bits (692),  Expect(2) = 1e-165, Method: Compositional matrix adjust.
 Identities = 129/197 (65%), Positives = 155/197 (79%), Gaps = 4/197 (2%)
 Frame = +2

Query  809   EDDERGEAHHNWVDEVIRSEGRDV--GNENRPG-YLIRKRPDKKDISLLTSEEIEMPKIW  979
             +DDERGE HHNWVDEV+R EGR    G++  P   +IR RP+KKD S LT EE+E PK+W
Sbjct  222   DDDERGEPHHNWVDEVVRCEGRGAAAGSDTGPSSMMIRPRPEKKDPSALTREEVETPKVW  281

Query  980   AHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSGNHQ  1159
             A ICIQRM DLAKE++TMRRVLDPMF +FD+ + W+PR GLA +VLSD++Y +E+SGN Q
Sbjct  282   ARICIQRMVDLAKETTTMRRVLDPMFTYFDSRRQWIPRQGLAMIVLSDMAYLMETSGNQQ  341

Query  1160  LILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKSLQ  1339
             LIL  V+ HLDHKNV+ D Q+KS+VIQ ATALARQIRSG    +IG VSDLCRHLRKS Q
Sbjct  342   LILASVIHHLDHKNVSHDPQLKSYVIQVATALARQIRSGMVLVEIGSVSDLCRHLRKSFQ  401

Query  1340  ATVDLAGE-EINLNLTL  1387
             ATV+  GE E NLN+ L
Sbjct  402   ATVESVGEQESNLNILL  418



>gb|KJB81104.1| hypothetical protein B456_013G129500 [Gossypium raimondii]
Length=996

 Score =   353 bits (907),  Expect(2) = 2e-164, Method: Compositional matrix adjust.
 Identities = 161/220 (73%), Positives = 184/220 (84%), Gaps = 0/220 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG++SRK+FPACESMC+CCPALRSRSRQPVKRYKKLL++IFPKSP    N RKI KLCEY
Sbjct  1    MGIISRKIFPACESMCVCCPALRSRSRQPVKRYKKLLSEIFPKSPGAPPNERKITKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            AA+NPFRIPKIAK LEERCYKELR  H K +N++ E YN+LLCMCKEQMA FAVNLLNVV
Sbjct  61   AARNPFRIPKIAKYLEERCYKELRYKHVKFINIVIEAYNKLLCMCKEQMAYFAVNLLNVV  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
             E+LD +K +A + +GC T TKFIYSQ DGTYT+NIE  V KVC LA E GEE  + CLR
Sbjct  121  SELLDNSKQEATQILGCQTLTKFIYSQADGTYTHNIEKFVHKVCKLAHEDGEEHLRSCLR  180

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNYEPDAH  804
            ASSL+CLSAMVWFMA++S+IF+  DEIVH TLDNYE D H
Sbjct  181  ASSLQCLSAMVWFMAQYSYIFSALDEIVHATLDNYELDTH  220


 Score =   255 bits (651),  Expect(2) = 2e-164, Method: Compositional matrix adjust.
 Identities = 125/197 (63%), Positives = 154/197 (78%), Gaps = 5/197 (3%)
 Frame = +2

Query  809   EDDERGEAHHNWVDEVIRSEGR--DVGNENRPG-YLIRKRPDKKDISLLTSEEIEMPKIW  979
             +DDERGE H NWVDEV+R EGR   V  +  P   +IR +P+KKD SLLT EEIE PK+W
Sbjct  223   DDDERGEPHRNWVDEVVRCEGRGATVACDASPSNMIIRPQPEKKDPSLLTREEIETPKVW  282

Query  980   AHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSGNHQ  1159
             A ICIQRM +LAKES+T+R V+DPMF++FD+ +HWV + GLA VVLSD+SY+ E+SGN Q
Sbjct  283   AQICIQRMVELAKESTTLRLVVDPMFVYFDSRQHWVSQQGLAMVVLSDMSYW-EASGNQQ  341

Query  1160  LILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKSLQ  1339
              +L  VVRHLDHKNVA D Q+KS++IQ A ALARQIRS    ++IGFVSDLCRHLRKS Q
Sbjct  342   HVLAAVVRHLDHKNVAHDPQLKSYIIQVAAALARQIRSRRMLAEIGFVSDLCRHLRKSFQ  401

Query  1340  ATVDLAGEE-INLNLTL  1387
             AT++  GE+  NLN+ L
Sbjct  402   ATLESVGEQDTNLNILL  418



>gb|KJB81106.1| hypothetical protein B456_013G129500 [Gossypium raimondii]
Length=870

 Score =   353 bits (905),  Expect(2) = 3e-164, Method: Compositional matrix adjust.
 Identities = 161/220 (73%), Positives = 184/220 (84%), Gaps = 0/220 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG++SRK+FPACESMC+CCPALRSRSRQPVKRYKKLL++IFPKSP    N RKI KLCEY
Sbjct  1    MGIISRKIFPACESMCVCCPALRSRSRQPVKRYKKLLSEIFPKSPGAPPNERKITKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            AA+NPFRIPKIAK LEERCYKELR  H K +N++ E YN+LLCMCKEQMA FAVNLLNVV
Sbjct  61   AARNPFRIPKIAKYLEERCYKELRYKHVKFINIVIEAYNKLLCMCKEQMAYFAVNLLNVV  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
             E+LD +K +A + +GC T TKFIYSQ DGTYT+NIE  V KVC LA E GEE  + CLR
Sbjct  121  SELLDNSKQEATQILGCQTLTKFIYSQADGTYTHNIEKFVHKVCKLAHEDGEEHLRSCLR  180

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNYEPDAH  804
            ASSL+CLSAMVWFMA++S+IF+  DEIVH TLDNYE D H
Sbjct  181  ASSLQCLSAMVWFMAQYSYIFSALDEIVHATLDNYELDTH  220


 Score =   255 bits (651),  Expect(2) = 3e-164, Method: Compositional matrix adjust.
 Identities = 125/197 (63%), Positives = 154/197 (78%), Gaps = 5/197 (3%)
 Frame = +2

Query  809   EDDERGEAHHNWVDEVIRSEGR--DVGNENRPG-YLIRKRPDKKDISLLTSEEIEMPKIW  979
             +DDERGE H NWVDEV+R EGR   V  +  P   +IR +P+KKD SLLT EEIE PK+W
Sbjct  223   DDDERGEPHRNWVDEVVRCEGRGATVACDASPSNMIIRPQPEKKDPSLLTREEIETPKVW  282

Query  980   AHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSGNHQ  1159
             A ICIQRM +LAKES+T+R V+DPMF++FD+ +HWV + GLA VVLSD+SY+ E+SGN Q
Sbjct  283   AQICIQRMVELAKESTTLRLVVDPMFVYFDSRQHWVSQQGLAMVVLSDMSYW-EASGNQQ  341

Query  1160  LILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKSLQ  1339
              +L  VVRHLDHKNVA D Q+KS++IQ A ALARQIRS    ++IGFVSDLCRHLRKS Q
Sbjct  342   HVLAAVVRHLDHKNVAHDPQLKSYIIQVAAALARQIRSRRMLAEIGFVSDLCRHLRKSFQ  401

Query  1340  ATVDLAGEE-INLNLTL  1387
             AT++  GE+  NLN+ L
Sbjct  402   ATLESVGEQDTNLNILL  418



>gb|KJB81105.1| hypothetical protein B456_013G129500 [Gossypium raimondii]
Length=847

 Score =   353 bits (905),  Expect(2) = 4e-164, Method: Compositional matrix adjust.
 Identities = 161/220 (73%), Positives = 184/220 (84%), Gaps = 0/220 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG++SRK+FPACESMC+CCPALRSRSRQPVKRYKKLL++IFPKSP    N RKI KLCEY
Sbjct  1    MGIISRKIFPACESMCVCCPALRSRSRQPVKRYKKLLSEIFPKSPGAPPNERKITKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            AA+NPFRIPKIAK LEERCYKELR  H K +N++ E YN+LLCMCKEQMA FAVNLLNVV
Sbjct  61   AARNPFRIPKIAKYLEERCYKELRYKHVKFINIVIEAYNKLLCMCKEQMAYFAVNLLNVV  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
             E+LD +K +A + +GC T TKFIYSQ DGTYT+NIE  V KVC LA E GEE  + CLR
Sbjct  121  SELLDNSKQEATQILGCQTLTKFIYSQADGTYTHNIEKFVHKVCKLAHEDGEEHLRSCLR  180

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNYEPDAH  804
            ASSL+CLSAMVWFMA++S+IF+  DEIVH TLDNYE D H
Sbjct  181  ASSLQCLSAMVWFMAQYSYIFSALDEIVHATLDNYELDTH  220


 Score =   254 bits (650),  Expect(2) = 4e-164, Method: Compositional matrix adjust.
 Identities = 125/197 (63%), Positives = 154/197 (78%), Gaps = 5/197 (3%)
 Frame = +2

Query  809   EDDERGEAHHNWVDEVIRSEGR--DVGNENRPG-YLIRKRPDKKDISLLTSEEIEMPKIW  979
             +DDERGE H NWVDEV+R EGR   V  +  P   +IR +P+KKD SLLT EEIE PK+W
Sbjct  223   DDDERGEPHRNWVDEVVRCEGRGATVACDASPSNMIIRPQPEKKDPSLLTREEIETPKVW  282

Query  980   AHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSGNHQ  1159
             A ICIQRM +LAKES+T+R V+DPMF++FD+ +HWV + GLA VVLSD+SY+ E+SGN Q
Sbjct  283   AQICIQRMVELAKESTTLRLVVDPMFVYFDSRQHWVSQQGLAMVVLSDMSYW-EASGNQQ  341

Query  1160  LILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKSLQ  1339
              +L  VVRHLDHKNVA D Q+KS++IQ A ALARQIRS    ++IGFVSDLCRHLRKS Q
Sbjct  342   HVLAAVVRHLDHKNVAHDPQLKSYIIQVAAALARQIRSRRMLAEIGFVSDLCRHLRKSFQ  401

Query  1340  ATVDLAGEE-INLNLTL  1387
             AT++  GE+  NLN+ L
Sbjct  402   ATLESVGEQDTNLNILL  418



>ref|XP_006472204.1| PREDICTED: uncharacterized protein LOC102623618 [Citrus sinensis]
Length=1000

 Score =   337 bits (865),  Expect(2) = 5e-164, Method: Compositional matrix adjust.
 Identities = 160/218 (73%), Positives = 182/218 (83%), Gaps = 1/218 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG +SRK+FPAC SMC+CCPALRSRSRQPVKRYKKLLA+IFPKS DG  N RKI+KLCEY
Sbjct  1    MGFISRKIFPACGSMCVCCPALRSRSRQPVKRYKKLLAEIFPKSIDGPPNERKIVKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            AAKNPFRIPKIAK LEERCYKELR  H KL+N++ E YN++LCMCK QMA FAV+LLNV 
Sbjct  61   AAKNPFRIPKIAKYLEERCYKELRCEHIKLINIVTEAYNKMLCMCKVQMAYFAVSLLNVA  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
             E+LD +K + V+ +GC T ++FIYSQ D TYT+NIE  V+KVC LA E G E  +R LR
Sbjct  121  TELLDNSKQETVQILGCQTLSRFIYSQADSTYTHNIEKFVKKVCKLACENGVE-HRRSLR  179

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNYEPD  798
            ASSL+CLSAMVWFMAEFS IFADFDEIV  TLDNYEPD
Sbjct  180  ASSLQCLSAMVWFMAEFSCIFADFDEIVSATLDNYEPD  217


 Score =   270 bits (689),  Expect(2) = 5e-164, Method: Compositional matrix adjust.
 Identities = 128/197 (65%), Positives = 155/197 (79%), Gaps = 4/197 (2%)
 Frame = +2

Query  809   EDDERGEAHHNWVDEVIRSEGRDV--GNENRPG-YLIRKRPDKKDISLLTSEEIEMPKIW  979
             +DDERGE HHNWVDEV+R EGR    G++  P   +IR RP+KKD S LT EE+E PK+W
Sbjct  222   DDDERGEPHHNWVDEVVRCEGRGAAAGSDTGPSSMMIRPRPEKKDPSALTREEVETPKVW  281

Query  980   AHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSGNHQ  1159
             A ICIQRM DLAKE++TMRRVLDPMF +FD+ + W+PR GLA +VLSD++Y +E+SGN Q
Sbjct  282   ARICIQRMVDLAKETTTMRRVLDPMFTYFDSRRQWIPRQGLAMIVLSDMAYLMETSGNQQ  341

Query  1160  LILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKSLQ  1339
             LIL  V+ HLDHKNV+ D Q+KS+VIQ A+ALARQIRSG    +IG VSDLCRHLRKS Q
Sbjct  342   LILASVIHHLDHKNVSHDPQLKSYVIQVASALARQIRSGMVLVEIGSVSDLCRHLRKSFQ  401

Query  1340  ATVDLAGE-EINLNLTL  1387
             ATV+  GE E NLN+ L
Sbjct  402   ATVESVGEQESNLNMLL  418



>gb|KHG26706.1| Protein EFR3 B [Gossypium arboreum]
Length=1050

 Score =   355 bits (910),  Expect(2) = 1e-163, Method: Compositional matrix adjust.
 Identities = 168/243 (69%), Positives = 195/243 (80%), Gaps = 8/243 (3%)
 Frame = +1

Query  94   SRFCGSSSSPDLSL--------QGKMGLLSRKLFPACESMCICCPALRSRSRQPVKRYKK  249
            S FCG  SS  LSL        + +MG +SRK+FPAC SMC+CCPALRSRSRQPVKRYKK
Sbjct  17   SEFCGLPSSVSLSLADLPVTAAEQEMGFISRKIFPACGSMCVCCPALRSRSRQPVKRYKK  76

Query  250  LLADIFPKSPDGSANGRKIMKLCEYAAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIA  429
            LL++IFPKSPD   N RKI+KLCEYAAKNPFRIPKIAK LEERCYKELR  H K +N++ 
Sbjct  77   LLSEIFPKSPDSPPNERKIVKLCEYAAKNPFRIPKIAKYLEERCYKELRYEHIKFINIVT  136

Query  430  EVYNELLCMCKEQMACFAVNLLNVVVEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYN  609
            E YN+LLCMCK QMA FAVNLLNVV E+LD +K DA++ +GC T T FIYSQVDGTYT++
Sbjct  137  EAYNKLLCMCKAQMAYFAVNLLNVVTELLDNSKQDAMRILGCETLTTFIYSQVDGTYTHS  196

Query  610  IENLVQKVCSLARETGEEDQKRCLRASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNY  789
            IE  V KVC LA E  EE Q+RCL+ASSL+CLSAMVWFMA++S+IFA  DE+V+ TLDNY
Sbjct  197  IEKFVHKVCKLAHEDREEHQRRCLKASSLQCLSAMVWFMAQYSYIFAALDEMVYATLDNY  256

Query  790  EPD  798
            E D
Sbjct  257  ELD  259


 Score =   251 bits (641),  Expect(2) = 1e-163, Method: Compositional matrix adjust.
 Identities = 124/199 (62%), Positives = 157/199 (79%), Gaps = 6/199 (3%)
 Frame = +2

Query  803   INEDDERGEAHHNWVDEVIRSEGRD--VGNENRPG-YLIRKRPDKKDISLLTSEEIEMPK  973
             I++D+ER E HHNWVDEV+R EGR   V  ++ P   +IR +P+KKD SLLT EEIE PK
Sbjct  262   IDDDNER-EPHHNWVDEVVRCEGRGAIVACDSSPSNMIIRPQPEKKDPSLLTREEIETPK  320

Query  974   IWAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSGN  1153
             +WA ICIQRM +LAKES+T+R+VLDP+F++ D+ +HWVP+ GLA VVLSD+ Y+ ESSGN
Sbjct  321   VWAQICIQRMVELAKESTTLRQVLDPVFVYLDSRRHWVPQQGLAMVVLSDMLYW-ESSGN  379

Query  1154  HQLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKS  1333
             HQLIL  V+RHLDHKNV+ D Q+KS ++Q A ALARQ RS G  ++ GFVSDLCRHLRKS
Sbjct  380   HQLILGAVIRHLDHKNVSHDPQLKSNIVQVAAALARQTRSRGVLAETGFVSDLCRHLRKS  439

Query  1334  LQATVDLAG-EEINLNLTL  1387
              QAT++  G +E NLN+ L
Sbjct  440   FQATLESVGQQESNLNILL  458



>gb|KHG26707.1| Efr3b [Gossypium arboreum]
Length=1041

 Score =   355 bits (910),  Expect(2) = 1e-163, Method: Compositional matrix adjust.
 Identities = 168/243 (69%), Positives = 195/243 (80%), Gaps = 8/243 (3%)
 Frame = +1

Query  94   SRFCGSSSSPDLSL--------QGKMGLLSRKLFPACESMCICCPALRSRSRQPVKRYKK  249
            S FCG  SS  LSL        + +MG +SRK+FPAC SMC+CCPALRSRSRQPVKRYKK
Sbjct  17   SEFCGLPSSVSLSLADLPVTAAEQEMGFISRKIFPACGSMCVCCPALRSRSRQPVKRYKK  76

Query  250  LLADIFPKSPDGSANGRKIMKLCEYAAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIA  429
            LL++IFPKSPD   N RKI+KLCEYAAKNPFRIPKIAK LEERCYKELR  H K +N++ 
Sbjct  77   LLSEIFPKSPDSPPNERKIVKLCEYAAKNPFRIPKIAKYLEERCYKELRYEHIKFINIVT  136

Query  430  EVYNELLCMCKEQMACFAVNLLNVVVEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYN  609
            E YN+LLCMCK QMA FAVNLLNVV E+LD +K DA++ +GC T T FIYSQVDGTYT++
Sbjct  137  EAYNKLLCMCKAQMAYFAVNLLNVVTELLDNSKQDAMRILGCETLTTFIYSQVDGTYTHS  196

Query  610  IENLVQKVCSLARETGEEDQKRCLRASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNY  789
            IE  V KVC LA E  EE Q+RCL+ASSL+CLSAMVWFMA++S+IFA  DE+V+ TLDNY
Sbjct  197  IEKFVHKVCKLAHEDREEHQRRCLKASSLQCLSAMVWFMAQYSYIFAALDEMVYATLDNY  256

Query  790  EPD  798
            E D
Sbjct  257  ELD  259


 Score =   251 bits (641),  Expect(2) = 1e-163, Method: Compositional matrix adjust.
 Identities = 124/199 (62%), Positives = 157/199 (79%), Gaps = 6/199 (3%)
 Frame = +2

Query  803   INEDDERGEAHHNWVDEVIRSEGRD--VGNENRPG-YLIRKRPDKKDISLLTSEEIEMPK  973
             I++D+ER E HHNWVDEV+R EGR   V  ++ P   +IR +P+KKD SLLT EEIE PK
Sbjct  262   IDDDNER-EPHHNWVDEVVRCEGRGAIVACDSSPSNMIIRPQPEKKDPSLLTREEIETPK  320

Query  974   IWAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSGN  1153
             +WA ICIQRM +LAKES+T+R+VLDP+F++ D+ +HWVP+ GLA VVLSD+ Y+ ESSGN
Sbjct  321   VWAQICIQRMVELAKESTTLRQVLDPVFVYLDSRRHWVPQQGLAMVVLSDMLYW-ESSGN  379

Query  1154  HQLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKS  1333
             HQLIL  V+RHLDHKNV+ D Q+KS ++Q A ALARQ RS G  ++ GFVSDLCRHLRKS
Sbjct  380   HQLILGAVIRHLDHKNVSHDPQLKSNIVQVAAALARQTRSRGVLAETGFVSDLCRHLRKS  439

Query  1334  LQATVDLAG-EEINLNLTL  1387
              QAT++  G +E NLN+ L
Sbjct  440   FQATLESVGQQESNLNILL  458



>ref|XP_010092978.1| hypothetical protein L484_018915 [Morus notabilis]
 gb|EXB53031.1| hypothetical protein L484_018915 [Morus notabilis]
Length=1022

 Score =   334 bits (857),  Expect(2) = 1e-163, Method: Compositional matrix adjust.
 Identities = 157/240 (65%), Positives = 188/240 (78%), Gaps = 20/240 (8%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG++SRK+FPAC SMC+CCPALRS SR+PVKRYKKLLA+IFPKS DG  + RKI+KLCEY
Sbjct  1    MGVISRKIFPACGSMCVCCPALRSSSRKPVKRYKKLLAEIFPKSLDGPPSERKIVKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            A++NP RIPKIAK LEERCYKELR  H K +N++ + Y++LLC+CKEQMA FAV+LLNV+
Sbjct  61   ASRNPVRIPKIAKYLEERCYKELRCEHIKFINIVTDTYSKLLCLCKEQMAYFAVSLLNVI  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQV--------------------DGTYTYNIENLV  624
             E+LD +K DAV+ +GC T T+FIYSQ+                    DGTYT+NIE+ V
Sbjct  121  NELLDNSKQDAVRILGCQTLTRFIYSQIFVVIDFYHELMFNGLMYEQADGTYTHNIESFV  180

Query  625  QKVCSLARETGEEDQKRCLRASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNYEPDAH  804
             KVC LARE G + Q+  LRASSL+CLSAMVWFMAEFS+IF DFDEIVHV LDNYEPD H
Sbjct  181  HKVCLLARERGGDHQRHSLRASSLQCLSAMVWFMAEFSNIFVDFDEIVHVILDNYEPDTH  240


 Score =   271 bits (693),  Expect(2) = 1e-163, Method: Compositional matrix adjust.
 Identities = 130/197 (66%), Positives = 158/197 (80%), Gaps = 4/197 (2%)
 Frame = +2

Query  809   EDDERGEAHHNWVDEVIRSEGRD---VGNENRPGYLIRKRPDKKDISLLTSEEIEMPKIW  979
             EDDER E+  NWVDEV+RSEGR    VG++  P  +IR RP+ KD SLL  EEIEMPK+W
Sbjct  243   EDDERAESRRNWVDEVVRSEGRIGAIVGSDTSPCNIIRARPEIKDPSLLLREEIEMPKVW  302

Query  980   AHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSGNHQ  1159
             A ICIQRM +L+KES+TMRRVLDPMF++FD+ +HWV   GLA VVLSD+SYF+E+S N Q
Sbjct  303   AQICIQRMVELSKESTTMRRVLDPMFVYFDSGRHWVSGQGLAMVVLSDMSYFMENSANQQ  362

Query  1160  LILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKSLQ  1339
             LILT V+RHLDHKN++ D ++KS+ +Q ATALARQIRSG   ++IGFVSDLCRHLRKSLQ
Sbjct  363   LILTYVIRHLDHKNISHDPELKSYAVQVATALARQIRSGAMLAEIGFVSDLCRHLRKSLQ  422

Query  1340  ATVDLAGE-EINLNLTL  1387
             AT+   GE E NLN+ L
Sbjct  423   ATLQPVGEQESNLNVML  439



>ref|XP_002512512.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF49964.1| conserved hypothetical protein [Ricinus communis]
Length=972

 Score =   348 bits (893),  Expect(2) = 2e-163, Method: Compositional matrix adjust.
 Identities = 166/221 (75%), Positives = 185/221 (84%), Gaps = 1/221 (0%)
 Frame = +1

Query  142  KMGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCE  321
            +MG +SRK+FPACESMC+CCPALRSRSRQPVKRYKKLLA+IFPKS DG  N RKI+KLCE
Sbjct  46   EMGFVSRKIFPACESMCVCCPALRSRSRQPVKRYKKLLAEIFPKS-DGPPNERKIVKLCE  104

Query  322  YAAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNV  501
            YAAKNPFRIPKIAK LEERC KELRS H K +N + E YN+LLC+CKEQMA FAV+LLNV
Sbjct  105  YAAKNPFRIPKIAKYLEERCCKELRSEHIKFINTVTETYNKLLCVCKEQMAYFAVSLLNV  164

Query  502  VVEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCL  681
            V E+LD  K DA+  +GC T T+FIYSQ DGTYT+NIE  VQKVC LARE G+E  K  L
Sbjct  165  VSELLDKPKQDALLILGCQTLTRFIYSQTDGTYTHNIEKFVQKVCKLAREHGDEHHKSRL  224

Query  682  RASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNYEPDAH  804
            RASSL+CLSAMVWFMAEF +IF  FDEIV VTLDNYEPD H
Sbjct  225  RASSLQCLSAMVWFMAEFLYIFGAFDEIVQVTLDNYEPDKH  265


 Score =   257 bits (656),  Expect(2) = 2e-163, Method: Compositional matrix adjust.
 Identities = 126/200 (63%), Positives = 152/200 (76%), Gaps = 4/200 (2%)
 Frame = +2

Query  800   PINEDDERGEAHHNWVDEVIRSEGRDVG---NENRPGYLIRKRPDKKDISLLTSEEIEMP  970
             P   DDERGE  HNWVDEV+RSEGR      + +     IR RP+KKD SLLT EEIE P
Sbjct  262   PDKHDDERGEPQHNWVDEVVRSEGRGAAVSYDTSSNCTTIRPRPEKKDPSLLTGEEIETP  321

Query  971   KIWAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSG  1150
               WA ICIQRMA+LAKES+T+R+VLDPMF++FD+ +HWVPR GL+  VLSD+ + +E+SG
Sbjct  322   SAWARICIQRMAELAKESTTVRQVLDPMFVYFDSGRHWVPRQGLSIAVLSDMCHLLETSG  381

Query  1151  NHQLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRK  1330
             + QL+L  VVRHLDHKNV  D Q+KS VIQ A  LA+QIRS    ++IGFVSDLCRHLRK
Sbjct  382   HQQLVLAAVVRHLDHKNVVHDPQLKSDVIQVAAVLAKQIRSETVLAEIGFVSDLCRHLRK  441

Query  1331  SLQATVDLAGE-EINLNLTL  1387
             SLQATV+ AGE E N+N+ L
Sbjct  442   SLQATVESAGEQESNMNVLL  461



>gb|KJB45453.1| hypothetical protein B456_007G306600 [Gossypium raimondii]
 gb|KJB45454.1| hypothetical protein B456_007G306600 [Gossypium raimondii]
Length=1000

 Score =   353 bits (905),  Expect(2) = 1e-162, Method: Compositional matrix adjust.
 Identities = 161/218 (74%), Positives = 186/218 (85%), Gaps = 0/218 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG +SRK+FPAC SMC+CCPALRSRSRQPVKRYKKLL++IFPKSPD   N RKI+KLCEY
Sbjct  1    MGFISRKIFPACGSMCVCCPALRSRSRQPVKRYKKLLSEIFPKSPDSPPNERKIVKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            AAKNPFRIPKIAK LEERCYKELR  H K +N++ E YN+LLCMCK QMA FAVNLLNVV
Sbjct  61   AAKNPFRIPKIAKYLEERCYKELRYEHIKFINIVTEAYNKLLCMCKAQMAYFAVNLLNVV  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
             E+LD +K DA++ +GC T T FIYSQVDGTYT++IE  V KVC LARE GEE Q+RCL+
Sbjct  121  TELLDNSKQDAMRILGCETLTSFIYSQVDGTYTHSIEKFVHKVCKLAREDGEEHQRRCLK  180

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNYEPD  798
            ASSL+CLSAMVWFMA++S+IFA  DE+V+ TLDNYE D
Sbjct  181  ASSLQCLSAMVWFMAQYSYIFAALDEMVYATLDNYELD  218


 Score =   249 bits (637),  Expect(2) = 1e-162, Method: Compositional matrix adjust.
 Identities = 122/199 (61%), Positives = 156/199 (78%), Gaps = 6/199 (3%)
 Frame = +2

Query  803   INEDDERGEAHHNWVDEVIRSEGRD---VGNENRPGYLIRKRPDKKDISLLTSEEIEMPK  973
             I++D+ER E HHNWVDEV+R EGR    V + +    +IR +P+KKD SLLT EEIE PK
Sbjct  221   IDDDNER-EPHHNWVDEVVRCEGRGAIVVCDSSPSNMIIRPQPEKKDPSLLTREEIETPK  279

Query  974   IWAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSGN  1153
             +WA ICIQRM +LAKES+T+R+VLDP+F++ D+ +HWVP+ GLA VVLSD+ Y+ E+SGN
Sbjct  280   VWAQICIQRMVELAKESTTLRQVLDPVFVYLDSRRHWVPQQGLAMVVLSDMLYW-EASGN  338

Query  1154  HQLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKS  1333
             HQLIL  V+RHLDHKNV+ D Q+KS ++Q A ALARQ RS G  ++ GFVSDLCRHLRKS
Sbjct  339   HQLILGAVIRHLDHKNVSHDPQLKSNIVQVAAALARQTRSRGVLAETGFVSDLCRHLRKS  398

Query  1334  LQATVDLAG-EEINLNLTL  1387
              QAT++  G +E NLN+ L
Sbjct  399   FQATLESVGQQESNLNILL  417



>gb|KHG02153.1| Protein EFR3 [Gossypium arboreum]
Length=999

 Score =   352 bits (903),  Expect(2) = 3e-162, Method: Compositional matrix adjust.
 Identities = 160/220 (73%), Positives = 183/220 (83%), Gaps = 0/220 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG++SRK+FPACESMC+CCPALRSRSRQPVKRYKKLL++IFPKSP    N RKI KLCEY
Sbjct  1    MGIISRKIFPACESMCVCCPALRSRSRQPVKRYKKLLSEIFPKSPGAPPNERKITKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            AA+NPFRIPKIAK LEERCYKELR  H K +N++ E YN+LLCMCKEQMA FAVNLLNVV
Sbjct  61   AARNPFRIPKIAKYLEERCYKELRYKHVKFINIVTEAYNKLLCMCKEQMAYFAVNLLNVV  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
             E+LD +K +A + +GC T TKFIYSQ DGTYT+NIE  V KVC LA E GEE  + CLR
Sbjct  121  SELLDNSKQEATQILGCQTLTKFIYSQADGTYTHNIEKFVHKVCKLAHEDGEEHLRSCLR  180

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNYEPDAH  804
            ASSL+CLSAMVWFMA++ +IF+  DEIVH TLDNYE D H
Sbjct  181  ASSLQCLSAMVWFMAQYPYIFSALDEIVHATLDNYELDTH  220


 Score =   249 bits (635),  Expect(2) = 3e-162, Method: Compositional matrix adjust.
 Identities = 124/197 (63%), Positives = 154/197 (78%), Gaps = 6/197 (3%)
 Frame = +2

Query  809   EDDERGEAHHNWVDEVIRSEGR--DVGNENRPG-YLIRKRPDKKDISLLTSEEIEMPKIW  979
             +DD+RGE H NWVDEV+R EGR   V  +  P   +I  +P+KKD SLLT EEIE PK+W
Sbjct  223   DDDDRGEPH-NWVDEVVRCEGRGATVACDASPSNMIITPQPEKKDPSLLTREEIETPKVW  281

Query  980   AHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSGNHQ  1159
             A ICIQRM +LAKES+T+R V+DPMF++FD+ +HWV + GLA VVLSD+SY+ E+SGN Q
Sbjct  282   AQICIQRMVELAKESTTLRLVVDPMFVYFDSRQHWVSQQGLAMVVLSDMSYW-EASGNRQ  340

Query  1160  LILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKSLQ  1339
             L+L  VVRHLDHKNVA D Q+KS++IQ A ALARQIRS    ++IGFVSDLCRHLRKS Q
Sbjct  341   LVLAAVVRHLDHKNVAHDPQLKSYIIQVAAALARQIRSRRMLAEIGFVSDLCRHLRKSFQ  400

Query  1340  ATVDLAGEE-INLNLTL  1387
             AT++  GE+  NLN+ L
Sbjct  401   ATLESVGEQDTNLNILL  417



>ref|XP_010267985.1| PREDICTED: uncharacterized protein LOC104605067 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010267986.1| PREDICTED: uncharacterized protein LOC104605067 isoform X1 [Nelumbo 
nucifera]
Length=1001

 Score =   340 bits (871),  Expect(2) = 1e-161, Method: Compositional matrix adjust.
 Identities = 155/220 (70%), Positives = 181/220 (82%), Gaps = 0/220 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG +SRK+ P C +MC+CCPALRSRSRQP KRYKKLL++IFPKS DG  N RKI+KLCEY
Sbjct  1    MGFISRKVLPVCGNMCVCCPALRSRSRQPTKRYKKLLSEIFPKSLDGPPNERKIVKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            A++NP RIPKIAK LE+R YKELRS H K VNVI E YN+LLCMCKEQMA FA++LLNVV
Sbjct  61   ASRNPIRIPKIAKYLEQRIYKELRSEHIKFVNVIMEAYNKLLCMCKEQMAYFALSLLNVV  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
            +E+LD  K D V+ +GC    +FIYSQ D TYT+NIE LV KVCSLA E+GEE  K+CLR
Sbjct  121  IELLDNTKQDVVRILGCQILARFIYSQADSTYTHNIEGLVHKVCSLACESGEERSKQCLR  180

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNYEPDAH  804
            ASSL+CLS+M+WFM EFSH+F DFDEIVH  LDNY+PD H
Sbjct  181  ASSLQCLSSMMWFMGEFSHVFDDFDEIVHAILDNYDPDMH  220


 Score =   259 bits (662),  Expect(2) = 1e-161, Method: Compositional matrix adjust.
 Identities = 124/198 (63%), Positives = 152/198 (77%), Gaps = 2/198 (1%)
 Frame = +2

Query  797   MPINEDDERGEAHHNWVDEVIRSEGRDVGNENRPGYLIRKRPDKKDISLLTSEEIEMPKI  976
             M +  D+ERGE  HNWVDEV+R E   VG +  P ++IR RP+KKD SLLT EEIE PKI
Sbjct  219   MHLEGDNERGELQHNWVDEVVRCEA-GVGGDLSPNHIIRPRPEKKDFSLLTREEIETPKI  277

Query  977   WAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSGNH  1156
             WA ICIQR+ +LAKES+TMRRVLDPMFI+FD  + WVPR GL+ VVLSD+ YF E+ G+ 
Sbjct  278   WAQICIQRVVELAKESTTMRRVLDPMFIYFDTKRKWVPRQGLSVVVLSDMCYFAENPGSE  337

Query  1157  QLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKSL  1336
             QLIL  V+RHLDHKNV+ D Q+KS +IQ A  LARQIR+    ++IG +SDLCRHLRKSL
Sbjct  338   QLILASVIRHLDHKNVSHDRQVKSDIIQIAATLARQIRTQTMVAEIGIISDLCRHLRKSL  397

Query  1337  QATVDLAG-EEINLNLTL  1387
             QA  +L G +E NLN++L
Sbjct  398   QAKAELVGQQEANLNISL  415



>ref|XP_010267987.1| PREDICTED: uncharacterized protein LOC104605067 isoform X2 [Nelumbo 
nucifera]
Length=989

 Score =   339 bits (870),  Expect(2) = 1e-161, Method: Compositional matrix adjust.
 Identities = 155/220 (70%), Positives = 181/220 (82%), Gaps = 0/220 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG +SRK+ P C +MC+CCPALRSRSRQP KRYKKLL++IFPKS DG  N RKI+KLCEY
Sbjct  1    MGFISRKVLPVCGNMCVCCPALRSRSRQPTKRYKKLLSEIFPKSLDGPPNERKIVKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            A++NP RIPKIAK LE+R YKELRS H K VNVI E YN+LLCMCKEQMA FA++LLNVV
Sbjct  61   ASRNPIRIPKIAKYLEQRIYKELRSEHIKFVNVIMEAYNKLLCMCKEQMAYFALSLLNVV  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
            +E+LD  K D V+ +GC    +FIYSQ D TYT+NIE LV KVCSLA E+GEE  K+CLR
Sbjct  121  IELLDNTKQDVVRILGCQILARFIYSQADSTYTHNIEGLVHKVCSLACESGEERSKQCLR  180

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNYEPDAH  804
            ASSL+CLS+M+WFM EFSH+F DFDEIVH  LDNY+PD H
Sbjct  181  ASSLQCLSSMMWFMGEFSHVFDDFDEIVHAILDNYDPDMH  220


 Score =   259 bits (663),  Expect(2) = 1e-161, Method: Compositional matrix adjust.
 Identities = 124/198 (63%), Positives = 152/198 (77%), Gaps = 2/198 (1%)
 Frame = +2

Query  797   MPINEDDERGEAHHNWVDEVIRSEGRDVGNENRPGYLIRKRPDKKDISLLTSEEIEMPKI  976
             M +  D+ERGE  HNWVDEV+R E   VG +  P ++IR RP+KKD SLLT EEIE PKI
Sbjct  219   MHLEGDNERGELQHNWVDEVVRCEA-GVGGDLSPNHIIRPRPEKKDFSLLTREEIETPKI  277

Query  977   WAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSGNH  1156
             WA ICIQR+ +LAKES+TMRRVLDPMFI+FD  + WVPR GL+ VVLSD+ YF E+ G+ 
Sbjct  278   WAQICIQRVVELAKESTTMRRVLDPMFIYFDTKRKWVPRQGLSVVVLSDMCYFAENPGSE  337

Query  1157  QLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKSL  1336
             QLIL  V+RHLDHKNV+ D Q+KS +IQ A  LARQIR+    ++IG +SDLCRHLRKSL
Sbjct  338   QLILASVIRHLDHKNVSHDRQVKSDIIQIAATLARQIRTQTMVAEIGIISDLCRHLRKSL  397

Query  1337  QATVDLAG-EEINLNLTL  1387
             QA  +L G +E NLN++L
Sbjct  398   QAKAELVGQQEANLNISL  415



>gb|KEH43106.1| cyclin-like protein [Medicago truncatula]
Length=997

 Score =   343 bits (879),  Expect(2) = 2e-161, Method: Compositional matrix adjust.
 Identities = 157/216 (73%), Positives = 186/216 (86%), Gaps = 0/216 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG++SRK+FPACESMC+CCPALRSRSRQPVKRY+KLLADIFPKSPD   N RKI+KLCEY
Sbjct  1    MGVISRKIFPACESMCVCCPALRSRSRQPVKRYRKLLADIFPKSPDELPNERKIVKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            AAKNPFRIPKIAK LEERCYKELRS H KLV +IAE +N+LL +CK Q+  FAV++LNV 
Sbjct  61   AAKNPFRIPKIAKYLEERCYKELRSEHIKLVKIIAESFNKLLSICKAQITYFAVDVLNVT  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
             E+LD +K +A++ +GC + T+FIY QVD TYT+NIE LV+KVC L++E GE  + RCLR
Sbjct  121  SELLDYSKDEAIQALGCQSLTRFIYCQVDSTYTHNIEKLVRKVCMLSQEPGETHENRCLR  180

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNYE  792
            ASSL+CLSAMVWFM EFSHIFADFDEIV+ TLDNY+
Sbjct  181  ASSLQCLSAMVWFMTEFSHIFADFDEIVYATLDNYD  216


 Score =   256 bits (654),  Expect(2) = 2e-161, Method: Compositional matrix adjust.
 Identities = 122/199 (61%), Positives = 155/199 (78%), Gaps = 5/199 (3%)
 Frame = +2

Query  806   NEDDERGEAHHNWVDEVIRSEGRD---VGNENRPGYLI-RKRPDKKDISLLTSEEIEMPK  973
             ++ D R EAHHNWV+EV+RSE R    VGN+NR   LI + RP+ KD SLLT EEIE P+
Sbjct  222   DDADIRTEAHHNWVNEVVRSESRAGSVVGNDNRSSCLIIQPRPEVKDPSLLTREEIEKPE  281

Query  974   IWAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSGN  1153
             IWA ICIQR+ +LAKES+TMRRVLDPMF++FD  +HW P++GLA VVLS ++YF+E++GN
Sbjct  282   IWAQICIQRLVELAKESTTMRRVLDPMFVYFDTRQHWAPQNGLAMVVLSRMAYFIENTGN  341

Query  1154  HQLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKS  1333
              + IL  V+ HLDHKNV  D Q+KS+V+Q AT+LA QIRSG   ++IGFV DLCRHLRKS
Sbjct  342   QRFILASVIHHLDHKNVMNDPQLKSYVVQVATSLAMQIRSGRRLAEIGFVGDLCRHLRKS  401

Query  1334  LQATVDLAGE-EINLNLTL  1387
              QA+ +  GE E NLN++L
Sbjct  402   FQASSEFVGEQEFNLNISL  420



>ref|XP_004495652.1| PREDICTED: uncharacterized protein LOC101508441 isoform X1 [Cicer 
arietinum]
 ref|XP_004495653.1| PREDICTED: uncharacterized protein LOC101508441 isoform X2 [Cicer 
arietinum]
 ref|XP_004495654.1| PREDICTED: uncharacterized protein LOC101508441 isoform X3 [Cicer 
arietinum]
 ref|XP_004495655.1| PREDICTED: uncharacterized protein LOC101508441 isoform X4 [Cicer 
arietinum]
Length=994

 Score =   337 bits (865),  Expect(2) = 2e-160, Method: Compositional matrix adjust.
 Identities = 154/216 (71%), Positives = 184/216 (85%), Gaps = 0/216 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG++SRK+FPAC SMC+CCPALRSRSRQPVKRY+KLL DIFPKSPD   N RKI+KLCEY
Sbjct  1    MGIISRKIFPACGSMCVCCPALRSRSRQPVKRYRKLLVDIFPKSPDELPNERKIIKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            AAKNPFRIPKIAK LEERCYKELRS H KLV ++AE +N+LL MCK Q+A FAV++LNV+
Sbjct  61   AAKNPFRIPKIAKYLEERCYKELRSEHIKLVKIVAESFNKLLSMCKVQIAYFAVDVLNVI  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
             E+L  +K + ++T+GC + T+FIY QVD TYT+NIE LV+KVC L++E GE  +K CL+
Sbjct  121  SELLGYSKDETIQTLGCQSLTRFIYCQVDATYTHNIEKLVRKVCMLSQEPGETHEKHCLK  180

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNYE  792
            ASSL+CLSAMVWFM EFSHIF DFDEIV+ TLDNYE
Sbjct  181  ASSLQCLSAMVWFMTEFSHIFVDFDEIVYATLDNYE  216


 Score =   258 bits (658),  Expect(2) = 2e-160, Method: Compositional matrix adjust.
 Identities = 123/198 (62%), Positives = 155/198 (78%), Gaps = 5/198 (3%)
 Frame = +2

Query  809   EDDERGEAHHNWVDEVIRSEGRD---VGNENRPGYLI-RKRPDKKDISLLTSEEIEMPKI  976
             + D   EAHHNWVDEV+RSE R    VGN+NR   LI + RP+ KD SLLT EEIE P+I
Sbjct  222   DSDLTAEAHHNWVDEVVRSESRAGSVVGNDNRSSCLIIQPRPEVKDPSLLTREEIEKPEI  281

Query  977   WAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSGNH  1156
             WA ICIQRM +LAKES+TMRRVLDPMF++FD+ +HW P++GLA +VLS ++YF+E++GN 
Sbjct  282   WAQICIQRMVELAKESTTMRRVLDPMFVYFDSRQHWAPQNGLAMMVLSSMAYFMENTGNQ  341

Query  1157  QLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKSL  1336
             + IL  V+ HLDHKNV  D Q+KSFV+Q AT+LA QIRSG   ++IGFV DLCRHLRKS 
Sbjct  342   RFILASVIHHLDHKNVMNDPQLKSFVVQVATSLAMQIRSGRRLAEIGFVGDLCRHLRKSF  401

Query  1337  QATVDLAGE-EINLNLTL  1387
             QA+ +  GE E+NLN++L
Sbjct  402   QASSEFVGEQELNLNISL  419



>emb|CAN82509.1| hypothetical protein VITISV_012725 [Vitis vinifera]
Length=1471

 Score =   315 bits (807),  Expect(2) = 4e-160, Method: Compositional matrix adjust.
 Identities = 155/234 (66%), Positives = 178/234 (76%), Gaps = 17/234 (7%)
 Frame = +1

Query  106  GSSSSPDLSLQGK-MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPD  282
            G  + PDL  QGK MG +SR++FPAC SMC+CCPALRSRSRQPVKRYKKLLA+IFPKS D
Sbjct  451  GVFAPPDLPPQGKEMGFISRRIFPACGSMCVCCPALRSRSRQPVKRYKKLLAEIFPKSID  510

Query  283  GSANGRKIMKLCEYAAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCK  462
            G  N RKI+KLCEYAAKNPFRIPKIAK LEERCYKELR  H K + ++ E YN+LLCMCK
Sbjct  511  GPPNERKIVKLCEYAAKNPFRIPKIAKYLEERCYKELRCEHIKFIAIVTEAYNKLLCMCK  570

Query  463  EQMACFAVNLLNVVVEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSL  642
            +QMA FAV+LLNVV E+LD  K DA++ +GC T T+FIY Q D TYT+NIEN V+KVC L
Sbjct  571  DQMAYFAVSLLNVVSELLDKPKKDAMRILGCQTLTRFIYCQADSTYTHNIENFVRKVCML  630

Query  643  ARETGEEDQKRCLRASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNYEPDAH  804
            ARE G+E Q   L+ASSL+CLSAM                IVHVTLDNYE D H
Sbjct  631  AREAGDEQQTSTLKASSLQCLSAM----------------IVHVTLDNYEQDTH  668


 Score =   279 bits (713),  Expect(2) = 4e-160, Method: Compositional matrix adjust.
 Identities = 135/198 (68%), Positives = 160/198 (81%), Gaps = 5/198 (3%)
 Frame = +2

Query  809   EDDERGEAHHNWVDEVIRSEGRD---VGNENRPGY-LIRKRPDKKDISLLTSEEIEMPKI  976
             EDDERGE HHNWVDEV+R EGR    VG+E  P   +IR + +KKD SLLT EEIE PK+
Sbjct  671   EDDERGEPHHNWVDEVVRCEGRGGAGVGSEISPSCPVIRPQTEKKDPSLLTREEIETPKV  730

Query  977   WAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSGNH  1156
             WA ICIQRM +LAKES+TMRRVLDPMF++FD  +HWVPR GLA VVLSD+SYFVES G+ 
Sbjct  731   WAQICIQRMVELAKESTTMRRVLDPMFVYFDTGRHWVPRQGLALVVLSDMSYFVESMGDQ  790

Query  1157  QLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKSL  1336
             ++IL  V+RHLDHKNVA D Q KS+VIQ ATAL  Q+RSG   ++IGFVSDLCRHLRKSL
Sbjct  791   KMILAAVIRHLDHKNVAHDPQTKSYVIQVATALVHQVRSGAILAEIGFVSDLCRHLRKSL  850

Query  1337  QATVDLAG-EEINLNLTL  1387
             QATV+ AG +E +LN++L
Sbjct  851   QATVESAGQQESDLNISL  868



>ref|XP_003555181.1| PREDICTED: uncharacterized protein LOC100788290 [Glycine max]
Length=995

 Score =   335 bits (860),  Expect(2) = 2e-159, Method: Compositional matrix adjust.
 Identities = 157/216 (73%), Positives = 185/216 (86%), Gaps = 0/216 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG++SRK+FPAC +MC+CCPALRSRSRQPVKRY+KLLADIFPKSPD S + RKI KLCEY
Sbjct  1    MGVISRKIFPACGNMCVCCPALRSRSRQPVKRYRKLLADIFPKSPDESPSERKITKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            AAKNPFRIPKIAK LEERCYKELR  H KLVN+IAE +N+LL +CK Q+A FAV++LNV+
Sbjct  61   AAKNPFRIPKIAKYLEERCYKELRYEHIKLVNIIAESFNKLLSICKVQIAYFAVDVLNVI  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
            +E+L  +K + ++T+GC   +KFIY Q+D TYT+NIE LV KVC L+RE GE  +KRCLR
Sbjct  121  LELLSYSKDETIQTLGCQCLSKFIYCQMDATYTHNIEKLVPKVCMLSREHGEACEKRCLR  180

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNYE  792
            ASSL+CLSAMVWFMAEFSHIF DFDEIV  TLDNYE
Sbjct  181  ASSLQCLSAMVWFMAEFSHIFVDFDEIVRATLDNYE  216


 Score =   256 bits (654),  Expect(2) = 2e-159, Method: Compositional matrix adjust.
 Identities = 124/198 (63%), Positives = 154/198 (78%), Gaps = 5/198 (3%)
 Frame = +2

Query  809   EDDERGEAHHNWVDEVIRSEGRD---VGNENRPGYLI-RKRPDKKDISLLTSEEIEMPKI  976
             E D R EAHHNWVDEVIR EGR    +GN+NR   LI + RP+ K  SLLT EEIE P+I
Sbjct  223   EADVRAEAHHNWVDEVIRCEGRGGSVIGNDNRSSCLIIQPRPEIKGPSLLTREEIEKPQI  282

Query  977   WAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSGNH  1156
             WA ICIQRM +LAKES+TMRRVLDPMF++FD+ +HW P+ GLA ++LS ++YF+E+SGN 
Sbjct  283   WAQICIQRMVELAKESTTMRRVLDPMFVYFDSRQHWAPQKGLAMIILSRMAYFMENSGNQ  342

Query  1157  QLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKSL  1336
             +LIL  V+ HLDHKNV  D Q+K+ VIQ AT+LA QIRS  G ++IGFV  LCRHLRKSL
Sbjct  343   RLILASVIHHLDHKNVMNDPQLKTCVIQVATSLAMQIRSESGLAEIGFVGVLCRHLRKSL  402

Query  1337  QATVDLAGE-EINLNLTL  1387
             QA+ +  GE E+NLN++L
Sbjct  403   QASSEFGGEQELNLNISL  420



>ref|XP_003536043.1| PREDICTED: uncharacterized protein LOC100785587 isoform X1 [Glycine 
max]
 ref|XP_006589117.1| PREDICTED: uncharacterized protein LOC100785587 isoform X2 [Glycine 
max]
Length=997

 Score =   333 bits (855),  Expect(2) = 3e-159, Method: Compositional matrix adjust.
 Identities = 153/216 (71%), Positives = 187/216 (87%), Gaps = 0/216 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG++SRK+FPAC +MC+CCPALRSRSRQPVKRY+KLLADIFPKSPD   + RKI+KLCEY
Sbjct  1    MGVISRKIFPACGNMCVCCPALRSRSRQPVKRYRKLLADIFPKSPDEPPSERKIIKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            AAKNPFRIPKIAK LEERCYKELRS H KLVN+IAE +N+LL +CK Q+A FAV++LNV+
Sbjct  61   AAKNPFRIPKIAKYLEERCYKELRSEHIKLVNIIAESFNKLLSICKVQIAYFAVDVLNVI  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
            +E+L  +K + ++T+GC   ++FIY QVD TYT++IE LV+KVC L++E GE  +KRCLR
Sbjct  121  LELLSYSKDETIQTLGCQCLSRFIYCQVDATYTHSIEKLVRKVCMLSQEHGEAREKRCLR  180

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNYE  792
            ASSL+CLSAMVWFMAEFSHIF DFDEIVH  LDN++
Sbjct  181  ASSLQCLSAMVWFMAEFSHIFVDFDEIVHSALDNFD  216


 Score =   257 bits (657),  Expect(2) = 3e-159, Method: Compositional matrix adjust.
 Identities = 125/198 (63%), Positives = 155/198 (78%), Gaps = 5/198 (3%)
 Frame = +2

Query  809   EDDERGEAHHNWVDEVIRSEGRD---VGNENRPGYLI-RKRPDKKDISLLTSEEIEMPKI  976
             E D R EAHHNWVDEVIR EGR    +GN+NR   LI + RP+ KD SLLT EEIE P+I
Sbjct  223   EADAREEAHHNWVDEVIRCEGRGGSVIGNDNRSSCLIIQPRPEVKDPSLLTREEIENPEI  282

Query  977   WAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSGNH  1156
             WA ICIQRM +LAKES+TMRRVLDPMF++FD+ +HW P+ GLA +VLS ++YF+E+SGN 
Sbjct  283   WAQICIQRMVELAKESTTMRRVLDPMFVYFDSRQHWAPQKGLAMIVLSRMAYFMENSGNQ  342

Query  1157  QLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKSL  1336
             +LIL  V+ HLDHKNV  D Q+K+ V+Q AT+LA QIRSG G ++I FV  LCRHLRKSL
Sbjct  343   RLILASVIHHLDHKNVMNDPQLKTCVVQVATSLAMQIRSGSGLAEIVFVGVLCRHLRKSL  402

Query  1337  QATVDLAGE-EINLNLTL  1387
             QA+ +  GE E+NLN++L
Sbjct  403   QASSEFVGEQELNLNISL  420



>ref|XP_006589118.1| PREDICTED: uncharacterized protein LOC100785587 isoform X3 [Glycine 
max]
 gb|KHN16056.1| Protein EFR3 like A [Glycine soja]
Length=996

 Score =   333 bits (855),  Expect(2) = 3e-159, Method: Compositional matrix adjust.
 Identities = 153/216 (71%), Positives = 187/216 (87%), Gaps = 0/216 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG++SRK+FPAC +MC+CCPALRSRSRQPVKRY+KLLADIFPKSPD   + RKI+KLCEY
Sbjct  1    MGVISRKIFPACGNMCVCCPALRSRSRQPVKRYRKLLADIFPKSPDEPPSERKIIKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            AAKNPFRIPKIAK LEERCYKELRS H KLVN+IAE +N+LL +CK Q+A FAV++LNV+
Sbjct  61   AAKNPFRIPKIAKYLEERCYKELRSEHIKLVNIIAESFNKLLSICKVQIAYFAVDVLNVI  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
            +E+L  +K + ++T+GC   ++FIY QVD TYT++IE LV+KVC L++E GE  +KRCLR
Sbjct  121  LELLSYSKDETIQTLGCQCLSRFIYCQVDATYTHSIEKLVRKVCMLSQEHGEAREKRCLR  180

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNYE  792
            ASSL+CLSAMVWFMAEFSHIF DFDEIVH  LDN++
Sbjct  181  ASSLQCLSAMVWFMAEFSHIFVDFDEIVHSALDNFD  216


 Score =   257 bits (657),  Expect(2) = 3e-159, Method: Compositional matrix adjust.
 Identities = 125/198 (63%), Positives = 155/198 (78%), Gaps = 5/198 (3%)
 Frame = +2

Query  809   EDDERGEAHHNWVDEVIRSEGRD---VGNENRPGYLI-RKRPDKKDISLLTSEEIEMPKI  976
             E D R EAHHNWVDEVIR EGR    +GN+NR   LI + RP+ KD SLLT EEIE P+I
Sbjct  223   EADAREEAHHNWVDEVIRCEGRGGSVIGNDNRSSCLIIQPRPEVKDPSLLTREEIENPEI  282

Query  977   WAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSGNH  1156
             WA ICIQRM +LAKES+TMRRVLDPMF++FD+ +HW P+ GLA +VLS ++YF+E+SGN 
Sbjct  283   WAQICIQRMVELAKESTTMRRVLDPMFVYFDSRQHWAPQKGLAMIVLSRMAYFMENSGNQ  342

Query  1157  QLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKSL  1336
             +LIL  V+ HLDHKNV  D Q+K+ V+Q AT+LA QIRSG G ++I FV  LCRHLRKSL
Sbjct  343   RLILASVIHHLDHKNVMNDPQLKTCVVQVATSLAMQIRSGSGLAEIVFVGVLCRHLRKSL  402

Query  1337  QATVDLAGE-EINLNLTL  1387
             QA+ +  GE E+NLN++L
Sbjct  403   QASSEFVGEQELNLNISL  420



>ref|XP_010024133.1| PREDICTED: uncharacterized protein LOC104414673 [Eucalyptus grandis]
 gb|KCW60561.1| hypothetical protein EUGRSUZ_H03293 [Eucalyptus grandis]
Length=993

 Score =   335 bits (859),  Expect(2) = 4e-159, Method: Compositional matrix adjust.
 Identities = 157/218 (72%), Positives = 177/218 (81%), Gaps = 0/218 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG +SRK+FPAC SMC+CCPA+RSRSRQPVKRYKKLLADIFPKSPDGS N RKI KLCEY
Sbjct  1    MGFISRKIFPACGSMCVCCPAMRSRSRQPVKRYKKLLADIFPKSPDGSPNDRKIGKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            AAKNPFRIPKI K LEERCYKELRS H K +N+  E YN+LL MCKEQM  FAV+LL VV
Sbjct  61   AAKNPFRIPKIVKYLEERCYKELRSEHIKFINIAVEAYNKLLSMCKEQMVYFAVSLLTVV  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
             E+LD  K D+++ +GC T TKFIYSQ D TY +NIE  V KVC LA+++GE  Q   LR
Sbjct  121  SELLDNGKQDSLQILGCQTLTKFIYSQSDSTYAHNIEKFVHKVCILAQKSGEGHQWCALR  180

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNYEPD  798
            ASSL+CLSAMVWFM EFS +F  FDEIV VTL+NYEPD
Sbjct  181  ASSLQCLSAMVWFMVEFSSMFDGFDEIVQVTLENYEPD  218


 Score =   256 bits (653),  Expect(2) = 4e-159, Method: Compositional matrix adjust.
 Identities = 126/195 (65%), Positives = 149/195 (76%), Gaps = 2/195 (1%)
 Frame = +2

Query  809   EDDERGEAHHNWVDEVIRSEGRDVGNENRPGYLIRKRPDKKDISLLTSEEIEMPKIWAHI  988
             E+DERG + HNWVDEV+RSEGR     +    ++R RP  KD SLLT EE+E PK+WA I
Sbjct  223   EEDERGGSLHNWVDEVVRSEGRTAAESSPNCIILRPRPVIKDPSLLTKEELETPKVWAQI  282

Query  989   CIQRMADLAKESS-TMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSGNHQLI  1165
             CIQRMADLAKES  TMRRV+DPM  +FD+  HWVPR GL+ +VLSD+SY +ESSGN QLI
Sbjct  283   CIQRMADLAKESMMTMRRVMDPMLAYFDSGHHWVPRDGLSSIVLSDMSYKLESSGNQQLI  342

Query  1166  LTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKSLQAT  1345
             L  V+RHLDHKN+  D Q+KS VIQ ATALARQIR     ++IG VSDLCRHLRKSLQ T
Sbjct  343   LASVIRHLDHKNIFHDLQLKSCVIQVATALARQIRISSALTEIGSVSDLCRHLRKSLQVT  402

Query  1346  VDLAGEE-INLNLTL  1387
             V+  GEE +NLN +L
Sbjct  403   VEAVGEEDLNLNYSL  417



>ref|XP_010546763.1| PREDICTED: uncharacterized protein LOC104818746 [Tarenaya hassleriana]
Length=989

 Score =   353 bits (905),  Expect(2) = 2e-157, Method: Compositional matrix adjust.
 Identities = 159/219 (73%), Positives = 187/219 (85%), Gaps = 0/219 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG +SR++FPACESMC+CCPALRSRSRQPVKRYKKLLA+IFPKS DG+ N RKI+KLCEY
Sbjct  1    MGFISRRVFPACESMCVCCPALRSRSRQPVKRYKKLLAEIFPKSLDGAPNERKIVKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            AA+NP RIPKIAK LEERCYKELRS   K ++++ E YN++LC+CKEQMA FA ++L+VV
Sbjct  61   AARNPLRIPKIAKFLEERCYKELRSEQIKFISIVTEAYNKMLCLCKEQMAYFATSVLSVV  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
             E+LD +K D+ K +GC T T+FIYSQVDG+YT+NIEN V KVCSLA E G+E QKRCLR
Sbjct  121  TELLDNSKQDSTKMLGCQTLTRFIYSQVDGSYTHNIENFVHKVCSLAHEDGDEHQKRCLR  180

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNYEPDA  801
            AS L+CLSAMVWFM EFS+IFA FDEIVH  LDNYEPD 
Sbjct  181  ASGLQCLSAMVWFMGEFSYIFAAFDEIVHAILDNYEPDT  219


 Score =   232 bits (592),  Expect(2) = 2e-157, Method: Compositional matrix adjust.
 Identities = 109/195 (56%), Positives = 144/195 (74%), Gaps = 3/195 (2%)
 Frame = +2

Query  812   DDERGEAHHNWVDEVIRSEGR--DVGNENRPGYLI-RKRPDKKDISLLTSEEIEMPKIWA  982
             +D+R E + NWV+EVIR EGR   VG  + P Y+I R R  +K+ SLLT +E E PK+WA
Sbjct  224   NDDREEQNCNWVNEVIRCEGRGITVGGGSSPSYMILRPRTARKEPSLLTKDETETPKVWA  283

Query  983   HICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSGNHQL  1162
              IC+QRM DLAKE +T+RRVLDPMF +FD+ + W P +GLA  VLSD +Y +E+S N QL
Sbjct  284   QICLQRMVDLAKERTTLRRVLDPMFCYFDSKRQWTPPNGLAMTVLSDATYLMENSENQQL  343

Query  1163  ILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKSLQA  1342
             +L+ VVRHLD+K+VA D ++K+F++Q A +LARQIR+     D  FVSDLCRHLRKS QA
Sbjct  344   VLSTVVRHLDNKHVANDPELKAFIVQGAASLARQIRTSSSLRDASFVSDLCRHLRKSFQA  403

Query  1343  TVDLAGEEINLNLTL  1387
             T  +  +E+NLN+ L
Sbjct  404   TAAVGEQELNLNMML  418



>ref|XP_007145003.1| hypothetical protein PHAVU_007G201500g [Phaseolus vulgaris]
 gb|ESW16997.1| hypothetical protein PHAVU_007G201500g [Phaseolus vulgaris]
Length=999

 Score =   327 bits (838),  Expect(2) = 2e-156, Method: Compositional matrix adjust.
 Identities = 151/216 (70%), Positives = 183/216 (85%), Gaps = 0/216 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG++SRK+FPAC +MC+CCPALRSRSRQPVKRY+KLLADIFPKSPD   + RKI+KLCEY
Sbjct  1    MGVISRKIFPACGNMCVCCPALRSRSRQPVKRYRKLLADIFPKSPDEPPSDRKIIKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            AAKNPFRIPKIAK LEERC +EL+S H K+VN+I E +N+LL +CK Q+A FAV++LNV+
Sbjct  61   AAKNPFRIPKIAKYLEERCSRELKSEHIKMVNIIMESFNKLLSICKVQIAYFAVDVLNVI  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
             E+L  +K + ++T+GC   ++FIY QVD TYTYNIE LV+KV  L+R+ GE  +KRCLR
Sbjct  121  SEILSYSKDETIQTLGCQCLSRFIYCQVDSTYTYNIEKLVRKVSMLSRDHGEASEKRCLR  180

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNYE  792
            ASSL+CLSAMVWFMAEFSHIF DFDEIVH TLDN E
Sbjct  181  ASSLQCLSAMVWFMAEFSHIFVDFDEIVHTTLDNCE  216


 Score =   255 bits (651),  Expect(2) = 2e-156, Method: Compositional matrix adjust.
 Identities = 124/199 (62%), Positives = 153/199 (77%), Gaps = 6/199 (3%)
 Frame = +2

Query  809   EDDERGEAHHNWVDEVIRSEGRD---VG-NENRPGYLI-RKRPDKKDISLLTSEEIEMPK  973
             E D R E HHNWVDEVIR EGR    +G N+NR   LI + RP+ KD SLLT EEIE P+
Sbjct  223   EADVRAETHHNWVDEVIRCEGRSGSVIGTNDNRSSCLIIQPRPEIKDPSLLTREEIEKPE  282

Query  974   IWAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSGN  1153
             IWA ICIQRM +LAKES+TMRRVLDPMF++FD  +HW P  GLA +VLS ++YF+E+SGN
Sbjct  283   IWAQICIQRMVELAKESTTMRRVLDPMFVYFDFRQHWAPEKGLAMIVLSRMAYFMENSGN  342

Query  1154  HQLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKS  1333
              + IL  V+ HLDHKNV  D Q+K+ V+Q AT+LA QIRSG G +++GFV DLCRHLRKS
Sbjct  343   QRFILASVIHHLDHKNVMNDPQLKTCVVQVATSLAMQIRSGRGLAEVGFVGDLCRHLRKS  402

Query  1334  LQATVDLAGE-EINLNLTL  1387
             LQA+ +  GE E+NLN++L
Sbjct  403   LQASSEFVGEQELNLNISL  421



>ref|NP_198037.3| uncharacterized protein [Arabidopsis thaliana]
 ref|NP_001031947.2| uncharacterized protein [Arabidopsis thaliana]
 ref|NP_001031948.2| uncharacterized protein [Arabidopsis thaliana]
 ref|NP_001190405.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AED93613.1| uncharacterized protein AT5G26850 [Arabidopsis thaliana]
 gb|AED93614.1| uncharacterized protein AT5G26850 [Arabidopsis thaliana]
 gb|AED93615.1| uncharacterized protein AT5G26850 [Arabidopsis thaliana]
 gb|AED93616.1| uncharacterized protein AT5G26850 [Arabidopsis thaliana]
Length=983

 Score =   347 bits (889),  Expect(2) = 3e-154, Method: Compositional matrix adjust.
 Identities = 158/218 (72%), Positives = 179/218 (82%), Gaps = 0/218 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG +SR +FPACESMCICCPALRSRSRQPVKRYKKLL +IFPKSPDG  N RKI+KLCEY
Sbjct  1    MGFISRNVFPACESMCICCPALRSRSRQPVKRYKKLLGEIFPKSPDGGPNERKIVKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            AAKNP RIPKIAK LEERCYK+LRS   K +N++ E YN++LC CK+QMA FA +LLNVV
Sbjct  61   AAKNPIRIPKIAKFLEERCYKDLRSEQMKFINIVTEAYNKMLCHCKDQMAYFATSLLNVV  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
             E+LD +K D    +GC T T+FIYSQVDGTYT++IE    KVCSLARE GEE QK+CLR
Sbjct  121  TELLDNSKQDTPTILGCQTLTRFIYSQVDGTYTHSIEKFALKVCSLAREEGEEHQKQCLR  180

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNYEPD  798
            AS L+CLSAMVW+M EFSHIFA  DEIVH  LDNYE D
Sbjct  181  ASGLQCLSAMVWYMGEFSHIFATVDEIVHAILDNYEAD  218


 Score =   228 bits (580),  Expect(2) = 3e-154, Method: Compositional matrix adjust.
 Identities = 107/199 (54%), Positives = 146/199 (73%), Gaps = 2/199 (1%)
 Frame = +2

Query  797   MPINEDDERGEAHHNWVDEVIRSEGRDVGNENRPGYLI-RKRPDKKDISLLTSEEIEMPK  973
             M +  +++R E + NWV+EVIR EGR     N P Y+I R R  +KD +LLT EE EMPK
Sbjct  219   MIVQTNEDREEQNCNWVNEVIRCEGRGTTICNSPSYMIVRPRTARKDPTLLTKEETEMPK  278

Query  974   IWAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSGN  1153
             +WA IC+QRM DLAKES+T+R++LDPMF +F++ + W P +GLA +VLSD  Y +E+SG+
Sbjct  279   VWAQICLQRMVDLAKESTTLRQILDPMFSYFNSRRQWTPPNGLAMIVLSDAVYLMETSGS  338

Query  1154  HQLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKS  1333
              QL+L+ VVRHLD+K+VA D ++K+++IQ A  LA+ IR+     DI FV+DLCRHLRKS
Sbjct  339   QQLVLSTVVRHLDNKHVANDPELKAYIIQVAGCLAKLIRTSSYLRDISFVNDLCRHLRKS  398

Query  1334  LQATVDLAG-EEINLNLTL  1387
              QAT    G EE+NLN+ +
Sbjct  399   FQATARSIGDEELNLNVMI  417



>ref|XP_002872241.1| hypothetical protein ARALYDRAFT_489516 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48500.1| hypothetical protein ARALYDRAFT_489516 [Arabidopsis lyrata subsp. 
lyrata]
Length=983

 Score =   346 bits (888),  Expect(2) = 7e-154, Method: Compositional matrix adjust.
 Identities = 157/218 (72%), Positives = 180/218 (83%), Gaps = 0/218 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG +SR +FPACESMC+CCPALRSRSRQPVKRYKKLL +IFPKSPDG+ N RKI+KLCEY
Sbjct  1    MGFISRNVFPACESMCVCCPALRSRSRQPVKRYKKLLGEIFPKSPDGAPNERKIVKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            AAKNP RIPKIAK LEERCYK+LRS   K +N++ E YN++LC CK+QMA FA +LLNVV
Sbjct  61   AAKNPIRIPKIAKFLEERCYKDLRSEQMKFINIVTEAYNKMLCHCKDQMAYFATSLLNVV  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
             E+LD +K D    +GC T T+FIYSQVDGTYT++IE    KVCSLARE GEE QK+CLR
Sbjct  121  TELLDNSKQDTPTILGCQTLTRFIYSQVDGTYTHSIEKFALKVCSLAREEGEEHQKQCLR  180

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNYEPD  798
            AS L+CLSAMVW+M EFSHIFA  DEIVH  LDNYE D
Sbjct  181  ASGLQCLSAMVWYMGEFSHIFATVDEIVHAILDNYEAD  218


 Score =   227 bits (578),  Expect(2) = 7e-154, Method: Compositional matrix adjust.
 Identities = 108/199 (54%), Positives = 145/199 (73%), Gaps = 2/199 (1%)
 Frame = +2

Query  797   MPINEDDERGEAHHNWVDEVIRSEGRDVGNENRPGYLI-RKRPDKKDISLLTSEEIEMPK  973
             M +  +++R E + NWV+EVIR EGR     N P Y+I R R  +KD +LLT EEIEMPK
Sbjct  219   MIVQTNEDREEQNCNWVNEVIRCEGRGTTVCNSPSYMIVRPRTARKDPTLLTKEEIEMPK  278

Query  974   IWAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSGN  1153
             +WA IC+QRM DLAKES+T+R++LDPMF +F+    W P +GLA +VLSD  Y +E+SG+
Sbjct  279   VWAQICLQRMVDLAKESTTLRQILDPMFSYFNARSQWTPPNGLAMIVLSDAVYLMETSGS  338

Query  1154  HQLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKS  1333
              QL+L+ VVR+LD+K+VA D ++K+++IQ A  LA+ IR+     DI FV+DLCRHLRKS
Sbjct  339   QQLVLSTVVRYLDNKHVANDPELKAYIIQVAGCLAKLIRTSSYLRDISFVNDLCRHLRKS  398

Query  1334  LQATVDLAG-EEINLNLTL  1387
              QAT    G EE+NLN+ L
Sbjct  399   FQATSRSIGDEELNLNVML  417



>ref|XP_010421542.1| PREDICTED: uncharacterized protein LOC104706999 isoform X2 [Camelina 
sativa]
Length=984

 Score =   342 bits (877),  Expect(2) = 1e-153, Method: Compositional matrix adjust.
 Identities = 156/216 (72%), Positives = 179/216 (83%), Gaps = 0/216 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG +SR +FPACESMCICCPALRSRSRQPVKRYKKLL +IFPKSPDG+ N RKI+KLCEY
Sbjct  1    MGFISRNVFPACESMCICCPALRSRSRQPVKRYKKLLGEIFPKSPDGAPNERKIVKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            AAKNP RIPKIAK LEERCYK+LRS   K +N++ E YN++LC CK+QMA FA +LLNVV
Sbjct  61   AAKNPIRIPKIAKFLEERCYKDLRSEQMKFINIVTEAYNKMLCHCKDQMAYFATSLLNVV  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
             E+L+ +K D    +GC T T+FIYSQVDGTYT++IE    KVC+LARE G+E QK CLR
Sbjct  121  TELLENSKLDTPTILGCQTLTRFIYSQVDGTYTHSIEKFTLKVCALAREEGDEHQKLCLR  180

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNYE  792
            AS L+CLSAMVWFM EFSHIFA  DEIVH TLDNYE
Sbjct  181  ASGLQCLSAMVWFMGEFSHIFAAVDEIVHATLDNYE  216


 Score =   230 bits (587),  Expect(2) = 1e-153, Method: Compositional matrix adjust.
 Identities = 109/201 (54%), Positives = 147/201 (73%), Gaps = 2/201 (1%)
 Frame = +2

Query  791   SQMPINEDDERGEAHHNWVDEVIRSEGRDVGNENRPGYLI-RKRPDKKDISLLTSEEIEM  967
             + M +  +++R E + NWV+EVIR EGR     N P YLI R R  +KD +LLT EE EM
Sbjct  217   ANMIVQTNEDREEQNCNWVNEVIRCEGRGTAVWNSPSYLIVRPRTARKDPTLLTKEETEM  276

Query  968   PKIWAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESS  1147
             PK+WA IC+QRM DLAKES+T+R++LDPMF +F++ + W P +GLA +VLSD  Y +E+S
Sbjct  277   PKVWAQICLQRMVDLAKESTTLRQILDPMFSYFNSRRQWTPPNGLAMIVLSDAVYLMETS  336

Query  1148  GNHQLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLR  1327
             G+ QL+L+ VVRHLD+K+VA D ++K+++IQ A  LA+ IR+     DI FV+DLCRHLR
Sbjct  337   GSQQLVLSTVVRHLDNKHVANDPELKAYIIQVAGCLAKLIRTSSYLRDISFVNDLCRHLR  396

Query  1328  KSLQATVDLAG-EEINLNLTL  1387
             KS QAT    G EE+NLN+ L
Sbjct  397   KSFQATARSIGDEELNLNVML  417



>ref|XP_006394915.1| hypothetical protein EUTSA_v10003593mg [Eutrema salsugineum]
 gb|ESQ32201.1| hypothetical protein EUTSA_v10003593mg [Eutrema salsugineum]
Length=983

 Score =   348 bits (894),  Expect(2) = 1e-153, Method: Compositional matrix adjust.
 Identities = 158/218 (72%), Positives = 180/218 (83%), Gaps = 0/218 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG +SR +FPACESMC+CCPALRSRSRQPVKRYKKLL +IFPKSPDG+ N RKI+KLCEY
Sbjct  1    MGFISRNIFPACESMCVCCPALRSRSRQPVKRYKKLLGEIFPKSPDGAPNERKIVKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            AAKNP RIPKIAK LEERCYK+LRS   K +N++ E YN++LC CK+QMA FA +LLNVV
Sbjct  61   AAKNPIRIPKIAKFLEERCYKDLRSEQMKFINIVTEAYNKMLCHCKDQMAYFATSLLNVV  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
             E+LD +K D    +GC T T+FIYSQVDGTYT++IE    KVCSLARE G+E QKRCLR
Sbjct  121  TELLDNSKQDTPTILGCQTLTRFIYSQVDGTYTHSIEKFAHKVCSLAREEGDEPQKRCLR  180

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNYEPD  798
            AS L+CLSAMVWFM EFSHIFA  DEIVH  LDNYE D
Sbjct  181  ASGLQCLSAMVWFMGEFSHIFAAVDEIVHAILDNYEAD  218


 Score =   224 bits (570),  Expect(2) = 1e-153, Method: Compositional matrix adjust.
 Identities = 106/203 (52%), Positives = 148/203 (73%), Gaps = 4/203 (2%)
 Frame = +2

Query  791   SQMPINEDDERGEAHHNWVDEVIRSEGRD--VGNENRPGYLI-RKRPDKKDISLLTSEEI  961
             + M +  +++R E + NWV+EVIR EGR   V   N P Y+I R R  +KD +LLT +E 
Sbjct  217   ADMIVQTNEDREEQNCNWVNEVIRCEGRGTAVSGCNSPSYMIIRPRTARKDPTLLTKDET  276

Query  962   EMPKIWAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVE  1141
             EMPK+WA IC+QRM DLAKES+T+R++L+PMF +F++ + W P +GLA +VLSD +Y +E
Sbjct  277   EMPKVWAQICLQRMVDLAKESTTLRQILEPMFSYFNSRRQWTPPNGLAMIVLSDATYLME  336

Query  1142  SSGNHQLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRH  1321
             +SG+ QL+L+ VVRHLD K+VA D ++K++++Q A  LA+ IR+     DI FV+DLCRH
Sbjct  337   TSGSQQLVLSTVVRHLDSKHVANDPELKAYIVQVAGCLAKLIRTSSYLRDISFVNDLCRH  396

Query  1322  LRKSLQATVDLAG-EEINLNLTL  1387
             LRKS QAT    G EE+NLN+ L
Sbjct  397   LRKSFQATARSIGDEELNLNVML  419



>ref|XP_006394914.1| hypothetical protein EUTSA_v10003593mg [Eutrema salsugineum]
 gb|ESQ32200.1| hypothetical protein EUTSA_v10003593mg [Eutrema salsugineum]
Length=976

 Score =   348 bits (894),  Expect(2) = 2e-153, Method: Compositional matrix adjust.
 Identities = 158/218 (72%), Positives = 180/218 (83%), Gaps = 0/218 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG +SR +FPACESMC+CCPALRSRSRQPVKRYKKLL +IFPKSPDG+ N RKI+KLCEY
Sbjct  1    MGFISRNIFPACESMCVCCPALRSRSRQPVKRYKKLLGEIFPKSPDGAPNERKIVKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            AAKNP RIPKIAK LEERCYK+LRS   K +N++ E YN++LC CK+QMA FA +LLNVV
Sbjct  61   AAKNPIRIPKIAKFLEERCYKDLRSEQMKFINIVTEAYNKMLCHCKDQMAYFATSLLNVV  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
             E+LD +K D    +GC T T+FIYSQVDGTYT++IE    KVCSLARE G+E QKRCLR
Sbjct  121  TELLDNSKQDTPTILGCQTLTRFIYSQVDGTYTHSIEKFAHKVCSLAREEGDEPQKRCLR  180

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNYEPD  798
            AS L+CLSAMVWFM EFSHIFA  DEIVH  LDNYE D
Sbjct  181  ASGLQCLSAMVWFMGEFSHIFAAVDEIVHAILDNYEAD  218


 Score =   224 bits (570),  Expect(2) = 2e-153, Method: Compositional matrix adjust.
 Identities = 106/203 (52%), Positives = 148/203 (73%), Gaps = 4/203 (2%)
 Frame = +2

Query  791   SQMPINEDDERGEAHHNWVDEVIRSEGRD--VGNENRPGYLI-RKRPDKKDISLLTSEEI  961
             + M +  +++R E + NWV+EVIR EGR   V   N P Y+I R R  +KD +LLT +E 
Sbjct  217   ADMIVQTNEDREEQNCNWVNEVIRCEGRGTAVSGCNSPSYMIIRPRTARKDPTLLTKDET  276

Query  962   EMPKIWAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVE  1141
             EMPK+WA IC+QRM DLAKES+T+R++L+PMF +F++ + W P +GLA +VLSD +Y +E
Sbjct  277   EMPKVWAQICLQRMVDLAKESTTLRQILEPMFSYFNSRRQWTPPNGLAMIVLSDATYLME  336

Query  1142  SSGNHQLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRH  1321
             +SG+ QL+L+ VVRHLD K+VA D ++K++++Q A  LA+ IR+     DI FV+DLCRH
Sbjct  337   TSGSQQLVLSTVVRHLDSKHVANDPELKAYIVQVAGCLAKLIRTSSYLRDISFVNDLCRH  396

Query  1322  LRKSLQATVDLAG-EEINLNLTL  1387
             LRKS QAT    G EE+NLN+ L
Sbjct  397   LRKSFQATARSIGDEELNLNVML  419



>ref|XP_010493942.1| PREDICTED: protein EFR3 homolog B-like isoform X2 [Camelina sativa]
Length=984

 Score =   342 bits (878),  Expect(2) = 2e-153, Method: Compositional matrix adjust.
 Identities = 156/218 (72%), Positives = 180/218 (83%), Gaps = 0/218 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG +SR +FPACESMCICCPALRSRSRQPVKRYKKLL +IFPKSPDG+ N RKI+KLCEY
Sbjct  1    MGFISRNVFPACESMCICCPALRSRSRQPVKRYKKLLGEIFPKSPDGAPNERKIVKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            AAKNP RIPKIAK LEERCYK+LRS   K +N++ E YN++LC CK+QMA FA +LLNVV
Sbjct  61   AAKNPIRIPKIAKFLEERCYKDLRSEQMKFINIVTEAYNKMLCHCKDQMAYFATSLLNVV  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
             E+L+ +K D    +GC T T+FIYSQVDGTYT++IE    KVC+LARE G+E QK CLR
Sbjct  121  TELLENSKLDTPTILGCQTLTRFIYSQVDGTYTHSIEKFALKVCALAREEGDEHQKLCLR  180

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNYEPD  798
            AS L+CLSAMVWFM EFSHIFA  DEIVH TLDNYE +
Sbjct  181  ASGLQCLSAMVWFMGEFSHIFAAVDEIVHATLDNYEAN  218


 Score =   230 bits (586),  Expect(2) = 2e-153, Method: Compositional matrix adjust.
 Identities = 108/201 (54%), Positives = 147/201 (73%), Gaps = 2/201 (1%)
 Frame = +2

Query  791   SQMPINEDDERGEAHHNWVDEVIRSEGRDVGNENRPGYLI-RKRPDKKDISLLTSEEIEM  967
             + M +  +++R E + NWV+EVIR EGR     N P Y+I R R  +KD +LLT EE EM
Sbjct  217   ANMIVQTNEDREEQNCNWVNEVIRCEGRGTAVCNSPSYMIVRPRTARKDPTLLTKEETEM  276

Query  968   PKIWAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESS  1147
             PK+WA IC+QRM DLAKES+T+R++LDPMF +F++ + W P +GLA +VLSD  Y +E+S
Sbjct  277   PKVWAQICLQRMVDLAKESTTLRQILDPMFSYFNSRRQWTPPNGLAMIVLSDAVYLMETS  336

Query  1148  GNHQLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLR  1327
             G+ QL+L+ VVRHLD+K+VA D ++K+++IQ A  LA+ IR+     DI FV+DLCRHLR
Sbjct  337   GSQQLVLSTVVRHLDNKHVANDPELKAYIIQVAGCLAKLIRTSSYLRDISFVNDLCRHLR  396

Query  1328  KSLQATVDLAG-EEINLNLTL  1387
             KS QAT    G EE+NLN+ L
Sbjct  397   KSFQATARSIGDEELNLNVML  417



>ref|XP_010455044.1| PREDICTED: uncharacterized protein LOC104736707 [Camelina sativa]
 ref|XP_010455045.1| PREDICTED: uncharacterized protein LOC104736707 [Camelina sativa]
Length=984

 Score =   343 bits (880),  Expect(2) = 2e-153, Method: Compositional matrix adjust.
 Identities = 157/216 (73%), Positives = 179/216 (83%), Gaps = 0/216 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG +SR +FPACESMCICCPALRSRSRQPVKRYKKLL +IFPKSPDG+ N RKI+KLCEY
Sbjct  1    MGFISRNVFPACESMCICCPALRSRSRQPVKRYKKLLGEIFPKSPDGTPNERKIVKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            AAKNP RIPKIAK LEERCYK+LRS   K +N++ E YN++LC CK+QMA FA +LLNVV
Sbjct  61   AAKNPIRIPKIAKFLEERCYKDLRSEQMKFINIVTEAYNKMLCHCKDQMAYFATSLLNVV  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
             E+L+ +K D    +GC T T+FIYSQVDGTYT++IE    KVC+LARE GEE QK CLR
Sbjct  121  TELLENSKLDTPTILGCQTLTRFIYSQVDGTYTHSIEKFALKVCALAREEGEEHQKLCLR  180

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNYE  792
            AS L+CLSAMVWFM EFSHIFA  DEIVH TLDNYE
Sbjct  181  ASGLQCLSAMVWFMGEFSHIFAAVDEIVHATLDNYE  216


 Score =   229 bits (583),  Expect(2) = 2e-153, Method: Compositional matrix adjust.
 Identities = 108/201 (54%), Positives = 146/201 (73%), Gaps = 2/201 (1%)
 Frame = +2

Query  791   SQMPINEDDERGEAHHNWVDEVIRSEGRDVGNENRPGYLI-RKRPDKKDISLLTSEEIEM  967
             + M +  +++R E + NWV+EVIR EGR     N P Y+I R R  +KD +LLT EE EM
Sbjct  217   ANMIVQTNEDREEQNCNWVNEVIRCEGRGTAVCNSPSYMIVRPRTARKDPTLLTKEETEM  276

Query  968   PKIWAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESS  1147
             PK+WA IC+QRM DLAKES+T+R++LDPMF +F++ + W P +GLA +VLSD  Y +E+S
Sbjct  277   PKVWAQICLQRMVDLAKESTTLRQILDPMFSYFNSRRQWTPPNGLAVIVLSDAVYLMETS  336

Query  1148  GNHQLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLR  1327
             G+ QL+L+ VVRHLD+K+VA D + K+++IQ A  LA+ IR+     DI FV+DLCRHLR
Sbjct  337   GSQQLVLSTVVRHLDNKHVANDPEFKAYIIQVAGCLAKLIRTSSYLRDISFVNDLCRHLR  396

Query  1328  KSLQATVDLAG-EEINLNLTL  1387
             KS QAT    G EE+NLN+ L
Sbjct  397   KSFQATARSIGDEELNLNVML  417



>ref|XP_004144747.1| PREDICTED: uncharacterized protein LOC101202927 [Cucumis sativus]
 ref|XP_011648868.1| PREDICTED: uncharacterized protein LOC101202927 [Cucumis sativus]
 ref|XP_011648869.1| PREDICTED: uncharacterized protein LOC101202927 [Cucumis sativus]
 gb|KGN61004.1| hypothetical protein Csa_2G034570 [Cucumis sativus]
Length=995

 Score =   317 bits (811),  Expect(2) = 1e-152, Method: Compositional matrix adjust.
 Identities = 146/217 (67%), Positives = 179/217 (82%), Gaps = 0/217 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG++SRK+FPAC ++CICCPALRSRSRQPVKRYKKLLADIFPKS DG  + RKI+KLCEY
Sbjct  1    MGVISRKIFPACGNICICCPALRSRSRQPVKRYKKLLADIFPKSLDGPQSERKIIKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            AAKNPFRIPKI K LE+RC KELRS   K + +IA+ YN+LL +CK QMA FA +LL V+
Sbjct  61   AAKNPFRIPKIVKYLEDRCCKELRSEQVKCITIIADAYNKLLSLCKNQMAYFAGSLLKVI  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
            VE+LD AK D ++ +GC T T FI++Q D TY + +ENLV KVC LA E GE+ +K+CLR
Sbjct  121  VELLDNAKHDDLRILGCQTLTNFIHNQADSTYMHTVENLVPKVCMLALERGEDHKKQCLR  180

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNYEP  795
            ASSL+C+SAMVWFM E+SHIF DFDE+V V+L+NY+P
Sbjct  181  ASSLQCISAMVWFMTEYSHIFLDFDEMVRVSLENYDP  217


 Score =   252 bits (644),  Expect(2) = 1e-152, Method: Compositional matrix adjust.
 Identities = 118/200 (59%), Positives = 155/200 (78%), Gaps = 4/200 (2%)
 Frame = +2

Query  800   PINEDDERGEAHHNWVDEVIRSEGRDV---GNENRPGYLIRKRPDKKDISLLTSEEIEMP  970
             P  + +   E HHNW++EV+RSEGR     G+ +    +IR RP+KKD +LLT EE+E P
Sbjct  217   PAPDGNSSSEPHHNWLNEVVRSEGRCGTVGGDASGSCTIIRPRPEKKDPALLTREEVEAP  276

Query  971   KIWAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSG  1150
             ++W+ IC+QRM DLAKES+TMRRVLDPM ++FD+ +HWVP+ GLA +VLSD+ YF+ESSG
Sbjct  277   RVWSQICLQRMVDLAKESTTMRRVLDPMLVYFDSGRHWVPQQGLALMVLSDILYFMESSG  336

Query  1151  NHQLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRK  1330
             +  L+L  V+RHLDHKN++ D Q+KS VIQ A+ LARQIRSG   +DIG VSDLCRHLRK
Sbjct  337   DQHLVLASVIRHLDHKNISHDPQLKSCVIQVASNLARQIRSGAVLADIGSVSDLCRHLRK  396

Query  1331  SLQATVDLAG-EEINLNLTL  1387
             SLQ TVD  G +E++LN++L
Sbjct  397   SLQVTVDSVGQQELDLNISL  416



>ref|XP_008453377.1| PREDICTED: uncharacterized protein LOC103494111 [Cucumis melo]
 ref|XP_008453385.1| PREDICTED: uncharacterized protein LOC103494111 [Cucumis melo]
 ref|XP_008453393.1| PREDICTED: uncharacterized protein LOC103494111 [Cucumis melo]
 ref|XP_008453402.1| PREDICTED: uncharacterized protein LOC103494111 [Cucumis melo]
Length=995

 Score =   318 bits (816),  Expect(2) = 1e-152, Method: Compositional matrix adjust.
 Identities = 146/217 (67%), Positives = 180/217 (83%), Gaps = 0/217 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG++SRK+FPAC +MCICCPALRSRSRQPVKRYKKLLADIFPKS DG  + RKI+KLCEY
Sbjct  1    MGVISRKIFPACGNMCICCPALRSRSRQPVKRYKKLLADIFPKSLDGPQSERKIIKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            AAKNPFRIPKI K LE+RC KELR+   K + +IA+ YN+LL +CK QMA FA +LL V+
Sbjct  61   AAKNPFRIPKIVKYLEDRCCKELRNEQVKCITIIADAYNKLLSLCKNQMAYFAGSLLKVI  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
            VE+LD AK D ++ +GC T T FI++Q D TY +N+ENLV KVC LA E G++ +K+CLR
Sbjct  121  VELLDNAKHDDLRILGCQTLTNFIHNQADSTYMHNVENLVPKVCMLALERGDDHKKQCLR  180

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNYEP  795
            ASSL+C+SAMVWFM E+SHIF DFDE+V V+L+NY+P
Sbjct  181  ASSLQCISAMVWFMTEYSHIFPDFDEMVRVSLENYDP  217


 Score =   251 bits (640),  Expect(2) = 1e-152, Method: Compositional matrix adjust.
 Identities = 117/194 (60%), Positives = 153/194 (79%), Gaps = 4/194 (2%)
 Frame = +2

Query  818   ERGEAHHNWVDEVIRSEGRDV---GNENRPGYLIRKRPDKKDISLLTSEEIEMPKIWAHI  988
             +  E HHNW++EV+RSEGR     G+ +    +IR RP+KKD +LLT EE+E P++W+ I
Sbjct  225   DSSEPHHNWLNEVVRSEGRCGTVGGDASGSCTIIRPRPEKKDPALLTREEVEAPRVWSQI  284

Query  989   CIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSGNHQLIL  1168
             C+QRM DLAKES+TMRRVLDPM ++FD+ +HWVP+ GLA +VLSD+ YF+ESSG+  L+L
Sbjct  285   CLQRMVDLAKESTTMRRVLDPMLVYFDSGRHWVPQQGLALMVLSDILYFMESSGDQHLVL  344

Query  1169  TGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKSLQATV  1348
               V+RHLDHKN++ D Q+KS VIQ A+ LARQIRSG   +DIG VSDLCRHLRKSLQ TV
Sbjct  345   ASVIRHLDHKNISHDPQLKSCVIQVASNLARQIRSGAVLADIGSVSDLCRHLRKSLQVTV  404

Query  1349  DLAG-EEINLNLTL  1387
             D  G +E++LN++L
Sbjct  405   DSVGQQELDLNISL  418



>ref|XP_010493940.1| PREDICTED: protein EFR3 homolog B-like isoform X1 [Camelina sativa]
 ref|XP_010493941.1| PREDICTED: protein EFR3 homolog B-like isoform X1 [Camelina sativa]
Length=986

 Score =   337 bits (865),  Expect(2) = 4e-152, Method: Compositional matrix adjust.
 Identities = 156/220 (71%), Positives = 180/220 (82%), Gaps = 2/220 (1%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSP--DGSANGRKIMKLC  318
            MG +SR +FPACESMCICCPALRSRSRQPVKRYKKLL +IFPKSP  DG+ N RKI+KLC
Sbjct  1    MGFISRNVFPACESMCICCPALRSRSRQPVKRYKKLLGEIFPKSPVSDGAPNERKIVKLC  60

Query  319  EYAAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLN  498
            EYAAKNP RIPKIAK LEERCYK+LRS   K +N++ E YN++LC CK+QMA FA +LLN
Sbjct  61   EYAAKNPIRIPKIAKFLEERCYKDLRSEQMKFINIVTEAYNKMLCHCKDQMAYFATSLLN  120

Query  499  VVVEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRC  678
            VV E+L+ +K D    +GC T T+FIYSQVDGTYT++IE    KVC+LARE G+E QK C
Sbjct  121  VVTELLENSKLDTPTILGCQTLTRFIYSQVDGTYTHSIEKFALKVCALAREEGDEHQKLC  180

Query  679  LRASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNYEPD  798
            LRAS L+CLSAMVWFM EFSHIFA  DEIVH TLDNYE +
Sbjct  181  LRASGLQCLSAMVWFMGEFSHIFAAVDEIVHATLDNYEAN  220


 Score =   230 bits (586),  Expect(2) = 4e-152, Method: Compositional matrix adjust.
 Identities = 108/201 (54%), Positives = 147/201 (73%), Gaps = 2/201 (1%)
 Frame = +2

Query  791   SQMPINEDDERGEAHHNWVDEVIRSEGRDVGNENRPGYLI-RKRPDKKDISLLTSEEIEM  967
             + M +  +++R E + NWV+EVIR EGR     N P Y+I R R  +KD +LLT EE EM
Sbjct  219   ANMIVQTNEDREEQNCNWVNEVIRCEGRGTAVCNSPSYMIVRPRTARKDPTLLTKEETEM  278

Query  968   PKIWAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESS  1147
             PK+WA IC+QRM DLAKES+T+R++LDPMF +F++ + W P +GLA +VLSD  Y +E+S
Sbjct  279   PKVWAQICLQRMVDLAKESTTLRQILDPMFSYFNSRRQWTPPNGLAMIVLSDAVYLMETS  338

Query  1148  GNHQLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLR  1327
             G+ QL+L+ VVRHLD+K+VA D ++K+++IQ A  LA+ IR+     DI FV+DLCRHLR
Sbjct  339   GSQQLVLSTVVRHLDNKHVANDPELKAYIIQVAGCLAKLIRTSSYLRDISFVNDLCRHLR  398

Query  1328  KSLQATVDLAG-EEINLNLTL  1387
             KS QAT    G EE+NLN+ L
Sbjct  399   KSFQATARSIGDEELNLNVML  419



>ref|XP_009111721.1| PREDICTED: protein EFR3 homolog B-like [Brassica rapa]
Length=982

 Score =   339 bits (870),  Expect(2) = 6e-152, Method: Compositional matrix adjust.
 Identities = 151/216 (70%), Positives = 177/216 (82%), Gaps = 0/216 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG +SR +FPACE+MC+CCPALR RS+ P KRYKKLL +IFPKSPDG+ N RKI+KLCEY
Sbjct  1    MGFISRNVFPACETMCVCCPALRPRSKHPAKRYKKLLGEIFPKSPDGAPNERKIVKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            AAKNP RIPKIAK LEERCYK+LRS   K +N++ E YN++LC CK+QMA FA +LLNVV
Sbjct  61   AAKNPIRIPKIAKILEERCYKDLRSEQMKFINIVTEAYNKMLCHCKDQMAYFATSLLNVV  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
             E+L+ +K D    +GC T T+FIYSQVDGTYT++IE    KVCSLARE G+E QK+CLR
Sbjct  121  TELLENSKEDTPTILGCQTLTRFIYSQVDGTYTHSIEKFAHKVCSLAREQGDEHQKQCLR  180

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNYE  792
            AS L+CLSAMVWFM EFSHIFA FDEIVH  LDNYE
Sbjct  181  ASGLQCLSAMVWFMGEFSHIFAAFDEIVHAILDNYE  216


 Score =   228 bits (580),  Expect(2) = 6e-152, Method: Compositional matrix adjust.
 Identities = 108/203 (53%), Positives = 149/203 (73%), Gaps = 4/203 (2%)
 Frame = +2

Query  791   SQMPINEDDERGEAHHNWVDEVIRSEGRD--VGNENRPGYLI-RKRPDKKDISLLTSEEI  961
             + M +  +++R E + NWV+EVIR EGR   V   N P Y++ R R  +KD +LLT EE 
Sbjct  217   ANMIVQTNEDREEQNCNWVNEVIRCEGRGGGVSGCNSPSYMVVRPRTARKDPTLLTKEEA  276

Query  962   EMPKIWAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVE  1141
             EMPK+WA IC+QRM DLAKES+T+RR+LDPMF +F++ + W P +GLA +VLSD +Y +E
Sbjct  277   EMPKVWAQICLQRMVDLAKESTTLRRILDPMFSYFNSRRQWTPPNGLAMIVLSDATYMME  336

Query  1142  SSGNHQLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRH  1321
             +SG+ QL+L+ VVRHLD+K+VA D ++K+++IQ A  LA+ IR+     DI FV+DLCRH
Sbjct  337   TSGSQQLVLSTVVRHLDNKHVANDPELKAYIIQVAGCLAKLIRTSSYLRDISFVNDLCRH  396

Query  1322  LRKSLQATV-DLAGEEINLNLTL  1387
             LRKS QAT   +  EE+NLN+ L
Sbjct  397   LRKSFQATSRSVEEEELNLNVML  419



>emb|CDX87029.1| BnaC09g03440D [Brassica napus]
Length=982

 Score =   341 bits (874),  Expect(2) = 6e-152, Method: Compositional matrix adjust.
 Identities = 152/218 (70%), Positives = 178/218 (82%), Gaps = 0/218 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG +SR +FPACE+MC+CCPALR RS+ P KRYKKLL +IFPKSPDG+ N RKI+KLCEY
Sbjct  1    MGFISRNVFPACETMCVCCPALRPRSKHPAKRYKKLLGEIFPKSPDGAPNERKIVKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            AAKNP RIPKIAK LEERCYK+LRS   K +N++ E YN++LC CK+QMA FA +LLNVV
Sbjct  61   AAKNPIRIPKIAKILEERCYKDLRSEQMKFINIVTEAYNKMLCHCKDQMAYFATSLLNVV  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
             E+L+ +K D    +GC T T+FIYSQVDGTYT++IE    KVCSLARE GEE QK+CLR
Sbjct  121  TELLENSKEDTPTILGCQTLTRFIYSQVDGTYTHSIEKFAHKVCSLAREQGEEHQKKCLR  180

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNYEPD  798
            AS L+CLSAMVWFM EFSHIFA FDEIVH  LDNYE +
Sbjct  181  ASGLQCLSAMVWFMGEFSHIFAAFDEIVHAILDNYEAN  218


 Score =   226 bits (575),  Expect(2) = 6e-152, Method: Compositional matrix adjust.
 Identities = 107/203 (53%), Positives = 147/203 (72%), Gaps = 4/203 (2%)
 Frame = +2

Query  791   SQMPINEDDERGEAHHNWVDEVIRSEGRDVGNE--NRPGYLI-RKRPDKKDISLLTSEEI  961
             + M +  +++R E + NWV+EVIR EGR  G    N P Y++ R R  +KD +LLT EE 
Sbjct  217   ANMIVQTNEDREEQNCNWVNEVIRCEGRGTGVSGCNSPSYMVVRPRTARKDPTLLTKEET  276

Query  962   EMPKIWAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVE  1141
             EMPK+WA IC+QRM DLAKES+T+R +LDPMF +F++ + W P +GLA +VLSD +Y +E
Sbjct  277   EMPKVWAQICLQRMVDLAKESTTLRLILDPMFSYFNSRRQWTPPNGLAMIVLSDATYMME  336

Query  1142  SSGNHQLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRH  1321
             +SG+ QL+L+ VVRHLD+K+VA D ++K+++IQ A  L + IR+     DI FV+DLCRH
Sbjct  337   TSGSQQLVLSTVVRHLDNKHVANDPELKAYIIQVAGCLGKLIRTSSYLRDISFVNDLCRH  396

Query  1322  LRKSLQATVDLAG-EEINLNLTL  1387
             LRKS QAT    G EE+NLN+ L
Sbjct  397   LRKSFQATSRSVGEEELNLNVML  419



>emb|CDY19753.1| BnaA09g04060D [Brassica napus]
Length=982

 Score =   337 bits (863),  Expect(2) = 2e-151, Method: Compositional matrix adjust.
 Identities = 149/216 (69%), Positives = 177/216 (82%), Gaps = 0/216 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG +SR +FPACE+MC+CCPALR RS+ P KRYKKLL +IFPKSPDG+ N RKI+KLCEY
Sbjct  1    MGFISRNVFPACETMCVCCPALRPRSKHPAKRYKKLLGEIFPKSPDGAPNERKIVKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            AAKNP RIPKIAK LEE+CYK+LRS   K +N++ E YN++LC CK+QMA FA +LLNVV
Sbjct  61   AAKNPIRIPKIAKILEEKCYKDLRSEQMKFINIVTEAYNKMLCHCKDQMAYFATSLLNVV  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
             E+L+ +K D    +GC T T+FIY+QVDGTYT++IE    KVCSLARE G+E QK+CLR
Sbjct  121  TELLENSKEDTPTILGCQTLTRFIYNQVDGTYTHSIEKFAHKVCSLAREQGDEHQKQCLR  180

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNYE  792
            AS L+CLSAMVWFM EFSHIFA FDEIVH  LDNYE
Sbjct  181  ASGLQCLSAMVWFMGEFSHIFAAFDEIVHAILDNYE  216


 Score =   228 bits (582),  Expect(2) = 2e-151, Method: Compositional matrix adjust.
 Identities = 108/203 (53%), Positives = 149/203 (73%), Gaps = 4/203 (2%)
 Frame = +2

Query  791   SQMPINEDDERGEAHHNWVDEVIRSEGRDVGNE--NRPGYLI-RKRPDKKDISLLTSEEI  961
             + M +  +++R E + NWV+EVIR EGR  G    N P Y++ R R  +KD +LLT EE 
Sbjct  217   AHMIVQTNEDREEQNCNWVNEVIRCEGRGTGVSGCNSPSYMVVRPRTARKDPTLLTKEEA  276

Query  962   EMPKIWAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVE  1141
             EMPK+WA IC+QRM DLAKES+T+RR+LDPMF +F++ + W P +GLA +VLSD +Y +E
Sbjct  277   EMPKVWAQICLQRMVDLAKESTTLRRILDPMFSYFNSRRQWTPPNGLAMIVLSDATYMME  336

Query  1142  SSGNHQLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRH  1321
             +SG+ QL+L+ VVRHLD+K+VA D ++K+++IQ A  LA+ IR+     DI FV+DLCRH
Sbjct  337   TSGSQQLVLSTVVRHLDNKHVANDPELKAYIIQVAGCLAKLIRTSSYLRDISFVNDLCRH  396

Query  1322  LRKSLQATV-DLAGEEINLNLTL  1387
             LRKS QAT   +  EE+NLN+ L
Sbjct  397   LRKSFQATSRSVEEEELNLNVML  419



>dbj|BAC41892.1| unknown protein [Arabidopsis thaliana]
 gb|AAQ89612.1| At5g26850 [Arabidopsis thaliana]
Length=970

 Score =   333 bits (854),  Expect(2) = 4e-150, Method: Compositional matrix adjust.
 Identities = 153/216 (71%), Positives = 174/216 (81%), Gaps = 0/216 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG +SR +FPACESMCICCPALRSRSRQPVKRYKKLL +IFPKSPDG  N RKI+KLCEY
Sbjct  1    MGFISRNVFPACESMCICCPALRSRSRQPVKRYKKLLGEIFPKSPDGGPNERKIVKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            AAKNP RIPKIAK LEERCYK+LRS   K +N++ E YN++LC CK+QMA FA +LLNVV
Sbjct  61   AAKNPIRIPKIAKFLEERCYKDLRSEQMKFINIVTEAYNKMLCHCKDQMAYFATSLLNVV  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
             E+LD +K D    +GC T T+FIYSQVDGTYT++IE    KVCSLARE GEE QK+CLR
Sbjct  121  TELLDNSKQDTPTILGCQTLTRFIYSQVDGTYTHSIEKFALKVCSLAREEGEEHQKQCLR  180

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNYE  792
            AS L+CLSAMVW+M EFSHIFA  DEIV    D  E
Sbjct  181  ASGLQCLSAMVWYMGEFSHIFATVDEIVQTNEDREE  216


 Score =   227 bits (579),  Expect(2) = 4e-150, Method: Compositional matrix adjust.
 Identities = 106/197 (54%), Positives = 145/197 (74%), Gaps = 2/197 (1%)
 Frame = +2

Query  803   INEDDERGEAHHNWVDEVIRSEGRDVGNENRPGYLI-RKRPDKKDISLLTSEEIEMPKIW  979
             +  +++R E + NWV+EVIR EGR     N P Y+I R R  +KD +LLT EE EMPK+W
Sbjct  208   VQTNEDREEQNCNWVNEVIRCEGRGTTICNSPSYMIVRPRTARKDPTLLTKEETEMPKVW  267

Query  980   AHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSGNHQ  1159
             A IC+QRM DLAKES+T+R++LDPMF +F++ + W P +GLA +VLSD  Y +E+SG+ Q
Sbjct  268   AQICLQRMVDLAKESTTLRQILDPMFSYFNSRRQWTPPNGLAMIVLSDAVYLMETSGSQQ  327

Query  1160  LILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKSLQ  1339
             L+L+ VVRHLD+K+VA D ++K+++IQ A  LA+ IR+     DI FV+DLCRHLRKS Q
Sbjct  328   LVLSTVVRHLDNKHVANDPELKAYIIQVAGCLAKLIRTSSYLRDISFVNDLCRHLRKSFQ  387

Query  1340  ATVDLAG-EEINLNLTL  1387
             AT    G EE+NLN+ +
Sbjct  388   ATARSIGDEELNLNVMI  404



>gb|AAB61061.1| Hypothetical protein F2P16.24 [Arabidopsis thaliana]
Length=907

 Score =   335 bits (860),  Expect(2) = 5e-149, Method: Compositional matrix adjust.
 Identities = 158/236 (67%), Positives = 179/236 (76%), Gaps = 18/236 (8%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG +SR +FPACESMCICCPALRSRSRQPVKRYKKLL +IFPKSPDG  N RKI+KLCEY
Sbjct  1    MGFISRNVFPACESMCICCPALRSRSRQPVKRYKKLLGEIFPKSPDGGPNERKIVKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            AAKNP RIPKIAK LEERCYK+LRS   K +N++ E YN++LC CK+QMA FA +LLNVV
Sbjct  61   AAKNPIRIPKIAKFLEERCYKDLRSEQMKFINIVTEAYNKMLCHCKDQMAYFATSLLNVV  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
             E+LD +K D    +GC T T+FIYSQVDGTYT++IE    KVCSLARE GEE QK+CLR
Sbjct  121  TELLDNSKQDTPTILGCQTLTRFIYSQVDGTYTHSIEKFALKVCSLAREEGEEHQKQCLR  180

Query  685  ASSLRCLSAM------------------VWFMAEFSHIFADFDEIVHVTLDNYEPD  798
            AS L+CLSAM                  VW+M EFSHIFA  DEIVH  LDNYE D
Sbjct  181  ASGLQCLSAMVLELVLLIFQIQSILLPKVWYMGEFSHIFATVDEIVHAILDNYEAD  236


 Score =   221 bits (564),  Expect(2) = 5e-149, Method: Compositional matrix adjust.
 Identities = 107/206 (52%), Positives = 146/206 (71%), Gaps = 9/206 (4%)
 Frame = +2

Query  797   MPINEDDERGEAHHNWVDEVIRSEGRDVGNENRPGYLI-RKRPDKKDISLLTSEEIEMPK  973
             M +  +++R E + NWV+EVIR EGR     N P Y+I R R  +KD +LLT EE EMPK
Sbjct  237   MIVQTNEDREEQNCNWVNEVIRCEGRGTTICNSPSYMIVRPRTARKDPTLLTKEETEMPK  296

Query  974   IWAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESS--  1147
             +WA IC+QRM DLAKES+T+R++LDPMF +F++ + W P +GLA +VLSD  Y +E+S  
Sbjct  297   VWAQICLQRMVDLAKESTTLRQILDPMFSYFNSRRQWTPPNGLAMIVLSDAVYLMETSVM  356

Query  1148  -----GNHQLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDL  1312
                  G+ QL+L+ VVRHLD+K+VA D ++K+++IQ A  LA+ IR+     DI FV+DL
Sbjct  357   FLYILGSQQLVLSTVVRHLDNKHVANDPELKAYIIQVAGCLAKLIRTSSYLRDISFVNDL  416

Query  1313  CRHLRKSLQATVDLAG-EEINLNLTL  1387
             CRHLRKS QAT    G EE+NLN+ +
Sbjct  417   CRHLRKSFQATARSIGDEELNLNVMI  442



>ref|XP_006840435.1| PREDICTED: uncharacterized protein LOC18430213 [Amborella trichopoda]
 gb|ERN02110.1| hypothetical protein AMTR_s00045p00164850 [Amborella trichopoda]
Length=1003

 Score =   324 bits (830),  Expect(2) = 1e-146, Method: Compositional matrix adjust.
 Identities = 149/220 (68%), Positives = 179/220 (81%), Gaps = 0/220 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG +SR++FP C S+C+CCPALRSRSRQPVKRYKKLL+DIFPKS DG  N R+I KLCEY
Sbjct  1    MGFISRRVFPVCGSICVCCPALRSRSRQPVKRYKKLLSDIFPKSLDGPPNERRITKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            AAKNPFRIPKIAK LE+R +KEL   H K + +I + +N+LL MCKEQM  FA+ LLNV+
Sbjct  61   AAKNPFRIPKIAKFLEQRSHKELHCDHFKYIEIIMQAFNKLLSMCKEQMPYFAIYLLNVI  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
             + LD ++   ++ +GC T T FIYSQ DGTYT+NIE LV+KVC LARE+GEE +KR LR
Sbjct  121  SDHLDQSRPVTIQILGCQTLTNFIYSQADGTYTHNIEGLVRKVCVLARESGEESEKRRLR  180

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNYEPDAH  804
            ASSL+CLSAMVWFMAEFSHIF DFDEI++VTLDNY  +A 
Sbjct  181  ASSLQCLSAMVWFMAEFSHIFTDFDEIIYVTLDNYAVEAQ  220


 Score =   225 bits (574),  Expect(2) = 1e-146, Method: Compositional matrix adjust.
 Identities = 108/196 (55%), Positives = 142/196 (72%), Gaps = 5/196 (3%)
 Frame = +2

Query  815   DERGEAHHNWVDEVIRSEGRD---VGNENRPGY-LIRKRPDKKDISLLTSEEIEMPKIWA  982
             DE  E+HHNWV+EVIR E R    V N+  P Y ++R  P+ KD S+L+ EE+E PK+W+
Sbjct  225   DEGEESHHNWVNEVIRCETRSGACVVNDMSPSYDIVRPHPEIKDPSILSREEMESPKVWS  284

Query  983   HICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSGNHQL  1162
              ICIQRM  LAKE++TMRRVLDPMF++FD  + W PR GLA  +LSD+SY + S+GN QL
Sbjct  285   QICIQRMVQLAKETTTMRRVLDPMFLYFDTRRQWTPRQGLALFILSDMSYLMASTGNDQL  344

Query  1163  ILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKSLQA  1342
             IL  ++RHLDHKN+A D  IKS +IQ  TAL R ++S    +++  VSDLCRHLRKSLQA
Sbjct  345   ILAAIIRHLDHKNIAHDPLIKSNIIQICTALVRLLKSRVIIAELSVVSDLCRHLRKSLQA  404

Query  1343  TVDLAGEE-INLNLTL  1387
             + DL  ++  N N++L
Sbjct  405   STDLVSQQDSNWNISL  420



>ref|XP_010674649.1| PREDICTED: protein EFR3 homolog A [Beta vulgaris subsp. vulgaris]
Length=998

 Score =   318 bits (814),  Expect(2) = 6e-140, Method: Compositional matrix adjust.
 Identities = 146/215 (68%), Positives = 176/215 (82%), Gaps = 0/215 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG++SRKLFPAC SMC+CCPALRSRSRQPVKRYKKL+ADIFPKSPDG  N RK++KLCEY
Sbjct  1    MGIISRKLFPACGSMCVCCPALRSRSRQPVKRYKKLIADIFPKSPDGQTNERKLVKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            AAKNP RIPKI K LEE+ ++ELR GH K+V ++ E Y++LLCMC +QMA FA +LL + 
Sbjct  61   AAKNPVRIPKITKQLEEKFFRELRYGHLKIVGIVMEAYDKLLCMCGKQMAYFAASLLLLS  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
             E+LD +K  +V+ +GC T T+FIYSQ DGTY  NI   V KVC LA+ETGEE QKR LR
Sbjct  121  DEVLDQSKEVSVQVVGCQTLTRFIYSQTDGTYARNIGTFVNKVCMLAKETGEEHQKRSLR  180

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNY  789
            ASSL+CLSAMVW+MAEFSHI+ + DE+V V LD+Y
Sbjct  181  ASSLQCLSAMVWYMAEFSHIYNNVDEVVQVILDSY  215


 Score =   209 bits (532),  Expect(2) = 6e-140, Method: Compositional matrix adjust.
 Identities = 103/188 (55%), Positives = 131/188 (70%), Gaps = 4/188 (2%)
 Frame = +2

Query  836   HNWVDEVIRSEGRDVGNENRPG---YLIRKRPDKKDISLLTSEEIEMPKIWAHICIQRMA  1006
             H WVDEV+R  G               +R  P+KK IS LT EEIE P++WA IC+QR+A
Sbjct  229   HQWVDEVVRCAGGGSAVAGAASPCCTAVRPHPNKKTISSLTKEEIENPRVWAQICLQRLA  288

Query  1007  DLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSGNHQLILTGVVRH  1186
             +LA+ES+TMR+VL+PMFI+FD  +HW  + GLA  VL D+ YF+E   N Q+IL G++RH
Sbjct  289   ELARESTTMRQVLEPMFIYFDTGRHWSTQQGLAVTVLCDMCYFMELPENQQIILNGIIRH  348

Query  1187  LDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKSLQATVDLAGE-  1363
             +DHKNV+ D  +KS V+Q A  +ARQIRSGG  SD+G VSDL RHLRKSLQ+     GE 
Sbjct  349   MDHKNVSHDPVVKSCVVQVAANVARQIRSGGTLSDVGCVSDLLRHLRKSLQSIAGPTGEQ  408

Query  1364  EINLNLTL  1387
             EINLN+ L
Sbjct  409   EINLNIHL  416



>emb|CDX80597.1| BnaC07g28470D [Brassica napus]
Length=951

 Score =   306 bits (785),  Expect(2) = 8e-140, Method: Compositional matrix adjust.
 Identities = 142/216 (66%), Positives = 166/216 (77%), Gaps = 0/216 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG +SR +FPACE + +CCPA   RS  PVKRYK LL DIFPKSPDG++N RKI+KLCEY
Sbjct  1    MGFISRTVFPACERVFVCCPAYGPRSLHPVKRYKILLLDIFPKSPDGASNERKIVKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            AAKNP  IPKIAKCLE  CYK+LRS   K +NV+ E YN +L  CK+ MA FA++LLNVV
Sbjct  61   AAKNPVHIPKIAKCLENMCYKDLRSRQMKFINVVTEAYNNMLFHCKDHMAYFAMSLLNVV  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
             E+L  +K DA   +GC T T+FIY+QVD TYT++IE    +VCSLARE G+E QKRCLR
Sbjct  121  TELLVNSKQDAPTILGCQTLTRFIYTQVDRTYTHSIEKFAHRVCSLAREEGDEHQKRCLR  180

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNYE  792
            AS L+CLSAMVWFM EFSHIFA  DEIVH  L NYE
Sbjct  181  ASGLQCLSAMVWFMGEFSHIFAAVDEIVHAILGNYE  216


 Score =   220 bits (560),  Expect(2) = 8e-140, Method: Compositional matrix adjust.
 Identities = 108/195 (55%), Positives = 138/195 (71%), Gaps = 10/195 (5%)
 Frame = +2

Query  806   NEDDERGEAHHNWVDEVIRSEGRDVGNENRPGYLIRKRPDKKDISLLTSEEIEMPKIWAH  985
             NED E  + + NWVDEVIR EGR  G        +R R  +KD +LLT EE EMPK+WA 
Sbjct  224   NEDREE-QKNCNWVDEVIRCEGRGAG--------VRPRTARKDPALLTKEETEMPKVWAQ  274

Query  986   ICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSGNHQLI  1165
             IC+QRM DLAKES+T+R++LDPMF +F + + W P +GLA +VLSD +Y  E SG  QL+
Sbjct  275   ICLQRMVDLAKESTTLRQILDPMFSYFTSRRQWTPPNGLAMIVLSDATYLTEISGTQQLV  334

Query  1166  LTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKSLQAT  1345
             L+ VVRHLD+K+VA D ++K+++IQ A  LA+ IR+     DI FV+DLCRHLRKS QAT
Sbjct  335   LSSVVRHLDNKHVANDPELKAYIIQVAGCLAKLIRTSSYLRDISFVNDLCRHLRKSFQAT  394

Query  1346  VDLAG-EEINLNLTL  1387
                 G EE+NLNL L
Sbjct  395   SRSIGEEELNLNLML  409



>ref|XP_009384437.1| PREDICTED: uncharacterized protein LOC103971984 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=997

 Score =   306 bits (783),  Expect(2) = 2e-138, Method: Compositional matrix adjust.
 Identities = 141/218 (65%), Positives = 174/218 (80%), Gaps = 1/218 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG +SRKL PAC +MC+CCPAL   SR+PVKRYKKLLA++FPK+ DG  N RKIMKLCEY
Sbjct  1    MGFISRKLLPACGNMCVCCPALNPSSRRPVKRYKKLLAEVFPKNLDGLPNERKIMKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            AA+NP RIPKIAK LE+RCYKELR+ H   V +I EVY++LL +CKEQMA FA++LL+V+
Sbjct  61   AARNPIRIPKIAKYLEQRCYKELRNEHINFVKIITEVYSKLLYICKEQMAYFAISLLDVI  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
            +E+LD  + D +K +GC T T+FI SQ D TYT+NIE LVQKVC LAR+ GEE QK  LR
Sbjct  121  IELLDSKQQDGIKILGCQTLTRFICSQADNTYTWNIEGLVQKVCMLARQNGEE-QKSLLR  179

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNYEPD  798
            ASSL+CLSAM+WFM+E  +IFA  DEI++  L+NY  D
Sbjct  180  ASSLQCLSAMIWFMSEHPYIFAGLDEIIYAILENYRTD  217


 Score =   216 bits (550),  Expect(2) = 2e-138, Method: Compositional matrix adjust.
 Identities = 105/192 (55%), Positives = 138/192 (72%), Gaps = 5/192 (3%)
 Frame = +2

Query  809   EDDERGEAHHNWVDEVIRSEGRDV----GNENRPGYLIRKRPDKKDISLLTSEEIEMPKI  976
             +DDER E+HHNWVDEV+R E R V       +    +IR+RP+ KD +LLT EE E P++
Sbjct  222   DDDERHESHHNWVDEVVRGEARGVVTIMSGLSPCNVVIRQRPESKDSTLLTREERECPEV  281

Query  977   WAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSGNH  1156
             W+ ICI+++A+LA ES T RRVL+PMF +FD  +HW  RHG A VVL D++Y  ++S N 
Sbjct  282   WSQICIEKLAELANESITTRRVLEPMFAYFDKGRHWASRHGFALVVLCDIAYLGKNSENE  341

Query  1157  QLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKSL  1336
             QLIL  V+RHLDHKNV  D QIKS ++Q AT+  RQ++S    ++I  VSDLCRHLRKSL
Sbjct  342   QLILAAVIRHLDHKNVVHDPQIKSDIVQVATSFVRQLKSRAVVAEI-VVSDLCRHLRKSL  400

Query  1337  QATVDLAGEEIN  1372
             QATV+  G +I+
Sbjct  401   QATVESVGLQIS  412



>ref|XP_009384434.1| PREDICTED: uncharacterized protein LOC103971984 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009384435.1| PREDICTED: uncharacterized protein LOC103971984 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009384436.1| PREDICTED: uncharacterized protein LOC103971984 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=998

 Score =   305 bits (782),  Expect(2) = 2e-138, Method: Compositional matrix adjust.
 Identities = 141/218 (65%), Positives = 174/218 (80%), Gaps = 1/218 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG +SRKL PAC +MC+CCPAL   SR+PVKRYKKLLA++FPK+ DG  N RKIMKLCEY
Sbjct  1    MGFISRKLLPACGNMCVCCPALNPSSRRPVKRYKKLLAEVFPKNLDGLPNERKIMKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            AA+NP RIPKIAK LE+RCYKELR+ H   V +I EVY++LL +CKEQMA FA++LL+V+
Sbjct  61   AARNPIRIPKIAKYLEQRCYKELRNEHINFVKIITEVYSKLLYICKEQMAYFAISLLDVI  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
            +E+LD  + D +K +GC T T+FI SQ D TYT+NIE LVQKVC LAR+ GEE QK  LR
Sbjct  121  IELLDSKQQDGIKILGCQTLTRFICSQADNTYTWNIEGLVQKVCMLARQNGEE-QKSLLR  179

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNYEPD  798
            ASSL+CLSAM+WFM+E  +IFA  DEI++  L+NY  D
Sbjct  180  ASSLQCLSAMIWFMSEHPYIFAGLDEIIYAILENYRTD  217


 Score =   216 bits (550),  Expect(2) = 2e-138, Method: Compositional matrix adjust.
 Identities = 105/192 (55%), Positives = 138/192 (72%), Gaps = 5/192 (3%)
 Frame = +2

Query  809   EDDERGEAHHNWVDEVIRSEGRDV----GNENRPGYLIRKRPDKKDISLLTSEEIEMPKI  976
             +DDER E+HHNWVDEV+R E R V       +    +IR+RP+ KD +LLT EE E P++
Sbjct  222   DDDERHESHHNWVDEVVRGEARGVVTIMSGLSPCNVVIRQRPESKDSTLLTREERECPEV  281

Query  977   WAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSGNH  1156
             W+ ICI+++A+LA ES T RRVL+PMF +FD  +HW  RHG A VVL D++Y  ++S N 
Sbjct  282   WSQICIEKLAELANESITTRRVLEPMFAYFDKGRHWASRHGFALVVLCDIAYLGKNSENE  341

Query  1157  QLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKSL  1336
             QLIL  V+RHLDHKNV  D QIKS ++Q AT+  RQ++S    ++I  VSDLCRHLRKSL
Sbjct  342   QLILAAVIRHLDHKNVVHDPQIKSDIVQVATSFVRQLKSRAVVAEI-VVSDLCRHLRKSL  400

Query  1337  QATVDLAGEEIN  1372
             QATV+  G +I+
Sbjct  401   QATVESVGLQIS  412



>ref|XP_008781115.1| PREDICTED: uncharacterized protein LOC103700980 isoform X2 [Phoenix 
dactylifera]
Length=993

 Score =   308 bits (790),  Expect(2) = 8e-138, Method: Compositional matrix adjust.
 Identities = 144/220 (65%), Positives = 176/220 (80%), Gaps = 1/220 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG +SRK+ PAC +MC+CCPALR  SR+PVKRYKKLLA+IFPK+ DG+ N RKIMKLCEY
Sbjct  1    MGFMSRKILPACGNMCVCCPALRPSSRRPVKRYKKLLAEIFPKNLDGTPNERKIMKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            AAKNP RIPKIAK LE+R YKELRS H   V +I EVY++LL +CKEQMA FA++LLNV+
Sbjct  61   AAKNPLRIPKIAKFLEQRSYKELRSEHINFVKIITEVYSKLLYICKEQMAYFAISLLNVI  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
            +E+LD  + D+V+ +GC T TKFI SQ D TY  NIE LV+KVC LA   GEE QK  L+
Sbjct  121  IELLDNKQRDSVQILGCQTLTKFICSQADSTYARNIECLVRKVCVLAYRQGEE-QKSLLQ  179

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNYEPDAH  804
            A+SL+CLSAM+WFM E+S+IF DFDEI+H  L+NY+ D H
Sbjct  180  AASLQCLSAMIWFMTEYSYIFTDFDEIIHAILENYQADDH  219


 Score =   211 bits (538),  Expect(2) = 8e-138, Method: Compositional matrix adjust.
 Identities = 105/200 (53%), Positives = 143/200 (72%), Gaps = 5/200 (3%)
 Frame = +2

Query  803   INEDDERGEAHHNWVDEVIRSEGR---DVGNE-NRPGYLIRKRPDKKDISLLTSEEIEMP  970
             I+ D+ER ++HHNWVDEV+RSE R    +G + N     +R     +D ++LT EE E P
Sbjct  220   IDIDNERSDSHHNWVDEVVRSEARAGVTLGKDVNLSTTSLRPHSVPRDSAMLTREERESP  279

Query  971   KIWAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSG  1150
             ++W+ IC++++A++AKES+TMR VLDPM  +FD  KHW  RHGLA  VLSD++Y  +SSG
Sbjct  280   EVWSQICVRKLAEMAKESTTMRCVLDPMLAYFDTGKHWASRHGLALFVLSDMTYSEKSSG  339

Query  1151  NHQLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRK  1330
             N QLIL+ ++RHLDHKNV  D + KS ++Q AT L + +RS    ++IG VSDLCRHLRK
Sbjct  340   NEQLILSAIIRHLDHKNVVHDPKTKSDIVQIATILVQHLRSQAVVAEIGAVSDLCRHLRK  399

Query  1331  SLQATVDLAG-EEINLNLTL  1387
             SLQ +V+ AG EE N N +L
Sbjct  400   SLQTSVESAGPEESNWNDSL  419



>ref|XP_008781114.1| PREDICTED: protein EFR3 homolog cmp44E-like isoform X1 [Phoenix 
dactylifera]
Length=1013

 Score =   308 bits (789),  Expect(2) = 1e-137, Method: Compositional matrix adjust.
 Identities = 144/220 (65%), Positives = 176/220 (80%), Gaps = 1/220 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG +SRK+ PAC +MC+CCPALR  SR+PVKRYKKLLA+IFPK+ DG+ N RKIMKLCEY
Sbjct  1    MGFMSRKILPACGNMCVCCPALRPSSRRPVKRYKKLLAEIFPKNLDGTPNERKIMKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            AAKNP RIPKIAK LE+R YKELRS H   V +I EVY++LL +CKEQMA FA++LLNV+
Sbjct  61   AAKNPLRIPKIAKFLEQRSYKELRSEHINFVKIITEVYSKLLYICKEQMAYFAISLLNVI  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
            +E+LD  + D+V+ +GC T TKFI SQ D TY  NIE LV+KVC LA   GEE QK  L+
Sbjct  121  IELLDNKQRDSVQILGCQTLTKFICSQADSTYARNIECLVRKVCVLAYRQGEE-QKSLLQ  179

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNYEPDAH  804
            A+SL+CLSAM+WFM E+S+IF DFDEI+H  L+NY+ D H
Sbjct  180  AASLQCLSAMIWFMTEYSYIFTDFDEIIHAILENYQADDH  219


 Score =   211 bits (537),  Expect(2) = 1e-137, Method: Compositional matrix adjust.
 Identities = 105/200 (53%), Positives = 143/200 (72%), Gaps = 5/200 (3%)
 Frame = +2

Query  803   INEDDERGEAHHNWVDEVIRSEGR---DVGNE-NRPGYLIRKRPDKKDISLLTSEEIEMP  970
             I+ D+ER ++HHNWVDEV+RSE R    +G + N     +R     +D ++LT EE E P
Sbjct  220   IDIDNERSDSHHNWVDEVVRSEARAGVTLGKDVNLSTTSLRPHSVPRDSAMLTREERESP  279

Query  971   KIWAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSG  1150
             ++W+ IC++++A++AKES+TMR VLDPM  +FD  KHW  RHGLA  VLSD++Y  +SSG
Sbjct  280   EVWSQICVRKLAEMAKESTTMRCVLDPMLAYFDTGKHWASRHGLALFVLSDMTYSEKSSG  339

Query  1151  NHQLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRK  1330
             N QLIL+ ++RHLDHKNV  D + KS ++Q AT L + +RS    ++IG VSDLCRHLRK
Sbjct  340   NEQLILSAIIRHLDHKNVVHDPKTKSDIVQIATILVQHLRSQAVVAEIGAVSDLCRHLRK  399

Query  1331  SLQATVDLAG-EEINLNLTL  1387
             SLQ +V+ AG EE N N +L
Sbjct  400   SLQTSVESAGPEESNWNDSL  419



>gb|ABF95548.1| cyclin, putative, expressed [Oryza sativa Japonica Group]
Length=729

 Score =   295 bits (756),  Expect(2) = 2e-137, Method: Compositional matrix adjust.
 Identities = 138/215 (64%), Positives = 170/215 (79%), Gaps = 3/215 (1%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG +S KLFP+CESMC+CCPALR  SR+PVKRYKKLLA+IFPK+PDG  N RKIMKLCEY
Sbjct  1    MGFMSAKLFPSCESMCVCCPALRPSSRRPVKRYKKLLAEIFPKTPDGLPNERKIMKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            AAKNP RIPKIAK LE+R +KELRS H   + +I E Y++LL +CKEQMA FA++L+NV+
Sbjct  61   AAKNPLRIPKIAKFLEQRSHKELRSAHVNFIKIITEAYSKLLFICKEQMAYFAISLVNVL  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
             E+L+ +K + +  +GC T  KFIYSQVD TY  NIE+LV+KVC L+R+ G E     LR
Sbjct  121  TELLE-SKQENIHILGCQTLAKFIYSQVDNTYARNIESLVRKVCVLSRQQGVEHS--LLR  177

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNY  789
            A+SL+CLSAM+WFM E S+IF DFDEIV   L+NY
Sbjct  178  AASLQCLSAMIWFMKEHSYIFVDFDEIVQSVLENY  212


 Score =   223 bits (568),  Expect(2) = 2e-137, Method: Compositional matrix adjust.
 Identities = 113/196 (58%), Positives = 141/196 (72%), Gaps = 5/196 (3%)
 Frame = +2

Query  812   DDERGEAHHNWVDEVIRSEGR---DVGNE-NRPGYLIRKRPDKKDISLLTSEEIEMPKIW  979
             D+ER    HNWVDE++R EGR     GN+ N     IR R   +D S LT EE E P++W
Sbjct  221   DEERHAPQHNWVDEIVRREGRAGLGGGNDVNCNSTAIRLR-SARDSSALTREERESPEVW  279

Query  980   AHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSGNHQ  1159
             AHIC+Q++A+LAKES+TMRR+LDPM  +FD  K W PR GLA +VLSD+SY  +SSGN Q
Sbjct  280   AHICVQKLAELAKESTTMRRILDPMLSYFDKKKQWAPRQGLALLVLSDMSYLEKSSGNEQ  339

Query  1160  LILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKSLQ  1339
             LILT V+RHLDHKNV  D QIKS +IQTAT LARQ+RS G  +++    DLCRHLRK+L+
Sbjct  340   LILTSVIRHLDHKNVLYDPQIKSDMIQTATLLARQLRSRGIAAELVVAGDLCRHLRKTLE  399

Query  1340  ATVDLAGEEINLNLTL  1387
             A    + EE+NLN +L
Sbjct  400   AMESASIEELNLNESL  415



>ref|XP_010921489.1| PREDICTED: uncharacterized protein LOC105045026 [Elaeis guineensis]
Length=992

 Score =   304 bits (779),  Expect(2) = 2e-137, Method: Compositional matrix adjust.
 Identities = 140/220 (64%), Positives = 170/220 (77%), Gaps = 1/220 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG +SRK+ PAC +MC+CCPALR  SR+PVKRYKKLLA+IFPK+ DG  N RKIMKLCEY
Sbjct  1    MGFISRKILPACGNMCVCCPALRPSSRRPVKRYKKLLAEIFPKNLDGPPNERKIMKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            AAKNP RIPKIAK LE+R YKELRS H   V +I E Y++LL +CKEQMA FA+ LLNV+
Sbjct  61   AAKNPLRIPKIAKFLEQRSYKELRSEHINFVKIITETYSKLLYICKEQMAYFAIGLLNVI  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
            +E+LD  + D+V+ +GC T  KFIYSQ D TY  NIE+LV  VC LA   GEE Q   L+
Sbjct  121  IELLDNKQRDSVQILGCQTLAKFIYSQADSTYARNIESLVGNVCVLAHGQGEE-QNSLLQ  179

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNYEPDAH  804
            A+SL+CLSA +WFM E+S+IF DFDEI+H  L+NY+ D H
Sbjct  180  AASLQCLSATIWFMTEYSYIFTDFDEIIHAILENYQADDH  219


 Score =   214 bits (544),  Expect(2) = 2e-137, Method: Compositional matrix adjust.
 Identities = 107/200 (54%), Positives = 144/200 (72%), Gaps = 5/200 (3%)
 Frame = +2

Query  803   INEDDERGEAHHNWVDEVIRSEGR---DVGNE-NRPGYLIRKRPDKKDISLLTSEEIEMP  970
             ++ D+ER ++HHNWVDEV+RSE R    +G + N     +R     +D ++LT EE E P
Sbjct  220   VDIDNERRDSHHNWVDEVVRSEARAGVTLGKDVNLSTTSLRPHSVPRDCAMLTREERESP  279

Query  971   KIWAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSG  1150
             K W+ IC+Q++A++AKES+TMR VLDPMF +FD  KHWV RHGLA  VLSD++Y  +SSG
Sbjct  280   KAWSQICVQKLAEMAKESTTMRCVLDPMFAYFDTGKHWVSRHGLALFVLSDMTYSEKSSG  339

Query  1151  NHQLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRK  1330
             N Q+IL+ ++RHLDHKNV  D + KS ++Q AT L + +RS    ++IG VSDLCRHLRK
Sbjct  340   NEQVILSAIIRHLDHKNVVRDPKTKSDIVQIATILVQYLRSLAVAAEIGTVSDLCRHLRK  399

Query  1331  SLQATVDLAG-EEINLNLTL  1387
             SLQ +V+ AG EE N N +L
Sbjct  400   SLQTSVESAGPEESNWNHSL  419



>ref|XP_008808672.1| PREDICTED: uncharacterized protein LOC103720646 isoform X2 [Phoenix 
dactylifera]
Length=986

 Score =   305 bits (780),  Expect(2) = 2e-137, Method: Compositional matrix adjust.
 Identities = 142/220 (65%), Positives = 174/220 (79%), Gaps = 1/220 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MGL+SRK+ PAC +MC+C PALR  SR+PVKRYKKLLA+IFPK+ DG  N RKI+KLCEY
Sbjct  1    MGLMSRKILPACGNMCVCFPALRPSSRRPVKRYKKLLAEIFPKTLDGPPNERKIIKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            AAKNP RIPKIAK LE+R YKELR  H   V +I EVY++LL +CKEQMA FA++LLNV+
Sbjct  61   AAKNPVRIPKIAKFLEQRSYKELRCAHINFVKIITEVYSKLLYICKEQMAYFAISLLNVI  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
            +E+LD  + D+++ +GC TFTKFIYSQ D TY  NIE+LV+KVC LA    EE+QK  LR
Sbjct  121  IELLDSKQQDSIQILGCQTFTKFIYSQADNTYARNIESLVRKVCMLAH-GQEEEQKSLLR  179

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNYEPDAH  804
            A+SL+CLSAM+WFM E+S IF DFDEI+H  L+NY    H
Sbjct  180  AASLQCLSAMIWFMTEYSCIFTDFDEIIHAILENYRAGDH  219


 Score =   214 bits (544),  Expect(2) = 2e-137, Method: Compositional matrix adjust.
 Identities = 109/200 (55%), Positives = 145/200 (73%), Gaps = 5/200 (3%)
 Frame = +2

Query  803   INEDDERGEAHHNWVDEVIRSEGR---DVGNE-NRPGYLIRKRPDKKDISLLTSEEIEMP  970
             I+ D+ER +++HNWVDEV+RSE R    VGN+ N      R +   +D ++LT EE E P
Sbjct  220   IDIDNERHDSNHNWVDEVVRSESRASVTVGNDVNLNHTSFRPQSVARDSAMLTREEHESP  279

Query  971   KIWAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSG  1150
             ++W+ IC+Q++A++AKES+TMR VLDPMF +FD  K W PRHGLA +VLSD+ +  +SSG
Sbjct  280   EVWSQICVQKLAEMAKESTTMRCVLDPMFSYFDTGKCWAPRHGLALLVLSDMIFSEKSSG  339

Query  1151  NHQLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRK  1330
             N QLIL+ ++RHLDHKNV  D + KS ++Q A  L RQ+RS    ++IG V+DLCRHLRK
Sbjct  340   NEQLILSAIIRHLDHKNVVHDPKTKSDIVQIAAILVRQLRSQAVVAEIGAVNDLCRHLRK  399

Query  1331  SLQATVDLAG-EEINLNLTL  1387
             SLQ TV+ AG EE N N TL
Sbjct  400   SLQTTVESAGPEESNWNDTL  419



>ref|XP_008808671.1| PREDICTED: uncharacterized protein LOC103720646 isoform X1 [Phoenix 
dactylifera]
Length=994

 Score =   304 bits (779),  Expect(2) = 3e-137, Method: Compositional matrix adjust.
 Identities = 142/220 (65%), Positives = 174/220 (79%), Gaps = 1/220 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MGL+SRK+ PAC +MC+C PALR  SR+PVKRYKKLLA+IFPK+ DG  N RKI+KLCEY
Sbjct  1    MGLMSRKILPACGNMCVCFPALRPSSRRPVKRYKKLLAEIFPKTLDGPPNERKIIKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            AAKNP RIPKIAK LE+R YKELR  H   V +I EVY++LL +CKEQMA FA++LLNV+
Sbjct  61   AAKNPVRIPKIAKFLEQRSYKELRCAHINFVKIITEVYSKLLYICKEQMAYFAISLLNVI  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
            +E+LD  + D+++ +GC TFTKFIYSQ D TY  NIE+LV+KVC LA    EE+QK  LR
Sbjct  121  IELLDSKQQDSIQILGCQTFTKFIYSQADNTYARNIESLVRKVCMLAH-GQEEEQKSLLR  179

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNYEPDAH  804
            A+SL+CLSAM+WFM E+S IF DFDEI+H  L+NY    H
Sbjct  180  AASLQCLSAMIWFMTEYSCIFTDFDEIIHAILENYRAGDH  219


 Score =   214 bits (544),  Expect(2) = 3e-137, Method: Compositional matrix adjust.
 Identities = 109/200 (55%), Positives = 145/200 (73%), Gaps = 5/200 (3%)
 Frame = +2

Query  803   INEDDERGEAHHNWVDEVIRSEGR---DVGNE-NRPGYLIRKRPDKKDISLLTSEEIEMP  970
             I+ D+ER +++HNWVDEV+RSE R    VGN+ N      R +   +D ++LT EE E P
Sbjct  220   IDIDNERHDSNHNWVDEVVRSESRASVTVGNDVNLNHTSFRPQSVARDSAMLTREEHESP  279

Query  971   KIWAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSG  1150
             ++W+ IC+Q++A++AKES+TMR VLDPMF +FD  K W PRHGLA +VLSD+ +  +SSG
Sbjct  280   EVWSQICVQKLAEMAKESTTMRCVLDPMFSYFDTGKCWAPRHGLALLVLSDMIFSEKSSG  339

Query  1151  NHQLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRK  1330
             N QLIL+ ++RHLDHKNV  D + KS ++Q A  L RQ+RS    ++IG V+DLCRHLRK
Sbjct  340   NEQLILSAIIRHLDHKNVVHDPKTKSDIVQIAAILVRQLRSQAVVAEIGAVNDLCRHLRK  399

Query  1331  SLQATVDLAG-EEINLNLTL  1387
             SLQ TV+ AG EE N N TL
Sbjct  400   SLQTTVESAGPEESNWNDTL  419



>ref|NP_001049903.1| Os03g0308200 [Oryza sativa Japonica Group]
 gb|ABF95547.1| cyclin, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF11817.1| Os03g0308200 [Oryza sativa Japonica Group]
 dbj|BAG93123.1| unnamed protein product [Oryza sativa Japonica Group]
Length=988

 Score =   295 bits (754),  Expect(2) = 6e-137, Method: Compositional matrix adjust.
 Identities = 138/215 (64%), Positives = 170/215 (79%), Gaps = 3/215 (1%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG +S KLFP+CESMC+CCPALR  SR+PVKRYKKLLA+IFPK+PDG  N RKIMKLCEY
Sbjct  1    MGFMSAKLFPSCESMCVCCPALRPSSRRPVKRYKKLLAEIFPKTPDGLPNERKIMKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            AAKNP RIPKIAK LE+R +KELRS H   + +I E Y++LL +CKEQMA FA++L+NV+
Sbjct  61   AAKNPLRIPKIAKFLEQRSHKELRSAHVNFIKIITEAYSKLLFICKEQMAYFAISLVNVL  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
             E+L+ +K + +  +GC T  KFIYSQVD TY  NIE+LV+KVC L+R+ G E     LR
Sbjct  121  TELLE-SKQENIHILGCQTLAKFIYSQVDNTYARNIESLVRKVCVLSRQQGVE--HSLLR  177

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNY  789
            A+SL+CLSAM+WFM E S+IF DFDEIV   L+NY
Sbjct  178  AASLQCLSAMIWFMKEHSYIFVDFDEIVQSVLENY  212


 Score =   223 bits (567),  Expect(2) = 6e-137, Method: Compositional matrix adjust.
 Identities = 113/196 (58%), Positives = 141/196 (72%), Gaps = 5/196 (3%)
 Frame = +2

Query  812   DDERGEAHHNWVDEVIRSEGR---DVGNE-NRPGYLIRKRPDKKDISLLTSEEIEMPKIW  979
             D+ER    HNWVDE++R EGR     GN+ N     IR R   +D S LT EE E P++W
Sbjct  221   DEERHAPQHNWVDEIVRREGRAGLGGGNDVNCNSTAIRLR-SARDSSALTREERESPEVW  279

Query  980   AHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSGNHQ  1159
             AHIC+Q++A+LAKES+TMRR+LDPM  +FD  K W PR GLA +VLSD+SY  +SSGN Q
Sbjct  280   AHICVQKLAELAKESTTMRRILDPMLSYFDKKKQWAPRQGLALLVLSDMSYLEKSSGNEQ  339

Query  1160  LILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKSLQ  1339
             LILT V+RHLDHKNV  D QIKS +IQTAT LARQ+RS G  +++    DLCRHLRK+L+
Sbjct  340   LILTSVIRHLDHKNVLYDPQIKSDMIQTATLLARQLRSRGIAAELVVAGDLCRHLRKTLE  399

Query  1340  ATVDLAGEEINLNLTL  1387
             A    + EE+NLN +L
Sbjct  400   AMESASIEELNLNESL  415



>ref|XP_006649970.1| PREDICTED: uncharacterized protein LOC102701065 [Oryza brachyantha]
Length=984

 Score =   297 bits (761),  Expect(2) = 2e-136, Method: Compositional matrix adjust.
 Identities = 139/215 (65%), Positives = 172/215 (80%), Gaps = 3/215 (1%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG +S KLFP+CESMC+CCPALR  SR+PVKRYKKLLA+IFPK+PDG  N RKIMKLCEY
Sbjct  1    MGFMSAKLFPSCESMCVCCPALRPSSRRPVKRYKKLLAEIFPKTPDGPPNERKIMKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            AAKNP RIPKIAK LE+R +KELR+ H   V +I E Y++LL +CKEQMA FA++L+NV+
Sbjct  61   AAKNPLRIPKIAKFLEQRSHKELRAAHVNFVKIITEAYSKLLFICKEQMAYFAISLVNVL  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
             E+L+ +K + +  +GC T  KFIYSQVD TY  NIE+LV+KVC+L+R+ G E     LR
Sbjct  121  TELLE-SKQENIHILGCQTLAKFIYSQVDNTYARNIESLVRKVCALSRQQGVEHS--LLR  177

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNY  789
            A+SL+CLSAM+WFM E S+IFADFDEIV   L+NY
Sbjct  178  AASLQCLSAMIWFMKEHSYIFADFDEIVQSVLENY  212


 Score =   218 bits (554),  Expect(2) = 2e-136, Method: Compositional matrix adjust.
 Identities = 110/196 (56%), Positives = 138/196 (70%), Gaps = 5/196 (3%)
 Frame = +2

Query  812   DDERGEAHHNWVDEVIRSEGR---DVGNE-NRPGYLIRKRPDKKDISLLTSEEIEMPKIW  979
             D+E     HNWVDE++R EGR     GN+ N     IR R   +D S LT EE E P++W
Sbjct  221   DEESHAPQHNWVDEIVRREGRAGLGGGNDVNCSSTTIRLR-SARDSSALTREERESPEVW  279

Query  980   AHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSGNHQ  1159
             AHIC+Q++A+LAKES+TMRR+LDPM  +FD  K W PR GLA +VLSD+SY  +SSGN Q
Sbjct  280   AHICVQKLAELAKESTTMRRILDPMLSYFDKKKQWAPRQGLALLVLSDMSYLEKSSGNEQ  339

Query  1160  LILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKSLQ  1339
             LILT V+RHLDHKNV  D QIKS +IQ+AT LARQ+RS G   ++    DLCRHLRK+L+
Sbjct  340   LILTSVIRHLDHKNVLYDPQIKSDMIQSATLLARQLRSRGIAPELVVAGDLCRHLRKTLE  399

Query  1340  ATVDLAGEEINLNLTL  1387
             A    + EE+N N +L
Sbjct  400   AMESASIEELNFNESL  415



>ref|XP_004984608.1| PREDICTED: uncharacterized protein LOC101782956 [Setaria italica]
Length=992

 Score =   297 bits (761),  Expect(2) = 1e-135, Method: Compositional matrix adjust.
 Identities = 139/215 (65%), Positives = 171/215 (80%), Gaps = 3/215 (1%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG LS KL P+CESMC+CCPALR  SR+PVKRYKKLLA+IFPK+PDG+ N RKIMKLCEY
Sbjct  1    MGFLSAKLLPSCESMCVCCPALRPSSRRPVKRYKKLLAEIFPKTPDGAPNERKIMKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            AAKNP RIPKIAK LE+R +KELRS H   V +I E Y++LL +CKEQMA FA++L+NV+
Sbjct  61   AAKNPLRIPKIAKFLEQRTHKELRSAHVSFVRIITEAYSKLLFICKEQMAYFAISLMNVL  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
             E+L+ +K + +  +GC T   FI SQVD TY  NIE+LV+KVC L+R+ GEE   R LR
Sbjct  121  TELLE-SKQENIHILGCQTLANFINSQVDNTYARNIESLVRKVCGLSRQQGEE--HRLLR  177

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNY  789
            A+SL+CLSAM+WFM E S+IFADFDE+V   L+NY
Sbjct  178  AASLQCLSAMIWFMKEHSYIFADFDEVVQSVLENY  212


 Score =   215 bits (547),  Expect(2) = 1e-135, Method: Compositional matrix adjust.
 Identities = 108/199 (54%), Positives = 143/199 (72%), Gaps = 5/199 (3%)
 Frame = +2

Query  803   INEDDERGEAHHNWVDEVIRSEGRDV---GNE-NRPGYLIRKRPDKKDISLLTSEEIEMP  970
             I   D+R  + HNWVDE+ R EGR     GN+ N     IR RP  ++ S LT EE E P
Sbjct  218   IGGGDDRHASQHNWVDEIARCEGRPGLGGGNDVNISSTTIRLRP-ARNSSALTREERESP  276

Query  971   KIWAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSG  1150
             ++W+HIC+Q++A+LAKES+TMRR+LDPM  +FD  K W PRHGLA +VLSD++Y  + SG
Sbjct  277   EVWSHICVQKLAELAKESTTMRRILDPMLSYFDKKKQWPPRHGLALLVLSDMAYPEKISG  336

Query  1151  NHQLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRK  1330
             N QLILT V+RHLDHKNV+ D Q KS +IQTAT+LARQ+RS G  +++    DLC+HLRK
Sbjct  337   NEQLILTAVIRHLDHKNVSHDPQTKSDIIQTATSLARQLRSRGFTAELVVAGDLCKHLRK  396

Query  1331  SLQATVDLAGEEINLNLTL  1387
             +L+A    + E++NLN +L
Sbjct  397   TLEAVESGSVEDLNLNESL  415



>ref|XP_010938251.1| PREDICTED: uncharacterized protein LOC105057345 isoform X2 [Elaeis 
guineensis]
Length=993

 Score =   307 bits (786),  Expect(2) = 4e-135, Method: Compositional matrix adjust.
 Identities = 142/220 (65%), Positives = 173/220 (79%), Gaps = 1/220 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG +SRK+ PACE+MC+CCPALR  SR+PVKRYKKLL++IFPK+ DG  N RKI+KLCEY
Sbjct  1    MGFISRKILPACENMCVCCPALRPSSRRPVKRYKKLLSEIFPKTLDGPPNERKIIKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            AA+NP RIPKIAK LE+R YKELR GH   V +I E Y++LL +CKEQMA FA++LLNV+
Sbjct  61   AARNPVRIPKIAKFLEQRSYKELRCGHINFVKIITEAYSKLLYVCKEQMAYFAISLLNVI  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
            +E+LD  +   V+ +GC TFTKFIYSQ D TY  NIE+LVQKVC L+   G E QK  LR
Sbjct  121  IELLDSKQQVRVQILGCQTFTKFIYSQADNTYARNIESLVQKVCMLSHGQG-EGQKSLLR  179

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNYEPDAH  804
            A+SL+CLSAM+WFM E+S IF DFDEI+H  L+NY  D H
Sbjct  180  AASLQCLSAMIWFMTEYSCIFTDFDEIIHAILENYRADDH  219


 Score =   204 bits (519),  Expect(2) = 4e-135, Method: Compositional matrix adjust.
 Identities = 106/200 (53%), Positives = 143/200 (72%), Gaps = 6/200 (3%)
 Frame = +2

Query  803   INEDDERGEAHHNWVDEVIRSEGR---DVGNE-NRPGYLIRKRPDKKDISLLTSEEIEMP  970
             I+ D+ER +++HNWVD V+RSE R    VGN  N      R     +D ++LT EE +  
Sbjct  220   IHIDNERHDSNHNWVD-VVRSESRAGATVGNGVNLSHASFRPHSVARDSAMLTREERDSS  278

Query  971   KIWAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSG  1150
             ++W+ IC+Q++A++A+ES+TMRRVLDPMF + D  KHW P HGLA +VLSD++Y  +SSG
Sbjct  279   EVWSQICVQKLAEMAQESTTMRRVLDPMFSYLDTGKHWDPLHGLALLVLSDMTYSEKSSG  338

Query  1151  NHQLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRK  1330
             N QLIL+ ++RHLDHKNV  D + KS ++Q AT L RQ+RS    ++IG V+DLCRHLRK
Sbjct  339   NEQLILSAIIRHLDHKNVVRDPKTKSDIVQIATILVRQLRSQAVVAEIGAVNDLCRHLRK  398

Query  1331  SLQATVDLAG-EEINLNLTL  1387
             SLQATV+  G EE N N +L
Sbjct  399   SLQATVESVGPEESNWNYSL  418



>ref|XP_010938250.1| PREDICTED: uncharacterized protein LOC105057345 isoform X1 [Elaeis 
guineensis]
Length=1003

 Score =   306 bits (785),  Expect(2) = 5e-135, Method: Compositional matrix adjust.
 Identities = 142/220 (65%), Positives = 173/220 (79%), Gaps = 1/220 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG +SRK+ PACE+MC+CCPALR  SR+PVKRYKKLL++IFPK+ DG  N RKI+KLCEY
Sbjct  1    MGFISRKILPACENMCVCCPALRPSSRRPVKRYKKLLSEIFPKTLDGPPNERKIIKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            AA+NP RIPKIAK LE+R YKELR GH   V +I E Y++LL +CKEQMA FA++LLNV+
Sbjct  61   AARNPVRIPKIAKFLEQRSYKELRCGHINFVKIITEAYSKLLYVCKEQMAYFAISLLNVI  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
            +E+LD  +   V+ +GC TFTKFIYSQ D TY  NIE+LVQKVC L+   G E QK  LR
Sbjct  121  IELLDSKQQVRVQILGCQTFTKFIYSQADNTYARNIESLVQKVCMLSHGQG-EGQKSLLR  179

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNYEPDAH  804
            A+SL+CLSAM+WFM E+S IF DFDEI+H  L+NY  D H
Sbjct  180  AASLQCLSAMIWFMTEYSCIFTDFDEIIHAILENYRADDH  219


 Score =   204 bits (518),  Expect(2) = 5e-135, Method: Compositional matrix adjust.
 Identities = 106/200 (53%), Positives = 143/200 (72%), Gaps = 6/200 (3%)
 Frame = +2

Query  803   INEDDERGEAHHNWVDEVIRSEGR---DVGNE-NRPGYLIRKRPDKKDISLLTSEEIEMP  970
             I+ D+ER +++HNWVD V+RSE R    VGN  N      R     +D ++LT EE +  
Sbjct  220   IHIDNERHDSNHNWVD-VVRSESRAGATVGNGVNLSHASFRPHSVARDSAMLTREERDSS  278

Query  971   KIWAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSG  1150
             ++W+ IC+Q++A++A+ES+TMRRVLDPMF + D  KHW P HGLA +VLSD++Y  +SSG
Sbjct  279   EVWSQICVQKLAEMAQESTTMRRVLDPMFSYLDTGKHWDPLHGLALLVLSDMTYSEKSSG  338

Query  1151  NHQLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRK  1330
             N QLIL+ ++RHLDHKNV  D + KS ++Q AT L RQ+RS    ++IG V+DLCRHLRK
Sbjct  339   NEQLILSAIIRHLDHKNVVRDPKTKSDIVQIATILVRQLRSQAVVAEIGAVNDLCRHLRK  398

Query  1331  SLQATVDLAG-EEINLNLTL  1387
             SLQATV+  G EE N N +L
Sbjct  399   SLQATVESVGPEESNWNYSL  418



>ref|XP_010228707.1| PREDICTED: uncharacterized protein LOC100831072 isoform X1 [Brachypodium 
distachyon]
Length=995

 Score =   291 bits (745),  Expect(2) = 4e-134, Method: Compositional matrix adjust.
 Identities = 136/215 (63%), Positives = 168/215 (78%), Gaps = 3/215 (1%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG +  KLFP+CESMC+CCPALR  SR+PVKRYKKLLA+IFPK PDG  N RKIMKLCEY
Sbjct  1    MGFMGAKLFPSCESMCVCCPALRPSSRRPVKRYKKLLAEIFPKMPDGPPNERKIMKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            AAKNP RIPKIAK LE+R  KELR+ H   V +I E Y++LL +CKEQMA FA++L+NV+
Sbjct  61   AAKNPLRIPKIAKFLEQRSRKELRAAHVNYVKIITEAYSKLLFICKEQMAYFAISLVNVL  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
             ++L+ +K + +  +GC T  KFIYSQVD TY  N+E+LV KVC+L+R+ G E     LR
Sbjct  121  TDLLE-SKQENIHILGCQTLAKFIYSQVDNTYARNVESLVHKVCTLSRQQGVE--HNLLR  177

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNY  789
            A+SL+CLSAM+WFM E S+IFADFDEIV   L+NY
Sbjct  178  AASLQCLSAMIWFMKEHSYIFADFDEIVQSVLENY  212


 Score =   216 bits (550),  Expect(2) = 4e-134, Method: Compositional matrix adjust.
 Identities = 107/197 (54%), Positives = 138/197 (70%), Gaps = 5/197 (3%)
 Frame = +2

Query  812   DDERGEAHHNWVDEVIRSEGR-DVGNEN----RPGYLIRKRPDKKDISLLTSEEIEMPKI  976
             DDER  + HNWVDE++R +GR  +G  N    R           +D S LT EE E P++
Sbjct  221   DDERHASQHNWVDEIVRRDGRAGLGGGNDVNFRSATATITLRSARDSSALTREERESPEV  280

Query  977   WAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSGNH  1156
             W+ IC+Q++A+LAKES+TMRR+LDPM  +FD  K W PRHGLA +VLSD+SY  +SSGN 
Sbjct  281   WSFICVQKLAELAKESTTMRRILDPMLSYFDMKKQWAPRHGLALLVLSDMSYLEKSSGNE  340

Query  1157  QLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKSL  1336
             QLILT V+RHLDHKN+  D Q KS +IQTAT+LARQ+RS G   ++    DLCRHLRK+L
Sbjct  341   QLILTAVIRHLDHKNILHDPQTKSDIIQTATSLARQLRSRGVAPELVVAGDLCRHLRKTL  400

Query  1337  QATVDLAGEEINLNLTL  1387
             +A    + EE+NLN +L
Sbjct  401   EALESASVEELNLNESL  417



>ref|XP_003558072.1| PREDICTED: uncharacterized protein LOC100831072 isoform X2 [Brachypodium 
distachyon]
Length=994

 Score =   291 bits (745),  Expect(2) = 4e-134, Method: Compositional matrix adjust.
 Identities = 136/215 (63%), Positives = 168/215 (78%), Gaps = 3/215 (1%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG +  KLFP+CESMC+CCPALR  SR+PVKRYKKLLA+IFPK PDG  N RKIMKLCEY
Sbjct  1    MGFMGAKLFPSCESMCVCCPALRPSSRRPVKRYKKLLAEIFPKMPDGPPNERKIMKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            AAKNP RIPKIAK LE+R  KELR+ H   V +I E Y++LL +CKEQMA FA++L+NV+
Sbjct  61   AAKNPLRIPKIAKFLEQRSRKELRAAHVNYVKIITEAYSKLLFICKEQMAYFAISLVNVL  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
             ++L+ +K + +  +GC T  KFIYSQVD TY  N+E+LV KVC+L+R+ G E     LR
Sbjct  121  TDLLE-SKQENIHILGCQTLAKFIYSQVDNTYARNVESLVHKVCTLSRQQGVE--HNLLR  177

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNY  789
            A+SL+CLSAM+WFM E S+IFADFDEIV   L+NY
Sbjct  178  AASLQCLSAMIWFMKEHSYIFADFDEIVQSVLENY  212


 Score =   216 bits (550),  Expect(2) = 4e-134, Method: Compositional matrix adjust.
 Identities = 107/197 (54%), Positives = 138/197 (70%), Gaps = 5/197 (3%)
 Frame = +2

Query  812   DDERGEAHHNWVDEVIRSEGR-DVGNEN----RPGYLIRKRPDKKDISLLTSEEIEMPKI  976
             DDER  + HNWVDE++R +GR  +G  N    R           +D S LT EE E P++
Sbjct  221   DDERHASQHNWVDEIVRRDGRAGLGGGNDVNFRSATATITLRSARDSSALTREERESPEV  280

Query  977   WAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSGNH  1156
             W+ IC+Q++A+LAKES+TMRR+LDPM  +FD  K W PRHGLA +VLSD+SY  +SSGN 
Sbjct  281   WSFICVQKLAELAKESTTMRRILDPMLSYFDMKKQWAPRHGLALLVLSDMSYLEKSSGNE  340

Query  1157  QLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKSL  1336
             QLILT V+RHLDHKN+  D Q KS +IQTAT+LARQ+RS G   ++    DLCRHLRK+L
Sbjct  341   QLILTAVIRHLDHKNILHDPQTKSDIIQTATSLARQLRSRGVAPELVVAGDLCRHLRKTL  400

Query  1337  QATVDLAGEEINLNLTL  1387
             +A    + EE+NLN +L
Sbjct  401   EALESASVEELNLNESL  417



>ref|XP_002465372.1| hypothetical protein SORBIDRAFT_01g037420 [Sorghum bicolor]
 gb|EER92370.1| hypothetical protein SORBIDRAFT_01g037420 [Sorghum bicolor]
Length=981

 Score =   296 bits (757),  Expect(2) = 7e-134, Method: Compositional matrix adjust.
 Identities = 137/215 (64%), Positives = 172/215 (80%), Gaps = 3/215 (1%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG LS KL P+CESMC+CCPALR  SR+PVKRYKKLLA+IFPK+PDG+ N RKI+KLCEY
Sbjct  1    MGFLSAKLLPSCESMCVCCPALRPSSRRPVKRYKKLLAEIFPKTPDGAPNERKIVKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            AAKNP RIPKIAK LE+R +KELRS H   V +I E Y++LL +CKEQMA FA++L+NV+
Sbjct  61   AAKNPLRIPKIAKFLEQRSHKELRSAHVNFVRIITEAYSKLLSICKEQMAYFAISLVNVL  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
             E+L+ +K + +  +GC T   FI SQVD TY  NIE+LV KVC+L+R+ G+E   R LR
Sbjct  121  TELLE-SKQENIHILGCQTLANFINSQVDNTYARNIESLVHKVCALSRQQGQE--HRLLR  177

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNY  789
            A+SL+CLSAM+WFM E S+IFADFDE+VH  L++Y
Sbjct  178  AASLQCLSAMIWFMKEHSYIFADFDEMVHSVLESY  212


 Score =   211 bits (536),  Expect(2) = 7e-134, Method: Compositional matrix adjust.
 Identities = 107/195 (55%), Positives = 139/195 (71%), Gaps = 5/195 (3%)
 Frame = +2

Query  815   DERGEAHHNWVDEVIRSEGRDV---GNE-NRPGYLIRKRPDKKDISLLTSEEIEMPKIWA  982
             DER    HNWVDE+ RSE R     GN+ N     IR RP  ++ S LT +E + P++W+
Sbjct  222   DERHALQHNWVDEIARSECRSGVGGGNDVNINTTTIRLRP-ARNSSALTRDECDSPEVWS  280

Query  983   HICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSGNHQL  1162
             HIC+Q++A+LAKES+TMRR+LDPM  +FD  K W PRHGLA +VLSD++Y  +SSGN QL
Sbjct  281   HICVQKLAELAKESTTMRRILDPMLSYFDMKKQWAPRHGLALLVLSDMAYLEKSSGNEQL  340

Query  1163  ILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKSLQA  1342
             ILT V+RHLDHKNV+ D Q KS +IQTAT+LARQ+RS G   ++    DLC+HLRK+L+A
Sbjct  341   ILTTVIRHLDHKNVSHDPQTKSDIIQTATSLARQLRSRGFAVELVVAGDLCKHLRKTLEA  400

Query  1343  TVDLAGEEINLNLTL  1387
                   E+ NLN +L
Sbjct  401   VESGNVEDQNLNESL  415



>emb|CDX88246.1| BnaA06g28370D [Brassica napus]
Length=963

 Score =   301 bits (772),  Expect(2) = 8e-134, Method: Compositional matrix adjust.
 Identities = 139/216 (64%), Positives = 165/216 (76%), Gaps = 0/216 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG +SR +FPACE + +CCPAL  RS  PVKRYK LL DIFPKSPDG+ N RKI+KLCEY
Sbjct  1    MGFISRTVFPACERVFVCCPALGPRSLHPVKRYKLLLLDIFPKSPDGAPNERKIIKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            AAKNP  IPKIAKCLE+ CYK+LRS   K + ++ E YN +L  CK+QM+ FA++LLNVV
Sbjct  61   AAKNPVHIPKIAKCLEKMCYKDLRSHQMKFIIIVTEAYNSMLFHCKDQMSYFAMSLLNVV  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
             E+L  +K D    +GC T T+FIYSQVDGTYT+++E   +KVCSL RE G+E Q   LR
Sbjct  121  TELLVNSKQDTPTILGCQTLTRFIYSQVDGTYTHSLEKFARKVCSLVREEGDEHQNLGLR  180

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNYE  792
            AS L+CLSAMVWFM EFSHIFA  DEIVH  LDNYE
Sbjct  181  ASGLQCLSAMVWFMGEFSHIFAAVDEIVHAVLDNYE  216


 Score =   205 bits (521),  Expect(2) = 8e-134, Method: Compositional matrix adjust.
 Identities = 95/192 (49%), Positives = 134/192 (70%), Gaps = 9/192 (5%)
 Frame = +2

Query  815   DERGEAHHNWVDEVIRSEGRDVGNENRPGYLIRKRPDKKDISLLTSEEIEMPKIWAHICI  994
             D+  + + NW +EVIR EGR  G        +R +  +KD +LLT EE EMP +WA IC+
Sbjct  226   DKEEQKNCNWGNEVIRCEGRGAG--------VRPKTARKDPALLTKEETEMPNVWAQICL  277

Query  995   QRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSGNHQLILTG  1174
             QRM DL+KES+T+R++LDPMF +F + + W P +GLA +VLSD +Y +E+SG  QL+L+ 
Sbjct  278   QRMVDLSKESTTLRQILDPMFSYFTSRRQWTPPNGLAMIVLSDATYLMETSGTQQLVLSS  337

Query  1175  VVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKSLQATVDL  1354
             VVR+LD+K+VA D ++K++++Q A  LA+ IR+     +I FV DLCRHLRKS QA    
Sbjct  338   VVRYLDNKHVASDPELKAYIVQVAGCLAKLIRTSSYLREISFVKDLCRHLRKSFQAASRS  397

Query  1355  AGE-EINLNLTL  1387
              GE E+NLN+ L
Sbjct  398   IGEKELNLNVML  409



>ref|XP_008646153.1| PREDICTED: uncharacterized protein LOC100384293 isoform X2 [Zea 
mays]
 tpg|DAA45028.1| TPA: hypothetical protein ZEAMMB73_794622 [Zea mays]
Length=982

 Score =   296 bits (759),  Expect(2) = 6e-133, Method: Compositional matrix adjust.
 Identities = 139/215 (65%), Positives = 171/215 (80%), Gaps = 3/215 (1%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG LS KL P+CES+C+CCPALR  SR+PVKRYKKLLA+IFPK+PDG+ N RKI+KLCEY
Sbjct  1    MGFLSAKLLPSCESVCVCCPALRPSSRRPVKRYKKLLAEIFPKTPDGAPNERKIVKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            AAKNP RIPKIAK LE+R +KELRS H   V +I E Y++LL +CKEQMA FA++L+NV+
Sbjct  61   AAKNPLRIPKIAKFLEQRSHKELRSAHVNFVRIITEAYSKLLFICKEQMAYFAISLVNVL  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
             E+L+ +K + V  +GC T   FI SQVD TY  NIE+LV KVC+L+R  GE+   R LR
Sbjct  121  TELLE-SKQENVHILGCQTLANFINSQVDNTYARNIESLVHKVCALSRRQGED--HRLLR  177

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNY  789
            A+SL+CLSAM+WFM E S+IFADFDEIVH  L+NY
Sbjct  178  AASLQCLSAMIWFMKEHSYIFADFDEIVHSVLENY  212


 Score =   207 bits (527),  Expect(2) = 6e-133, Method: Compositional matrix adjust.
 Identities = 105/195 (54%), Positives = 138/195 (71%), Gaps = 5/195 (3%)
 Frame = +2

Query  815   DERGEAHHNWVDEVIRSEGRDV---GNE-NRPGYLIRKRPDKKDISLLTSEEIEMPKIWA  982
             D+R    HNWVDE+ RSEGR     GN+ N     IR RP  ++ S LT +E + P++W+
Sbjct  222   DDRHALQHNWVDEIARSEGRPGVGGGNDVNINTTTIRLRP-ARNSSALTRDERDSPEVWS  280

Query  983   HICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSGNHQL  1162
             HIC+Q++A+LA+ES+TMRR+LDPM  +FD  K W PRHGLA +VLSD++Y  +SSGN QL
Sbjct  281   HICVQKLAELARESTTMRRILDPMLSYFDMKKQWAPRHGLALLVLSDMAYLEKSSGNEQL  340

Query  1163  ILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKSLQA  1342
             ILT ++RHLDHKNV  D Q KS +IQTAT+LARQ+RS G   ++    DLC+HLRK+L+A
Sbjct  341   ILTTIIRHLDHKNVLHDPQTKSDIIQTATSLARQLRSRGFAVELVVAGDLCKHLRKTLEA  400

Query  1343  TVDLAGEEINLNLTL  1387
                   E+ NLN  L
Sbjct  401   VESGNVEDQNLNEPL  415



>ref|XP_009151505.1| PREDICTED: uncharacterized protein LOC103874824 [Brassica rapa]
Length=767

 Score =   299 bits (765),  Expect(2) = 6e-133, Method: Compositional matrix adjust.
 Identities = 138/216 (64%), Positives = 164/216 (76%), Gaps = 0/216 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG +SR +FPACE + +CCPA   RS  PVKRYK LL DIFPKSPDG+ N RKI+KLCEY
Sbjct  1    MGFISRTVFPACERVFVCCPAYGPRSLHPVKRYKLLLLDIFPKSPDGAPNERKIVKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            AAKNP  IPKIAKCLE+ CYK+LRS   K + ++ E YN +L  CK+QM+ FA++LLNVV
Sbjct  61   AAKNPVHIPKIAKCLEKMCYKDLRSHQMKFIIIVTEAYNSMLFHCKDQMSYFAMSLLNVV  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
             E+L  +K D    +GC T T+FIYSQVDGTYT+++E   +KVCSL RE G+E Q   LR
Sbjct  121  TELLVNSKQDTPTILGCQTLTRFIYSQVDGTYTHSLEKFARKVCSLVREEGDEHQNLGLR  180

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNYE  792
            AS L+CLSAMVWFM EFSHIFA  DEIVH  LDNYE
Sbjct  181  ASGLQCLSAMVWFMGEFSHIFAAVDEIVHAVLDNYE  216


 Score =   204 bits (520),  Expect(2) = 6e-133, Method: Compositional matrix adjust.
 Identities = 95/192 (49%), Positives = 134/192 (70%), Gaps = 9/192 (5%)
 Frame = +2

Query  815   DERGEAHHNWVDEVIRSEGRDVGNENRPGYLIRKRPDKKDISLLTSEEIEMPKIWAHICI  994
             D+  + + NW +EVIR EGR  G        +R +  +KD +LLT EE EMP +WA IC+
Sbjct  226   DKEEQKNCNWGNEVIRCEGRGAG--------VRPKTARKDPALLTKEETEMPNVWAQICL  277

Query  995   QRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSGNHQLILTG  1174
             QRM DL+KES+T+R++LDPMF +F + + W P +GLA +VLSD +Y +E+SG  QL+L+ 
Sbjct  278   QRMVDLSKESTTLRQILDPMFSYFTSRRQWTPPNGLAMIVLSDATYLMETSGTQQLVLSS  337

Query  1175  VVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKSLQATVDL  1354
             VVR+LD+K+VA D ++K++++Q A  LA+ IR+     +I FV DLCRHLRKS QA    
Sbjct  338   VVRYLDNKHVASDPELKAYIVQVAGCLAKLIRTSSYLREISFVKDLCRHLRKSFQAASRS  397

Query  1355  AGE-EINLNLTL  1387
              GE E+NLN+ L
Sbjct  398   IGEKELNLNVML  409



>ref|XP_008646145.1| PREDICTED: uncharacterized protein LOC100384293 isoform X1 [Zea 
mays]
Length=983

 Score =   292 bits (747),  Expect(2) = 1e-131, Method: Compositional matrix adjust.
 Identities = 139/216 (64%), Positives = 171/216 (79%), Gaps = 4/216 (2%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG LS KL P+CES+C+CCPALR  SR+PVKRYKKLLA+IFPK+PDG+ N RKI+KLCEY
Sbjct  1    MGFLSAKLLPSCESVCVCCPALRPSSRRPVKRYKKLLAEIFPKTPDGAPNERKIVKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            AAKNP RIPKIAK LE+R +KELRS H   V +I E Y++LL +CKEQMA FA++L+NV+
Sbjct  61   AAKNPLRIPKIAKFLEQRSHKELRSAHVNFVRIITEAYSKLLFICKEQMAYFAISLVNVL  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYS-QVDGTYTYNIENLVQKVCSLARETGEEDQKRCL  681
             E+L+ +K + V  +GC T   FI S QVD TY  NIE+LV KVC+L+R  GE+   R L
Sbjct  121  TELLE-SKQENVHILGCQTLANFINSQQVDNTYARNIESLVHKVCALSRRQGED--HRLL  177

Query  682  RASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNY  789
            RA+SL+CLSAM+WFM E S+IFADFDEIVH  L+NY
Sbjct  178  RAASLQCLSAMIWFMKEHSYIFADFDEIVHSVLENY  213


 Score =   207 bits (527),  Expect(2) = 1e-131, Method: Compositional matrix adjust.
 Identities = 105/195 (54%), Positives = 138/195 (71%), Gaps = 5/195 (3%)
 Frame = +2

Query  815   DERGEAHHNWVDEVIRSEGRDV---GNE-NRPGYLIRKRPDKKDISLLTSEEIEMPKIWA  982
             D+R    HNWVDE+ RSEGR     GN+ N     IR RP  ++ S LT +E + P++W+
Sbjct  223   DDRHALQHNWVDEIARSEGRPGVGGGNDVNINTTTIRLRP-ARNSSALTRDERDSPEVWS  281

Query  983   HICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSGNHQL  1162
             HIC+Q++A+LA+ES+TMRR+LDPM  +FD  K W PRHGLA +VLSD++Y  +SSGN QL
Sbjct  282   HICVQKLAELARESTTMRRILDPMLSYFDMKKQWAPRHGLALLVLSDMAYLEKSSGNEQL  341

Query  1163  ILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKSLQA  1342
             ILT ++RHLDHKNV  D Q KS +IQTAT+LARQ+RS G   ++    DLC+HLRK+L+A
Sbjct  342   ILTTIIRHLDHKNVLHDPQTKSDIIQTATSLARQLRSRGFAVELVVAGDLCKHLRKTLEA  401

Query  1343  TVDLAGEEINLNLTL  1387
                   E+ NLN  L
Sbjct  402   VESGNVEDQNLNEPL  416



>gb|EAZ26671.1| hypothetical protein OsJ_10574 [Oryza sativa Japonica Group]
Length=963

 Score =   236 bits (603),  Expect(2) = 2e-119, Method: Compositional matrix adjust.
 Identities = 117/215 (54%), Positives = 149/215 (69%), Gaps = 28/215 (13%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG +S KLFP+CESMC+CCPALR  SR+PVKRYKKLLA+IFPK+P               
Sbjct  1    MGFMSAKLFPSCESMCVCCPALRPSSRRPVKRYKKLLAEIFPKTP---------------  45

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
                      IAK LE+R +KELRS H   + +I E Y++LL +CKEQMA FA++L+NV+
Sbjct  46   ----------IAKFLEQRSHKELRSAHVNFIKIITEAYSKLLFICKEQMAYFAISLVNVL  95

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
             E+L+ +K + +  +GC T  KFIYSQVD TY  NIE+LV+KVC L+R+ G E     LR
Sbjct  96   TELLE-SKQENIHILGCQTLAKFIYSQVDNTYARNIESLVRKVCVLSRQQGVE--HSLLR  152

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNY  789
            A+SL+CLSAM+WFM E S+IF DFDEIV   L+NY
Sbjct  153  AASLQCLSAMIWFMKEHSYIFVDFDEIVQSVLENY  187


 Score =   222 bits (566),  Expect(2) = 2e-119, Method: Compositional matrix adjust.
 Identities = 113/196 (58%), Positives = 141/196 (72%), Gaps = 5/196 (3%)
 Frame = +2

Query  812   DDERGEAHHNWVDEVIRSEGR---DVGNE-NRPGYLIRKRPDKKDISLLTSEEIEMPKIW  979
             D+ER    HNWVDE++R EGR     GN+ N     IR R   +D S LT EE E P++W
Sbjct  196   DEERHAPQHNWVDEIVRREGRAGLGGGNDVNCNSTAIRLR-SARDSSALTREERESPEVW  254

Query  980   AHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSGNHQ  1159
             AHIC+Q++A+LAKES+TMRR+LDPM  +FD  K W PR GLA +VLSD+SY  +SSGN Q
Sbjct  255   AHICVQKLAELAKESTTMRRILDPMLSYFDKKKQWAPRQGLALLVLSDMSYLEKSSGNEQ  314

Query  1160  LILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKSLQ  1339
             LILT V+RHLDHKNV  D QIKS +IQTAT LARQ+RS G  +++    DLCRHLRK+L+
Sbjct  315   LILTSVIRHLDHKNVLYDPQIKSDMIQTATLLARQLRSRGIAAELVVAGDLCRHLRKTLE  374

Query  1340  ATVDLAGEEINLNLTL  1387
             A    + EE+NLN +L
Sbjct  375   AMESASIEELNLNESL  390



>gb|EMS54754.1| Protein EFR3-like protein A [Triticum urartu]
Length=893

 Score =   232 bits (592),  Expect(2) = 1e-116, Method: Compositional matrix adjust.
 Identities = 115/219 (53%), Positives = 149/219 (68%), Gaps = 28/219 (13%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG +  KLFP+CESMC+CCPALR  SR+PVKRYKKLLA+IFPK+P               
Sbjct  1    MGFMGAKLFPSCESMCVCCPALRPSSRRPVKRYKKLLAEIFPKTP---------------  45

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
                      IAK LE+R  KELR+ H   V +I E Y++LL +CKEQMA FA++L+NV+
Sbjct  46   ----------IAKFLEQRSRKELRAAHLNYVKIITEAYSKLLFICKEQMAYFAISLVNVL  95

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
             ++L+ +K + +  +GC TF +FIYSQVD TY  NIE+L  KVC+L+R+ G E     LR
Sbjct  96   TDLLE-SKQENIHILGCQTFARFIYSQVDNTYARNIESLAHKVCTLSRQQGVEHS--LLR  152

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNYEPDA  801
            A+SL+CLSAM+WFM E S+IFADFDE+V   L+NY  D 
Sbjct  153  AASLQCLSAMIWFMKEHSYIFADFDEMVQSVLENYRMDG  191


 Score =   217 bits (552),  Expect(2) = 1e-116, Method: Compositional matrix adjust.
 Identities = 107/197 (54%), Positives = 141/197 (72%), Gaps = 6/197 (3%)
 Frame = +2

Query  812   DDERGEAHHNWVDEVIRSEGR-DVGNENRPGYL----IRKRPDKKDISLLTSEEIEMPKI  976
             DD+R  + HNWVDE++R EGR  +G  N   +      R R   +D S LT EE E P++
Sbjct  196   DDDRHASQHNWVDEIVRREGRAGLGGGNDVNFCSATTTRLR-SARDSSALTREERESPEV  254

Query  977   WAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSGNH  1156
             W+HIC+Q++A+LAKES+TMRR+LDPMF +FD  K W PRHGLA +VLSD+SY  +SSGN 
Sbjct  255   WSHICVQKLAELAKESTTMRRILDPMFSYFDMKKQWAPRHGLALLVLSDMSYLEKSSGNE  314

Query  1157  QLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKSL  1336
             QLILT V+RHLDHKN+    Q KS +IQTAT+LARQ+RS G   ++    DLCRHLRK+L
Sbjct  315   QLILTAVIRHLDHKNILHCPQTKSDIIQTATSLARQLRSRGVAPELAVTGDLCRHLRKTL  374

Query  1337  QATVDLAGEEINLNLTL  1387
             +A    + +E++LN +L
Sbjct  375   EAMESASVQELSLNESL  391



>gb|EMT28557.1| Protein EFR3-like protein [Aegilops tauschii]
Length=881

 Score =   231 bits (590),  Expect(2) = 2e-115, Method: Compositional matrix adjust.
 Identities = 115/219 (53%), Positives = 149/219 (68%), Gaps = 28/219 (13%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG +  KLFP+CESMC+CCPALR  SR+PVKRYKKLLA+IFPK+P               
Sbjct  1    MGFMGAKLFPSCESMCVCCPALRPSSRRPVKRYKKLLAEIFPKTP---------------  45

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
                      IAK LE+R  KELR+ H   V +I E Y++LL +CKEQMA FA++L+NV+
Sbjct  46   ----------IAKFLEQRSRKELRAAHLNYVKIITEAYSKLLFICKEQMAYFAISLVNVL  95

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
             ++L+ +K + +  +GC T  +FIYSQVD TY  NIE+LV KVC+L+R+ G E     LR
Sbjct  96   TDLLE-SKQENIHILGCQTLARFIYSQVDNTYARNIESLVHKVCTLSRQQGVE--HSLLR  152

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNYEPDA  801
            A+SL+CLSAM+WFM E S+IFADFDE+V   L+NY  D 
Sbjct  153  AASLQCLSAMIWFMKEHSYIFADFDEMVQSVLENYRMDG  191


 Score =   214 bits (544),  Expect(2) = 2e-115, Method: Compositional matrix adjust.
 Identities = 106/196 (54%), Positives = 139/196 (71%), Gaps = 4/196 (2%)
 Frame = +2

Query  812   DDERGEAHHNWVDEVIRSEGR---DVGNE-NRPGYLIRKRPDKKDISLLTSEEIEMPKIW  979
             DD+R  + HNWVDE++R EGR     GN+ N  G    +    +D S LT EE E P++W
Sbjct  196   DDDRHASQHNWVDEIVRREGRAGLGGGNDVNFCGATTTRLRSARDSSALTREERESPEVW  255

Query  980   AHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSGNHQ  1159
             +HIC+Q++ +LAKES+TMRR+LDPMF +FD  K W PRHGLA +VLSD+SY  +SSGN Q
Sbjct  256   SHICVQKLVELAKESTTMRRILDPMFSYFDMKKQWAPRHGLALLVLSDMSYPEKSSGNEQ  315

Query  1160  LILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKSLQ  1339
             LILT V+RHLDHKN+    Q KS +IQTAT+LARQ+RS G   ++    DLCRHLRK+L+
Sbjct  316   LILTTVIRHLDHKNILHCPQTKSDIIQTATSLARQLRSRGVSPELAVAGDLCRHLRKTLE  375

Query  1340  ATVDLAGEEINLNLTL  1387
             A    +  E++LN +L
Sbjct  376   AMESASVAELSLNESL  391



>ref|XP_008778937.1| PREDICTED: protein EFR3 homolog cmp44E-like [Phoenix dactylifera]
Length=352

 Score =   305 bits (782),  Expect(2) = 9e-112, Method: Compositional matrix adjust.
 Identities = 144/220 (65%), Positives = 176/220 (80%), Gaps = 1/220 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG +SRK+ PAC +MC+CCPALR  SR+PVKRYKKLLA+IFPK+ DG+ N RKIMKLCEY
Sbjct  1    MGFMSRKILPACGNMCVCCPALRPSSRRPVKRYKKLLAEIFPKNLDGTPNERKIMKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            AAKNP RIPKIAK LE+R YKELRS H   V +I EVY++LL +CKEQMA FA++LLNV+
Sbjct  61   AAKNPLRIPKIAKFLEQRSYKELRSEHINFVKIITEVYSKLLYICKEQMAYFAISLLNVI  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
            +E+LD  + D+V+ +GC T TKFI SQ D TY  NIE LV+KVC LA   GEE QK  L+
Sbjct  121  IELLDNKQRDSVQILGCQTLTKFICSQADSTYARNIECLVRKVCVLAYRQGEE-QKSLLQ  179

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNYEPDAH  804
            A+SL+CLSAM+WFM E+S+IF DFDEI+H  L+NY+ D H
Sbjct  180  AASLQCLSAMIWFMTEYSYIFTDFDEIIHAILENYQADDH  219


 Score =   127 bits (320),  Expect(2) = 9e-112, Method: Compositional matrix adjust.
 Identities = 60/121 (50%), Positives = 85/121 (70%), Gaps = 4/121 (3%)
 Frame = +2

Query  803   INEDDERGEAHHNWVDEVIRSEGR---DVGNE-NRPGYLIRKRPDKKDISLLTSEEIEMP  970
             I+ D+ER ++HHNWVDEV+RSE R    +G + N     +R     +D ++LT EE E P
Sbjct  220   IDIDNERSDSHHNWVDEVVRSEARAGVTLGKDVNLSTTSLRPHSVPRDSAMLTREERESP  279

Query  971   KIWAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSG  1150
             ++W+ IC++++A++AKES+TMR VLDPM  +FD  KHW  RHGLA  VLSD++Y  +SS 
Sbjct  280   EVWSQICVRKLAEMAKESTTMRCVLDPMLAYFDTGKHWASRHGLALFVLSDMTYSEKSSD  339

Query  1151  N  1153
             N
Sbjct  340   N  340



>ref|XP_006287016.1| hypothetical protein CARUB_v10000164mg [Capsella rubella]
 gb|EOA19914.1| hypothetical protein CARUB_v10000164mg [Capsella rubella]
Length=925

 Score =   227 bits (579),  Expect(2) = 1e-108, Method: Compositional matrix adjust.
 Identities = 107/201 (53%), Positives = 146/201 (73%), Gaps = 2/201 (1%)
 Frame = +2

Query  791   SQMPINEDDERGEAHHNWVDEVIRSEGRDVGNENRPGYLI-RKRPDKKDISLLTSEEIEM  967
             + M +  +++R E + NWV+EVIR EGR     N P Y+I R R  +KD +LLT EE EM
Sbjct  130   ADMIVQTNEDREEQNSNWVNEVIRCEGRGTAVCNSPSYMIVRPRTARKDPTLLTKEETEM  189

Query  968   PKIWAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESS  1147
             PK+WA IC+QRM DLAKES+T+R++LDPMF +F+  + W P +GLA +VLSD  Y +E+S
Sbjct  190   PKVWAQICLQRMVDLAKESTTLRQILDPMFSYFNIRRQWTPPNGLALIVLSDAVYLMETS  249

Query  1148  GNHQLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLR  1327
             G+ QL+L+ VVRHLD+K+VA D ++K+++IQ A  LA+ IR+     DI FV+DLCRHLR
Sbjct  250   GSQQLVLSTVVRHLDNKHVANDPELKAYIIQVAGCLAKLIRTSSYLRDISFVNDLCRHLR  309

Query  1328  KSLQATVDLAG-EEINLNLTL  1387
             KS QAT    G E++NLN+ L
Sbjct  310   KSFQATARSIGDEDLNLNVML  330


 Score =   195 bits (495),  Expect(2) = 1e-108, Method: Compositional matrix adjust.
 Identities = 89/130 (68%), Positives = 102/130 (78%), Gaps = 0/130 (0%)
 Frame = +1

Query  409  KLVNVIAEVYNELLCMCKEQMACFAVNLLNVVVEMLDCAKTDAVKTIGCLTFTKFIYSQV  588
            K +N++ E YN++LC CK+QMA FA +LLNVV E+LD  K DA   +GC T T+FIYSQV
Sbjct  2    KFINIVTEAYNKMLCHCKDQMAYFATSLLNVVTELLDNPKQDAPTILGCQTLTRFIYSQV  61

Query  589  DGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRCLSAMVWFMAEFSHIFADFDEIV  768
            DGTYT++IE    KVCSLARE GEE QK CLRAS L+CLSAMVWFM EFSHIFA  DEIV
Sbjct  62   DGTYTHSIEKFALKVCSLAREEGEEHQKLCLRASGLQCLSAMVWFMGEFSHIFAAIDEIV  121

Query  769  HVTLDNYEPD  798
            H TLDNYE D
Sbjct  122  HATLDNYEAD  131



>dbj|BAH57285.1| AT5G26850 [Arabidopsis thaliana]
Length=896

 Score =   228 bits (580),  Expect(2) = 6e-108, Method: Compositional matrix adjust.
 Identities = 107/199 (54%), Positives = 146/199 (73%), Gaps = 2/199 (1%)
 Frame = +2

Query  797   MPINEDDERGEAHHNWVDEVIRSEGRDVGNENRPGYLI-RKRPDKKDISLLTSEEIEMPK  973
             M +  +++R E + NWV+EVIR EGR     N P Y+I R R  +KD +LLT EE EMPK
Sbjct  132   MIVQTNEDREEQNCNWVNEVIRCEGRGTTICNSPSYMIVRPRTARKDPTLLTKEETEMPK  191

Query  974   IWAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSGN  1153
             +WA IC+QRM DLAKES+T+R++LDPMF +F++ + W P +GLA +VLSD  Y +E+SG+
Sbjct  192   VWAQICLQRMVDLAKESTTLRQILDPMFSYFNSRRQWTPPNGLAMIVLSDAVYLMETSGS  251

Query  1154  HQLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKS  1333
              QL+L+ VVRHLD+K+VA D ++K+++IQ A  LA+ IR+     DI FV+DLCRHLRKS
Sbjct  252   QQLVLSTVVRHLDNKHVANDPELKAYIIQVAGCLAKLIRTSSYLRDISFVNDLCRHLRKS  311

Query  1334  LQATVDLAG-EEINLNLTL  1387
              QAT    G EE+NLN+ +
Sbjct  312   FQATARSIGDEELNLNVMI  330


 Score =   192 bits (489),  Expect(2) = 6e-108, Method: Compositional matrix adjust.
 Identities = 86/130 (66%), Positives = 102/130 (78%), Gaps = 0/130 (0%)
 Frame = +1

Query  409  KLVNVIAEVYNELLCMCKEQMACFAVNLLNVVVEMLDCAKTDAVKTIGCLTFTKFIYSQV  588
            K +N++ E YN++LC CK+QMA FA +LLNVV E+LD +K D    +GC T T+FIYSQV
Sbjct  2    KFINIVTEAYNKMLCHCKDQMAYFATSLLNVVTELLDNSKQDTPTILGCQTLTRFIYSQV  61

Query  589  DGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRCLSAMVWFMAEFSHIFADFDEIV  768
            DGTYT++IE    KVCSLARE GEE QK+CLRAS L+CLSAMVW+M EFSHIFA  DEIV
Sbjct  62   DGTYTHSIEKFALKVCSLAREEGEEHQKQCLRASGLQCLSAMVWYMGEFSHIFATVDEIV  121

Query  769  HVTLDNYEPD  798
            H  LDNYE D
Sbjct  122  HAILDNYEAD  131



>ref|XP_006838291.1| PREDICTED: uncharacterized protein LOC18428932 [Amborella trichopoda]
 gb|ERN00860.1| hypothetical protein AMTR_s00103p00108190 [Amborella trichopoda]
Length=1044

 Score =   265 bits (676),  Expect(2) = 5e-100, Method: Compositional matrix adjust.
 Identities = 122/215 (57%), Positives = 159/215 (74%), Gaps = 0/215 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG++SRK+ PAC  +C  CP+LR+RSRQPVKRYKKLLADIFPKS D   N RKI KLCEY
Sbjct  1    MGIMSRKVLPACGRLCFFCPSLRARSRQPVKRYKKLLADIFPKSQDEEPNDRKIGKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            A+KNP R+PKIA  LE+RCYKELR  H     V+  +Y +LL  CKEQM   A +LL+V+
Sbjct  61   ASKNPLRVPKIADYLEQRCYKELRIEHFGFAKVVMCIYRKLLFSCKEQMPLLASSLLSVI  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
              +LD  + D ++ +GC T   F+ +Q+DGTY +N+E+ V K+C LA+E GE+D+   LR
Sbjct  121  RTLLDQTRQDDMRVLGCQTLVDFVNNQMDGTYMFNLESFVPKLCQLAQEMGEDDRGCILR  180

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNY  789
            +  L+ LS+MVWFM E+SHI A+FDE+V VTL+NY
Sbjct  181  SFGLQALSSMVWFMGEYSHISAEFDEVVSVTLENY  215


 Score =   129 bits (324),  Expect(2) = 5e-100, Method: Compositional matrix adjust.
 Identities = 72/191 (38%), Positives = 117/191 (61%), Gaps = 7/191 (4%)
 Frame = +2

Query  815   DERGEAHHNWVDEVIRSEG--RDVGNENRPGYLIRKRPDKKDISLLTSEEIEMPKIWAHI  988
             +++G  +H WV EV + EG    +    R     +   DK ++++ T+EE + P  W+ +
Sbjct  228   EKQGSKNH-WVQEVRKVEGLVSPMPVATRVASWKKIVNDKGEVNV-TTEEAKSPMFWSRV  285

Query  989   CIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSG-NHQLI  1165
             C+  MA LAKE++T+RRVL+ +F +FDN  HW P HGLA  VL D+   +E+SG N  L+
Sbjct  286   CLHNMAKLAKEATTVRRVLESLFRYFDNGNHWSPEHGLAVSVLLDMQSLMEASGQNIHLL  345

Query  1166  LTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKSLQAT  1345
             L+ +++HLDHK+V     ++  +++  T LA   +     + IG +SDL RHLRKS+  +
Sbjct  346   LSILIKHLDHKSVIKQPGMQLKIVEVTTILAEHSKVQTSVAIIGAISDLMRHLRKSIHCS  405

Query  1346  VDLA--GEEIN  1372
             ++ A  G++IN
Sbjct  406   IEAANLGDDIN  416



>ref|XP_008798151.1| PREDICTED: uncharacterized protein LOC103713119 [Phoenix dactylifera]
Length=1043

 Score =   267 bits (682),  Expect(2) = 3e-98, Method: Compositional matrix adjust.
 Identities = 118/215 (55%), Positives = 161/215 (75%), Gaps = 0/215 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG++SRK+ PAC  +C  CPALR+RSRQPVKRYKKLL +IFP++ D   N RKI KLCEY
Sbjct  1    MGVMSRKVLPACGRLCFFCPALRARSRQPVKRYKKLLVEIFPRTQDEEPNDRKIGKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            A++NP RIPKI   LE+RCY+ELR+ H     +I  +Y++LL  C+EQM  FA +LL+VV
Sbjct  61   ASRNPLRIPKITSYLEQRCYRELRNEHFSFAKIIMCIYHKLLLTCREQMPLFATSLLSVV  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
              +LD  + D ++ IGC T   F+ SQVDGTY +N+E L+ ++C LA+E GE+++ + LR
Sbjct  121  HTLLDQTRQDEMQIIGCQTLFDFVNSQVDGTYQFNLEGLIPRLCHLAQEVGEDERAQHLR  180

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNY  789
            A++L+ LS+MVWFM EFSHI A+FD +V + L+NY
Sbjct  181  AAALQALSSMVWFMGEFSHISAEFDNVVTIVLENY  215


 Score =   121 bits (303),  Expect(2) = 3e-98, Method: Compositional matrix adjust.
 Identities = 65/194 (34%), Positives = 114/194 (59%), Gaps = 14/194 (7%)
 Frame = +2

Query  827   EAHHNWVDEVIRSEGRDVGNENRPGYLIRKRPDKKDIS------LLTSEEIEMPKIWAHI  988
             ++   WV EV+++EG    + +   +++ + P  + I        LT +E + P  W+ +
Sbjct  231   DSQSRWVQEVLKAEG----HVDPSPFVMSRVPSWRSIFNEKGELCLTKDEAQNPNFWSRV  286

Query  989   CIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSG-NHQLI  1165
             C+  MA LAKE++T+RRVL+ +F +FD+N  W  ++GLA VVL D+   +E +G N  L+
Sbjct  287   CVHNMAKLAKEATTVRRVLESLFRYFDSNNSWSSQNGLALVVLMDMQLLMEKTGQNTHLL  346

Query  1166  LTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKSLQAT  1345
             ++ +V+HL+HK V     ++  +++   +LA Q ++    + IG +SDL RHLRK++  T
Sbjct  347   ISIMVKHLEHKAVLKQPDLQLNIVEVTASLAGQSKAQASVAIIGAISDLVRHLRKTMHCT  406

Query  1346  V---DLAGEEINLN  1378
             +   DL  + I  N
Sbjct  407   LGSQDLGDDMIRWN  420



>ref|XP_008784320.1| PREDICTED: uncharacterized protein LOC103703292 isoform X2 [Phoenix 
dactylifera]
Length=1034

 Score =   263 bits (672),  Expect(2) = 1e-97, Method: Compositional matrix adjust.
 Identities = 119/216 (55%), Positives = 157/216 (73%), Gaps = 0/216 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG++SRK+ PAC S+C  CP+LR+RSRQPVKRYKKLL+DIFP+S D   N RKI KLCEY
Sbjct  1    MGVMSRKVLPACGSLCFFCPSLRARSRQPVKRYKKLLSDIFPRSQDEEPNDRKIGKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            A+KNP RIPKI   LE+RCYKELR  H   V ++  +Y +LL  CKEQM  FA +LL ++
Sbjct  61   ASKNPLRIPKITNYLEQRCYKELRIEHFGSVKIVMCIYRKLLISCKEQMPLFASSLLTII  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
              +LD  + + ++ IGC TF  F+  Q D TY +N+E ++ K+C LA+E GE+++   LR
Sbjct  121  RTLLDQTRQEEMRIIGCNTFFDFVNGQRDSTYMFNLEGIIPKLCHLAQEMGEDERAHNLR  180

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNYE  792
            A+ LR LS+MVWFM E+SHI  +FD +V V L+NYE
Sbjct  181  AAGLRALSSMVWFMGEYSHISTEFDNVVSVALENYE  216


 Score =   122 bits (307),  Expect(2) = 1e-97, Method: Compositional matrix adjust.
 Identities = 73/193 (38%), Positives = 114/193 (59%), Gaps = 9/193 (5%)
 Frame = +2

Query  812   DDERGEAHHNWVDEVIRSEGRDVGNENRPGYLIRKRPDKKDISLLTSEEIEMPKIWAHIC  991
             DD+R  + + WV EV  +E         P  + R   D+ +++L T EE + P  W+ +C
Sbjct  227   DDDRI-SQNRWVQEVHNAEAH---VSPFPVSMTRIVNDRGELNL-TLEEDKSPSFWSRVC  281

Query  992   IQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSG-NHQLIL  1168
             +  MA LAKE++T+RR+L+ +F +FDN   W PR  LA  VL D+   +E+SG N  L+L
Sbjct  282   VHNMAKLAKEATTVRRILESLFRYFDNCNLWSPRSRLALCVLLDMQIVMENSGQNTHLLL  341

Query  1169  TGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKSLQAT-  1345
             + +V+HL+HK V+    ++  +I+  T LA Q ++    + IG +SDL RHLR+S+Q T 
Sbjct  342   SMLVKHLEHKTVSKQPDMQLDIIEITTCLAVQSKAQSSVAIIGAISDLLRHLRRSMQCTL  401

Query  1346  --VDLAGEEINLN  1378
               +DL  + I  N
Sbjct  402   SNLDLGDDMIKWN  414



>ref|XP_008784316.1| PREDICTED: protein EFR3 homolog isoform X1 [Phoenix dactylifera]
 ref|XP_008784317.1| PREDICTED: protein EFR3 homolog isoform X1 [Phoenix dactylifera]
 ref|XP_008784318.1| PREDICTED: protein EFR3 homolog isoform X1 [Phoenix dactylifera]
 ref|XP_008784319.1| PREDICTED: protein EFR3 homolog isoform X1 [Phoenix dactylifera]
Length=1058

 Score =   263 bits (672),  Expect(2) = 1e-97, Method: Compositional matrix adjust.
 Identities = 119/216 (55%), Positives = 157/216 (73%), Gaps = 0/216 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG++SRK+ PAC S+C  CP+LR+RSRQPVKRYKKLL+DIFP+S D   N RKI KLCEY
Sbjct  1    MGVMSRKVLPACGSLCFFCPSLRARSRQPVKRYKKLLSDIFPRSQDEEPNDRKIGKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            A+KNP RIPKI   LE+RCYKELR  H   V ++  +Y +LL  CKEQM  FA +LL ++
Sbjct  61   ASKNPLRIPKITNYLEQRCYKELRIEHFGSVKIVMCIYRKLLISCKEQMPLFASSLLTII  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
              +LD  + + ++ IGC TF  F+  Q D TY +N+E ++ K+C LA+E GE+++   LR
Sbjct  121  RTLLDQTRQEEMRIIGCNTFFDFVNGQRDSTYMFNLEGIIPKLCHLAQEMGEDERAHNLR  180

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNYE  792
            A+ LR LS+MVWFM E+SHI  +FD +V V L+NYE
Sbjct  181  AAGLRALSSMVWFMGEYSHISTEFDNVVSVALENYE  216


 Score =   122 bits (307),  Expect(2) = 1e-97, Method: Compositional matrix adjust.
 Identities = 73/193 (38%), Positives = 114/193 (59%), Gaps = 9/193 (5%)
 Frame = +2

Query  812   DDERGEAHHNWVDEVIRSEGRDVGNENRPGYLIRKRPDKKDISLLTSEEIEMPKIWAHIC  991
             DD+R  + + WV EV  +E         P  + R   D+ +++L T EE + P  W+ +C
Sbjct  227   DDDRI-SQNRWVQEVHNAEAH---VSPFPVSMTRIVNDRGELNL-TLEEDKSPSFWSRVC  281

Query  992   IQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSG-NHQLIL  1168
             +  MA LAKE++T+RR+L+ +F +FDN   W PR  LA  VL D+   +E+SG N  L+L
Sbjct  282   VHNMAKLAKEATTVRRILESLFRYFDNCNLWSPRSRLALCVLLDMQIVMENSGQNTHLLL  341

Query  1169  TGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKSLQAT-  1345
             + +V+HL+HK V+    ++  +I+  T LA Q ++    + IG +SDL RHLR+S+Q T 
Sbjct  342   SMLVKHLEHKTVSKQPDMQLDIIEITTCLAVQSKAQSSVAIIGAISDLLRHLRRSMQCTL  401

Query  1346  --VDLAGEEINLN  1378
               +DL  + I  N
Sbjct  402   SNLDLGDDMIKWN  414



>ref|XP_008784321.1| PREDICTED: uncharacterized protein LOC103703292 isoform X3 [Phoenix 
dactylifera]
Length=1028

 Score =   263 bits (672),  Expect(2) = 1e-97, Method: Compositional matrix adjust.
 Identities = 119/216 (55%), Positives = 157/216 (73%), Gaps = 0/216 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG++SRK+ PAC S+C  CP+LR+RSRQPVKRYKKLL+DIFP+S D   N RKI KLCEY
Sbjct  1    MGVMSRKVLPACGSLCFFCPSLRARSRQPVKRYKKLLSDIFPRSQDEEPNDRKIGKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            A+KNP RIPKI   LE+RCYKELR  H   V ++  +Y +LL  CKEQM  FA +LL ++
Sbjct  61   ASKNPLRIPKITNYLEQRCYKELRIEHFGSVKIVMCIYRKLLISCKEQMPLFASSLLTII  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
              +LD  + + ++ IGC TF  F+  Q D TY +N+E ++ K+C LA+E GE+++   LR
Sbjct  121  RTLLDQTRQEEMRIIGCNTFFDFVNGQRDSTYMFNLEGIIPKLCHLAQEMGEDERAHNLR  180

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNYE  792
            A+ LR LS+MVWFM E+SHI  +FD +V V L+NYE
Sbjct  181  AAGLRALSSMVWFMGEYSHISTEFDNVVSVALENYE  216


 Score =   122 bits (307),  Expect(2) = 1e-97, Method: Compositional matrix adjust.
 Identities = 73/193 (38%), Positives = 114/193 (59%), Gaps = 9/193 (5%)
 Frame = +2

Query  812   DDERGEAHHNWVDEVIRSEGRDVGNENRPGYLIRKRPDKKDISLLTSEEIEMPKIWAHIC  991
             DD+R  + + WV EV  +E         P  + R   D+ +++L T EE + P  W+ +C
Sbjct  227   DDDRI-SQNRWVQEVHNAEAH---VSPFPVSMTRIVNDRGELNL-TLEEDKSPSFWSRVC  281

Query  992   IQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSG-NHQLIL  1168
             +  MA LAKE++T+RR+L+ +F +FDN   W PR  LA  VL D+   +E+SG N  L+L
Sbjct  282   VHNMAKLAKEATTVRRILESLFRYFDNCNLWSPRSRLALCVLLDMQIVMENSGQNTHLLL  341

Query  1169  TGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKSLQAT-  1345
             + +V+HL+HK V+    ++  +I+  T LA Q ++    + IG +SDL RHLR+S+Q T 
Sbjct  342   SMLVKHLEHKTVSKQPDMQLDIIEITTCLAVQSKAQSSVAIIGAISDLLRHLRRSMQCTL  401

Query  1346  --VDLAGEEINLN  1378
               +DL  + I  N
Sbjct  402   SNLDLGDDMIKWN  414



>ref|XP_009405043.1| PREDICTED: uncharacterized protein LOC103988214 [Musa acuminata 
subsp. malaccensis]
Length=1022

 Score =   264 bits (674),  Expect(2) = 8e-96, Method: Compositional matrix adjust.
 Identities = 119/215 (55%), Positives = 158/215 (73%), Gaps = 0/215 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG++SRK+ PAC ++C  CP+LR+RSRQPVKRYKKLLADIFP S D   N RKI KLCEY
Sbjct  1    MGVMSRKVLPACGNLCFFCPSLRARSRQPVKRYKKLLADIFPHSQDEEPNDRKIGKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
             ++NP RIPKI   LE+RCY+ELR+ H   V V+  +Y +LL  C+EQM  FA +LL+++
Sbjct  61   TSRNPLRIPKITNYLEQRCYRELRNEHFGYVKVVMRIYWKLLIACREQMPLFASSLLSII  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
              + D ++ D ++ IGC T   F+ SQVDGTY +N+E L+ ++CSLA+E GE++    LR
Sbjct  121  HTLFDQSRHDEMQIIGCHTLFDFVNSQVDGTYQFNLEGLIPRLCSLAQEMGEDENACYLR  180

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNY  789
            A+ L+ LS++VWFM EFSHI A+FD IV   LDNY
Sbjct  181  AAGLQALSSLVWFMGEFSHISAEFDSIVSAVLDNY  215


 Score =   116 bits (290),  Expect(2) = 8e-96, Method: Compositional matrix adjust.
 Identities = 62/190 (33%), Positives = 110/190 (58%), Gaps = 13/190 (7%)
 Frame = +2

Query  806   NEDDERGE--AHHNWVDEVIRSEGRDVGNENRPGYLIRKRPDKKDISL------LTSEEI  961
             +E+ ++ E      WV EV+++EG    + +   +++ + P  K I        LT++E 
Sbjct  222   SENGQQSEEGTQSRWVQEVLKTEG----HVSPSPFVMARVPSWKSIVNDRGELNLTTDET  277

Query  962   EMPKIWAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVE  1141
               P  W+ +C+  MA LAKE++T+RR+L+ +F +FDNN  W  ++GLA  +L D+   +E
Sbjct  278   RNPYFWSRVCVHNMAKLAKEATTVRRILESLFRYFDNNSSWSRQNGLARYILLDMQLLME  337

Query  1142  SSG-NHQLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCR  1318
              +G N  L+++ +V+HL+HK V     I+  +++    LA Q ++    + IG +SD+ +
Sbjct  338   KAGQNTHLLISILVKHLEHKAVLKQPDIQLSIVEVTACLAEQSKAQASVAIIGAISDMVK  397

Query  1319  HLRKSLQATV  1348
             HLRKSL   +
Sbjct  398   HLRKSLHCAL  407



>ref|XP_011048039.1| PREDICTED: uncharacterized protein LOC105142218 [Populus euphratica]
Length=1022

 Score =   247 bits (631),  Expect(2) = 1e-95, Method: Compositional matrix adjust.
 Identities = 108/214 (50%), Positives = 154/214 (72%), Gaps = 0/214 (0%)
 Frame = +1

Query  148  GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  327
            G++SR++ PAC S+C  CPA+R+RSRQPVKRYKKL+ADIFP++ +   N RKI KLCEYA
Sbjct  6    GVISRQVMPACGSLCFFCPAMRARSRQPVKRYKKLIADIFPRNQEEGPNDRKIGKLCEYA  65

Query  328  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  507
            AKNP RIPKI   LE+RCYKELR  + +   ++  +Y +LL  CKEQM  FA +LL+++ 
Sbjct  66   AKNPLRIPKITSSLEQRCYKELRIENFQSAKIVMCIYRKLLITCKEQMPLFASSLLSIIS  125

Query  508  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRA  687
             +LD  + D ++ IGC T   F+ +Q DGT+ +N+E  + K+C   +E G+++ ++ LRA
Sbjct  126  TLLDQTRQDDIQVIGCETLFDFVNNQNDGTFMFNLEGFIPKLCQFTQEEGKDESEKSLRA  185

Query  688  SSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNY  789
            + L+ LS+M+WFM + SHI  +FD IV V L+NY
Sbjct  186  AGLQALSSMIWFMGQHSHISVEFDNIVSVVLENY  219


 Score =   132 bits (331),  Expect(2) = 1e-95, Method: Compositional matrix adjust.
 Identities = 72/197 (37%), Positives = 116/197 (59%), Gaps = 13/197 (7%)
 Frame = +2

Query  806   NEDDERGEAHHNWVDEVIRSEGRDVGNENRPGYLIRKRPDKKDISL------LTSEEIEM  967
             N D ++  A + WV EV+++EG           +I + P  + I        +T+EE   
Sbjct  228   NLDTDKPGAQNRWVQEVLKNEGHATPLPE----VITRVPSWRTIVNERGEVNMTAEEARS  283

Query  968   PKIWAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESS  1147
             P  W+ +C+  MA L KE++T+RRVL+ +F +FDN   W P +GLAF VL D+ + +++S
Sbjct  284   PCFWSRVCLHNMAKLGKEATTIRRVLESLFRYFDNGNLWSPENGLAFPVLKDMQFLMDNS  343

Query  1148  G-NHQLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHL  1324
             G N  ++L+ +++HLDHKNV  +  ++  +++  TALA   +     + IG VSD+ RHL
Sbjct  344   GQNTHVLLSILIKHLDHKNVLKEPSMQLDIVEVTTALAEHAKVNPSLAIIGAVSDVMRHL  403

Query  1325  RKSLQATVDLA--GEEI  1369
             RKS+  ++D A  G EI
Sbjct  404   RKSIHCSLDDANLGAEI  420



>ref|XP_009401306.1| PREDICTED: uncharacterized protein LOC103985362 [Musa acuminata 
subsp. malaccensis]
Length=1028

 Score =   259 bits (662),  Expect(2) = 2e-95, Method: Compositional matrix adjust.
 Identities = 115/215 (53%), Positives = 158/215 (73%), Gaps = 0/215 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG++SRK+ PAC ++C  CP+LR RSRQPVKRYKKLLADIFP++ D   N RKI KLCEY
Sbjct  1    MGVMSRKVVPACGALCFLCPSLRERSRQPVKRYKKLLADIFPRAQDEEPNDRKIGKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            A++NP RIPKI   LE+RCYKE+R+     V V+  +Y +LL  C+EQM  FA +LL+++
Sbjct  61   ASRNPLRIPKITTYLEQRCYKEMRNERFGSVKVVMCIYRKLLIACREQMPLFASSLLSII  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
              + D  + D ++ IGC T   F+ SQVDGTY +N+E++V ++CSLA+E GE++    LR
Sbjct  121  HTLFDQTRHDEMQIIGCYTLFDFVNSQVDGTYQFNLESMVPRLCSLAQEVGEDENAGSLR  180

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNY  789
            A+ L+ LS+++WFM EFSHI ++FD IV   L+NY
Sbjct  181  AAGLQALSSLIWFMGEFSHISSEFDSIVSAVLENY  215


 Score =   119 bits (298),  Expect(2) = 2e-95, Method: Compositional matrix adjust.
 Identities = 64/190 (34%), Positives = 110/190 (58%), Gaps = 13/190 (7%)
 Frame = +2

Query  806   NEDDERGE--AHHNWVDEVIRSEGRDVGNENRPGYLIRKRPDKKDISL------LTSEEI  961
             +ED ++ E      WV+EV+++EG    +     ++I + P  K I        LT++E 
Sbjct  222   SEDGQQSEQVTQSRWVEEVLKTEGHVTPSP----FVITRVPSWKSIVNDRGELNLTTDET  277

Query  962   EMPKIWAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVE  1141
             + P  W+ +C+  MA LAKE++T+RRVL+ +F +FDNN  W   + LA  VL D+   +E
Sbjct  278   KNPNFWSRVCVHNMAKLAKEATTVRRVLESLFRYFDNNSSWSVENSLARYVLLDMQLLME  337

Query  1142  SSG-NHQLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCR  1318
              +G N  L+++ +V+HL+HK V     I+  +++   +LA Q ++    + IG ++DL +
Sbjct  338   KAGQNTHLLISILVKHLEHKAVLKQPDIQLNIVEVTASLAEQSKAQASVAIIGAITDLVK  397

Query  1319  HLRKSLQATV  1348
             HLRKS+   +
Sbjct  398   HLRKSMHCAL  407



>ref|XP_010257179.1| PREDICTED: uncharacterized protein LOC104597386 isoform X1 [Nelumbo 
nucifera]
Length=1026

 Score =   257 bits (656),  Expect(2) = 2e-95, Method: Compositional matrix adjust.
 Identities = 115/215 (53%), Positives = 158/215 (73%), Gaps = 0/215 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG++SRK+ P C+ +C  CP++R+RSRQPVKRYKKL+ADIFP+S D   N RKI KLCEY
Sbjct  1    MGVMSRKVLPICDGLCFLCPSMRTRSRQPVKRYKKLIADIFPRSQDEEPNDRKIGKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            A+KNP RIPKIA  LE+RCYKELR+   +L  V+  +Y +LL  CK+QM  FA +LL+++
Sbjct  61   ASKNPLRIPKIANSLEQRCYKELRNEQFRLAKVVMCIYRKLLISCKDQMPLFASSLLSII  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
              +LD  +   ++ IGC T   F+ SQ+DGTY +N+E L+ K+C  A+E G+++    LR
Sbjct  121  NTLLDQTRQYEMRVIGCQTLFDFVNSQMDGTYMFNLEGLIPKICQTAQEIGDDEGTCQLR  180

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNY  789
            A+ L+ LS+MVWFM E+SHI ++FD +V V LDNY
Sbjct  181  AAGLQALSSMVWFMGEYSHISSEFDIVVSVVLDNY  215


 Score =   121 bits (304),  Expect(2) = 2e-95, Method: Compositional matrix adjust.
 Identities = 67/185 (36%), Positives = 106/185 (57%), Gaps = 12/185 (6%)
 Frame = +2

Query  818   ERGEAHHNWVDEVIRSEGRDVGNENRPGYLIRKRPDKKDISL------LTSEEIEMPKIW  979
             +R E  + WV EV++ EG        P   + K P  K I        +T E+ + P+ W
Sbjct  228   DRQETKNRWVQEVLKVEGH-----VSPADAMTKIPSWKKIINEKGELNVTVEDAKNPQFW  282

Query  980   AHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSG-NH  1156
             + +C+  MA LAKE++T+RRVL+ +F +FD+   W P HGLA  VL D+   +E  G N 
Sbjct  283   SRVCLHNMAKLAKEATTVRRVLESLFRYFDSGNLWSPEHGLALFVLMDMQLLMEDFGQNT  342

Query  1157  QLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKSL  1336
              L+L+ +V+HLDHKNV     ++  +++  T LA+  +     + IG V+D+ RHLRKS+
Sbjct  343   HLLLSILVKHLDHKNVIKQPDMQLNIVEIITILAQHSKVQASIAIIGAVTDIMRHLRKSI  402

Query  1337  QATVD  1351
               +++
Sbjct  403   HYSLE  407



>ref|XP_009391228.1| PREDICTED: uncharacterized protein LOC103977445 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009391229.1| PREDICTED: uncharacterized protein LOC103977445 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009391230.1| PREDICTED: uncharacterized protein LOC103977445 [Musa acuminata 
subsp. malaccensis]
Length=1033

 Score =   260 bits (665),  Expect(2) = 3e-95, Method: Compositional matrix adjust.
 Identities = 119/216 (55%), Positives = 157/216 (73%), Gaps = 0/216 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG++SR + PACES+CI CP+LR+RSRQPVKRYKKLLADIFP+S D   N RKI KLCEY
Sbjct  1    MGVVSRSIMPACESLCIFCPSLRTRSRQPVKRYKKLLADIFPRSQDEEPNDRKISKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
             ++NP RIPKI   LE++ YKELR  H   V V+  +Y +LL  CKEQM  FA +LL ++
Sbjct  61   VSRNPLRIPKITSYLEQKFYKELRLEHFGTVKVVLCIYRKLLVSCKEQMPLFASSLLTII  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
              +LD  + D +  IGC T   F+  Q+DGTY +N+E L+ K+C LA+E GE+++   +R
Sbjct  121  CTLLDQRRQDEMCIIGCHTIFDFVICQIDGTYMFNLEGLIPKLCELAQEMGEDERANDMR  180

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNYE  792
            A+ LR LS+M+WFM E+SHI A+FD +V V L+NYE
Sbjct  181  AAGLRALSSMIWFMGEYSHISAEFDNVVSVVLENYE  216


 Score =   118 bits (295),  Expect(2) = 3e-95, Method: Compositional matrix adjust.
 Identities = 68/192 (35%), Positives = 108/192 (56%), Gaps = 14/192 (7%)
 Frame = +2

Query  803   INEDDERGEAHHNWVDEVIRSEGRDVGNENRPGYLIRKRPDKKDIS------LLTSEEIE  964
             +N+ D+  E  + WV EV  +EG     +  P  +  + P  K I        LT+EE +
Sbjct  225   LNKSDQVSE--NGWVQEVSNTEG-----QASPSPVATRVPSWKSIVDARGELSLTTEEAK  277

Query  965   MPKIWAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVES  1144
                 W+ IC+  MA LA+E++T+RRVL+ +F  FD+N  W P  GLA  VL ++   +E+
Sbjct  278   SSNFWSRICLHNMAKLAREATTVRRVLESLFRFFDDNDMWSPDKGLALCVLLEMQVVMEN  337

Query  1145  SG-NHQLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRH  1321
              G N  L+ + +++HL+HK V    +++  +I+  T LA    +    + I  +SDL RH
Sbjct  338   YGQNAHLLFSILIKHLEHKTVFKQPEMQLNIIEVTTHLAENSEAKTSVTVISAISDLVRH  397

Query  1322  LRKSLQATVDLA  1357
             LRKS+Q+T+D A
Sbjct  398   LRKSMQSTLDKA  409



>gb|KDO81672.1| hypothetical protein CISIN_1g0461821mg, partial [Citrus sinensis]
Length=853

 Score =   270 bits (691),  Expect(2) = 4e-95, Method: Compositional matrix adjust.
 Identities = 129/197 (65%), Positives = 155/197 (79%), Gaps = 4/197 (2%)
 Frame = +2

Query  809   EDDERGEAHHNWVDEVIRSEGRDV--GNENRPG-YLIRKRPDKKDISLLTSEEIEMPKIW  979
             +DDERGE HHNWVDEV+R EGR    G++  P   +IR RP+KKD S LT EE+E PK+W
Sbjct  75    DDDERGEPHHNWVDEVVRCEGRGAAAGSDTGPSSMMIRPRPEKKDPSALTREEVETPKVW  134

Query  980   AHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSGNHQ  1159
             A ICIQRM DLAKE++TMRRVLDPMF +FD+ + W+PR GLA +VLSD++Y +E+SGN Q
Sbjct  135   ARICIQRMVDLAKETTTMRRVLDPMFTYFDSRRQWIPRQGLAMIVLSDMAYLMETSGNQQ  194

Query  1160  LILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKSLQ  1339
             LIL  V+ HLDHKNV+ D Q+KS+VIQ ATALARQIRSG    +IG VSDLCRHLRKS Q
Sbjct  195   LILASVIHHLDHKNVSHDPQLKSYVIQVATALARQIRSGMVLVEIGSVSDLCRHLRKSFQ  254

Query  1340  ATVDLAGE-EINLNLTL  1387
             ATV+  GE E NLN+ L
Sbjct  255   ATVESVGEQESNLNILL  271


 Score =   107 bits (267),  Expect(2) = 4e-95, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 57/70 (81%), Gaps = 1/70 (1%)
 Frame = +1

Query  589  DGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRCLSAMVWFMAEFSHIFADFDEIV  768
            D TYT+NIE  V+KVC LA E G E  +R LRASSL+CLSAMVWFMAEFS IFADFDEIV
Sbjct  2    DSTYTHNIEKFVKKVCKLACENGVE-HRRSLRASSLQCLSAMVWFMAEFSCIFADFDEIV  60

Query  769  HVTLDNYEPD  798
              TLDNYEPD
Sbjct  61   SATLDNYEPD  70



>ref|XP_008443197.1| PREDICTED: uncharacterized protein LOC103486854 isoform X1 [Cucumis 
melo]
 ref|XP_008443199.1| PREDICTED: uncharacterized protein LOC103486854 isoform X1 [Cucumis 
melo]
 ref|XP_008443200.1| PREDICTED: uncharacterized protein LOC103486854 isoform X1 [Cucumis 
melo]
 ref|XP_008443201.1| PREDICTED: uncharacterized protein LOC103486854 isoform X1 [Cucumis 
melo]
Length=1003

 Score =   253 bits (645),  Expect(2) = 5e-95, Method: Compositional matrix adjust.
 Identities = 110/214 (51%), Positives = 156/214 (73%), Gaps = 0/214 (0%)
 Frame = +1

Query  148  GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  327
            G++SR++ P C S+C  CPALR+RSRQPVKRYKKL+ADIFP++P+   N RKI KLCEYA
Sbjct  9    GVISRQVLPVCGSLCFFCPALRARSRQPVKRYKKLIADIFPRNPEEGPNDRKIGKLCEYA  68

Query  328  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  507
             KNP RIPKI   LE+RCYKELR+ + + V V+  +Y +LL  CKEQM  FA +L++++ 
Sbjct  69   GKNPLRIPKITTSLEQRCYKELRNENFQAVKVVMSIYRKLLVSCKEQMPLFASSLISIMQ  128

Query  508  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRA  687
             ++D  +   ++ IGC T   F+ SQ DGTY +N+E  + K+C +A+++G+++    LR+
Sbjct  129  TLMDQTRQKEMQIIGCQTLFSFVNSQSDGTYMFNLEAFIPKLCQIAQDSGDDEGAENLRS  188

Query  688  SSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNY  789
            + L+ LS+MVWFM E+SHI  +FD IV V L+NY
Sbjct  189  AGLQGLSSMVWFMGEYSHISTEFDNIVSVVLENY  222


 Score =   124 bits (312),  Expect(2) = 5e-95, Method: Compositional matrix adjust.
 Identities = 66/177 (37%), Positives = 106/177 (60%), Gaps = 11/177 (6%)
 Frame = +2

Query  842   WVDEVIRSEG----RDVGNENRPGY--LIRKRPDKKDISLLTSEEIEMPKIWAHICIQRM  1003
             WV EV R EG      V   N P +  ++ +R +      LT E ++ P  W+ +C+  M
Sbjct  235   WVQEVQREEGHISSSSVVTMNTPSWREIVTERGEMN----LTGENVQNPCFWSRVCLHNM  290

Query  1004  ADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSG-NHQLILTGVV  1180
             A LAKE++TMRR+L+ +F +FDN   W  +HG+A  VL DL + ++ SG N  ++L+ ++
Sbjct  291   AKLAKEATTMRRILESLFRYFDNENLWSTKHGIAAPVLKDLQFLMDKSGQNTHVLLSILI  350

Query  1181  RHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKSLQATVD  1351
             +HLDHKNV    +++  ++   TALA++ ++    + I  VSD  RHLRKS+  ++D
Sbjct  351   KHLDHKNVLKLPKMQLDIVAVTTALAQEAKAEPSIAIISAVSDCLRHLRKSIHCSLD  407



>ref|XP_002322714.1| cyclin-related family protein [Populus trichocarpa]
 gb|EEF04475.1| cyclin-related family protein [Populus trichocarpa]
Length=1020

 Score =   251 bits (641),  Expect(2) = 2e-94, Method: Compositional matrix adjust.
 Identities = 112/214 (52%), Positives = 154/214 (72%), Gaps = 0/214 (0%)
 Frame = +1

Query  148  GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  327
            GL+SR++ PAC S+C  CPA+R+RSRQPVKRYKKL+ADIFP++ +   N RKI KLCEYA
Sbjct  6    GLVSRQVMPACGSLCFFCPAMRARSRQPVKRYKKLMADIFPRNQEEGPNDRKIGKLCEYA  65

Query  328  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  507
            AKNP RIPKI   LE+RCYKELR  + +   ++  +Y +LL  CKEQM  FA +LL ++ 
Sbjct  66   AKNPLRIPKITCSLEQRCYKELRIENFQSAKIVMCIYRKLLVTCKEQMTLFASSLLGIIN  125

Query  508  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRA  687
             +LD  + D ++ IGC T   F+ +Q DGTY +N+E  + K+C  A+E GE+++ + LRA
Sbjct  126  TLLDQTRQDDIQVIGCETLFDFVNNQKDGTYMFNLEGFIPKLCQFAQEEGEDERAKSLRA  185

Query  688  SSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNY  789
            + L+ LS+MVWFM + SHI  +FD +V V L+NY
Sbjct  186  AGLQALSSMVWFMGQHSHISVEFDNVVSVVLENY  219


 Score =   124 bits (312),  Expect(2) = 2e-94, Method: Compositional matrix adjust.
 Identities = 69/197 (35%), Positives = 116/197 (59%), Gaps = 13/197 (7%)
 Frame = +2

Query  806   NEDDERGEAHHNWVDEVIRSEGRDVGNENRPGYLIRKRPDKKDISL------LTSEEIEM  967
             N D ++      WV EV+++EG           +I + P  + I        +T E+ + 
Sbjct  228   NLDTDKQGPQSRWVQEVLKNEGHVTPLPE----VITRVPSWRTIVNERGEVNMTEEDSQN  283

Query  968   PKIWAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESS  1147
             P  W+ +C+  MA L KE++T+RRVL+ +F +FDN   W   +GLAF VL D+ + +++S
Sbjct  284   PCFWSRVCLHNMAKLGKEATTIRRVLESLFRYFDNGNLWSLENGLAFPVLKDMQFLMDNS  343

Query  1148  G-NHQLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHL  1324
             G N  ++L+ +++HLDHKNV  +  ++  +++  TALA+ +++    + IG VSD+ RHL
Sbjct  344   GQNTHVLLSILIKHLDHKNVLKEPSMQLDIVEVTTALAQHVKADPSVAIIGAVSDVMRHL  403

Query  1325  RKSLQATVDLA--GEEI  1369
             RKS+  ++D A  G EI
Sbjct  404   RKSIHCSLDDANLGAEI  420



>ref|XP_009393518.1| PREDICTED: uncharacterized protein LOC103979184 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009393521.1| PREDICTED: uncharacterized protein LOC103979184 [Musa acuminata 
subsp. malaccensis]
Length=1021

 Score =   260 bits (665),  Expect(2) = 2e-94, Method: Compositional matrix adjust.
 Identities = 116/216 (54%), Positives = 158/216 (73%), Gaps = 0/216 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG++SR++ PAC ++C  CP+LR+RSRQPVKRYKKLL D+FP+SPDG  N R I KLCEY
Sbjct  1    MGVMSRRVLPACGNLCCFCPSLRARSRQPVKRYKKLLTDVFPRSPDGQPNDRMIGKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            A+KNP RIPKI   LE+RCYKELR+G      V+  +Y +LL  CKEQM  +A +LL++V
Sbjct  61   ASKNPMRIPKITNYLEQRCYKELRNGQFNSAKVVPCIYRKLLASCKEQMPLYATSLLSIV  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
              +LD  + D ++ +GCLT   F+ +QVD TY +N+E  + K+C L +E GE+D+   LR
Sbjct  121  RTLLDQTQQDDMRILGCLTLVDFLNNQVDSTYMFNVEGFIPKLCQLGQEIGEDDRGLRLR  180

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNYE  792
            ++ L+ L++MV FM E+SHI  +FD+IV V LDNYE
Sbjct  181  SAGLQALASMVLFMGEYSHISMNFDDIVSVILDNYE  216


 Score =   115 bits (288),  Expect(2) = 2e-94, Method: Compositional matrix adjust.
 Identities = 64/195 (33%), Positives = 114/195 (58%), Gaps = 19/195 (10%)
 Frame = +2

Query  809   EDDERGEAHHNWVDEVIRSEGRDVGNENRPGYLIRKRPDKKDISLLTSEEIEM-------  967
             +D E  E  ++WV+EV+R+E      +N   +   +   KK +S+  S  IE        
Sbjct  227   QDFECNEHQNHWVEEVVRAE------DNVSSF---QDSWKKVLSVHQSTTIEFDATVDSS  277

Query  968   --PKIWAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVE  1141
               P  W+ +C+Q MA  AKE++T+RRVL+P+F   D+ K+W P  G+A  VLS++   +E
Sbjct  278   KSPTYWSKVCLQNMAKPAKEATTVRRVLEPLFRKLDSGKYWSPERGIACSVLSEIQLLME  337

Query  1142  SSG-NHQLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCR  1318
             ++G N  L+++ +++H+DHK+++     +  +I  A  L +Q +  G  S +  +S+L R
Sbjct  338   NTGQNSDLLISTLIKHIDHKSISKQLITQVNIINVARHLTQQAKFQGSLSIMTSISELMR  397

Query  1319  HLRKSLQATVDLAGE  1363
             HLRK LQ +++++ +
Sbjct  398   HLRKCLQCSMEVSNQ  412



>ref|XP_002277870.1| PREDICTED: uncharacterized protein LOC100255472 isoform X1 [Vitis 
vinifera]
Length=1017

 Score =   249 bits (637),  Expect(2) = 2e-94, Method: Compositional matrix adjust.
 Identities = 113/214 (53%), Positives = 154/214 (72%), Gaps = 0/214 (0%)
 Frame = +1

Query  148  GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  327
            G++SRK+ PAC ++C  CPA+R RSRQP+KRYKKL++DIFP++ D   N RKI KLCEYA
Sbjct  6    GVISRKVLPACGNLCFLCPAMRPRSRQPLKRYKKLISDIFPRAQDEEPNDRKIGKLCEYA  65

Query  328  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  507
            AKNP RIPKI   LE+RCYKELRS + +   V+  +Y + L  CKEQM  FA +LL+++ 
Sbjct  66   AKNPLRIPKITNSLEQRCYKELRSENFRSAKVVMCIYRKFLVSCKEQMPLFASSLLSIIH  125

Query  508  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRA  687
             +LD A+ D ++ IGC T   F+ +Q DGTY  N+E  + K+C LA+E GE+++ + LR+
Sbjct  126  TLLDQARQDEMQIIGCQTLFDFVNNQRDGTYMCNLEGFIPKLCQLAQEVGEDERAQHLRS  185

Query  688  SSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNY  789
            + L  LS+MVWFM E SHI A+ D +V V L+NY
Sbjct  186  AGLHALSSMVWFMGEHSHISAEIDNVVSVILENY  219


 Score =   125 bits (315),  Expect(2) = 2e-94, Method: Compositional matrix adjust.
 Identities = 67/181 (37%), Positives = 110/181 (61%), Gaps = 11/181 (6%)
 Frame = +2

Query  830   AHHNWVDEVIRSEGRDVGNENRPGYLIRKRP------DKKDISLLTSEEIEMPKIWAHIC  991
             A + WV EV++ EG    +   P   +R         +K ++++ ++E+ + P  W+ +C
Sbjct  227   AQNRWVQEVLKVEGHVSPS---PEVTMRVLSWNTIVNEKGEVNV-STEDAKNPCFWSRVC  282

Query  992   IQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSG-NHQLIL  1168
             +  MA LAKES+T RR+L+ +F++FDN   W P +GLAF VL D+ +  E+SG N   +L
Sbjct  283   LHNMALLAKESTTKRRILESLFLYFDNGNLWSPENGLAFPVLKDMQFLGENSGQNTHFLL  342

Query  1169  TGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKSLQATV  1348
             + +V+HLDHKNV     ++  +++  T+LAR  +     + IG VSD+ RHLRKS+  ++
Sbjct  343   SLLVKHLDHKNVLKKPSMQLDIVEVTTSLARHAKVESSVAIIGAVSDVMRHLRKSIHCSI  402

Query  1349  D  1351
             D
Sbjct  403   D  403



>ref|XP_010653791.1| PREDICTED: uncharacterized protein LOC100255472 isoform X2 [Vitis 
vinifera]
Length=993

 Score =   249 bits (637),  Expect(2) = 2e-94, Method: Compositional matrix adjust.
 Identities = 113/214 (53%), Positives = 154/214 (72%), Gaps = 0/214 (0%)
 Frame = +1

Query  148  GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  327
            G++SRK+ PAC ++C  CPA+R RSRQP+KRYKKL++DIFP++ D   N RKI KLCEYA
Sbjct  6    GVISRKVLPACGNLCFLCPAMRPRSRQPLKRYKKLISDIFPRAQDEEPNDRKIGKLCEYA  65

Query  328  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  507
            AKNP RIPKI   LE+RCYKELRS + +   V+  +Y + L  CKEQM  FA +LL+++ 
Sbjct  66   AKNPLRIPKITNSLEQRCYKELRSENFRSAKVVMCIYRKFLVSCKEQMPLFASSLLSIIH  125

Query  508  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRA  687
             +LD A+ D ++ IGC T   F+ +Q DGTY  N+E  + K+C LA+E GE+++ + LR+
Sbjct  126  TLLDQARQDEMQIIGCQTLFDFVNNQRDGTYMCNLEGFIPKLCQLAQEVGEDERAQHLRS  185

Query  688  SSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNY  789
            + L  LS+MVWFM E SHI A+ D +V V L+NY
Sbjct  186  AGLHALSSMVWFMGEHSHISAEIDNVVSVILENY  219


 Score =   125 bits (315),  Expect(2) = 2e-94, Method: Compositional matrix adjust.
 Identities = 67/181 (37%), Positives = 110/181 (61%), Gaps = 11/181 (6%)
 Frame = +2

Query  830   AHHNWVDEVIRSEGRDVGNENRPGYLIRKRP------DKKDISLLTSEEIEMPKIWAHIC  991
             A + WV EV++ EG    +   P   +R         +K ++++ ++E+ + P  W+ +C
Sbjct  227   AQNRWVQEVLKVEGHVSPS---PEVTMRVLSWNTIVNEKGEVNV-STEDAKNPCFWSRVC  282

Query  992   IQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSG-NHQLIL  1168
             +  MA LAKES+T RR+L+ +F++FDN   W P +GLAF VL D+ +  E+SG N   +L
Sbjct  283   LHNMALLAKESTTKRRILESLFLYFDNGNLWSPENGLAFPVLKDMQFLGENSGQNTHFLL  342

Query  1169  TGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKSLQATV  1348
             + +V+HLDHKNV     ++  +++  T+LAR  +     + IG VSD+ RHLRKS+  ++
Sbjct  343   SLLVKHLDHKNVLKKPSMQLDIVEVTTSLARHAKVESSVAIIGAVSDVMRHLRKSIHCSI  402

Query  1349  D  1351
             D
Sbjct  403   D  403



>ref|XP_004309822.1| PREDICTED: uncharacterized protein LOC101313176 isoform X1 [Fragaria 
vesca subsp. vesca]
 ref|XP_011457272.1| PREDICTED: uncharacterized protein LOC101313176 isoform X1 [Fragaria 
vesca subsp. vesca]
 ref|XP_011457273.1| PREDICTED: uncharacterized protein LOC101313176 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=998

 Score =   257 bits (656),  Expect(2) = 2e-94, Method: Compositional matrix adjust.
 Identities = 116/220 (53%), Positives = 160/220 (73%), Gaps = 1/220 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG++SR++ PAC ++C  CP+LR+RSRQPVKRYKKLL+DIFP+  D   N RKI KLCEY
Sbjct  1    MGVMSRRVVPACGNLCFFCPSLRARSRQPVKRYKKLLSDIFPRHQDAEPNDRKIGKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            A+KNP RIPKI + LE++CYK+LR+ H   V VI  +Y +LL  CKEQM  FA +LL ++
Sbjct  61   ASKNPLRIPKITELLEQKCYKDLRNEHFGSVKVILRIYRKLLSSCKEQMPLFASSLLEII  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
              +L+  + D ++ +GC T   FI SQ+DGT+ +N+E L+ K+C LA+E G++++   LR
Sbjct  121  RILLEQTRHDEMQILGCNTLVDFINSQIDGTHMFNLEGLIPKLCELAQEMGDDERALHLR  180

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNYEPDAH  804
            ++ L+ L+ MVWFM E SHI  DFD I+ VTL+NY  D H
Sbjct  181  SAGLQSLAFMVWFMGEHSHISMDFDTIISVTLENYT-DIH  219


 Score =   118 bits (295),  Expect(2) = 2e-94, Method: Compositional matrix adjust.
 Identities = 64/189 (34%), Positives = 109/189 (58%), Gaps = 9/189 (5%)
 Frame = +2

Query  809   EDDERGEAHHNWVDEVIRSEGRDVGNENRPGYLIRKRPDKKDISLL----TSEEIEMPKI  976
             E  +  E+ H WV  V+++E  D    +    + +K P    ++ L    T +  + P  
Sbjct  227   EGGQFSESQHQWVQGVLKAEVHDSSFPD----VSQKVPSLPILNTLDLDPTIDTDKSPSY  282

Query  977   WAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSG-N  1153
             W+ +C++ +A LAKE++T+RRVL+P+F +FD   HW P + LA+ VL  L   +E SG N
Sbjct  283   WSKVCLRNIARLAKEATTVRRVLEPLFQNFDAANHWSPENRLAYHVLMYLQSLLEESGDN  342

Query  1154  HQLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKS  1333
               L+L+ +V+HLDHKNV    ++++ ++   T +A+  +     + IG +SDL +HLRK 
Sbjct  343   SHLLLSILVKHLDHKNVVKQPRLQTDIVNVTTQIAQSAKQQASVAIIGAISDLIKHLRKC  402

Query  1334  LQATVDLAG  1360
             LQ   +++ 
Sbjct  403   LQNQAEVSN  411



>ref|XP_011457274.1| PREDICTED: uncharacterized protein LOC101313176 isoform X3 [Fragaria 
vesca subsp. vesca]
Length=984

 Score =   257 bits (656),  Expect(2) = 2e-94, Method: Compositional matrix adjust.
 Identities = 116/220 (53%), Positives = 160/220 (73%), Gaps = 1/220 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG++SR++ PAC ++C  CP+LR+RSRQPVKRYKKLL+DIFP+  D   N RKI KLCEY
Sbjct  1    MGVMSRRVVPACGNLCFFCPSLRARSRQPVKRYKKLLSDIFPRHQDAEPNDRKIGKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            A+KNP RIPKI + LE++CYK+LR+ H   V VI  +Y +LL  CKEQM  FA +LL ++
Sbjct  61   ASKNPLRIPKITELLEQKCYKDLRNEHFGSVKVILRIYRKLLSSCKEQMPLFASSLLEII  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
              +L+  + D ++ +GC T   FI SQ+DGT+ +N+E L+ K+C LA+E G++++   LR
Sbjct  121  RILLEQTRHDEMQILGCNTLVDFINSQIDGTHMFNLEGLIPKLCELAQEMGDDERALHLR  180

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNYEPDAH  804
            ++ L+ L+ MVWFM E SHI  DFD I+ VTL+NY  D H
Sbjct  181  SAGLQSLAFMVWFMGEHSHISMDFDTIISVTLENYT-DIH  219


 Score =   118 bits (295),  Expect(2) = 2e-94, Method: Compositional matrix adjust.
 Identities = 64/188 (34%), Positives = 109/188 (58%), Gaps = 9/188 (5%)
 Frame = +2

Query  809   EDDERGEAHHNWVDEVIRSEGRDVGNENRPGYLIRKRPDKKDISLL----TSEEIEMPKI  976
             E  +  E+ H WV  V+++E  D    +    + +K P    ++ L    T +  + P  
Sbjct  227   EGGQFSESQHQWVQGVLKAEVHDSSFPD----VSQKVPSLPILNTLDLDPTIDTDKSPSY  282

Query  977   WAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSG-N  1153
             W+ +C++ +A LAKE++T+RRVL+P+F +FD   HW P + LA+ VL  L   +E SG N
Sbjct  283   WSKVCLRNIARLAKEATTVRRVLEPLFQNFDAANHWSPENRLAYHVLMYLQSLLEESGDN  342

Query  1154  HQLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKS  1333
               L+L+ +V+HLDHKNV    ++++ ++   T +A+  +     + IG +SDL +HLRK 
Sbjct  343   SHLLLSILVKHLDHKNVVKQPRLQTDIVNVTTQIAQSAKQQASVAIIGAISDLIKHLRKC  402

Query  1334  LQATVDLA  1357
             LQ   +++
Sbjct  403   LQNQAEVS  410



>ref|XP_011652158.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101210251 
[Cucumis sativus]
Length=1036

 Score =   249 bits (637),  Expect(2) = 5e-94, Method: Compositional matrix adjust.
 Identities = 110/214 (51%), Positives = 156/214 (73%), Gaps = 0/214 (0%)
 Frame = +1

Query  148  GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  327
            G++SR++ P C S+C  CPALR+RSRQPVKRYKKL+ADIFP++P+   N RKI KLCEYA
Sbjct  9    GVISRQVLPVCGSLCFFCPALRARSRQPVKRYKKLIADIFPRNPEEGPNDRKIGKLCEYA  68

Query  328  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  507
            AKNP RIPKI   LE+RCYKELR+ + + V V+  +Y +LL  CKEQM  FA +L++++ 
Sbjct  69   AKNPLRIPKITTSLEQRCYKELRNENFQAVKVVMSIYRKLLVSCKEQMPLFASSLISIMQ  128

Query  508  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRA  687
             ++D  +   ++ IGC T   F+ SQ DGTY +N+E  + K+C +A+++G+++    L +
Sbjct  129  TLMDQTRQKEMQIIGCQTLFSFVNSQSDGTYMFNLEAFIPKLCQIAQDSGDDEGAENLCS  188

Query  688  SSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNY  789
            + L+ LS+MVWFM E+SHI  +FD IV V L+NY
Sbjct  189  AGLQGLSSMVWFMGEYSHISTEFDNIVSVVLENY  222


 Score =   124 bits (311),  Expect(2) = 5e-94, Method: Compositional matrix adjust.
 Identities = 66/184 (36%), Positives = 107/184 (58%), Gaps = 11/184 (6%)
 Frame = +2

Query  821   RGEAHHNWVDEVIRSEG----RDVGNENRPGY--LIRKRPDKKDISLLTSEEIEMPKIWA  982
             +  ++  WV EV R EG      V   N P +  ++ +R +      LT E ++ P  W+
Sbjct  228   KSNSNDRWVQEVQREEGHISSSSVVTMNTPSWREIVTERGEVN----LTGENVQNPCFWS  283

Query  983   HICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSG-NHQ  1159
              +C+  MA LAKE++TMRR+L+ +F +FDN   W  +HG+A  VL DL + ++ SG N  
Sbjct  284   RVCLHNMAKLAKEATTMRRILESLFRYFDNENLWSTKHGIAAPVLKDLQFLMDKSGQNTH  343

Query  1160  LILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKSLQ  1339
             ++L+ +++HLDHKNV     ++  ++   TALA++ ++    + I  VSD  RHLRKS+ 
Sbjct  344   VLLSILIKHLDHKNVLKLPNMQLDIVAVTTALAQEAKAEPSIAVISAVSDCLRHLRKSIH  403

Query  1340  ATVD  1351
               +D
Sbjct  404   CALD  407



>ref|XP_007203221.1| hypothetical protein PRUPE_ppa000725mg [Prunus persica]
 gb|EMJ04420.1| hypothetical protein PRUPE_ppa000725mg [Prunus persica]
Length=1021

 Score =   254 bits (649),  Expect(2) = 6e-94, Method: Compositional matrix adjust.
 Identities = 114/214 (53%), Positives = 157/214 (73%), Gaps = 0/214 (0%)
 Frame = +1

Query  148  GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  327
            G+LSR++ PAC  +C  CPALR+RSRQPVKRYKKL+ADIFP++ +   N RKI KLCEYA
Sbjct  6    GILSRQVLPACGGLCFFCPALRARSRQPVKRYKKLIADIFPRNQEEGPNDRKIGKLCEYA  65

Query  328  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  507
            AKNP RIPKI   LE+RCYKELR+ + +   ++  +YN+LL  CKEQM  FA +LL+++ 
Sbjct  66   AKNPLRIPKITNFLEQRCYKELRNENFRSTKIVMCIYNKLLISCKEQMRLFASSLLSIMH  125

Query  508  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRA  687
             +LD  + D ++ IGC T   F+ +Q DGTY +N+E  + K+C +A+E GE+++   LR+
Sbjct  126  TLLDQTRQDEMQIIGCQTLFNFVNNQKDGTYMFNLEGFIPKLCQIAQEPGEDERANNLRS  185

Query  688  SSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNY  789
            ++L+ LS+MVWFM E SHI  +FD IV V L+NY
Sbjct  186  AALQALSSMVWFMGEHSHISVEFDNIVAVVLENY  219


 Score =   119 bits (298),  Expect(2) = 6e-94, Method: Compositional matrix adjust.
 Identities = 67/176 (38%), Positives = 107/176 (61%), Gaps = 9/176 (5%)
 Frame = +2

Query  842   WVDEVIRSEGR-----DVGNENRPGYLIRKRPDKKDISLLTSEEIEMPKIWAHICIQRMA  1006
             WV EV ++EG      DV N N P +      D+K    +  E+ + P  W+ +C+Q MA
Sbjct  236   WVQEVRKNEGHVSPSPDV-NINVPSW--SSIVDEKGELNVKVEDAKNPCFWSRVCLQNMA  292

Query  1007  DLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSG-NHQLILTGVVR  1183
              LAKE++T+RRVL+ +F +FDN   W P HGLAF VL ++   +++SG N  ++L+ +++
Sbjct  293   KLAKEATTIRRVLESVFRYFDNGNLWSPEHGLAFPVLKEIQLLMDTSGQNTHVLLSILIK  352

Query  1184  HLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKSLQATVD  1351
             HLDHKNV     ++  +++  T+L++  +     + IG VSD  RHLRKS+  ++D
Sbjct  353   HLDHKNVLKQPNMQLDIVEVTTSLSQLAKIEPSVAIIGAVSDAMRHLRKSIHCSLD  408



>gb|EPS68493.1| hypothetical protein M569_06272 [Genlisea aurea]
Length=1007

 Score =   258 bits (658),  Expect(2) = 7e-94, Method: Compositional matrix adjust.
 Identities = 117/215 (54%), Positives = 155/215 (72%), Gaps = 0/215 (0%)
 Frame = +1

Query  148  GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  327
            G++SR++ PACES+C  CP LR+RSRQPVKRYKKL+ADIFP+S D   N RKI KLCEYA
Sbjct  6    GVISRQILPACESLCFFCPGLRTRSRQPVKRYKKLIADIFPRSQDEEPNYRKIEKLCEYA  65

Query  328  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  507
            +KNP RIPKI   LE+RCYKELR  + + V ++  +Y +LL  CKEQM  FA +LL+++ 
Sbjct  66   SKNPMRIPKIESSLEQRCYKELRVENIRSVKIVMSIYKKLLFTCKEQMPLFANSLLSIIY  125

Query  508  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRA  687
             +LD    D +   GC T   F+ +Q D TY +N+E L+ K+C +A+E G++D+   +RA
Sbjct  126  VLLDQTNHDEMLISGCQTLFDFVNNQNDSTYMFNLEGLIPKLCQIAQEVGDDDRGENIRA  185

Query  688  SSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNYE  792
            + L+ LSAMVWFM E SHI ADFD IV V L+NY+
Sbjct  186  AGLQALSAMVWFMGETSHISADFDNIVSVVLENYK  220


 Score =   115 bits (289),  Expect(2) = 7e-94, Method: Compositional matrix adjust.
 Identities = 70/200 (35%), Positives = 114/200 (57%), Gaps = 16/200 (8%)
 Frame = +2

Query  815   DERGEAHHNWVDEVIRSEGR-----DVGNENRPG--YLIRKRPDKKDISLLTSEEIEMPK  973
             +++ +  + W+ EV ++EG      DV  E  P   YL+    DK +++L T +E   P 
Sbjct  227   NDQYQNQNRWLQEVQKAEGHSAPDPDVAME-VPSWRYLVN---DKGNLNL-TPKETTSPC  281

Query  974   IWAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSG-  1150
              W+ +C+  MA+L KE++TMRRVL+ +F +FDN   W    G+AF +L D+   +++SG 
Sbjct  282   FWSRVCLHNMANLGKEATTMRRVLESLFRYFDNGNLWPIEDGIAFPILKDMQLLMDNSGQ  341

Query  1151  NHQLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRK  1330
             N   +L+ +V+HLDHKNV     ++  +I+  T L +  R+    + +  VSD+ RHLRK
Sbjct  342   NAHFLLSILVKHLDHKNVLKKPYMQLEIIEVVTELVKLTRTQSSMAILSAVSDVMRHLRK  401

Query  1331  SLQATVD---LAGEEINLNL  1381
             S+   +D   L  E I  N+
Sbjct  402   SIHCRLDDDKLGDEVIKWNI  421



>ref|XP_011078902.1| PREDICTED: uncharacterized protein LOC105162543 [Sesamum indicum]
Length=1009

 Score =   256 bits (653),  Expect(2) = 9e-94, Method: Compositional matrix adjust.
 Identities = 119/214 (56%), Positives = 155/214 (72%), Gaps = 0/214 (0%)
 Frame = +1

Query  148  GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  327
            G++SR++ PAC S+C  CPALR RSRQPVKRYKKL++DIFPKS D   N RKI KLCEYA
Sbjct  7    GVISRQVLPACGSLCFFCPALRERSRQPVKRYKKLISDIFPKSLDEEPNDRKIGKLCEYA  66

Query  328  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  507
            AKNP RIPKIA  LE+RCYKELR+ + + V V+  +Y + L  CKEQM  FA +LL ++ 
Sbjct  67   AKNPLRIPKIANSLEQRCYKELRNENFRAVKVVMCIYRKFLSACKEQMPLFANSLLTIIN  126

Query  508  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRA  687
             +LD    D +  IGC +   F+ +Q DGTY +N+E L+ K+C LA+E G++++   LRA
Sbjct  127  TLLDQTSQDEMLVIGCHSVFDFVNNQNDGTYMFNLEGLIPKLCQLAQEPGDDERAENLRA  186

Query  688  SSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNY  789
            ++L+ LSAMVWFM E SHI  +FD IV V L+NY
Sbjct  187  AALQALSAMVWFMGENSHISVEFDNIVSVVLENY  220


 Score =   117 bits (293),  Expect(2) = 9e-94, Method: Compositional matrix adjust.
 Identities = 67/178 (38%), Positives = 103/178 (58%), Gaps = 5/178 (3%)
 Frame = +2

Query  845   VDEVIRSEGRDVGNENRPGYLIRKRPDKKDISLLTSEEIEMPKIWAHICIQRMADLAKES  1024
             V E  R+   D G    P +  R   D+K    +T+EE + P  W+ +C+Q MA L KE+
Sbjct  230   VSETERTTSPDQGVARVPSW--RLIVDEKGQLNVTTEESKSPSFWSRVCLQNMAKLGKEA  287

Query  1025  STMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSG-NHQLILTGVVRHLDHKN  1201
             +TMRRVL+ +F +FDN   W  + G+AF VL D+   ++ SG N   +L+ +++HLDHKN
Sbjct  288   TTMRRVLESLFRYFDNGNLWPIQFGIAFPVLKDMQLVMDDSGQNTHFLLSILIKHLDHKN  347

Query  1202  VACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKSLQATVDLA--GEEI  1369
             V     ++  +++  TAL R  +     + +  VSD+ RHLRKS+  T+D A  G E+
Sbjct  348   VLKLPDMQLDIVEVVTALVRLTKVQSSVAIVSAVSDIMRHLRKSIHYTLDDANLGNEV  405



>gb|KGN59399.1| hypothetical protein Csa_3G816120 [Cucumis sativus]
Length=870

 Score =   249 bits (636),  Expect(2) = 9e-94, Method: Compositional matrix adjust.
 Identities = 110/214 (51%), Positives = 156/214 (73%), Gaps = 0/214 (0%)
 Frame = +1

Query  148  GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  327
            G++SR++ P C S+C  CPALR+RSRQPVKRYKKL+ADIFP++P+   N RKI KLCEYA
Sbjct  9    GVISRQVLPVCGSLCFFCPALRARSRQPVKRYKKLIADIFPRNPEEGPNDRKIGKLCEYA  68

Query  328  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  507
            AKNP RIPKI   LE+RCYKELR+ + + V V+  +Y +LL  CKEQM  FA +L++++ 
Sbjct  69   AKNPLRIPKITTSLEQRCYKELRNENFQAVKVVMSIYRKLLVSCKEQMPLFASSLISIMQ  128

Query  508  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRA  687
             ++D  +   ++ IGC T   F+ SQ DGTY +N+E  + K+C +A+++G+++    L +
Sbjct  129  TLMDQTRQKEMQIIGCQTLFSFVNSQSDGTYMFNLEAFIPKLCQIAQDSGDDEGAENLCS  188

Query  688  SSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNY  789
            + L+ LS+MVWFM E+SHI  +FD IV V L+NY
Sbjct  189  AGLQGLSSMVWFMGEYSHISTEFDNIVSVVLENY  222


 Score =   124 bits (310),  Expect(2) = 9e-94, Method: Compositional matrix adjust.
 Identities = 67/187 (36%), Positives = 108/187 (58%), Gaps = 11/187 (6%)
 Frame = +2

Query  821   RGEAHHNWVDEVIRSEG----RDVGNENRPGY--LIRKRPDKKDISLLTSEEIEMPKIWA  982
             +  ++  WV EV R EG      V   N P +  ++ +R +      LT E ++ P  W+
Sbjct  228   KSNSNDRWVQEVQREEGHISSSSVVTMNTPSWREIVTERGEVN----LTGENVQNPCFWS  283

Query  983   HICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSG-NHQ  1159
              +C+  MA LAKE++TMRR+L+ +F +FDN   W  +HG+A  VL DL + ++ SG N  
Sbjct  284   RVCLHNMAKLAKEATTMRRILESLFRYFDNENLWSTKHGIAAPVLKDLQFLMDKSGQNTH  343

Query  1160  LILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKSLQ  1339
             ++L+ +++HLDHKNV     ++  ++   TALA++ ++    + I  VSD  RHLRKS+ 
Sbjct  344   VLLSILIKHLDHKNVLKLPNMQLDIVAVTTALAQEAKAEPSIAVISAVSDCLRHLRKSIH  403

Query  1340  ATVDLAG  1360
               +D A 
Sbjct  404   CALDDAN  410



>ref|XP_002529611.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF32756.1| conserved hypothetical protein [Ricinus communis]
Length=985

 Score =   246 bits (628),  Expect(2) = 2e-93, Method: Compositional matrix adjust.
 Identities = 107/214 (50%), Positives = 156/214 (73%), Gaps = 0/214 (0%)
 Frame = +1

Query  148  GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  327
            G++SR++ PAC S+C  CPA+R+RSRQP+KRYKKL+A+IFP++PD   N R I +LCEYA
Sbjct  6    GVVSRQVLPACGSLCFFCPAMRARSRQPIKRYKKLIANIFPRNPDDGPNDRMIGRLCEYA  65

Query  328  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  507
            AKNP RIPKI   LE+RCYKELR+ + +   ++  +Y +LL  C+EQM  FA +LL+++ 
Sbjct  66   AKNPLRIPKITNSLEQRCYKELRNENFQSAKIVMCIYRKLLISCREQMPLFASSLLSIMH  125

Query  508  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRA  687
             +LD  + D ++ +GC T   F+ +Q DGTY +N++  + K+C  A+E G++++ + LRA
Sbjct  126  TLLDQTRQDELQIVGCETLFDFVTNQKDGTYLFNLDGFIPKLCQSAQEVGDDERAKNLRA  185

Query  688  SSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNY  789
            ++L+ LS+MVW M E SHI  DFD IV V L+NY
Sbjct  186  AALQALSSMVWLMGEHSHISVDFDSIVSVILENY  219


 Score =   126 bits (316),  Expect(2) = 2e-93, Method: Compositional matrix adjust.
 Identities = 63/178 (35%), Positives = 110/178 (62%), Gaps = 7/178 (4%)
 Frame = +2

Query  842   WVDEVIRSEGRDVGNENRPGYLI-----RKRPDKKDISLLTSEEIEMPKIWAHICIQRMA  1006
             WV+EV+++EG  +     P ++      R   ++K++++ T+E    P  W+ +C+  MA
Sbjct  240   WVEEVLKNEGHVIHVSLPPEFITTVPSWRTVVNEKEVNV-TAENARDPCFWSRVCLHNMA  298

Query  1007  DLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSG-NHQLILTGVVR  1183
              L KE++ +RRVL+ +F +FDN   W P +GLAF VL D+ + ++ SG N  ++L+ +++
Sbjct  299   QLGKEATNIRRVLESLFRYFDNANLWCPEYGLAFTVLKDMQFLMDDSGQNTHILLSTLIK  358

Query  1184  HLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKSLQATVDLA  1357
             HLDHKNV   S+++  +++  T+LA+  +     + IG VSD+ RH RKS+  + D A
Sbjct  359   HLDHKNVLQQSKMQLDIVEVTTSLAQHAKVEPSVAIIGAVSDVMRHWRKSIHCSFDNA  416



>ref|XP_011033324.1| PREDICTED: protein EFR3 homolog B-like isoform X2 [Populus euphratica]
Length=1010

 Score =   247 bits (631),  Expect(2) = 6e-93, Method: Compositional matrix adjust.
 Identities = 110/214 (51%), Positives = 154/214 (72%), Gaps = 0/214 (0%)
 Frame = +1

Query  148  GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  327
            GL+SR++ PAC S+C  CPA+R+RSRQPVKRYKKL+ADIFP++ +   N RKI KLCEYA
Sbjct  6    GLVSRQVMPACGSLCFFCPAMRARSRQPVKRYKKLIADIFPRNQEEGPNDRKIGKLCEYA  65

Query  328  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  507
            AKNP RIPKI   LE+RCYKELR  + +   ++  +Y +LL  CKE M  FA +LL ++ 
Sbjct  66   AKNPLRIPKITCSLEQRCYKELRIENFQSAKIVMCIYRKLLVTCKEHMTLFASSLLGIIN  125

Query  508  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRA  687
             +LD  + D ++ IGC T   F+ +Q DGTY +N+E  + K+C  A+E GE+++ + LRA
Sbjct  126  TLLDQTRQDDIQVIGCETLFDFVNNQKDGTYMFNLEGFIPKLCQFAQEEGEDERAKSLRA  185

Query  688  SSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNY  789
            + L+ LS++VWFM++ SHI  +FD +V V L+NY
Sbjct  186  AGLQALSSVVWFMSQHSHISVEFDNVVSVVLENY  219


 Score =   123 bits (309),  Expect(2) = 6e-93, Method: Compositional matrix adjust.
 Identities = 68/195 (35%), Positives = 115/195 (59%), Gaps = 9/195 (5%)
 Frame = +2

Query  806   NEDDERGEAHHNWVDEVIRSEGRDVG----NENRPGYLIRKRPDKKDISLLTSEEIEMPK  973
             N D ++      WV EV+++EG            P +  R   +++    +T E+ + P 
Sbjct  228   NLDTDKQGPQSRWVQEVLKNEGHVTPLPEVTTRVPSW--RTIVNERGEVNMTEEDSQNPC  285

Query  974   IWAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSG-  1150
              W+ +C+  MA L KE++T+RRVL+ +F +FDN   W   +GLAF VL D+ + + +SG 
Sbjct  286   FWSRVCLHNMAKLGKEATTIRRVLESLFRYFDNGNLWSLENGLAFPVLKDMQFLMHNSGQ  345

Query  1151  NHQLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRK  1330
             N  ++L+ +++HLDHKNV  +  ++  +++  TALA+ +++    + IG VSD+ RHLRK
Sbjct  346   NTHVLLSILIKHLDHKNVLKEPSMQLDIVEVTTALAQHVKADPSVAIIGAVSDVMRHLRK  405

Query  1331  SLQATVDLA--GEEI  1369
             S+  ++D A  G EI
Sbjct  406   SIHCSLDDANLGAEI  420



>ref|XP_011033323.1| PREDICTED: uncharacterized protein LOC105131844 isoform X1 [Populus 
euphratica]
Length=1018

 Score =   247 bits (630),  Expect(2) = 6e-93, Method: Compositional matrix adjust.
 Identities = 110/214 (51%), Positives = 154/214 (72%), Gaps = 0/214 (0%)
 Frame = +1

Query  148  GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  327
            GL+SR++ PAC S+C  CPA+R+RSRQPVKRYKKL+ADIFP++ +   N RKI KLCEYA
Sbjct  6    GLVSRQVMPACGSLCFFCPAMRARSRQPVKRYKKLIADIFPRNQEEGPNDRKIGKLCEYA  65

Query  328  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  507
            AKNP RIPKI   LE+RCYKELR  + +   ++  +Y +LL  CKE M  FA +LL ++ 
Sbjct  66   AKNPLRIPKITCSLEQRCYKELRIENFQSAKIVMCIYRKLLVTCKEHMTLFASSLLGIIN  125

Query  508  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRA  687
             +LD  + D ++ IGC T   F+ +Q DGTY +N+E  + K+C  A+E GE+++ + LRA
Sbjct  126  TLLDQTRQDDIQVIGCETLFDFVNNQKDGTYMFNLEGFIPKLCQFAQEEGEDERAKSLRA  185

Query  688  SSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNY  789
            + L+ LS++VWFM++ SHI  +FD +V V L+NY
Sbjct  186  AGLQALSSVVWFMSQHSHISVEFDNVVSVVLENY  219


 Score =   123 bits (309),  Expect(2) = 6e-93, Method: Compositional matrix adjust.
 Identities = 68/195 (35%), Positives = 115/195 (59%), Gaps = 9/195 (5%)
 Frame = +2

Query  806   NEDDERGEAHHNWVDEVIRSEGRDVG----NENRPGYLIRKRPDKKDISLLTSEEIEMPK  973
             N D ++      WV EV+++EG            P +  R   +++    +T E+ + P 
Sbjct  228   NLDTDKQGPQSRWVQEVLKNEGHVTPLPEVTTRVPSW--RTIVNERGEVNMTEEDSQNPC  285

Query  974   IWAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSG-  1150
              W+ +C+  MA L KE++T+RRVL+ +F +FDN   W   +GLAF VL D+ + + +SG 
Sbjct  286   FWSRVCLHNMAKLGKEATTIRRVLESLFRYFDNGNLWSLENGLAFPVLKDMQFLMHNSGQ  345

Query  1151  NHQLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRK  1330
             N  ++L+ +++HLDHKNV  +  ++  +++  TALA+ +++    + IG VSD+ RHLRK
Sbjct  346   NTHVLLSILIKHLDHKNVLKEPSMQLDIVEVTTALAQHVKADPSVAIIGAVSDVMRHLRK  405

Query  1331  SLQATVDLA--GEEI  1369
             S+  ++D A  G EI
Sbjct  406   SIHCSLDDANLGAEI  420



>ref|XP_010057214.1| PREDICTED: uncharacterized protein LOC104445096 isoform X1 [Eucalyptus 
grandis]
Length=1045

 Score =   249 bits (637),  Expect(2) = 7e-93, Method: Compositional matrix adjust.
 Identities = 108/214 (50%), Positives = 155/214 (72%), Gaps = 0/214 (0%)
 Frame = +1

Query  148  GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  327
            G++SR++ P C S+C  CPA+R+RSRQPVKRYKKL++DIFPK+ D   N RKI KLCEYA
Sbjct  6    GVISRQVLPVCGSLCFFCPAMRARSRQPVKRYKKLISDIFPKNQDEEPNDRKIGKLCEYA  65

Query  328  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  507
            AKNP RIPKI   LE+RCYKELR+ + +   ++  +Y +LL  CK+QM  FA +LL+++ 
Sbjct  66   AKNPLRIPKITSTLEQRCYKELRTENFRSAKIVMCIYRKLLVSCKDQMPLFASSLLSIIS  125

Query  508  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRA  687
             +LD  + D ++ IGC     F+ +Q DGTY +N+E  + K+C LA+E G++++ + LRA
Sbjct  126  TLLDQTRQDEMQLIGCQNLFDFVNNQGDGTYMFNLEGFIPKLCQLAQELGQDERAQHLRA  185

Query  688  SSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNY  789
            + L+ LS+M+WFM E+SH   +FD +V V L+NY
Sbjct  186  AGLQALSSMIWFMGEYSHFSGEFDNVVSVVLENY  219


 Score =   120 bits (302),  Expect(2) = 7e-93, Method: Compositional matrix adjust.
 Identities = 68/196 (35%), Positives = 114/196 (58%), Gaps = 10/196 (5%)
 Frame = +2

Query  803   INEDDERGEAHHNWVDEVIRSEGRDVGNENRPGYLIRKRPDKKDIS----LLTSEEIEMP  970
             ++ED  +  + + WV EV++ EG    +   P   +R    KK ++    +  + + + P
Sbjct  225   VSEDPNKQGSENRWVQEVLKHEGHVSAS---PEVTMRVPSWKKLVNDKGEVNATVDAKNP  281

Query  971   KIWAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSG  1150
               W+ +C+  MA LAKE++T+RRVL+  F +FDN   W   HGLAF VL D+   +ESSG
Sbjct  282   CFWSRVCVHNMAKLAKEATTIRRVLESFFRYFDNGNLWSSEHGLAFPVLKDMQLLMESSG  341

Query  1151  -NHQLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLR  1327
              +   +L+ +++HLDH+NV     ++  +++  T LA+  +     + IG VSD+ RHLR
Sbjct  342   QSTHFLLSILIKHLDHRNVLKQPSMQIDIVEVTTFLAQHAKVEPSVAIIGAVSDVMRHLR  401

Query  1328  KSLQATVDLA--GEEI  1369
             KS+  ++D A  GE++
Sbjct  402   KSIHCSLDDANLGEDV  417



>ref|XP_010057221.1| PREDICTED: uncharacterized protein LOC104445096 isoform X2 [Eucalyptus 
grandis]
Length=1036

 Score =   249 bits (637),  Expect(2) = 7e-93, Method: Compositional matrix adjust.
 Identities = 108/214 (50%), Positives = 155/214 (72%), Gaps = 0/214 (0%)
 Frame = +1

Query  148  GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  327
            G++SR++ P C S+C  CPA+R+RSRQPVKRYKKL++DIFPK+ D   N RKI KLCEYA
Sbjct  6    GVISRQVLPVCGSLCFFCPAMRARSRQPVKRYKKLISDIFPKNQDEEPNDRKIGKLCEYA  65

Query  328  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  507
            AKNP RIPKI   LE+RCYKELR+ + +   ++  +Y +LL  CK+QM  FA +LL+++ 
Sbjct  66   AKNPLRIPKITSTLEQRCYKELRTENFRSAKIVMCIYRKLLVSCKDQMPLFASSLLSIIS  125

Query  508  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRA  687
             +LD  + D ++ IGC     F+ +Q DGTY +N+E  + K+C LA+E G++++ + LRA
Sbjct  126  TLLDQTRQDEMQLIGCQNLFDFVNNQGDGTYMFNLEGFIPKLCQLAQELGQDERAQHLRA  185

Query  688  SSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNY  789
            + L+ LS+M+WFM E+SH   +FD +V V L+NY
Sbjct  186  AGLQALSSMIWFMGEYSHFSGEFDNVVSVVLENY  219


 Score =   120 bits (301),  Expect(2) = 7e-93, Method: Compositional matrix adjust.
 Identities = 68/196 (35%), Positives = 113/196 (58%), Gaps = 10/196 (5%)
 Frame = +2

Query  803   INEDDERGEAHHNWVDEVIRSEGRDVGNENRPGYLIRKRPDKKDIS----LLTSEEIEMP  970
             ++ED  +  + + WV EV++ EG    +   P   +R    KK ++    +  + + + P
Sbjct  225   VSEDPNKQGSENRWVQEVLKHEGHVSAS---PEVTMRVPSWKKLVNDKGEVNATVDAKNP  281

Query  971   KIWAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSG  1150
               W+ +C+  MA LAKE++T+RRVL+  F +FDN   W   HGLAF VL D+   +ESSG
Sbjct  282   CFWSRVCVHNMAKLAKEATTIRRVLESFFRYFDNGNLWSSEHGLAFPVLKDMQLLMESSG  341

Query  1151  NH-QLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLR  1327
                  +L+ +++HLDH+NV     ++  +++  T LA+  +     + IG VSD+ RHLR
Sbjct  342   QSTHFLLSILIKHLDHRNVLKQPSMQIDIVEVTTFLAQHAKVEPSVAIIGAVSDVMRHLR  401

Query  1328  KSLQATVDLA--GEEI  1369
             KS+  ++D A  GE++
Sbjct  402   KSIHCSLDDANLGEDV  417



>gb|KCW90195.1| hypothetical protein EUGRSUZ_A02368 [Eucalyptus grandis]
Length=1010

 Score =   249 bits (637),  Expect(2) = 7e-93, Method: Compositional matrix adjust.
 Identities = 108/214 (50%), Positives = 155/214 (72%), Gaps = 0/214 (0%)
 Frame = +1

Query  148  GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  327
            G++SR++ P C S+C  CPA+R+RSRQPVKRYKKL++DIFPK+ D   N RKI KLCEYA
Sbjct  6    GVISRQVLPVCGSLCFFCPAMRARSRQPVKRYKKLISDIFPKNQDEEPNDRKIGKLCEYA  65

Query  328  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  507
            AKNP RIPKI   LE+RCYKELR+ + +   ++  +Y +LL  CK+QM  FA +LL+++ 
Sbjct  66   AKNPLRIPKITSTLEQRCYKELRTENFRSAKIVMCIYRKLLVSCKDQMPLFASSLLSIIS  125

Query  508  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRA  687
             +LD  + D ++ IGC     F+ +Q DGTY +N+E  + K+C LA+E G++++ + LRA
Sbjct  126  TLLDQTRQDEMQLIGCQNLFDFVNNQGDGTYMFNLEGFIPKLCQLAQELGQDERAQHLRA  185

Query  688  SSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNY  789
            + L+ LS+M+WFM E+SH   +FD +V V L+NY
Sbjct  186  AGLQALSSMIWFMGEYSHFSGEFDNVVSVVLENY  219


 Score =   120 bits (302),  Expect(2) = 7e-93, Method: Compositional matrix adjust.
 Identities = 68/196 (35%), Positives = 113/196 (58%), Gaps = 10/196 (5%)
 Frame = +2

Query  803   INEDDERGEAHHNWVDEVIRSEGRDVGNENRPGYLIRKRPDKKDIS----LLTSEEIEMP  970
             ++ED  +  + + WV EV++ EG    +   P   +R    KK ++    +  + + + P
Sbjct  225   VSEDPNKQGSENRWVQEVLKHEGHVSAS---PEVTMRVPSWKKLVNDKGEVNATVDAKNP  281

Query  971   KIWAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSG  1150
               W+ +C+  MA LAKE++T+RRVL+  F +FDN   W   HGLAF VL D+   +ESSG
Sbjct  282   CFWSRVCVHNMAKLAKEATTIRRVLESFFRYFDNGNLWSSEHGLAFPVLKDMQLLMESSG  341

Query  1151  NH-QLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLR  1327
                  +L+ +++HLDH+NV     ++  +++  T LA+  +     + IG VSD+ RHLR
Sbjct  342   QSTHFLLSILIKHLDHRNVLKQPSMQIDIVEVTTFLAQHAKVEPSVAIIGAVSDVMRHLR  401

Query  1328  KSLQATVDLA--GEEI  1369
             KS+  ++D A  GE++
Sbjct  402   KSIHCSLDDANLGEDV  417



>ref|XP_010241506.1| PREDICTED: uncharacterized protein LOC104586087 isoform X1 [Nelumbo 
nucifera]
Length=998

 Score =   252 bits (643),  Expect(2) = 1e-92, Method: Compositional matrix adjust.
 Identities = 113/215 (53%), Positives = 156/215 (73%), Gaps = 0/215 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG++SR++ P C ++C  CP++R+RSRQPVKRYKKLL+DIFP+S D   N RKI KLCEY
Sbjct  1    MGVMSRRVVPVCGNLCFFCPSMRARSRQPVKRYKKLLSDIFPRSQDAEPNDRKIGKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            A+KNP RIPKI K LE+RCYK+LR+ H   V V+  +Y +LL  CK+QM  FA ++L +V
Sbjct  61   ASKNPLRIPKITKYLEQRCYKDLRNEHFGSVKVVLCIYRKLLSSCKDQMPLFASSILCIV  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
              +L+ ++ D ++ +GC T   FI SQ D TY +N+E L+ K+C LA+E G+ ++   +R
Sbjct  121  RTLLEQSRQDEMRILGCQTLVDFINSQTDSTYMFNLEGLIPKLCELAQEFGDSERTLSVR  180

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNY  789
            A+ L+ L+ MVWFM E+SHI  DFD I+ V LDNY
Sbjct  181  AAGLQALAFMVWFMGEYSHISMDFDNIISVVLDNY  215


 Score =   117 bits (294),  Expect(2) = 1e-92, Method: Compositional matrix adjust.
 Identities = 66/195 (34%), Positives = 109/195 (56%), Gaps = 15/195 (8%)
 Frame = +2

Query  818   ERGEAHHNWVDEVIRSEGRDVGNENRPGYLIRKRPDKKDISLLTSEEIE-------MPKI  976
             E  +    WV EV++++       +    + +K P   D+ + T  E++        P  
Sbjct  230   ENSQLQDQWVQEVLKAQDHCSSFPD----ISKKVPRLPDV-MNTKPELDPTVDVSKSPTY  284

Query  977   WAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSG-N  1153
             W+ +C+  MA LAKE++T+RRVLDP+F +FD   +W P+ G A  VLSDL   +E SG N
Sbjct  285   WSRVCLHNMAGLAKEATTVRRVLDPLFRNFDTGNNWSPKKGFACSVLSDLQSLMEKSGQN  344

Query  1154  HQLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKS  1333
               L+L+ +V+HLDHKNV     ++  ++     LA+ ++     + IG ++DL +HLRK 
Sbjct  345   THLLLSILVKHLDHKNVIRKPSMQIEIVDVIIYLAQHVKMQSSVAIIGAITDLIKHLRKC  404

Query  1334  LQATVDLA--GEEIN  1372
             +Q + + +  G+E N
Sbjct  405   MQCSSEASNPGDETN  419



>ref|XP_010241507.1| PREDICTED: uncharacterized protein LOC104586087 isoform X2 [Nelumbo 
nucifera]
Length=997

 Score =   251 bits (642),  Expect(2) = 1e-92, Method: Compositional matrix adjust.
 Identities = 113/215 (53%), Positives = 156/215 (73%), Gaps = 0/215 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG++SR++ P C ++C  CP++R+RSRQPVKRYKKLL+DIFP+S D   N RKI KLCEY
Sbjct  1    MGVMSRRVVPVCGNLCFFCPSMRARSRQPVKRYKKLLSDIFPRSQDAEPNDRKIGKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            A+KNP RIPKI K LE+RCYK+LR+ H   V V+  +Y +LL  CK+QM  FA ++L +V
Sbjct  61   ASKNPLRIPKITKYLEQRCYKDLRNEHFGSVKVVLCIYRKLLSSCKDQMPLFASSILCIV  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
              +L+ ++ D ++ +GC T   FI SQ D TY +N+E L+ K+C LA+E G+ ++   +R
Sbjct  121  RTLLEQSRQDEMRILGCQTLVDFINSQTDSTYMFNLEGLIPKLCELAQEFGDSERTLSVR  180

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNY  789
            A+ L+ L+ MVWFM E+SHI  DFD I+ V LDNY
Sbjct  181  AAGLQALAFMVWFMGEYSHISMDFDNIISVVLDNY  215


 Score =   117 bits (294),  Expect(2) = 1e-92, Method: Compositional matrix adjust.
 Identities = 66/195 (34%), Positives = 109/195 (56%), Gaps = 15/195 (8%)
 Frame = +2

Query  818   ERGEAHHNWVDEVIRSEGRDVGNENRPGYLIRKRPDKKDISLLTSEEIE-------MPKI  976
             E  +    WV EV++++       +    + +K P   D+ + T  E++        P  
Sbjct  230   ENSQLQDQWVQEVLKAQDHCSSFPD----ISKKVPRLPDV-MNTKPELDPTVDVSKSPTY  284

Query  977   WAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSG-N  1153
             W+ +C+  MA LAKE++T+RRVLDP+F +FD   +W P+ G A  VLSDL   +E SG N
Sbjct  285   WSRVCLHNMAGLAKEATTVRRVLDPLFRNFDTGNNWSPKKGFACSVLSDLQSLMEKSGQN  344

Query  1154  HQLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKS  1333
               L+L+ +V+HLDHKNV     ++  ++     LA+ ++     + IG ++DL +HLRK 
Sbjct  345   THLLLSILVKHLDHKNVIRKPSMQIEIVDVIIYLAQHVKMQSSVAIIGAITDLIKHLRKC  404

Query  1334  LQATVDLA--GEEIN  1372
             +Q + + +  G+E N
Sbjct  405   MQCSSEASNPGDETN  419



>ref|XP_002264735.1| PREDICTED: uncharacterized protein LOC100264644 isoform X1 [Vitis 
vinifera]
 ref|XP_010650556.1| PREDICTED: uncharacterized protein LOC100264644 isoform X1 [Vitis 
vinifera]
 ref|XP_010650557.1| PREDICTED: uncharacterized protein LOC100264644 isoform X1 [Vitis 
vinifera]
 emb|CBI36655.3| unnamed protein product [Vitis vinifera]
Length=1000

 Score =   256 bits (655),  Expect(2) = 4e-92, Method: Compositional matrix adjust.
 Identities = 117/215 (54%), Positives = 157/215 (73%), Gaps = 0/215 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG++SR++ PAC ++C  CP+LR+RSRQPVKRYKKLLADIFP+S D   N RKI KLCEY
Sbjct  1    MGVMSRRVVPACGNLCFFCPSLRARSRQPVKRYKKLLADIFPRSQDAEPNERKIGKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            A+KN  RIPKI   LE+RCYK+LR+GH     V+  +Y +LL  CKEQM  +A +LL +V
Sbjct  61   ASKNALRIPKITDYLEQRCYKDLRNGHFGSAKVVLCIYRKLLSSCKEQMPFYASSLLGMV  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
              +L+  + D ++ +GC T   FI SQ+DGTY +N+E L+ K+C LA+E GE+++   LR
Sbjct  121  RILLEQTRHDEMRILGCSTLVDFINSQMDGTYMFNLEGLIPKLCQLAQEPGEDERALSLR  180

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNY  789
            ++ L+ L+ MVWFM E SHI  DFD I+ VTL+NY
Sbjct  181  SAGLQALAFMVWFMGEHSHISMDFDNIISVTLENY  215


 Score =   111 bits (277),  Expect(2) = 4e-92, Method: Compositional matrix adjust.
 Identities = 60/190 (32%), Positives = 106/190 (56%), Gaps = 13/190 (7%)
 Frame = +2

Query  806   NEDDERGEAHHNWVDEVIRSEGR-----DVGNE--NRPGYLIRKRPDKKDISLLTSEEIE  964
             +ED    +    WV  ++++E       D+  +  + P + I+ +P+       T++  +
Sbjct  226   DEDKHHSQNQDQWVQGILKTEENGSSFPDISKKVPSLPNH-IKAKPELDS----TADTSK  280

Query  965   MPKIWAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVES  1144
              P  W+ +C+  MA L+KE++T+RRVL+P F +FD   +W    GLA+ VL  L   +E 
Sbjct  281   SPCYWSRVCLHNMAILSKEATTVRRVLEPFFHNFDAENYWSSEKGLAYSVLMYLQSLLEE  340

Query  1145  SG-NHQLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRH  1321
             SG N  L+L+ +V+HLDHKNV     I++ ++   T LA+  +     + +G ++DL +H
Sbjct  341   SGDNSHLLLSILVKHLDHKNVVKQPHIQTDIVNVTTQLAQNAKQQTSLAMVGAITDLMKH  400

Query  1322  LRKSLQATVD  1351
             LRK +Q + +
Sbjct  401   LRKCMQYSAE  410



>ref|XP_004304390.1| PREDICTED: uncharacterized protein LOC101298629 [Fragaria vesca 
subsp. vesca]
Length=1028

 Score =   251 bits (642),  Expect(2) = 5e-92, Method: Compositional matrix adjust.
 Identities = 112/214 (52%), Positives = 157/214 (73%), Gaps = 0/214 (0%)
 Frame = +1

Query  148  GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  327
            G++SR++ PAC S+C  CP LR+RSRQPVKRYKKL+ADIFPK+ +   N RKI KLCEYA
Sbjct  6    GVVSRQVLPACGSLCFFCPGLRARSRQPVKRYKKLIADIFPKNQEEGPNDRKIGKLCEYA  65

Query  328  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  507
            +KNP RIPKI   LE+RCYKELR+ + +   ++  +Y +LL  CKEQM  FA +LL+++ 
Sbjct  66   SKNPLRIPKITTSLEQRCYKELRNENFRSTKIVMCIYKKLLITCKEQMPLFASSLLSIMH  125

Query  508  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRA  687
             +LD  + D ++ IGC T   F+ +QVDGTY +N+E  + K+C +A+E GE+++   LR+
Sbjct  126  TLLDQTRQDEMQIIGCQTLFDFVNNQVDGTYMFNLEGFIPKLCQIAQEPGEDERANNLRS  185

Query  688  SSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNY  789
            ++L+ LS+MVWFM + SHI  +FD IV V L+NY
Sbjct  186  AALQALSSMVWFMGQNSHISVEFDNIVAVVLENY  219


 Score =   115 bits (289),  Expect(2) = 5e-92, Method: Compositional matrix adjust.
 Identities = 69/189 (37%), Positives = 107/189 (57%), Gaps = 9/189 (5%)
 Frame = +2

Query  812   DDERGEAHHN-WVDEVIRSEG----RDVGNENRPGYLIRKRPDKKDISLLTSEEIEMPKI  976
             D +  E   N WV EV  +EG    +DV    RP   I    D K    ++ E+      
Sbjct  221   DSKENEGPQNQWVQEVQTNEGGVSPQDVKMRIRPWSAIV---DAKGELKVSEEDARNVSF  277

Query  977   WAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSG-N  1153
             W+ +C+  MA LAKE++T+RRVL+ +F +FDN   W  +HGLA  VL D+ + ++SSG N
Sbjct  278   WSRVCLHNMAKLAKEATTIRRVLESLFRYFDNGNLWSLKHGLAISVLKDIQFLMDSSGQN  337

Query  1154  HQLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKS  1333
               ++L+ +++HLDHKNV     ++  +++  T+LA   +     + IG +SD  RHLRKS
Sbjct  338   THVLLSILMKHLDHKNVLKQPNMQLDIVEITTSLALHAKVEPSVAIIGALSDAMRHLRKS  397

Query  1334  LQATVDLAG  1360
             +  ++D A 
Sbjct  398   IHCSLDDAN  406



>ref|XP_004250744.1| PREDICTED: uncharacterized protein LOC101250362 isoform X2 [Solanum 
lycopersicum]
Length=993

 Score =   259 bits (662),  Expect(2) = 5e-92, Method: Compositional matrix adjust.
 Identities = 114/215 (53%), Positives = 156/215 (73%), Gaps = 0/215 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG++SRK+ PAC S+C  CP+LR+RSRQPVKRYKKLL +IFPKS D   N RKI KLCEY
Sbjct  1    MGVMSRKVVPACGSLCFFCPSLRARSRQPVKRYKKLLGEIFPKSQDAEPNDRKIAKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            A++NP RIPKI + LE+RCYK+LR+ H   V V+  +Y +LL  CKEQM  +A +LL ++
Sbjct  61   ASRNPLRIPKITEYLEQRCYKDLRNEHLGSVKVVTMIYRKLLSSCKEQMPLYAASLLGII  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
              + +  + D ++ +GC T   FI SQ+DGTY +N+E L+ K+C LARE G++D+   LR
Sbjct  121  RTLFEQTQHDEMQILGCNTLVDFINSQMDGTYMFNLEGLIPKLCQLAREVGDDDRALRLR  180

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNY  789
            ++ ++ L+ +VWFM E SHI  DFD I+  TL+NY
Sbjct  181  SAGMQTLAVLVWFMGEQSHISIDFDHIITATLENY  215


 Score =   108 bits (269),  Expect(2) = 5e-92, Method: Compositional matrix adjust.
 Identities = 58/194 (30%), Positives = 102/194 (53%), Gaps = 3/194 (2%)
 Frame = +2

Query  809   EDDERGEAHHNWVDEVIRSEGRDVGNENRPGYLIRKRPDKKDISLLTS-EEIEMPKIWAH  985
             +D ++ +    WV  V+ S+       +     +   P+  + +  +S E  + P  WA 
Sbjct  226   QDSKQSQPSEQWVQGVLNSDDHSSSFPDM-SKKVSTSPNIMNANTTSSIETAKSPSYWAR  284

Query  986   ICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSG-NHQL  1162
             +C++ MA L KE++++RRVL+P+F  FD   +W    GLA  VL  L   +E SG N  L
Sbjct  285   VCLRNMALLTKEATSVRRVLEPLFHSFDTENYWASEKGLACSVLMHLQCLLEESGENSHL  344

Query  1163  ILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKSLQA  1342
             +L+ +V+HLDHKN+     I+  ++   T L    +     + +G ++DL +HLRK +Q 
Sbjct  345   LLSILVKHLDHKNIVKQPDIQISIVNVVTHLVESAKEKASATIVGVINDLIKHLRKCMQY  404

Query  1343  TVDLAGEEINLNLT  1384
             + + +  +  LN +
Sbjct  405   STEASSPKDGLNTS  418



>ref|XP_012086147.1| PREDICTED: uncharacterized protein LOC105645218 isoform X1 [Jatropha 
curcas]
Length=1013

 Score =   242 bits (617),  Expect(2) = 5e-92, Method: Compositional matrix adjust.
 Identities = 107/215 (50%), Positives = 153/215 (71%), Gaps = 0/215 (0%)
 Frame = +1

Query  148  GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  327
            G++SR+L PAC S+C  CP LR+RSRQP+KRYKK+++ IFP++ +   N R I KLCEYA
Sbjct  6    GVISRQLLPACGSLCFFCPGLRARSRQPIKRYKKIISGIFPRNQEDGPNERMIGKLCEYA  65

Query  328  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  507
            +KNP RIPKI   LE+RCYKELR+ +     ++  +Y +LL  CKEQM  FA +LL+++ 
Sbjct  66   SKNPLRIPKITNSLEQRCYKELRNENIHSAKIVICIYRKLLTSCKEQMPLFASSLLSIMH  125

Query  508  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRA  687
             +LD  +   ++ IGC T   F+ +Q DGT+ +N+E  + K+C LA+E GE+D+ + LR+
Sbjct  126  ILLDQTRQGELQLIGCDTLFDFVNNQKDGTFMFNLEGFLPKLCQLAQEVGEDDRAKNLRS  185

Query  688  SSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNYE  792
            + L+ LS+M+WFM E SHI  +FD IV V L+NYE
Sbjct  186  AGLQALSSMIWFMGEHSHISVEFDNIVSVVLENYE  220


 Score =   125 bits (314),  Expect(2) = 5e-92, Method: Compositional matrix adjust.
 Identities = 62/190 (33%), Positives = 114/190 (60%), Gaps = 8/190 (4%)
 Frame = +2

Query  803   INEDDERGEAHHNWVDEVIRSEGRDVGNENRPGYLIRKRP------DKKDISLLTSEEIE  964
             +N D ++ +    WV EV+++EG  +    +P  + R         +K ++++ T+E+ +
Sbjct  227   VNLDGDKQDPPDRWVQEVLKNEGHAIHANPQPDSMTRVPSWRTVVNEKGEVNV-TAEDAQ  285

Query  965   MPKIWAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVES  1144
              P  W+ +C+  MA L KE++ +RRVL+ +F +FD    W   +G+A+ VL D+   +E+
Sbjct  286   SPSFWSRVCLYNMAQLGKEATNIRRVLESLFRYFDFTNLWSLDYGVAYPVLKDMQLLMEN  345

Query  1145  SG-NHQLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRH  1321
             SG N  ++L+ +++HLDHKNV     ++  +++  T+LAR  +     + +G VSD+ RH
Sbjct  346   SGQNTHVLLSTLIKHLDHKNVLKQPNMQLEIVEVTTSLARDAKVESSMAIMGAVSDVMRH  405

Query  1322  LRKSLQATVD  1351
             LRKS+Q ++D
Sbjct  406   LRKSIQCSLD  415



>ref|XP_010313082.1| PREDICTED: uncharacterized protein LOC101250362 isoform X1 [Solanum 
lycopersicum]
Length=994

 Score =   259 bits (662),  Expect(2) = 5e-92, Method: Compositional matrix adjust.
 Identities = 114/215 (53%), Positives = 156/215 (73%), Gaps = 0/215 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG++SRK+ PAC S+C  CP+LR+RSRQPVKRYKKLL +IFPKS D   N RKI KLCEY
Sbjct  1    MGVMSRKVVPACGSLCFFCPSLRARSRQPVKRYKKLLGEIFPKSQDAEPNDRKIAKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            A++NP RIPKI + LE+RCYK+LR+ H   V V+  +Y +LL  CKEQM  +A +LL ++
Sbjct  61   ASRNPLRIPKITEYLEQRCYKDLRNEHLGSVKVVTMIYRKLLSSCKEQMPLYAASLLGII  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
              + +  + D ++ +GC T   FI SQ+DGTY +N+E L+ K+C LARE G++D+   LR
Sbjct  121  RTLFEQTQHDEMQILGCNTLVDFINSQMDGTYMFNLEGLIPKLCQLAREVGDDDRALRLR  180

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNY  789
            ++ ++ L+ +VWFM E SHI  DFD I+  TL+NY
Sbjct  181  SAGMQTLAVLVWFMGEQSHISIDFDHIITATLENY  215


 Score =   108 bits (269),  Expect(2) = 5e-92, Method: Compositional matrix adjust.
 Identities = 58/194 (30%), Positives = 102/194 (53%), Gaps = 3/194 (2%)
 Frame = +2

Query  809   EDDERGEAHHNWVDEVIRSEGRDVGNENRPGYLIRKRPDKKDISLLTS-EEIEMPKIWAH  985
             +D ++ +    WV  V+ S+       +     +   P+  + +  +S E  + P  WA 
Sbjct  226   QDSKQSQPSEQWVQGVLNSDDHSSSFPDM-SKKVSTSPNIMNANTTSSIETAKSPSYWAR  284

Query  986   ICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSG-NHQL  1162
             +C++ MA L KE++++RRVL+P+F  FD   +W    GLA  VL  L   +E SG N  L
Sbjct  285   VCLRNMALLTKEATSVRRVLEPLFHSFDTENYWASEKGLACSVLMHLQCLLEESGENSHL  344

Query  1163  ILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKSLQA  1342
             +L+ +V+HLDHKN+     I+  ++   T L    +     + +G ++DL +HLRK +Q 
Sbjct  345   LLSILVKHLDHKNIVKQPDIQISIVNVVTHLVESAKEKASATIVGVINDLIKHLRKCMQY  404

Query  1343  TVDLAGEEINLNLT  1384
             + + +  +  LN +
Sbjct  405   STEASSPKDGLNTS  418



>ref|XP_004951914.1| PREDICTED: uncharacterized protein LOC101783143 isoform X1 [Setaria 
italica]
Length=1032

 Score =   246 bits (629),  Expect(2) = 5e-92, Method: Compositional matrix adjust.
 Identities = 111/224 (50%), Positives = 157/224 (70%), Gaps = 1/224 (0%)
 Frame = +1

Query  127  LSLQGKM-GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRK  303
            + L G + G++SRK+ PAC  +C  CP+LR RSRQPVKRYKK++ADIFP S +   N R+
Sbjct  1    MGLNGAVSGMVSRKVLPACGGLCYLCPSLRPRSRQPVKRYKKIIADIFPSSQEDEPNERR  60

Query  304  IMKLCEYAAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFA  483
            I KLCEY A+NP R+PKI   LE+RCYKELRS H     V+  +Y  LL  CKEQ+   A
Sbjct  61   IGKLCEYVARNPQRVPKITDYLEQRCYKELRSEHYGYAKVVVLIYRRLLVSCKEQIPLLA  120

Query  484  VNLLNVVVEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEE  663
             +LL+++  +LD ++ D ++ IGC     F+ +QVDGTY +N+E LV ++C L++   E+
Sbjct  121  SSLLSIIQTLLDQSRQDDMRIIGCEALFDFVVTQVDGTYQFNLEELVPRLCKLSQVVRED  180

Query  664  DQKRCLRASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNYEP  795
            ++   LRA++L+ L AMVWFM E SHI ++FD++V V L++YEP
Sbjct  181  EKANALRAAALQSLCAMVWFMGELSHISSEFDDVVQVVLESYEP  224


 Score =   120 bits (302),  Expect(2) = 5e-92, Method: Compositional matrix adjust.
 Identities = 61/176 (35%), Positives = 101/176 (57%), Gaps = 11/176 (6%)
 Frame = +2

Query  842   WVDEVIRSEGRDVGNENRPGYLIRKRPDKKDISL------LTSEEIEMPKIWAHICIQRM  1003
             WV+E+++ EG          + I   P  K I        L  E+ + P  W+ IC+  M
Sbjct  241   WVEEILKIEGHAASTP----FTISTIPSWKSIVSDNGGIHLPMEDAKDPSFWSRICVHNM  296

Query  1004  ADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSGNH-QLILTGVV  1180
             A L++E++T RRV+D +F HFDN   W   +GLA  VL D+  F+E+SG H  L+++ +V
Sbjct  297   ATLSREATTFRRVMDSLFRHFDNTNSWSSTNGLALCVLLDMQMFMENSGQHINLMISILV  356

Query  1181  RHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKSLQATV  1348
             +HL+HK +    +++  +++  +ALA Q R+    + IG +SDL RH++K+L   +
Sbjct  357   KHLEHKAILKQPEMQLSIVEVISALAEQSRAQASAATIGAISDLVRHMKKTLHVAL  412



>emb|CDP18636.1| unnamed protein product [Coffea canephora]
Length=1027

 Score =   247 bits (630),  Expect(2) = 8e-92, Method: Compositional matrix adjust.
 Identities = 108/214 (50%), Positives = 156/214 (73%), Gaps = 0/214 (0%)
 Frame = +1

Query  148  GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  327
            G++SR++ PAC S+C  CPA+R+RSRQPVKRYKKL++DIFP+S +   N RKI KLCEYA
Sbjct  6    GVISRQVLPACGSLCFFCPAMRARSRQPVKRYKKLISDIFPRSQEEEPNERKISKLCEYA  65

Query  328  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  507
            AKNP RIPKI   LE+RCYKE+R+ + + V ++  +Y +LL  CKEQM  FA +LL+++ 
Sbjct  66   AKNPLRIPKITTSLEQRCYKEIRNENFRSVKIVMSIYRKLLISCKEQMPLFANSLLSIIH  125

Query  508  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRA  687
             +L+  + D +   GC +   F+ +Q DGTY +N+E  + K+C  A+E G++++ + LRA
Sbjct  126  TLLEQTRQDDILITGCQSLFDFVNNQKDGTYMFNLEGFIPKLCQFAQEVGDDERAKHLRA  185

Query  688  SSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNY  789
            + L+ L+A+VWFM E+ HI A+FD IV V L+NY
Sbjct  186  AGLQSLAALVWFMGEYCHISAEFDNIVSVVLENY  219


 Score =   119 bits (299),  Expect(2) = 8e-92, Method: Compositional matrix adjust.
 Identities = 65/183 (36%), Positives = 108/183 (59%), Gaps = 11/183 (6%)
 Frame = +2

Query  833   HHNWVDEVIRSEGRDVGNENRPGYLIRKRP------DKKDISLLTSEEIEMPKIWAHICI  994
              + WV EV + EG    + +    L+ K P      + K I+ +  E+ + P  W+ +C+
Sbjct  232   QNKWVQEVRKGEGHVSPSPD----LLTKVPSWRMLVNDKGIANVPMEDAQDPCFWSRVCL  287

Query  995   QRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSG-NHQLILT  1171
               MA + KE++TMRRVL+ +F +FDN   W   +G+AF VL D+   ++ SG N   +L+
Sbjct  288   HNMAKIGKEATTMRRVLESLFRYFDNGNLWESGYGIAFPVLKDMQLIMDGSGQNTHFLLS  347

Query  1172  GVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKSLQATVD  1351
              +V+HLDHKNV     ++  +++ AT+LA+  ++ G  + IG V+D+ RHLRKS+  ++D
Sbjct  348   ILVKHLDHKNVLKQPDMQLDIVKVATSLAQDTKTLGSVAIIGAVTDIMRHLRKSIHYSLD  407

Query  1352  LAG  1360
              A 
Sbjct  408   DAN  410



>ref|XP_006352098.1| PREDICTED: uncharacterized protein LOC102584417 isoform X1 [Solanum 
tuberosum]
Length=1000

 Score =   259 bits (662),  Expect(2) = 8e-92, Method: Compositional matrix adjust.
 Identities = 114/215 (53%), Positives = 156/215 (73%), Gaps = 0/215 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG++SRK+ PAC S+C  CP+LR+RSRQPVKRYKKLL +IFPKS D   N RKI KLCEY
Sbjct  1    MGVMSRKVVPACGSLCFFCPSLRARSRQPVKRYKKLLGEIFPKSQDAEPNDRKIAKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            A++NP RIPKI + LE+RCYK+LR+ H   V V+  +Y +LL  CKEQM  +A +LL ++
Sbjct  61   ASRNPLRIPKITEYLEQRCYKDLRNEHLGSVKVVTMIYRKLLSSCKEQMPLYAASLLGII  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
              + +  + D ++ +GC T   FI SQ+DGTY +N+E L+ K+C LARE G++D+   LR
Sbjct  121  RTLFEQTQHDEMQILGCNTLVDFINSQMDGTYMFNLEGLIPKLCQLAREVGDDDRALRLR  180

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNY  789
            ++ ++ L+ +VWFM E SHI  DFD I+  TL+NY
Sbjct  181  SAGMQTLAVLVWFMGEQSHISIDFDHIITATLENY  215


 Score =   107 bits (267),  Expect(2) = 8e-92, Method: Compositional matrix adjust.
 Identities = 60/196 (31%), Positives = 101/196 (52%), Gaps = 9/196 (5%)
 Frame = +2

Query  809   EDDERGEAHHNWVDEVIRSEGRDVGNENRP--GYLIRKRPDKKDISLLTSEEIEM---PK  973
             +D ++ E    WV  V+ S   D  + + P     +   P+  + +   +  IE    P 
Sbjct  226   QDSKQSEPSEQWVQGVLNS---DYHSSSFPDMSKKVSSSPNSMNANTKLTSSIETAKSPS  282

Query  974   IWAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSG-  1150
              WA +C++ MA L KE++++RRVL+P+F  FD   +W    GLA  VL      +E SG 
Sbjct  283   YWARVCLRNMALLTKEATSVRRVLEPLFHSFDTENYWGSEKGLACSVLMHFQCLLEESGE  342

Query  1151  NHQLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRK  1330
             N  L+L+ +V+HLDHKN+     I+  ++   T L    +     + +G ++DL +HLRK
Sbjct  343   NSHLLLSILVKHLDHKNIVKQPDIQISIVNVVTHLVESAKEKASATIVGVINDLIKHLRK  402

Query  1331  SLQATVDLAGEEINLN  1378
              +Q + + +  +  LN
Sbjct  403   CMQYSTEASSPKDGLN  418



>ref|XP_006352099.1| PREDICTED: uncharacterized protein LOC102584417 isoform X2 [Solanum 
tuberosum]
Length=999

 Score =   259 bits (662),  Expect(2) = 1e-91, Method: Compositional matrix adjust.
 Identities = 114/215 (53%), Positives = 156/215 (73%), Gaps = 0/215 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG++SRK+ PAC S+C  CP+LR+RSRQPVKRYKKLL +IFPKS D   N RKI KLCEY
Sbjct  1    MGVMSRKVVPACGSLCFFCPSLRARSRQPVKRYKKLLGEIFPKSQDAEPNDRKIAKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            A++NP RIPKI + LE+RCYK+LR+ H   V V+  +Y +LL  CKEQM  +A +LL ++
Sbjct  61   ASRNPLRIPKITEYLEQRCYKDLRNEHLGSVKVVTMIYRKLLSSCKEQMPLYAASLLGII  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
              + +  + D ++ +GC T   FI SQ+DGTY +N+E L+ K+C LARE G++D+   LR
Sbjct  121  RTLFEQTQHDEMQILGCNTLVDFINSQMDGTYMFNLEGLIPKLCQLAREVGDDDRALRLR  180

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNY  789
            ++ ++ L+ +VWFM E SHI  DFD I+  TL+NY
Sbjct  181  SAGMQTLAVLVWFMGEQSHISIDFDHIITATLENY  215


 Score =   107 bits (266),  Expect(2) = 1e-91, Method: Compositional matrix adjust.
 Identities = 60/196 (31%), Positives = 101/196 (52%), Gaps = 9/196 (5%)
 Frame = +2

Query  809   EDDERGEAHHNWVDEVIRSEGRDVGNENRP--GYLIRKRPDKKDISLLTSEEIEM---PK  973
             +D ++ E    WV  V+ S   D  + + P     +   P+  + +   +  IE    P 
Sbjct  226   QDSKQSEPSEQWVQGVLNS---DYHSSSFPDMSKKVSSSPNSMNANTKLTSSIETAKSPS  282

Query  974   IWAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSG-  1150
              WA +C++ MA L KE++++RRVL+P+F  FD   +W    GLA  VL      +E SG 
Sbjct  283   YWARVCLRNMALLTKEATSVRRVLEPLFHSFDTENYWGSEKGLACSVLMHFQCLLEESGE  342

Query  1151  NHQLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRK  1330
             N  L+L+ +V+HLDHKN+     I+  ++   T L    +     + +G ++DL +HLRK
Sbjct  343   NSHLLLSILVKHLDHKNIVKQPDIQISIVNVVTHLVESAKEKASATIVGVINDLIKHLRK  402

Query  1331  SLQATVDLAGEEINLN  1378
              +Q + + +  +  LN
Sbjct  403   CMQYSTEASSPKDGLN  418



>ref|XP_009355500.1| PREDICTED: uncharacterized protein LOC103946512 [Pyrus x bretschneideri]
 ref|XP_009355501.1| PREDICTED: uncharacterized protein LOC103946512 [Pyrus x bretschneideri]
Length=1036

 Score =   254 bits (650),  Expect(2) = 3e-91, Method: Compositional matrix adjust.
 Identities = 114/214 (53%), Positives = 158/214 (74%), Gaps = 0/214 (0%)
 Frame = +1

Query  148  GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  327
            G++SR++ PAC S+C  CPALR+RSRQPVKRYKKL+ADIFP++ +   N RKI KLCEY 
Sbjct  6    GVISRQVLPACGSLCFFCPALRARSRQPVKRYKKLIADIFPRNQEEGPNDRKIGKLCEYV  65

Query  328  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  507
            AKNP RIPKI   LE+RCYKELR+ + +   ++  +YN+LL  CKEQM  FA +LL+++ 
Sbjct  66   AKNPLRIPKITTYLEQRCYKELRNENFRSAKIVMCIYNKLLISCKEQMPLFASSLLSIMH  125

Query  508  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRA  687
             +LD  + D ++ IGC T   F+ +Q DGTYT+N+E  + K+C +A+E GE+++   LR+
Sbjct  126  TLLDQTRQDEMQIIGCQTLFNFVNNQTDGTYTFNLEGFIPKLCQIAQEPGEDERASNLRS  185

Query  688  SSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNY  789
            ++L+ LS+MVWFM E SHI  +FD IV V L+NY
Sbjct  186  AALQALSSMVWFMGENSHISVEFDNIVAVVLENY  219


 Score =   110 bits (274),  Expect(2) = 3e-91, Method: Compositional matrix adjust.
 Identities = 65/190 (34%), Positives = 106/190 (56%), Gaps = 12/190 (6%)
 Frame = +2

Query  806   NEDDERGEAHHN-WVDEVIRSEGRDVGNENRPGYLIRKRP------DKKDISLLTSEEIE  964
             N+  E  E   N WV EV  +EG      + P   IR         DK ++++ T E+ +
Sbjct  223   NKTTENLEGSKNRWVQEVQSNEGH---CSSSPNVAIRLTSWSTLVDDKGELNV-TVEDAK  278

Query  965   MPKIWAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVES  1144
              P  W+ +C+  MA LAKE++T+RRVL+ +F +FD    W P++GLA  VL D+   ++ 
Sbjct  279   NPCFWSRVCLHNMAKLAKEATTIRRVLESLFRYFDTGNLWSPKYGLAIPVLKDIQVLMDD  338

Query  1145  SG-NHQLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRH  1321
              G +  ++L+ +++HLDHKNV     ++  + +  T L++  +     + IG VSD  RH
Sbjct  339   CGQSTHILLSILIKHLDHKNVLKQPNMQLEIAEVTTTLSQLAKVEPSVAIIGAVSDAMRH  398

Query  1322  LRKSLQATVD  1351
             LRKS+  ++D
Sbjct  399   LRKSIHCSLD  408



>ref|XP_009789122.1| PREDICTED: protein EFR3 homolog B isoform X2 [Nicotiana sylvestris]
Length=1010

 Score =   251 bits (641),  Expect(2) = 1e-90, Method: Compositional matrix adjust.
 Identities = 111/219 (51%), Positives = 158/219 (72%), Gaps = 0/219 (0%)
 Frame = +1

Query  133  LQGKMGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMK  312
            + G  G++SR++ PAC ++C  CPA+R+RSRQPVKRYKKL++DIFP+S +   N RKI K
Sbjct  1    MNGVSGVISRQVLPACGNLCFFCPAMRTRSRQPVKRYKKLISDIFPRSQEEEPNDRKIGK  60

Query  313  LCEYAAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNL  492
            LCEYAAKNPFRIPKI K LEERCYKELR+ + +   V+  +Y +L+  CKE M  FA +L
Sbjct  61   LCEYAAKNPFRIPKITKSLEERCYKELRNENFRSAKVVMCIYKKLVVSCKEHMPLFANSL  120

Query  493  LNVVVEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQK  672
            L+++  +LD ++ + +  +GC     F+ +Q DGTY ++++  + K+C LA++ GEE+  
Sbjct  121  LSIIQTLLDQSRENDMLIVGCEALFDFVNNQKDGTYMFHLDGFIPKLCQLAQQIGEEENA  180

Query  673  RCLRASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNY  789
            + LR   L+ LSAMVWFM E+SH+ A+FD IV V L+NY
Sbjct  181  KHLRTVGLKALSAMVWFMGEYSHVSAEFDNIVSVVLENY  219


 Score =   112 bits (279),  Expect(2) = 1e-90, Method: Compositional matrix adjust.
 Identities = 65/210 (31%), Positives = 117/210 (56%), Gaps = 16/210 (8%)
 Frame = +2

Query  782   ITMSQMPINEDDERGEAHHNWVDEVIRSEGRDVGNENRPGYLIRKRP-------DKKDIS  940
             + +   P    + +    + WV+EV + EG    + +    +I K P       +K +++
Sbjct  214   VVLENYPRPRKETQDSNQNRWVEEVRKHEGHISPSPD----VIVKVPSWRMIVNEKGELN  269

Query  941   LLTSEEIEMPKIWAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLS  1120
             + + E+ E P  W+ +C+  +A L KE++T RRVL+ +F +FD++  W    G+A  +L 
Sbjct  270   I-SKEDAENPSFWSKVCLHNIAKLGKEATTTRRVLESLFRYFDDDNLWPTETGIALPILK  328

Query  1121  DLSYFVESSG-NHQLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIG  1297
             D+ Y +++SG N  L+L+ +V+HLDHKNV    +++  ++Q  T+LA+  +     + + 
Sbjct  329   DMQYTMDASGENAHLLLSILVKHLDHKNVLKQPEMQLDIVQVVTSLAQTTKIHHSMALVS  388

Query  1298  FVSDLCRHLRKSLQATVD---LAGEEINLN  1378
              V+D+ RHLRKS+  T+D   L  E I  N
Sbjct  389   AVTDIMRHLRKSIHYTLDDAKLGAELIKWN  418



>ref|XP_009789124.1| PREDICTED: protein EFR3 homolog B isoform X3 [Nicotiana sylvestris]
Length=1008

 Score =   251 bits (641),  Expect(2) = 1e-90, Method: Compositional matrix adjust.
 Identities = 111/219 (51%), Positives = 158/219 (72%), Gaps = 0/219 (0%)
 Frame = +1

Query  133  LQGKMGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMK  312
            + G  G++SR++ PAC ++C  CPA+R+RSRQPVKRYKKL++DIFP+S +   N RKI K
Sbjct  1    MNGVSGVISRQVLPACGNLCFFCPAMRTRSRQPVKRYKKLISDIFPRSQEEEPNDRKIGK  60

Query  313  LCEYAAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNL  492
            LCEYAAKNPFRIPKI K LEERCYKELR+ + +   V+  +Y +L+  CKE M  FA +L
Sbjct  61   LCEYAAKNPFRIPKITKSLEERCYKELRNENFRSAKVVMCIYKKLVVSCKEHMPLFANSL  120

Query  493  LNVVVEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQK  672
            L+++  +LD ++ + +  +GC     F+ +Q DGTY ++++  + K+C LA++ GEE+  
Sbjct  121  LSIIQTLLDQSRENDMLIVGCEALFDFVNNQKDGTYMFHLDGFIPKLCQLAQQIGEEENA  180

Query  673  RCLRASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNY  789
            + LR   L+ LSAMVWFM E+SH+ A+FD IV V L+NY
Sbjct  181  KHLRTVGLKALSAMVWFMGEYSHVSAEFDNIVSVVLENY  219


 Score =   112 bits (279),  Expect(2) = 1e-90, Method: Compositional matrix adjust.
 Identities = 65/210 (31%), Positives = 117/210 (56%), Gaps = 16/210 (8%)
 Frame = +2

Query  782   ITMSQMPINEDDERGEAHHNWVDEVIRSEGRDVGNENRPGYLIRKRP-------DKKDIS  940
             + +   P    + +    + WV+EV + EG    + +    +I K P       +K +++
Sbjct  214   VVLENYPRPRKETQDSNQNRWVEEVRKHEGHISPSPD----VIVKVPSWRMIVNEKGELN  269

Query  941   LLTSEEIEMPKIWAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLS  1120
             + + E+ E P  W+ +C+  +A L KE++T RRVL+ +F +FD++  W    G+A  +L 
Sbjct  270   I-SKEDAENPSFWSKVCLHNIAKLGKEATTTRRVLESLFRYFDDDNLWPTETGIALPILK  328

Query  1121  DLSYFVESSG-NHQLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIG  1297
             D+ Y +++SG N  L+L+ +V+HLDHKNV    +++  ++Q  T+LA+  +     + + 
Sbjct  329   DMQYTMDASGENAHLLLSILVKHLDHKNVLKQPEMQLDIVQVVTSLAQTTKIHHSMALVS  388

Query  1298  FVSDLCRHLRKSLQATVD---LAGEEINLN  1378
              V+D+ RHLRKS+  T+D   L  E I  N
Sbjct  389   AVTDIMRHLRKSIHYTLDDAKLGAELIKWN  418



>ref|XP_009789120.1| PREDICTED: protein EFR3 homolog B isoform X1 [Nicotiana sylvestris]
 ref|XP_009789121.1| PREDICTED: protein EFR3 homolog B isoform X1 [Nicotiana sylvestris]
Length=1012

 Score =   251 bits (641),  Expect(2) = 1e-90, Method: Compositional matrix adjust.
 Identities = 111/219 (51%), Positives = 158/219 (72%), Gaps = 0/219 (0%)
 Frame = +1

Query  133  LQGKMGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMK  312
            + G  G++SR++ PAC ++C  CPA+R+RSRQPVKRYKKL++DIFP+S +   N RKI K
Sbjct  1    MNGVSGVISRQVLPACGNLCFFCPAMRTRSRQPVKRYKKLISDIFPRSQEEEPNDRKIGK  60

Query  313  LCEYAAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNL  492
            LCEYAAKNPFRIPKI K LEERCYKELR+ + +   V+  +Y +L+  CKE M  FA +L
Sbjct  61   LCEYAAKNPFRIPKITKSLEERCYKELRNENFRSAKVVMCIYKKLVVSCKEHMPLFANSL  120

Query  493  LNVVVEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQK  672
            L+++  +LD ++ + +  +GC     F+ +Q DGTY ++++  + K+C LA++ GEE+  
Sbjct  121  LSIIQTLLDQSRENDMLIVGCEALFDFVNNQKDGTYMFHLDGFIPKLCQLAQQIGEEENA  180

Query  673  RCLRASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNY  789
            + LR   L+ LSAMVWFM E+SH+ A+FD IV V L+NY
Sbjct  181  KHLRTVGLKALSAMVWFMGEYSHVSAEFDNIVSVVLENY  219


 Score =   112 bits (279),  Expect(2) = 1e-90, Method: Compositional matrix adjust.
 Identities = 65/210 (31%), Positives = 117/210 (56%), Gaps = 16/210 (8%)
 Frame = +2

Query  782   ITMSQMPINEDDERGEAHHNWVDEVIRSEGRDVGNENRPGYLIRKRP-------DKKDIS  940
             + +   P    + +    + WV+EV + EG    + +    +I K P       +K +++
Sbjct  214   VVLENYPRPRKETQDSNQNRWVEEVRKHEGHISPSPD----VIVKVPSWRMIVNEKGELN  269

Query  941   LLTSEEIEMPKIWAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLS  1120
             + + E+ E P  W+ +C+  +A L KE++T RRVL+ +F +FD++  W    G+A  +L 
Sbjct  270   I-SKEDAENPSFWSKVCLHNIAKLGKEATTTRRVLESLFRYFDDDNLWPTETGIALPILK  328

Query  1121  DLSYFVESSG-NHQLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIG  1297
             D+ Y +++SG N  L+L+ +V+HLDHKNV    +++  ++Q  T+LA+  +     + + 
Sbjct  329   DMQYTMDASGENAHLLLSILVKHLDHKNVLKQPEMQLDIVQVVTSLAQTTKIHHSMALVS  388

Query  1298  FVSDLCRHLRKSLQATVD---LAGEEINLN  1378
              V+D+ RHLRKS+  T+D   L  E I  N
Sbjct  389   AVTDIMRHLRKSIHYTLDDAKLGAELIKWN  418



>ref|XP_009610937.1| PREDICTED: protein EFR3 homolog B isoform X2 [Nicotiana tomentosiformis]
Length=1012

 Score =   248 bits (634),  Expect(2) = 1e-90, Method: Compositional matrix adjust.
 Identities = 110/219 (50%), Positives = 157/219 (72%), Gaps = 0/219 (0%)
 Frame = +1

Query  133  LQGKMGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMK  312
            + G  G++SR++ PAC ++C  CPA+R+RSRQPVKRYKKL++DIFP+S +   N RKI K
Sbjct  1    MNGVSGVISRQVLPACGNLCFFCPAMRTRSRQPVKRYKKLISDIFPRSQEEEPNDRKIGK  60

Query  313  LCEYAAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNL  492
            LCEYAAKNPFRIPKI K LEERCYKELR+ + +   V+  +Y +L+  CKE M  FA +L
Sbjct  61   LCEYAAKNPFRIPKITKSLEERCYKELRNENFRSAKVVMCIYKKLVVSCKEHMPLFANSL  120

Query  493  LNVVVEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQK  672
            L+++  +LD ++ + +  +GC     F+ +Q DGTY ++++  + K+C LA++ GEE+  
Sbjct  121  LSIIQTLLDQSRENDMLIVGCEALFDFVNNQKDGTYMFHLDGFIPKLCQLAQQIGEEESA  180

Query  673  RCLRASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNY  789
            + L    L+ LSAMVWFM E+SH+ A+FD IV V L+NY
Sbjct  181  KHLHTVGLKALSAMVWFMGEYSHVSAEFDNIVSVVLENY  219


 Score =   114 bits (285),  Expect(2) = 1e-90, Method: Compositional matrix adjust.
 Identities = 66/210 (31%), Positives = 117/210 (56%), Gaps = 16/210 (8%)
 Frame = +2

Query  782   ITMSQMPINEDDERGEAHHNWVDEVIRSEGRDVGNENRPGYLIRKRP-------DKKDIS  940
             + +   P    + +    + WV+EV + EG    + +    +I K P       +K +++
Sbjct  214   VVLENYPRPRKETQDSNQNRWVEEVRKVEGHVSPSPD----VIAKVPSWRIIVNEKGELN  269

Query  941   LLTSEEIEMPKIWAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLS  1120
             + + E+ E P  W+ IC+  +A L KE++T RRVL+ +F +FD++  W    G+A  +L 
Sbjct  270   I-SKEDAENPSFWSRICLHNIAKLGKEATTTRRVLESLFCYFDDDNLWPTETGIALPILK  328

Query  1121  DLSYFVESSG-NHQLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIG  1297
             D+ Y +++SG N  L+L+ +V+HLDHKNV    +++  ++Q  T+LA+  +     + + 
Sbjct  329   DMQYTMDASGENAHLLLSILVKHLDHKNVLKQPEMQLDIVQVVTSLAQTTKIHHSMALVS  388

Query  1298  FVSDLCRHLRKSLQATVD---LAGEEINLN  1378
              V+D+ RHLRKS+  T+D   L  E I  N
Sbjct  389   AVTDIMRHLRKSIHYTLDDAKLGAELIKWN  418



>ref|XP_009610949.1| PREDICTED: protein EFR3 homolog B isoform X4 [Nicotiana tomentosiformis]
Length=1008

 Score =   248 bits (634),  Expect(2) = 1e-90, Method: Compositional matrix adjust.
 Identities = 110/219 (50%), Positives = 157/219 (72%), Gaps = 0/219 (0%)
 Frame = +1

Query  133  LQGKMGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMK  312
            + G  G++SR++ PAC ++C  CPA+R+RSRQPVKRYKKL++DIFP+S +   N RKI K
Sbjct  1    MNGVSGVISRQVLPACGNLCFFCPAMRTRSRQPVKRYKKLISDIFPRSQEEEPNDRKIGK  60

Query  313  LCEYAAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNL  492
            LCEYAAKNPFRIPKI K LEERCYKELR+ + +   V+  +Y +L+  CKE M  FA +L
Sbjct  61   LCEYAAKNPFRIPKITKSLEERCYKELRNENFRSAKVVMCIYKKLVVSCKEHMPLFANSL  120

Query  493  LNVVVEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQK  672
            L+++  +LD ++ + +  +GC     F+ +Q DGTY ++++  + K+C LA++ GEE+  
Sbjct  121  LSIIQTLLDQSRENDMLIVGCEALFDFVNNQKDGTYMFHLDGFIPKLCQLAQQIGEEESA  180

Query  673  RCLRASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNY  789
            + L    L+ LSAMVWFM E+SH+ A+FD IV V L+NY
Sbjct  181  KHLHTVGLKALSAMVWFMGEYSHVSAEFDNIVSVVLENY  219


 Score =   114 bits (284),  Expect(2) = 1e-90, Method: Compositional matrix adjust.
 Identities = 66/210 (31%), Positives = 117/210 (56%), Gaps = 16/210 (8%)
 Frame = +2

Query  782   ITMSQMPINEDDERGEAHHNWVDEVIRSEGRDVGNENRPGYLIRKRP-------DKKDIS  940
             + +   P    + +    + WV+EV + EG    + +    +I K P       +K +++
Sbjct  214   VVLENYPRPRKETQDSNQNRWVEEVRKVEGHVSPSPD----VIAKVPSWRIIVNEKGELN  269

Query  941   LLTSEEIEMPKIWAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLS  1120
             + + E+ E P  W+ IC+  +A L KE++T RRVL+ +F +FD++  W    G+A  +L 
Sbjct  270   I-SKEDAENPSFWSRICLHNIAKLGKEATTTRRVLESLFCYFDDDNLWPTETGIALPILK  328

Query  1121  DLSYFVESSG-NHQLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIG  1297
             D+ Y +++SG N  L+L+ +V+HLDHKNV    +++  ++Q  T+LA+  +     + + 
Sbjct  329   DMQYTMDASGENAHLLLSILVKHLDHKNVLKQPEMQLDIVQVVTSLAQTTKIHHSMALVS  388

Query  1298  FVSDLCRHLRKSLQATVD---LAGEEINLN  1378
              V+D+ RHLRKS+  T+D   L  E I  N
Sbjct  389   AVTDIMRHLRKSIHYTLDDAKLGAELIKWN  418



>ref|XP_009610919.1| PREDICTED: protein EFR3 homolog B isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009610926.1| PREDICTED: protein EFR3 homolog B isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009610931.1| PREDICTED: protein EFR3 homolog B isoform X1 [Nicotiana tomentosiformis]
Length=1014

 Score =   248 bits (634),  Expect(2) = 1e-90, Method: Compositional matrix adjust.
 Identities = 110/219 (50%), Positives = 157/219 (72%), Gaps = 0/219 (0%)
 Frame = +1

Query  133  LQGKMGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMK  312
            + G  G++SR++ PAC ++C  CPA+R+RSRQPVKRYKKL++DIFP+S +   N RKI K
Sbjct  1    MNGVSGVISRQVLPACGNLCFFCPAMRTRSRQPVKRYKKLISDIFPRSQEEEPNDRKIGK  60

Query  313  LCEYAAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNL  492
            LCEYAAKNPFRIPKI K LEERCYKELR+ + +   V+  +Y +L+  CKE M  FA +L
Sbjct  61   LCEYAAKNPFRIPKITKSLEERCYKELRNENFRSAKVVMCIYKKLVVSCKEHMPLFANSL  120

Query  493  LNVVVEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQK  672
            L+++  +LD ++ + +  +GC     F+ +Q DGTY ++++  + K+C LA++ GEE+  
Sbjct  121  LSIIQTLLDQSRENDMLIVGCEALFDFVNNQKDGTYMFHLDGFIPKLCQLAQQIGEEESA  180

Query  673  RCLRASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNY  789
            + L    L+ LSAMVWFM E+SH+ A+FD IV V L+NY
Sbjct  181  KHLHTVGLKALSAMVWFMGEYSHVSAEFDNIVSVVLENY  219


 Score =   114 bits (284),  Expect(2) = 1e-90, Method: Compositional matrix adjust.
 Identities = 66/209 (32%), Positives = 115/209 (55%), Gaps = 14/209 (7%)
 Frame = +2

Query  782   ITMSQMPINEDDERGEAHHNWVDEVIRSEGRDVGNENRPGYLIRKRP------DKKDISL  943
             + +   P    + +    + WV+EV + EG    + +    +I K P      ++K    
Sbjct  214   VVLENYPRPRKETQDSNQNRWVEEVRKVEGHVSPSPD----VIAKVPSWRIIVNEKGELN  269

Query  944   LTSEEIEMPKIWAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSD  1123
             ++ E+ E P  W+ IC+  +A L KE++T RRVL+ +F +FD++  W    G+A  +L D
Sbjct  270   ISKEDAENPSFWSRICLHNIAKLGKEATTTRRVLESLFCYFDDDNLWPTETGIALPILKD  329

Query  1124  LSYFVESSG-NHQLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGF  1300
             + Y +++SG N  L+L+ +V+HLDHKNV    +++  ++Q  T+LA+  +     + +  
Sbjct  330   MQYTMDASGENAHLLLSILVKHLDHKNVLKQPEMQLDIVQVVTSLAQTTKIHHSMALVSA  389

Query  1301  VSDLCRHLRKSLQATVD---LAGEEINLN  1378
             V+D+ RHLRKS+  T+D   L  E I  N
Sbjct  390   VTDIMRHLRKSIHYTLDDAKLGAELIKWN  418



>ref|XP_009610943.1| PREDICTED: protein EFR3 homolog B isoform X3 [Nicotiana tomentosiformis]
Length=1010

 Score =   248 bits (634),  Expect(2) = 1e-90, Method: Compositional matrix adjust.
 Identities = 110/219 (50%), Positives = 157/219 (72%), Gaps = 0/219 (0%)
 Frame = +1

Query  133  LQGKMGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMK  312
            + G  G++SR++ PAC ++C  CPA+R+RSRQPVKRYKKL++DIFP+S +   N RKI K
Sbjct  1    MNGVSGVISRQVLPACGNLCFFCPAMRTRSRQPVKRYKKLISDIFPRSQEEEPNDRKIGK  60

Query  313  LCEYAAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNL  492
            LCEYAAKNPFRIPKI K LEERCYKELR+ + +   V+  +Y +L+  CKE M  FA +L
Sbjct  61   LCEYAAKNPFRIPKITKSLEERCYKELRNENFRSAKVVMCIYKKLVVSCKEHMPLFANSL  120

Query  493  LNVVVEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQK  672
            L+++  +LD ++ + +  +GC     F+ +Q DGTY ++++  + K+C LA++ GEE+  
Sbjct  121  LSIIQTLLDQSRENDMLIVGCEALFDFVNNQKDGTYMFHLDGFIPKLCQLAQQIGEEESA  180

Query  673  RCLRASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNY  789
            + L    L+ LSAMVWFM E+SH+ A+FD IV V L+NY
Sbjct  181  KHLHTVGLKALSAMVWFMGEYSHVSAEFDNIVSVVLENY  219


 Score =   114 bits (285),  Expect(2) = 1e-90, Method: Compositional matrix adjust.
 Identities = 66/209 (32%), Positives = 115/209 (55%), Gaps = 14/209 (7%)
 Frame = +2

Query  782   ITMSQMPINEDDERGEAHHNWVDEVIRSEGRDVGNENRPGYLIRKRP------DKKDISL  943
             + +   P    + +    + WV+EV + EG    + +    +I K P      ++K    
Sbjct  214   VVLENYPRPRKETQDSNQNRWVEEVRKVEGHVSPSPD----VIAKVPSWRIIVNEKGELN  269

Query  944   LTSEEIEMPKIWAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSD  1123
             ++ E+ E P  W+ IC+  +A L KE++T RRVL+ +F +FD++  W    G+A  +L D
Sbjct  270   ISKEDAENPSFWSRICLHNIAKLGKEATTTRRVLESLFCYFDDDNLWPTETGIALPILKD  329

Query  1124  LSYFVESSG-NHQLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGF  1300
             + Y +++SG N  L+L+ +V+HLDHKNV    +++  ++Q  T+LA+  +     + +  
Sbjct  330   MQYTMDASGENAHLLLSILVKHLDHKNVLKQPEMQLDIVQVVTSLAQTTKIHHSMALVSA  389

Query  1301  VSDLCRHLRKSLQATVD---LAGEEINLN  1378
             V+D+ RHLRKS+  T+D   L  E I  N
Sbjct  390   VTDIMRHLRKSIHYTLDDAKLGAELIKWN  418



>ref|XP_009379627.1| PREDICTED: uncharacterized protein LOC103968023 isoform X1 [Pyrus 
x bretschneideri]
Length=1040

 Score =   250 bits (638),  Expect(2) = 1e-90, Method: Compositional matrix adjust.
 Identities = 112/214 (52%), Positives = 156/214 (73%), Gaps = 0/214 (0%)
 Frame = +1

Query  148  GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  327
            G++SR++ PAC S+C  CPALR+RSRQPVKRYKKL+ADIFP++ +   N RKI KLCEY 
Sbjct  6    GVISRQVLPACGSLCFFCPALRARSRQPVKRYKKLIADIFPRNQEEGPNDRKIGKLCEYV  65

Query  328  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  507
            AKNP RIPKI   LE+RCYKELR+ + +   ++  +YN+LL  CKEQM  FA +LL+++ 
Sbjct  66   AKNPLRIPKITTYLEQRCYKELRNENFRSAKIVMCIYNKLLISCKEQMPLFASSLLSIMH  125

Query  508  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRA  687
             +LD  + D ++ IGC T   F+ +Q+DGTY +N+E  + K C +A+E GE++    LR+
Sbjct  126  TLLDQTRQDEMQIIGCQTLFNFVNNQMDGTYMFNLEGFIPKFCQIAQEPGEDEGASNLRS  185

Query  688  SSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNY  789
            ++L+ L++MVWFM E SHI  +FD IV V L+NY
Sbjct  186  AALQALASMVWFMGENSHISVEFDNIVAVVLENY  219


 Score =   112 bits (281),  Expect(2) = 1e-90, Method: Compositional matrix adjust.
 Identities = 64/191 (34%), Positives = 110/191 (58%), Gaps = 12/191 (6%)
 Frame = +2

Query  803   INEDDERGEAHHN-WVDEVIRSEGRDVGNENRPGYLIRKRP------DKKDISLLTSEEI  961
             +N+  E  E   N WV E+  +EG      + P  +IR         DK D+++ T ++ 
Sbjct  222   LNKTSENLEGSKNRWVQELQSNEGH---GSSSPDVVIRLTSWSTLVDDKGDLNV-TVKDA  277

Query  962   EMPKIWAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVE  1141
             + P  W+ +C+  MA LAKE++T+RRVL+ +F +FD    W P++GLA  VL D+   ++
Sbjct  278   KNPCFWSRVCLHNMAKLAKEATTIRRVLESLFRYFDTGNLWSPKYGLAIPVLKDIQVLMD  337

Query  1142  SSG-NHQLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCR  1318
               G +  ++L+ +++HLDHKNV     ++  +++  T+L++  +     + IG VSD  R
Sbjct  338   DCGQSTHVLLSILIKHLDHKNVLKQPNMQVDIVEATTSLSQLAKVEPSVAIIGAVSDAMR  397

Query  1319  HLRKSLQATVD  1351
             HLRKS+  ++D
Sbjct  398   HLRKSIHCSLD  408



>ref|XP_009379628.1| PREDICTED: uncharacterized protein LOC103968023 isoform X2 [Pyrus 
x bretschneideri]
Length=1036

 Score =   249 bits (637),  Expect(2) = 2e-90, Method: Compositional matrix adjust.
 Identities = 112/214 (52%), Positives = 156/214 (73%), Gaps = 0/214 (0%)
 Frame = +1

Query  148  GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  327
            G++SR++ PAC S+C  CPALR+RSRQPVKRYKKL+ADIFP++ +   N RKI KLCEY 
Sbjct  6    GVISRQVLPACGSLCFFCPALRARSRQPVKRYKKLIADIFPRNQEEGPNDRKIGKLCEYV  65

Query  328  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  507
            AKNP RIPKI   LE+RCYKELR+ + +   ++  +YN+LL  CKEQM  FA +LL+++ 
Sbjct  66   AKNPLRIPKITTYLEQRCYKELRNENFRSAKIVMCIYNKLLISCKEQMPLFASSLLSIMH  125

Query  508  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRA  687
             +LD  + D ++ IGC T   F+ +Q+DGTY +N+E  + K C +A+E GE++    LR+
Sbjct  126  TLLDQTRQDEMQIIGCQTLFNFVNNQMDGTYMFNLEGFIPKFCQIAQEPGEDEGASNLRS  185

Query  688  SSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNY  789
            ++L+ L++MVWFM E SHI  +FD IV V L+NY
Sbjct  186  AALQALASMVWFMGENSHISVEFDNIVAVVLENY  219


 Score =   112 bits (281),  Expect(2) = 2e-90, Method: Compositional matrix adjust.
 Identities = 64/191 (34%), Positives = 110/191 (58%), Gaps = 12/191 (6%)
 Frame = +2

Query  803   INEDDERGEAHHN-WVDEVIRSEGRDVGNENRPGYLIRKRP------DKKDISLLTSEEI  961
             +N+  E  E   N WV E+  +EG      + P  +IR         DK D+++ T ++ 
Sbjct  222   LNKTSENLEGSKNRWVQELQSNEGH---GSSSPDVVIRLTSWSTLVDDKGDLNV-TVKDA  277

Query  962   EMPKIWAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVE  1141
             + P  W+ +C+  MA LAKE++T+RRVL+ +F +FD    W P++GLA  VL D+   ++
Sbjct  278   KNPCFWSRVCLHNMAKLAKEATTIRRVLESLFRYFDTGNLWSPKYGLAIPVLKDIQVLMD  337

Query  1142  SSG-NHQLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCR  1318
               G +  ++L+ +++HLDHKNV     ++  +++  T+L++  +     + IG VSD  R
Sbjct  338   DCGQSTHVLLSILIKHLDHKNVLKQPNMQVDIVEATTSLSQLAKVEPSVAIIGAVSDAMR  397

Query  1319  HLRKSLQATVD  1351
             HLRKS+  ++D
Sbjct  398   HLRKSIHCSLD  408



>ref|XP_008222533.1| PREDICTED: uncharacterized protein LOC103322398 [Prunus mume]
Length=997

 Score =   248 bits (633),  Expect(2) = 2e-90, Method: Compositional matrix adjust.
 Identities = 114/220 (52%), Positives = 156/220 (71%), Gaps = 1/220 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG++SR++ PAC ++C  CP++R+RSRQPVKRYKKLL DIFP++ D   N RKI KLCEY
Sbjct  1    MGVMSRRIVPACGNLCFFCPSMRARSRQPVKRYKKLLTDIFPRNQDAEPNDRKIGKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            A KNP RIPKI   LE+RCYK+LR+ H   V V+  +Y +LL  CKEQM  FA +LL +V
Sbjct  61   ALKNPLRIPKITGSLEQRCYKDLRNEHFGSVKVVLCIYRKLLSSCKEQMPLFASSLLGIV  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
              +L+  + D ++ +GC T   FI SQ+D T+ +++E L+ K+C +A+E G+ ++   LR
Sbjct  121  RILLEQNRHDEMRILGCNTLVDFINSQIDSTHMFSLEGLIPKLCQMAQEVGDNERALRLR  180

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNYEPDAH  804
            ++ L+ L+ MVWFM E SHI  DFD I+ VTLDNY  D H
Sbjct  181  SAGLQSLAFMVWFMGEHSHISMDFDTIISVTLDNYA-DIH  219


 Score =   114 bits (284),  Expect(2) = 2e-90, Method: Compositional matrix adjust.
 Identities = 65/191 (34%), Positives = 106/191 (55%), Gaps = 11/191 (6%)
 Frame = +2

Query  806   NEDDERGEAHHNWVDEVIRSEGRD----VGNENRPGYLIRKRPDKKDISL-LTSEEIEMP  970
              ED +  E+   WV  V+++E  D    V ++  P       P+ K+  L  T +  + P
Sbjct  226   TEDRQYSESQDQWVQGVLKAEVHDSSFPVISQKVPSL-----PNLKNADLDPTIDANKSP  280

Query  971   KIWAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSG  1150
               W+ +C++ +A LAKE++T+RRVL+P+F  FD   HW P   LA+ VL  L   +E SG
Sbjct  281   SYWSRVCLRNIARLAKEATTVRRVLEPLFQSFDAENHWSPDKPLAYHVLMYLQSLLEESG  340

Query  1151  -NHQLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLR  1327
              N  L+L  +V+HLDHKNV    ++++ ++   T +A+  +     +  G +SDL +HLR
Sbjct  341   DNSHLLLHILVKHLDHKNVVKQPRLQADIVNVTTQIAQGAKQQASVAITGAISDLIKHLR  400

Query  1328  KSLQATVDLAG  1360
             K LQ   +++ 
Sbjct  401   KCLQNQAEVSS  411



>ref|XP_009789125.1| PREDICTED: protein EFR3 homolog B isoform X4 [Nicotiana sylvestris]
Length=973

 Score =   251 bits (640),  Expect(2) = 5e-90, Method: Compositional matrix adjust.
 Identities = 111/219 (51%), Positives = 158/219 (72%), Gaps = 0/219 (0%)
 Frame = +1

Query  133  LQGKMGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMK  312
            + G  G++SR++ PAC ++C  CPA+R+RSRQPVKRYKKL++DIFP+S +   N RKI K
Sbjct  1    MNGVSGVISRQVLPACGNLCFFCPAMRTRSRQPVKRYKKLISDIFPRSQEEEPNDRKIGK  60

Query  313  LCEYAAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNL  492
            LCEYAAKNPFRIPKI K LEERCYKELR+ + +   V+  +Y +L+  CKE M  FA +L
Sbjct  61   LCEYAAKNPFRIPKITKSLEERCYKELRNENFRSAKVVMCIYKKLVVSCKEHMPLFANSL  120

Query  493  LNVVVEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQK  672
            L+++  +LD ++ + +  +GC     F+ +Q DGTY ++++  + K+C LA++ GEE+  
Sbjct  121  LSIIQTLLDQSRENDMLIVGCEALFDFVNNQKDGTYMFHLDGFIPKLCQLAQQIGEEENA  180

Query  673  RCLRASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNY  789
            + LR   L+ LSAMVWFM E+SH+ A+FD IV V L+NY
Sbjct  181  KHLRTVGLKALSAMVWFMGEYSHVSAEFDNIVSVVLENY  219


 Score =   109 bits (273),  Expect(2) = 5e-90, Method: Compositional matrix adjust.
 Identities = 58/158 (37%), Positives = 96/158 (61%), Gaps = 6/158 (4%)
 Frame = +2

Query  887   ENRPGYLIRKRPDKKDISLLTSEEIEMPKIWAHICIQRMADLAKESSTMRRVLDPMFIHF  1066
             EN P    R R + +D S    E+ E P  W+ +C+  +A L KE++T RRVL+ +F +F
Sbjct  217   ENYP----RPRKETQD-SNQNREDAENPSFWSKVCLHNIAKLGKEATTTRRVLESLFRYF  271

Query  1067  DNNKHWVPRHGLAFVVLSDLSYFVESSG-NHQLILTGVVRHLDHKNVACDSQIKSFVIQT  1243
             D++  W    G+A  +L D+ Y +++SG N  L+L+ +V+HLDHKNV    +++  ++Q 
Sbjct  272   DDDNLWPTETGIALPILKDMQYTMDASGENAHLLLSILVKHLDHKNVLKQPEMQLDIVQV  331

Query  1244  ATALARQIRSGGGFSDIGFVSDLCRHLRKSLQATVDLA  1357
              T+LA+  +     + +  V+D+ RHLRKS+  T+D A
Sbjct  332   VTSLAQTTKIHHSMALVSAVTDIMRHLRKSIHYTLDDA  369



>ref|XP_009610957.1| PREDICTED: protein EFR3 homolog B isoform X5 [Nicotiana tomentosiformis]
Length=975

 Score =   249 bits (635),  Expect(2) = 7e-90, Method: Compositional matrix adjust.
 Identities = 110/219 (50%), Positives = 157/219 (72%), Gaps = 0/219 (0%)
 Frame = +1

Query  133  LQGKMGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMK  312
            + G  G++SR++ PAC ++C  CPA+R+RSRQPVKRYKKL++DIFP+S +   N RKI K
Sbjct  1    MNGVSGVISRQVLPACGNLCFFCPAMRTRSRQPVKRYKKLISDIFPRSQEEEPNDRKIGK  60

Query  313  LCEYAAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNL  492
            LCEYAAKNPFRIPKI K LEERCYKELR+ + +   V+  +Y +L+  CKE M  FA +L
Sbjct  61   LCEYAAKNPFRIPKITKSLEERCYKELRNENFRSAKVVMCIYKKLVVSCKEHMPLFANSL  120

Query  493  LNVVVEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQK  672
            L+++  +LD ++ + +  +GC     F+ +Q DGTY ++++  + K+C LA++ GEE+  
Sbjct  121  LSIIQTLLDQSRENDMLIVGCEALFDFVNNQKDGTYMFHLDGFIPKLCQLAQQIGEEESA  180

Query  673  RCLRASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNY  789
            + L    L+ LSAMVWFM E+SH+ A+FD IV V L+NY
Sbjct  181  KHLHTVGLKALSAMVWFMGEYSHVSAEFDNIVSVVLENY  219


 Score =   111 bits (278),  Expect(2) = 7e-90, Method: Compositional matrix adjust.
 Identities = 59/158 (37%), Positives = 96/158 (61%), Gaps = 6/158 (4%)
 Frame = +2

Query  887   ENRPGYLIRKRPDKKDISLLTSEEIEMPKIWAHICIQRMADLAKESSTMRRVLDPMFIHF  1066
             EN P    R R + +D S    E+ E P  W+ IC+  +A L KE++T RRVL+ +F +F
Sbjct  217   ENYP----RPRKETQD-SNQNREDAENPSFWSRICLHNIAKLGKEATTTRRVLESLFCYF  271

Query  1067  DNNKHWVPRHGLAFVVLSDLSYFVESSG-NHQLILTGVVRHLDHKNVACDSQIKSFVIQT  1243
             D++  W    G+A  +L D+ Y +++SG N  L+L+ +V+HLDHKNV    +++  ++Q 
Sbjct  272   DDDNLWPTETGIALPILKDMQYTMDASGENAHLLLSILVKHLDHKNVLKQPEMQLDIVQV  331

Query  1244  ATALARQIRSGGGFSDIGFVSDLCRHLRKSLQATVDLA  1357
              T+LA+  +     + +  V+D+ RHLRKS+  T+D A
Sbjct  332   VTSLAQTTKIHHSMALVSAVTDIMRHLRKSIHYTLDDA  369



>ref|XP_006350204.1| PREDICTED: protein EFR3 homolog B-like isoform X1 [Solanum tuberosum]
Length=1008

 Score =   248 bits (633),  Expect(2) = 1e-89, Method: Compositional matrix adjust.
 Identities = 111/219 (51%), Positives = 158/219 (72%), Gaps = 0/219 (0%)
 Frame = +1

Query  133  LQGKMGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMK  312
            + G  G++SR++ PAC S+C  CPA+R+RSRQPVKRYKKL++DIFP+S +   N RKI K
Sbjct  1    MNGVSGVMSRQVLPACGSLCFFCPAMRTRSRQPVKRYKKLISDIFPRSQEEEPNDRKIGK  60

Query  313  LCEYAAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNL  492
            LCEYAAKNPFRIPKI K LEE+CYKELR+ + +   V+  +Y +L+  CKE M  FA +L
Sbjct  61   LCEYAAKNPFRIPKITKSLEEKCYKELRNENFRSAKVVMCIYKKLVVSCKEHMPLFANSL  120

Query  493  LNVVVEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQK  672
            L+V+  +LD ++ + +  +GC +   F+ +Q DGTY ++++  + K+C LA++ GEE+  
Sbjct  121  LSVLQTLLDQSRENDMLIVGCESLFDFVNNQKDGTYMFHLDGFIPKLCQLAQQIGEEESA  180

Query  673  RCLRASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNY  789
              LR   ++ LSAMVWFM E+SH+ A+FD IV V L+NY
Sbjct  181  INLRTVGVKALSAMVWFMGEYSHVSAEFDNIVSVVLENY  219


 Score =   112 bits (279),  Expect(2) = 1e-89, Method: Compositional matrix adjust.
 Identities = 65/210 (31%), Positives = 115/210 (55%), Gaps = 16/210 (8%)
 Frame = +2

Query  782   ITMSQMPINEDDERGEAHHNWVDEVIRSEGRDVGNENRPGYLIRKRP-------DKKDIS  940
             + +   P    + +    + WV+EV + EG    +      +I K P       +K +++
Sbjct  214   VVLENYPRPRKETQDSNQNRWVEEVRKVEGHVSPSPE----VIAKVPSWRIIVNEKGELN  269

Query  941   LLTSEEIEMPKIWAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLS  1120
             + + E+ E P  W+  C+  MA L KE++T RRVL+ +F +FD++  W   +G+A  +L 
Sbjct  270   I-SKEDAENPAFWSRACLHNMAKLGKEATTTRRVLESLFRYFDDDNLWPTENGIAVPILK  328

Query  1121  DLSYFVESSG-NHQLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIG  1297
             D+ Y +++SG N  L+L+ +V+HLDHKNV    +++  ++Q  T+LA+  +     + + 
Sbjct  329   DMQYTMDASGENAHLLLSALVKHLDHKNVLKQPEMQLDIVQVVTSLAQTTKIHHSIALVS  388

Query  1298  FVSDLCRHLRKSLQATVD---LAGEEINLN  1378
              ++D+ RHLRKS+  T D   L  E I  N
Sbjct  389   AITDIMRHLRKSIHYTHDDAKLGAELIKWN  418



>ref|XP_004236620.1| PREDICTED: protein EFR3 homolog B isoform X2 [Solanum lycopersicum]
Length=1008

 Score =   249 bits (635),  Expect(2) = 1e-89, Method: Compositional matrix adjust.
 Identities = 112/219 (51%), Positives = 158/219 (72%), Gaps = 0/219 (0%)
 Frame = +1

Query  133  LQGKMGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMK  312
            + G  G++SR++ PAC S+C  CPA+R+RSRQPVKRYKKL++DIFP+S +   N RKI K
Sbjct  1    MNGVSGVMSRQVLPACGSLCFFCPAMRTRSRQPVKRYKKLISDIFPRSQEEEPNDRKIGK  60

Query  313  LCEYAAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNL  492
            LCEYAAKNPFRIPKI K LEE+CYKELR+ + +   V+  +Y +L+  CKE M  FA +L
Sbjct  61   LCEYAAKNPFRIPKITKSLEEKCYKELRNENFRSAKVVMCIYKKLVVSCKEHMPLFANSL  120

Query  493  LNVVVEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQK  672
            L+V+  +LD ++ + +  +GC +   F+ +Q DGTY ++++  + K+C LA++ GEE+  
Sbjct  121  LSVLQTLLDQSRENDMLIVGCESLFDFVNNQKDGTYMFHLDGFIPKLCQLAQQIGEEESA  180

Query  673  RCLRASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNY  789
              LR   L+ LSAMVWFM E+SH+ A+FD IV V L+NY
Sbjct  181  IKLRTVGLKALSAMVWFMGEYSHVSAEFDNIVSVVLENY  219


 Score =   110 bits (276),  Expect(2) = 1e-89, Method: Compositional matrix adjust.
 Identities = 64/193 (33%), Positives = 111/193 (58%), Gaps = 16/193 (8%)
 Frame = +2

Query  833   HHNWVDEVIRSEGRDVGNENRPGYLIRKRP-------DKKDISLLTSEEIEMPKIWAHIC  991
              + WV+EV + EG    +      +I K P       +K ++++ + E+ E P  W+  C
Sbjct  231   QNRWVEEVRKVEGHVSPSPE----VIAKVPSWRIIVNEKGELNI-SKEDDENPAFWSKAC  285

Query  992   IQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSG-NHQLIL  1168
             +  MA L KE++T RRVL+ +F +FD++  W   +G+A  +L D+ Y +++SG N  L+L
Sbjct  286   LHNMAKLGKEATTTRRVLESLFRYFDDDNLWPTENGIAVPILKDMQYTMDASGENAHLLL  345

Query  1169  TGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKSLQATV  1348
             + +V+HLDHKNV    +++  ++Q  T+LA+  ++    + +  ++D+ RHLRKS+  T 
Sbjct  346   STLVKHLDHKNVLKQPEMQLDIVQVVTSLAQTTKTHHSIALVSAITDIMRHLRKSIHYTH  405

Query  1349  D---LAGEEINLN  1378
             D   L  E I  N
Sbjct  406   DDAKLGAELIKWN  418



>ref|XP_010319191.1| PREDICTED: protein EFR3 homolog B isoform X1 [Solanum lycopersicum]
 ref|XP_010319192.1| PREDICTED: protein EFR3 homolog B isoform X1 [Solanum lycopersicum]
Length=1012

 Score =   249 bits (636),  Expect(2) = 1e-89, Method: Compositional matrix adjust.
 Identities = 112/219 (51%), Positives = 158/219 (72%), Gaps = 0/219 (0%)
 Frame = +1

Query  133  LQGKMGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMK  312
            + G  G++SR++ PAC S+C  CPA+R+RSRQPVKRYKKL++DIFP+S +   N RKI K
Sbjct  1    MNGVSGVMSRQVLPACGSLCFFCPAMRTRSRQPVKRYKKLISDIFPRSQEEEPNDRKIGK  60

Query  313  LCEYAAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNL  492
            LCEYAAKNPFRIPKI K LEE+CYKELR+ + +   V+  +Y +L+  CKE M  FA +L
Sbjct  61   LCEYAAKNPFRIPKITKSLEEKCYKELRNENFRSAKVVMCIYKKLVVSCKEHMPLFANSL  120

Query  493  LNVVVEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQK  672
            L+V+  +LD ++ + +  +GC +   F+ +Q DGTY ++++  + K+C LA++ GEE+  
Sbjct  121  LSVLQTLLDQSRENDMLIVGCESLFDFVNNQKDGTYMFHLDGFIPKLCQLAQQIGEEESA  180

Query  673  RCLRASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNY  789
              LR   L+ LSAMVWFM E+SH+ A+FD IV V L+NY
Sbjct  181  IKLRTVGLKALSAMVWFMGEYSHVSAEFDNIVSVVLENY  219


 Score =   110 bits (275),  Expect(2) = 1e-89, Method: Compositional matrix adjust.
 Identities = 64/193 (33%), Positives = 111/193 (58%), Gaps = 16/193 (8%)
 Frame = +2

Query  833   HHNWVDEVIRSEGRDVGNENRPGYLIRKRP-------DKKDISLLTSEEIEMPKIWAHIC  991
              + WV+EV + EG    +      +I K P       +K ++++ + E+ E P  W+  C
Sbjct  231   QNRWVEEVRKVEGHVSPSPE----VIAKVPSWRIIVNEKGELNI-SKEDDENPAFWSKAC  285

Query  992   IQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSG-NHQLIL  1168
             +  MA L KE++T RRVL+ +F +FD++  W   +G+A  +L D+ Y +++SG N  L+L
Sbjct  286   LHNMAKLGKEATTTRRVLESLFRYFDDDNLWPTENGIAVPILKDMQYTMDASGENAHLLL  345

Query  1169  TGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKSLQATV  1348
             + +V+HLDHKNV    +++  ++Q  T+LA+  ++    + +  ++D+ RHLRKS+  T 
Sbjct  346   STLVKHLDHKNVLKQPEMQLDIVQVVTSLAQTTKTHHSIALVSAITDIMRHLRKSIHYTH  405

Query  1349  D---LAGEEINLN  1378
             D   L  E I  N
Sbjct  406   DDAKLGAELIKWN  418



>gb|KEH23652.1| cyclin-like protein [Medicago truncatula]
Length=990

 Score =   247 bits (630),  Expect(2) = 1e-89, Method: Compositional matrix adjust.
 Identities = 109/215 (51%), Positives = 153/215 (71%), Gaps = 0/215 (0%)
 Frame = +1

Query  148  GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  327
            G++SR++ PAC S+C CCP+LR+RSRQPVKRYKKL+ADIFP++ +   N RKI KLC+Y 
Sbjct  6    GVVSRQVLPACGSLCFCCPSLRTRSRQPVKRYKKLIADIFPRNQEEGPNDRKIGKLCDYV  65

Query  328  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  507
            AKNP RIPKI   LE+RCYKELR+ +     ++  +Y + L  CKEQM  FA ++L+++ 
Sbjct  66   AKNPLRIPKIVTALEQRCYKELRNENIHSTRIVMCIYKKFLSSCKEQMPLFASSILSIIQ  125

Query  508  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRA  687
             +LD  + D ++ IGC     F+ +QVDGTY +N+E ++ K+C L +ETGE++  R  R+
Sbjct  126  ALLDQTRQDEMRVIGCNILFDFVNNQVDGTYLFNLEGVIPKLCQLTQETGEDESARIRRS  185

Query  688  SSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNYE  792
            + L+ LS+MV FM E SHI  +FD IV   L+NYE
Sbjct  186  AGLKALSSMVRFMGEHSHISVEFDNIVSAVLENYE  220


 Score =   112 bits (280),  Expect(2) = 1e-89, Method: Compositional matrix adjust.
 Identities = 59/180 (33%), Positives = 109/180 (61%), Gaps = 10/180 (6%)
 Frame = +2

Query  866   EGRDVGNENRPGYLIRKRP--------DKKDISLLTSEEIEMPKIWAHICIQRMADLAKE  1021
             +G ++ NE++    ++KR         DK +++    E+ + P  W+ +C+  MA+LAKE
Sbjct  234   QGTNIRNEDQIMLDVKKRNPSWSKVVNDKGEVNF-AMEDDKNPSFWSGVCLHNMANLAKE  292

Query  1022  SSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFV-ESSGNHQLILTGVVRHLDHK  1198
              +T+RRV++ +F +FDN   W  +HGLA  VL D+ + + +S  N  ++L+ +++H+DHK
Sbjct  293   GTTIRRVMESLFRYFDNGNLWSIKHGLACSVLKDILFLMDDSEKNTHVLLSMLIKHIDHK  352

Query  1199  NVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKSLQATVDLAGEEINLN  1378
              V  +  ++  +++ AT+LA+  +     S IG VSD+ RHLRK++  ++D +  + N N
Sbjct  353   TVLKEPNMQLDIVEVATSLAQYAKVQPSVSIIGAVSDMMRHLRKTIHCSLDNSNLDTNWN  412



>ref|XP_007225374.1| hypothetical protein PRUPE_ppa000810mg [Prunus persica]
 gb|EMJ26573.1| hypothetical protein PRUPE_ppa000810mg [Prunus persica]
Length=997

 Score =   248 bits (633),  Expect(2) = 2e-89, Method: Compositional matrix adjust.
 Identities = 114/220 (52%), Positives = 156/220 (71%), Gaps = 1/220 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG++SR++ PAC ++C  CP++R+RSRQPVKRYKKLL DIFP++ D   N RKI KLCEY
Sbjct  1    MGVMSRRIVPACGNLCFFCPSMRARSRQPVKRYKKLLTDIFPRNQDAEPNDRKIGKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            A KNP RIPKI   LE+RCYK+LR+ H   V V+  +Y +LL  CKEQM  FA +LL +V
Sbjct  61   ALKNPLRIPKITDSLEQRCYKDLRNEHFGSVKVVLCIYRKLLSSCKEQMPLFASSLLGIV  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
              +L+  + D ++ +GC T   FI SQ+D T+ +++E L+ K+C +A+E G+ ++   LR
Sbjct  121  RILLEQNRHDEMRILGCNTLVDFINSQIDSTHMFSLEGLIPKLCQMAQEVGDNERALRLR  180

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNYEPDAH  804
            ++ L+ L+ MVWFM E SHI  DFD I+ VTLDNY  D H
Sbjct  181  SAGLQSLAFMVWFMGEHSHISMDFDTIISVTLDNYA-DIH  219


 Score =   111 bits (277),  Expect(2) = 2e-89, Method: Compositional matrix adjust.
 Identities = 64/191 (34%), Positives = 105/191 (55%), Gaps = 11/191 (6%)
 Frame = +2

Query  806   NEDDERGEAHHNWVDEVIRSEGRD----VGNENRPGYLIRKRPDKKDISL-LTSEEIEMP  970
              ED +   +   WV  V+++E  D    V ++  P       P+ K+  L  T +  + P
Sbjct  226   TEDRQYSVSQDQWVQGVLKAEVHDSSFPVISQKVPSL-----PNLKNADLDPTIDANKSP  280

Query  971   KIWAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSG  1150
               W+ +C++ +A LAKE++T+RRVL+P+F  FD   HW P   LA+ VL  L   +E SG
Sbjct  281   SYWSRVCLRNIARLAKEATTVRRVLEPLFQSFDAENHWSPDKPLAYHVLMYLQSLLEESG  340

Query  1151  -NHQLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLR  1327
              N  L+L  +V+HLDHKNV    ++++ ++   T +A+  +     +  G +SDL +HLR
Sbjct  341   DNSHLLLHILVKHLDHKNVVKQPRLQADIVNVTTQIAQGAKQQASVAITGAISDLIKHLR  400

Query  1328  KSLQATVDLAG  1360
             K LQ   +++ 
Sbjct  401   KCLQNQAEVSS  411



>ref|XP_007028781.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY09283.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=1023

 Score =   241 bits (616),  Expect(2) = 2e-89, Method: Compositional matrix adjust.
 Identities = 106/214 (50%), Positives = 158/214 (74%), Gaps = 0/214 (0%)
 Frame = +1

Query  148  GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  327
            G++SR++ PAC S+C  CPA+R+RSRQPVKRYKKL+A+IFP++ +  AN RKI KLC+YA
Sbjct  6    GVISRQVLPACGSLCFFCPAMRARSRQPVKRYKKLIAEIFPRNQEEGANDRKIGKLCDYA  65

Query  328  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  507
            +KNP RIPKI+  LE+RCYKELR+ + +   ++  +Y +LL  CKEQM  FA +LL+++ 
Sbjct  66   SKNPLRIPKISNSLEQRCYKELRNENFQSAKIVMCIYRKLLVSCKEQMTLFASSLLSIIQ  125

Query  508  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRA  687
             +LD  + D ++ +GC T   F+ +Q DGT+ +N+E  + K+C LA+E GE +++R L +
Sbjct  126  TLLDQTRQDEMRIMGCQTLFDFVNNQKDGTFMFNLEGFIPKLCQLAQEIGEGERERKLCS  185

Query  688  SSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNY  789
            + L+ LS+M+WFM E SHI  +FD IV V +++Y
Sbjct  186  AGLQALSSMIWFMGEHSHISVEFDNIVSVVVESY  219


 Score =   117 bits (293),  Expect(2) = 2e-89, Method: Compositional matrix adjust.
 Identities = 65/180 (36%), Positives = 105/180 (58%), Gaps = 9/180 (5%)
 Frame = +2

Query  830   AHHNWVDEVIRSEGRDVGNENRPGYLIRKRP-----DKKDISLLTSEEIEMPKIWAHICI  994
             A   WV EV+++EG    +   P  LIR        + K    +T+E+ + P  W+ +C+
Sbjct  232   AQSRWVQEVLKNEGHVSPS---PDVLIRVPSWGAIVNDKGEPNVTAEDAQNPCFWSRVCL  288

Query  995   QRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSG-NHQLILT  1171
               MA+LAKE++T RRVL+ +F +FD    W  ++GLAF VL D+   ++SSG N   +L+
Sbjct  289   HNMANLAKEATTTRRVLESLFRYFDKENLWSLQNGLAFSVLKDIQLLMDSSGQNTHFLLS  348

Query  1172  GVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKSLQATVD  1351
              +V+HLDHKN+     ++  +I+   +LA   ++    + +G VSD+ RHLRKS+   +D
Sbjct  349   VLVKHLDHKNILKQPDMQLQIIEVTASLAELSKAEPSVAILGAVSDVMRHLRKSIHCLLD  408



>ref|XP_006648302.1| PREDICTED: uncharacterized protein LOC102704216 [Oryza brachyantha]
Length=1039

 Score =   244 bits (624),  Expect(2) = 2e-89, Method: Compositional matrix adjust.
 Identities = 109/216 (50%), Positives = 151/216 (70%), Gaps = 0/216 (0%)
 Frame = +1

Query  148  GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  327
            G++SRK+ PAC  +C  CP LR+RSRQPVKRYKK+LADIFP + +   N R+I KLCEY 
Sbjct  12   GVVSRKVLPACGGLCYLCPGLRARSRQPVKRYKKILADIFPATQEEEPNVRRIGKLCEYV  71

Query  328  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  507
            AKNP R+PKI   LE+RCYKELR+     V V+  +Y +LL  CK+QM   A ++L+++ 
Sbjct  72   AKNPHRVPKITAYLEQRCYKELRNEQYGFVKVVVLIYRKLLVSCKDQMPLLASSVLSIIS  131

Query  508  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRA  687
             +LD  + D ++ IGC T   F  SQVDGTY +N+E LV ++C LA+    E++   LR+
Sbjct  132  TLLDQTRRDDLRIIGCETLFDFTVSQVDGTYQFNLEELVPRICELAQIVKIEEKDNTLRS  191

Query  688  SSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNYEP  795
            S+L+ LSAM+WFM E SHI ++FD ++ V L++Y P
Sbjct  192  SALQALSAMIWFMGELSHISSEFDTVIQVVLESYNP  227


 Score =   114 bits (285),  Expect(2) = 2e-89, Method: Compositional matrix adjust.
 Identities = 65/177 (37%), Positives = 108/177 (61%), Gaps = 13/177 (7%)
 Frame = +2

Query  842   WVDEVIRSEGRDVGNENRPGYLIRKRP-------DKKDISLLTSEEIEMPKIWAHICIQR  1000
             WV++V+++E     + + P + I K P       DK +I L   E+ + P  W+ +C+  
Sbjct  244   WVEQVVKTED----HVSPPTFTISKIPSWRSIVTDKGEIHLPV-EDAKDPNFWSRVCVHN  298

Query  1001  MADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSG-NHQLILTGV  1177
             MA L++E++T RRVL+ +F HFDNN  W  ++ LAF VL D+  FVE+ G N  L+++ +
Sbjct  299   MAKLSREATTFRRVLESLFRHFDNNNSWSSQNTLAFCVLLDMQMFVENQGQNTNLMISIL  358

Query  1178  VRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKSLQATV  1348
             V+HL+HK+V    +++  V++   +LA Q R+    + IG +SDL RH++K L  T+
Sbjct  359   VKHLEHKSVLKQPEMQLSVVEVIASLAAQSRAQASAATIGAISDLVRHMKKILHVTL  415



>ref|XP_010319193.1| PREDICTED: protein EFR3 homolog B isoform X3 [Solanum lycopersicum]
Length=973

 Score =   249 bits (636),  Expect(2) = 2e-89, Method: Compositional matrix adjust.
 Identities = 112/219 (51%), Positives = 158/219 (72%), Gaps = 0/219 (0%)
 Frame = +1

Query  133  LQGKMGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMK  312
            + G  G++SR++ PAC S+C  CPA+R+RSRQPVKRYKKL++DIFP+S +   N RKI K
Sbjct  1    MNGVSGVMSRQVLPACGSLCFFCPAMRTRSRQPVKRYKKLISDIFPRSQEEEPNDRKIGK  60

Query  313  LCEYAAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNL  492
            LCEYAAKNPFRIPKI K LEE+CYKELR+ + +   V+  +Y +L+  CKE M  FA +L
Sbjct  61   LCEYAAKNPFRIPKITKSLEEKCYKELRNENFRSAKVVMCIYKKLVVSCKEHMPLFANSL  120

Query  493  LNVVVEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQK  672
            L+V+  +LD ++ + +  +GC +   F+ +Q DGTY ++++  + K+C LA++ GEE+  
Sbjct  121  LSVLQTLLDQSRENDMLIVGCESLFDFVNNQKDGTYMFHLDGFIPKLCQLAQQIGEEESA  180

Query  673  RCLRASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNY  789
              LR   L+ LSAMVWFM E+SH+ A+FD IV V L+NY
Sbjct  181  IKLRTVGLKALSAMVWFMGEYSHVSAEFDNIVSVVLENY  219


 Score =   109 bits (272),  Expect(2) = 2e-89, Method: Compositional matrix adjust.
 Identities = 58/158 (37%), Positives = 95/158 (60%), Gaps = 6/158 (4%)
 Frame = +2

Query  887   ENRPGYLIRKRPDKKDISLLTSEEIEMPKIWAHICIQRMADLAKESSTMRRVLDPMFIHF  1066
             EN P    R R +  D S    E+ E P  W+  C+  MA L KE++T RRVL+ +F +F
Sbjct  217   ENYP----RPRKETPD-SNQNREDDENPAFWSKACLHNMAKLGKEATTTRRVLESLFRYF  271

Query  1067  DNNKHWVPRHGLAFVVLSDLSYFVESSG-NHQLILTGVVRHLDHKNVACDSQIKSFVIQT  1243
             D++  W   +G+A  +L D+ Y +++SG N  L+L+ +V+HLDHKNV    +++  ++Q 
Sbjct  272   DDDNLWPTENGIAVPILKDMQYTMDASGENAHLLLSTLVKHLDHKNVLKQPEMQLDIVQV  331

Query  1244  ATALARQIRSGGGFSDIGFVSDLCRHLRKSLQATVDLA  1357
              T+LA+  ++    + +  ++D+ RHLRKS+  T D A
Sbjct  332   VTSLAQTTKTHHSIALVSAITDIMRHLRKSIHYTHDDA  369



>ref|XP_007028783.1| Uncharacterized protein isoform 3 [Theobroma cacao]
 gb|EOY09285.1| Uncharacterized protein isoform 3 [Theobroma cacao]
Length=706

 Score =   241 bits (615),  Expect(2) = 3e-89, Method: Compositional matrix adjust.
 Identities = 106/214 (50%), Positives = 158/214 (74%), Gaps = 0/214 (0%)
 Frame = +1

Query  148  GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  327
            G++SR++ PAC S+C  CPA+R+RSRQPVKRYKKL+A+IFP++ +  AN RKI KLC+YA
Sbjct  6    GVISRQVLPACGSLCFFCPAMRARSRQPVKRYKKLIAEIFPRNQEEGANDRKIGKLCDYA  65

Query  328  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  507
            +KNP RIPKI+  LE+RCYKELR+ + +   ++  +Y +LL  CKEQM  FA +LL+++ 
Sbjct  66   SKNPLRIPKISNSLEQRCYKELRNENFQSAKIVMCIYRKLLVSCKEQMTLFASSLLSIIQ  125

Query  508  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRA  687
             +LD  + D ++ +GC T   F+ +Q DGT+ +N+E  + K+C LA+E GE +++R L +
Sbjct  126  TLLDQTRQDEMRIMGCQTLFDFVNNQKDGTFMFNLEGFIPKLCQLAQEIGEGERERKLCS  185

Query  688  SSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNY  789
            + L+ LS+M+WFM E SHI  +FD IV V +++Y
Sbjct  186  AGLQALSSMIWFMGEHSHISVEFDNIVSVVVESY  219


 Score =   117 bits (293),  Expect(2) = 3e-89, Method: Compositional matrix adjust.
 Identities = 65/180 (36%), Positives = 105/180 (58%), Gaps = 9/180 (5%)
 Frame = +2

Query  830   AHHNWVDEVIRSEGRDVGNENRPGYLIRKRP-----DKKDISLLTSEEIEMPKIWAHICI  994
             A   WV EV+++EG    +   P  LIR        + K    +T+E+ + P  W+ +C+
Sbjct  232   AQSRWVQEVLKNEGHVSPS---PDVLIRVPSWGAIVNDKGEPNVTAEDAQNPCFWSRVCL  288

Query  995   QRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSG-NHQLILT  1171
               MA+LAKE++T RRVL+ +F +FD    W  ++GLAF VL D+   ++SSG N   +L+
Sbjct  289   HNMANLAKEATTTRRVLESLFRYFDKENLWSLQNGLAFSVLKDIQLLMDSSGQNTHFLLS  348

Query  1172  GVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKSLQATVD  1351
              +V+HLDHKN+     ++  +I+   +LA   ++    + +G VSD+ RHLRKS+   +D
Sbjct  349   VLVKHLDHKNILKQPDMQLQIIEVTASLAELSKAEPSVAILGAVSDVMRHLRKSIHCLLD  408



>dbj|BAK01387.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1055

 Score =   263 bits (671),  Expect(2) = 3e-89, Method: Compositional matrix adjust.
 Identities = 117/217 (54%), Positives = 158/217 (73%), Gaps = 0/217 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG++SRK+ PAC ++C  CP LR+RSRQPVKRYKK+LA+IFP++PD   N R+I KLCEY
Sbjct  1    MGVISRKVLPACGALCYFCPGLRARSRQPVKRYKKILAEIFPRTPDEEPNERRIGKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            AAKNP R+PKI   LE+R YKELR+       V+  +Y  LL  CKEQM  FA +LL++V
Sbjct  61   AAKNPLRVPKITVYLEQRIYKELRTEQYGFAKVVMLIYRRLLVSCKEQMPLFASSLLSIV  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
              +LD  + D ++ IGC T   F  +QVDGTY +N+E LV ++C LA+E GE+++   LR
Sbjct  121  HTLLDQKRQDDMRIIGCETLFDFAVNQVDGTYQFNLEGLVPRLCELAQEAGEDERATSLR  180

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNYEP  795
            A++L+ LSAM+WFM E SHI ++FD +V V L+NY+P
Sbjct  181  AAALQALSAMIWFMGELSHISSEFDNVVEVVLENYKP  217


 Score = 95.5 bits (236),  Expect(2) = 3e-89, Method: Compositional matrix adjust.
 Identities = 58/187 (31%), Positives = 105/187 (56%), Gaps = 14/187 (7%)
 Frame = +2

Query  812   DDERGEAHHN-WVDEVIRSEGRDVGNENRPGYLIRKRP------DKKDISLLTSEEIEMP  970
             DD+  +   N +  EV ++E      EN   ++I + P      + K    L +E+ + P
Sbjct  223   DDQVTKVPDNEFAQEVPKTE------ENTSPFVITEIPSWESIVNPKGGVNLPTEDAKDP  276

Query  971   KIWAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSG  1150
             K+W+ IC+  MA L++E++T RR+L+ +F  F ++  W P +GLA  VL D+   VE SG
Sbjct  277   KLWSRICVHNMAKLSREATTFRRILESVFRCFGSSSSWSPDNGLALCVLLDMQLLVEHSG  336

Query  1151  -NHQLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLR  1327
              N  L+L+ +++H+++K +     ++  +++ A  LA Q  +    + IG +SDL RHL+
Sbjct  337   LNMHLLLSLLIKHIENKAMVKQPDMQLSIVEVAAILAEQSNAQASAATIGAISDLVRHLK  396

Query  1328  KSLQATV  1348
             ++   T+
Sbjct  397   RTFHITL  403



>ref|XP_006350206.1| PREDICTED: protein EFR3 homolog B-like isoform X3 [Solanum tuberosum]
Length=969

 Score =   248 bits (633),  Expect(2) = 3e-89, Method: Compositional matrix adjust.
 Identities = 111/219 (51%), Positives = 158/219 (72%), Gaps = 0/219 (0%)
 Frame = +1

Query  133  LQGKMGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMK  312
            + G  G++SR++ PAC S+C  CPA+R+RSRQPVKRYKKL++DIFP+S +   N RKI K
Sbjct  1    MNGVSGVMSRQVLPACGSLCFFCPAMRTRSRQPVKRYKKLISDIFPRSQEEEPNDRKIGK  60

Query  313  LCEYAAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNL  492
            LCEYAAKNPFRIPKI K LEE+CYKELR+ + +   V+  +Y +L+  CKE M  FA +L
Sbjct  61   LCEYAAKNPFRIPKITKSLEEKCYKELRNENFRSAKVVMCIYKKLVVSCKEHMPLFANSL  120

Query  493  LNVVVEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQK  672
            L+V+  +LD ++ + +  +GC +   F+ +Q DGTY ++++  + K+C LA++ GEE+  
Sbjct  121  LSVLQTLLDQSRENDMLIVGCESLFDFVNNQKDGTYMFHLDGFIPKLCQLAQQIGEEESA  180

Query  673  RCLRASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNY  789
              LR   ++ LSAMVWFM E+SH+ A+FD IV V L+NY
Sbjct  181  INLRTVGVKALSAMVWFMGEYSHVSAEFDNIVSVVLENY  219


 Score =   110 bits (274),  Expect(2) = 3e-89, Method: Compositional matrix adjust.
 Identities = 58/158 (37%), Positives = 95/158 (60%), Gaps = 6/158 (4%)
 Frame = +2

Query  887   ENRPGYLIRKRPDKKDISLLTSEEIEMPKIWAHICIQRMADLAKESSTMRRVLDPMFIHF  1066
             EN P    R R + +D S    E+ E P  W+  C+  MA L KE++T RRVL+ +F +F
Sbjct  217   ENYP----RPRKETQD-SNQNREDAENPAFWSRACLHNMAKLGKEATTTRRVLESLFRYF  271

Query  1067  DNNKHWVPRHGLAFVVLSDLSYFVESSG-NHQLILTGVVRHLDHKNVACDSQIKSFVIQT  1243
             D++  W   +G+A  +L D+ Y +++SG N  L+L+ +V+HLDHKNV    +++  ++Q 
Sbjct  272   DDDNLWPTENGIAVPILKDMQYTMDASGENAHLLLSALVKHLDHKNVLKQPEMQLDIVQV  331

Query  1244  ATALARQIRSGGGFSDIGFVSDLCRHLRKSLQATVDLA  1357
              T+LA+  +     + +  ++D+ RHLRKS+  T D A
Sbjct  332   VTSLAQTTKIHHSIALVSAITDIMRHLRKSIHYTHDDA  369



>ref|XP_009363645.1| PREDICTED: uncharacterized protein LOC103953608 [Pyrus x bretschneideri]
 ref|XP_009363646.1| PREDICTED: uncharacterized protein LOC103953608 [Pyrus x bretschneideri]
Length=997

 Score =   244 bits (622),  Expect(2) = 4e-89, Method: Compositional matrix adjust.
 Identities = 110/215 (51%), Positives = 151/215 (70%), Gaps = 0/215 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG++SR++ PAC ++C  CP++R+RSRQPVKRYKKLL DI P++ D   N RKI KLC+Y
Sbjct  1    MGVMSRRIVPACGNLCFFCPSMRARSRQPVKRYKKLLTDILPRNQDAEPNDRKIGKLCDY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            A KNP RIPKI   LE+RCYK+LR+ H   V V+  +Y +LL  CKEQM  FA +LL +V
Sbjct  61   AMKNPLRIPKITDSLEQRCYKDLRNEHFGSVKVVLCIYRKLLSSCKEQMPLFASSLLGIV  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
              +L+  + D ++ +GC T   FI SQ D T+ +++E L+ KVC +A E G+ ++   LR
Sbjct  121  RILLEQTRHDEMRILGCNTLVDFIQSQTDSTHMFSLEGLIPKVCQMAEEVGDNERALRLR  180

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNY  789
            ++ L+ L+ MVWFM E SHI  DFD I+ VTL+NY
Sbjct  181  SAGLQSLAFMVWFMGEHSHISMDFDTIISVTLENY  215


 Score =   114 bits (284),  Expect(2) = 4e-89, Method: Compositional matrix adjust.
 Identities = 63/184 (34%), Positives = 105/184 (57%), Gaps = 9/184 (5%)
 Frame = +2

Query  803   INEDDERGEAHHNWVDEVIRSEGRD----VGNENRPGYLIRKRPDKKDISLLTSEEIEMP  970
             + ED +  E+   WV+ V+++E  D    V ++        + PD  D ++ T++    P
Sbjct  225   LKEDRQYSESQDQWVNGVLKAEVHDSSFPVISQKVTSLPSLENPDL-DPTIDTNKS---P  280

Query  971   KIWAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSG  1150
               W+ +C++ +A LAKE++T+RRVL+P+F  FD   HW P   LA+ VL  +   +E SG
Sbjct  281   SYWSRVCLRNIAKLAKEATTVRRVLEPLFQSFDAENHWSPEKPLAYNVLMYMQSLLEESG  340

Query  1151  -NHQLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLR  1327
              N  L+L  +V+HLDHKNV    ++++ ++   T +A+  +     +  G +SDL +HLR
Sbjct  341   DNSHLLLHILVKHLDHKNVVKQPRLQTDIVNVTTQIAQGAKQQASVAITGAISDLIKHLR  400

Query  1328  KSLQ  1339
             K LQ
Sbjct  401   KCLQ  404



>ref|XP_010666756.1| PREDICTED: uncharacterized protein LOC104883885 [Beta vulgaris 
subsp. vulgaris]
Length=1011

 Score =   245 bits (625),  Expect(2) = 7e-89, Method: Compositional matrix adjust.
 Identities = 108/214 (50%), Positives = 153/214 (71%), Gaps = 0/214 (0%)
 Frame = +1

Query  148  GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  327
            G++SR++ PAC S+C  CP LR+RSRQPVKRYKKL+ADIFPK+ D   N R I KLCEYA
Sbjct  6    GVISRQVLPACGSLCFFCPGLRARSRQPVKRYKKLIADIFPKTQDEGPNDRMIGKLCEYA  65

Query  328  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  507
            A+NP R+PKI   LE+RCYKELR+ +   V ++  +Y  LL  CK+QM  FA +L++++ 
Sbjct  66   ARNPLRVPKITNNLEQRCYKELRNQNFNAVKIVMSIYRRLLVSCKDQMPLFASSLVSIMH  125

Query  508  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRA  687
             +LD    D ++ IGC     F+ +Q DGT+ +N+E+ + K+C LA+E GE+++   LRA
Sbjct  126  ILLDQTGQDELRVIGCQALFVFVNNQKDGTFIFNLEDFIPKLCLLAQEVGEDERGFRLRA  185

Query  688  SSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNY  789
            + L+ LS+M+WFM E SH+ A+FD +V V L+NY
Sbjct  186  AGLQTLSSMIWFMGEHSHMLAEFDNVVSVVLENY  219


 Score =   112 bits (279),  Expect(2) = 7e-89, Method: Compositional matrix adjust.
 Identities = 68/199 (34%), Positives = 106/199 (53%), Gaps = 13/199 (7%)
 Frame = +2

Query  809   EDDERGEAHHNWVDEVIRSEGR-----DVGNENRPGYLIRKRPDKKDISLLTSEEIEMPK  973
             +D E+      WV EV   EG      D+      G +I  + +      +T E  + P 
Sbjct  224   DDTEQQGTDGGWVQEVQNDEGHVTASLDISKIPTWGGIINSKGELN----VTEEVAKHPG  279

Query  974   IWAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSG-  1150
              W+ +C+  MA L  E++T RRVL+ +F +FDN   W P+HG+A  V+ D+   +ES G 
Sbjct  280   FWSRVCLHNMAKLGTEATTTRRVLESLFRYFDNGNLWSPKHGVACPVIRDMQSVMESLGH  339

Query  1151  NHQLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRK  1330
             +   +L+ +V+HLDHKNV    +++  + +  T+LA Q       S +G VSD+ RHLRK
Sbjct  340   SSHFLLSILVKHLDHKNVLKRPEMQLDIFEVTTSLAEQAAVEPSVSLLGAVSDVMRHLRK  399

Query  1331  SLQATVD---LAGEEINLN  1378
             S+ +++D   L  E I  N
Sbjct  400   SIHSSLDDSKLGAEVIKYN  418



>ref|XP_006421414.1| hypothetical protein CICLE_v10006843mg [Citrus clementina]
 gb|ESR34654.1| hypothetical protein CICLE_v10006843mg [Citrus clementina]
Length=1027

 Score =   247 bits (630),  Expect(2) = 9e-89, Method: Compositional matrix adjust.
 Identities = 110/214 (51%), Positives = 153/214 (71%), Gaps = 0/214 (0%)
 Frame = +1

Query  148  GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  327
            G++SRK+ PAC  +C  CPA+R+RSRQPVKRYKKL++DIFP++ D   N RKI KLCEYA
Sbjct  6    GVISRKVLPACGRLCFFCPAMRARSRQPVKRYKKLISDIFPRNQDEGPNDRKIGKLCEYA  65

Query  328  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  507
             KNP RIPKI   LE+RCYKELR+ + +   ++  +Y +LL  CKEQM  FA +LL ++ 
Sbjct  66   NKNPLRIPKITTSLEQRCYKELRNENFQFAKIVMCIYRKLLISCKEQMPLFASSLLTIIH  125

Query  508  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRA  687
             +LD  + D ++ IGC+T   F+ +Q DGTY +N+E  + K+C LA+E GE ++ R +R+
Sbjct  126  TLLDQTRQDEIQIIGCMTLFDFVNNQKDGTYMFNLECFIPKLCQLAQEVGENERARSIRS  185

Query  688  SSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNY  789
            + L+ LS+MV FM E SHI  +FD +V V L+NY
Sbjct  186  AGLQALSSMVRFMGEHSHISVEFDNVVSVVLENY  219


 Score =   109 bits (273),  Expect(2) = 9e-89, Method: Compositional matrix adjust.
 Identities = 62/193 (32%), Positives = 105/193 (54%), Gaps = 9/193 (5%)
 Frame = +2

Query  800   PINEDDERGEAHHNWVDEVIRSEGR-----DVGNENRPGYLIRKRPDKKDISLLTSEEIE  964
             P    +  G+    WV+EV + EG      DV        L+     + ++ +   ++ E
Sbjct  222   PRRNSENSGQNQSRWVEEVRKKEGHVSPLPDVSIRVPSWRLMVNEKGEINVPI---QDAE  278

Query  965   MPKIWAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVES  1144
              P  W+ +C+  MA LAKE++T+RRVL+ +F +FDN   W    GLAF+VL D+   +++
Sbjct  279   DPCFWSRVCLHNMAKLAKEATTIRRVLESLFRYFDNANLWSLDTGLAFLVLKDMQVLMDN  338

Query  1145  SG-NHQLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRH  1321
             +G N   +L+ +++HLDHKNV     ++  ++   T+L    +     + IG V+D+ RH
Sbjct  339   TGQNTHFLLSILIKHLDHKNVLKKPNMQLEIVDVTTSLIEHTKVEPSVAIIGAVTDVMRH  398

Query  1322  LRKSLQATVDLAG  1360
             LRKS+  ++D A 
Sbjct  399   LRKSIHCSLDDAN  411



>dbj|BAK04246.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1037

 Score =   242 bits (618),  Expect(2) = 1e-88, Method: Compositional matrix adjust.
 Identities = 108/216 (50%), Positives = 153/216 (71%), Gaps = 0/216 (0%)
 Frame = +1

Query  148  GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  327
            G++SRK+ PAC  +C  CP+LR+RSRQPVKRYKK+LA+IFP + +   N R+I KLC+Y 
Sbjct  27   GVVSRKVLPACGGLCYFCPSLRARSRQPVKRYKKILAEIFPATQEEEPNERRIGKLCDYV  86

Query  328  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  507
            A+NP R+PKI + LE+RCYKELR      V V+  +Y +LL  CK+QM   A +LL+++ 
Sbjct  87   ARNPHRVPKITEYLEQRCYKELRKEQYGFVKVVVLIYRKLLVSCKDQMPLLASSLLSIIC  146

Query  508  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRA  687
             +LD  + D ++ IGC T   F+ +QVDGTY +N+E LV K+C LA+    +++   LRA
Sbjct  147  TLLDRMRHDDMRIIGCETLFDFVVTQVDGTYQFNLEELVPKLCELAQVVKVQEKSNALRA  206

Query  688  SSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNYEP  795
            S+L+ LSAM+WFM E SHI ++FD +V V L++Y P
Sbjct  207  SALQALSAMIWFMGELSHISSEFDTVVQVVLESYSP  242


 Score =   114 bits (284),  Expect(2) = 1e-88, Method: Compositional matrix adjust.
 Identities = 66/195 (34%), Positives = 112/195 (57%), Gaps = 9/195 (5%)
 Frame = +2

Query  785   TMSQMPINEDDERGEAHHNWVDEVIRSEGRDVGNENRPGYLIRKRP------DKKDISLL  946
             + S   ++ D++  EA  +   EV+++EGR   + + P  + R         DK +I L 
Sbjct  239   SYSPQKMHNDNDGVEAQGSGWTEVLKAEGRASPSPS-PFTISRTTSWKSIVSDKGEIQLP  297

Query  947   TSEEIEMPKIWAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDL  1126
               E  + P  W+ IC+  MA L++E++T RRV++ +  HFDNN  W  +  LA  VL D+
Sbjct  298   V-EVTKDPNFWSRICVHNMARLSREATTFRRVIESLLRHFDNNNSWSSQSTLALSVLLDM  356

Query  1127  SYFVESSG-NHQLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFV  1303
                +E SG N  L+++ +V+HL+HK+V    +++  +++  TALA Q R+    + IG +
Sbjct  357   QMLMEYSGQNTNLMMSILVKHLEHKSVLKQPEMQLCIVEVITALAEQSRAQASAATIGAI  416

Query  1304  SDLCRHLRKSLQATV  1348
             SDL RH++K+L+  V
Sbjct  417   SDLVRHMKKTLRVAV  431



>ref|XP_001770437.1| predicted protein [Physcomitrella patens]
 gb|EDQ64774.1| predicted protein [Physcomitrella patens]
Length=1107

 Score =   204 bits (519),  Expect(2) = 1e-88, Method: Compositional matrix adjust.
 Identities = 109/262 (42%), Positives = 154/262 (59%), Gaps = 48/262 (18%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MGL+SR++ P C SMC+CCPALR+RSRQPVKRY  LLADI+PK+     N RKI KL +Y
Sbjct  1    MGLMSRRVLPVCGSMCVCCPALRARSRQPVKRYNMLLADIYPKTQVEVPNDRKIGKLVDY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQ------------  468
            AAKNP RIPKIA  LE+R  KEL++ H   V V+   Y++L   C+++            
Sbjct  61   AAKNPLRIPKIASALEQRGLKELKNEHIGTVRVVMRAYSKLFIACRDEILSHHALGTGPG  120

Query  469  ----------------------------------MACFAVNLLNVVVEMLDCAKTDAVKT  546
                                              M+ FA N LN++  +LD  K D+++ 
Sbjct  121  LGINFRQEVYNAFLVASAIDFAFSCDSTLVLADTMSLFANNALNMIKSLLDQPKHDSLRI  180

Query  547  IGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRCLSAMVWFM  726
            +GC+    FI  + D TY  N++++V  +C+LA E G+E ++  +RA++L+ L+AMV FM
Sbjct  181  LGCMILVDFI--RTDATYIRNLDSMVPVLCALALEHGDEKKRMPIRAAALQALAAMVGFM  238

Query  727  AEFSHIFADFDEIVHVTLDNYE  792
             + SHI  +FDEIV V+L+NYE
Sbjct  239  GQHSHIPPEFDEIVSVSLENYE  260


 Score =   152 bits (383),  Expect(2) = 1e-88, Method: Compositional matrix adjust.
 Identities = 81/202 (40%), Positives = 122/202 (60%), Gaps = 17/202 (8%)
 Frame = +2

Query  818   ERGEAHHNWVDEVIRSEGRDVGNENRPGYLIRKRPDK------KDISL----LTSEEIEM  967
             E+GEA   W+ E +RSE     +     +++R++ +K       DI +    LTSEE + 
Sbjct  272   EKGEAQQQWMRETMRSE-----SHAHALHVMREKLNKLHRHKAHDIIMDPLNLTSEEADA  326

Query  968   PKIWAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESS  1147
             P +W+ ICIQ M  LAKE++T+RRVLDPMF +FD  KHW    GLA V+L ++ + +E +
Sbjct  327   PSVWSQICIQNMGTLAKEATTVRRVLDPMFRYFDAKKHWSLERGLALVILQNMQFLMEQT  386

Query  1148  GNHQLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLR  1327
             GN QL+L  +VRHLDHK V     +K  ++     LARQ ++    +++G +SDL RHLR
Sbjct  387   GNGQLLLAALVRHLDHKIVEEKVVMKRNIVALTAVLARQSKTKATVAEVGAMSDLSRHLR  446

Query  1328  KSLQATV--DLAGEEINLNLTL  1387
              SLQ ++   + G   + N++L
Sbjct  447   MSLQMSMQSSVPGSVFDENISL  468



>gb|EEE56284.1| hypothetical protein OsJ_05346 [Oryza sativa Japonica Group]
Length=1056

 Score =   239 bits (610),  Expect(2) = 2e-88, Method: Compositional matrix adjust.
 Identities = 109/214 (51%), Positives = 148/214 (69%), Gaps = 0/214 (0%)
 Frame = +1

Query  148  GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  327
            G++SRK+ PAC  +C  CP LR+RSRQPVKRYKK++ADIFP + D   N R+I KLCEY 
Sbjct  12   GVVSRKVLPACGGLCYFCPGLRARSRQPVKRYKKIIADIFPATQDEEPNERRIGKLCEYV  71

Query  328  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  507
            A+N  R+PKI   LE+RCYKELR+     V V+  +Y +LL  CK+QM   A + L+++ 
Sbjct  72   ARNHHRVPKITAYLEQRCYKELRNEQYGFVKVVVLIYRKLLVSCKKQMPLLASSALSIIC  131

Query  508  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRA  687
             +LD  + D ++ IGC T   F  SQVDGTY +N+E LV K+C LA+    E++   LRA
Sbjct  132  TLLDQTRRDDMRIIGCETLFDFTVSQVDGTYQFNLEELVPKLCELAQIVKAEEKDNMLRA  191

Query  688  SSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNY  789
            S+L+ LSAM+WFM EFSHI + FD ++ V L++Y
Sbjct  192  STLQALSAMIWFMGEFSHISSAFDNVIQVVLESY  225


 Score =   116 bits (291),  Expect(2) = 2e-88, Method: Compositional matrix adjust.
 Identities = 63/180 (35%), Positives = 109/180 (61%), Gaps = 5/180 (3%)
 Frame = +2

Query  803   INEDDERGEAHHN-WVDEVIRSEGRDVGNENRPGYLIRKRPDKKDISLLTSEEIEMPKIW  979
             +  D+   EA  N WV++V+++EG +      P +  +   D K    L +E+ + P  W
Sbjct  230   MQNDNIDSEAPGNRWVEQVLKAEG-NATISRIPSW--KSIVDDKGELHLPAEDAKDPNFW  286

Query  980   AHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSG-NH  1156
             + +C+  MA L++E++T RRVL+ +F HFDNN  W  ++ LAF VL D+   +E+ G N 
Sbjct  287   SRVCVHNMAKLSREATTFRRVLESLFRHFDNNNSWSSQNTLAFCVLLDMQILMENQGQNI  346

Query  1157  QLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKSL  1336
              L+++ +V+HL+HK+V    +++  V++   +LA Q R+    + IG +SDL RH++K+L
Sbjct  347   DLMISILVKHLEHKSVLKQPEMQLSVVEVIASLAEQSRAEASAATIGAISDLIRHMKKTL  406



>ref|XP_004493504.1| PREDICTED: uncharacterized protein LOC101511203 isoform X1 [Cicer 
arietinum]
Length=1013

 Score =   243 bits (621),  Expect(2) = 2e-88, Method: Compositional matrix adjust.
 Identities = 109/215 (51%), Positives = 156/215 (73%), Gaps = 0/215 (0%)
 Frame = +1

Query  148  GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  327
            G++SR++ PAC S+C  CPALR+RSRQPVKRYKKL+A+IFP++ +   N RKI KLC+YA
Sbjct  7    GVVSRQVLPACGSLCFFCPALRARSRQPVKRYKKLIAEIFPRNQEEGLNDRKIGKLCDYA  66

Query  328  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  507
            AKNP RIPKI   LE+RCYKELR+ + +   ++  +Y + L  CKEQM  FA +LL+++ 
Sbjct  67   AKNPLRIPKIVNALEQRCYKELRNENFRSTRIVMCIYKKFLSSCKEQMPLFASSLLSIIH  126

Query  508  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRA  687
             +LD  + D ++ IGC     F+ +QVDG+Y +++E ++ K+C LA+ETGE+++ R  R+
Sbjct  127  TLLDQTRQDEMRVIGCNILFDFVNNQVDGSYLFSLEGVIPKLCQLAQETGEDERARTRRS  186

Query  688  SSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNYE  792
            + L+ LS+MV FM E SHI  +FD IV   L+NYE
Sbjct  187  AGLKALSSMVRFMGEHSHISVEFDNIVSAVLENYE  221


 Score =   112 bits (280),  Expect(2) = 2e-88, Method: Compositional matrix adjust.
 Identities = 64/187 (34%), Positives = 108/187 (58%), Gaps = 9/187 (5%)
 Frame = +2

Query  806   NEDDERGEAHHNW----VDEVIRSEGRDVGNENRPGYLIRKRPDKKDISLLTSEEIEMPK  973
             N ++E+G   + W     +E   S   DV   N P   +    DK +++    E+ + P 
Sbjct  232   NINEEQG-TENKWDPDTTNEAQTSPLLDVKKRNPPWSKVVN--DKGEVNF-AMEDDKNPS  287

Query  974   IWAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFV-ESSG  1150
              W+ +C+  MA+LAKE +T+RRV++ +F +FDN   W   HGLAF VL D+ + + +S  
Sbjct  288   FWSGVCLHNMANLAKEGTTIRRVMESLFRYFDNGNLWSINHGLAFSVLKDILFLMDDSEK  347

Query  1151  NHQLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRK  1330
             N  ++L+ +++HLDHK V  +  ++  +++ AT+LA+  +     S IG VSD+ RHLRK
Sbjct  348   NTHVLLSMLIKHLDHKTVLKEPNMQLDIVEVATSLAQYAKVQPSVSIIGSVSDMMRHLRK  407

Query  1331  SLQATVD  1351
             ++   +D
Sbjct  408   TIHCCLD  414



>ref|XP_004493505.1| PREDICTED: uncharacterized protein LOC101511203 isoform X2 [Cicer 
arietinum]
Length=1012

 Score =   243 bits (621),  Expect(2) = 2e-88, Method: Compositional matrix adjust.
 Identities = 109/215 (51%), Positives = 156/215 (73%), Gaps = 0/215 (0%)
 Frame = +1

Query  148  GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  327
            G++SR++ PAC S+C  CPALR+RSRQPVKRYKKL+A+IFP++ +   N RKI KLC+YA
Sbjct  7    GVVSRQVLPACGSLCFFCPALRARSRQPVKRYKKLIAEIFPRNQEEGLNDRKIGKLCDYA  66

Query  328  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  507
            AKNP RIPKI   LE+RCYKELR+ + +   ++  +Y + L  CKEQM  FA +LL+++ 
Sbjct  67   AKNPLRIPKIVNALEQRCYKELRNENFRSTRIVMCIYKKFLSSCKEQMPLFASSLLSIIH  126

Query  508  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRA  687
             +LD  + D ++ IGC     F+ +QVDG+Y +++E ++ K+C LA+ETGE+++ R  R+
Sbjct  127  TLLDQTRQDEMRVIGCNILFDFVNNQVDGSYLFSLEGVIPKLCQLAQETGEDERARTRRS  186

Query  688  SSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNYE  792
            + L+ LS+MV FM E SHI  +FD IV   L+NYE
Sbjct  187  AGLKALSSMVRFMGEHSHISVEFDNIVSAVLENYE  221


 Score =   112 bits (279),  Expect(2) = 2e-88, Method: Compositional matrix adjust.
 Identities = 64/187 (34%), Positives = 108/187 (58%), Gaps = 9/187 (5%)
 Frame = +2

Query  806   NEDDERGEAHHNW----VDEVIRSEGRDVGNENRPGYLIRKRPDKKDISLLTSEEIEMPK  973
             N ++E+G   + W     +E   S   DV   N P   +    DK +++    E+ + P 
Sbjct  232   NINEEQG-TENKWDPDTTNEAQTSPLLDVKKRNPPWSKVVN--DKGEVNF-AMEDDKNPS  287

Query  974   IWAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFV-ESSG  1150
              W+ +C+  MA+LAKE +T+RRV++ +F +FDN   W   HGLAF VL D+ + + +S  
Sbjct  288   FWSGVCLHNMANLAKEGTTIRRVMESLFRYFDNGNLWSINHGLAFSVLKDILFLMDDSEK  347

Query  1151  NHQLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRK  1330
             N  ++L+ +++HLDHK V  +  ++  +++ AT+LA+  +     S IG VSD+ RHLRK
Sbjct  348   NTHVLLSMLIKHLDHKTVLKEPNMQLDIVEVATSLAQYAKVQPSVSIIGSVSDMMRHLRK  407

Query  1331  SLQATVD  1351
             ++   +D
Sbjct  408   TIHCCLD  414



>ref|NP_001045867.1| Os02g0143200 [Oryza sativa Japonica Group]
 dbj|BAD13233.1| cyclin-like protein [Oryza sativa Japonica Group]
 dbj|BAF07781.1| Os02g0143200 [Oryza sativa Japonica Group]
Length=1035

 Score =   239 bits (609),  Expect(2) = 2e-88, Method: Compositional matrix adjust.
 Identities = 109/214 (51%), Positives = 148/214 (69%), Gaps = 0/214 (0%)
 Frame = +1

Query  148  GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  327
            G++SRK+ PAC  +C  CP LR+RSRQPVKRYKK++ADIFP + D   N R+I KLCEY 
Sbjct  12   GVVSRKVLPACGGLCYFCPGLRARSRQPVKRYKKIIADIFPATQDEEPNERRIGKLCEYV  71

Query  328  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  507
            A+N  R+PKI   LE+RCYKELR+     V V+  +Y +LL  CK+QM   A + L+++ 
Sbjct  72   ARNHHRVPKITAYLEQRCYKELRNEQYGFVKVVVLIYRKLLVSCKKQMPLLASSALSIIC  131

Query  508  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRA  687
             +LD  + D ++ IGC T   F  SQVDGTY +N+E LV K+C LA+    E++   LRA
Sbjct  132  TLLDQTRRDDMRIIGCETLFDFTVSQVDGTYQFNLEELVPKLCELAQIVKAEEKDNMLRA  191

Query  688  SSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNY  789
            S+L+ LSAM+WFM EFSHI + FD ++ V L++Y
Sbjct  192  STLQALSAMIWFMGEFSHISSAFDNVIQVVLESY  225


 Score =   116 bits (290),  Expect(2) = 2e-88, Method: Compositional matrix adjust.
 Identities = 63/180 (35%), Positives = 109/180 (61%), Gaps = 5/180 (3%)
 Frame = +2

Query  803   INEDDERGEAHHN-WVDEVIRSEGRDVGNENRPGYLIRKRPDKKDISLLTSEEIEMPKIW  979
             +  D+   EA  N WV++V+++EG +      P +  +   D K    L +E+ + P  W
Sbjct  230   MQNDNIDSEAPGNRWVEQVLKAEG-NATISRIPSW--KSIVDDKGELHLPAEDAKDPNFW  286

Query  980   AHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSG-NH  1156
             + +C+  MA L++E++T RRVL+ +F HFDNN  W  ++ LAF VL D+   +E+ G N 
Sbjct  287   SRVCVHNMAKLSREATTFRRVLESLFRHFDNNNSWSSQNTLAFCVLLDMQILMENQGQNI  346

Query  1157  QLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKSL  1336
              L+++ +V+HL+HK+V    +++  V++   +LA Q R+    + IG +SDL RH++K+L
Sbjct  347   DLMISILVKHLEHKSVLKQPEMQLSVVEVIASLAEQSRAEASAATIGAISDLIRHMKKTL  406



>gb|EEC72466.1| hypothetical protein OsI_05818 [Oryza sativa Indica Group]
Length=1056

 Score =   239 bits (609),  Expect(2) = 5e-88, Method: Compositional matrix adjust.
 Identities = 109/214 (51%), Positives = 148/214 (69%), Gaps = 0/214 (0%)
 Frame = +1

Query  148  GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  327
            G++SRK+ PAC  +C  CP LR+RSRQPVKRYKK++ADIFP + D   N R+I KLCEY 
Sbjct  12   GVVSRKVLPACGGLCYFCPGLRARSRQPVKRYKKIIADIFPATQDEEPNERRIGKLCEYV  71

Query  328  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  507
            A+N  R+PKI   LE+RCYKELR+     V V+  +Y +LL  CK+QM   A + L+++ 
Sbjct  72   ARNHHRVPKITAYLEQRCYKELRNEQYGFVKVVVLIYRKLLVSCKKQMPLLASSALSIIC  131

Query  508  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRA  687
             +LD  + D ++ IGC T   F  SQVDGTY +N+E LV K+C LA+    E++   LRA
Sbjct  132  TLLDQTRRDDMRIIGCETLFDFTVSQVDGTYQFNLEELVPKLCELAQIVKAEEKDNMLRA  191

Query  688  SSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNY  789
            S+L+ LSAM+WFM EFSHI + FD ++ V L++Y
Sbjct  192  SALQALSAMIWFMGEFSHISSAFDNVIQVVLESY  225


 Score =   115 bits (287),  Expect(2) = 5e-88, Method: Compositional matrix adjust.
 Identities = 62/180 (34%), Positives = 109/180 (61%), Gaps = 5/180 (3%)
 Frame = +2

Query  803   INEDDERGEAHHN-WVDEVIRSEGRDVGNENRPGYLIRKRPDKKDISLLTSEEIEMPKIW  979
             +  D+   EA  N WV++V+++EG +      P +  +   D K    L +E+ + P  W
Sbjct  230   MQNDNIDSEAPGNRWVEQVLKAEG-NATISRIPSW--KSIVDDKGELHLPAEDAKDPNFW  286

Query  980   AHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSG-NH  1156
             + +C+  MA L++E++T RRV++ +F HFDNN  W  ++ LAF VL D+   +E+ G N 
Sbjct  287   SRVCVHNMAKLSREATTFRRVVESLFRHFDNNNSWSSQNTLAFCVLLDMQILMENQGQNI  346

Query  1157  QLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKSL  1336
              L+++ +V+HL+HK+V    +++  V++   +LA Q R+    + IG +SDL RH++K+L
Sbjct  347   DLMISILVKHLEHKSVLKQPEMQLSVVEVIASLAEQSRAEASAATIGAISDLIRHMKKTL  406



>ref|XP_006489936.1| PREDICTED: uncharacterized protein LOC102624456 [Citrus sinensis]
Length=1039

 Score =   244 bits (624),  Expect(2) = 5e-88, Method: Compositional matrix adjust.
 Identities = 109/214 (51%), Positives = 153/214 (71%), Gaps = 0/214 (0%)
 Frame = +1

Query  148  GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  327
            G++SRK+ PAC  +C  CPA+R+RSRQPVKRYKKL++DIFP++ D   N RKI KLCEYA
Sbjct  6    GVISRKVLPACGRLCFFCPAMRARSRQPVKRYKKLISDIFPRNQDEGPNDRKIGKLCEYA  65

Query  328  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  507
             KNP RIPKI   LE+RCYKELR+ + +   ++  +Y +LL  CKEQM  FA +LL ++ 
Sbjct  66   NKNPLRIPKITTSLEQRCYKELRNENFQSAKIVMCIYRKLLISCKEQMPLFASSLLTIIH  125

Query  508  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRA  687
             +LD  + D ++ IGC+T   F+ +Q DGTY +N+E  + K+C L++E GE ++ R +R+
Sbjct  126  TLLDQTRQDEIQIIGCMTLFDFVNNQKDGTYMFNLECFIPKLCQLSQEVGENERARSIRS  185

Query  688  SSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNY  789
            + L+ LS+MV FM E SHI  +FD +V V L+NY
Sbjct  186  AGLQALSSMVRFMGEHSHISVEFDNVVSVVLENY  219


 Score =   109 bits (272),  Expect(2) = 5e-88, Method: Compositional matrix adjust.
 Identities = 64/202 (32%), Positives = 108/202 (53%), Gaps = 12/202 (6%)
 Frame = +2

Query  800   PINEDDERGEAHHNWVDEVIRSEGR-----DVGNENRPGYLIRKRPDKKDISLLTSEEIE  964
             P    +  G+    WV+EV + EG      DV        L+     + ++ +   ++ E
Sbjct  222   PRRNSENSGQNQSRWVEEVRKKEGHVSPLPDVSIRVPSWRLMVNEKGEINVPI---QDAE  278

Query  965   MPKIWAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVES  1144
              P  W+ +C+  MA LAKE++T+RRVL+ +F +FDN   W    GLAF+VL D+   +++
Sbjct  279   DPCFWSRVCLHNMAKLAKEATTIRRVLESLFRYFDNANLWSLDTGLAFLVLKDMQVLMDN  338

Query  1145  SG-NHQLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRH  1321
             +G N   +L+ +++HLDHKNV     ++  ++   T+L    +     + IG V+D+ RH
Sbjct  339   TGQNTHFLLSILIKHLDHKNVLKKPNMQLEIVDVTTSLIEHTKVEPSVAIIGAVTDVMRH  398

Query  1322  LRKSLQATVD---LAGEEINLN  1378
             LRKS+  ++D   L  + I  N
Sbjct  399   LRKSIHCSLDDANLGADVIKFN  420



>ref|NP_001048304.1| Os02g0780500 [Oryza sativa Japonica Group]
 dbj|BAD19529.1| cyclin-like protein [Oryza sativa Japonica Group]
 dbj|BAF10218.1| Os02g0780500 [Oryza sativa Japonica Group]
 dbj|BAH00340.1| unnamed protein product [Oryza sativa Japonica Group]
Length=997

 Score =   241 bits (616),  Expect(2) = 7e-88, Method: Compositional matrix adjust.
 Identities = 108/216 (50%), Positives = 154/216 (71%), Gaps = 0/216 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG++SR++ PACE +C  CP+LR+RSR PVKRYKKLL++IFPKS D   N RKI KLCEY
Sbjct  3    MGVVSREVLPACERLCFLCPSLRTRSRHPVKRYKKLLSEIFPKSQDEEPNDRKIGKLCEY  62

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
             ++NP R+PKI   LE++ YKELR  H   V V+  +Y +++C C+EQ+  FA +LLN+V
Sbjct  63   ISRNPLRVPKITVYLEQKFYKELRVEHFGSVKVVMAIYRKVICSCQEQLPLFANSLLNIV  122

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
              +L+  + D ++TI C T   F+ +QVD TY +N+E+ + K+C LA+E GE+++   + 
Sbjct  123  EALLEQNRQDDLRTIACRTLFYFVNNQVDSTYMFNLESQIPKLCQLAQEMGEKEKISIVH  182

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNYE  792
            A+ L+ LS+MVWFM E SHI A+ D +V   L+NYE
Sbjct  183  AAGLQALSSMVWFMGEHSHISAELDNVVSAVLENYE  218


 Score =   112 bits (279),  Expect(2) = 7e-88, Method: Compositional matrix adjust.
 Identities = 62/178 (35%), Positives = 103/178 (58%), Gaps = 7/178 (4%)
 Frame = +2

Query  842   WVDEVIRSEGRDVGN----ENRPGYLIRKRPDKKDISLLTSEEIEMPKIWAHICIQRMAD  1009
             WV EV+++E  +          P +   + P + ++SL T+EE E P  W+ IC+  +A 
Sbjct  237   WVSEVLKAEDHEPSGITILTRVPSWKAIRAP-RGELSL-TTEESESPNFWSGICLHNLAR  294

Query  1010  LAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSG-NHQLILTGVVRH  1186
             +++E++T+RRVL+ +F +FDNN  W P  GLA  VL D+   +E SG N  ++L+ +V+H
Sbjct  295   ISREATTVRRVLEAIFRYFDNNNLWSPSKGLALCVLLDMQIVIEKSGQNSHILLSMLVKH  354

Query  1187  LDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKSLQATVDLAG  1360
             L+HKNV   +     +I+  T LA   ++    + +  +SD+ RHL K++Q  V   G
Sbjct  355   LEHKNVLKQTDKILDIIEVTTRLAEHSKAQSSTALMAAISDMVRHLSKNMQLLVSDVG  412



>ref|XP_010930207.1| PREDICTED: uncharacterized protein LOC105051451 [Elaeis guineensis]
Length=1016

 Score =   250 bits (639),  Expect(2) = 8e-88, Method: Compositional matrix adjust.
 Identities = 111/216 (51%), Positives = 156/216 (72%), Gaps = 0/216 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG++SR++ PAC ++C  CP++R+RSRQPVKRYKKL+AD FPK+P+G  N R I KLCEY
Sbjct  1    MGMVSRQVLPACGNLCFLCPSMRARSRQPVKRYKKLIADSFPKTPEGEPNNRMIGKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            A KNP RIPKI +CLE++ YK LR+ H  L  V+  +Y  LL  CKEQM  FA +LL+V+
Sbjct  61   ACKNPMRIPKITECLEQKFYKALRNEHFSLAKVVPCIYRTLLASCKEQMPLFAPSLLSVI  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
              + D  + D ++ +GC T   F+ SQ D T+ +N+E L+ K+C L +E G +++   LR
Sbjct  121  RTLFDQTRQDDMRILGCHTVVDFLNSQKDSTFMFNLEGLIPKLCQLGQELGGDERGLRLR  180

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNYE  792
            ++ L+ L++M+WFM E+SHI  DFD+IV VTLDN+E
Sbjct  181  SAGLQALASMMWFMGEYSHISVDFDDIVSVTLDNFE  216


 Score =   103 bits (256),  Expect(2) = 8e-88, Method: Compositional matrix adjust.
 Identities = 63/188 (34%), Positives = 102/188 (54%), Gaps = 20/188 (11%)
 Frame = +2

Query  818   ERGEAHHNWVDEVIRSEGRDVGNENRPGYLIRKRPDKKDISLLTSEEIEM---------P  970
             + G   ++ V EV+R+E            L+ +   KK  SL    + E          P
Sbjct  227   QYGPPQNSSVQEVLRTEN---------AILVLQSSLKKVSSLRVRNKAEPDEPIDASKNP  277

Query  971   KIWAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSG  1150
               W+ IC+  MA +AKE++T+RRVL+P+F + D+   W    G+A+ VLS++   +E SG
Sbjct  278   AYWSKICLHNMAKIAKEATTVRRVLEPLFRNLDSGNKWS-LQGIAWPVLSEIQVVMEKSG  336

Query  1151  -NHQLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLR  1327
              N  L+L+ +V+HLDHKNV     ++  +++  T LA+  RS    +    ++DL RHLR
Sbjct  337   ENSHLLLSILVKHLDHKNVVKKPDMQISIVKVITNLAQHARSQASVAISTAITDLLRHLR  396

Query  1328  KSLQATVD  1351
             K +Q +V+
Sbjct  397   KCMQCSVE  404



>ref|XP_010546486.1| PREDICTED: uncharacterized protein LOC104818426 isoform X2 [Tarenaya 
hassleriana]
Length=1025

 Score =   241 bits (614),  Expect(2) = 9e-88, Method: Compositional matrix adjust.
 Identities = 110/214 (51%), Positives = 150/214 (70%), Gaps = 0/214 (0%)
 Frame = +1

Query  148  GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  327
            G++SR+L PAC  +CI CPALR+RSRQPVKRYKKL+A+IFP++     N RKI KLCEYA
Sbjct  6    GVISRQLLPACGDLCIFCPALRARSRQPVKRYKKLIAEIFPRNQAEGPNDRKIGKLCEYA  65

Query  328  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  507
            AKNP R+PKI+  LE+R YKELR+ + +   ++  +Y +LL  CKEQM  FA  LL  + 
Sbjct  66   AKNPLRMPKISNSLEQRFYKELRNENFQSAKIVMCIYRKLLVTCKEQMTLFASGLLRAIQ  125

Query  508  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRA  687
             +LD ++ D ++  GC T  +F+ +Q D +Y  N+E  + K+C LARE G+ D+ R LRA
Sbjct  126  ALLDQSQQDDMQITGCQTLFEFVNNQKDSSYINNLEGFIPKLCQLAREVGDNDRSRNLRA  185

Query  688  SSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNY  789
            + L+ LS+MVW M E+SHI  DFD +V   L+NY
Sbjct  186  AGLQALSSMVWLMGEYSHISNDFDNVVCGVLENY  219


 Score =   112 bits (280),  Expect(2) = 9e-88, Method: Compositional matrix adjust.
 Identities = 63/192 (33%), Positives = 107/192 (56%), Gaps = 9/192 (5%)
 Frame = +2

Query  824   GEAHHNWVDEVIRSEGRDVGNE---NRPGYLIRKRPDKKDISLLTSEEIEMPKIWAHICI  994
              E++  WV+EV+++EG     +   N P +  R   +    S +T E+   P  W+ +C+
Sbjct  229   NESNRKWVNEVLKNEGHTAYPDSLINVPSW--RNVVNDNGESNVTMEDSRDPSFWSKVCL  286

Query  995   QRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSGN-HQLILT  1171
             Q MA L +E++T+RR+L+ +F +FD    W   +  AF VL DL + +E SG     +L+
Sbjct  287   QNMAKLGEEATTVRRILESLFRYFDEGNLWSKENSTAFQVLRDLQFLMEKSGQGTHFLLS  346

Query  1172  GVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKSLQATVD  1351
              +++HLDHKNV     I+  ++   T+LA Q +     + +G + D+ RHLRK++  ++D
Sbjct  347   MLIKHLDHKNVLKQPSIQLDILWVTTSLAEQAKIEHSVAIVGAICDIMRHLRKNMHCSLD  406

Query  1352  LA---GEEINLN  1378
              A    +E  LN
Sbjct  407   DANSGADETKLN  418



>gb|EYU20743.1| hypothetical protein MIMGU_mgv1a000711mg [Erythranthe guttata]
Length=1009

 Score =   240 bits (613),  Expect(2) = 2e-87, Method: Compositional matrix adjust.
 Identities = 114/215 (53%), Positives = 158/215 (73%), Gaps = 0/215 (0%)
 Frame = +1

Query  148  GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  327
            G++SR++ PAC S+C  CP LR+RSRQPVKRYKKL+++IFP+S +   N RKI KLCEYA
Sbjct  6    GVISRQVLPACGSLCFFCPGLRARSRQPVKRYKKLISEIFPRSQEEEPNDRKIGKLCEYA  65

Query  328  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  507
            AKNP RIPK+A  LE+RCYKELR+ + + V V+  +Y + L  CKEQM  FA +LL+++ 
Sbjct  66   AKNPLRIPKMANSLEQRCYKELRNENFRAVKVVMCIYRKFLFSCKEQMPLFANSLLSILY  125

Query  508  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRA  687
             +LD    D +  IGC +   F+ +Q DGTY +N+E L+ K+C LA+E G++++ + LRA
Sbjct  126  ILLDQTSQDEILVIGCHSLFDFVNNQNDGTYMFNLEGLIPKLCQLAQEVGDDERVQQLRA  185

Query  688  SSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNYE  792
            ++L+ LSAMVWFM E SHI  +FD IV V L+NY+
Sbjct  186  AALQALSAMVWFMGENSHISVEFDNIVSVVLENYK  220


 Score =   111 bits (278),  Expect(2) = 2e-87, Method: Compositional matrix adjust.
 Identities = 65/196 (33%), Positives = 113/196 (58%), Gaps = 10/196 (5%)
 Frame = +2

Query  806   NEDDERGEAHHN-WVDEVIRSEGRDVGNE----NRPGYLIRKRPDKKDISLLTSEEIEMP  970
             ++  E  +++ N WV EV ++EG    ++    N P + +    D+  +++ + E+   P
Sbjct  221   SQSKESNDSNENRWVQEVAKTEGHISPDQDFEMNVPSWTVIIN-DRGQLNV-SPEDANNP  278

Query  971   KIWAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSG  1150
               W+ +C+  MA+L KE++TMRRVL+ +F +FD    W   +G+AF VL D+   ++ SG
Sbjct  279   CFWSRVCLHNMANLGKEATTMRRVLESLFRYFDTACLWRAEYGVAFPVLKDMQILMDESG  338

Query  1151  -NHQLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLR  1327
              N   +L+ +V+HLDHKNV     I+  +++  TAL R  +     + +  VS + RHLR
Sbjct  339   QNTHFLLSILVKHLDHKNVLKQPDIQLDIVEVVTALVRLTKIESSVAIVSAVSGMMRHLR  398

Query  1328  KSLQATVDLA--GEEI  1369
             KS+  ++D A  G+E+
Sbjct  399   KSIHYSLDDANLGQEV  414



>ref|XP_010546363.1| PREDICTED: uncharacterized protein LOC104818426 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010546433.1| PREDICTED: uncharacterized protein LOC104818426 isoform X1 [Tarenaya 
hassleriana]
Length=1026

 Score =   238 bits (607),  Expect(2) = 5e-87, Method: Compositional matrix adjust.
 Identities = 110/215 (51%), Positives = 150/215 (70%), Gaps = 1/215 (0%)
 Frame = +1

Query  148  GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSA-NGRKIMKLCEY  324
            G++SR+L PAC  +CI CPALR+RSRQPVKRYKKL+A+IFP++      N RKI KLCEY
Sbjct  6    GVISRQLLPACGDLCIFCPALRARSRQPVKRYKKLIAEIFPRNQQAEGPNDRKIGKLCEY  65

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            AAKNP R+PKI+  LE+R YKELR+ + +   ++  +Y +LL  CKEQM  FA  LL  +
Sbjct  66   AAKNPLRMPKISNSLEQRFYKELRNENFQSAKIVMCIYRKLLVTCKEQMTLFASGLLRAI  125

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
              +LD ++ D ++  GC T  +F+ +Q D +Y  N+E  + K+C LARE G+ D+ R LR
Sbjct  126  QALLDQSQQDDMQITGCQTLFEFVNNQKDSSYINNLEGFIPKLCQLAREVGDNDRSRNLR  185

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNY  789
            A+ L+ LS+MVW M E+SHI  DFD +V   L+NY
Sbjct  186  AAGLQALSSMVWLMGEYSHISNDFDNVVCGVLENY  220


 Score =   112 bits (281),  Expect(2) = 5e-87, Method: Compositional matrix adjust.
 Identities = 63/192 (33%), Positives = 107/192 (56%), Gaps = 9/192 (5%)
 Frame = +2

Query  824   GEAHHNWVDEVIRSEGRDVGNE---NRPGYLIRKRPDKKDISLLTSEEIEMPKIWAHICI  994
              E++  WV+EV+++EG     +   N P +  R   +    S +T E+   P  W+ +C+
Sbjct  230   NESNRKWVNEVLKNEGHTAYPDSLINVPSW--RNVVNDNGESNVTMEDSRDPSFWSKVCL  287

Query  995   QRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSGN-HQLILT  1171
             Q MA L +E++T+RR+L+ +F +FD    W   +  AF VL DL + +E SG     +L+
Sbjct  288   QNMAKLGEEATTVRRILESLFRYFDEGNLWSKENSTAFQVLRDLQFLMEKSGQGTHFLLS  347

Query  1172  GVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKSLQATVD  1351
              +++HLDHKNV     I+  ++   T+LA Q +     + +G + D+ RHLRK++  ++D
Sbjct  348   MLIKHLDHKNVLKQPSIQLDILWVTTSLAEQAKIEHSVAIVGAICDIMRHLRKNMHCSLD  407

Query  1352  LA---GEEINLN  1378
              A    +E  LN
Sbjct  408   DANSGADETKLN  419



>ref|XP_006648006.1| PREDICTED: protein EFR3 homolog B-like isoform X1 [Oryza brachyantha]
Length=997

 Score =   241 bits (616),  Expect(2) = 1e-86, Method: Compositional matrix adjust.
 Identities = 106/216 (49%), Positives = 154/216 (71%), Gaps = 0/216 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG++SR++ PACE +C  CP+LR+RSR PVKRYKKLL++IFPKS D   N RKI KLCEY
Sbjct  3    MGVVSREVLPACERLCFLCPSLRTRSRHPVKRYKKLLSEIFPKSQDEEPNDRKIGKLCEY  62

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
             ++NP R+PKI   LE++ YKELR+ H   V V+  +Y +++C C+EQ+  FA +LLN++
Sbjct  63   ISRNPLRVPKITVYLEQKFYKELRAEHFGSVKVVMAIYRKVICSCQEQLPLFANSLLNII  122

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
              +L+  + D ++TI C T   F+ +QVD TY +N+E+ + K+C LA+E GE ++   + 
Sbjct  123  EALLEQNRHDDLRTIACQTLFYFVNNQVDSTYMFNLESQIPKLCHLAQEIGENEKTSIVH  182

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNYE  792
            A+ L+ LS+MVWFM E SHI ++ D +V   L+NYE
Sbjct  183  AAGLQALSSMVWFMGEHSHISSELDNVVSAVLENYE  218


 Score =   107 bits (268),  Expect(2) = 1e-86, Method: Compositional matrix adjust.
 Identities = 67/177 (38%), Positives = 101/177 (57%), Gaps = 14/177 (8%)
 Frame = +2

Query  842   WVDEVIRSEGRDVGNENRPGYLIRKR-PDKKDI----SLL--TSEEIEMPKIWAHICIQR  1000
             WV EV+ +E  +      P   I  R P  KDI    SLL  T EE E P  W+ IC+  
Sbjct  238   WVSEVLETERHE-----PPSVTILTRVPSWKDIRSSRSLLNLTIEESESPNFWSGICLHN  292

Query  1001  MADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSG-NHQLILTGV  1177
             +A +++E++T+RRVL+ +F +FDNN  W P  GLA  VL D+   +E SG N  ++L+ +
Sbjct  293   LARISREATTVRRVLEAIFRYFDNNL-WSPSKGLALCVLLDMQIVIEKSGQNSHILLSML  351

Query  1178  VRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKSLQATV  1348
             V+HL+HKNV         +I+  T LA   ++    + +  +SD+ RHL K++Q+ V
Sbjct  352   VKHLEHKNVLKQPDKILDIIEVTTRLAEHSKAQSSTALMSAISDMVRHLSKNMQSLV  408



>ref|XP_010555004.1| PREDICTED: uncharacterized protein LOC104824606 [Tarenaya hassleriana]
Length=1042

 Score =   249 bits (635),  Expect(2) = 1e-86, Method: Compositional matrix adjust.
 Identities = 114/226 (50%), Positives = 156/226 (69%), Gaps = 12/226 (5%)
 Frame = +1

Query  148  GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPD------------GSA  291
            G+LSR++ P C S+C+ CPALR+RSRQPVKRYKKL+ADIFP++ +            G+ 
Sbjct  6    GVLSRQVLPVCGSLCVFCPALRARSRQPVKRYKKLIADIFPRNQEQLGVSLPMRKSFGNG  65

Query  292  NGRKIMKLCEYAAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQM  471
               KI KLC+YAAKNP R+PKI+  LE+RCYKELR+ + +   ++  +Y +LL  CKEQM
Sbjct  66   AKWKIGKLCDYAAKNPLRMPKISNSLEQRCYKELRNENFQSAKIVMCIYRKLLVTCKEQM  125

Query  472  ACFAVNLLNVVVEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARE  651
              FA  LL  V  +LD  + D ++ IGC T   F+ +Q DG+Y  N+E  + K+C LARE
Sbjct  126  TLFASGLLRAVQALLDQTRQDEMQIIGCQTLFDFVNNQKDGSYINNLEGFIPKLCQLARE  185

Query  652  TGEEDQKRCLRASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNY  789
             G++D+ R LRA+ L+ LS+MVW M E+SHIF+DFD +V V L+NY
Sbjct  186  VGDDDRSRNLRAAGLQALSSMVWLMGEYSHIFSDFDNVVAVVLENY  231


 Score =   100 bits (249),  Expect(2) = 1e-86, Method: Compositional matrix adjust.
 Identities = 60/190 (32%), Positives = 99/190 (52%), Gaps = 31/190 (16%)
 Frame = +2

Query  827   EAHHNWVDEVIRSEG--------------RDVGNENRPGYLIRKRPDKKDISLLTSEEIE  964
             E+   WV+EV+++EG              R+V N+   G L  K  D +D          
Sbjct  242   ESDRKWVNEVLKNEGLTAHAGSLISVPSWRNVVNDK--GELNVKMEDSQD----------  289

Query  965   MPKIWAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVES  1144
              P  W+ +C+Q MA L +E+   RR+L+ +F +FD    W   + +AF VL DL + +E 
Sbjct  290   -PSFWSKVCLQNMAKLGEEA---RRILESLFRYFDEGNLWSKENSMAFPVLRDLQFLMEK  345

Query  1145  SGN-HQLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRH  1321
             +G     +L+ +++HLDHKNV     I+  +++  T+LA         + +G +SD+ RH
Sbjct  346   AGQGTHFLLSMLIKHLDHKNVLKQPIIQLDILEVTTSLAEHANVEHSVAIVGAISDIMRH  405

Query  1322  LRKSLQATVD  1351
             LRKS+  ++D
Sbjct  406   LRKSMHFSLD  415



>tpg|DAA53702.1| TPA: hypothetical protein ZEAMMB73_302622, partial [Zea mays]
Length=708

 Score =   233 bits (595),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 104/216 (48%), Positives = 152/216 (70%), Gaps = 0/216 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG++SR++  ACE +C  CP+LR+RSR PVKRYKKLLA+IFP++ D   N RKI KLCEY
Sbjct  3    MGVVSREVLSACERLCFICPSLRTRSRHPVKRYKKLLAEIFPRTQDEEPNDRKIGKLCEY  62

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
             ++NP R+PKI   LE++CYKELR+     V V+  +Y +++C C+EQ+  FA +LL +V
Sbjct  63   ISRNPMRVPKITFYLEQKCYKELRAERYGSVKVVIAIYRKVICSCQEQLPLFANSLLTIV  122

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
              +L+  + D ++ + C T   FI +QVD TY +N+EN + K+C LA+E GE+++   L 
Sbjct  123  ETLLEQNRQDDLRKLACQTLFDFINNQVDSTYMFNLENQIPKLCHLAQEMGEKEKICILH  182

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNYE  792
            A+ L+ LS+M+WFM E SH+ A+ D +V   L+NYE
Sbjct  183  AAGLQALSSMIWFMGEHSHMSAELDNVVSAVLENYE  218


 Score =   112 bits (279),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 65/187 (35%), Positives = 103/187 (55%), Gaps = 13/187 (7%)
 Frame = +2

Query  839   NWVDEVIRSEGRDVGNENRPGYLIRKR-PDKKDISL------LTSEEIEMPKIWAHICIQ  997
              WVDEV+++EG +      P   I  R P  K I        LT EE   P  W+ IC+ 
Sbjct  236   QWVDEVLKAEGHE-----PPAVTILTRVPSWKVIRTVHGELSLTIEESTSPNFWSGICLH  290

Query  998   RMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSG-NHQLILTG  1174
              +A +++E++T+RRVL+ +F +FDNN  W P  G A  VL D+   +E SG N  ++L+ 
Sbjct  291   NLARISREATTVRRVLEVIFRYFDNNNLWSPSKGFALCVLLDMQIVMEKSGQNAHILLSM  350

Query  1175  VVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKSLQATVDL  1354
             +V+HL+HKNV     +   +I+  + LA   ++    + +  +SD+ RH+ KS+Q+    
Sbjct  351   LVKHLEHKNVLKQPDMNLDIIEVTSRLAGHSKAQSSTALMASISDMVRHMGKSMQSLASD  410

Query  1355  AGEEINL  1375
             AG   N+
Sbjct  411   AGPGDNM  417



>ref|XP_009142010.1| PREDICTED: uncharacterized protein LOC103865904 isoform X2 [Brassica 
rapa]
Length=1046

 Score =   237 bits (605),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 103/214 (48%), Positives = 152/214 (71%), Gaps = 0/214 (0%)
 Frame = +1

Query  148  GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  327
            G++SR++ P C S+CI CPA R+RSRQPVKRYKKL++DIFP++ +   N RKI KLCEYA
Sbjct  6    GVISRQVLPVCGSLCILCPAFRARSRQPVKRYKKLISDIFPRNQEEGPNDRKIGKLCEYA  65

Query  328  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  507
            AKN  R+PKI++ LE+RCYKELR+ + +   ++  +Y +LL  CKEQM  ++   L  V 
Sbjct  66   AKNAVRMPKISESLEQRCYKELRNENFQSAKIVMCIYRKLLVTCKEQMPLYSSGFLRTVQ  125

Query  508  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRA  687
             +LD  + D ++ +GC +  +F+ +Q DG+  +N+E  + K+C LA E G++D+ R LRA
Sbjct  126  ALLDQTRQDEMQIVGCQSLFEFVNNQKDGSSLFNLEGFLPKLCQLALEGGDDDRSRSLRA  185

Query  688  SSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNY  789
            + L+ LSAM+W M E+SHI +DFD +V   ++NY
Sbjct  186  AGLQALSAMIWLMGEYSHIPSDFDNVVSGVIENY  219


 Score =   107 bits (268),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 62/188 (33%), Positives = 99/188 (53%), Gaps = 28/188 (15%)
 Frame = +2

Query  842   WVDEVIRSEG--------------RDVGNENRPGYLIRKRPDKKDISLLTSEEIEMPKIW  979
             WVDEV+++EG              R V NE   G L  K  D  D           P  W
Sbjct  235   WVDEVLKNEGHVAHADYHINVPSWRTVVNEK--GELNVKMEDSLD-----------PSFW  281

Query  980   AHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSGNH-  1156
             + +C+  MA L +E++TMRR+L+ +F +FD    W   + +AF VL DL YF+E SG   
Sbjct  282   SKVCLHNMAKLGEEATTMRRILESLFRYFDEGYLWSTENSIAFPVLRDLQYFMEISGQRT  341

Query  1157  QLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKSL  1336
               +L+ +++HLDHK+V     ++  +++  T+LA   +     + +  +SD+ RHLRK +
Sbjct  342   HFLLSMLIKHLDHKSVLKQPSMQLNILEVTTSLAENAKVEHSAAIVSAISDIMRHLRKCM  401

Query  1337  QATVDLAG  1360
              +++D A 
Sbjct  402   HSSLDEAN  409



>ref|XP_008655586.1| PREDICTED: uncharacterized protein LOC103634777 isoform X1 [Zea 
mays]
 ref|XP_008655587.1| PREDICTED: uncharacterized protein LOC103634777 isoform X1 [Zea 
mays]
 ref|XP_008655588.1| PREDICTED: uncharacterized protein LOC103634777 isoform X1 [Zea 
mays]
Length=1002

 Score =   231 bits (589),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 104/216 (48%), Positives = 150/216 (69%), Gaps = 0/216 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG +SR++  ACE +C  CP+LR+RSR PVKRYKKLLA+IFP++ D   N RKI KLCEY
Sbjct  3    MGAVSREVSSACERLCFICPSLRTRSRHPVKRYKKLLAEIFPRTQDEGPNDRKIGKLCEY  62

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
             ++NP R+PKI   LE++CYKE R+     V V+  +Y +++C C+EQ+  FA +LL +V
Sbjct  63   ISRNPMRVPKITVYLEQKCYKEFRAERYGSVKVVMAIYRKVICSCQEQLPLFANSLLTIV  122

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
              +L+  + D ++ + C T   FI SQVD TY +N+EN + K+C LA+E GE+++   L 
Sbjct  123  ETLLEQNRQDDLRKLACQTLFDFINSQVDSTYMFNLENQIPKLCHLAQEMGEKEKICILH  182

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNYE  792
            A+ L+ LS+M+WFM E SH+ A+ D +V   L+NYE
Sbjct  183  AAGLQALSSMIWFMGEHSHMSAELDNVVSAVLENYE  218


 Score =   113 bits (283),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 65/186 (35%), Positives = 102/186 (55%), Gaps = 13/186 (7%)
 Frame = +2

Query  842   WVDEVIRSEGRDVGNENRPGYLIRKR-PDKKDISL------LTSEEIEMPKIWAHICIQR  1000
             WVDEV+++EG +      P   I  R P  K I        LT EE   P  W+ IC+  
Sbjct  237   WVDEVLKAEGHE-----PPAVTILTRVPSWKVIRAVHGELSLTIEESTSPNFWSGICLHN  291

Query  1001  MADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSG-NHQLILTGV  1177
             +A +++E++T RRVL+ +F +FDNN  W P  G A  VL D+   +E SG N  ++L+ +
Sbjct  292   LARISRETTTTRRVLEAIFRYFDNNNLWSPSKGFALCVLLDMQIVMEKSGQNAHILLSML  351

Query  1178  VRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKSLQATVDLA  1357
             V+HL+HKNV     +   +I+  + LA   ++    + +  +SD+ RH+ KS+Q+    A
Sbjct  352   VKHLEHKNVLKQPDMNLDIIEVTSRLAEHSKAQSSIALMSSISDMVRHMGKSMQSLASDA  411

Query  1358  GEEINL  1375
             G   N+
Sbjct  412   GPGDNM  417



>ref|XP_009142011.1| PREDICTED: uncharacterized protein LOC103865904 isoform X3 [Brassica 
rapa]
Length=1042

 Score =   237 bits (604),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 103/214 (48%), Positives = 152/214 (71%), Gaps = 0/214 (0%)
 Frame = +1

Query  148  GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  327
            G++SR++ P C S+CI CPA R+RSRQPVKRYKKL++DIFP++ +   N RKI KLCEYA
Sbjct  6    GVISRQVLPVCGSLCILCPAFRARSRQPVKRYKKLISDIFPRNQEEGPNDRKIGKLCEYA  65

Query  328  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  507
            AKN  R+PKI++ LE+RCYKELR+ + +   ++  +Y +LL  CKEQM  ++   L  V 
Sbjct  66   AKNAVRMPKISESLEQRCYKELRNENFQSAKIVMCIYRKLLVTCKEQMPLYSSGFLRTVQ  125

Query  508  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRA  687
             +LD  + D ++ +GC +  +F+ +Q DG+  +N+E  + K+C LA E G++D+ R LRA
Sbjct  126  ALLDQTRQDEMQIVGCQSLFEFVNNQKDGSSLFNLEGFLPKLCQLALEGGDDDRSRSLRA  185

Query  688  SSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNY  789
            + L+ LSAM+W M E+SHI +DFD +V   ++NY
Sbjct  186  AGLQALSAMIWLMGEYSHIPSDFDNVVSGVIENY  219


 Score =   107 bits (268),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 62/188 (33%), Positives = 99/188 (53%), Gaps = 28/188 (15%)
 Frame = +2

Query  842   WVDEVIRSEG--------------RDVGNENRPGYLIRKRPDKKDISLLTSEEIEMPKIW  979
             WVDEV+++EG              R V NE   G L  K  D  D           P  W
Sbjct  235   WVDEVLKNEGHVAHADYHINVPSWRTVVNEK--GELNVKMEDSLD-----------PSFW  281

Query  980   AHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSGNH-  1156
             + +C+  MA L +E++TMRR+L+ +F +FD    W   + +AF VL DL YF+E SG   
Sbjct  282   SKVCLHNMAKLGEEATTMRRILESLFRYFDEGYLWSTENSIAFPVLRDLQYFMEISGQRT  341

Query  1157  QLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKSL  1336
               +L+ +++HLDHK+V     ++  +++  T+LA   +     + +  +SD+ RHLRK +
Sbjct  342   HFLLSMLIKHLDHKSVLKQPSMQLNILEVTTSLAENAKVEHSAAIVSAISDIMRHLRKCM  401

Query  1337  QATVDLAG  1360
              +++D A 
Sbjct  402   HSSLDEAN  409



>ref|XP_009142012.1| PREDICTED: uncharacterized protein LOC103865904 isoform X4 [Brassica 
rapa]
Length=1039

 Score =   237 bits (604),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 103/214 (48%), Positives = 152/214 (71%), Gaps = 0/214 (0%)
 Frame = +1

Query  148  GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  327
            G++SR++ P C S+CI CPA R+RSRQPVKRYKKL++DIFP++ +   N RKI KLCEYA
Sbjct  6    GVISRQVLPVCGSLCILCPAFRARSRQPVKRYKKLISDIFPRNQEEGPNDRKIGKLCEYA  65

Query  328  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  507
            AKN  R+PKI++ LE+RCYKELR+ + +   ++  +Y +LL  CKEQM  ++   L  V 
Sbjct  66   AKNAVRMPKISESLEQRCYKELRNENFQSAKIVMCIYRKLLVTCKEQMPLYSSGFLRTVQ  125

Query  508  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRA  687
             +LD  + D ++ +GC +  +F+ +Q DG+  +N+E  + K+C LA E G++D+ R LRA
Sbjct  126  ALLDQTRQDEMQIVGCQSLFEFVNNQKDGSSLFNLEGFLPKLCQLALEGGDDDRSRSLRA  185

Query  688  SSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNY  789
            + L+ LSAM+W M E+SHI +DFD +V   ++NY
Sbjct  186  AGLQALSAMIWLMGEYSHIPSDFDNVVSGVIENY  219


 Score =   107 bits (268),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 62/188 (33%), Positives = 99/188 (53%), Gaps = 28/188 (15%)
 Frame = +2

Query  842   WVDEVIRSEG--------------RDVGNENRPGYLIRKRPDKKDISLLTSEEIEMPKIW  979
             WVDEV+++EG              R V NE   G L  K  D  D           P  W
Sbjct  235   WVDEVLKNEGHVAHADYHINVPSWRTVVNEK--GELNVKMEDSLD-----------PSFW  281

Query  980   AHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSGNH-  1156
             + +C+  MA L +E++TMRR+L+ +F +FD    W   + +AF VL DL YF+E SG   
Sbjct  282   SKVCLHNMAKLGEEATTMRRILESLFRYFDEGYLWSTENSIAFPVLRDLQYFMEISGQRT  341

Query  1157  QLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKSL  1336
               +L+ +++HLDHK+V     ++  +++  T+LA   +     + +  +SD+ RHLRK +
Sbjct  342   HFLLSMLIKHLDHKSVLKQPSMQLNILEVTTSLAENAKVEHSAAIVSAISDIMRHLRKCM  401

Query  1337  QATVDLAG  1360
              +++D A 
Sbjct  402   HSSLDEAN  409



>ref|XP_009142008.1| PREDICTED: uncharacterized protein LOC103865904 isoform X1 [Brassica 
rapa]
 ref|XP_009142009.1| PREDICTED: uncharacterized protein LOC103865904 isoform X1 [Brassica 
rapa]
Length=1049

 Score =   237 bits (604),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 103/214 (48%), Positives = 152/214 (71%), Gaps = 0/214 (0%)
 Frame = +1

Query  148  GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  327
            G++SR++ P C S+CI CPA R+RSRQPVKRYKKL++DIFP++ +   N RKI KLCEYA
Sbjct  6    GVISRQVLPVCGSLCILCPAFRARSRQPVKRYKKLISDIFPRNQEEGPNDRKIGKLCEYA  65

Query  328  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  507
            AKN  R+PKI++ LE+RCYKELR+ + +   ++  +Y +LL  CKEQM  ++   L  V 
Sbjct  66   AKNAVRMPKISESLEQRCYKELRNENFQSAKIVMCIYRKLLVTCKEQMPLYSSGFLRTVQ  125

Query  508  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRA  687
             +LD  + D ++ +GC +  +F+ +Q DG+  +N+E  + K+C LA E G++D+ R LRA
Sbjct  126  ALLDQTRQDEMQIVGCQSLFEFVNNQKDGSSLFNLEGFLPKLCQLALEGGDDDRSRSLRA  185

Query  688  SSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNY  789
            + L+ LSAM+W M E+SHI +DFD +V   ++NY
Sbjct  186  AGLQALSAMIWLMGEYSHIPSDFDNVVSGVIENY  219


 Score =   107 bits (268),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 62/188 (33%), Positives = 99/188 (53%), Gaps = 28/188 (15%)
 Frame = +2

Query  842   WVDEVIRSEG--------------RDVGNENRPGYLIRKRPDKKDISLLTSEEIEMPKIW  979
             WVDEV+++EG              R V NE   G L  K  D  D           P  W
Sbjct  235   WVDEVLKNEGHVAHADYHINVPSWRTVVNEK--GELNVKMEDSLD-----------PSFW  281

Query  980   AHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSGNH-  1156
             + +C+  MA L +E++TMRR+L+ +F +FD    W   + +AF VL DL YF+E SG   
Sbjct  282   SKVCLHNMAKLGEEATTMRRILESLFRYFDEGYLWSTENSIAFPVLRDLQYFMEISGQRT  341

Query  1157  QLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKSL  1336
               +L+ +++HLDHK+V     ++  +++  T+LA   +     + +  +SD+ RHLRK +
Sbjct  342   HFLLSMLIKHLDHKSVLKQPSMQLNILEVTTSLAENAKVEHSAAIVSAISDIMRHLRKCM  401

Query  1337  QATVDLAG  1360
              +++D A 
Sbjct  402   HSSLDEAN  409



>ref|XP_008673097.1| PREDICTED: uncharacterized protein LOC100381825 isoform X1 [Zea 
mays]
 ref|XP_008673098.1| PREDICTED: uncharacterized protein LOC100381825 isoform X1 [Zea 
mays]
Length=1001

 Score =   233 bits (594),  Expect(2) = 4e-85, Method: Compositional matrix adjust.
 Identities = 104/216 (48%), Positives = 152/216 (70%), Gaps = 0/216 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG++SR++  ACE +C  CP+LR+RSR PVKRYKKLLA+IFP++ D   N RKI KLCEY
Sbjct  3    MGVVSREVLSACERLCFICPSLRTRSRHPVKRYKKLLAEIFPRTQDEEPNDRKIGKLCEY  62

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
             ++NP R+PKI   LE++CYKELR+     V V+  +Y +++C C+EQ+  FA +LL +V
Sbjct  63   ISRNPMRVPKITFYLEQKCYKELRAERYGSVKVVIAIYRKVICSCQEQLPLFANSLLTIV  122

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
              +L+  + D ++ + C T   FI +QVD TY +N+EN + K+C LA+E GE+++   L 
Sbjct  123  ETLLEQNRQDDLRKLACQTLFDFINNQVDSTYMFNLENQIPKLCHLAQEMGEKEKICILH  182

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNYE  792
            A+ L+ LS+M+WFM E SH+ A+ D +V   L+NYE
Sbjct  183  AAGLQALSSMIWFMGEHSHMSAELDNVVSAVLENYE  218


 Score =   111 bits (278),  Expect(2) = 4e-85, Method: Compositional matrix adjust.
 Identities = 65/187 (35%), Positives = 103/187 (55%), Gaps = 13/187 (7%)
 Frame = +2

Query  839   NWVDEVIRSEGRDVGNENRPGYLIRKR-PDKKDISL------LTSEEIEMPKIWAHICIQ  997
              WVDEV+++EG +      P   I  R P  K I        LT EE   P  W+ IC+ 
Sbjct  236   QWVDEVLKAEGHE-----PPAVTILTRVPSWKVIRTVHGELSLTIEESTSPNFWSGICLH  290

Query  998   RMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSG-NHQLILTG  1174
              +A +++E++T+RRVL+ +F +FDNN  W P  G A  VL D+   +E SG N  ++L+ 
Sbjct  291   NLARISREATTVRRVLEVIFRYFDNNNLWSPSKGFALCVLLDMQIVMEKSGQNAHILLSM  350

Query  1175  VVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKSLQATVDL  1354
             +V+HL+HKNV     +   +I+  + LA   ++    + +  +SD+ RH+ KS+Q+    
Sbjct  351   LVKHLEHKNVLKQPDMNLDIIEVTSRLAGHSKAQSSTALMASISDMVRHMGKSMQSLASD  410

Query  1355  AGEEINL  1375
             AG   N+
Sbjct  411   AGPGDNM  417



>emb|CDY14788.1| BnaC04g47850D [Brassica napus]
Length=1020

 Score =   238 bits (607),  Expect(2) = 6e-85, Method: Compositional matrix adjust.
 Identities = 103/214 (48%), Positives = 153/214 (71%), Gaps = 0/214 (0%)
 Frame = +1

Query  148  GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  327
            G++SR++ P C S+CI CPA R+RSRQPVKRYKKL++DIFP++ +   N RKI KLCEYA
Sbjct  6    GVISRQVLPVCGSLCILCPAFRARSRQPVKRYKKLISDIFPRNQEEGPNDRKIGKLCEYA  65

Query  328  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  507
            AKN  R+PKI++ LE+RCYKELR+ + +   ++  +Y +LL  CKEQM  ++   L  V 
Sbjct  66   AKNAVRMPKISESLEQRCYKELRNENFQSAKIVMCIYRKLLVTCKEQMLLYSSGFLRTVQ  125

Query  508  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRA  687
             +LD  + D ++ +GC +  +F+ +Q DG+  +N+E  + K+C LA+E G++D+ R LRA
Sbjct  126  ALLDQTRQDEMQIVGCQSLFEFVNNQKDGSSLFNLEGFLPKLCQLAQEGGDDDRSRSLRA  185

Query  688  SSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNY  789
            + L+ LSAM+W M E+SHI +DFD +V   ++NY
Sbjct  186  AGLQALSAMIWLMGEYSHIPSDFDNVVSGVIENY  219


 Score =   105 bits (263),  Expect(2) = 6e-85, Method: Compositional matrix adjust.
 Identities = 63/193 (33%), Positives = 101/193 (52%), Gaps = 30/193 (16%)
 Frame = +2

Query  842   WVDEVIRSEG--------------RDVGNENRPGYLIRKRPDKKDISLLTSEEIEMPKIW  979
             WVDEV+++EG              R V NE   G L  K  D  D           P  W
Sbjct  235   WVDEVLKNEGHVAHADYHINVPSWRTVVNEK--GELNVKMEDSLD-----------PSFW  281

Query  980   AHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSGNH-  1156
             + +C+  MA L +E++TMRR+L+ +F +FD    W   + +AF VL DL Y +E SG   
Sbjct  282   SKVCLHNMAKLGEEATTMRRILESLFRYFDEGYLWSTENSIAFPVLRDLQYLMEISGQRT  341

Query  1157  QLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKSL  1336
               +L+ +++HLDHK+V     ++  +++  T+LA   +     + +  +SD+ RHLRK +
Sbjct  342   HFLLSMLIKHLDHKSVLKQPSMQLNILEVTTSLAENAKVEHSAAIVSAISDIMRHLRKCM  401

Query  1337  QATVDLA--GEEI  1369
              +++D A  G E+
Sbjct  402   HSSLDEANLGPEV  414



>ref|XP_002457472.1| hypothetical protein SORBIDRAFT_03g007790 [Sorghum bicolor]
 gb|EES02592.1| hypothetical protein SORBIDRAFT_03g007790 [Sorghum bicolor]
Length=974

 Score =   237 bits (605),  Expect(2) = 7e-85, Method: Compositional matrix adjust.
 Identities = 104/216 (48%), Positives = 152/216 (70%), Gaps = 0/216 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG++SR++ PACE +C  CP+LR+RSR PVKRYKKLLA+IFP++ D   N RKI KLCEY
Sbjct  3    MGVVSREVLPACEKLCFICPSLRTRSRHPVKRYKKLLAEIFPRTQDEGPNDRKIGKLCEY  62

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
             ++NP R+PKI   LE++CYKE R+     V V+  +Y +++C C+EQ+  FA +LL +V
Sbjct  63   ISRNPMRVPKITVYLEQKCYKEFRAERYGSVKVVMAIYRKVICSCQEQLPLFANSLLTIV  122

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
              +L+  + D ++ + C T   FI  QVD TY +N+EN + K+C LA+E GE+++   L 
Sbjct  123  ETLLEQNRQDDLRKLACQTLFDFINHQVDSTYMFNLENQIPKLCHLAQEMGEKEKICILH  182

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNYE  792
            A+ L+ LS+M+WFM E+SH+ A+ D +V   L+NYE
Sbjct  183  AAGLQALSSMIWFMGEYSHMSAELDNVVSAVLENYE  218


 Score =   106 bits (264),  Expect(2) = 7e-85, Method: Compositional matrix adjust.
 Identities = 60/176 (34%), Positives = 97/176 (55%), Gaps = 13/176 (7%)
 Frame = +2

Query  839   NWVDEVIRSEGRDVGNENRPGYLIRKR-PDKKDISL------LTSEEIEMPKIWAHICIQ  997
              WV+EV+++EG +      P   I  R P  K I        LT EE   P  W+ IC+ 
Sbjct  236   QWVNEVLKAEGHE-----PPAVTILTRVPSWKVIRTVHGELSLTIEESTSPNFWSGICLH  290

Query  998   RMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSG-NHQLILTG  1174
              +A +++  +T+RRVL+ +F +FDNN  W P  G A  VL D+   +E SG N  ++L+ 
Sbjct  291   NLARISRGGTTVRRVLEAIFRYFDNNNLWSPSKGFALCVLLDMQIVMEKSGQNAHILLSM  350

Query  1175  VVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKSLQA  1342
             +V+HL+HKNV     +   +I+  + LA   ++    + +  +SD+ RH+ KS+Q+
Sbjct  351   LVKHLEHKNVLKQPDMNLDIIEVTSRLAEHSKAQSSTALMASISDMVRHMAKSMQS  406



>emb|CDY06905.1| BnaA04g24100D [Brassica napus]
Length=1020

 Score =   238 bits (608),  Expect(2) = 1e-84, Method: Compositional matrix adjust.
 Identities = 103/214 (48%), Positives = 153/214 (71%), Gaps = 0/214 (0%)
 Frame = +1

Query  148  GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  327
            G++SR++ P C S+CI CPA R+RSRQPVKRYKKL++DIFP++ +   N RKI KLCEYA
Sbjct  6    GVISRQVLPVCGSLCILCPAFRARSRQPVKRYKKLISDIFPRNQEEGPNDRKIGKLCEYA  65

Query  328  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  507
            AKN  R+PKI++ LE+RCYKELR+ + +   ++  +Y +LL  CKEQM  ++   L  V 
Sbjct  66   AKNAVRMPKISESLEQRCYKELRNENFQSAKIVMCIYRKLLVTCKEQMPLYSSGFLRTVQ  125

Query  508  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRA  687
             +LD  + D ++ +GC +  +F+ +Q DG+  +N+E  + K+C LA+E G++D+ R LRA
Sbjct  126  ALLDQTRQDEMQIVGCQSLFEFVNNQKDGSSLFNLEGFLPKLCQLAQEGGDDDRSRSLRA  185

Query  688  SSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNY  789
            + L+ LSAM+W M E+SHI +DFD +V   ++NY
Sbjct  186  AGLQALSAMIWLMGEYSHIPSDFDNVVSGVIENY  219


 Score =   104 bits (260),  Expect(2) = 1e-84, Method: Compositional matrix adjust.
 Identities = 57/182 (31%), Positives = 105/182 (58%), Gaps = 8/182 (4%)
 Frame = +2

Query  842   WVDEVIRSEGRDVGNE---NRPGYLIRKRPDKKDISLLTSEEIEMPKIWAHICIQRMADL  1012
             WVDEV+++EG     +   N P +      DK ++++   + ++ P  W+ +C+  MA L
Sbjct  235   WVDEVLKNEGHVAHADYHINVPSWRTVVN-DKGELNVKMEDSLD-PSFWSKVCLHNMAKL  292

Query  1013  AKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSGNH-QLILTGVVRHL  1189
              +E++TMRR+L+ +F +FD    W   + +AF VL DL + +E SG     +L+ +++HL
Sbjct  293   GEEATTMRRILESLFRYFDEGYLWSTENSIAFPVLRDLQFLMEISGQRTHFLLSMLIKHL  352

Query  1190  DHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKSLQATVDLA--GE  1363
             DHK+V     ++  +++  T+LA   +     + +  +SD+ RHLRK + +++D A  G 
Sbjct  353   DHKSVLKQPSMQLNILEVTTSLAENAKVEHSAAIVSAISDIMRHLRKCMHSSLDEANMGP  412

Query  1364  EI  1369
             E+
Sbjct  413   EV  414



>ref|XP_010257180.1| PREDICTED: uncharacterized protein LOC104597386 isoform X2 [Nelumbo 
nucifera]
Length=1010

 Score =   221 bits (563),  Expect(2) = 1e-84, Method: Compositional matrix adjust.
 Identities = 106/215 (49%), Positives = 145/215 (67%), Gaps = 16/215 (7%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG++SRK+ P C+ +C  CP++R+RSRQPVKRYKKL+ADIFP+S D   N RKI KLCEY
Sbjct  1    MGVMSRKVLPICDGLCFLCPSMRTRSRQPVKRYKKLIADIFPRSQDEEPNDRKIGKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            A+KNP RIPKIA  LE+RCYKELR+   +L  V+  +Y +LL  CK+QM  FA +LL+++
Sbjct  61   ASKNPLRIPKIANSLEQRCYKELRNEQFRLAKVVMCIYRKLLISCKDQMPLFASSLLSII  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
              +LD  +   ++ IGC T   F+ SQ+DGTY +N+E L+ K+C  A+E G+++    LR
Sbjct  121  NTLLDQTRQYEMRVIGCQTLFDFVNSQMDGTYMFNLEGLIPKICQTAQEIGDDEGTCQLR  180

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNY  789
            A+ L+ LS+MV                V V LDNY
Sbjct  181  AAGLQALSSMV----------------VSVVLDNY  199


 Score =   121 bits (304),  Expect(2) = 1e-84, Method: Compositional matrix adjust.
 Identities = 67/185 (36%), Positives = 106/185 (57%), Gaps = 12/185 (6%)
 Frame = +2

Query  818   ERGEAHHNWVDEVIRSEGRDVGNENRPGYLIRKRPDKKDISL------LTSEEIEMPKIW  979
             +R E  + WV EV++ EG        P   + K P  K I        +T E+ + P+ W
Sbjct  212   DRQETKNRWVQEVLKVEGH-----VSPADAMTKIPSWKKIINEKGELNVTVEDAKNPQFW  266

Query  980   AHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSG-NH  1156
             + +C+  MA LAKE++T+RRVL+ +F +FD+   W P HGLA  VL D+   +E  G N 
Sbjct  267   SRVCLHNMAKLAKEATTVRRVLESLFRYFDSGNLWSPEHGLALFVLMDMQLLMEDFGQNT  326

Query  1157  QLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKSL  1336
              L+L+ +V+HLDHKNV     ++  +++  T LA+  +     + IG V+D+ RHLRKS+
Sbjct  327   HLLLSILVKHLDHKNVIKQPDMQLNIVEIITILAQHSKVQASIAIIGAVTDIMRHLRKSI  386

Query  1337  QATVD  1351
               +++
Sbjct  387   HYSLE  391



>ref|XP_006293443.1| hypothetical protein CARUB_v10022560mg [Capsella rubella]
 gb|EOA26341.1| hypothetical protein CARUB_v10022560mg [Capsella rubella]
Length=1027

 Score =   242 bits (617),  Expect(2) = 1e-84, Method: Compositional matrix adjust.
 Identities = 109/214 (51%), Positives = 149/214 (70%), Gaps = 0/214 (0%)
 Frame = +1

Query  148  GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  327
            G++SR++ P C S+CI CPALR+RSRQPVKRYKKL+ADIFP++ D   N RKI KLCEYA
Sbjct  6    GVISRQVLPVCGSLCILCPALRARSRQPVKRYKKLIADIFPRNQDEGPNDRKIGKLCEYA  65

Query  328  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  507
            AKN  R+PKI+  LE+RCYKELR+ +  L  +   +Y  LL  CKEQM  F+   L  V 
Sbjct  66   AKNAVRMPKISDSLEQRCYKELRNENFHLAKIAMCIYRRLLVTCKEQMPLFSSGFLRTVQ  125

Query  508  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRA  687
             +LD  + D ++ IGC +  +F+ +Q DG+  +N+E  + K+C L  E G++D+ R LRA
Sbjct  126  ALLDQTRQDEMQIIGCQSLFEFVNNQKDGSSLFNLEGFLPKLCQLGLEGGDDDRLRSLRA  185

Query  688  SSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNY  789
            + L+ LSAM+W M E+SHI +DFD +V   L+NY
Sbjct  186  AGLQALSAMIWLMGEYSHIPSDFDNVVSAVLENY  219


 Score =   100 bits (250),  Expect(2) = 1e-84, Method: Compositional matrix adjust.
 Identities = 55/177 (31%), Positives = 101/177 (57%), Gaps = 6/177 (3%)
 Frame = +2

Query  842   WVDEVIRSEGRDVGNE---NRPGYLIRKRPDKKDISLLTSEEIEMPKIWAHICIQRMADL  1012
             WVDEV+++EG     +   N P +      DK ++++   + ++ P  W+ +C+  MA L
Sbjct  235   WVDEVLKNEGHVAYADSLINVPSWRTVVN-DKGELNVKMEDSLD-PSFWSKVCLYNMAKL  292

Query  1013  AKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSGNH-QLILTGVVRHL  1189
              +E++TMRR+L+ +F +FD    W   + +AF VL DL + +E SG     IL+ +++HL
Sbjct  293   GEEATTMRRILESVFRYFDEGYLWSKENSIAFPVLRDLQFLMEISGQRTHFILSMLIKHL  352

Query  1190  DHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKSLQATVDLAG  1360
             DHK+V     ++  +++   +LA   +     + +  +SD+ RHLRK + +++D A 
Sbjct  353   DHKSVLKQPSMQLNILEVTFSLAEIAKVEYSAAIVSAISDIMRHLRKCMHSSLDEAN  409



>ref|XP_010505973.1| PREDICTED: uncharacterized protein LOC104782671 [Camelina sativa]
Length=1022

 Score =   239 bits (609),  Expect(2) = 2e-84, Method: Compositional matrix adjust.
 Identities = 106/214 (50%), Positives = 149/214 (70%), Gaps = 0/214 (0%)
 Frame = +1

Query  148  GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  327
            G++SR++ P C S+CI CPALR+RSRQPVKRYKKL+ADIFP++ +   N RKI KLCEYA
Sbjct  6    GVISRQVLPVCGSLCILCPALRARSRQPVKRYKKLIADIFPRNQEEGPNDRKIGKLCEYA  65

Query  328  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  507
            AKN  R+PKI+  LE+RCYKELR+ +     +   +Y  LL  CKEQM  F+   L  V 
Sbjct  66   AKNAVRMPKISDSLEQRCYKELRNENFHSAKIAMCIYRRLLVTCKEQMPLFSSGFLRTVQ  125

Query  508  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRA  687
             +LD ++ D ++ +GC +  +F+ +Q DG+  +N+E  + K+C L  E G++D+ R LRA
Sbjct  126  ALLDQSRQDEMQIVGCQSLFEFVNNQKDGSSLFNLEGFLPKLCQLGLEGGDDDRSRSLRA  185

Query  688  SSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNY  789
            + L+ LSAM+W M E+SHI +DFD +V   L+NY
Sbjct  186  AGLQALSAMIWLMGEYSHIPSDFDNVVSAVLENY  219


 Score =   103 bits (257),  Expect(2) = 2e-84, Method: Compositional matrix adjust.
 Identities = 56/186 (30%), Positives = 107/186 (58%), Gaps = 9/186 (5%)
 Frame = +2

Query  842   WVDEVIRSEGRDVGNENR---PGYLIRKRPDKKDISLLTSEEIEMPKIWAHICIQRMADL  1012
             WVDEV+++EG     ++    P +      DK ++++   + ++ P  W+ +C++ MA L
Sbjct  235   WVDEVLKNEGHVAYADSLITVPSWRTVVN-DKGELNVKMEDSLD-PSFWSKVCLRNMAKL  292

Query  1013  AKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSGNH-QLILTGVVRHL  1189
              +E++TMRR+L+ +F +FD    W   H +AF VL DL + +E SG     +L+ +++HL
Sbjct  293   GEEATTMRRILESLFRYFDEGCLWSTEHSVAFPVLRDLQFLMEISGQRTHFLLSMLIKHL  352

Query  1190  DHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKSLQATVD---LAG  1360
             DHK+V     ++  +++  ++LA   +     + +  +SD+ RHLRK + +++D   L  
Sbjct  353   DHKSVLKQPSMQLNILEVTSSLAENAKVEHSAAIVSAISDIMRHLRKCMHSSLDEANLGT  412

Query  1361  EEINLN  1378
             + +N N
Sbjct  413   DVVNCN  418



>ref|XP_002533049.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF29339.1| conserved hypothetical protein [Ricinus communis]
Length=988

 Score =   224 bits (571),  Expect(2) = 2e-84, Method: Compositional matrix adjust.
 Identities = 102/215 (47%), Positives = 149/215 (69%), Gaps = 0/215 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG++SR++ P C S+C  CP++R+RSRQPVKRYKK L+DIFP++ +   N RKI KLC+Y
Sbjct  1    MGVMSRRVLPVCGSLCFFCPSMRARSRQPVKRYKKFLSDIFPRNQEAEPNDRKIGKLCDY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            A+KNP RIPKI + LE+R +KELR  +   V V+  +Y + L  C+EQM  FA +LL +V
Sbjct  61   ASKNPLRIPKITETLEQRFFKELRHENFGSVRVVVCIYRKSLSSCREQMPLFASSLLGIV  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
              +L+  K D ++ + C     FI SQ D T+ +N+E L+ K+C LA+E G+ ++   L 
Sbjct  121  RTLLEETKQDELRILACNLLVDFINSQTDSTHMFNLEGLIPKLCQLAQEVGDGERTLRLH  180

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNY  789
            ++ L+ L++MV FM E SHI  +FD+I+ VTL+NY
Sbjct  181  SAGLQALASMVSFMGEHSHISMEFDKIISVTLENY  215


 Score =   117 bits (294),  Expect(2) = 2e-84, Method: Compositional matrix adjust.
 Identities = 69/192 (36%), Positives = 108/192 (56%), Gaps = 16/192 (8%)
 Frame = +2

Query  806   NEDDERGEAHHNWVDEVIRSEGRDVG------NENRPGYLIRKRPDKKDISLLTSEEIEM  967
             N++D +G+    WV  V+ +E +D          + PG+  +  PD  D S+ TS     
Sbjct  221   NQEDPKGD---QWVQGVLNAEDKDSSFPDISKKVSLPGHTTK--PDL-DPSMDTSRN---  271

Query  968   PKIWAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESS  1147
             P  W+ +C+  MA LAKE++T+RRVL+P+F++FD N HW    G+A+ VL  L   +E +
Sbjct  272   PSYWSRVCLLNMARLAKEATTVRRVLEPLFLNFDANNHWPLEKGVAYPVLIYLQSLLEEA  331

Query  1148  G-NHQLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHL  1324
             G N  L+L  +V+HLDH+NVA    ++  VI     L +  +     + IG +SDL +HL
Sbjct  332   GENSHLLLANLVKHLDHRNVAKQPLVQIDVINVTMQLGKNAKQEVTVAIIGAISDLIKHL  391

Query  1325  RKSLQATVDLAG  1360
             RK LQ   +++ 
Sbjct  392   RKCLQNLAEMSS  403



>ref|XP_006411452.1| hypothetical protein EUTSA_v10016171mg [Eutrema salsugineum]
 gb|ESQ52905.1| hypothetical protein EUTSA_v10016171mg [Eutrema salsugineum]
Length=1037

 Score =   239 bits (611),  Expect(2) = 3e-84, Method: Compositional matrix adjust.
 Identities = 108/214 (50%), Positives = 151/214 (71%), Gaps = 1/214 (0%)
 Frame = +1

Query  148  GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  327
            G++SR++ P C S+CI CPALR+RSRQPVKRYKKL+ADIFP++ +G  N RKI KLCEYA
Sbjct  6    GVISRQVLPVCGSLCILCPALRARSRQPVKRYKKLIADIFPRNQEG-PNDRKIGKLCEYA  64

Query  328  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  507
            AKN  R+PKI+  LE+RCYKELR+ + +   ++  +Y  LL  CKEQM  F+   L  V 
Sbjct  65   AKNAVRMPKISDSLEQRCYKELRNENFQSAKIVMCIYRRLLVTCKEQMPLFSSGFLRTVQ  124

Query  508  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRA  687
             +LD  + D ++ +GC +  +F+ +Q DG+  +N+E  + K+C LA E G +D+ R LRA
Sbjct  125  ALLDQTRQDEMQRVGCQSLFEFVNNQKDGSSLFNLEGFLPKLCQLALEGGGDDRSRSLRA  184

Query  688  SSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNY  789
            + L+ LSAM+W M E+SHI +DFD +V   L+NY
Sbjct  185  AGLQALSAMIWLMGEYSHIPSDFDNVVSAVLENY  218


 Score =   102 bits (253),  Expect(2) = 3e-84, Method: Compositional matrix adjust.
 Identities = 61/205 (30%), Positives = 105/205 (51%), Gaps = 31/205 (15%)
 Frame = +2

Query  827   EAHHNWVDEVIRSEG--------------RDVGNENRPGYLIRKRPDKKDISLLTSEEIE  964
             ++   WVDEV+++EG              R V N+N  G L  K  D  D          
Sbjct  229   DSSRKWVDEVLKNEGHVAHADSLINVPSWRTVVNDN--GELNVKMEDSLD----------  276

Query  965   MPKIWAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVES  1144
              P  W+ +C+  MA L +E++TMRR+L+ +F +FD    W   + +A  +L DL + +E 
Sbjct  277   -PSFWSKVCLHNMAKLGEEATTMRRILESLFRYFDEGYLWSTENSIALPILRDLQFLMEI  335

Query  1145  SGNH-QLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRH  1321
             SG     +L+ +++HLDHK+V     ++  +++  ++LA   +     + +  +SD+ RH
Sbjct  336   SGQRTHFLLSMLIKHLDHKSVLKQPSMQLNILEVTSSLAENAKVEHSAAIVSAISDIMRH  395

Query  1322  LRKSLQATVD---LAGEEINLNLTL  1387
             LRK + +++D   L  E  N N T+
Sbjct  396   LRKGMHSSLDESNLGTEVANCNRTV  420



>ref|XP_007162228.1| hypothetical protein PHAVU_001G134800g [Phaseolus vulgaris]
 gb|ESW34222.1| hypothetical protein PHAVU_001G134800g [Phaseolus vulgaris]
Length=1021

 Score =   238 bits (606),  Expect(2) = 6e-84, Method: Compositional matrix adjust.
 Identities = 105/215 (49%), Positives = 158/215 (73%), Gaps = 0/215 (0%)
 Frame = +1

Query  148  GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  327
            G++SR++ P C ++C  CP+LR+RSRQPVKRYKKL+ADIFP++ +  AN R+I KLC+YA
Sbjct  7    GVISRQVLPVCGNLCFFCPSLRARSRQPVKRYKKLIADIFPRNQEDGANDRQIGKLCDYA  66

Query  328  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  507
            A+NP RIPKI + LE+RCY+ELR+ + +   ++  +Y + L  CKEQM  FA +LL+++ 
Sbjct  67   ARNPLRIPKIMQALEQRCYRELRNENIRSAKIVMCIYKKFLFSCKEQMPLFANSLLSIIH  126

Query  508  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRA  687
             +LD ++ D ++ IGC     F+ +Q DG+Y +N+E ++ K+C LA+ETG++++ R  R+
Sbjct  127  TLLDQSRQDEMRIIGCQILFDFVNNQSDGSYLFNLEAVIPKLCQLAQETGDDERARMSRS  186

Query  688  SSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNYE  792
            + L+ LSAMV FM E SH+  +FD IV V L+NYE
Sbjct  187  TGLKALSAMVRFMGENSHMSVEFDNIVCVVLENYE  221


 Score =   102 bits (255),  Expect(2) = 6e-84, Method: Compositional matrix adjust.
 Identities = 62/200 (31%), Positives = 110/200 (55%), Gaps = 12/200 (6%)
 Frame = +2

Query  806   NEDDERGEAHHNWVDEVIRSEGR-----DVGNENRPGYLIRKRPDKKDISLLTSEEIEMP  970
             N   E     + WV + + +E +     DV   N P    RK  ++K   ++  E+ + P
Sbjct  229   NVSHEEESVENMWVQDGMSNEDQSSPLLDVKTRNPPW---RKVVNEKGEMIVAMEDDKNP  285

Query  971   KIWAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFV-ESS  1147
               W+ +C+  MA+L +E +T+RRV++ +F +FD+   W    GLA  VL D+ + + +S 
Sbjct  286   SFWSGVCLHNMANLTREGTTIRRVMESIFRYFDSGNLWSIDDGLAISVLKDILFLMDDSE  345

Query  1148  GNHQLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLR  1327
              N  ++L+ +++HLDHK V  +  ++  +++  T+L++  +     S IG VSD+ RHLR
Sbjct  346   KNTHVLLSMLIKHLDHKAVLKEPHMQLDIVEVTTSLSQYAKVQPSISIIGAVSDMMRHLR  405

Query  1328  KSLQATVD---LAGEEINLN  1378
             K +  ++D   LA +EI  N
Sbjct  406   KCIHCSLDESKLAPDEIAWN  425



>ref|XP_007162229.1| hypothetical protein PHAVU_001G134800g [Phaseolus vulgaris]
 gb|ESW34223.1| hypothetical protein PHAVU_001G134800g [Phaseolus vulgaris]
Length=978

 Score =   237 bits (605),  Expect(2) = 8e-84, Method: Compositional matrix adjust.
 Identities = 105/215 (49%), Positives = 158/215 (73%), Gaps = 0/215 (0%)
 Frame = +1

Query  148  GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  327
            G++SR++ P C ++C  CP+LR+RSRQPVKRYKKL+ADIFP++ +  AN R+I KLC+YA
Sbjct  7    GVISRQVLPVCGNLCFFCPSLRARSRQPVKRYKKLIADIFPRNQEDGANDRQIGKLCDYA  66

Query  328  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  507
            A+NP RIPKI + LE+RCY+ELR+ + +   ++  +Y + L  CKEQM  FA +LL+++ 
Sbjct  67   ARNPLRIPKIMQALEQRCYRELRNENIRSAKIVMCIYKKFLFSCKEQMPLFANSLLSIIH  126

Query  508  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRA  687
             +LD ++ D ++ IGC     F+ +Q DG+Y +N+E ++ K+C LA+ETG++++ R  R+
Sbjct  127  TLLDQSRQDEMRIIGCQILFDFVNNQSDGSYLFNLEAVIPKLCQLAQETGDDERARMSRS  186

Query  688  SSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNYE  792
            + L+ LSAMV FM E SH+  +FD IV V L+NYE
Sbjct  187  TGLKALSAMVRFMGENSHMSVEFDNIVCVVLENYE  221


 Score =   102 bits (255),  Expect(2) = 8e-84, Method: Compositional matrix adjust.
 Identities = 62/200 (31%), Positives = 110/200 (55%), Gaps = 12/200 (6%)
 Frame = +2

Query  806   NEDDERGEAHHNWVDEVIRSEGR-----DVGNENRPGYLIRKRPDKKDISLLTSEEIEMP  970
             N   E     + WV + + +E +     DV   N P    RK  ++K   ++  E+ + P
Sbjct  229   NVSHEEESVENMWVQDGMSNEDQSSPLLDVKTRNPPW---RKVVNEKGEMIVAMEDDKNP  285

Query  971   KIWAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFV-ESS  1147
               W+ +C+  MA+L +E +T+RRV++ +F +FD+   W    GLA  VL D+ + + +S 
Sbjct  286   SFWSGVCLHNMANLTREGTTIRRVMESIFRYFDSGNLWSIDDGLAISVLKDILFLMDDSE  345

Query  1148  GNHQLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLR  1327
              N  ++L+ +++HLDHK V  +  ++  +++  T+L++  +     S IG VSD+ RHLR
Sbjct  346   KNTHVLLSMLIKHLDHKAVLKEPHMQLDIVEVTTSLSQYAKVQPSISIIGAVSDMMRHLR  405

Query  1328  KSLQATVD---LAGEEINLN  1378
             K +  ++D   LA +EI  N
Sbjct  406   KCIHCSLDESKLAPDEIAWN  425



>ref|XP_011033325.1| PREDICTED: uncharacterized protein LOC105131844 isoform X3 [Populus 
euphratica]
Length=1000

 Score =   216 bits (550),  Expect(2) = 1e-83, Method: Compositional matrix adjust.
 Identities = 102/214 (48%), Positives = 142/214 (66%), Gaps = 18/214 (8%)
 Frame = +1

Query  148  GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  327
            GL+SR++ PAC S+C  CPA+R+RSRQPVKRYKKL+ADIFP++ +   N RKI KLCEYA
Sbjct  6    GLVSRQVMPACGSLCFFCPAMRARSRQPVKRYKKLIADIFPRNQEEGPNDRKIGKLCEYA  65

Query  328  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  507
            AKNP RIPKI   LE+RCYKELR  + +   ++  +Y +LL  CKE M  FA +LL ++ 
Sbjct  66   AKNPLRIPKITCSLEQRCYKELRIENFQSAKIVMCIYRKLLVTCKEHMTLFASSLLGIIN  125

Query  508  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRA  687
             +LD  + D ++ IGC T   F+ +Q                   A+E GE+++ + LRA
Sbjct  126  TLLDQTRQDDIQVIGCETLFDFVNNQ------------------FAQEEGEDERAKSLRA  167

Query  688  SSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNY  789
            + L+ LS++VWFM++ SHI  +FD +V V L+NY
Sbjct  168  AGLQALSSVVWFMSQHSHISVEFDNVVSVVLENY  201


 Score =   123 bits (309),  Expect(2) = 1e-83, Method: Compositional matrix adjust.
 Identities = 68/195 (35%), Positives = 115/195 (59%), Gaps = 9/195 (5%)
 Frame = +2

Query  806   NEDDERGEAHHNWVDEVIRSEGRDVG----NENRPGYLIRKRPDKKDISLLTSEEIEMPK  973
             N D ++      WV EV+++EG            P +  R   +++    +T E+ + P 
Sbjct  210   NLDTDKQGPQSRWVQEVLKNEGHVTPLPEVTTRVPSW--RTIVNERGEVNMTEEDSQNPC  267

Query  974   IWAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSG-  1150
              W+ +C+  MA L KE++T+RRVL+ +F +FDN   W   +GLAF VL D+ + + +SG 
Sbjct  268   FWSRVCLHNMAKLGKEATTIRRVLESLFRYFDNGNLWSLENGLAFPVLKDMQFLMHNSGQ  327

Query  1151  NHQLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRK  1330
             N  ++L+ +++HLDHKNV  +  ++  +++  TALA+ +++    + IG VSD+ RHLRK
Sbjct  328   NTHVLLSILIKHLDHKNVLKEPSMQLDIVEVTTALAQHVKADPSVAIIGAVSDVMRHLRK  387

Query  1331  SLQATVDLA--GEEI  1369
             S+  ++D A  G EI
Sbjct  388   SIHCSLDDANLGAEI  402



>ref|XP_010508669.1| PREDICTED: uncharacterized protein LOC104785201 isoform X1 [Camelina 
sativa]
 ref|XP_010508670.1| PREDICTED: uncharacterized protein LOC104785201 isoform X2 [Camelina 
sativa]
Length=1026

 Score =   238 bits (608),  Expect(2) = 1e-83, Method: Compositional matrix adjust.
 Identities = 106/214 (50%), Positives = 149/214 (70%), Gaps = 0/214 (0%)
 Frame = +1

Query  148  GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  327
            G++SR++ P C S+CI CPALR+RSRQPVKRYKKL+ADIFP++ +   N RKI KLCEYA
Sbjct  6    GVISRQVLPVCGSLCILCPALRARSRQPVKRYKKLIADIFPRNQEEGPNDRKIGKLCEYA  65

Query  328  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  507
            AKN  R+PKI+  LE+RCYKELR+ +     +   +Y  LL  CKEQM  F+   L  V 
Sbjct  66   AKNAVRMPKISDSLEQRCYKELRNENFHSAKIAMCIYRRLLVTCKEQMPLFSSGFLRTVQ  125

Query  508  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRA  687
             +LD ++ D ++ +GC +  +F+ +Q DG+  +N+E  + K+C L  E G++D+ R LRA
Sbjct  126  ALLDQSRQDEMQIVGCQSLFEFVNNQKDGSSLFNLEGFLPKLCQLGLEGGDDDRSRSLRA  185

Query  688  SSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNY  789
            + L+ LSAM+W M E+SHI +DFD +V   L+NY
Sbjct  186  AGLQALSAMIWLMGEYSHIPSDFDNVVSAVLENY  219


 Score =   100 bits (250),  Expect(2) = 1e-83, Method: Compositional matrix adjust.
 Identities = 55/186 (30%), Positives = 107/186 (58%), Gaps = 9/186 (5%)
 Frame = +2

Query  842   WVDEVIRSEGRDVGNENR---PGYLIRKRPDKKDISLLTSEEIEMPKIWAHICIQRMADL  1012
             WVDEV+++EG     ++    P +      DK ++++   + ++ P  W+ +C++ MA L
Sbjct  235   WVDEVLKNEGHVAYADSLITVPSWRTVVN-DKGELNVKMEDSLD-PSFWSKVCLRNMAKL  292

Query  1013  AKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSGNH-QLILTGVVRHL  1189
              +E++TMRR+L+ +F +FD    W   + +AF VL DL + +E SG     +L+ +++HL
Sbjct  293   GEEATTMRRILESLFRYFDEGCLWSTENSVAFPVLRDLQFLMEISGQRTHFLLSMLIKHL  352

Query  1190  DHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKSLQATVD---LAG  1360
             DHK+V     ++  +++  ++LA   +     + +  +SD+ RHLRK + +++D   L  
Sbjct  353   DHKSVLKQPSMQLNILEVTSSLAENAKVEHSAAIVSAISDIMRHLRKCMHSSLDEANLGT  412

Query  1361  EEINLN  1378
             + +N N
Sbjct  413   DVVNCN  418



>ref|XP_002309810.1| hypothetical protein POPTR_0007s02020g [Populus trichocarpa]
 gb|EEE90260.1| hypothetical protein POPTR_0007s02020g [Populus trichocarpa]
Length=988

 Score =   232 bits (592),  Expect(2) = 1e-83, Method: Compositional matrix adjust.
 Identities = 110/215 (51%), Positives = 149/215 (69%), Gaps = 0/215 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG++SR++ PAC S+C  CP+LR+RSRQPVKRYKKLLADI P++ +   N RKI KLCEY
Sbjct  1    MGVMSRRVVPACGSLCFFCPSLRARSRQPVKRYKKLLADILPRNQEAEPNDRKIGKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            A+KNP RIPKI   LE+R YKELR  +   V V+  +Y +LL  CKEQM  FA +LL++V
Sbjct  61   ASKNPLRIPKITDTLEQRFYKELRHENFGSVKVVVCIYRKLLSSCKEQMPLFASSLLSIV  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
              +L+    D ++ + C     FI  Q+DGTY +N+E L+ K+C LA+E G  ++   LR
Sbjct  121  RTLLEQTGKDDLRLLACDVLVDFISCQMDGTYMFNLEGLIPKLCQLAQEAGNNERTLRLR  180

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNY  789
            ++ L+ L +MV FM E +HI  DFD I+ VTL+NY
Sbjct  181  SAGLQVLGSMVCFMGEQAHISMDFDSIISVTLENY  215


 Score =   107 bits (266),  Expect(2) = 1e-83, Method: Compositional matrix adjust.
 Identities = 63/172 (37%), Positives = 101/172 (59%), Gaps = 9/172 (5%)
 Frame = +2

Query  839   NWVDEVIRSE--GRDVGNENRPGYL--IRKRPDKKDISLLTSEEIEMPKIWAHICIQRMA  1006
              WV  V+++E  G    + ++   L  +  +P+  D+++ TS+    P  W+ +C+  MA
Sbjct  228   QWVQGVLKTEDNGSSFPDISKKVSLSDLTTKPEL-DLAMDTSKS---PSYWSRVCLCNMA  283

Query  1007  DLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDL-SYFVESSGNHQLILTGVVR  1183
              LAKE++T+RRVL+P+F +FD N HW    G+A+ VL+ L S  VES  N  L+L+ +V+
Sbjct  284   RLAKEATTIRRVLEPLFQNFDANNHWSLEKGVAYPVLTFLQSLLVESGENSHLLLSILVK  343

Query  1184  HLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKSLQ  1339
             HLDHK+VA    +   ++     L +  +     + IG +SDL +HLRK LQ
Sbjct  344   HLDHKSVAKQPLLLVDIVNVTARLGQSAKQQATVAIIGAISDLMKHLRKCLQ  395



>ref|XP_011026408.1| PREDICTED: uncharacterized protein LOC105127024 isoform X1 [Populus 
euphratica]
 ref|XP_011026409.1| PREDICTED: uncharacterized protein LOC105127024 isoform X1 [Populus 
euphratica]
 ref|XP_011026410.1| PREDICTED: uncharacterized protein LOC105127024 isoform X1 [Populus 
euphratica]
Length=988

 Score =   232 bits (592),  Expect(2) = 3e-83, Method: Compositional matrix adjust.
 Identities = 110/215 (51%), Positives = 149/215 (69%), Gaps = 0/215 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG++SR++ PAC S+C  CP+LR+RSRQPVKRYKKLLADI P++ +   N RKI KLCEY
Sbjct  1    MGVMSRRVVPACGSLCFFCPSLRARSRQPVKRYKKLLADILPRNQEAEPNDRKIGKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            A+KNP RIPKI   LE+R YKELR  +   V V+  +Y +LL  CKEQM  FA +LL++V
Sbjct  61   ASKNPLRIPKITDTLEQRFYKELRHENFGSVKVVVCIYRKLLSSCKEQMPLFASSLLSIV  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
              +L+    D ++ + C     FI  Q+DGTY +N+E L+ K+C LA+E G  ++   LR
Sbjct  121  RTLLEQTGKDDLRLLACDVLVDFISCQMDGTYMFNLEGLIPKLCQLAQEAGNNERTLRLR  180

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNY  789
            ++ L+ L +MV FM E +HI  DFD I+ VTL+NY
Sbjct  181  SAGLQVLGSMVCFMGEQAHISMDFDSIISVTLENY  215


 Score =   105 bits (263),  Expect(2) = 3e-83, Method: Compositional matrix adjust.
 Identities = 63/172 (37%), Positives = 100/172 (58%), Gaps = 9/172 (5%)
 Frame = +2

Query  839   NWVDEVIRSE--GRDVGNENRPGYL--IRKRPDKKDISLLTSEEIEMPKIWAHICIQRMA  1006
              WV  V+++E  G    + ++   L  +  +P+  D+++ TS+    P  W+ +C+  MA
Sbjct  228   QWVQGVLKTEDNGSSFPDISKKVSLSDLTTKPEL-DLAMDTSKS---PSYWSRVCLCNMA  283

Query  1007  DLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDL-SYFVESSGNHQLILTGVVR  1183
              LAKE++T+RRVL+P+F +FD N HW    G+A+ VL  L S  VES  N  L+L+ +V+
Sbjct  284   RLAKEATTIRRVLEPLFQNFDANNHWSLEKGVAYPVLMFLQSLLVESGENSHLLLSILVK  343

Query  1184  HLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKSLQ  1339
             HLDHK+VA    +   ++     L +  +     + IG +SDL +HLRK LQ
Sbjct  344   HLDHKSVAKQPLLLVDIVNVTARLGQSAKQQATVAIIGAISDLMKHLRKCLQ  395



>ref|XP_011026411.1| PREDICTED: uncharacterized protein LOC105127024 isoform X2 [Populus 
euphratica]
Length=987

 Score =   232 bits (592),  Expect(2) = 3e-83, Method: Compositional matrix adjust.
 Identities = 110/215 (51%), Positives = 149/215 (69%), Gaps = 0/215 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG++SR++ PAC S+C  CP+LR+RSRQPVKRYKKLLADI P++ +   N RKI KLCEY
Sbjct  1    MGVMSRRVVPACGSLCFFCPSLRARSRQPVKRYKKLLADILPRNQEAEPNDRKIGKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            A+KNP RIPKI   LE+R YKELR  +   V V+  +Y +LL  CKEQM  FA +LL++V
Sbjct  61   ASKNPLRIPKITDTLEQRFYKELRHENFGSVKVVVCIYRKLLSSCKEQMPLFASSLLSIV  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
              +L+    D ++ + C     FI  Q+DGTY +N+E L+ K+C LA+E G  ++   LR
Sbjct  121  RTLLEQTGKDDLRLLACDVLVDFISCQMDGTYMFNLEGLIPKLCQLAQEAGNNERTLRLR  180

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNY  789
            ++ L+ L +MV FM E +HI  DFD I+ VTL+NY
Sbjct  181  SAGLQVLGSMVCFMGEQAHISMDFDSIISVTLENY  215


 Score =   105 bits (263),  Expect(2) = 3e-83, Method: Compositional matrix adjust.
 Identities = 63/172 (37%), Positives = 100/172 (58%), Gaps = 9/172 (5%)
 Frame = +2

Query  839   NWVDEVIRSE--GRDVGNENRPGYL--IRKRPDKKDISLLTSEEIEMPKIWAHICIQRMA  1006
              WV  V+++E  G    + ++   L  +  +P+  D+++ TS+    P  W+ +C+  MA
Sbjct  228   QWVQGVLKTEDNGSSFPDISKKVSLSDLTTKPEL-DLAMDTSKS---PSYWSRVCLCNMA  283

Query  1007  DLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDL-SYFVESSGNHQLILTGVVR  1183
              LAKE++T+RRVL+P+F +FD N HW    G+A+ VL  L S  VES  N  L+L+ +V+
Sbjct  284   RLAKEATTIRRVLEPLFQNFDANNHWSLEKGVAYPVLMFLQSLLVESGENSHLLLSILVK  343

Query  1184  HLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKSLQ  1339
             HLDHK+VA    +   ++     L +  +     + IG +SDL +HLRK LQ
Sbjct  344   HLDHKSVAKQPLLLVDIVNVTARLGQSAKQQATVAIIGAISDLMKHLRKCLQ  395



>gb|KHN23227.1| Protein EFR3 like cmp44E [Glycine soja]
Length=896

 Score =   286 bits (731),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 138/202 (68%), Positives = 167/202 (83%), Gaps = 0/202 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG++SRK+FPAC +MC+CCPALRSRSRQPVKRY+KLLADIFPKSPD S + RKI KLCEY
Sbjct  1    MGVISRKIFPACGNMCVCCPALRSRSRQPVKRYRKLLADIFPKSPDESPSERKITKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            AAKNPFRIPKIAK LEERCYKELR  H KLVN+IAE +N+LL +CK Q+A FAV++LNV+
Sbjct  61   AAKNPFRIPKIAKYLEERCYKELRYEHLKLVNIIAESFNKLLSICKVQIAYFAVDVLNVI  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
            +E+L  +K + ++T+GC   +KFIY Q+D TYT+NIE LV KVC L+RE GE  +KRCLR
Sbjct  121  LELLSYSKDETIQTLGCQCLSKFIYCQMDATYTHNIEKLVPKVCMLSREHGEACEKRCLR  180

Query  685  ASSLRCLSAMVWFMAEFSHIFA  750
            ASSL+CLSAMV    E   I+A
Sbjct  181  ASSLQCLSAMVIEEIEKPEIWA  202


 Score =   205 bits (521),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 94/152 (62%), Positives = 122/152 (80%), Gaps = 1/152 (1%)
 Frame = +2

Query  935   ISLLTSEEIEMPKIWAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVV  1114
             +S +  EEIE P+IWA ICIQRM +LAKES+TMRRVLDPMF++FD+ +HW P+ GLA ++
Sbjct  187   LSAMVIEEIEKPEIWAQICIQRMVELAKESTTMRRVLDPMFVYFDSRQHWAPQKGLAMII  246

Query  1115  LSDLSYFVESSGNHQLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDI  1294
             LS ++YF+E+SGN +LIL  V+ HLDHKNV  D Q+K+ VIQ AT+LA QIRS  G ++I
Sbjct  247   LSRMAYFMENSGNQRLILASVIHHLDHKNVMNDPQLKTCVIQVATSLAMQIRSESGLAEI  306

Query  1295  GFVSDLCRHLRKSLQATVDLAGE-EINLNLTL  1387
             GFV  LCRHLRKSLQA+ +  GE E+NLN++L
Sbjct  307   GFVGVLCRHLRKSLQASSEFVGEQELNLNISL  338



>ref|XP_004954123.1| PREDICTED: protein EFR3 homolog B-like [Setaria italica]
Length=994

 Score =   233 bits (595),  Expect(2) = 4e-83, Method: Compositional matrix adjust.
 Identities = 103/216 (48%), Positives = 152/216 (70%), Gaps = 0/216 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG++SR++ PACE +C  CP+LR+RSR PVKRYKKLLA+IFP++ D   N RKI KLCEY
Sbjct  3    MGVVSREVLPACERLCFICPSLRTRSRHPVKRYKKLLAEIFPRTQDEGPNDRKIGKLCEY  62

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
             ++NP R+PKI   LE++CYKE+R+     V V+  +Y +++  C+EQ+  FA +LL +V
Sbjct  63   ISRNPMRVPKITVYLEQKCYKEMRAERYGSVKVVMAIYRKVIYSCQEQLPLFANSLLTIV  122

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
              +L+  + D ++ + C T   FI +QVD TY +N+EN + K+C LA+E GE+++   L 
Sbjct  123  ETLLEQNRQDDLRKLACQTLFDFINNQVDSTYMFNLENQIPKLCHLAQEVGEKEKICILH  182

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNYE  792
            ++ L+ LS+M+WFM E SHI A+ D +V   L+NYE
Sbjct  183  SAGLQALSSMIWFMGEHSHISAELDSVVSAVLENYE  218


 Score =   104 bits (259),  Expect(2) = 4e-83, Method: Compositional matrix adjust.
 Identities = 63/198 (32%), Positives = 103/198 (52%), Gaps = 13/198 (7%)
 Frame = +2

Query  806   NEDDERGEAHHNWVDEVIRSEGRDVGNENRPGYLIRKRPDK-KDISL------LTSEEIE  964
             N+D    +  + WV E ++SEG +      P   I  R    KDI        LT EE  
Sbjct  226   NDDTPAEDKRNRWVSEALKSEGHE-----PPAVSILTRISSWKDIRAAHGELSLTIEESR  280

Query  965   MPKIWAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVES  1144
              P  W+ IC+  +A +++E +T+RRVL+ +F +FDNN  W    G A  VL D+   ++ 
Sbjct  281   SPNFWSGICLHNLARISREGTTVRRVLEAIFRYFDNNSLWSRSKGFALCVLLDMQIVMDK  340

Query  1145  SG-NHQLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRH  1321
             SG N  ++L+ +++HL+HKNV         +I+  T LA   ++    + +  +SD+ RH
Sbjct  341   SGQNAHILLSMLIKHLEHKNVLKQPDKILDIIEITTCLAEHSKAQSSTALMAAISDMVRH  400

Query  1322  LRKSLQATVDLAGEEINL  1375
             + KS+Q+  +  G   N+
Sbjct  401   MGKSMQSLANDGGPGDNI  418



>ref|XP_002881801.1| hypothetical protein ARALYDRAFT_483264 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58060.1| hypothetical protein ARALYDRAFT_483264 [Arabidopsis lyrata subsp. 
lyrata]
Length=1025

 Score =   234 bits (598),  Expect(2) = 1e-82, Method: Compositional matrix adjust.
 Identities = 104/214 (49%), Positives = 148/214 (69%), Gaps = 0/214 (0%)
 Frame = +1

Query  148  GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  327
            G++SR++ P C S+CI CPALR+RSRQPVKRYKKL+ADIFP++ +   N RKI KLCEYA
Sbjct  6    GVISRQVLPVCGSLCILCPALRARSRQPVKRYKKLIADIFPRNQEEGINDRKIGKLCEYA  65

Query  328  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  507
            AKN  R+PKI+  LE++CYKELR+ +     +   +Y  LL  CKEQ+  F+   L  V 
Sbjct  66   AKNAVRMPKISDSLEQKCYKELRNENFHSAKIAMCIYRRLLVTCKEQIPLFSSGFLRTVQ  125

Query  508  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRA  687
             +LD  + D ++ +GC +  +F+ +Q DG+  +N+E  + K+C L  E G++D+ R LRA
Sbjct  126  ALLDQTRQDEMQIVGCQSLFEFVINQKDGSSLFNLEGFLPKLCQLGLEGGDDDRSRSLRA  185

Query  688  SSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNY  789
            + L+ LSAM+W M E+SHI +DFD +V   L+NY
Sbjct  186  AGLQALSAMIWLMGEYSHIPSDFDNVVSAVLENY  219


 Score =   101 bits (252),  Expect(2) = 1e-82, Method: Compositional matrix adjust.
 Identities = 54/176 (31%), Positives = 102/176 (58%), Gaps = 6/176 (3%)
 Frame = +2

Query  842   WVDEVIRSEGRDVGNE---NRPGYLIRKRPDKKDISLLTSEEIEMPKIWAHICIQRMADL  1012
             WVDEV+++EG     +   N P +      DK ++++   + ++ P  W+ +C+  MA L
Sbjct  235   WVDEVLKNEGHVAYADSLINVPSWRTVVN-DKGELNVKMEDSLD-PSFWSKVCLHNMAKL  292

Query  1013  AKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSGNH-QLILTGVVRHL  1189
              +E++TMRR+L+ +F +FD    W   + +AF VL DL + +E SG     +L+ +++HL
Sbjct  293   GEEATTMRRILESLFRYFDEGCLWSTENSIAFPVLRDLQFLMEISGQRTHFLLSMLIKHL  352

Query  1190  DHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKSLQATVDLA  1357
             DHK+V     ++  +++  ++L+   +     + +  +SDL RHLRK + +++D A
Sbjct  353   DHKSVLKHPSMQLNILEVTSSLSENAKVEHSAAIVSAISDLMRHLRKCMHSSLDEA  408



>ref|XP_008655589.1| PREDICTED: uncharacterized protein LOC103634777 isoform X2 [Zea 
mays]
Length=996

 Score =   221 bits (563),  Expect(2) = 3e-82, Method: Compositional matrix adjust.
 Identities = 102/216 (47%), Positives = 146/216 (68%), Gaps = 6/216 (3%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG +SR++  ACE +C  CP+LR+RSR PVKRYKKLLA+IFP++ D   N RKI KLCEY
Sbjct  3    MGAVSREVSSACERLCFICPSLRTRSRHPVKRYKKLLAEIFPRTQDEGPNDRKIGKLCEY  62

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
             ++NP R+PKI   LE++CYKE R+     V V+  +Y +++C C+EQ       LL +V
Sbjct  63   ISRNPMRVPKITVYLEQKCYKEFRAERYGSVKVVMAIYRKVICSCQEQF------LLTIV  116

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
              +L+  + D ++ + C T   FI SQVD TY +N+EN + K+C LA+E GE+++   L 
Sbjct  117  ETLLEQNRQDDLRKLACQTLFDFINSQVDSTYMFNLENQIPKLCHLAQEMGEKEKICILH  176

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNYE  792
            A+ L+ LS+M+WFM E SH+ A+ D +V   L+NYE
Sbjct  177  AAGLQALSSMIWFMGEHSHMSAELDNVVSAVLENYE  212


 Score =   113 bits (283),  Expect(2) = 3e-82, Method: Compositional matrix adjust.
 Identities = 65/187 (35%), Positives = 102/187 (55%), Gaps = 13/187 (7%)
 Frame = +2

Query  839   NWVDEVIRSEGRDVGNENRPGYLIRKR-PDKKDISL------LTSEEIEMPKIWAHICIQ  997
              WVDEV+++EG +      P   I  R P  K I        LT EE   P  W+ IC+ 
Sbjct  230   QWVDEVLKAEGHE-----PPAVTILTRVPSWKVIRAVHGELSLTIEESTSPNFWSGICLH  284

Query  998   RMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSG-NHQLILTG  1174
              +A +++E++T RRVL+ +F +FDNN  W P  G A  VL D+   +E SG N  ++L+ 
Sbjct  285   NLARISRETTTTRRVLEAIFRYFDNNNLWSPSKGFALCVLLDMQIVMEKSGQNAHILLSM  344

Query  1175  VVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKSLQATVDL  1354
             +V+HL+HKNV     +   +I+  + LA   ++    + +  +SD+ RH+ KS+Q+    
Sbjct  345   LVKHLEHKNVLKQPDMNLDIIEVTSRLAEHSKAQSSIALMSSISDMVRHMGKSMQSLASD  404

Query  1355  AGEEINL  1375
             AG   N+
Sbjct  405   AGPGDNM  411



>gb|KJB16447.1| hypothetical protein B456_002G230500 [Gossypium raimondii]
Length=1003

 Score =   228 bits (581),  Expect(2) = 4e-82, Method: Compositional matrix adjust.
 Identities = 108/215 (50%), Positives = 155/215 (72%), Gaps = 0/215 (0%)
 Frame = +1

Query  148  GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  327
            G +SR++ PAC S+C  CP LR+RSRQPVKRYKK++A+IFP++ +   N RKI KLCEYA
Sbjct  6    GAISRQVLPACGSLCFLCPGLRTRSRQPVKRYKKMIAEIFPRNQEEGPNERKIGKLCEYA  65

Query  328  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  507
            +KNP RIPKI+  LE+RCYKELR+   + V ++  +Y +LL  CKEQM+ F+ +LL+++ 
Sbjct  66   SKNPLRIPKISTSLEQRCYKELRNEKFQSVKIVMCIYRKLLVSCKEQMSLFSSSLLSIIQ  125

Query  508  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRA  687
             +LD  + D ++ IGC T   F+ +Q DGT  + +E  + K+C LA+ETGE ++++ L A
Sbjct  126  TLLDQTRHDEMRIIGCQTLFYFLNNQNDGTCMFKLEGFIPKLCQLAQETGESEREKNLCA  185

Query  688  SSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNYE  792
            + L+ LS+M+WFM   SHI  +FD IV V L+NYE
Sbjct  186  AGLQALSSMIWFMGIHSHISVEFDNIVSVVLENYE  220


 Score =   106 bits (264),  Expect(2) = 4e-82, Method: Compositional matrix adjust.
 Identities = 68/204 (33%), Positives = 112/204 (55%), Gaps = 17/204 (8%)
 Frame = +2

Query  809   EDDERGEAHHN-----WVDEVIRSEGRDVGNENRPGYL-----IRKRPDKKDISLLTSEE  958
             ED  +   +HN        EV++ EG D  + + P        I     + +IS+   E+
Sbjct  220   EDPRKNLENHNGGKSQLEKEVVKDEGHDSPSPDVPITFPSWDTIVNDNGELNISV---ED  276

Query  959   IEMPKIWAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFV  1138
              +    W+ +C+  MA+LAKE++T RRVL+ +F + D+   W  + GLAF VL D+   +
Sbjct  277   AQNRSFWSKVCLHNMANLAKEATTARRVLESLFRYLDSENLWSLQTGLAFPVLKDMQLLM  336

Query  1139  ESSG-NHQLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLC  1315
             ESSG N   +L+ +V+HLDHK+V     ++  +++  ++LAR  +     + +G VSD+ 
Sbjct  337   ESSGQNTHFLLSLLVKHLDHKSVLKQPDVQLQILEVTSSLARYSKVEPSIAILGAVSDVM  396

Query  1316  RHLRKSLQATVD---LAGEEINLN  1378
             RHLRKS+  ++D   L  + IN N
Sbjct  397   RHLRKSIHCSLDDATLGVDTINWN  420



>ref|XP_008240995.1| PREDICTED: uncharacterized protein LOC103339476 [Prunus mume]
Length=1046

 Score =   220 bits (561),  Expect(2) = 4e-82, Method: Compositional matrix adjust.
 Identities = 106/227 (47%), Positives = 152/227 (67%), Gaps = 13/227 (6%)
 Frame = +1

Query  148  GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCE--  321
            G+LSR++ PAC  +C  CPALR+RSRQPVKRYKKL+ADIFP++     +  +++   E  
Sbjct  6    GVLSRQVLPACGGLCFFCPALRARSRQPVKRYKKLIADIFPRNQGLVISIPELIDEQEPH  65

Query  322  -----------YAAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQ  468
                       YAAKNP RIPKI   LE+RCYKELR+ + +   ++  +YN+LL  CKEQ
Sbjct  66   FEFRTCSIHLTYAAKNPLRIPKITNFLEQRCYKELRNENFRSTKIVMCIYNKLLISCKEQ  125

Query  469  MACFAVNLLNVVVEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLAR  648
            M  FA +LL+++  +LD  + D ++ IGC T   F+ +Q DGTY +N+E  + K+C +A+
Sbjct  126  MRLFASSLLSIMHTLLDQTRQDEMQIIGCQTLFNFVNNQKDGTYMFNLEGFIPKLCQIAQ  185

Query  649  ETGEEDQKRCLRASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNY  789
            E GE+++   L +++L+ LS+MVWFM E SHI  +FD IV V L+NY
Sbjct  186  EPGEDERANNLCSAALQALSSMVWFMGEHSHISVEFDNIVAVVLENY  232


 Score =   114 bits (284),  Expect(2) = 4e-82, Method: Compositional matrix adjust.
 Identities = 63/175 (36%), Positives = 103/175 (59%), Gaps = 7/175 (4%)
 Frame = +2

Query  842   WVDEVIRSEGRDVGNE----NRPGYLIRKRPDKKDISLLTSEEIEMPKIWAHICIQRMAD  1009
             WV EV ++EG    +     N P +      D+K    +  E+ + P  W+ +C+  MA 
Sbjct  249   WVQEVRKNEGHVSPSPDVKINVPSW--SSIVDEKGELNVKVEDAKNPCFWSRVCLHNMAK  306

Query  1010  LAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSG-NHQLILTGVVRH  1186
             LAKE++T+RRVL+ +F +FDN   W P  GLAF VL D+   +++SG N  + L+ +++H
Sbjct  307   LAKEATTIRRVLESVFRYFDNGNLWSPERGLAFPVLKDIQLLMDTSGQNTHVFLSILIKH  366

Query  1187  LDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKSLQATVD  1351
             LDHKNV     ++  +++  T+L++  +     + IG VSD+ RHLRKS+  ++D
Sbjct  367   LDHKNVLKQPNMQLDIVEVTTSLSQLAKIEPSVAIIGAVSDVMRHLRKSIHCSLD  421



>ref|XP_003570918.1| PREDICTED: uncharacterized protein LOC100821314 isoform X1 [Brachypodium 
distachyon]
Length=1059

 Score =   225 bits (573),  Expect(2) = 7e-82, Method: Compositional matrix adjust.
 Identities = 99/216 (46%), Positives = 148/216 (69%), Gaps = 0/216 (0%)
 Frame = +1

Query  148  GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  327
            G++SRK+ PAC  +C  CP+LR+RSRQPVKRYKK+LADIFP + +   N R I KLC+Y 
Sbjct  12   GVVSRKVLPACGGLCYLCPSLRARSRQPVKRYKKILADIFPATQEEEPNVRMIGKLCDYV  71

Query  328  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  507
            ++NP R+PKI + L++R Y+ELR        V+  +Y + L  CK+Q+   A +LL+++ 
Sbjct  72   SRNPHRVPKITEYLDQRFYRELRKELYGFAKVVVLIYRKFLISCKDQLPLIASSLLSIIS  131

Query  508  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRA  687
             +LD  + D ++ +GC T   F+  Q+DGTY +N+E LV ++C LA+    E++   LRA
Sbjct  132  TLLDQTRHDDMRIVGCETLFDFVVIQIDGTYQFNMEELVPRLCELAQVVKVEEKSNELRA  191

Query  688  SSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNYEP  795
            S+L+ LSAM+WFM E SH+ ++FD +V V L++Y P
Sbjct  192  SALQALSAMIWFMGELSHLSSEFDNVVQVVLESYTP  227


 Score =   108 bits (271),  Expect(2) = 7e-82, Method: Compositional matrix adjust.
 Identities = 62/176 (35%), Positives = 100/176 (57%), Gaps = 11/176 (6%)
 Frame = +2

Query  845   VDEVIRSEGRDVGNENRPGYLIRKRP-------DKKDISLLTSEEIEMPKIWAHICIQRM  1003
              DEV+++EGR V     P   I + P       DK +I +   E  + P  W+ IC+  M
Sbjct  245   ADEVLKTEGR-VSLSPSP-VTISRIPSWKSIVSDKGEIQVPV-EGAKDPNFWSRICVHNM  301

Query  1004  ADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSGNHQLILTGV-V  1180
             A+L++E++T RRVL+ +F HFDNN  W  +  LA  VL D+   +E +G +  ++T V V
Sbjct  302   ANLSREAATFRRVLESLFRHFDNNNSWSSQSTLALCVLLDMQMLMEDAGQNMNLMTSVLV  361

Query  1181  RHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKSLQATV  1348
             +HL+HK+V    +++  +++    LA Q R+    + I  +SDL RH++K+L   V
Sbjct  362   KHLEHKSVLKQPEMQLSIVEVIATLAEQSRAQASAATISAISDLVRHMKKTLHIAV  417



>dbj|BAF00551.1| hypothetical protein [Arabidopsis thaliana]
Length=1025

 Score =   232 bits (591),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 103/214 (48%), Positives = 147/214 (69%), Gaps = 0/214 (0%)
 Frame = +1

Query  148  GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  327
            G++SR++ P C S+CI CPALR+RSRQPVKRYKKL+A+IFP++ +   N RKI KLCEYA
Sbjct  6    GVISRQVLPVCGSLCILCPALRARSRQPVKRYKKLIAEIFPRNQEEGINDRKIGKLCEYA  65

Query  328  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  507
            AKN  R+PKI+  LE RCYKELR+ +     +   +Y  LL  CKEQ+  F+   L  V 
Sbjct  66   AKNAVRMPKISDSLEHRCYKELRNENFHSAKIAVCIYRRLLVTCKEQIPLFSSGFLRTVQ  125

Query  508  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRA  687
             +LD  + D ++ +GC +  +F+ +Q DG+  +N+E  + K+C L  E G++D+ R LRA
Sbjct  126  ALLDQTRQDEMQIVGCQSLFEFVINQKDGSSLFNLEGFLPKLCQLGLEGGDDDRSRSLRA  185

Query  688  SSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNY  789
            + L+ LSAM+W M E+SHI ++FD +V   L+NY
Sbjct  186  AGLQALSAMIWLMGEYSHIPSEFDNVVSAVLENY  219


 Score =   100 bits (249),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 55/177 (31%), Positives = 103/177 (58%), Gaps = 8/177 (5%)
 Frame = +2

Query  842   WVDEVIRSEGRDVGNE----NRPGYLIRKRPDKKDISLLTSEEIEMPKIWAHICIQRMAD  1009
             WVDEV+++EG  V  E    N P +      DK ++++   + ++ P  W+ +C+  MA 
Sbjct  235   WVDEVLKNEGH-VAYEDSLINVPSWRTVVN-DKGELNVKMEDSLD-PSFWSKVCLHNMAK  291

Query  1010  LAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSGNH-QLILTGVVRH  1186
             L +E++TMRR+L+ +F +FD    W   + +AF VL DL + +E SG     +L+ +++H
Sbjct  292   LGEEATTMRRILESLFRNFDEGCLWSTENSIAFPVLRDLQFLMEISGQRTHFLLSMLIKH  351

Query  1187  LDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKSLQATVDLA  1357
             LDHK+V     ++  +++  ++L+   +     + +  +SD+ RHLRK + +++D A
Sbjct  352   LDHKSVLKHPSMQLNILEVTSSLSETAKVEHSATIVSAISDIMRHLRKCMHSSLDEA  408



>ref|NP_181714.3| uncharacterized protein [Arabidopsis thaliana]
 gb|AEC10037.1| uncharacterized protein AT2G41830 [Arabidopsis thaliana]
Length=1025

 Score =   232 bits (591),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 103/214 (48%), Positives = 147/214 (69%), Gaps = 0/214 (0%)
 Frame = +1

Query  148  GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  327
            G++SR++ P C S+CI CPALR+RSRQPVKRYKKL+A+IFP++ +   N RKI KLCEYA
Sbjct  6    GVISRQVLPVCGSLCILCPALRARSRQPVKRYKKLIAEIFPRNQEEGINDRKIGKLCEYA  65

Query  328  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  507
            AKN  R+PKI+  LE RCYKELR+ +     +   +Y  LL  CKEQ+  F+   L  V 
Sbjct  66   AKNAVRMPKISDSLEHRCYKELRNENFHSAKIAMCIYRRLLVTCKEQIPLFSSGFLRTVQ  125

Query  508  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRA  687
             +LD  + D ++ +GC +  +F+ +Q DG+  +N+E  + K+C L  E G++D+ R LRA
Sbjct  126  ALLDQTRQDEMQIVGCQSLFEFVINQKDGSSLFNLEGFLPKLCQLGLEGGDDDRSRSLRA  185

Query  688  SSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNY  789
            + L+ LSAM+W M E+SHI ++FD +V   L+NY
Sbjct  186  AGLQALSAMIWLMGEYSHIPSEFDNVVSAVLENY  219


 Score =   100 bits (249),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 55/177 (31%), Positives = 103/177 (58%), Gaps = 8/177 (5%)
 Frame = +2

Query  842   WVDEVIRSEGRDVGNE----NRPGYLIRKRPDKKDISLLTSEEIEMPKIWAHICIQRMAD  1009
             WVDEV+++EG  V  E    N P +      DK ++++   + ++ P  W+ +C+  MA 
Sbjct  235   WVDEVLKNEGH-VAYEDSLINVPSWRTVVN-DKGELNVKMEDSLD-PSFWSKVCLHNMAK  291

Query  1010  LAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSGNH-QLILTGVVRH  1186
             L +E++TMRR+L+ +F +FD    W   + +AF VL DL + +E SG     +L+ +++H
Sbjct  292   LGEEATTMRRILESLFRNFDEGCLWSTENSIAFPVLRDLQFLMEISGQRTHFLLSMLIKH  351

Query  1187  LDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKSLQATVDLA  1357
             LDHK+V     ++  +++  ++L+   +     + +  +SD+ RHLRK + +++D A
Sbjct  352   LDHKSVLKHPSMQLNILEVTSSLSETAKVEHSATIVSAISDIMRHLRKCMHSSLDEA  408



>ref|XP_012066154.1| PREDICTED: uncharacterized protein LOC105629221 [Jatropha curcas]
 ref|XP_012066155.1| PREDICTED: uncharacterized protein LOC105629221 [Jatropha curcas]
 ref|XP_012066156.1| PREDICTED: uncharacterized protein LOC105629221 [Jatropha curcas]
 gb|KDP42800.1| hypothetical protein JCGZ_23742 [Jatropha curcas]
Length=982

 Score =   217 bits (552),  Expect(2) = 7e-81, Method: Compositional matrix adjust.
 Identities = 100/215 (47%), Positives = 145/215 (67%), Gaps = 0/215 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG++SR++ P C ++C  CP+LR+RSRQPVKRYKK L++IFP++     N RKI KLCEY
Sbjct  1    MGVMSRRVVPVCGNLCFFCPSLRARSRQPVKRYKKFLSEIFPRNQGAEPNDRKIGKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            A+KNP RIPKI + LE+R YKELR G+   V V+  +Y + L  CKEQM  FA +LL +V
Sbjct  61   ASKNPLRIPKITETLEQRFYKELRHGNFGSVKVVMCIYRKFLSSCKEQMPLFASSLLGIV  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
              +L+    D ++ + C     FI  Q D T+ +N+E L+ K+C +A++  + ++   L 
Sbjct  121  RVLLEQTGQDEMRILACNVLVDFINIQTDSTHMFNLEGLIPKLCQVAQDVADGERMLRLH  180

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNY  789
            ++ L+ L++MV FM E SHI  +FD I+ VTL+NY
Sbjct  181  SAGLQALASMVSFMGEHSHISMEFDIIISVTLENY  215


 Score =   113 bits (282),  Expect(2) = 7e-81, Method: Compositional matrix adjust.
 Identities = 63/175 (36%), Positives = 100/175 (57%), Gaps = 8/175 (5%)
 Frame = +2

Query  842   WVDEVIRSEGRDVGNEN---RPGYLIRKRPDKKDISLLTSEEIEMPKIWAHICIQRMADL  1012
             WV  V++ E  D    +   +       +P+  D S+ TS+    P  W+ +C+  MA L
Sbjct  230   WVQGVLKGEENDSSFPDISKKVALSFNAKPEL-DPSVDTSKS---PSYWSRVCLHNMAKL  285

Query  1013  AKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSG-NHQLILTGVVRHL  1189
             AKE++T+RRVL+P+F +FD N HW    G+A+ VL  L   +E +G N  L+L+ +V+HL
Sbjct  286   AKEATTVRRVLEPLFHNFDTNNHWPLERGVAYPVLIYLQSLLEEAGENSHLLLSNLVKHL  345

Query  1190  DHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKSLQATVDL  1354
             DHKNV     +++ ++     L +  +     + IG +SDL +HLRK LQ +V+L
Sbjct  346   DHKNVVKQPLLQTDIVNVTMQLVQNAKQEVTVAIIGAISDLVKHLRKCLQNSVEL  400



>ref|XP_008647477.1| PREDICTED: uncharacterized protein LOC100217264 isoform X1 [Zea 
mays]
 gb|AFW75853.1| hypothetical protein ZEAMMB73_198613 [Zea mays]
Length=1048

 Score =   218 bits (556),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 102/204 (50%), Positives = 142/204 (70%), Gaps = 0/204 (0%)
 Frame = +1

Query  184  SMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPFRIPKIAK  363
            S+C  CP L +RSR PVKRYKK+LA+IFPK+ D   N R+I KLCEYA+KNP R+PKI  
Sbjct  4    SLCYFCPGLTTRSRMPVKRYKKILAEIFPKTQDEEPNERRIGKLCEYASKNPLRVPKITV  63

Query  364  CLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVVEMLDCAKTDAVK  543
             LE+  Y++LRS       V+  +Y  L   CKEQM  FA +LL++V  +LD  + D ++
Sbjct  64   YLEQHIYRDLRSEQYGFAKVVMLIYRRLSVSCKEQMPLFASSLLSIVHTLLDQKRQDDLR  123

Query  544  TIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRCLSAMVWF  723
             +GC T   F  +QVDGTY +N+E LV ++C +A+E GE+++   LRA++L+ LSAM+WF
Sbjct  124  IVGCETLFDFTVNQVDGTYQFNLEGLVPRLCEIAQEVGEDERASALRAAALQSLSAMIWF  183

Query  724  MAEFSHIFADFDEIVHVTLDNYEP  795
            M E SHI ++FD +V V L+NY+P
Sbjct  184  MGELSHISSEFDNVVQVVLENYKP  207


 Score =   110 bits (274),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 60/189 (32%), Positives = 105/189 (56%), Gaps = 15/189 (8%)
 Frame = +2

Query  806   NEDDERGEAHHNWVDEVIRSEGRDVGNENRPG-YLIRKRPDKKDISL------LTSEEIE  964
             N+D    +A +  V E       D   E+ P  ++I   P  ++I        L  E++ 
Sbjct  212   NDDQSTNDADNQLVQE-------DQKAEHPPSPFIITPAPSWENIVNAKGGINLPEEDVR  264

Query  965   MPKIWAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVES  1144
              PK+W+ IC+  MA L++E++T RR+L+ +F +F NN  W+  +GLA  VL D+   VES
Sbjct  265   DPKVWSRICVHNMAKLSREATTFRRILECLFRYFGNNSSWLSENGLALCVLLDMQLLVES  324

Query  1145  SG-NHQLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRH  1321
             SG N  L+L+ +++H++HK +     ++  +++ A  LA Q  +    + +G +SDL RH
Sbjct  325   SGQNMHLMLSLLIKHIEHKTMLKQPDMQLSIVEVAATLAEQSSAIASPATVGAISDLVRH  384

Query  1322  LRKSLQATV  1348
             L+++   T+
Sbjct  385   LKRTFHITL  393



>ref|XP_010094723.1| hypothetical protein L484_003597 [Morus notabilis]
 gb|EXB56843.1| hypothetical protein L484_003597 [Morus notabilis]
Length=570

 Score =   271 bits (693),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 129/197 (65%), Positives = 158/197 (80%), Gaps = 4/197 (2%)
 Frame = +2

Query  809   EDDERGEAHHNWVDEVIRSEGRD---VGNENRPGYLIRKRPDKKDISLLTSEEIEMPKIW  979
             EDDER E+  NWVDEV+RSEGR    VG++  P  +IR RP+ KD SLL+ EEIE PK+W
Sbjct  164   EDDERAESRRNWVDEVVRSEGRIGAIVGSDTSPCNIIRARPEIKDPSLLSREEIETPKVW  223

Query  980   AHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSGNHQ  1159
             A ICIQRM +L+KES+TMRRVLDPMF++FD+ +HWV   GLA VVLSD+SYF+E+S N Q
Sbjct  224   AQICIQRMVELSKESTTMRRVLDPMFVYFDSGRHWVSGQGLAMVVLSDMSYFMENSANQQ  283

Query  1160  LILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKSLQ  1339
             LILT V+RHLDHKN++ D ++KS+ +Q ATALARQIRSG   ++IGFVSDLCRHLRKSLQ
Sbjct  284   LILTYVIRHLDHKNISHDPELKSYAVQVATALARQIRSGAMLAEIGFVSDLCRHLRKSLQ  343

Query  1340  ATVDLAGE-EINLNLTL  1387
             AT+   GE E NLN+ L
Sbjct  344   ATLQPVGEQESNLNVML  360


 Score =   229 bits (584),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 109/178 (61%), Positives = 135/178 (76%), Gaps = 9/178 (5%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG++SRK+FPAC SMC+CCPALRS SR+PVKRYKKLLA+IFPKS DG  + RKI+KLCEY
Sbjct  1    MGVISRKIFPACGSMCVCCPALRSSSRKPVKRYKKLLAEIFPKSLDGPPSERKIVKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            A++NP RIPKIAK LEERCYKELR  H K +N++ + Y++LLC+CKEQMA FAV+LLNV+
Sbjct  61   ASRNPVRIPKIAKYLEERCYKELRCEHIKFINIVTDTYSKLLCLCKEQMAYFAVSLLNVI  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRC  678
             E+LD +K DAV+ +GC T T+FIYSQ+      N E             GEED +R 
Sbjct  121  NELLDNSKKDAVRILGCQTLTRFIYSQIVHVILDNYEPDTH---------GEEDDERA  169



>ref|XP_008647478.1| PREDICTED: uncharacterized protein LOC100217264 isoform X2 [Zea 
mays]
 gb|AFW75854.1| hypothetical protein ZEAMMB73_198613 [Zea mays]
Length=1047

 Score =   218 bits (556),  Expect(2) = 3e-80, Method: Compositional matrix adjust.
 Identities = 102/204 (50%), Positives = 142/204 (70%), Gaps = 0/204 (0%)
 Frame = +1

Query  184  SMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPFRIPKIAK  363
            S+C  CP L +RSR PVKRYKK+LA+IFPK+ D   N R+I KLCEYA+KNP R+PKI  
Sbjct  4    SLCYFCPGLTTRSRMPVKRYKKILAEIFPKTQDEEPNERRIGKLCEYASKNPLRVPKITV  63

Query  364  CLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVVEMLDCAKTDAVK  543
             LE+  Y++LRS       V+  +Y  L   CKEQM  FA +LL++V  +LD  + D ++
Sbjct  64   YLEQHIYRDLRSEQYGFAKVVMLIYRRLSVSCKEQMPLFASSLLSIVHTLLDQKRQDDLR  123

Query  544  TIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRCLSAMVWF  723
             +GC T   F  +QVDGTY +N+E LV ++C +A+E GE+++   LRA++L+ LSAM+WF
Sbjct  124  IVGCETLFDFTVNQVDGTYQFNLEGLVPRLCEIAQEVGEDERASALRAAALQSLSAMIWF  183

Query  724  MAEFSHIFADFDEIVHVTLDNYEP  795
            M E SHI ++FD +V V L+NY+P
Sbjct  184  MGELSHISSEFDNVVQVVLENYKP  207


 Score =   109 bits (273),  Expect(2) = 3e-80, Method: Compositional matrix adjust.
 Identities = 60/189 (32%), Positives = 105/189 (56%), Gaps = 15/189 (8%)
 Frame = +2

Query  806   NEDDERGEAHHNWVDEVIRSEGRDVGNENRPG-YLIRKRPDKKDISL------LTSEEIE  964
             N+D    +A +  V E       D   E+ P  ++I   P  ++I        L  E++ 
Sbjct  212   NDDQSTNDADNQLVQE-------DQKAEHPPSPFIITPAPSWENIVNAKGGINLPEEDVR  264

Query  965   MPKIWAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVES  1144
              PK+W+ IC+  MA L++E++T RR+L+ +F +F NN  W+  +GLA  VL D+   VES
Sbjct  265   DPKVWSRICVHNMAKLSREATTFRRILECLFRYFGNNSSWLSENGLALCVLLDMQLLVES  324

Query  1145  SG-NHQLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRH  1321
             SG N  L+L+ +++H++HK +     ++  +++ A  LA Q  +    + +G +SDL RH
Sbjct  325   SGQNMHLMLSLLIKHIEHKTMLKQPDMQLSIVEVAATLAEQSSAIASPATVGAISDLVRH  384

Query  1322  LRKSLQATV  1348
             L+++   T+
Sbjct  385   LKRTFHITL  393



>ref|XP_010413002.1| PREDICTED: uncharacterized protein LOC104699388 [Camelina sativa]
Length=1046

 Score =   225 bits (573),  Expect(2) = 3e-80, Method: Compositional matrix adjust.
 Identities = 107/235 (46%), Positives = 151/235 (64%), Gaps = 21/235 (9%)
 Frame = +1

Query  148  GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  327
            G++SR++ P C S+CI CPALR+RSRQPVKRYKKL+ADIFP++ +   N RKI KLCEYA
Sbjct  6    GVISRQVLPVCGSLCILCPALRARSRQPVKRYKKLIADIFPRNQEEGPNDRKIGKLCEYA  65

Query  328  AKNPFRIPKIAKCLEERCYKELRSGHTKL-------VNVIAEVYNE--------------  444
            AKN  R+PKI+  LE+RCYKELR+ +             +  +YNE              
Sbjct  66   AKNAVRMPKISDSLEQRCYKELRNENFXSDFLCKFDFGGVWVIYNEWVPLLINFCFWKXR  125

Query  445  LLCMCKEQMACFAVNLLNVVVEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLV  624
            LL  CKEQM  F+   L  V  +LD ++ D ++ +GC +  +F+ +Q DG+  +N+E  +
Sbjct  126  LLVTCKEQMPLFSSGFLRTVQALLDQSRQDEMQIVGCQSLFEFVNNQKDGSSLFNLEGFL  185

Query  625  QKVCSLARETGEEDQKRCLRASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNY  789
             K+C L  E G++++ R LRA+ L+ LSAM+W M E+SHI +DFD +V   L+NY
Sbjct  186  PKLCQLGLEGGDDNRSRSLRAAGLQALSAMIWLMGEYSHIPSDFDNVVSAVLENY  240


 Score =   103 bits (256),  Expect(2) = 3e-80, Method: Compositional matrix adjust.
 Identities = 56/186 (30%), Positives = 108/186 (58%), Gaps = 9/186 (5%)
 Frame = +2

Query  842   WVDEVIRSEGRDVGNENR---PGYLIRKRPDKKDISLLTSEEIEMPKIWAHICIQRMADL  1012
             WVDEV+++EG    +++    P +      DK ++++   + ++ P  W+ +C++ MA L
Sbjct  256   WVDEVLKNEGHIAYSDSLITVPSWRTVVN-DKGELNVKMEDSLD-PSFWSKVCLRNMAKL  313

Query  1013  AKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSGNH-QLILTGVVRHL  1189
              +E++TMRR+L+ +F +FD    W   + +AF VL DL + +E SG     +L+ +++HL
Sbjct  314   GEEATTMRRILESLFRYFDEGCLWSTENSVAFPVLRDLQFLMEISGQRTHFLLSMLIKHL  373

Query  1190  DHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKSLQATVD---LAG  1360
             DHK+V     ++  +++  ++LA   +     + +  +SD+ RHLRK + ++VD   L  
Sbjct  374   DHKSVLKQPSMQLNILEVTSSLAENAKVEHSAAIVSAISDIMRHLRKCMHSSVDEANLGT  433

Query  1361  EEINLN  1378
             + +N N
Sbjct  434   DVVNCN  439



>ref|XP_006417969.1| hypothetical protein EUTSA_v10006704mg [Eutrema salsugineum]
 gb|ESQ36322.1| hypothetical protein EUTSA_v10006704mg [Eutrema salsugineum]
Length=965

 Score =   223 bits (568),  Expect(2) = 2e-79, Method: Compositional matrix adjust.
 Identities = 99/215 (46%), Positives = 153/215 (71%), Gaps = 0/215 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG++SR++ PAC ++C  CP+LR+RSR PVKRYK++LA+IFP++ D   N RKI KLCEY
Sbjct  1    MGVMSRRVLPACGNLCFFCPSLRARSRHPVKRYKQMLAEIFPRNQDAEPNDRKIGKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            A++NP RIPKI + LE++CYKELR+G+   V V+  +Y +LL  CKEQM  F+ +LL++V
Sbjct  61   ASRNPLRIPKITEYLEQKCYKELRNGNIGSVKVVLCIYKKLLSSCKEQMPLFSCSLLSIV  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
              +L+  + + V+ +GC T   FI  Q + ++ +N+E L+ K+C LA+E G++++   LR
Sbjct  121  RTLLEQTREEEVQILGCSTLVDFISLQTENSHMFNLEGLIAKLCQLAQEMGDDERSLRLR  180

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNY  789
            ++ ++ L+ MV F+ E S +  D D I+ V L+NY
Sbjct  181  SAGMQALAFMVSFIGEHSQLSMDLDMIISVILENY  215


 Score =   102 bits (255),  Expect(2) = 2e-79, Method: Compositional matrix adjust.
 Identities = 62/198 (31%), Positives = 106/198 (54%), Gaps = 13/198 (7%)
 Frame = +2

Query  812   DDERGEAHHNWVDEVIRSEGRDVGNEN---RPGYLIRKRPDKKDISLLTSEEIEMPKIWA  982
             D E+G+   N V +   ++  ++ ++    +P  +   + D  DIS       + P  W+
Sbjct  217   DLEKGQEDINEVGQNSETKIPNIMSKKVSFKPNPVTDYKLDNMDIS-------KSPSYWS  269

Query  983   HICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSG-NHQ  1159
              +C+  +A LAKE++T+RRVL+P+   FDN  +W P+ G+A  VL  L   +E SG N  
Sbjct  270   MVCLCNIAKLAKETTTVRRVLEPLLNAFDNGNYWSPQKGVASSVLLFLQSRLEESGENCH  329

Query  1160  LILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKSLQ  1339
             ++++ +++HLDHKNV     ++  ++  AT L    +     +    ++DL +HLRK LQ
Sbjct  330   VLVSSLIKHLDHKNVTKQQGLQVSMVNVATCLVLHAKQQASCAMTAVIADLIKHLRKCLQ  389

Query  1340  --ATVDLAGEEINLNLTL  1387
               A  DL+ +E   N  L
Sbjct  390   NAAESDLSADETKENSEL  407



>emb|CDX79909.1| BnaA05g02470D [Brassica napus]
Length=970

 Score =   228 bits (582),  Expect(2) = 3e-79, Method: Compositional matrix adjust.
 Identities = 104/215 (48%), Positives = 145/215 (67%), Gaps = 0/215 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG  SRK+ P C  +CI CP LR RSRQ VKRYKKL+ADIFP+  + + N RKI KLC+Y
Sbjct  1    MGAFSRKVVPVCGRLCIFCPGLRPRSRQAVKRYKKLIADIFPRHQEEAPNDRKIGKLCDY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            AAKN  R+P+I+  LE+RCYKELR+ +     ++  +Y  LL  CKEQM  F+   L  V
Sbjct  61   AAKNAIRMPEISDLLEQRCYKELRNENFHSAKIVMCIYRRLLVTCKEQMPLFSSGFLRTV  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
              +LD  +   ++ +GC +  +F+ +Q DG+  +N+E  +QK+C LA E G++D+ R LR
Sbjct  121  QALLDQTRQVEMQIVGCQSLFEFVNNQEDGSSLFNLEGFLQKLCQLALEVGDDDRSRSLR  180

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNY  789
            A+ L+ LSAM+W M E+SHI +DFD +V   L+NY
Sbjct  181  AAGLQALSAMIWLMGEYSHIPSDFDIVVSGVLENY  215


 Score = 96.3 bits (238),  Expect(2) = 3e-79, Method: Compositional matrix adjust.
 Identities = 55/183 (30%), Positives = 98/183 (54%), Gaps = 6/183 (3%)
 Frame = +2

Query  842   WVDEVIRSEGRDVGNENRPGYLIRKRPDKKDISLLTSEEIEMPKIWAHICIQRMADLAKE  1021
             WVDEV+++EG        P +      DK ++++   + +  P  W+ +C+  MA L ++
Sbjct  231   WVDEVLKNEGHANSLIIVPSWRTVVN-DKSELNVKMEDSLA-PSFWSKVCVHNMAKLGED  288

Query  1022  SSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSGNH-QLILTGVVRHLDHK  1198
             ++TMRR+L  +F +FD    W   + +A  VL DL + +E SG     IL+ + +HLDHK
Sbjct  289   ATTMRRILQSLFRYFDEGHLWSTENSIALPVLRDLQFLMELSGQRTHFILSMLTKHLDHK  348

Query  1199  NVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKSLQA---TVDLAGEEI  1369
             +V     ++  +++  ++LA   +     + +  +SD+ RHLRK + +    V+L  E  
Sbjct  349   SVLKQPSMQLSILEVTSSLAENAKVEHSAAIVSAISDIMRHLRKCMHSFLHEVNLGTEVA  408

Query  1370  NLN  1378
             N N
Sbjct  409   NSN  411



>ref|NP_563755.1| ARM repeat superfamily protein [Arabidopsis thaliana]
 gb|AEE27923.1| ARM repeat superfamily protein [Arabidopsis thaliana]
Length=982

 Score =   221 bits (563),  Expect(2) = 1e-77, Method: Compositional matrix adjust.
 Identities = 100/215 (47%), Positives = 152/215 (71%), Gaps = 0/215 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG++SR++ PAC ++C  CP+LR+RSR PVKRYKK+LA+IFP++ +   N RKI KLCEY
Sbjct  1    MGVMSRRVLPACGNLCFFCPSLRARSRHPVKRYKKMLAEIFPRNQEAEPNDRKIGKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            A++NP RIPKI + LE++CYKELR+G+   V V+  +Y +LL  CKEQM  F+ +LL++V
Sbjct  61   ASRNPLRIPKITEYLEQKCYKELRNGNIGSVKVVLCIYKKLLSSCKEQMPLFSCSLLSIV  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
              +L+  K + V+ +GC T   FI  Q   ++ +N+E L+ K+C LA+E G++++   LR
Sbjct  121  RTLLEQTKEEEVQILGCNTLVDFISLQTVNSHMFNLEGLIPKLCQLAQEMGDDERSLQLR  180

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNY  789
            ++ ++ L+ MV F+ E S +  D D I+ V L+NY
Sbjct  181  SAGMQALAFMVSFIGEHSQLSMDLDMIISVILENY  215


 Score = 98.2 bits (243),  Expect(2) = 1e-77, Method: Compositional matrix adjust.
 Identities = 55/179 (31%), Positives = 99/179 (55%), Gaps = 10/179 (6%)
 Frame = +2

Query  812   DDERGEAHHNWVDEVIRSEGRDVGNEN--RPGYLIRKRPDKKDISLLTSEEIEMPKIWAH  985
             D E+G+     VD++  ++  ++  +   +P  +   + +  DIS       + P  W+ 
Sbjct  217   DLEKGQEDTKEVDQISDTKIPNMTKKVSFKPNPVTDYKLENMDIS-------KSPSYWSM  269

Query  986   ICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSG-NHQL  1162
             +C+  +A LAKE++T+RRVL+P+   FD+  +W P+ G+A  VL  L   +E SG N  +
Sbjct  270   VCLCNIAKLAKETTTVRRVLEPLLTAFDSGDYWSPQKGVASSVLLFLQSRLEESGENCHV  329

Query  1163  ILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKSLQ  1339
             +++ +++HLDHKNV     ++  ++  AT LA   +     +    ++DL +HLRK LQ
Sbjct  330   LVSSLIKHLDHKNVIKQQGLQINMVNVATCLALHAKQQASGAMTAVIADLIKHLRKCLQ  388



>gb|AAK56279.1|AF367291_1 At1g05960/T21E18_20 [Arabidopsis thaliana]
 gb|AAN72256.1| At1g05960/T21E18_20 [Arabidopsis thaliana]
Length=731

 Score =   221 bits (562),  Expect(2) = 2e-77, Method: Compositional matrix adjust.
 Identities = 100/215 (47%), Positives = 152/215 (71%), Gaps = 0/215 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG++SR++ PAC ++C  CP+LR+RSR PVKRYKK+LA+IFP++ +   N RKI KLCEY
Sbjct  1    MGVMSRRVLPACGNLCFFCPSLRARSRHPVKRYKKMLAEIFPRNQEAEPNDRKIGKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            A++NP RIPKI + LE++CYKELR+G+   V V+  +Y +LL  CKEQM  F+ +LL++V
Sbjct  61   ASRNPLRIPKITEYLEQKCYKELRNGNIGSVKVVLCIYKKLLSSCKEQMPLFSCSLLSIV  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
              +L+  K + V+ +GC T   FI  Q   ++ +N+E L+ K+C LA+E G++++   LR
Sbjct  121  RTLLEQTKEEEVQILGCNTLVDFISLQTVNSHMFNLEGLIPKLCQLAQEMGDDERSLQLR  180

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNY  789
            ++ ++ L+ MV F+ E S +  D D I+ V L+NY
Sbjct  181  SAGMQALAFMVSFIGEHSQLSMDLDMIISVILENY  215


 Score = 98.2 bits (243),  Expect(2) = 2e-77, Method: Compositional matrix adjust.
 Identities = 55/179 (31%), Positives = 99/179 (55%), Gaps = 10/179 (6%)
 Frame = +2

Query  812   DDERGEAHHNWVDEVIRSEGRDVGNEN--RPGYLIRKRPDKKDISLLTSEEIEMPKIWAH  985
             D E+G+     VD++  ++  ++  +   +P  +   + +  DIS       + P  W+ 
Sbjct  217   DLEKGQEDTKEVDQISDTKIPNMTKKVSFKPNPVTDYKLENMDIS-------KSPSYWSM  269

Query  986   ICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSG-NHQL  1162
             +C+  +A LAKE++T+RRVL+P+   FD+  +W P+ G+A  VL  L   +E SG N  +
Sbjct  270   VCLCNIAKLAKETTTVRRVLEPLLTAFDSGDYWSPQKGVASSVLLFLQSRLEESGENCHV  329

Query  1163  ILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKSLQ  1339
             +++ +++HLDHKNV     ++  ++  AT LA   +     +    ++DL +HLRK LQ
Sbjct  330   LVSSLIKHLDHKNVIKQQGLQINMVNVATCLALHAKQQASGAMTAVIADLIKHLRKCLQ  388



>gb|AAF80120.1|AC024174_2 Contains similarity to an unknown protein T11A7.7 gi|2335096 
from Arabidopsis thaliana BAC T11A7 gb|AC002339 and contains 
a tropomyosin PF|00261 domain. ESTs gb|AI995205, gb|N37925, 
gb|F13889, gb|AV523107, gb|AV535948, gb|AV558461, gb|F13888 
come from this gene [Arabidopsis thaliana]
Length=1628

 Score =   220 bits (560),  Expect(2) = 3e-77, Method: Compositional matrix adjust.
 Identities = 100/215 (47%), Positives = 152/215 (71%), Gaps = 0/215 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG++SR++ PAC ++C  CP+LR+RSR PVKRYKK+LA+IFP++ +   N RKI KLCEY
Sbjct  1    MGVMSRRVLPACGNLCFFCPSLRARSRHPVKRYKKMLAEIFPRNQEAEPNDRKIGKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            A++NP RIPKI + LE++CYKELR+G+   V V+  +Y +LL  CKEQM  F+ +LL++V
Sbjct  61   ASRNPLRIPKITEYLEQKCYKELRNGNIGSVKVVLCIYKKLLSSCKEQMPLFSCSLLSIV  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
              +L+  K + V+ +GC T   FI  Q   ++ +N+E L+ K+C LA+E G++++   LR
Sbjct  121  RTLLEQTKEEEVQILGCNTLVDFISLQTVNSHMFNLEGLIPKLCQLAQEMGDDERSLQLR  180

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNY  789
            ++ ++ L+ MV F+ E S +  D D I+ V L+NY
Sbjct  181  SAGMQALAFMVSFIGEHSQLSMDLDMIISVILENY  215


 Score = 97.8 bits (242),  Expect(2) = 3e-77, Method: Compositional matrix adjust.
 Identities = 55/179 (31%), Positives = 99/179 (55%), Gaps = 10/179 (6%)
 Frame = +2

Query  812   DDERGEAHHNWVDEVIRSEGRDVGNEN--RPGYLIRKRPDKKDISLLTSEEIEMPKIWAH  985
             D E+G+     VD++  ++  ++  +   +P  +   + +  DIS       + P  W+ 
Sbjct  217   DLEKGQEDTKEVDQISDTKIPNMTKKVSFKPNPVTDYKLENMDIS-------KSPSYWSM  269

Query  986   ICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSG-NHQL  1162
             +C+  +A LAKE++T+RRVL+P+   FD+  +W P+ G+A  VL  L   +E SG N  +
Sbjct  270   VCLCNIAKLAKETTTVRRVLEPLLTAFDSGDYWSPQKGVASSVLLFLQSRLEESGENCHV  329

Query  1163  ILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKSLQ  1339
             +++ +++HLDHKNV     ++  ++  AT LA   +     +    ++DL +HLRK LQ
Sbjct  330   LVSSLIKHLDHKNVIKQQGLQINMVNVATCLALHAKQQASGAMTAVIADLIKHLRKCLQ  388



>gb|KHG08769.1| Protein EFR3 B [Gossypium arboreum]
Length=1010

 Score =   201 bits (511),  Expect(2) = 1e-76, Method: Compositional matrix adjust.
 Identities = 95/214 (44%), Positives = 141/214 (66%), Gaps = 16/214 (7%)
 Frame = +1

Query  148  GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  327
            G++SR++ PAC S+C  CP+LR+RSRQPVKRYK L+ADIFP+  +   N RKI KLCEYA
Sbjct  6    GVISRQVMPACGSLCFFCPSLRTRSRQPVKRYKVLIADIFPRKKEDGPNDRKIGKLCEYA  65

Query  328  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  507
            +KNP RIPKI + LE+RCYKELR+ + + V ++  +Y  LL  C +QM  F+ +L +++ 
Sbjct  66   SKNPLRIPKITESLEQRCYKELRNENFQSVKIVICIYKRLLVSCHDQMTLFSSSLQSIIQ  125

Query  508  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRA  687
             +LD  + D ++ +GC T   F+ +Q D    +N+E  + KVC LA+ETGE ++++ LRA
Sbjct  126  TLLDQTRQDEMQILGCQTLFDFVNNQKDSNCMFNLEGFIPKVCQLAQETGEGEREKNLRA  185

Query  688  SSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNY  789
            + L+ +S+M                +V V L+NY
Sbjct  186  AGLQAISSM----------------MVSVVLENY  203


 Score =   114 bits (286),  Expect(2) = 1e-76, Method: Compositional matrix adjust.
 Identities = 68/204 (33%), Positives = 111/204 (54%), Gaps = 16/204 (8%)
 Frame = +2

Query  800   PINEDDERGEAHHNWVDEVIRSEGRDVGNENRPGYLIRKRP-------DKKDISLLTSEE  958
             P+   +E       WV EV + E R   + N    ++ K P       DK ++++ T E+
Sbjct  206   PMKNLEENNSGQSRWVQEVQKIESRMSPSPN----VLAKVPSWRTIVNDKGELNVAT-ED  260

Query  959   IEMPKIWAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFV  1138
                P  W+ +C+  MA LAKE++T RR+ + +F +FDN K W   +GLA  VL ++   +
Sbjct  261   ARNPSFWSRVCLHNMAKLAKEATTARRIFESIFRYFDNEKLWSVHNGLALPVLREMQLLI  320

Query  1139  ESSG-NHQLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLC  1315
             +SSG N   +L+ +V+HLDHKNV     ++  +++  T LAR  +     + +G VSD+ 
Sbjct  321   DSSGQNAHYLLSILVKHLDHKNVLKQPDMQLQIVEVTTYLARDSKVEPSVAILGAVSDVM  380

Query  1316  RHLRKSLQATV---DLAGEEINLN  1378
             R LRKS+  ++   ++  E IN N
Sbjct  381   RQLRKSIHCSLNDSNMGTEVINWN  404



>ref|XP_010932401.1| PREDICTED: uncharacterized protein LOC105053077 isoform X1 [Elaeis 
guineensis]
Length=797

 Score =   266 bits (680),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 123/216 (57%), Positives = 159/216 (74%), Gaps = 0/216 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG++SRK+ PAC S+C  CP+LR+RSRQPVKRYKKLL+DIFP+S D   N RKI KLCEY
Sbjct  1    MGVMSRKVLPACGSLCFFCPSLRARSRQPVKRYKKLLSDIFPRSQDEEPNDRKIGKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            A+KNP RIPKI   LE+RCYKELR  H   V V+  +Y +LL  CKEQM  FA +LL ++
Sbjct  61   ASKNPLRIPKITNYLEQRCYKELRIEHFGSVKVVMCIYRKLLISCKEQMPLFASSLLTII  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
              +LD  + D ++ IG  TF  F+ SQ DGTY +N+E ++ K+C LA+E GE+++   LR
Sbjct  121  CTLLDQTRQDEMRIIGSHTFFDFVNSQRDGTYMFNLEGIIPKLCYLAQEMGEDERAHNLR  180

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNYE  792
            A+ LR LS+MVWFM E+SHI A+FD +V V L+NYE
Sbjct  181  AAGLRALSSMVWFMGEYSHISAEFDNVVSVALENYE  216


 Score =   117 bits (294),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 62/149 (42%), Positives = 94/149 (63%), Gaps = 4/149 (3%)
 Frame = +2

Query  944   LTSEEIEMPKIWAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSD  1123
             LT EE + P  W+ +C+  MA LAKE++T+RRVL+ +F +FD+   W PR+ LA  VL D
Sbjct  272   LTVEEDKSPSFWSRVCVHNMAKLAKEATTVRRVLESLFRYFDSCNLWSPRNRLALCVLLD  331

Query  1124  LSYFVESSG-NHQLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGF  1300
             +   +E+SG N  L+L+ +V+HL+HK V     ++  +I+  T LA Q ++    + IG 
Sbjct  332   MQIVMENSGQNTHLLLSILVKHLEHKTVLKQPDMQLNIIEVTTCLAAQSKAQSSVAIIGA  391

Query  1301  VSDLCRHLRKSLQAT---VDLAGEEINLN  1378
             +SDL RHLR+S+Q T   +DL  + I  N
Sbjct  392   ISDLLRHLRRSMQCTLSKLDLGDDMIKWN  420



>gb|KJB46322.1| hypothetical protein B456_007G360200 [Gossypium raimondii]
Length=987

 Score =   196 bits (499),  Expect(2) = 8e-76, Method: Compositional matrix adjust.
 Identities = 92/214 (43%), Positives = 133/214 (62%), Gaps = 29/214 (14%)
 Frame = +1

Query  148  GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  327
            G++SR++ PAC S+C  CP+LR+RSRQPVKRYK L+ADIFP+  +   N RKI KLCEYA
Sbjct  6    GVISRQVMPACGSLCFFCPSLRTRSRQPVKRYKALIADIFPRKKEDGPNDRKIGKLCEYA  65

Query  328  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  507
            +KNP RIPKI + LE+RCYKELR+ + + V ++  +Y  LL  C +QM  F+ +L +++ 
Sbjct  66   SKNPLRIPKITESLEQRCYKELRNENFQSVKIVICIYKRLLVSCHDQMTLFSSSLQSIIQ  125

Query  508  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRA  687
             +LD  + D ++ +GC T   F+ +Q                             + LRA
Sbjct  126  TLLDQTRQDEMQILGCQTLFDFVNNQ-----------------------------KNLRA  156

Query  688  SSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNY  789
            + L+ +S+M+WFM E SHI  +FD +V V L+NY
Sbjct  157  AGLQAISSMIWFMGEHSHISVEFDNMVSVVLENY  190


 Score =   117 bits (292),  Expect(2) = 8e-76, Method: Compositional matrix adjust.
 Identities = 70/204 (34%), Positives = 112/204 (55%), Gaps = 16/204 (8%)
 Frame = +2

Query  800   PINEDDERGEAHHNWVDEVIRSEGRDVGNENRPGYLIRKRP-------DKKDISLLTSEE  958
             P+   +E       WV EV + E R       P +L  K P       +K ++++ T E+
Sbjct  193   PMKNLEENNSGQSRWVQEVQKIESR---MSPLPNFLT-KVPSWRTIVNEKGELNVAT-ED  247

Query  959   IEMPKIWAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFV  1138
                P  W+ +C+  MA LAKE++T RR+ + MF +FDN K W   +GLA  VL ++   +
Sbjct  248   ARNPSFWSRVCLHNMAKLAKEATTARRIFESMFRYFDNEKLWSVHNGLALPVLREMQLLI  307

Query  1139  ESSG-NHQLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLC  1315
             +SSG N   +L+ +V+HLDHKNV     ++  +++  T+LAR  +     + +G VSD+ 
Sbjct  308   DSSGQNAHYLLSILVKHLDHKNVLKQPDMQLQIVEVTTSLARDSKVEPSVAILGAVSDVM  367

Query  1316  RHLRKSLQATV---DLAGEEINLN  1378
             RHLRKS+  ++   ++  E IN N
Sbjct  368   RHLRKSIHCSLNDSNMGTEVINWN  391



>ref|XP_003591099.1| EFR3-like protein [Medicago truncatula]
Length=210

 Score =   247 bits (631),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 129/204 (63%), Positives = 151/204 (74%), Gaps = 19/204 (9%)
 Frame = +1

Query  154  LSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAK  333
            +S +L  AC      CPALRSRSRQPVK Y+KLLADIFPKSP    N RKI+KLCEYAAK
Sbjct  14   ISSQLVRAC---VFTCPALRSRSRQPVKCYRKLLADIFPKSP--LPNERKIVKLCEYAAK  68

Query  334  NPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVVEM  513
            NP RIPKIAK LEERCYKELRS H KLV +IAE +N+LL +CK Q+  FAV++LNV  E+
Sbjct  69   NPLRIPKIAKYLEERCYKELRSEHIKLVKIIAESFNKLLSICKAQITYFAVDVLNVTSEL  128

Query  514  LDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASS  693
            LD +K +A+              QVD TYT+NIE LV+KVC L++E GE  +  CLRASS
Sbjct  129  LDYSKDEAI--------------QVDSTYTHNIEKLVRKVCMLSQEPGETHENGCLRASS  174

Query  694  LRCLSAMVWFMAEFSHIFADFDEI  765
            L+CLSAMVW M EFSHIFADFDE+
Sbjct  175  LQCLSAMVWLMTEFSHIFADFDEV  198



>ref|XP_007031157.1| Uncharacterized protein isoform 3, partial [Theobroma cacao]
 gb|EOY11659.1| Uncharacterized protein isoform 3, partial [Theobroma cacao]
Length=740

 Score =   259 bits (662),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 123/197 (62%), Positives = 157/197 (80%), Gaps = 5/197 (3%)
 Frame = +2

Query  809   EDDERGEAHHNWVDEVIRSEGRD--VGNENRPG-YLIRKRPDKKDISLLTSEEIEMPKIW  979
             +D+ERGE HHNWVDEV+R EGR   V  +  P   +IR +P+KKD SLLT EE E PK+W
Sbjct  30    DDNERGEPHHNWVDEVVRCEGRGAIVARDASPSNMIIRPQPEKKDPSLLTREETETPKVW  89

Query  980   AHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSGNHQ  1159
             A ICIQRM +LAKES+T+R++LDPMF++FD+ +HWV + GLA VVLSD+SY+ E+SG+ Q
Sbjct  90    AQICIQRMVELAKESTTLRQILDPMFVYFDSRQHWVSQQGLAMVVLSDMSYW-EASGDQQ  148

Query  1160  LILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKSLQ  1339
             LIL  V+RHLDHKNVA D Q+KS+++Q A ALARQIRS G  ++IGFVSDLCRHLRKS Q
Sbjct  149   LILAAVIRHLDHKNVAHDPQLKSYIVQVAAALARQIRSRGVLAEIGFVSDLCRHLRKSFQ  208

Query  1340  ATVDLAGE-EINLNLTL  1387
             A ++  GE E++LN+ L
Sbjct  209   ANLESVGEQELDLNILL  225



>ref|NP_001154308.1| ARM repeat superfamily protein [Arabidopsis thaliana]
 gb|AEE27924.1| ARM repeat superfamily protein [Arabidopsis thaliana]
Length=1003

 Score =   208 bits (529),  Expect(2) = 1e-73, Method: Compositional matrix adjust.
 Identities = 99/236 (42%), Positives = 153/236 (65%), Gaps = 21/236 (9%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG++SR++ PAC ++C  CP+LR+RSR PVKRYKK+LA+IFP++ +   N RKI KLCEY
Sbjct  1    MGVMSRRVLPACGNLCFFCPSLRARSRHPVKRYKKMLAEIFPRNQEAEPNDRKIGKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMAC---------  477
            A++NP RIPKI + LE++CYKELR+G+   V V+  +Y +LL  CKEQ++          
Sbjct  61   ASRNPLRIPKITEYLEQKCYKELRNGNIGSVKVVLCIYKKLLSSCKEQISSEIMLTFFFL  120

Query  478  ------------FAVNLLNVVVEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENL  621
                        F+ +LL++V  +L+  K + V+ +GC T   FI  Q   ++ +N+E L
Sbjct  121  VARSFTFEFLPLFSCSLLSIVRTLLEQTKEEEVQILGCNTLVDFISLQTVNSHMFNLEGL  180

Query  622  VQKVCSLARETGEEDQKRCLRASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNY  789
            + K+C LA+E G++++   LR++ ++ L+ MV F+ E S +  D D I+ V L+NY
Sbjct  181  IPKLCQLAQEMGDDERSLQLRSAGMQALAFMVSFIGEHSQLSMDLDMIISVILENY  236


 Score = 98.2 bits (243),  Expect(2) = 1e-73, Method: Compositional matrix adjust.
 Identities = 55/179 (31%), Positives = 99/179 (55%), Gaps = 10/179 (6%)
 Frame = +2

Query  812   DDERGEAHHNWVDEVIRSEGRDVGNE--NRPGYLIRKRPDKKDISLLTSEEIEMPKIWAH  985
             D E+G+     VD++  ++  ++  +   +P  +   + +  DIS       + P  W+ 
Sbjct  238   DLEKGQEDTKEVDQISDTKIPNMTKKVSFKPNPVTDYKLENMDIS-------KSPSYWSM  290

Query  986   ICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSG-NHQL  1162
             +C+  +A LAKE++T+RRVL+P+   FD+  +W P+ G+A  VL  L   +E SG N  +
Sbjct  291   VCLCNIAKLAKETTTVRRVLEPLLTAFDSGDYWSPQKGVASSVLLFLQSRLEESGENCHV  350

Query  1163  ILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKSLQ  1339
             +++ +++HLDHKNV     ++  ++  AT LA   +     +    ++DL +HLRK LQ
Sbjct  351   LVSSLIKHLDHKNVIKQQGLQINMVNVATCLALHAKQQASGAMTAVIADLIKHLRKCLQ  409



>ref|XP_012065587.1| PREDICTED: uncharacterized protein LOC105628722 [Jatropha curcas]
Length=1033

 Score =   260 bits (665),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 112/217 (52%), Positives = 154/217 (71%), Gaps = 0/217 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            M  +S ++ P C+ +C  CP LR+RSRQP+KRYKKLL+DIFP++PD   N RKI KLCEY
Sbjct  1    MSTMSSQVMPVCDILCFFCPGLRTRSRQPIKRYKKLLSDIFPRTPDEQVNDRKIGKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            AA+NP RIPKI   LE+RCYK+LR+   + V ++  +Y +LL  CKEQM  FA +LL+++
Sbjct  61   AARNPLRIPKITSSLEQRCYKDLRTEQFQSVRIVMSIYRKLLVSCKEQMPLFASSLLSII  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
              +LD  + D ++ +GC T   F+ +Q DGTY +N++ L+ K+C L +E GE  +   +R
Sbjct  121  HILLDQTRHDGIRILGCQTLFDFVNNQTDGTYVFNLDGLIPKLCHLVQEIGEPGRIEDIR  180

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNYEP  795
             + L+ LS+MVWFM EFSHI ADFD +V V LDNYEP
Sbjct  181  TAGLQALSSMVWFMGEFSHISADFDTVVSVVLDNYEP  217


 Score =   119 bits (297),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 56/145 (39%), Positives = 94/145 (65%), Gaps = 3/145 (2%)
 Frame = +2

Query  944   LTSEEIEMPKIWAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSD  1123
             ++ E+++ P  W+ +C+  MA LAKE++T+RRVL+ +F +FD+   W P+HGLA  VL D
Sbjct  260   ISQEDLKNPTFWSKVCLHNMAQLAKEATTVRRVLESLFRYFDDGDLWSPQHGLALSVLLD  319

Query  1124  LSYFVESSGNH-QLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGF  1300
             +   +E +G     +L+ +++HLDHKNV     ++  ++  AT+LA+Q +     + IG 
Sbjct  320   MQLVIEKTGQKTHFVLSILIKHLDHKNVLKKPNMQLDIVNVATSLAQQTKVQPSVAIIGA  379

Query  1301  VSDLCRHLRKSLQATVDLA--GEEI  1369
             +SD+ RHLRKS+  ++D A  G E+
Sbjct  380   LSDMMRHLRKSIHCSLDDAKLGTEV  404



>ref|XP_010241226.1| PREDICTED: uncharacterized protein LOC104585894 isoform X1 [Nelumbo 
nucifera]
Length=1005

 Score =   259 bits (662),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 115/215 (53%), Positives = 158/215 (73%), Gaps = 0/215 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG++SRK+ P C S+C  CPALR+RSRQPVKRYKKL+A+IFP+S D   N RKI KLCEY
Sbjct  1    MGVMSRKVLPVCGSLCFFCPALRARSRQPVKRYKKLIAEIFPRSQDEEPNDRKISKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            A+KNP RIPKI   LE+RCYKELR+    L  V+  +Y +LL  CK+QM  FA +LL+++
Sbjct  61   ASKNPMRIPKITSTLEQRCYKELRNEQFWLAKVVMCIYRKLLISCKDQMPLFASSLLSII  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
              +LD  + D ++ IGC T   F+ +Q DGTY +N+E ++ K+C L++E G++++   LR
Sbjct  121  NILLDQTRQDEIRIIGCQTLFDFVNNQTDGTYMFNLEGMIPKLCMLSQEVGQDERAEQLR  180

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNY  789
            ++ L+ LS+MVWFM E+SHI A+FD +V V LDNY
Sbjct  181  SAGLQALSSMVWFMGEYSHISAEFDNVVSVILDNY  215


 Score =   105 bits (262),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 51/138 (37%), Positives = 89/138 (64%), Gaps = 1/138 (1%)
 Frame = +2

Query  941   LLTSEEIEMPKIWAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLS  1120
             ++T E  + P+ W+ +C+  +  LAKE++T+RRVL+ +F +FD+   W P HG+A  VLS
Sbjct  255   IVTVENAKNPQFWSRVCLHNVTKLAKEATTVRRVLESLFRYFDSGNLWSPTHGVALSVLS  314

Query  1121  DLSYFVESSG-NHQLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIG  1297
             ++   +E SG N  L+L+ +++HLDHKNV     I+  +++ AT+L++  +     + I 
Sbjct  315   NMQSLMEDSGQNTHLLLSILIKHLDHKNVLKQPDIQLNILEVATSLSKHTKVQASVAIIA  374

Query  1298  FVSDLCRHLRKSLQATVD  1351
               SDL +HLRKS+  +++
Sbjct  375   AASDLMKHLRKSIHCSLN  392



>ref|XP_006858684.1| PREDICTED: uncharacterized protein LOC18448561 [Amborella trichopoda]
 gb|ERN20151.1| hypothetical protein AMTR_s00066p00085830 [Amborella trichopoda]
Length=1020

 Score =   259 bits (661),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 119/216 (55%), Positives = 158/216 (73%), Gaps = 0/216 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG++SR++ P C S+C  CP+LR+RSRQPVKRYKKLLADIFP+S D   N RKI KLCEY
Sbjct  1    MGVMSRRVLPVCGSLCFFCPSLRARSRQPVKRYKKLLADIFPRSQDAEPNDRKICKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            AAKNP RIPKI K LE+RCY+ELR+ H   V V+  +Y +LL   KEQM  FA +LL+++
Sbjct  61   AAKNPLRIPKITKYLEQRCYRELRNEHFGSVKVVLCIYRKLLASSKEQMPLFASSLLSII  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
              +L+  + D +  +GC T   FI SQVDGTY +N+E L+ K+C L++E GE+++   LR
Sbjct  121  RTLLEQTQQDEMLILGCNTLVDFINSQVDGTYMFNLEGLIPKLCQLSQEVGEDERAHNLR  180

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNYE  792
            ++ L+ ++ MVWFM E SHI  DFD+IV V L+NYE
Sbjct  181  SAGLQAIAFMVWFMGECSHISVDFDDIVSVILENYE  216


 Score =   114 bits (284),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 59/138 (43%), Positives = 92/138 (67%), Gaps = 3/138 (2%)
 Frame = +2

Query  968   PKIWAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESS  1147
             PK W+ IC+  MA L+KE++T+RRVL+P+F +FD   HW P++GLAF+VL D+   +E  
Sbjct  273   PKYWSRICLHNMAKLSKEATTIRRVLEPLFRYFDKGNHWSPQNGLAFMVLLDMLLLMEKL  332

Query  1148  G-NHQLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHL  1324
             G N   +L+ +++HLDHKNVA +  ++  +I   T L++  +     + IG +SDL RHL
Sbjct  333   GQNTHFLLSLLIKHLDHKNVAKEPNLQVDIIGVTTRLSQYSKLQASVAIIGAISDLMRHL  392

Query  1325  RKSLQATVDLA--GEEIN  1372
             RKS+Q + +    G++IN
Sbjct  393   RKSMQCSFEATNLGDDIN  410



>ref|XP_008231409.1| PREDICTED: uncharacterized protein LOC103330592 [Prunus mume]
Length=1053

 Score =   259 bits (661),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 115/215 (53%), Positives = 161/215 (75%), Gaps = 0/215 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG++SR++FP CES+C  CPALR+RSR PVKRYKKLLA+IFP+SPD   N RKI KLCEY
Sbjct  1    MGVISRQVFPVCESLCFFCPALRARSRHPVKRYKKLLAEIFPRSPDEEPNDRKISKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            A+K P RIPKI   LE+RCYK+LR+ +   V V+  +Y +LL  CKEQM  FA ++L++V
Sbjct  61   ASKTPLRIPKITTTLEQRCYKDLRTENFHSVKVVMCIYRKLLVSCKEQMPLFASSVLSIV  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
              +LD ++ D ++ +GC T  +F+ +Q DGTY +N++ ++ K+C LA+E  E+  ++ LR
Sbjct  121  QILLDQSRHDEIRILGCQTLFEFVNNQKDGTYMFNLDGMIPKLCLLAQEMREDGSEKHLR  180

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNY  789
            ++ L+ LS+MVWFM EFSHI +DFD +V V L+NY
Sbjct  181  SAGLKTLSSMVWFMGEFSHISSDFDNVVSVVLENY  215


 Score =   122 bits (306),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 58/149 (39%), Positives = 95/149 (64%), Gaps = 4/149 (3%)
 Frame = +2

Query  944   LTSEEIEMPKIWAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSD  1123
             ++ E++  P+ W+ +C+  +A LAKE++T+RRVL+ +F +FDN   W P+HGLA  VL D
Sbjct  265   VSGEDMNNPRFWSRVCLHNIAKLAKEATTVRRVLESLFRYFDNGNLWSPKHGLALCVLMD  324

Query  1124  LSYFVESSG-NHQLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGF  1300
             +   +E+ G N   IL+ +++HLDHKNV  +  ++  ++  AT+L R+ +     + IG 
Sbjct  325   MQLIIENCGQNRHFILSILIKHLDHKNVLKNPNMQLDIVDVATSLTREAKVQSSVAIIGA  384

Query  1301  VSDLCRHLRKSLQATVD---LAGEEINLN  1378
             +SD+ RHLRKS+  ++D   L  E I  N
Sbjct  385   LSDMMRHLRKSIHCSLDDSNLGAEVIEWN  413



>ref|XP_007218911.1| hypothetical protein PRUPE_ppa000649mg [Prunus persica]
 gb|EMJ20110.1| hypothetical protein PRUPE_ppa000649mg [Prunus persica]
Length=1052

 Score =   258 bits (660),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 115/215 (53%), Positives = 161/215 (75%), Gaps = 0/215 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG++SR++FP CES+C  CPALR+RSR PVKRYKKLLA+IFP+SPD   N RKI KLCEY
Sbjct  1    MGVISRQVFPVCESLCFFCPALRARSRHPVKRYKKLLAEIFPRSPDEEPNDRKISKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            A+K P RIPKI   LE+RCYK+LR+ +   V V+  +Y +LL  CKEQM  FA ++L++V
Sbjct  61   ASKTPLRIPKITTTLEQRCYKDLRTENFHSVKVVMCIYRKLLVSCKEQMPLFASSVLSIV  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
              +LD ++ D ++ +GC T  +F+ +Q DGTY +N++ ++ K+C LA+E  E+  ++ LR
Sbjct  121  QILLDQSRHDDIRILGCQTLFEFVNNQKDGTYMFNLDGMIPKLCLLAQEMREDGSEKHLR  180

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNY  789
            ++ L+ LS+MVWFM EFSHI +DFD +V V L+NY
Sbjct  181  SAGLKTLSSMVWFMGEFSHISSDFDNVVSVVLENY  215


 Score =   122 bits (306),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 54/137 (39%), Positives = 91/137 (66%), Gaps = 1/137 (1%)
 Frame = +2

Query  944   LTSEEIEMPKIWAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSD  1123
             ++ E++  P+ W+ +C+  +A LAKE++T+RRVL+ +F +FDN   W P+HGLA  VL D
Sbjct  265   VSGEDMNNPRFWSRVCMHNIAKLAKEATTVRRVLESLFRYFDNGNLWSPKHGLALCVLMD  324

Query  1124  LSYFVESSG-NHQLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGF  1300
             +   +E+ G N   IL+ +++HLDHKNV  +  ++  ++  AT+L R+ +     + IG 
Sbjct  325   MQLIIENCGQNRHFILSILIKHLDHKNVLKNPNMQLDIVDVATSLTREAKVQSSVAIIGA  384

Query  1301  VSDLCRHLRKSLQATVD  1351
             +SD+ RHLRKS+  ++D
Sbjct  385   LSDMMRHLRKSIHCSLD  401



>ref|XP_002968494.1| hypothetical protein SELMODRAFT_90004 [Selaginella moellendorffii]
 gb|EFJ30748.1| hypothetical protein SELMODRAFT_90004 [Selaginella moellendorffii]
Length=875

 Score =   254 bits (650),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 118/216 (55%), Positives = 155/216 (72%), Gaps = 1/216 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG++SR++ P C  +C+CCP LR+RSRQPVKRYKKLL+D+FPKS     N RKI KL +Y
Sbjct  1    MGIISRRVLPLCGHLCVCCPGLRARSRQPVKRYKKLLSDLFPKSQAEQPNDRKISKLTDY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            A KNPFRIPKIAK LE R YKELR  H   V VI   + +L   CK+QM   AV+ LN++
Sbjct  61   AVKNPFRIPKIAKNLELRGYKELRHEHYGSVRVIMRTFFKLFSTCKDQMPLLAVSALNMI  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
              +L+  + D ++ +GC+T  +FIY QVD TY +N+++ + K C+LARETG E ++  LR
Sbjct  121  HVLLE-QQNDEMRVLGCVTVVEFIYQQVDTTYMHNLDSFIPKFCALARETGPEPKRSILR  179

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNYE  792
            A+ L+ LSAM+WFM EFSH+ +DFDEIV   L NYE
Sbjct  180  AAGLQALSAMLWFMGEFSHMPSDFDEIVRAVLMNYE  215


 Score =   137 bits (346),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 62/139 (45%), Positives = 94/139 (68%), Gaps = 0/139 (0%)
 Frame = +2

Query  944   LTSEEIEMPKIWAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSD  1123
             LT EE E PK+W+ IC+Q MA L KE++T+R VLD  F +FD+ K W    G+A  VL D
Sbjct  266   LTKEESETPKVWSQICVQNMACLGKETTTIRCVLDAAFNYFDSEKSWSLESGIALPVLRD  325

Query  1124  LSYFVESSGNHQLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFV  1303
             + + +E +GN  L+L  +VRHLDHKNVA +  +K+ +++  T LAR  +     S++G +
Sbjct  326   MVFLMEKTGNDHLVLGALVRHLDHKNVANELPVKTEIVRVTTVLARHSKPKSKHSEVGII  385

Query  1304  SDLCRHLRKSLQATVDLAG  1360
             +DL RHLR+SLQ +++++ 
Sbjct  386   NDLSRHLRRSLQLSLEMSS  404



>ref|XP_002975992.1| hypothetical protein SELMODRAFT_443103 [Selaginella moellendorffii]
 gb|EFJ22897.1| hypothetical protein SELMODRAFT_443103 [Selaginella moellendorffii]
Length=950

 Score =   255 bits (651),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 118/216 (55%), Positives = 155/216 (72%), Gaps = 1/216 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG++SR++ P C  +C+CCP LR+RSRQPVKRYKKLL+D+FPKS     N RKI KL +Y
Sbjct  1    MGIISRRVLPLCGHLCVCCPGLRARSRQPVKRYKKLLSDLFPKSQAEQPNDRKISKLTDY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            A KNPFRIPKIAK LE R YKELR  H   V VI   + +L   CK+QM   AV+ LN++
Sbjct  61   AVKNPFRIPKIAKNLELRGYKELRHEHHGSVRVIMRTFFKLFSTCKDQMPLLAVSALNMI  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
              +L+  + D ++ +GC+T  +FIY QVD TY +N+++ + K C+LARETG E ++  LR
Sbjct  121  HVLLE-QQNDEMRVLGCVTVVEFIYQQVDTTYMHNLDSFIPKFCALARETGPEPKRSILR  179

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNYE  792
            A+ L+ LSAM+WFM EFSH+ +DFDEIV   L NYE
Sbjct  180  AAGLQALSAMLWFMGEFSHMPSDFDEIVRAVLMNYE  215


 Score =   137 bits (346),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 62/139 (45%), Positives = 94/139 (68%), Gaps = 0/139 (0%)
 Frame = +2

Query  944   LTSEEIEMPKIWAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSD  1123
             LT EE E PK+W+ IC+Q MA L KE++T+R VLD  F +FD+ K W    G+A  VL D
Sbjct  266   LTKEESETPKVWSQICVQNMACLGKETTTIRCVLDAAFNYFDSEKSWSLESGIALPVLRD  325

Query  1124  LSYFVESSGNHQLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFV  1303
             + + +E +GN  L+L  +VRHLDHKNVA +  +K+ +++  T LAR  +     S++G +
Sbjct  326   MVFLMEKTGNDHLVLGALVRHLDHKNVANELPVKTEIVRVTTVLARHSKPKSKHSEVGII  385

Query  1304  SDLCRHLRKSLQATVDLAG  1360
             +DL RHLR+SLQ +++++ 
Sbjct  386   NDLSRHLRRSLQLSLEMSS  404



>ref|XP_010523668.1| PREDICTED: protein EFR3 homolog isoform X2 [Tarenaya hassleriana]
Length=1019

 Score =   254 bits (650),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 113/215 (53%), Positives = 154/215 (72%), Gaps = 0/215 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG++SR +FP CES+C  CPALR+RSR PVKRYKKLL+DIFP+SPD   N RKI KLCEY
Sbjct  1    MGVVSRTVFPVCESLCCFCPALRARSRHPVKRYKKLLSDIFPRSPDEQPNDRKISKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            AAKN  RIPKI + LE+RCY++LR      V ++  +Y +LL  CKEQM+ FA + L ++
Sbjct  61   AAKNSLRIPKITRSLEQRCYRDLRMEQFHSVKIVMCIYKKLLVSCKEQMSLFASSYLGLI  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
              +LD  + D ++ +GC     F+ +Q DGT+ +N++ L+  +C LA E GEE++ R LR
Sbjct  121  HILLDQTRHDEIRILGCEALYDFVNNQTDGTHMFNLDGLIPNICPLAHEMGEEERPRNLR  180

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNY  789
            ++ L+ LS+MVWFM EFSHI  +FD +V V L+NY
Sbjct  181  SAGLQALSSMVWFMGEFSHISVEFDNVVSVVLENY  215


 Score =   126 bits (316),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 63/157 (40%), Positives = 102/157 (65%), Gaps = 4/157 (3%)
 Frame = +2

Query  923   DKKDISLLTSEEIEMPKIWAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGL  1102
             D +  ++++ E+ + PK W+ +C+  MA LAKE++T+RRVL+ +F +FDNN+ W    GL
Sbjct  256   DDRGKAVVSVEDAKDPKFWSRVCLHNMAKLAKEATTVRRVLESLFRYFDNNEVWSTVDGL  315

Query  1103  AFVVLSDLSYFVESSG-NHQLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGG  1279
             A +VL D+   +E SG N   +L+ +++HLDHKNV  + +++  ++  ATALARQ +   
Sbjct  316   ALLVLQDMQLLIERSGQNTHFLLSMLIKHLDHKNVLKNPRMQLDIVCVATALARQTKVQP  375

Query  1280  GFSDIGFVSDLCRHLRKSLQATVD---LAGEEINLNL  1381
               + +G +SD+ RHLRKS+  ++D   L  E I  NL
Sbjct  376   SMAIVGALSDMIRHLRKSIHCSLDDSNLGDEMIQYNL  412



>ref|XP_010523667.1| PREDICTED: protein EFR3 homolog isoform X1 [Tarenaya hassleriana]
Length=1028

 Score =   254 bits (650),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 113/215 (53%), Positives = 154/215 (72%), Gaps = 0/215 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG++SR +FP CES+C  CPALR+RSR PVKRYKKLL+DIFP+SPD   N RKI KLCEY
Sbjct  1    MGVVSRTVFPVCESLCCFCPALRARSRHPVKRYKKLLSDIFPRSPDEQPNDRKISKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            AAKN  RIPKI + LE+RCY++LR      V ++  +Y +LL  CKEQM+ FA + L ++
Sbjct  61   AAKNSLRIPKITRSLEQRCYRDLRMEQFHSVKIVMCIYKKLLVSCKEQMSLFASSYLGLI  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
              +LD  + D ++ +GC     F+ +Q DGT+ +N++ L+  +C LA E GEE++ R LR
Sbjct  121  HILLDQTRHDEIRILGCEALYDFVNNQTDGTHMFNLDGLIPNICPLAHEMGEEERPRNLR  180

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNY  789
            ++ L+ LS+MVWFM EFSHI  +FD +V V L+NY
Sbjct  181  SAGLQALSSMVWFMGEFSHISVEFDNVVSVVLENY  215


 Score =   126 bits (316),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 63/157 (40%), Positives = 102/157 (65%), Gaps = 4/157 (3%)
 Frame = +2

Query  923   DKKDISLLTSEEIEMPKIWAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGL  1102
             D +  ++++ E+ + PK W+ +C+  MA LAKE++T+RRVL+ +F +FDNN+ W    GL
Sbjct  256   DDRGKAVVSVEDAKDPKFWSRVCLHNMAKLAKEATTVRRVLESLFRYFDNNEVWSTVDGL  315

Query  1103  AFVVLSDLSYFVESSG-NHQLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGG  1279
             A +VL D+   +E SG N   +L+ +++HLDHKNV  + +++  ++  ATALARQ +   
Sbjct  316   ALLVLQDMQLLIERSGQNTHFLLSMLIKHLDHKNVLKNPRMQLDIVCVATALARQTKVQP  375

Query  1280  GFSDIGFVSDLCRHLRKSLQATVD---LAGEEINLNL  1381
               + +G +SD+ RHLRKS+  ++D   L  E I  NL
Sbjct  376   SMAIVGALSDMIRHLRKSIHCSLDDSNLGDEMIQYNL  412



>ref|XP_004308677.1| PREDICTED: uncharacterized protein LOC101307642 [Fragaria vesca 
subsp. vesca]
Length=1047

 Score =   254 bits (648),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 114/215 (53%), Positives = 157/215 (73%), Gaps = 0/215 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MGL+ R++FP CES+C  CPALR+RSR PVKRYKKLLA+IFP+SPD   N RKI KLCEY
Sbjct  1    MGLIQRQVFPVCESLCFFCPALRARSRHPVKRYKKLLAEIFPRSPDEEPNDRKISKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            A+K P RIPKI   LE+RCYK+LR+ +   V V+  VY +LL  CK+QM  FA +LL +V
Sbjct  61   ASKTPLRIPKITTTLEQRCYKDLRTENFHSVKVVMCVYRKLLISCKDQMPLFASSLLTIV  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
              +LD ++ D ++ +GC T  +F+ +Q DGTY +N+++++ K+C +A+E  E+     +R
Sbjct  121  QILLDQSRHDEMRILGCQTLFEFVNNQKDGTYMFNLDSMIPKLCQIAQEMREDGTAMKVR  180

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNY  789
            A+ L+ LS+MVWFM EFSHI  +FD +V V L+NY
Sbjct  181  AAGLQALSSMVWFMGEFSHISTEFDNVVSVVLENY  215


 Score =   125 bits (314),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 62/156 (40%), Positives = 100/156 (64%), Gaps = 5/156 (3%)
 Frame = +2

Query  923   DKKDISLLTSEEIEMPKIWAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGL  1102
             +K D+++ + E++  P  W+ +C+  +A LAKE++T+RRVLD +F +FDN   W P+HGL
Sbjct  253   EKGDVNV-SGEDLHNPGFWSRVCLYNIAKLAKEATTVRRVLDSLFRYFDNGNLWSPKHGL  311

Query  1103  AFVVLSDLSYFVESSG-NHQLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGG  1279
             A  VL D+   +E+SG N   IL+ +++HLDHKNV  +  ++  ++   T+LAR+ +   
Sbjct  312   ALSVLMDMQLIIENSGQNRHFILSILIKHLDHKNVLKNPNMQLVIVDVVTSLARETKVQS  371

Query  1280  GFSDIGFVSDLCRHLRKSLQATVD---LAGEEINLN  1378
               + IG +SD+ RHLRKS+  ++D   L  E I  N
Sbjct  372   SVAIIGALSDMMRHLRKSIHCSLDDSNLGAEVIEWN  407



>ref|XP_006657548.1| PREDICTED: uncharacterized protein LOC102712271 [Oryza brachyantha]
Length=1071

 Score =   253 bits (647),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 114/217 (53%), Positives = 154/217 (71%), Gaps = 0/217 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG++SRK+ PAC S+C  CPALR+RSRQPVKRYK +LA+IFPK+ D   N R+I KLCEY
Sbjct  1    MGVISRKVLPACGSLCYFCPALRARSRQPVKRYKTILAEIFPKTQDEEPNERRIGKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
             ++NP R+PKI   LE+R YKELR+       V+  +Y  LL  CKEQM  FA +LL++V
Sbjct  61   CSRNPLRVPKITVFLEQRIYKELRTEQYGFAKVVMLIYRRLLVSCKEQMPLFASSLLSIV  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
              +LD  + D ++ IGC T   F  +QVDGTY +N+E LV ++C LA+E GE+++   LR
Sbjct  121  HTLLDQKRQDDMRIIGCETLFDFAVNQVDGTYQFNLEGLVPRLCELAQEVGEDEKTITLR  180

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNYEP  795
            A++L+ +SAM+WFM E SHI ++FD +V V LD Y P
Sbjct  181  AAALQAISAMIWFMGELSHISSEFDNVVQVVLDTYRP  217


 Score =   105 bits (263),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 87/143 (61%), Gaps = 1/143 (1%)
 Frame = +2

Query  944   LTSEEIEMPKIWAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSD  1123
             L  E+ + PK WA I +  MA L++E++T RR+L+ +F +F NN  W P +GLA  VL D
Sbjct  267   LPEEDAKDPKFWARISVHNMARLSREATTFRRILESLFRYFGNNSSWSPENGLALCVLLD  326

Query  1124  LSYFVESSG-NHQLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGF  1300
             +   VE+SG N  L+L+ +++H++HK +    +++  +++ A  LA Q  +    + I  
Sbjct  327   MQLLVENSGQNMHLMLSLLIKHIEHKAMVKQPEMQLSIVEVAATLAEQSIAQASAATISA  386

Query  1301  VSDLCRHLRKSLQATVDLAGEEI  1369
             +SDL RH++++   T+    +E+
Sbjct  387   ISDLVRHMKRTFHITLGSKDQEL  409



>gb|EMS53000.1| Protein EFR3-like protein B [Triticum urartu]
Length=1041

 Score =   253 bits (647),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 114/217 (53%), Positives = 154/217 (71%), Gaps = 0/217 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG++SRK+ PAC ++C  CP LR+RSRQPVKRYKK+LA+IFP++ D   N R+I KLCEY
Sbjct  1    MGVISRKVLPACGALCYFCPGLRARSRQPVKRYKKILAEIFPRTQDEEPNERRIGKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            AAKNP R+PKI   LE+R YKELR+       V+  +Y  LL  CKEQM   A +LL++V
Sbjct  61   AAKNPLRVPKITVYLEQRIYKELRAEQYGFAKVVMLIYRRLLVSCKEQMPLLASSLLSIV  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
              +LD  + D ++ I C T   F  +QVDGTY +N+E LV ++C LA+E GE+++   LR
Sbjct  121  HTLLDQKRQDDMRIIACETLFDFAVNQVDGTYQFNLEGLVPRLCELAQEAGEDERATSLR  180

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNYEP  795
            A+ L+ LSAM+WFM E SHI ++FD +V V L+NY+P
Sbjct  181  AAGLQALSAMIWFMGELSHISSEFDNVVEVVLENYKP  217


 Score = 95.9 bits (237),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 52/157 (33%), Positives = 89/157 (57%), Gaps = 8/157 (5%)
 Frame = +2

Query  881   GNENRPGYLIRKRPDKKDISLLTSEEIEMPKIWAHICIQRMADLAKESSTMRRVLDPMFI  1060
             G  N P +L+ +        L   EE + PK+W+ IC+  MA  A+E++T RR+L+ +F 
Sbjct  264   GGVNLPTWLLNRL-------LCCREEAKDPKLWSRICVHNMAKFAREATTFRRILECVFR  316

Query  1061  HFDNNKHWVPRHGLAFVVLSDLSYFVESSG-NHQLILTGVVRHLDHKNVACDSQIKSFVI  1237
              F ++  W P +GLA  VL D+   VE SG N  L+L  +++H+++K +     ++  ++
Sbjct  317   CFGSSSSWSPDNGLALCVLLDMQLLVEHSGLNMHLLLALLIKHIENKAMVKQPDMQLSIV  376

Query  1238  QTATALARQIRSGGGFSDIGFVSDLCRHLRKSLQATV  1348
             + A  LA Q  +    + IG +SDL RHL+++   T+
Sbjct  377   EVAAILAEQSNAQASVATIGAISDLVRHLKRTFHITL  413



>ref|XP_011075240.1| PREDICTED: uncharacterized protein LOC105159750 isoform X2 [Sesamum 
indicum]
Length=1011

 Score =   252 bits (643),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 115/214 (54%), Positives = 155/214 (72%), Gaps = 0/214 (0%)
 Frame = +1

Query  148  GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  327
            G++SR++ PAC S+C  CPALRSRSRQPVKRYKKL++DIFP+S +   N RKI KLCEYA
Sbjct  6    GVISRQVLPACGSLCFFCPALRSRSRQPVKRYKKLISDIFPRSQEEEPNDRKIGKLCEYA  65

Query  328  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  507
            AKNP RIPKIA  LE+RCYKELR+ + + V ++  +Y ++L  CKEQM  FA +++ ++ 
Sbjct  66   AKNPMRIPKIATSLEQRCYKELRNENFRSVKIVMCIYRKMLSSCKEQMPLFANSVMTIIQ  125

Query  508  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRA  687
             +LD A  D +  IGC +   F+ +Q D TY +N+E  + K+C LA+E GE+++   LRA
Sbjct  126  TLLDQANQDEMLIIGCESLFDFVNNQNDATYMFNLEGFITKLCQLAQEVGEDERAEHLRA  185

Query  688  SSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNY  789
            + L+ LSAMVWFM E SHI  +FD IV V L+NY
Sbjct  186  AGLQALSAMVWFMGENSHISVEFDNIVSVVLENY  219


 Score =   110 bits (275),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 53/137 (39%), Positives = 85/137 (62%), Gaps = 1/137 (1%)
 Frame = +2

Query  944   LTSEEIEMPKIWAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSD  1123
             + +E+ + P  W+ +C+  MA L KE++TMRRVL+ +F +FDN   W  + G+AF VL D
Sbjct  255   VAAEDSKNPCFWSRVCLHNMAKLGKEATTMRRVLESLFRYFDNGNLWPAKDGIAFPVLKD  314

Query  1124  LSYFVESSG-NHQLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGF  1300
             +   ++ SG N   +L+ +V+HLDHKNV     ++  ++Q  TALAR  +     + +  
Sbjct  315   MQLLMDDSGQNTHFLLSILVKHLDHKNVLKQPDMQLDIVQVVTALARLAKIHPSVAIVSA  374

Query  1301  VSDLCRHLRKSLQATVD  1351
             VSD+ RHLRK +  ++D
Sbjct  375   VSDVMRHLRKGIHCSLD  391



>ref|XP_011075238.1| PREDICTED: uncharacterized protein LOC105159750 isoform X1 [Sesamum 
indicum]
 ref|XP_011075239.1| PREDICTED: uncharacterized protein LOC105159750 isoform X1 [Sesamum 
indicum]
Length=1012

 Score =   252 bits (643),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 115/214 (54%), Positives = 155/214 (72%), Gaps = 0/214 (0%)
 Frame = +1

Query  148  GLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYA  327
            G++SR++ PAC S+C  CPALRSRSRQPVKRYKKL++DIFP+S +   N RKI KLCEYA
Sbjct  6    GVISRQVLPACGSLCFFCPALRSRSRQPVKRYKKLISDIFPRSQEEEPNDRKIGKLCEYA  65

Query  328  AKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVV  507
            AKNP RIPKIA  LE+RCYKELR+ + + V ++  +Y ++L  CKEQM  FA +++ ++ 
Sbjct  66   AKNPMRIPKIATSLEQRCYKELRNENFRSVKIVMCIYRKMLSSCKEQMPLFANSVMTIIQ  125

Query  508  EMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRA  687
             +LD A  D +  IGC +   F+ +Q D TY +N+E  + K+C LA+E GE+++   LRA
Sbjct  126  TLLDQANQDEMLIIGCESLFDFVNNQNDATYMFNLEGFITKLCQLAQEVGEDERAEHLRA  185

Query  688  SSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNY  789
            + L+ LSAMVWFM E SHI  +FD IV V L+NY
Sbjct  186  AGLQALSAMVWFMGENSHISVEFDNIVSVVLENY  219


 Score =   110 bits (275),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 53/137 (39%), Positives = 85/137 (62%), Gaps = 1/137 (1%)
 Frame = +2

Query  944   LTSEEIEMPKIWAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSD  1123
             + +E+ + P  W+ +C+  MA L KE++TMRRVL+ +F +FDN   W  + G+AF VL D
Sbjct  255   VAAEDSKNPCFWSRVCLHNMAKLGKEATTMRRVLESLFRYFDNGNLWPAKDGIAFPVLKD  314

Query  1124  LSYFVESSG-NHQLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGF  1300
             +   ++ SG N   +L+ +V+HLDHKNV     ++  ++Q  TALAR  +     + +  
Sbjct  315   MQLLMDDSGQNTHFLLSILVKHLDHKNVLKQPDMQLDIVQVVTALARLAKIHPSVAIVSA  374

Query  1301  VSDLCRHLRKSLQATVD  1351
             VSD+ RHLRK +  ++D
Sbjct  375   VSDVMRHLRKGIHCSLD  391



>gb|EMT11310.1| hypothetical protein F775_16040 [Aegilops tauschii]
Length=1041

 Score =   252 bits (643),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 114/217 (53%), Positives = 152/217 (70%), Gaps = 0/217 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG++SRK+ P C ++C  CP LR+RSRQPVKRYKK+LA+IFP+S D   N R+I KLCEY
Sbjct  1    MGVISRKVLPVCGALCYFCPGLRARSRQPVKRYKKILAEIFPRSQDEEPNERRIGKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            AAKNP R+PKI   LE+R YKELR+       V+  +Y  LL  CKEQM   A +LL++V
Sbjct  61   AAKNPLRVPKITVYLEQRIYKELRAEQYGFAKVVMLIYRRLLVSCKEQMPLLASSLLSIV  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
              +LD  + D ++ I C T   F  +QVDGTY +N+E LV ++C LA+E GE+ +   LR
Sbjct  121  HTLLDQKRQDDMRIIACETLFDFAVNQVDGTYQFNLEGLVPRLCELAQEAGEDQRATSLR  180

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNYEP  795
            A+ L+ LSAM+WFM E SHI ++FD +V V L+NY+P
Sbjct  181  AAGLQALSAMIWFMGELSHISSEFDNVVEVVLENYKP  217


 Score = 95.1 bits (235),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 53/161 (33%), Positives = 89/161 (55%), Gaps = 16/161 (10%)
 Frame = +2

Query  881   GNENRPGYLIRK----RPDKKDISLLTSEEIEMPKIWAHICIQRMADLAKESSTMRRVLD  1048
             G  N P +L+ +    R D KD           PK+W+ IC+  MA  A+E++T RR+L+
Sbjct  264   GGVNLPTWLLNRLLCCREDAKD-----------PKLWSRICVHNMAKFAREATTFRRILE  312

Query  1049  PMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSG-NHQLILTGVVRHLDHKNVACDSQIK  1225
              +F  F ++  W P +GLA  VL D+   VE SG N  L+L  +++H+++K +     ++
Sbjct  313   SVFRCFGSSSSWSPDNGLALCVLLDMQLLVEHSGLNMHLLLALLIKHIENKAMVKQPDMQ  372

Query  1226  SFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKSLQATV  1348
               +++ A  LA Q  +    + IG +SDL RHL+++   T+
Sbjct  373   LSIVEVAAILAEQSNAQASVATIGAISDLVRHLKRTFHITL  413



>ref|XP_009625867.1| PREDICTED: protein EFR3 homolog isoform X2 [Nicotiana tomentosiformis]
Length=924

 Score =   251 bits (641),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 112/215 (52%), Positives = 154/215 (72%), Gaps = 0/215 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG++SRK+ PAC ++C  CP+LR+RSRQPVKRYKKLLA+IFPKS D   N RKI KLCEY
Sbjct  1    MGVMSRKVVPACGNLCFFCPSLRARSRQPVKRYKKLLAEIFPKSQDAEPNDRKIAKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            A+KNPFRIPKI + LE+RCYK+LR+ H   V V+  +Y +LL  CKE M  +A +LL ++
Sbjct  61   ASKNPFRIPKITEYLEQRCYKDLRNEHLGSVKVVTVIYRKLLSSCKEHMPLYATSLLGII  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
              + +  + D ++ +GC T   FI  Q+DGTY +N+E L+ K+C LARE G++ +   LR
Sbjct  121  RTLFEQTQHDEMQILGCNTLVDFINCQMDGTYMFNLEGLIPKMCQLAREIGDDGRALRLR  180

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNY  789
            ++ ++ L+ +VWFM E SHI  D D I+  TL+NY
Sbjct  181  SAGMQTLAVLVWFMGEQSHISMDVDHIITATLENY  215


 Score =   108 bits (269),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 56/151 (37%), Positives = 88/151 (58%), Gaps = 2/151 (1%)
 Frame = +2

Query  932   DISLLTS-EEIEMPKIWAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAF  1108
             DI L +S E  + P  WA IC++ MA L KE++++RRVL+P++  FD   +W    GLA 
Sbjct  268   DIKLTSSIETTKSPSYWARICLRNMALLTKEATSVRRVLEPLYHCFDTENYWASEKGLAC  327

Query  1109  VVLSDLSYFVESSG-NHQLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGF  1285
              VL DL   +E SG N  L+L+ +V+HLDHKN+     I+  ++   T LA   +     
Sbjct  328   SVLMDLQCLLEESGENSHLLLSILVKHLDHKNIVKQPDIQISIVNVVTHLAENAKEQAST  387

Query  1286  SDIGFVSDLCRHLRKSLQATVDLAGEEINLN  1378
             + +G +SDL +HL K +Q + + +  +  L+
Sbjct  388   TIVGVISDLIKHLMKCMQYSAEASSSKDRLD  418



>ref|XP_009625862.1| PREDICTED: protein EFR3 homolog isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009625864.1| PREDICTED: protein EFR3 homolog isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009625865.1| PREDICTED: protein EFR3 homolog isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009625866.1| PREDICTED: protein EFR3 homolog isoform X1 [Nicotiana tomentosiformis]
Length=993

 Score =   251 bits (641),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 112/215 (52%), Positives = 154/215 (72%), Gaps = 0/215 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG++SRK+ PAC ++C  CP+LR+RSRQPVKRYKKLLA+IFPKS D   N RKI KLCEY
Sbjct  1    MGVMSRKVVPACGNLCFFCPSLRARSRQPVKRYKKLLAEIFPKSQDAEPNDRKIAKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            A+KNPFRIPKI + LE+RCYK+LR+ H   V V+  +Y +LL  CKE M  +A +LL ++
Sbjct  61   ASKNPFRIPKITEYLEQRCYKDLRNEHLGSVKVVTVIYRKLLSSCKEHMPLYATSLLGII  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
              + +  + D ++ +GC T   FI  Q+DGTY +N+E L+ K+C LARE G++ +   LR
Sbjct  121  RTLFEQTQHDEMQILGCNTLVDFINCQMDGTYMFNLEGLIPKMCQLAREIGDDGRALRLR  180

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNY  789
            ++ ++ L+ +VWFM E SHI  D D I+  TL+NY
Sbjct  181  SAGMQTLAVLVWFMGEQSHISMDVDHIITATLENY  215


 Score =   108 bits (270),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 56/151 (37%), Positives = 88/151 (58%), Gaps = 2/151 (1%)
 Frame = +2

Query  932   DISLLTS-EEIEMPKIWAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAF  1108
             DI L +S E  + P  WA IC++ MA L KE++++RRVL+P++  FD   +W    GLA 
Sbjct  268   DIKLTSSIETTKSPSYWARICLRNMALLTKEATSVRRVLEPLYHCFDTENYWASEKGLAC  327

Query  1109  VVLSDLSYFVESSG-NHQLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGF  1285
              VL DL   +E SG N  L+L+ +V+HLDHKN+     I+  ++   T LA   +     
Sbjct  328   SVLMDLQCLLEESGENSHLLLSILVKHLDHKNIVKQPDIQISIVNVVTHLAENAKEQAST  387

Query  1286  SDIGFVSDLCRHLRKSLQATVDLAGEEINLN  1378
             + +G +SDL +HL K +Q + + +  +  L+
Sbjct  388   TIVGVISDLIKHLMKCMQYSAEASSSKDRLD  418



>gb|EAY92960.1| hypothetical protein OsI_14753 [Oryza sativa Indica Group]
Length=279

 Score =   236 bits (601),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 115/217 (53%), Positives = 154/217 (71%), Gaps = 0/217 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG++SRK+ PAC S+C  CP LR+RSRQPVKRYK +LA+IFPK+ D   N R+I KLCEY
Sbjct  1    MGVISRKVLPACGSLCYFCPGLRARSRQPVKRYKSILAEIFPKTQDEEPNERRIGKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
             ++NP R+PKI   LE+R YKELRS       V+  +Y  LL  CKEQM  FA +LL++V
Sbjct  61   CSRNPLRVPKITVSLEQRIYKELRSEQYGFAKVVMLIYRRLLVSCKEQMPLFASSLLSIV  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
              +LD  + D ++ IGC T   F  +QVDGTY +N+E LV ++C L++E GE++Q   LR
Sbjct  121  HTLLDQKRQDDMRIIGCETLFDFAVNQVDGTYQFNLEGLVPRLCELSQEVGEDEQTIALR  180

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNYEP  795
            A++L+ LSAM+WFM E SHI ++FD +V V L+NY P
Sbjct  181  AAALQALSAMIWFMGELSHISSEFDNVVQVVLENYRP  217



>ref|NP_197607.5| uncharacterized protein [Arabidopsis thaliana]
 gb|AED92929.1| uncharacterized protein AT5G21080 [Arabidopsis thaliana]
Length=1025

 Score =   250 bits (639),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 115/215 (53%), Positives = 148/215 (69%), Gaps = 0/215 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG++SR +FP CES+C  CPALR+RSR PVKRYK LLADIFP+S D   N RKI KLCEY
Sbjct  1    MGVVSRTVFPVCESLCCFCPALRARSRHPVKRYKHLLADIFPRSQDEQPNDRKIGKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            AAKNP RIPKI   LE+RCYKELR      V ++  +Y +LL  C EQM  FA + L ++
Sbjct  61   AAKNPLRIPKITTSLEQRCYKELRMEQFHSVKIVMSIYKKLLVSCNEQMLLFASSYLGLI  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
              +LD  + D ++ +GC     F+ SQ +GTY +N++ L+ K+C LA E GEED    L 
Sbjct  121  HILLDQTRYDEMRILGCEALYDFVTSQAEGTYMFNLDGLIPKICPLAHELGEEDSTTNLC  180

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNY  789
            A+ L+ LS++VWFM EFSHI  +FD +V V L+NY
Sbjct  181  AAGLQALSSLVWFMGEFSHISVEFDNVVSVVLENY  215


 Score =   119 bits (299),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 61/157 (39%), Positives = 100/157 (64%), Gaps = 4/157 (3%)
 Frame = +2

Query  923   DKKDISLLTSEEIEMPKIWAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGL  1102
             D +  ++++ E+ + PK W+ +C+  +A LAKE++T+RRVL+ +F +FD N+ W   +GL
Sbjct  256   DDRGKAIVSVEDAKNPKFWSRVCLHNLAKLAKEATTVRRVLESLFRYFDFNEVWSTENGL  315

Query  1103  AFVVLSDLSYFVESSG-NHQLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGG  1279
             A  VL D+   +E SG N   +L+ +++HLDHKNV    +++  ++  ATALA+Q +   
Sbjct  316   AVYVLQDVQLLIERSGQNTHFLLSILIKHLDHKNVLKKPRMQLEIVYVATALAQQTKVLP  375

Query  1280  GFSDIGFVSDLCRHLRKSLQATVD---LAGEEINLNL  1381
               + IG +SD+ RHLRKS+  ++D   L  E I  NL
Sbjct  376   SVAIIGALSDMIRHLRKSIHCSLDDSNLGNEMIQYNL  412



>ref|XP_002874031.1| hypothetical protein ARALYDRAFT_489019 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50290.1| hypothetical protein ARALYDRAFT_489019 [Arabidopsis lyrata subsp. 
lyrata]
Length=1027

 Score =   250 bits (638),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 115/215 (53%), Positives = 150/215 (70%), Gaps = 0/215 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG++SR +FP CES+C  CPALR+RSR PVKRYK LLADIFP+S D   N RKI KLCEY
Sbjct  1    MGVVSRTVFPVCESLCCFCPALRARSRHPVKRYKHLLADIFPRSQDEQPNDRKIGKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            AAKNP RIPKI   LE+RCYKELR      V ++  +Y +LL  C EQM+ FA + L ++
Sbjct  61   AAKNPLRIPKITTYLEQRCYKELRMEQFHSVKIVMSIYKKLLVSCNEQMSLFASSYLGLI  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
              +LD  + D ++ +GC     F+ +Q +GTY +N++ L+ K+C LA E GEED+   L 
Sbjct  121  HILLDQNRYDEMRILGCEALYDFVTNQAEGTYMFNLDGLIPKICPLAHELGEEDRTTNLC  180

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNY  789
            A+ L+ LS+MVWFM EFSHI  +FD +V V L+NY
Sbjct  181  AAGLQALSSMVWFMGEFSHISVEFDNVVSVVLENY  215


 Score =   113 bits (282),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 62/154 (40%), Positives = 94/154 (61%), Gaps = 8/154 (5%)
 Frame = +2

Query  929   KDISLLTSEEIEMPKIWAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAF  1108
             K I ++  E+ + PK W+ +C+  +A LAKE++T+RRVL+ +F +FD N+ W   +GLA 
Sbjct  260   KAIRVINREDAKNPKFWSRVCLHNLAKLAKEATTVRRVLESLFRYFDFNEVWSTENGLAL  319

Query  1109  VVLSDLSYFVESSGNHQLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFS  1288
              VL D+   +E SG + L L     HLDHKNV    +++  ++  ATALA+Q +     +
Sbjct  320   YVLQDVQLLIERSGLYCLHL-----HLDHKNVLKKPRMQLDIVYVATALAQQTKVLPSVA  374

Query  1289  DIGFVSDLCRHLRKSLQATVD---LAGEEINLNL  1381
              IG +SD+ RHLRKS+  ++D   L  E I  NL
Sbjct  375   IIGALSDMIRHLRKSIHCSLDDSNLGNEMIQYNL  408



>ref|XP_003605757.1| EFR3-like protein [Medicago truncatula]
 gb|AES87954.1| cyclin-like protein [Medicago truncatula]
Length=1028

 Score =   249 bits (637),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 109/215 (51%), Positives = 157/215 (73%), Gaps = 0/215 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            M ++SR ++P C S+C  CPALR RSR P+KRYKKLLADIFP++P+   N RKI KLCEY
Sbjct  1    MSVISRNIWPVCGSLCCFCPALRERSRHPIKRYKKLLADIFPRTPEEEPNDRKISKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            A+KNP R+PKI   LE+RCYKELR+ + + V V+  +Y +LL  C++QM  FA +LL+++
Sbjct  61   ASKNPLRVPKITSYLEQRCYKELRTENYQAVKVVICIYRKLLVSCRDQMPLFASSLLSII  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
              +LD ++ D V+ +GC T   F+ +Q DGTY +N+++ + K+C LA++ G++ +   LR
Sbjct  121  QILLDQSRQDEVQILGCQTLFDFVNNQRDGTYMFNLDSFILKLCHLAQQVGDDGKVEHLR  180

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNY  789
            AS L+ LS+MVWFM EF+HI  +FD +V V L+NY
Sbjct  181  ASGLQVLSSMVWFMGEFTHISVEFDNVVSVVLENY  215


 Score =   116 bits (290),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 57/134 (43%), Positives = 85/134 (63%), Gaps = 1/134 (1%)
 Frame = +2

Query  953   EEIEMPKIWAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSY  1132
             E+   P  W+ +CI  MA LAKE +T+RRVL+ +F +FDN   W P HGLA  VL D+  
Sbjct  248   EDATNPGFWSRVCILNMAKLAKEGTTVRRVLESLFRYFDNTNLWSPEHGLALSVLLDMQS  307

Query  1133  FVESSG-NHQLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSD  1309
              +E++G N  L+L+ +V+HLDHKNV  +  ++  ++   T LA + R     + IG +SD
Sbjct  308   IIENAGQNTHLLLSILVKHLDHKNVLKNPNMQLDIVGVITHLAEKTRVQQSVAIIGALSD  367

Query  1310  LCRHLRKSLQATVD  1351
             + RHLRKS+  ++D
Sbjct  368   MMRHLRKSIHCSLD  381



>ref|XP_006286974.1| hypothetical protein CARUB_v10000121mg [Capsella rubella]
 gb|EOA19872.1| hypothetical protein CARUB_v10000121mg [Capsella rubella]
Length=1026

 Score =   249 bits (637),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 114/215 (53%), Positives = 150/215 (70%), Gaps = 0/215 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG++SR +FP CES+C  CPALR+RSR PVKRYK LLADIFP+S D   N RKI KLCEY
Sbjct  1    MGVVSRTVFPVCESLCCFCPALRARSRHPVKRYKHLLADIFPRSQDEQPNDRKISKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            AAKNP RIPKI   LE+RCYKELR      V ++  +Y +LL  C EQM+ FA + L ++
Sbjct  61   AAKNPLRIPKITTSLEQRCYKELRMEQFHSVKIVMSIYKKLLVSCNEQMSLFASSYLGLI  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
              +LD  + D ++ +GC     F+ SQ +GTY +N++ L+ K+C LA E GEE++   L 
Sbjct  121  HILLDQTRYDEMRILGCEALYDFVTSQAEGTYMFNLDGLIPKICPLAHELGEEERTTNLC  180

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNY  789
            A+ L+ LS++VWFM EFSHI  +FD +V V L+NY
Sbjct  181  AAGLQALSSLVWFMGEFSHISVEFDNVVSVVLENY  215


 Score =   119 bits (299),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 61/157 (39%), Positives = 100/157 (64%), Gaps = 4/157 (3%)
 Frame = +2

Query  923   DKKDISLLTSEEIEMPKIWAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGL  1102
             D +  ++++ E+ + PK W+ +C+  +A LAKE++T+RRVL+ +F +FD N+ W   +GL
Sbjct  257   DDRGKAIVSVEDAKNPKFWSRVCLHNLAKLAKEATTVRRVLESLFRYFDFNEVWSTENGL  316

Query  1103  AFVVLSDLSYFVESSG-NHQLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGG  1279
             A  VL D+   +E SG N   +L+ +++HLDHKNV    +++  ++  ATALA+Q +   
Sbjct  317   ALYVLQDVQLLIERSGQNTHFLLSILIKHLDHKNVLKKPRMQLDIVYVATALAQQTKVLP  376

Query  1280  GFSDIGFVSDLCRHLRKSLQATVD---LAGEEINLNL  1381
               + IG +SD+ RHLRKS+  ++D   L  E I  NL
Sbjct  377   SVAIIGALSDMIRHLRKSIHCSLDDSNLGNEMIQYNL  413



>ref|XP_010420957.1| PREDICTED: uncharacterized protein LOC104706460 [Camelina sativa]
Length=1024

 Score =   249 bits (637),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 113/215 (53%), Positives = 150/215 (70%), Gaps = 0/215 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG++SR +FP CES+C  CPALR+RSR PVKRYK LLADIFP+S D   N RKI KLCEY
Sbjct  1    MGVVSRTMFPVCESLCCFCPALRARSRHPVKRYKHLLADIFPRSQDEQPNDRKIGKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            AAKNP RIPKI   LE+RCYKELR      V ++  +Y +LL  C EQM+ FA + L ++
Sbjct  61   AAKNPLRIPKITTSLEQRCYKELRMEQFHSVKIVMSIYKKLLVSCNEQMSLFASSYLGLI  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
              +LD  + D ++ +GC     F+ SQ +GTY +N++ L+ K+C LA E GEE++   + 
Sbjct  121  HILLDQTRYDEMRMLGCEALYDFVTSQTEGTYMFNLDGLIPKICPLAHELGEEERTTNMC  180

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNY  789
            A+ L+ LS++VWFM EFSHI  +FD +V V L+NY
Sbjct  181  AAGLQALSSLVWFMGEFSHISVEFDNVVSVVLENY  215


 Score =   120 bits (300),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 61/157 (39%), Positives = 100/157 (64%), Gaps = 4/157 (3%)
 Frame = +2

Query  923   DKKDISLLTSEEIEMPKIWAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGL  1102
             D +  ++++ E+ + PK W+ +C+  +A LAKE++T+RRVL+ +F +FD N+ W   +GL
Sbjct  256   DDRGKAIVSVEDAKNPKFWSRVCLHNLAKLAKEATTVRRVLESLFRYFDFNEVWSTENGL  315

Query  1103  AFVVLSDLSYFVESSG-NHQLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGG  1279
             A  VL D+   +E SG N   +L+ +++HLDHKNV    +++  ++  ATALA+Q +   
Sbjct  316   ALYVLQDVQLLIERSGQNTHFLLSILIKHLDHKNVLKKPRMQLDIVYVATALAQQTKVLP  375

Query  1280  GFSDIGFVSDLCRHLRKSLQATVD---LAGEEINLNL  1381
               + IG +SD+ RHLRKS+  ++D   L  E I  NL
Sbjct  376   SVAIIGALSDMIRHLRKSIHCSLDDSNLGNEMIQYNL  412



>ref|XP_003540587.1| PREDICTED: uncharacterized protein LOC100816475 [Glycine max]
Length=1037

 Score =   249 bits (637),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 110/215 (51%), Positives = 157/215 (73%), Gaps = 0/215 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            M ++SR ++P C S+C  CPALR RSR P+KRYKKLLADIFP++PD   N R I KLCEY
Sbjct  1    MSVISRNIWPVCGSLCCFCPALRERSRHPIKRYKKLLADIFPRTPDEEPNERMISKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            A+KNP R+PKI   LE+RCY+ELR+ + + V V+  +Y +LL  CK+QM  FA +LL+++
Sbjct  61   ASKNPLRVPKITSYLEQRCYRELRTENYQSVKVVICIYRKLLISCKDQMPLFASSLLSII  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
              +LD  + D V+ +GC T   F+ +Q DGTY +N++  + K+C+LA+E G++ + + LR
Sbjct  121  QILLDQPRQDEVQILGCQTLFDFVNNQRDGTYMFNLDGFILKLCNLAQEMGDDAKVQLLR  180

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNY  789
            A+ L+ LS+MVWFM EF+HI A+FD +V V L+NY
Sbjct  181  AAGLQVLSSMVWFMGEFTHISAEFDNVVSVVLENY  215


 Score =   121 bits (304),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 61/137 (45%), Positives = 91/137 (66%), Gaps = 3/137 (2%)
 Frame = +2

Query  968   PKIWAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESS  1147
             P  W+ +CIQ MA LAKE +T+RRVL+ +F +FD+   W P HGLA  VL ++   +E+S
Sbjct  253   PGFWSRVCIQNMAKLAKEGTTVRRVLESLFRYFDDTNRWSPEHGLALSVLLNMQSIIENS  312

Query  1148  G-NHQLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHL  1324
             G N  L+L+ +V+HLDHKNV  + +++  ++   T LA+Q RS    + IG +SD+ RHL
Sbjct  313   GHNTHLLLSILVKHLDHKNVLKNPKMQLDIVGVITHLAQQTRSQQSVAIIGALSDMMRHL  372

Query  1325  RKSLQATVDLA--GEEI  1369
             RKS+  ++D +  G EI
Sbjct  373   RKSIHCSLDDSNLGSEI  389



>ref|XP_010493228.1| PREDICTED: uncharacterized protein LOC104770495 [Camelina sativa]
Length=1024

 Score =   249 bits (637),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 113/215 (53%), Positives = 150/215 (70%), Gaps = 0/215 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG++SR +FP CES+C  CPALR+RSR PVKRYK LLADIFP+S D   N RKI KLCEY
Sbjct  1    MGVVSRTMFPVCESLCCFCPALRARSRHPVKRYKHLLADIFPRSQDEQPNDRKIGKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            AAKNP RIPKI   LE+RCYKELR      V ++  +Y +LL  C EQM+ FA + L ++
Sbjct  61   AAKNPLRIPKITTSLEQRCYKELRMEQFHSVKIVMSIYKKLLVSCNEQMSLFASSYLGLI  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
              +LD  + D ++ +GC     F+ SQ +GTY +N++ L+ K+C LA E GEE++   + 
Sbjct  121  HILLDQTRYDEMRMLGCEALYDFVTSQTEGTYMFNLDGLIPKICPLAHELGEEERTTNMC  180

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNY  789
            A+ L+ LS++VWFM EFSHI  +FD +V V L+NY
Sbjct  181  AAGLQALSSLVWFMGEFSHISVEFDNVVSVVLENY  215


 Score =   120 bits (300),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 61/157 (39%), Positives = 100/157 (64%), Gaps = 4/157 (3%)
 Frame = +2

Query  923   DKKDISLLTSEEIEMPKIWAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGL  1102
             D +  ++++ E+ + PK W+ +C+  +A LAKE++T+RRVL+ +F +FD N+ W   +GL
Sbjct  256   DDRGKAIVSVEDAKNPKFWSRVCLHNLAKLAKEATTVRRVLESLFRYFDFNEVWSTENGL  315

Query  1103  AFVVLSDLSYFVESSG-NHQLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGG  1279
             A  VL D+   +E SG N   +L+ +++HLDHKNV    +++  ++  ATALA+Q +   
Sbjct  316   ALYVLQDVQLLIERSGQNTHFLLSILIKHLDHKNVLKKPRMQLDIVYVATALAQQTKVLP  375

Query  1280  GFSDIGFVSDLCRHLRKSLQATVD---LAGEEINLNL  1381
               + IG +SD+ RHLRKS+  ++D   L  E I  NL
Sbjct  376   SVAIIGALSDMIRHLRKSIHCSLDDSNLGNEMIQYNL  412



>ref|XP_002517810.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF44617.1| conserved hypothetical protein [Ricinus communis]
Length=1025

 Score =   249 bits (636),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 114/217 (53%), Positives = 154/217 (71%), Gaps = 2/217 (1%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSA--NGRKIMKLC  318
            M ++S ++ PAC+S+C  CPALR+RSRQP+KRYKKLLADIFP++P G    N RKI KLC
Sbjct  1    MSVISTQVMPACDSLCFFCPALRTRSRQPIKRYKKLLADIFPRAPVGEEQLNDRKIGKLC  60

Query  319  EYAAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLN  498
            EYAAKNP RIPKI   LE+RCYK+LRS   + V ++  +Y +LL  CKEQM  FA +LL+
Sbjct  61   EYAAKNPLRIPKITSSLEQRCYKDLRSEQFQSVKIVMCIYRKLLISCKEQMPLFASSLLS  120

Query  499  VVVEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRC  678
            ++  +LD  + D ++ +GC     F+ +Q DGTY +N++ L+ K+C + +  GEE +   
Sbjct  121  IIHILLDQTRHDDIRILGCQVLFDFVNNQRDGTYVFNLDGLIPKLCIIVQVIGEEGRVEQ  180

Query  679  LRASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNY  789
            LR + L+ LS+MVWFM EFSHI  DFD +V V LDNY
Sbjct  181  LRTAGLQALSSMVWFMGEFSHISTDFDTVVSVVLDNY  217


 Score =   120 bits (302),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 57/137 (42%), Positives = 89/137 (65%), Gaps = 1/137 (1%)
 Frame = +2

Query  944   LTSEEIEMPKIWAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSD  1123
             ++ EE + P  W+ +C+  MA LAKE++T+RRVL+ +F +FD+   W P+HGLA  VL D
Sbjct  262   VSMEESKNPTFWSRVCLHNMAQLAKEATTVRRVLESLFRYFDDGDLWSPQHGLALSVLLD  321

Query  1124  LSYFVESSGNH-QLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGF  1300
             +   +E SG     +L+ +++HLDHKNV     ++  +++ AT LARQ R     + IG 
Sbjct  322   MQLIIEKSGQKTHFVLSILIKHLDHKNVLKKPNMQLDIVEVATRLARQTRIQPSVAIIGA  381

Query  1301  VSDLCRHLRKSLQATVD  1351
             +SD+ RHLRKS+  ++D
Sbjct  382   LSDMMRHLRKSIHCSLD  398



>emb|CDP16550.1| unnamed protein product [Coffea canephora]
Length=1009

 Score =   247 bits (631),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 115/224 (51%), Positives = 157/224 (70%), Gaps = 9/224 (4%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG++SRK+ PAC ++C  CP++R+RSRQPVKRYKKLLADIFP+S D   N RKI KLCEY
Sbjct  1    MGVMSRKVVPACGNLCFFCPSMRARSRQPVKRYKKLLADIFPRSQDAEPNDRKIGKLCEY  60

Query  325  AAKNPFRIPK---------IAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMAC  477
            A+KNP RIPK         I + LE++ YK+LR+ H   V V+  +Y +LL  CKEQM  
Sbjct  61   ASKNPLRIPKASLIHLFALITEYLEQKFYKDLRNEHFGSVKVVLRIYRKLLSSCKEQMPL  120

Query  478  FAVNLLNVVVEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETG  657
            FA +LL +V  +LD  + D ++ +GC T   FI  Q+DGTY +N+E L+ K+C LARE G
Sbjct  121  FASSLLGMVRTLLDLPQYDELQILGCNTLVDFINGQLDGTYMFNLEGLIPKLCQLAREVG  180

Query  658  EEDQKRCLRASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNY  789
            ++D+  CLR++ ++ L+ +V FM + SHI  DFD I+ VTL+NY
Sbjct  181  DDDRALCLRSAGMQVLAVLVHFMGKNSHISMDFDHIITVTLENY  224


 Score =   104 bits (260),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 53/135 (39%), Positives = 82/135 (61%), Gaps = 1/135 (1%)
 Frame = +2

Query  935   ISLLTSEEIEMPKIWAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVV  1114
             + + T E  + P  W+ +C+  +A  A+E +T+RRVL+P+F  FD+  +W P  GLA  V
Sbjct  279   MEMATLEATKNPSYWSRVCLWNIAQSAREVTTVRRVLEPLFHRFDSENYWSPDKGLAGSV  338

Query  1115  LSDLSYFVESSG-NHQLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSD  1291
             L+ L   +E SG +  L+L+ VV+HLDHKNVA    ++  +I   T LAR  +     + 
Sbjct  339   LAYLQSLLEESGESSHLLLSIVVKHLDHKNVAKRRDMQINIIDVTTQLARNAKQQASVAI  398

Query  1292  IGFVSDLCRHLRKSL  1336
             +G +S+L +HLRK L
Sbjct  399   VGAISELVKHLRKCL  413



>ref|XP_006587694.1| PREDICTED: uncharacterized protein LOC100808352 [Glycine max]
Length=1036

 Score =   247 bits (630),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 109/215 (51%), Positives = 156/215 (73%), Gaps = 0/215 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            M ++SR ++P C S+C  CPALR RSR P+KRYKK LADIFP++PD   N R I KLCEY
Sbjct  1    MSVISRNIWPVCGSLCCFCPALRERSRHPIKRYKKFLADIFPRTPDEEPNERMIGKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            A+KNP R+PKI   LE+RCY+ELR+ + + V V+  +Y +LL  CK+QM  FA +LL+++
Sbjct  61   ASKNPLRVPKITSYLEQRCYRELRTENYQSVKVVICIYRKLLISCKDQMPLFASSLLSII  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
              +LD  + D V+ +GC T   F+ +Q DGTY +N++  + K+C+LA+E G++ + + LR
Sbjct  121  QILLDQPRHDEVQILGCQTLFDFVNNQRDGTYMFNLDGFILKLCNLAQEMGDDAKVQHLR  180

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNY  789
            A+ L+ LS+MVWFM EF+HI A+FD +V V L+NY
Sbjct  181  AAGLQVLSSMVWFMGEFTHISAEFDNVVSVVLENY  215


 Score =   120 bits (301),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 61/137 (45%), Positives = 90/137 (66%), Gaps = 3/137 (2%)
 Frame = +2

Query  968   PKIWAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESS  1147
             P  W+ +CIQ MA LAKE +T+RRVL+ +F +FDN   W P HGLA  VL ++   +E+S
Sbjct  253   PGFWSRVCIQNMAKLAKEGTTVRRVLESLFRYFDNTNLWSPEHGLALSVLLNMQSIIENS  312

Query  1148  G-NHQLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHL  1324
             G N  L+L+ +V+HLDHKNV  + +++  ++   T LA+Q R     + IG +SD+ RHL
Sbjct  313   GHNTHLLLSILVKHLDHKNVLKNPKMQLDIVGVITHLAQQTRVQQSVAIIGALSDMMRHL  372

Query  1325  RKSLQATVDLA--GEEI  1369
             RKS+  ++D +  G EI
Sbjct  373   RKSIHCSLDDSNLGSEI  389



>ref|XP_009124331.1| PREDICTED: uncharacterized protein LOC103849280 [Brassica rapa]
Length=1024

 Score =   247 bits (630),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 113/215 (53%), Positives = 151/215 (70%), Gaps = 0/215 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG ++R +FP CES+C  CPALR+RSR PVKRYK+LLADIFP+SPD   N RKI KLCEY
Sbjct  1    MGAVARTVFPVCESLCCFCPALRARSRHPVKRYKQLLADIFPRSPDEQPNDRKISKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            AAKNP RIPKI   LE+RCYKELR      V  +  +Y +LL  C EQM+ FA + L ++
Sbjct  61   AAKNPLRIPKITTYLEQRCYKELRLEQFHSVKTVMCIYKKLLVACNEQMSLFASSYLGLI  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
              +LD ++ D ++ +GC     F+ SQ +GTY +N++ L+ K+C LA E GEE++   L 
Sbjct  121  HILLDQSRHDEMRVLGCEAIYDFVTSQTEGTYMFNLDGLIPKICPLAHELGEEERTIHLC  180

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNY  789
            ++ L+ LS++VWFM EFSHI  +FD +V V L+NY
Sbjct  181  SAGLQALSSLVWFMGEFSHISVEFDNVVSVVLENY  215


 Score =   119 bits (299),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 61/157 (39%), Positives = 100/157 (64%), Gaps = 4/157 (3%)
 Frame = +2

Query  923   DKKDISLLTSEEIEMPKIWAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGL  1102
             D +  ++++ E+ + PK W+ +C+  +A LAKE++T+RRVL+ +F +FD N+ W   +GL
Sbjct  254   DDRGKAIVSVEDSKNPKFWSRVCLHNLAKLAKEATTVRRVLESLFRYFDFNEVWSTDNGL  313

Query  1103  AFVVLSDLSYFVESSG-NHQLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGG  1279
             A  VL D+   +E SG N   +L+ +++HLDHKNV    +++  ++  ATALA+Q +   
Sbjct  314   ALYVLQDVQLLIERSGQNTHFLLSILIKHLDHKNVLKKPKMQLDIVYVATALAQQTKVQP  373

Query  1280  GFSDIGFVSDLCRHLRKSLQATVD---LAGEEINLNL  1381
               + IG +SD+ RHLRKS+  ++D   L  E I  NL
Sbjct  374   SVAIIGALSDMIRHLRKSIHCSLDDSNLGNEMIQYNL  410



>emb|CDY09095.1| BnaA02g05210D [Brassica napus]
Length=996

 Score =   246 bits (629),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 113/215 (53%), Positives = 151/215 (70%), Gaps = 0/215 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG ++R +FP CES+C  CPALR+RSR PVKRYK+LLADIFP+SPD   N RKI KLCEY
Sbjct  1    MGAVARTVFPVCESLCCFCPALRARSRHPVKRYKQLLADIFPRSPDEQPNDRKISKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            AAKNP RIPKI   LE+RCYKELR      V  +  +Y +LL  C EQM+ FA + L ++
Sbjct  61   AAKNPLRIPKITTYLEQRCYKELRLEQFHSVKTVMCIYKKLLVACNEQMSLFASSYLGLI  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
              +LD ++ D ++ +GC     F+ SQ +GTY +N++ L+ K+C LA E GEE++   L 
Sbjct  121  HILLDQSRHDEMRVLGCEAIYDFVTSQTEGTYMFNLDGLIPKICPLAHELGEEERTIHLC  180

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNY  789
            ++ L+ LS++VWFM EFSHI  +FD +V V L+NY
Sbjct  181  SAGLQALSSLVWFMGEFSHISVEFDNVVSVVLENY  215


 Score =   119 bits (298),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 61/157 (39%), Positives = 100/157 (64%), Gaps = 4/157 (3%)
 Frame = +2

Query  923   DKKDISLLTSEEIEMPKIWAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGL  1102
             D +  ++++ E+ + PK W+ +C+  +A LAKE++T+RRVL+ +F +FD N+ W   +GL
Sbjct  254   DDRGKAIVSVEDSKNPKFWSRVCLHNLAKLAKEATTVRRVLESLFRYFDFNEVWSTDNGL  313

Query  1103  AFVVLSDLSYFVESSG-NHQLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGG  1279
             A  VL D+   +E SG N   +L+ +++HLDHKNV    +++  ++  ATALA+Q +   
Sbjct  314   ALYVLQDVQLLIERSGQNTHFLLSILIKHLDHKNVLKKPKMQLDIVYVATALAQQTKVQP  373

Query  1280  GFSDIGFVSDLCRHLRKSLQATVD---LAGEEINLNL  1381
               + IG +SD+ RHLRKS+  ++D   L  E I  NL
Sbjct  374   SVAIIGALSDMIRHLRKSIHCSLDDSNLGNEMIQYNL  410



>gb|KFK26320.1| hypothetical protein AALP_AA8G232400 [Arabis alpina]
Length=1061

 Score =   246 bits (629),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 113/215 (53%), Positives = 150/215 (70%), Gaps = 0/215 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            MG++SR +FP CES+C  CPALR+RSR PVKRYK LLADIFP+S D   N RKI KLCEY
Sbjct  1    MGVVSRTVFPVCESLCCFCPALRARSRHPVKRYKHLLADIFPRSVDEQPNDRKIGKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            AAKNP RIPKI   LE+RCY+ELR      V ++  +Y +LL  C EQM+ FA + L ++
Sbjct  61   AAKNPLRIPKITTSLEQRCYRELRMEQFHSVKIVMCIYKKLLVACNEQMSLFASSYLGLI  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
              +LD  + D ++ +GC     F+ +Q +GTY +N++ L+ K+C LA E GEED+   L 
Sbjct  121  HILLDQTRHDEMRILGCEALYDFVTNQAEGTYMFNLDGLIPKICPLAHELGEEDRTTNLC  180

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNY  789
            A+ L+ LS++VWFM EFSHI  +FD +V V L+NY
Sbjct  181  AAGLQALSSLVWFMGEFSHISVEFDNVVSVVLENY  215


 Score =   120 bits (300),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 61/157 (39%), Positives = 100/157 (64%), Gaps = 4/157 (3%)
 Frame = +2

Query  923   DKKDISLLTSEEIEMPKIWAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGL  1102
             D +  ++++ E+ + PK W+ +C+  +A LAKE++T+RRVL+ +F +FD N+ W   +GL
Sbjct  256   DDRGKAIVSVEDAKNPKFWSRVCLHNLAKLAKEATTVRRVLESLFRYFDFNEVWSTENGL  315

Query  1103  AFVVLSDLSYFVESSG-NHQLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGG  1279
             A  VL D+   +E SG N   +L+ +++HLDHKNV    +++  ++  ATALA+Q +   
Sbjct  316   ALYVLQDVQLLIERSGQNTHFLLSILIKHLDHKNVLKKPRMQLDIVYVATALAQQTKVLP  375

Query  1280  GFSDIGFVSDLCRHLRKSLQATVD---LAGEEINLNL  1381
               + IG +SD+ RHLRKS+  ++D   L  E I  NL
Sbjct  376   SVAIIGALSDMIRHLRKSIHCSLDDSNLGNEMIQYNL  412



>ref|XP_007131432.1| hypothetical protein PHAVU_011G013000g [Phaseolus vulgaris]
 gb|ESW03426.1| hypothetical protein PHAVU_011G013000g [Phaseolus vulgaris]
Length=1037

 Score =   246 bits (627),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 110/216 (51%), Positives = 156/216 (72%), Gaps = 1/216 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            M ++SR ++P C S+C  CPALR RSR P+KRYKK LADIFP++P    N R I KLCEY
Sbjct  1    MSVISRNIWPVCGSLCCFCPALRERSRHPIKRYKKFLADIFPRTPGEEPNERMIGKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            AA+NP R+PKI   LE+RCY+ELR+ + + V V+  +Y +LL  CK+QM  FA +LL ++
Sbjct  61   AARNPLRVPKITSYLEQRCYRELRTENYQSVKVVILIYRKLLISCKDQMPLFASSLLGII  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQK-RCL  681
              +LD ++ D V+ +GC T   F+ +Q DGTY +N++  + K+C+LA+ETG++D K + L
Sbjct  121  QILLDQSRHDEVQILGCQTLFDFVNNQKDGTYMFNLDAFIVKLCNLAQETGDDDFKIQQL  180

Query  682  RASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNY  789
            RA+ L+ LS+MVWFM EF+HI  +FD +V V L+NY
Sbjct  181  RAAGLQVLSSMVWFMGEFTHISVEFDNVVSVVLENY  216


 Score =   118 bits (295),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 60/142 (42%), Positives = 91/142 (64%), Gaps = 3/142 (2%)
 Frame = +2

Query  953   EEIEMPKIWAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSY  1132
             ++ + P  W+ IC+Q MA LAKE +T+RRVL+ +F +FD    W P HGLA  VL ++  
Sbjct  249   DDAQKPGFWSRICVQNMAKLAKEGTTVRRVLESLFRYFDTANLWSPEHGLALAVLLNMQS  308

Query  1133  FVESSG-NHQLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSD  1309
              +E+SG N  L+L+ +V+HLDHKNV  +  ++  ++   T LA+Q R     + IG +SD
Sbjct  309   IIENSGQNTHLLLSILVKHLDHKNVLKNPNMQLDIVGVITHLAQQTRVQQSVAIIGALSD  368

Query  1310  LCRHLRKSLQATVDLA--GEEI  1369
             + RHLRKS+  ++D +  G EI
Sbjct  369   MMRHLRKSIHCSLDDSKLGSEI  390



>gb|KHN11694.1| Protein EFR3 like B [Glycine soja]
Length=1010

 Score =   245 bits (626),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 108/215 (50%), Positives = 156/215 (73%), Gaps = 0/215 (0%)
 Frame = +1

Query  145  MGLLSRKLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEY  324
            M ++SR ++P C S+C  CPAL+ RSR P+KRYKK LADIFP++PD   N R I KLCEY
Sbjct  1    MSVISRNIWPVCGSLCCFCPALQERSRHPIKRYKKFLADIFPRTPDEEPNERMIGKLCEY  60

Query  325  AAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVV  504
            A+KNP R+PKI   LE+RCY+ELR+ + + V V+  +Y +LL  CK+QM  FA +LL+++
Sbjct  61   ASKNPLRVPKITSYLEQRCYRELRTENYQSVKVVICIYRKLLISCKDQMPLFASSLLSII  120

Query  505  VEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLR  684
              +LD  + D V+ +GC T   F+ +Q DGTY +N++  + K+C+LA+E G++ + + LR
Sbjct  121  QILLDQPRHDEVQILGCQTLFDFVNNQRDGTYMFNLDGFILKLCNLAQEMGDDAKVQHLR  180

Query  685  ASSLRCLSAMVWFMAEFSHIFADFDEIVHVTLDNY  789
            A+ L+ LS+MVWFM EF+HI A+FD +V V L+NY
Sbjct  181  AAGLQVLSSMVWFMGEFTHISAEFDNVVSVVLENY  215


 Score =   120 bits (301),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 61/137 (45%), Positives = 90/137 (66%), Gaps = 3/137 (2%)
 Frame = +2

Query  968   PKIWAHICIQRMADLAKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESS  1147
             P  W+ +CIQ MA LAKE +T+RRVL+ +F +FDN   W P HGLA  VL ++   +E+S
Sbjct  253   PGFWSRVCIQNMAKLAKEGTTVRRVLESLFRYFDNTNLWSPEHGLALSVLLNMQSIIENS  312

Query  1148  G-NHQLILTGVVRHLDHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHL  1324
             G N  L+L+ +V+HLDHKNV  + +++  ++   T LA+Q R     + IG +SD+ RHL
Sbjct  313   GHNTHLLLSILVKHLDHKNVLKNPKMQLDIVGVITHLAQQTRVQQSVAIIGALSDMMRHL  372

Query  1325  RKSLQATVDLA--GEEI  1369
             RKS+  ++D +  G EI
Sbjct  373   RKSIHCSLDDSNLGSEI  389



>emb|CDY48767.1| BnaC04g02200D [Brassica napus]
Length=1275

 Score =   188 bits (478),  Expect(2) = 3e-68, Method: Compositional matrix adjust.
 Identities = 90/205 (44%), Positives = 132/205 (64%), Gaps = 2/205 (1%)
 Frame = +1

Query  181  ESMCICCPALRSRSRQPVKRYKKLLADIF--PKSPDGSANGRKIMKLCEYAAKNPFRIPK  354
            E +CI CPALR RS+Q +KRYKKL+ADIF  P+  + + N RKI KLC+YAAKN   +P+
Sbjct  285  EKLCILCPALRPRSKQAMKRYKKLIADIFHTPRHQEEAPNERKIGKLCKYAAKNAVGMPE  344

Query  355  IAKCLEERCYKELRSGHTKLVNVIAEVYNELLCMCKEQMACFAVNLLNVVVEMLDCAKTD  534
                LE+R YKELR+ +     ++  +Y  LL  C EQM  F+   L  V  +LD  +  
Sbjct  345  STHLLEQRRYKELRNENFHSAKIVMCIYRRLLVTCNEQMPLFSSGFLRTVQALLDQTRQV  404

Query  535  AVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRCLSAM  714
             ++ IGC +  +F+ +Q DG+  +++E ++ K+C LA E  ++D+ R LRA+ L+ LSAM
Sbjct  405  EMQIIGCQSLFEFVNNQTDGSSLFSLEGILSKLCQLALEVEDDDRSRSLRAAGLQALSAM  464

Query  715  VWFMAEFSHIFADFDEIVHVTLDNY  789
            +W M E+ HI +DFD +V   L+NY
Sbjct  465  IWLMGEYCHIPSDFDNVVSGVLENY  489


 Score = 99.4 bits (246),  Expect(2) = 3e-68, Method: Compositional matrix adjust.
 Identities = 55/186 (30%), Positives = 104/186 (56%), Gaps = 9/186 (5%)
 Frame = +2

Query  842   WVDEVIRSEGRDVGNE---NRPGYLIRKRPDKKDISLLTSEEIEMPKIWAHICIQRMADL  1012
             WVDEV+++EG     +   N P +      DK ++++   + ++ P  W+ +C+  MA L
Sbjct  505   WVDEVLKNEGHLAHADSLINVPSWRTVVN-DKGELNVKMEDSLD-PSFWSKVCLHNMAKL  562

Query  1013  AKESSTMRRVLDPMFIHFDNNKHWVPRHGLAFVVLSDLSYFVESSGNH-QLILTGVVRHL  1189
              ++++TMRR+L+ +F +FD    W   + +A  VL DL + +E SG     IL+ +++HL
Sbjct  563   GEDATTMRRILESLFRYFDEGHLWSTENSIALPVLRDLQFLMELSGQRTHFILSMLIKHL  622

Query  1190  DHKNVACDSQIKSFVIQTATALARQIRSGGGFSDIGFVSDLCRHLRKSLQATV---DLAG  1360
             DHK+V     ++  +++  ++LA   +     + +  +SD+ RHLRK + +++   +L  
Sbjct  623   DHKSVLKQPSMQLNILEVTSSLAENAKVEHSAAIVSAISDIMRHLRKCMHSSLHEANLGT  682

Query  1361  EEINLN  1378
             E  N N
Sbjct  683   EAANCN  688



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4142156179002