BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig11621

Length=1037
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011078375.1|  PREDICTED: 36.4 kDa proline-rich protein-like      119   4e-28   Sesamum indicum [beniseed]
ref|XP_011020188.1|  PREDICTED: 36.4 kDa proline-rich protein-like      118   6e-28   Populus euphratica
ref|XP_011017834.1|  PREDICTED: 36.4 kDa proline-rich protein-like      119   7e-28   Populus euphratica
gb|AAT42190.1|  putative proline-rich protein                           116   4e-27   Nicotiana tabacum [American tobacco]
ref|XP_002308060.1|  hypothetical protein POPTR_0006s06430g             115   5e-27   
ref|XP_009613824.1|  PREDICTED: repetitive proline-rich cell wall...    118   6e-27   Nicotiana tomentosiformis
ref|XP_004251730.1|  PREDICTED: 36.4 kDa proline-rich protein           116   1e-26   
ref|XP_009793400.1|  PREDICTED: repetitive proline-rich cell wall...    116   2e-26   Nicotiana sylvestris
ref|XP_006345219.1|  PREDICTED: 36.4 kDa proline-rich protein-like      115   2e-26   Solanum tuberosum [potatoes]
ref|XP_010090189.1|  hypothetical protein L484_011178                   115   2e-26   Morus notabilis
ref|XP_002324631.2|  hypothetical protein POPTR_0018s12630g             117   2e-26   
ref|XP_009340667.1|  PREDICTED: 36.4 kDa proline-rich protein-like      114   3e-26   
ref|XP_008336989.1|  PREDICTED: 36.4 kDa proline-rich protein-like      113   5e-26   
ref|XP_008354364.1|  PREDICTED: 36.4 kDa proline-rich protein-lik...    113   2e-25   
ref|XP_008354363.1|  PREDICTED: 36.4 kDa proline-rich protein-lik...    114   2e-25   
ref|XP_009363973.1|  PREDICTED: 36.4 kDa proline-rich protein-like      112   4e-25   Pyrus x bretschneideri [bai li]
ref|XP_010241580.1|  PREDICTED: 36.4 kDa proline-rich protein           110   4e-25   Nelumbo nucifera [Indian lotus]
ref|XP_008242820.1|  PREDICTED: repetitive proline-rich cell wall...    113   4e-25   Prunus mume [ume]
ref|XP_007202524.1|  hypothetical protein PRUPE_ppa010958mg             111   4e-25   
gb|EYU18244.1|  hypothetical protein MIMGU_mgv1a011967mg                112   5e-25   Erythranthe guttata [common monkey flower]
ref|XP_010656474.1|  PREDICTED: 36.4 kDa proline-rich protein           112   6e-25   
dbj|BAJ34930.1|  hypothetical protein                                   111   7e-25   Vitis hybrid cultivar
ref|XP_008443950.1|  PREDICTED: 36.4 kDa proline-rich protein iso...    110   8e-25   
gb|KJB23625.1|  hypothetical protein B456_004G107700                    109   9e-25   Gossypium raimondii
gb|KJB53996.1|  hypothetical protein B456_009G015500                    109   9e-25   Gossypium raimondii
gb|EYU18245.1|  hypothetical protein MIMGU_mgv11b010660mg               110   1e-24   Erythranthe guttata [common monkey flower]
ref|XP_008443949.1|  PREDICTED: 36.4 kDa proline-rich protein iso...    110   1e-24   Cucumis melo [Oriental melon]
ref|XP_011084187.1|  PREDICTED: 36.4 kDa proline-rich protein-like      111   2e-24   Sesamum indicum [beniseed]
ref|XP_004150208.2|  PREDICTED: 36.4 kDa proline-rich protein           108   2e-24   Cucumis sativus [cucumbers]
emb|CDP10452.1|  unnamed protein product                                109   2e-24   Coffea canephora [robusta coffee]
gb|AAL35979.1|AF104392_1  extensin-like protein                         109   2e-24   Cucumis sativus [cucumbers]
ref|XP_010250205.1|  PREDICTED: 36.4 kDa proline-rich protein-like      109   3e-24   Nelumbo nucifera [Indian lotus]
ref|NP_565348.1|  Bifunctional inhibitor/lipid-transfer protein/s...    110   3e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002885841.1|  hypothetical protein ARALYDRAFT_480276             110   3e-24   
ref|XP_004287279.1|  PREDICTED: 36.4 kDa proline-rich protein           108   5e-24   Fragaria vesca subsp. vesca
gb|EPS72315.1|  hypothetical protein M569_02443                         107   1e-23   Genlisea aurea
ref|XP_006298325.1|  hypothetical protein CARUB_v10014389mg             107   2e-23   Capsella rubella
ref|XP_010488821.1|  PREDICTED: 36.4 kDa proline-rich protein-like      106   9e-23   Camelina sativa [gold-of-pleasure]
ref|XP_009392131.1|  PREDICTED: 36.4 kDa proline-rich protein-like      105   1e-22   
ref|XP_010413891.1|  PREDICTED: 36.4 kDa proline-rich protein-like      105   1e-22   Camelina sativa [gold-of-pleasure]
gb|ABS79455.1|  At2g10940-like protein                                  100   1e-22   Arabidopsis halleri subsp. halleri
gb|ABS79456.1|  At2g10940-like protein                                  100   1e-22   Arabidopsis halleri subsp. halleri
gb|ABS79484.1|  At2g10940-like protein                                  100   1e-22   Arabidopsis lyrata subsp. petraea
ref|XP_010467159.1|  PREDICTED: 36.4 kDa proline-rich protein-like      105   1e-22   Camelina sativa [gold-of-pleasure]
gb|ABS79457.1|  At2g10940-like protein                                99.8    2e-22   Arabidopsis lyrata subsp. petraea
gb|ABS79461.1|  At2g10940-like protein                                99.8    2e-22   Arabidopsis lyrata subsp. petraea
gb|ABS79476.1|  At2g10940-like protein                                99.8    2e-22   Arabidopsis lyrata subsp. lyrata
gb|ABS79459.1|  At2g10940-like protein                                99.4    2e-22   Arabidopsis lyrata subsp. petraea
ref|XP_006855688.1|  PREDICTED: 36.4 kDa proline-rich protein           102   1e-21   Amborella trichopoda
ref|XP_009390999.1|  PREDICTED: 36.4 kDa proline-rich protein-like      100   3e-21   Musa acuminata subsp. malaccensis [pisang utan]
gb|EYU25259.1|  hypothetical protein MIMGU_mgv1a020004mg              94.4    9e-20   Erythranthe guttata [common monkey flower]
dbj|BAK07129.1|  predicted protein                                    97.8    1e-19   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006409710.1|  hypothetical protein EUTSA_v10022809mg           95.1    2e-19   
ref|XP_006385727.1|  hypothetical protein POPTR_0003s11060g           95.1    2e-19   
ref|XP_011033954.1|  PREDICTED: 36.4 kDa proline-rich protein         95.1    3e-19   Populus euphratica
ref|XP_010533777.1|  PREDICTED: LOW QUALITY PROTEIN: 36.4 kDa pro...  95.1    4e-19   Tarenaya hassleriana [spider flower]
ref|XP_006409711.1|  hypothetical protein EUTSA_v10022809mg           94.7    5e-19   Eutrema salsugineum [saltwater cress]
dbj|BAA19128.1|  unnamed protein product                              95.9    5e-19   Daucus carota [carrots]
ref|XP_004151037.2|  PREDICTED: 36.4 kDa proline-rich protein         94.4    6e-19   Cucumis sativus [cucumbers]
ref|XP_012087162.1|  PREDICTED: 36.4 kDa proline-rich protein         93.6    8e-19   Jatropha curcas
ref|XP_010093707.1|  hypothetical protein L484_019048                 94.0    8e-19   Morus notabilis
ref|XP_008238563.1|  PREDICTED: 36.4 kDa proline-rich protein         94.0    1e-18   Prunus mume [ume]
ref|XP_003608742.1|  Proline rich protein                             92.4    1e-18   Medicago truncatula
ref|XP_006477233.1|  PREDICTED: 36.4 kDa proline-rich protein-like    93.6    1e-18   Citrus sinensis [apfelsine]
gb|KDO61487.1|  hypothetical protein CISIN_1g026333mg                 93.2    1e-18   Citrus sinensis [apfelsine]
emb|CDX81428.1|  BnaC09g08390D                                        93.6    1e-18   
ref|XP_010933687.1|  PREDICTED: 36.4 kDa proline-rich protein-like    91.3    1e-18   Elaeis guineensis
ref|XP_007211118.1|  hypothetical protein PRUPE_ppa025269mg           93.6    1e-18   Prunus persica
ref|XP_008448869.1|  PREDICTED: 36.4 kDa proline-rich protein         92.8    1e-18   Cucumis melo [Oriental melon]
ref|XP_006440348.1|  hypothetical protein CICLE_v10021835mg           93.2    1e-18   Citrus clementina [clementine]
ref|XP_010533129.1|  PREDICTED: 36.4 kDa proline-rich protein         93.2    2e-18   Tarenaya hassleriana [spider flower]
ref|XP_009333634.1|  PREDICTED: 36.4 kDa proline-rich protein-like    92.8    2e-18   Pyrus x bretschneideri [bai li]
ref|XP_008376234.1|  PREDICTED: 36.4 kDa proline-rich protein         92.8    2e-18   
ref|XP_009112260.1|  PREDICTED: 36.4 kDa proline-rich protein         92.8    2e-18   Brassica rapa
emb|CDY18576.1|  BnaA09g08190D                                        92.8    3e-18   Brassica napus [oilseed rape]
ref|XP_009397643.1|  PREDICTED: 36.4 kDa proline-rich protein-like    90.1    4e-18   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008796818.1|  PREDICTED: 36.4 kDa proline-rich protein-like    89.7    4e-18   Phoenix dactylifera
ref|XP_004298649.1|  PREDICTED: 36.4 kDa proline-rich protein         91.3    5e-18   Fragaria vesca subsp. vesca
ref|XP_009397885.1|  PREDICTED: 36.4 kDa proline-rich protein-like    89.7    5e-18   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003525816.1|  PREDICTED: 36.4 kDa proline-rich protein-like    89.7    7e-18   Glycine max [soybeans]
emb|CBI34143.3|  unnamed protein product                              88.6    8e-18   Vitis vinifera
ref|XP_010913319.1|  PREDICTED: 36.4 kDa proline-rich protein         90.5    8e-18   Elaeis guineensis
emb|CBI31905.3|  unnamed protein product                              88.6    1e-17   Vitis vinifera
ref|XP_004516835.1|  PREDICTED: 36.4 kDa proline-rich protein-like    88.6    1e-17   
ref|XP_007013549.1|  Bifunctional inhibitor/lipid-transfer protei...  90.5    2e-17   
ref|XP_011002407.1|  PREDICTED: 36.4 kDa proline-rich protein iso...  89.0    2e-17   Populus euphratica
ref|XP_006841160.1|  PREDICTED: 36.4 kDa proline-rich protein         89.0    2e-17   Amborella trichopoda
emb|CDY12951.1|  BnaA09g13230D                                        90.5    2e-17   Brassica napus [oilseed rape]
ref|XP_011081226.1|  PREDICTED: LOW QUALITY PROTEIN: 36.4 kDa pro...  90.1    2e-17   
ref|XP_011002403.1|  PREDICTED: 36.4 kDa proline-rich protein iso...  89.0    2e-17   Populus euphratica
emb|CDY70376.1|  BnaCnng68070D                                        90.1    2e-17   Brassica napus [oilseed rape]
ref|XP_009113073.1|  PREDICTED: 36.4 kDa proline-rich protein         90.5    2e-17   Brassica rapa
ref|XP_003549908.1|  PREDICTED: 36.4 kDa proline-rich protein-like    88.2    2e-17   Glycine max [soybeans]
ref|XP_007013548.1|  Bifunctional inhibitor/lipid-transfer protei...  89.0    2e-17   
ref|XP_010430304.1|  PREDICTED: LOW QUALITY PROTEIN: 36.4 kDa pro...  90.1    3e-17   Camelina sativa [gold-of-pleasure]
ref|XP_010418242.1|  PREDICTED: 36.4 kDa proline-rich protein-like    90.1    3e-17   Camelina sativa [gold-of-pleasure]
ref|XP_006657183.1|  PREDICTED: 36.4 kDa proline-rich protein-like    88.2    4e-17   Oryza brachyantha
ref|XP_009418218.1|  PREDICTED: 36.4 kDa proline-rich protein-like    88.6    4e-17   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011002408.1|  PREDICTED: 36.4 kDa proline-rich protein iso...  87.4    4e-17   Populus euphratica
ref|XP_002271658.2|  PREDICTED: 36.4 kDa proline-rich protein-like    88.6    4e-17   Vitis vinifera
gb|EYU30299.1|  hypothetical protein MIMGU_mgv11b015559mg             88.6    4e-17   Erythranthe guttata [common monkey flower]
ref|XP_006391857.1|  hypothetical protein EUTSA_v10023531mg           90.5    5e-17   Eutrema salsugineum [saltwater cress]
ref|XP_002531954.1|  lipid binding protein, putative                  88.6    5e-17   
ref|XP_002264442.1|  PREDICTED: 36.4 kDa proline-rich protein-like    87.4    5e-17   
gb|KJB51915.1|  hypothetical protein B456_008G237700                  88.2    5e-17   Gossypium raimondii
emb|CAN80711.1|  hypothetical protein VITISV_033378                   89.0    5e-17   Vitis vinifera
emb|CDP09933.1|  unnamed protein product                              89.0    6e-17   Coffea canephora [robusta coffee]
gb|KFK25908.1|  hypothetical protein AALP_AA8G178300                  89.7    6e-17   Arabis alpina [alpine rockcress]
ref|XP_006380877.1|  hypothetical protein POPTR_0006s01020g           87.4    6e-17   
ref|XP_010258986.1|  PREDICTED: 36.4 kDa proline-rich protein-like    88.2    6e-17   Nelumbo nucifera [Indian lotus]
ref|XP_004242756.1|  PREDICTED: 36.4 kDa proline-rich protein-like    86.3    6e-17   Solanum lycopersicum
ref|XP_007155642.1|  hypothetical protein PHAVU_003G219000g           87.0    6e-17   Phaseolus vulgaris [French bean]
gb|AAL02329.1|  proline-rich protein 1                                87.4    7e-17   Vitis vinifera
gb|EPS72593.1|  hypothetical protein M569_02163                       86.3    7e-17   Genlisea aurea
ref|XP_006358307.1|  PREDICTED: 36.4 kDa proline-rich protein-like    85.9    7e-17   Solanum tuberosum [potatoes]
gb|ABK95045.1|  unknown                                               86.7    8e-17   Populus trichocarpa [western balsam poplar]
ref|XP_011002404.1|  PREDICTED: 36.4 kDa proline-rich protein iso...  86.7    8e-17   Populus euphratica
ref|XP_004965761.1|  PREDICTED: 36.4 kDa proline-rich protein-like    88.6    9e-17   Setaria italica
ref|XP_008795904.1|  PREDICTED: 36.4 kDa proline-rich protein-like    87.0    1e-16   
ref|XP_009607969.1|  PREDICTED: 36.4 kDa proline-rich protein-like    85.5    1e-16   Nicotiana tomentosiformis
emb|CAN77497.1|  hypothetical protein VITISV_040680                   86.3    1e-16   Vitis vinifera
ref|XP_010047989.1|  PREDICTED: 36.4 kDa proline-rich protein-lik...  87.8    1e-16   
ref|XP_009365676.1|  PREDICTED: 36.4 kDa proline-rich protein         86.3    1e-16   Pyrus x bretschneideri [bai li]
ref|XP_008380324.1|  PREDICTED: 36.4 kDa proline-rich protein-like    87.8    1e-16   
ref|XP_010473466.1|  PREDICTED: 36.4 kDa proline-rich protein-like    88.2    1e-16   Camelina sativa [gold-of-pleasure]
ref|XP_002520567.1|  Repetitive proline-rich cell wall protein 2 ...  88.2    1e-16   Ricinus communis
ref|XP_009785634.1|  PREDICTED: 36.4 kDa proline-rich protein-like    85.1    1e-16   Nicotiana sylvestris
ref|XP_007039885.1|  Bifunctional inhibitor/lipid-transfer protei...  87.4    1e-16   
ref|XP_010047988.1|  PREDICTED: 36.4 kDa proline-rich protein-lik...  87.4    2e-16   
ref|XP_008368547.1|  PREDICTED: 36.4 kDa proline-rich protein-like    86.3    2e-16   
ref|XP_007155053.1|  hypothetical protein PHAVU_003G169100g           86.7    2e-16   Phaseolus vulgaris [French bean]
ref|XP_002888023.1|  hypothetical protein ARALYDRAFT_475096           87.8    2e-16   
gb|AFK39919.1|  unknown                                               86.7    2e-16   Lotus japonicus
ref|XP_003631735.1|  PREDICTED: 36.4 kDa proline-rich protein         87.8    2e-16   Vitis vinifera
ref|NP_001058178.1|  Os06g0643500                                     87.0    2e-16   
ref|XP_008342310.1|  PREDICTED: 36.4 kDa proline-rich protein         86.3    2e-16   
gb|AFK49537.1|  unknown                                               86.3    3e-16   Medicago truncatula
gb|ACJ84260.1|  unknown                                               85.9    3e-16   Medicago truncatula
gb|KJB27067.1|  hypothetical protein B456_004G2756001                 84.3    4e-16   Gossypium raimondii
emb|CAA75594.1|  MtN4                                                 86.3    4e-16   Medicago truncatula
ref|XP_010055512.1|  PREDICTED: 36.4 kDa proline-rich protein iso...  86.3    4e-16   
ref|NP_176439.1|  bifunctional inhibitor/lipid-transfer protein/s...  86.7    4e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009595816.1|  PREDICTED: 36.4 kDa proline-rich protein         86.3    4e-16   Nicotiana tomentosiformis
emb|CAA49341.1|  ADR11                                                84.0    5e-16   Glycine max [soybeans]
gb|KHN15055.1|  36.4 kDa proline-rich protein                         84.0    5e-16   Glycine soja [wild soybean]
gb|KJB37623.1|  hypothetical protein B456_006G213000                  85.1    5e-16   Gossypium raimondii
ref|XP_010055511.1|  PREDICTED: 36.4 kDa proline-rich protein iso...  86.3    5e-16   Eucalyptus grandis [rose gum]
ref|XP_010093116.1|  hypothetical protein L484_009307                 86.3    6e-16   Morus notabilis
ref|XP_010687917.1|  PREDICTED: 36.4 kDa proline-rich protein         85.9    6e-16   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011100461.1|  PREDICTED: LOW QUALITY PROTEIN: 36.4 kDa pro...  85.9    6e-16   
ref|XP_006355521.1|  PREDICTED: 36.4 kDa proline-rich protein-like    85.1    7e-16   
ref|XP_003549740.1|  PREDICTED: 36.4 kDa proline-rich protein         84.3    8e-16   
ref|XP_004508457.1|  PREDICTED: 36.4 kDa proline-rich protein-like    85.1    9e-16   Cicer arietinum [garbanzo]
ref|XP_004245751.1|  PREDICTED: 36.4 kDa proline-rich protein         85.5    9e-16   Solanum lycopersicum
ref|XP_006301895.1|  hypothetical protein CARUB_v10022370mg           85.9    1e-15   
ref|XP_010532493.1|  PREDICTED: 36.4 kDa proline-rich protein-like    85.1    1e-15   Tarenaya hassleriana [spider flower]
gb|EMS66044.1|  36.4 kDa proline-rich protein                         82.0    1e-15   Triticum urartu
ref|XP_009759781.1|  PREDICTED: 36.4 kDa proline-rich protein         85.9    1e-15   Nicotiana sylvestris
gb|EMT06542.1|  36.4 kDa proline-rich protein                         81.6    2e-15   
ref|XP_003609406.1|  proline-rich protein                             84.7    2e-15   
ref|XP_008788893.1|  PREDICTED: 36.4 kDa proline-rich protein-like    82.8    2e-15   
ref|XP_003542640.1|  PREDICTED: 36.4 kDa proline-rich protein-like    83.6    3e-15   
ref|XP_008362354.1|  PREDICTED: 36.4 kDa proline-rich protein-like    80.1    3e-15   
gb|KCW47606.1|  hypothetical protein EUGRSUZ_K01352                   80.1    3e-15   Eucalyptus grandis [rose gum]
gb|EYU42870.1|  hypothetical protein MIMGU_mgv1a011120mg              84.0    4e-15   Erythranthe guttata [common monkey flower]
ref|XP_009135778.1|  PREDICTED: 36.4 kDa proline-rich protein-like    83.6    4e-15   Brassica rapa
gb|KFK25004.1|  hypothetical protein AALP_AA8G053900                  84.7    4e-15   Arabis alpina [alpine rockcress]
ref|XP_010490020.1|  PREDICTED: 36.4 kDa proline-rich protein         82.0    6e-15   
ref|XP_006453085.1|  hypothetical protein CICLE_v10009567mg           82.0    6e-15   
ref|XP_008464631.1|  PREDICTED: 36.4 kDa proline-rich protein-like    82.4    6e-15   
ref|NP_001150138.1|  36.4 kDa proline-rich protein precursor          83.2    6e-15   
ref|XP_011001017.1|  PREDICTED: 36.4 kDa proline-rich protein         84.3    6e-15   Populus euphratica
dbj|BAJ34557.1|  unnamed protein product                              84.0    6e-15   Eutrema halophilum
ref|XP_011654010.1|  PREDICTED: 36.4 kDa proline-rich protein         82.4    7e-15   Cucumis sativus [cucumbers]
ref|XP_002323166.2|  hypothetical protein POPTR_0016s01720g           85.1    7e-15   
ref|XP_004304516.1|  PREDICTED: 36.4 kDa proline-rich protein         83.6    7e-15   Fragaria vesca subsp. vesca
emb|CDP06245.1|  unnamed protein product                              84.3    8e-15   Coffea canephora [robusta coffee]
emb|CAA47812.1|  ptxA                                                 83.6    1e-14   Pisum sativum [garden pea]
ref|XP_003601475.1|  Proline rich protein                             83.6    1e-14   Medicago truncatula
ref|XP_002437338.1|  hypothetical protein SORBIDRAFT_10g025210        83.2    1e-14   Sorghum bicolor [broomcorn]
gb|ACF88427.1|  unknown                                               82.8    1e-14   Zea mays [maize]
dbj|BAE71274.1|  hypothetical protein                                 82.0    1e-14   Trifolium pratense [peavine clover]
gb|EEC84097.1|  hypothetical protein OsI_30410                        82.0    1e-14   Oryza sativa Indica Group [Indian rice]
ref|NP_001056927.1|  Os06g0168700                                     82.0    1e-14   
emb|CAA57810.1|  proline-rich-like protein                            80.9    1e-14   Asparagus officinalis
ref|XP_011656197.1|  PREDICTED: 36.4 kDa proline-rich protein-like    84.0    1e-14   Cucumis sativus [cucumbers]
ref|XP_008342311.1|  PREDICTED: 36.4 kDa proline-rich protein-like    82.8    1e-14   
gb|EAZ35967.1|  hypothetical protein OsJ_20271                        82.0    1e-14   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003560341.1|  PREDICTED: 36.4 kDa proline-rich protein-like    82.0    1e-14   Brachypodium distachyon [annual false brome]
ref|XP_012081188.1|  PREDICTED: 36.4 kDa proline-rich protein         81.3    1e-14   Jatropha curcas
gb|ERN15013.1|  hypothetical protein AMTR_s00032p00233360             80.1    1e-14   Amborella trichopoda
ref|XP_006853546.2|  PREDICTED: 36.4 kDa proline-rich protein         80.5    2e-14   
gb|AGT16397.1|  hypothetical protein SHCRBa_181_K17_R_210             82.8    2e-14   Saccharum hybrid cultivar R570
ref|XP_002437917.1|  hypothetical protein SORBIDRAFT_10g004790        82.8    2e-14   Sorghum bicolor [broomcorn]
ref|NP_001144590.1|  uncharacterized protein LOC100277605 precursor   82.4    2e-14   
gb|AFH57274.1|  proline-rich protein                                  84.0    2e-14   Gossypium hirsutum [American cotton]
gb|AAD03487.1|  proline-rich cell wall protein                        83.6    2e-14   Medicago sativa [alfalfa]
dbj|BAJ89958.1|  predicted protein                                    81.6    2e-14   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AGT16919.1|  proline-rich protein                                  82.4    3e-14   Saccharum hybrid cultivar R570
ref|XP_010420896.1|  PREDICTED: 36.4 kDa proline-rich protein-like    82.8    4e-14   
dbj|BAJ88732.1|  predicted protein                                    80.5    4e-14   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010466481.1|  PREDICTED: 36.4 kDa proline-rich protein-like    80.1    5e-14   Camelina sativa [gold-of-pleasure]
gb|AAF32353.1|AF220197_1  proline rich protein 2                      75.9    5e-14   Vitis riparia [frost grape]
ref|XP_008785888.1|  PREDICTED: 36.4 kDa proline-rich protein-like    79.3    5e-14   
ref|XP_003564254.1|  PREDICTED: 36.4 kDa proline-rich protein-like    79.7    6e-14   Brachypodium distachyon [annual false brome]
gb|EMT21385.1|  36.4 kDa proline-rich protein                         79.7    6e-14   
ref|XP_004966695.1|  PREDICTED: 36.4 kDa proline-rich protein-like    80.5    7e-14   Setaria italica
ref|XP_009145429.1|  PREDICTED: 36.4 kDa proline-rich protein-like    81.3    7e-14   Brassica rapa
ref|XP_010038743.1|  PREDICTED: 36.4 kDa proline-rich protein-like    79.3    8e-14   Eucalyptus grandis [rose gum]
emb|CAA64425.1|  cell wall-plasma membrane linker protein             81.3    1e-13   Brassica napus [oilseed rape]
ref|XP_010466478.1|  PREDICTED: 36.4 kDa proline-rich protein-lik...  80.9    1e-13   
ref|XP_010510955.1|  PREDICTED: 36.4 kDa proline-rich protein-like    80.5    1e-13   Camelina sativa [gold-of-pleasure]
ref|XP_006856527.1|  PREDICTED: 36.4 kDa proline-rich protein         79.0    1e-13   Amborella trichopoda
gb|AAC06386.1|  proline rich protein                                  75.1    1e-13   Malus domestica [apple tree]
ref|XP_002307866.2|  hypothetical protein POPTR_0006s01030g           78.2    1e-13   
gb|ACN36521.1|  unknown                                               79.3    2e-13   Zea mays [maize]
gb|ACG39902.1|  36.4 kDa proline-rich protein                         79.3    2e-13   Zea mays [maize]
ref|XP_009346908.1|  PREDICTED: uncharacterized protein LOC103938610  81.3    2e-13   
ref|XP_006655834.1|  PREDICTED: 36.4 kDa proline-rich protein-like    78.2    2e-13   Oryza brachyantha
gb|ABK26093.1|  unknown                                               78.2    2e-13   Picea sitchensis
ref|NP_001149720.1|  hybrid proline-rich protein1 precursor           79.3    2e-13   Zea mays [maize]
ref|XP_004502092.1|  PREDICTED: repetitive proline-rich cell wall...  80.5    2e-13   Cicer arietinum [garbanzo]
gb|ADW66157.1|  proline-rich protein                                  75.1    2e-13   Solanum nigrum
ref|XP_006853490.1|  PREDICTED: 36.4 kDa proline-rich protein         77.0    2e-13   
gb|AAS20977.1|  protease inhibitor/seed storage/lipid transfer pr...  75.5    3e-13   Hyacinthus orientalis [common hyacinth]
gb|ABK24042.1|  unknown                                               77.0    3e-13   Picea sitchensis
ref|XP_006652908.1|  PREDICTED: 36.4 kDa proline-rich protein-like    78.2    3e-13   Oryza brachyantha
ref|XP_009380947.1|  PREDICTED: 36.4 kDa proline-rich protein-like    76.3    3e-13   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABR13301.1|  putative proline-rich cell wall protein               75.1    6e-13   Prunus dulcis [sweet almond]
ref|XP_010490022.1|  PREDICTED: 36.4 kDa proline-rich protein-like    74.7    7e-13   
gb|EMS54619.1|  14 kDa proline-rich protein DC2.15                    73.6    1e-12   Triticum urartu
gb|AAD11796.1|  cell wall-plasma membrane linker protein homolog      77.0    1e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009414495.1|  PREDICTED: 36.4 kDa proline-rich protein-like    75.5    1e-12   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010680174.1|  PREDICTED: 36.4 kDa proline-rich protein-lik...  77.8    2e-12   
ref|XP_010680173.1|  PREDICTED: 36.4 kDa proline-rich protein-lik...  77.8    2e-12   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010914263.1|  PREDICTED: 36.4 kDa proline-rich protein         74.7    2e-12   Elaeis guineensis
gb|AAF75825.1|AF101789_1  proline-rich protein                        73.6    2e-12   Pinus taeda
gb|AGW00930.1|  PRP                                                   73.9    3e-12   Citrus trifoliata [hardy orange]
ref|NP_188851.2|  cell wall-plasma membrane linker protein            76.3    4e-12   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001054058.2|  Os04g0644400                                     73.9    4e-12   
gb|ACU22880.1|  unknown                                               73.9    4e-12   Glycine max [soybeans]
ref|XP_009621287.1|  PREDICTED: 36.4 kDa proline-rich protein-like    75.1    4e-12   Nicotiana tomentosiformis
ref|XP_006429793.1|  hypothetical protein CICLE_v10012789mg           73.9    4e-12   
ref|XP_010436582.1|  PREDICTED: 36.4 kDa proline-rich protein-like    74.3    4e-12   Camelina sativa [gold-of-pleasure]
gb|KHN31117.1|  36.4 kDa proline-rich protein                         76.3    5e-12   Glycine soja [wild soybean]
ref|XP_010440330.1|  PREDICTED: 36.4 kDa proline-rich protein         75.1    5e-12   Camelina sativa [gold-of-pleasure]
ref|XP_006492911.1|  PREDICTED: 36.4 kDa proline-rich protein-lik...  73.6    5e-12   
gb|ACU20743.1|  unknown                                               73.9    6e-12   Glycine max [soybeans]
gb|KJB42884.1|  hypothetical protein B456_007G172300                  74.7    6e-12   Gossypium raimondii
ref|XP_003542174.1|  PREDICTED: 36.4 kDa proline-rich protein-like    75.9    6e-12   
ref|NP_567391.1|  bifunctional inhibitor/lipid-transfer protein/s...  72.0    6e-12   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001141199.1|  uncharacterized protein LOC100273286 precursor   73.6    7e-12   
ref|XP_006492910.1|  PREDICTED: 36.4 kDa proline-rich protein-lik...  73.6    7e-12   Citrus sinensis [apfelsine]
ref|XP_002870258.1|  hypothetical protein ARALYDRAFT_493374           76.3    7e-12   
gb|KJB08619.1|  hypothetical protein B456_001G094000                  76.3    7e-12   Gossypium raimondii
ref|XP_006605589.1|  PREDICTED: 36.4 kDa proline-rich protein-like    75.1    8e-12   Glycine max [soybeans]
ref|XP_009109207.1|  PREDICTED: 36.4 kDa proline-rich protein-lik...  73.6    8e-12   
ref|XP_004977017.1|  PREDICTED: 36.4 kDa proline-rich protein-like    74.3    8e-12   
ref|XP_010449961.1|  PREDICTED: 36.4 kDa proline-rich protein-like    74.7    1e-11   Camelina sativa [gold-of-pleasure]
ref|XP_006396750.1|  hypothetical protein EUTSA_v10029060mg           71.6    1e-11   Eutrema salsugineum [saltwater cress]
dbj|BAJ86617.1|  predicted protein                                    74.7    1e-11   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009109198.1|  PREDICTED: 36.4 kDa proline-rich protein-lik...  73.2    1e-11   
gb|ACU14401.1|  unknown                                               72.8    1e-11   Glycine max [soybeans]
ref|XP_007049066.1|  Bifunctional inhibitor/lipid-transfer protei...  75.1    1e-11   
gb|AAG31637.1|  putative proline-rich protein                         71.6    2e-11   Solanum lycopersicum
ref|XP_007049067.1|  Bifunctional inhibitor/lipid-transfer protei...  74.7    2e-11   
ref|XP_006494496.1|  PREDICTED: 36.4 kDa proline-rich protein-like    72.4    2e-11   
ref|XP_002285197.1|  PREDICTED: putative lipid-binding protein At...  70.9    2e-11   Vitis vinifera
ref|XP_009107833.1|  PREDICTED: 36.4 kDa proline-rich protein-lik...  73.2    2e-11   Brassica rapa
ref|XP_008777671.1|  PREDICTED: 36.4 kDa proline-rich protein-like    71.6    2e-11   
emb|CAE01544.2|  OSJNBa0033G05.15                                     73.2    2e-11   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006286225.1|  hypothetical protein CARUB_v10007792mg           72.8    2e-11   Capsella rubella
emb|CDY39502.1|  BnaA01g24860D                                        73.2    2e-11   Brassica napus [oilseed rape]
ref|XP_010914316.1|  PREDICTED: 36.4 kDa proline-rich protein-like    71.2    2e-11   Elaeis guineensis
emb|CDY19310.1|  BnaC01g31700D                                        73.2    2e-11   Brassica napus [oilseed rape]
ref|XP_002448629.1|  hypothetical protein SORBIDRAFT_06g030490        72.4    2e-11   Sorghum bicolor [broomcorn]
ref|XP_010422224.1|  PREDICTED: lipid transfer protein EARLI 1-like   70.9    2e-11   Camelina sativa [gold-of-pleasure]
ref|XP_010422222.1|  PREDICTED: lipid transfer protein EARLI 1-li...  70.9    2e-11   Camelina sativa [gold-of-pleasure]
ref|XP_009107834.1|  PREDICTED: 36.4 kDa proline-rich protein-lik...  72.4    2e-11   Brassica rapa
ref|XP_010455699.1|  PREDICTED: lipid transfer protein EARLI 1-like   70.9    2e-11   
ref|XP_010455698.1|  PREDICTED: lipid transfer protein EARLI 1-like   70.9    2e-11   
ref|XP_010911928.1|  PREDICTED: 36.4 kDa proline-rich protein-like    74.3    2e-11   
ref|XP_010422223.1|  PREDICTED: lipid transfer protein EARLI 1-li...  70.5    2e-11   
gb|EEE61791.1|  hypothetical protein OsJ_16391                        72.8    2e-11   
ref|XP_011082205.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  70.5    3e-11   
ref|NP_001148182.1|  LOC100281790 precursor                           71.6    3e-11   
ref|XP_006289733.1|  hypothetical protein CARUB_v10003301mg           70.5    3e-11   
gb|KFK24098.1|  hypothetical protein AALP_AAs65529U000100             72.4    3e-11   
gb|EEC78118.1|  hypothetical protein OsI_17654                        72.8    3e-11   
emb|CAJ86153.1|  H0413E07.6                                           72.8    3e-11   
ref|NP_001148843.1|  36.4 kDa proline-rich protein precursor          71.6    3e-11   
ref|XP_006289141.1|  hypothetical protein CARUB_v10002564mg           70.1    4e-11   
dbj|BAD44137.1|  cell wall protein like                               71.2    4e-11   
emb|CDY47794.1|  BnaC01g22500D                                        71.6    4e-11   
ref|XP_010433369.1|  PREDICTED: lipid transfer protein EARLI 1-like   69.7    5e-11   
ref|NP_001154236.2|  bifunctional inhibitor/lipid-transfer protei...  70.9    5e-11   
ref|XP_010260719.1|  PREDICTED: 36.4 kDa proline-rich protein         72.0    5e-11   
ref|XP_008229725.1|  PREDICTED: 36.4 kDa proline-rich protein         73.6    5e-11   
emb|CDY22936.1|  BnaA01g18740D                                        72.4    6e-11   
ref|XP_008807062.1|  PREDICTED: 36.4 kDa proline-rich protein-like    72.0    6e-11   
gb|AGV54787.1|  hypothetical protein                                  72.8    6e-11   
ref|XP_007145990.1|  hypothetical protein PHAVU_006G003700g           72.8    6e-11   
ref|XP_009793942.1|  PREDICTED: 36.4 kDa proline-rich protein-like    72.8    6e-11   
ref|NP_001078199.1|  protease inhibitor/seed storage/LTP family p...  73.6    7e-11   
gb|AGV54811.1|  hypothetical protein                                  72.4    8e-11   
ref|XP_002885484.1|  predicted protein                                73.2    9e-11   
ref|XP_002874779.1|  hypothetical protein ARALYDRAFT_911652           68.9    9e-11   
emb|CAA40361.1|  proline rich protein                                 72.0    9e-11   
emb|CDY59805.1|  BnaA05g35360D                                        70.9    9e-11   
ref|XP_010906726.1|  PREDICTED: 36.4 kDa proline-rich protein-like    70.1    1e-10   
ref|XP_009147527.1|  PREDICTED: 36.4 kDa proline-rich protein         71.6    1e-10   
gb|AEO92077.1|  hybrid proline-rich protein                           72.4    1e-10   
dbj|BAJ89984.1|  predicted protein                                    70.1    1e-10   
ref|XP_009144715.1|  PREDICTED: 36.4 kDa proline-rich protein-like    70.9    1e-10   
ref|XP_006481445.1|  PREDICTED: 36.4 kDa proline-rich protein-like    70.1    1e-10   
sp|Q00451.1|PRF1_SOLLC  RecName: Full=36.4 kDa proline-rich protein   71.6    1e-10   
prf||2022306A  salt-inducible protein RF2                             66.6    1e-10
ref|XP_012076526.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  68.2    2e-10   
ref|XP_011076346.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  68.9    2e-10   
ref|XP_004243657.1|  PREDICTED: 36.4 kDa proline-rich protein         71.6    2e-10   
emb|CAB10295.1|  cell wall protein like                               72.0    2e-10   
ref|XP_006429789.1|  hypothetical protein CICLE_v10013746mg           69.3    2e-10   
ref|XP_010433379.1|  PREDICTED: lipid transfer protein EARLI 1-like   68.2    2e-10   
ref|XP_006425978.1|  hypothetical protein CICLE_v10027482mg           69.3    2e-10   
ref|XP_012083618.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    68.2    2e-10   
ref|NP_193252.5|  bifunctional inhibitor/lipid-transfer protein/s...  70.5    2e-10   
emb|CDY09061.1|  BnaC08g10150D                                        70.1    2e-10   
ref|XP_006353733.1|  PREDICTED: 36.4 kDa proline-rich protein-like    71.6    2e-10   
gb|AEO79031.1|  PRP1 precursor                                        71.2    2e-10   
gb|AFB82981.1|  proline-rich protein                                  69.7    2e-10   
emb|CDY21275.1|  BnaC03g29590D                                        67.8    2e-10   
ref|XP_009134274.1|  PREDICTED: lipid transfer protein EARLI 1-like   67.8    3e-10   
ref|XP_010490023.1|  PREDICTED: proline-rich extensin-like protei...  72.0    3e-10   
gb|AEO79030.1|  PRP1 precursor                                        70.9    3e-10   
emb|CDX90834.1|  BnaA03g25140D                                        67.4    3e-10   
gb|AAB18205.1|  cold acclimation protein WCOR518                      70.5    3e-10   
ref|XP_006429790.1|  hypothetical protein CICLE_v10011810mg           70.9    3e-10   
ref|XP_006366172.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  67.0    4e-10   
gb|KFK31985.1|  hypothetical protein AALP_AA6G185200                  67.4    4e-10   
ref|XP_006429791.1|  hypothetical protein CICLE_v10011810mg           70.9    4e-10   
emb|CAN77080.1|  hypothetical protein VITISV_025477                   67.0    4e-10   
ref|XP_007216673.1|  hypothetical protein PRUPE_ppb004684mg           70.9    4e-10   
ref|XP_011036580.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  67.0    4e-10   
emb|CDY61290.1|  BnaCnng37610D                                        67.0    4e-10   
ref|XP_010553464.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    67.0    5e-10   
ref|XP_002874778.1|  hypothetical protein ARALYDRAFT_911651           67.0    5e-10   
ref|XP_011085466.1|  PREDICTED: 36.4 kDa proline-rich protein         70.1    5e-10   
ref|XP_006414560.1|  hypothetical protein EUTSA_v10025987mg           68.9    5e-10   
emb|CDY06505.1|  BnaC06g11390D                                        68.2    5e-10   
ref|XP_003603362.1|  Proline-rich protein                             66.6    6e-10   
ref|XP_002324869.2|  hypothetical protein POPTR_0018s01890g           66.2    7e-10   
gb|EMS56167.1|  36.4 kDa proline-rich protein                         70.1    7e-10   
ref|XP_009403208.1|  PREDICTED: 36.4 kDa proline-rich protein-like    68.6    7e-10   
ref|XP_006396753.1|  hypothetical protein EUTSA_v10029038mg           66.6    8e-10   
ref|XP_006306558.1|  hypothetical protein CARUB_v10012658mg           66.2    8e-10   
gb|KDO38754.1|  hypothetical protein CISIN_1g040356mg                 67.8    8e-10   
ref|XP_006396754.1|  hypothetical protein EUTSA_v10029528mg           66.6    9e-10   
dbj|BAJ90863.1|  predicted protein                                    70.1    9e-10   
ref|XP_002515493.1|  14 kDa proline-rich protein DC2.15 precursor...  66.2    1e-09   
ref|XP_002533299.1|  14 kDa proline-rich protein DC2.15 precursor...  66.2    1e-09   
gb|EMT20314.1|  Cortical cell-delineating protein                     66.2    1e-09   
gb|EMT20315.1|  Cortical cell-delineating protein                     66.2    1e-09   
ref|XP_008394102.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  65.9    1e-09   
ref|XP_009134275.1|  PREDICTED: lipid transfer protein EARLI 1-like   65.9    1e-09   
ref|XP_006477234.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  65.9    1e-09   
ref|XP_009333597.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  65.9    1e-09   
ref|XP_011469171.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    65.5    2e-09   
ref|XP_010055514.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  65.5    2e-09   
ref|XP_006440349.1|  hypothetical protein CICLE_v10022832mg           65.5    2e-09   
gb|AEW08695.1|  hypothetical protein CL1225Contig1_03                 63.9    2e-09   
ref|XP_009333675.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  65.9    2e-09   
ref|XP_010264240.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  65.5    2e-09   
emb|CDX82944.1|  BnaC01g13940D                                        65.5    2e-09   
ref|XP_011081224.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  65.1    2e-09   
gb|EMS63332.1|  Cortical cell-delineating protein                     65.1    2e-09   
gb|EMS63331.1|  Cortical cell-delineating protein                     65.1    2e-09   
gb|AFG60376.1|  hypothetical protein CL1225Contig1_03                 63.5    2e-09   
ref|XP_006429788.1|  hypothetical protein CICLE_v10011766mg           68.6    2e-09   
ref|XP_009611018.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  65.1    3e-09   
emb|CDY21274.1|  BnaC03g29580D                                        65.5    3e-09   
ref|XP_006355477.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  65.1    3e-09   
ref|XP_009798259.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  65.1    3e-09   
ref|XP_010433403.1|  PREDICTED: pEARLI1-like lipid transfer prote...  65.5    3e-09   
ref|XP_009135928.1|  PREDICTED: putative lipid-binding protein AIR1   64.7    3e-09   
gb|AAA33132.1|  hybrid proline-rich protein;cytokinin-induced;hau...  67.8    3e-09   
ref|XP_010695114.1|  PREDICTED: lipid transfer protein EARLI 1-like   65.5    3e-09   
ref|NP_001233824.1|  arachidonic acid-induced DEA1 precursor          64.7    3e-09   
gb|AEW08694.1|  hypothetical protein CL1225Contig1_03                 63.2    3e-09   
gb|AFB33865.1|  hypothetical protein CL1225Contig1_03                 63.2    3e-09   
ref|XP_009113072.1|  PREDICTED: lipid transfer protein EARLI 1        65.1    3e-09   
gb|AAC60566.1|  proline-rich SAC51                                    65.1    3e-09   
emb|CDX90833.1|  BnaA03g25130D                                        65.1    4e-09   
ref|XP_007052129.1|  Bifunctional inhibitor/lipid-transfer protei...  64.7    4e-09   
gb|EYU30303.1|  hypothetical protein MIMGU_mgv1a016181mg              64.3    4e-09   
ref|XP_012087160.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    64.3    4e-09   
ref|XP_006396751.1|  hypothetical protein EUTSA_v10029036mg           64.7    4e-09   
ref|XP_006391856.1|  hypothetical protein EUTSA_v10023747mg           64.7    4e-09   
ref|NP_001152394.1|  36.4 kDa proline-rich protein precursor          64.7    4e-09   
ref|XP_010695113.1|  PREDICTED: lipid transfer protein EARLI 1-like   65.1    4e-09   
ref|XP_004235150.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  63.9    4e-09   
ref|XP_006417265.1|  hypothetical protein EUTSA_v10009083mg           64.3    4e-09   
ref|XP_006445312.1|  hypothetical protein CICLE_v10022835mg           64.3    5e-09   
ref|XP_011018291.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    64.3    5e-09   
ref|XP_010055513.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  63.9    6e-09   
ref|XP_009134272.1|  PREDICTED: lipid transfer protein EARLI 1-like   64.3    6e-09   
ref|XP_007039887.1|  Bifunctional inhibitor/lipid-transfer protei...  63.9    6e-09   
dbj|BAK03206.1|  predicted protein                                    63.9    6e-09   
ref|XP_006368193.1|  hypothetical protein POPTR_0001s00400g           63.9    6e-09   
ref|XP_008338137.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  63.9    6e-09   
ref|XP_010493734.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  63.9    6e-09   
ref|XP_010539640.1|  PREDICTED: lipid transfer protein EARLI 1-like   63.9    6e-09   
ref|XP_006302912.1|  hypothetical protein CARUB_v10021046mg           64.3    7e-09   
emb|CDY31241.1|  BnaC08g15360D                                        63.9    7e-09   
gb|AFK43955.1|  unknown                                               63.5    7e-09   
ref|XP_002270769.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    63.9    7e-09   
ref|XP_002454525.1|  hypothetical protein SORBIDRAFT_04g032660        63.5    7e-09   
ref|XP_009795308.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  63.5    7e-09   
ref|XP_002454523.1|  hypothetical protein SORBIDRAFT_04g032640        63.5    7e-09   
ref|XP_004245748.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  63.5    7e-09   
ref|XP_002454524.1|  hypothetical protein SORBIDRAFT_04g032650        63.5    7e-09   
ref|XP_009795761.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  63.9    8e-09   
dbj|BAA05471.1|  tumor-related protein                                62.8    8e-09   
ref|NP_192984.1|  azelaic acid induced 1                              63.9    8e-09   
ref|XP_009114618.1|  PREDICTED: lipid transfer protein EARLI 1        64.3    8e-09   
gb|EYU24741.1|  hypothetical protein MIMGU_mgv1a016172mg              63.5    8e-09   
ref|XP_009110670.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    63.5    8e-09   
emb|CDY21034.1|  BnaA08g24910D                                        63.5    8e-09   
ref|XP_009123402.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  63.5    9e-09   
emb|CDY32208.1|  BnaA03g54590D                                        63.5    9e-09   
ref|XP_003559026.1|  PREDICTED: putative lipid-binding protein AIR1   63.5    9e-09   
emb|CDY08680.1|  BnaC04g19890D                                        63.5    9e-09   
ref|XP_009795760.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  63.9    9e-09   
ref|XP_010048953.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  63.2    9e-09   
ref|XP_009333630.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  63.5    9e-09   
ref|XP_006396752.1|  hypothetical protein EUTSA_v10029040mg           63.5    1e-08   
ref|XP_009783445.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  63.5    1e-08   
ref|XP_008392581.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  63.5    1e-08   
ref|XP_008445235.1|  PREDICTED: pEARLI1-like lipid transfer prote...  63.5    1e-08   
gb|KDO61485.1|  hypothetical protein CISIN_1g047179mg                 63.2    1e-08   
ref|XP_006440346.1|  hypothetical protein CICLE_v10022839mg           63.2    1e-08   
ref|NP_001140565.1|  uncharacterized protein LOC100272630 precursor   63.5    1e-08   
ref|XP_009796138.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  63.5    1e-08   
gb|ABF93505.1|  retrotransposon protein, putative, Ty1-copia subc...  63.9    1e-08   
ref|XP_010430305.1|  PREDICTED: lipid transfer protein EARLI 1        63.5    1e-08   
ref|XP_010473467.1|  PREDICTED: lipid transfer protein EARLI 1-like   63.5    1e-08   
ref|XP_010418243.1|  PREDICTED: lipid transfer protein EARLI 1-like   63.5    1e-08   
ref|XP_010088890.1|  hypothetical protein L484_020878                 63.2    1e-08   
gb|AFK37174.1|  unknown                                               63.2    1e-08   
gb|EPS71802.1|  hypothetical protein M569_02964                       63.5    1e-08   
ref|XP_010493743.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  63.2    1e-08   
gb|KDO50207.1|  hypothetical protein CISIN_1g038618mg                 62.8    1e-08   
gb|KFK25909.1|  hypothetical protein AALP_AA8G178400                  63.5    1e-08   
ref|XP_010906608.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  63.2    1e-08   
emb|CBI31906.3|  unnamed protein product                              62.8    1e-08   
ref|NP_001288371.1|  36.4 kDa proline-rich protein-like precursor     63.2    1e-08   
ref|XP_006367623.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  63.2    1e-08   
ref|NP_001048668.1|  Os03g0103300                                     63.9    1e-08   
ref|XP_010676148.1|  PREDICTED: pEARLI1-like lipid transfer prote...  63.5    1e-08   
gb|EAY88189.1|  hypothetical protein OsI_09636                        63.9    1e-08   
ref|XP_010906606.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  63.2    1e-08   
ref|XP_009782706.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  63.5    1e-08   
dbj|BAG50511.1|  qLTG-3-1                                             63.9    1e-08   
ref|XP_010906607.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  62.8    1e-08   
ref|XP_010919519.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  63.2    1e-08   
ref|XP_009796139.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  63.5    1e-08   
ref|XP_011081228.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  62.8    1e-08   
dbj|BAJ08379.1|  qLTG3-1                                              63.9    1e-08   
gb|EAY95111.1|  hypothetical protein OsI_16928                        63.2    1e-08   
dbj|BAJ08384.1|  qLTG3-1                                              63.9    1e-08   
dbj|BAJ08383.1|  qLTG3-1                                              63.9    1e-08   
dbj|BAJ08381.1|  qLTG3-1                                              63.9    1e-08   
ref|NP_001053513.2|  Os04g0554800                                     62.8    1e-08   
ref|XP_010695178.1|  PREDICTED: pEARLI1-like lipid transfer prote...  64.3    1e-08   
ref|XP_006477231.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  62.8    1e-08   
dbj|BAJ08382.1|  qLTG3-1                                              63.9    1e-08   
dbj|BAJ08386.1|  qLTG3-1                                              63.9    1e-08   
ref|XP_009617786.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  63.2    1e-08   
ref|XP_010258988.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  62.8    1e-08   
ref|XP_012066415.1|  PREDICTED: 36.4 kDa proline-rich protein-lik...  65.5    1e-08   
ref|XP_004235149.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  62.4    1e-08   
gb|EAY95514.1|  hypothetical protein OsI_17360                        63.5    1e-08   
ref|XP_004235416.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  62.4    2e-08   
dbj|BAJ08385.1|  qLTG3-1                                              63.9    2e-08   
ref|XP_010053451.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  62.8    2e-08   
ref|XP_006413657.1|  hypothetical protein EUTSA_v10026536mg           62.8    2e-08   
ref|XP_010433400.1|  PREDICTED: lipid transfer protein EARLI 1-like   63.2    2e-08   
ref|XP_010422217.1|  PREDICTED: lipid transfer protein EARLI 1-like   63.2    2e-08   
ref|XP_006440347.1|  hypothetical protein CICLE_v10022825mg           62.8    2e-08   
ref|XP_009619252.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  63.2    2e-08   
ref|XP_012066414.1|  PREDICTED: 36.4 kDa proline-rich protein-lik...  65.5    2e-08   
ref|XP_010695112.1|  PREDICTED: lipid transfer protein EARLI 1-like   63.9    2e-08   
ref|XP_006429794.1|  hypothetical protein CICLE_v10013074mg           62.8    2e-08   
ref|XP_008786990.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  62.4    2e-08   
ref|XP_011001498.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  62.4    2e-08   
gb|KCW77749.1|  hypothetical protein EUGRSUZ_D02043                   62.8    2e-08   
ref|XP_009110671.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    62.4    2e-08   
ref|XP_006417266.1|  hypothetical protein EUTSA_v10009061mg           62.4    2e-08   
emb|CAI51313.1|  arachidonic acid-induced DEA1                        62.8    2e-08   
gb|KFK28807.1|  hypothetical protein AALP_AA7G051200                  62.4    2e-08   
ref|XP_010422221.1|  PREDICTED: lipid transfer protein EARLI 1        62.8    2e-08   



>ref|XP_011078375.1| PREDICTED: 36.4 kDa proline-rich protein-like [Sesamum indicum]
Length=208

 Score =   119 bits (298),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 77/82 (94%), Positives = 81/82 (99%), Gaps = 0/82 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            IDTLKLGACVDLLGGLVH+GLGDPAVNECCP+L GLVELEAAACLCTTLKIKALNL+IYV
Sbjct  127  IDTLKLGACVDLLGGLVHIGLGDPAVNECCPMLSGLVELEAAACLCTTLKIKALNLNIYV  186

Query  621  PLALQLLVTCGKTPPPGYTCAL  686
            PLALQLLVTCGKTPPPGYTC+L
Sbjct  187  PLALQLLVTCGKTPPPGYTCSL  208



>ref|XP_011020188.1| PREDICTED: 36.4 kDa proline-rich protein-like [Populus euphratica]
Length=193

 Score =   118 bits (296),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 75/82 (91%), Positives = 80/82 (98%), Gaps = 0/82 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            IDTLKLGACVDLLGGLVH+GLGDP VN+CCP+LKGLVELEAA CLCTTLKIKALNL+IYV
Sbjct  112  IDTLKLGACVDLLGGLVHIGLGDPVVNQCCPVLKGLVELEAAVCLCTTLKIKALNLNIYV  171

Query  621  PLALQLLVTCGKTPPPGYTCAL  686
            PLALQLLVTCGKTPPPGYTC+L
Sbjct  172  PLALQLLVTCGKTPPPGYTCSL  193



>ref|XP_011017834.1| PREDICTED: 36.4 kDa proline-rich protein-like [Populus euphratica]
Length=219

 Score =   119 bits (297),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 76/82 (93%), Positives = 80/82 (98%), Gaps = 0/82 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            IDTLKLGACVDLLGGLVHVGLGDP VN+CCP+LKGLVELEAA CLCTTLKIKALNL+IYV
Sbjct  138  IDTLKLGACVDLLGGLVHVGLGDPVVNQCCPVLKGLVELEAAVCLCTTLKIKALNLNIYV  197

Query  621  PLALQLLVTCGKTPPPGYTCAL  686
            PLALQLLVTCGKTPPPGYTC+L
Sbjct  198  PLALQLLVTCGKTPPPGYTCSL  219



>gb|AAT42190.1| putative proline-rich protein [Nicotiana tabacum]
Length=195

 Score =   116 bits (291),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 74/82 (90%), Positives = 79/82 (96%), Gaps = 0/82 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            IDTLKLGACVDLLGGLVH+G+GDPAVNECCPIL GLVELEAAACLCTTLK+K LNL I+V
Sbjct  114  IDTLKLGACVDLLGGLVHIGIGDPAVNECCPILHGLVELEAAACLCTTLKVKLLNLKIFV  173

Query  621  PLALQLLVTCGKTPPPGYTCAL  686
            PLALQLLVTCGKTPPPGYTC+L
Sbjct  174  PLALQLLVTCGKTPPPGYTCSL  195



>ref|XP_002308060.1| hypothetical protein POPTR_0006s06430g [Populus trichocarpa]
 gb|ABK95081.1| unknown [Populus trichocarpa]
 gb|EEE91583.1| hypothetical protein POPTR_0006s06430g [Populus trichocarpa]
Length=198

 Score =   115 bits (289),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 74/82 (90%), Positives = 79/82 (96%), Gaps = 0/82 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            IDTLKLGACVDLLGGLVH+GLGDP VN+CCP+L GLVELEAA CLCTTLKIKALNL+IYV
Sbjct  117  IDTLKLGACVDLLGGLVHIGLGDPVVNQCCPVLTGLVELEAAVCLCTTLKIKALNLNIYV  176

Query  621  PLALQLLVTCGKTPPPGYTCAL  686
            PLALQLLVTCGKTPPPGYTC+L
Sbjct  177  PLALQLLVTCGKTPPPGYTCSL  198



>ref|XP_009613824.1| PREDICTED: repetitive proline-rich cell wall protein 1 [Nicotiana 
tomentosiformis]
Length=289

 Score =   118 bits (295),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 75/82 (91%), Positives = 80/82 (98%), Gaps = 0/82 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            IDTLKLGACVDLLGGLVH+G+GDPAVNECCPIL+GLVELEAAACLCTTLK+K LNL IYV
Sbjct  208  IDTLKLGACVDLLGGLVHIGIGDPAVNECCPILQGLVELEAAACLCTTLKVKLLNLKIYV  267

Query  621  PLALQLLVTCGKTPPPGYTCAL  686
            PLALQLLVTCGKTPPPGYTC+L
Sbjct  268  PLALQLLVTCGKTPPPGYTCSL  289



>ref|XP_004251730.1| PREDICTED: 36.4 kDa proline-rich protein [Solanum lycopersicum]
Length=262

 Score =   116 bits (291),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 74/82 (90%), Positives = 79/82 (96%), Gaps = 0/82 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            IDTLKLGACVDLLGGLVH+GLGDPAVNECCPIL GLVELEAAACLCTTLK+K LNL IYV
Sbjct  181  IDTLKLGACVDLLGGLVHIGLGDPAVNECCPILSGLVELEAAACLCTTLKVKLLNLKIYV  240

Query  621  PLALQLLVTCGKTPPPGYTCAL  686
            PLALQLLVTCGK+PPPGYTC++
Sbjct  241  PLALQLLVTCGKSPPPGYTCSI  262



>ref|XP_009793400.1| PREDICTED: repetitive proline-rich cell wall protein 1 [Nicotiana 
sylvestris]
Length=280

 Score =   116 bits (291),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 74/82 (90%), Positives = 79/82 (96%), Gaps = 0/82 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            IDTLKLGACVDLLGGLVH+G+GDPAVNECCPIL GLVELEAAACLCTTLK+K LNL I+V
Sbjct  199  IDTLKLGACVDLLGGLVHIGIGDPAVNECCPILHGLVELEAAACLCTTLKVKLLNLKIFV  258

Query  621  PLALQLLVTCGKTPPPGYTCAL  686
            PLALQLLVTCGKTPPPGYTC+L
Sbjct  259  PLALQLLVTCGKTPPPGYTCSL  280



>ref|XP_006345219.1| PREDICTED: 36.4 kDa proline-rich protein-like [Solanum tuberosum]
Length=241

 Score =   115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 74/82 (90%), Positives = 79/82 (96%), Gaps = 0/82 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            IDTLKLGACVDLLGGLVH+GLGDPAVNECCPIL GLVELEAAACLCTTLK+K LNL IYV
Sbjct  160  IDTLKLGACVDLLGGLVHIGLGDPAVNECCPILSGLVELEAAACLCTTLKVKLLNLKIYV  219

Query  621  PLALQLLVTCGKTPPPGYTCAL  686
            PLALQLLVTCGK+PPPGYTC++
Sbjct  220  PLALQLLVTCGKSPPPGYTCSI  241



>ref|XP_010090189.1| hypothetical protein L484_011178 [Morus notabilis]
 gb|EXB39018.1| hypothetical protein L484_011178 [Morus notabilis]
Length=248

 Score =   115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 74/82 (90%), Positives = 80/82 (98%), Gaps = 0/82 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            IDTLKLGACVDLLGGLVH+GLGDP VN+CCPIL+GLVE+EAA CLCTTLKIKALNL+IYV
Sbjct  167  IDTLKLGACVDLLGGLVHIGLGDPVVNKCCPILQGLVEVEAAVCLCTTLKIKALNLNIYV  226

Query  621  PLALQLLVTCGKTPPPGYTCAL  686
            PLALQLLVTCGKTPPPGYTC+L
Sbjct  227  PLALQLLVTCGKTPPPGYTCSL  248


 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +3

Query  33   MEVSKVTALLLISMLFISSATPILACGSCGKPS  131
            ME SK  ALLLI MLF+SS TPIL CGSCGKPS
Sbjct  1    MEFSKSYALLLICMLFVSSVTPILGCGSCGKPS  33



>ref|XP_002324631.2| hypothetical protein POPTR_0018s12630g [Populus trichocarpa]
 gb|EEF03196.2| hypothetical protein POPTR_0018s12630g [Populus trichocarpa]
Length=309

 Score =   117 bits (292),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 75/82 (91%), Positives = 79/82 (96%), Gaps = 0/82 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            IDTLKLG CVDLLGGLVHVGLGDP VN+CCP+LKGLVELEAA CLCTTLKIKALNL+IYV
Sbjct  228  IDTLKLGNCVDLLGGLVHVGLGDPVVNQCCPVLKGLVELEAAVCLCTTLKIKALNLNIYV  287

Query  621  PLALQLLVTCGKTPPPGYTCAL  686
            PLALQLLVTCGKTPPPGYTC+L
Sbjct  288  PLALQLLVTCGKTPPPGYTCSL  309



>ref|XP_009340667.1| PREDICTED: 36.4 kDa proline-rich protein-like [Pyrus x bretschneideri]
Length=209

 Score =   114 bits (285),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 72/82 (88%), Positives = 79/82 (96%), Gaps = 0/82 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            IDTLKLGACVDLLGGLVH+GLGDPAVNECCP+L+GL ELEAA CLCTTLKIK LNL+I+V
Sbjct  128  IDTLKLGACVDLLGGLVHIGLGDPAVNECCPVLQGLAELEAAVCLCTTLKIKLLNLNIFV  187

Query  621  PLALQLLVTCGKTPPPGYTCAL  686
            PLALQLLVTCGK+PPPGYTC+L
Sbjct  188  PLALQLLVTCGKSPPPGYTCSL  209



>ref|XP_008336989.1| PREDICTED: 36.4 kDa proline-rich protein-like [Malus domestica]
Length=193

 Score =   113 bits (282),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 72/82 (88%), Positives = 78/82 (95%), Gaps = 0/82 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            IDTLKLGACVDLLGGLVH+GLGDPAVNECCP+L+GL ELEAA CLCTTLKIK LNL+I+V
Sbjct  112  IDTLKLGACVDLLGGLVHIGLGDPAVNECCPVLQGLAELEAAVCLCTTLKIKLLNLNIFV  171

Query  621  PLALQLLVTCGKTPPPGYTCAL  686
            PLALQLLVTCGK PPPGYTC+L
Sbjct  172  PLALQLLVTCGKNPPPGYTCSL  193



>ref|XP_008354364.1| PREDICTED: 36.4 kDa proline-rich protein-like isoform X2 [Malus 
domestica]
Length=253

 Score =   113 bits (282),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 71/82 (87%), Positives = 78/82 (95%), Gaps = 0/82 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            IDTLKLGACVDLLGGLVHVG GDP VNECCP+L+GLVELEAA CLCTTLKIK LNL+I+V
Sbjct  172  IDTLKLGACVDLLGGLVHVGQGDPVVNECCPVLQGLVELEAAVCLCTTLKIKLLNLNIFV  231

Query  621  PLALQLLVTCGKTPPPGYTCAL  686
            PLALQLLVTCGK+PPPG+TC+L
Sbjct  232  PLALQLLVTCGKSPPPGFTCSL  253



>ref|XP_008354363.1| PREDICTED: 36.4 kDa proline-rich protein-like isoform X1 [Malus 
domestica]
Length=287

 Score =   114 bits (284),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 71/82 (87%), Positives = 78/82 (95%), Gaps = 0/82 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            IDTLKLGACVDLLGGLVHVG GDP VNECCP+L+GLVELEAA CLCTTLKIK LNL+I+V
Sbjct  206  IDTLKLGACVDLLGGLVHVGQGDPVVNECCPVLQGLVELEAAVCLCTTLKIKLLNLNIFV  265

Query  621  PLALQLLVTCGKTPPPGYTCAL  686
            PLALQLLVTCGK+PPPG+TC+L
Sbjct  266  PLALQLLVTCGKSPPPGFTCSL  287



>ref|XP_009363973.1| PREDICTED: 36.4 kDa proline-rich protein-like [Pyrus x bretschneideri]
 ref|XP_009363974.1| PREDICTED: 36.4 kDa proline-rich protein-like [Pyrus x bretschneideri]
Length=287

 Score =   112 bits (281),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 70/82 (85%), Positives = 78/82 (95%), Gaps = 0/82 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            IDTLKLGACVDLLGGLVH+G GDP VNECCP+L+GLVELEAA CLCTTLKIK LNL+I+V
Sbjct  206  IDTLKLGACVDLLGGLVHIGQGDPVVNECCPVLQGLVELEAAVCLCTTLKIKLLNLNIFV  265

Query  621  PLALQLLVTCGKTPPPGYTCAL  686
            PLALQLLVTCGK+PPPG+TC+L
Sbjct  266  PLALQLLVTCGKSPPPGFTCSL  287



>ref|XP_010241580.1| PREDICTED: 36.4 kDa proline-rich protein [Nelumbo nucifera]
Length=194

 Score =   110 bits (276),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 70/82 (85%), Positives = 78/82 (95%), Gaps = 0/82 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            IDTLKLGACVDLLGGLVH+GLGDP VN+CCP+L+GLVELEAA CLCTTLK+K LN++IY+
Sbjct  113  IDTLKLGACVDLLGGLVHIGLGDPVVNQCCPLLEGLVELEAAVCLCTTLKVKLLNINIYL  172

Query  621  PLALQLLVTCGKTPPPGYTCAL  686
            PLALQLLVTCGKTPPPGYTC L
Sbjct  173  PLALQLLVTCGKTPPPGYTCTL  194



>ref|XP_008242820.1| PREDICTED: repetitive proline-rich cell wall protein 1 [Prunus 
mume]
Length=315

 Score =   113 bits (283),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 70/82 (85%), Positives = 78/82 (95%), Gaps = 0/82 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            IDTLKLGACVDLLGGLVH+G GDP VNECCP+L+GLVELEAA CLCTTLKIK LNL+I+V
Sbjct  234  IDTLKLGACVDLLGGLVHIGQGDPVVNECCPVLQGLVELEAAVCLCTTLKIKLLNLNIFV  293

Query  621  PLALQLLVTCGKTPPPGYTCAL  686
            P+ALQLLVTCGK+PPPGYTC+L
Sbjct  294  PIALQLLVTCGKSPPPGYTCSL  315



>ref|XP_007202524.1| hypothetical protein PRUPE_ppa010958mg [Prunus persica]
 gb|EMJ03723.1| hypothetical protein PRUPE_ppa010958mg [Prunus persica]
Length=229

 Score =   111 bits (278),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 68/82 (83%), Positives = 78/82 (95%), Gaps = 0/82 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            IDT+KLGACVDLLGGLVH+G GDP VNECCP+L+GLVELEAA CLCTTLK+K LNL+I+V
Sbjct  148  IDTMKLGACVDLLGGLVHIGQGDPVVNECCPVLQGLVELEAAMCLCTTLKMKLLNLNIFV  207

Query  621  PLALQLLVTCGKTPPPGYTCAL  686
            P+ALQLLVTCGK+PPPGYTC+L
Sbjct  208  PIALQLLVTCGKSPPPGYTCSL  229



>gb|EYU18244.1| hypothetical protein MIMGU_mgv1a011967mg [Erythranthe guttata]
Length=265

 Score =   112 bits (279),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 70/82 (85%), Positives = 78/82 (95%), Gaps = 0/82 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            IDTLKLGACVDLLGGLVH+GLGDPAVNECCPI+ GLVE EAAACLCTTLK+KALNL +YV
Sbjct  184  IDTLKLGACVDLLGGLVHIGLGDPAVNECCPIISGLVEAEAAACLCTTLKVKALNLKLYV  243

Query  621  PLALQLLVTCGKTPPPGYTCAL  686
            P+ALQLLV+CGKTPPPGY C++
Sbjct  244  PIALQLLVSCGKTPPPGYECSI  265



>ref|XP_010656474.1| PREDICTED: 36.4 kDa proline-rich protein [Vitis vinifera]
Length=266

 Score =   112 bits (279),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 71/82 (87%), Positives = 76/82 (93%), Gaps = 0/82 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            IDTLKLGACVDLLGGLVH+GLGDP  NECCP+L GLVELEAA CLCTTLKIK LNL+IYV
Sbjct  185  IDTLKLGACVDLLGGLVHIGLGDPVANECCPVLSGLVELEAAVCLCTTLKIKLLNLNIYV  244

Query  621  PLALQLLVTCGKTPPPGYTCAL  686
            PLALQLL+TCGKTPPPGYTC +
Sbjct  245  PLALQLLITCGKTPPPGYTCTV  266



>dbj|BAJ34930.1| hypothetical protein [Vitis hybrid cultivar]
Length=244

 Score =   111 bits (277),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 71/82 (87%), Positives = 76/82 (93%), Gaps = 0/82 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            IDTLKLGACVDLLGGLVH+GLGDP  NECCP+L GLVELEAA CLCTTLKIK LNL+IYV
Sbjct  163  IDTLKLGACVDLLGGLVHIGLGDPVANECCPVLSGLVELEAAVCLCTTLKIKLLNLNIYV  222

Query  621  PLALQLLVTCGKTPPPGYTCAL  686
            PLALQLL+TCGKTPPPGYTC +
Sbjct  223  PLALQLLITCGKTPPPGYTCTV  244



>ref|XP_008443950.1| PREDICTED: 36.4 kDa proline-rich protein isoform X2 [Cucumis 
melo]
Length=199

 Score =   110 bits (274),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 69/82 (84%), Positives = 75/82 (91%), Gaps = 0/82 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            IDTLKLG CVDLLGGLVH+G+GDPA N CCPI+ GL ELEAA CLCTTLKIKALNL IYV
Sbjct  118  IDTLKLGGCVDLLGGLVHIGIGDPAANACCPIISGLAELEAAVCLCTTLKIKALNLKIYV  177

Query  621  PLALQLLVTCGKTPPPGYTCAL  686
            P+ALQLL+TCGKTPPPGYTC+L
Sbjct  178  PIALQLLITCGKTPPPGYTCSL  199



>gb|KJB23625.1| hypothetical protein B456_004G107700 [Gossypium raimondii]
Length=172

 Score =   109 bits (272),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 70/81 (86%), Positives = 76/81 (94%), Gaps = 0/81 (0%)
 Frame = +3

Query  444  DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  623
            DTLKLGACVDLLGGLVH+GLGDP VN CCP+L GLVELEAA CLCTTLK+K LNL+IYVP
Sbjct  92   DTLKLGACVDLLGGLVHIGLGDPLVNACCPVLAGLVELEAAVCLCTTLKLKVLNLNIYVP  151

Query  624  LALQLLVTCGKTPPPGYTCAL  686
            LALQLL+TCGKTPPPGYTC+L
Sbjct  152  LALQLLITCGKTPPPGYTCSL  172



>gb|KJB53996.1| hypothetical protein B456_009G015500 [Gossypium raimondii]
Length=194

 Score =   109 bits (273),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 70/82 (85%), Positives = 76/82 (93%), Gaps = 0/82 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            IDTLKLGACVDLLGGLVH+GLGDP +N+CCP+L GL ELEAA CLCTTLK+K LNL IYV
Sbjct  113  IDTLKLGACVDLLGGLVHIGLGDPVLNQCCPVLSGLAELEAAVCLCTTLKLKVLNLKIYV  172

Query  621  PLALQLLVTCGKTPPPGYTCAL  686
            PLALQLLVTCGKTPPPGYTC+L
Sbjct  173  PLALQLLVTCGKTPPPGYTCSL  194



>gb|EYU18245.1| hypothetical protein MIMGU_mgv11b010660mg [Erythranthe guttata]
Length=240

 Score =   110 bits (276),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 70/82 (85%), Positives = 77/82 (94%), Gaps = 0/82 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            IDTLKLGACVDLLGGLVH+GLGDPAVNECCPI+ GLVE EAA CLCTTLKIKALNL +YV
Sbjct  159  IDTLKLGACVDLLGGLVHIGLGDPAVNECCPIISGLVEAEAAVCLCTTLKIKALNLKLYV  218

Query  621  PLALQLLVTCGKTPPPGYTCAL  686
            P+ALQLLVTCGK+PPPGY C++
Sbjct  219  PIALQLLVTCGKSPPPGYECSI  240



>ref|XP_008443949.1| PREDICTED: 36.4 kDa proline-rich protein isoform X1 [Cucumis 
melo]
Length=215

 Score =   110 bits (274),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 69/82 (84%), Positives = 75/82 (91%), Gaps = 0/82 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            IDTLKLG CVDLLGGLVH+G+GDPA N CCPI+ GL ELEAA CLCTTLKIKALNL IYV
Sbjct  134  IDTLKLGGCVDLLGGLVHIGIGDPAANACCPIISGLAELEAAVCLCTTLKIKALNLKIYV  193

Query  621  PLALQLLVTCGKTPPPGYTCAL  686
            P+ALQLL+TCGKTPPPGYTC+L
Sbjct  194  PIALQLLITCGKTPPPGYTCSL  215



>ref|XP_011084187.1| PREDICTED: 36.4 kDa proline-rich protein-like [Sesamum indicum]
Length=305

 Score =   111 bits (277),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 70/82 (85%), Positives = 78/82 (95%), Gaps = 0/82 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            IDTLKLGACVDLLGGLVH+GLGDPAVN+CCP++ GL E+EAA CLCTTLKIKALNL IYV
Sbjct  224  IDTLKLGACVDLLGGLVHIGLGDPAVNKCCPVISGLAEVEAAVCLCTTLKIKALNLKIYV  283

Query  621  PLALQLLVTCGKTPPPGYTCAL  686
            P+ALQLLVTCGKTPPPG+TC+L
Sbjct  284  PIALQLLVTCGKTPPPGFTCSL  305



>ref|XP_004150208.2| PREDICTED: 36.4 kDa proline-rich protein [Cucumis sativus]
 gb|KGN65120.1| hypothetical protein Csa_1G228960 [Cucumis sativus]
Length=204

 Score =   108 bits (271),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 67/82 (82%), Positives = 76/82 (93%), Gaps = 0/82 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            IDTLKLG CV+LLGGLVH+G+GDPA N CCPI+ GL ELEAA CLCTTLKIKAL+L+IYV
Sbjct  123  IDTLKLGGCVNLLGGLVHIGIGDPAANACCPIISGLAELEAAVCLCTTLKIKALDLNIYV  182

Query  621  PLALQLLVTCGKTPPPGYTCAL  686
            P+ALQLL+TCGKTPPPGYTC+L
Sbjct  183  PIALQLLITCGKTPPPGYTCSL  204



>emb|CDP10452.1| unnamed protein product [Coffea canephora]
Length=237

 Score =   109 bits (273),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 61/82 (74%), Positives = 75/82 (91%), Gaps = 0/82 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            +DTLK+GAC D+LGG++H+G GDP VNECCPIL GLV++EAA CLCTTLK+KALNL ++V
Sbjct  156  VDTLKMGACADVLGGVMHIGFGDPVVNECCPILSGLVDVEAAVCLCTTLKLKALNLEMFV  215

Query  621  PLALQLLVTCGKTPPPGYTCAL  686
            P+AL+LLV CGKTPPPGYTC+L
Sbjct  216  PIALELLVYCGKTPPPGYTCSL  237



>gb|AAL35979.1|AF104392_1 extensin-like protein, partial [Cucumis sativus]
Length=219

 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 67/82 (82%), Positives = 76/82 (93%), Gaps = 0/82 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            IDTLKLG CV+LLGGLVH+G+GDPA N CCPI+ GL ELEAA CLCTTLKIKAL+L+IYV
Sbjct  138  IDTLKLGGCVNLLGGLVHIGIGDPAANACCPIISGLAELEAAVCLCTTLKIKALDLNIYV  197

Query  621  PLALQLLVTCGKTPPPGYTCAL  686
            P+ALQLL+TCGKTPPPGYTC+L
Sbjct  198  PIALQLLITCGKTPPPGYTCSL  219



>ref|XP_010250205.1| PREDICTED: 36.4 kDa proline-rich protein-like [Nelumbo nucifera]
Length=225

 Score =   109 bits (272),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 70/81 (86%), Positives = 77/81 (95%), Gaps = 0/81 (0%)
 Frame = +3

Query  444  DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  623
            D+LKLGACVDLLGGLVH+GLGDP VN+CCP+L+GLVELEAA CLCTTLKIK LNL+IY+P
Sbjct  145  DSLKLGACVDLLGGLVHIGLGDPVVNKCCPLLQGLVELEAAVCLCTTLKIKLLNLNIYLP  204

Query  624  LALQLLVTCGKTPPPGYTCAL  686
            LALQLLVTCGKTPPPGYTC L
Sbjct  205  LALQLLVTCGKTPPPGYTCTL  225



>ref|NP_565348.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Arabidopsis thaliana]
 ref|NP_849949.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Arabidopsis thaliana]
 gb|AAD26911.1| expressed protein [Arabidopsis thaliana]
 gb|AAL38354.1| unknown protein [Arabidopsis thaliana]
 gb|AAM83238.1| At2g10940/F15K19.1 [Arabidopsis thaliana]
 gb|AAN18126.1| At2g10940/F15K19.1 [Arabidopsis thaliana]
 gb|AEC06157.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Arabidopsis thaliana]
 gb|AEC06158.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Arabidopsis thaliana]
Length=291

 Score =   110 bits (275),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 68/82 (83%), Positives = 80/82 (98%), Gaps = 0/82 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            IDTLKLGACVDLLGGLV +GLGDPAVN+CCP+LKGLVE+EAAACLCTTLK+KAL+L++YV
Sbjct  210  IDTLKLGACVDLLGGLVKIGLGDPAVNKCCPLLKGLVEVEAAACLCTTLKLKALDLNLYV  269

Query  621  PLALQLLVTCGKTPPPGYTCAL  686
            P+ALQLL+TCGK PPPGYTC++
Sbjct  270  PVALQLLLTCGKNPPPGYTCSI  291



>ref|XP_002885841.1| hypothetical protein ARALYDRAFT_480276 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62100.1| hypothetical protein ARALYDRAFT_480276 [Arabidopsis lyrata subsp. 
lyrata]
Length=287

 Score =   110 bits (275),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 68/82 (83%), Positives = 80/82 (98%), Gaps = 0/82 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            IDTLKLGACVDLLGGLV +GLGDPAVN+CCP+LKGLVE+EAAACLCTTLK+KAL+L++YV
Sbjct  206  IDTLKLGACVDLLGGLVKIGLGDPAVNKCCPLLKGLVEVEAAACLCTTLKLKALDLNLYV  265

Query  621  PLALQLLVTCGKTPPPGYTCAL  686
            P+ALQLL+TCGK PPPGYTC++
Sbjct  266  PVALQLLLTCGKNPPPGYTCSI  287



>ref|XP_004287279.1| PREDICTED: 36.4 kDa proline-rich protein [Fragaria vesca subsp. 
vesca]
Length=251

 Score =   108 bits (271),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 68/82 (83%), Positives = 77/82 (94%), Gaps = 0/82 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            IDTLKLGACVDLLGGLVH+GLGDP VNECCP+L GLVELEAA CLCT LKIK LNL+I+V
Sbjct  170  IDTLKLGACVDLLGGLVHIGLGDPVVNECCPVLSGLVELEAAVCLCTALKIKLLNLNIFV  229

Query  621  PLALQLLVTCGKTPPPGYTCAL  686
            P+ALQLLVTCGK+PPPG+TC++
Sbjct  230  PIALQLLVTCGKSPPPGFTCSI  251



>gb|EPS72315.1| hypothetical protein M569_02443, partial [Genlisea aurea]
Length=213

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 65/82 (79%), Positives = 78/82 (95%), Gaps = 0/82 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            IDTLKLGACVDLLGGL+H+G+GDPAVN CCP+L GLVE+EAA CLCT++KIKALNL+IY+
Sbjct  132  IDTLKLGACVDLLGGLIHIGIGDPAVNTCCPVLAGLVEIEAAVCLCTSIKIKALNLNIYL  191

Query  621  PLALQLLVTCGKTPPPGYTCAL  686
            P+AL+LL+TCGKTPPPG+TC L
Sbjct  192  PIALELLLTCGKTPPPGFTCTL  213



>ref|XP_006298325.1| hypothetical protein CARUB_v10014389mg [Capsella rubella]
 gb|EOA31223.1| hypothetical protein CARUB_v10014389mg [Capsella rubella]
Length=269

 Score =   107 bits (268),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 67/82 (82%), Positives = 78/82 (95%), Gaps = 0/82 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            I+TLKLGACVDLLGGLV +GLGDPAVN+CCP+LKGL E+EAAACLCTTLKIKAL+L +YV
Sbjct  188  INTLKLGACVDLLGGLVKIGLGDPAVNKCCPLLKGLAEIEAAACLCTTLKIKALDLKLYV  247

Query  621  PLALQLLVTCGKTPPPGYTCAL  686
            P+ALQLL+TCGK PPPGYTC++
Sbjct  248  PVALQLLLTCGKNPPPGYTCSI  269



>ref|XP_010488821.1| PREDICTED: 36.4 kDa proline-rich protein-like [Camelina sativa]
Length=306

 Score =   106 bits (264),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 65/82 (79%), Positives = 77/82 (94%), Gaps = 0/82 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            I+TLKLGACV+LLGGLV +GLGDP VN+CCP+LKGLVE+EAAACLCTTLKI AL+L +YV
Sbjct  225  INTLKLGACVELLGGLVKIGLGDPTVNKCCPLLKGLVEVEAAACLCTTLKINALDLKLYV  284

Query  621  PLALQLLVTCGKTPPPGYTCAL  686
            P+ALQLL+TCGK PPPGYTC++
Sbjct  285  PVALQLLLTCGKNPPPGYTCSI  306



>ref|XP_009392131.1| PREDICTED: 36.4 kDa proline-rich protein-like [Musa acuminata 
subsp. malaccensis]
Length=274

 Score =   105 bits (263),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 62/82 (76%), Positives = 77/82 (94%), Gaps = 0/82 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            +DTLK+GACVDLLGGLVH+G GDPA N+CCP+L+GLVE+EAA CLCTT+K+K L++++YV
Sbjct  193  VDTLKIGACVDLLGGLVHIGAGDPAANQCCPLLQGLVEIEAAVCLCTTIKLKVLDMNVYV  252

Query  621  PLALQLLVTCGKTPPPGYTCAL  686
            PLALQLL+TCGKTPPPGYTC +
Sbjct  253  PLALQLLLTCGKTPPPGYTCTV  274



>ref|XP_010413891.1| PREDICTED: 36.4 kDa proline-rich protein-like [Camelina sativa]
Length=272

 Score =   105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 64/82 (78%), Positives = 77/82 (94%), Gaps = 0/82 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            I+TLKLGACV+LLGGLV +GLGDP VN+CCP+LKGLVE+EAAACLCTTLKI AL+L +YV
Sbjct  191  INTLKLGACVELLGGLVKIGLGDPTVNKCCPLLKGLVEVEAAACLCTTLKINALDLKLYV  250

Query  621  PLALQLLVTCGKTPPPGYTCAL  686
            P+ALQ+L+TCGK PPPGYTC++
Sbjct  251  PVALQILLTCGKNPPPGYTCSI  272



>gb|ABS79455.1| At2g10940-like protein, partial [Arabidopsis halleri subsp. halleri]
Length=76

 Score =   100 bits (248),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 61/76 (80%), Positives = 74/76 (97%), Gaps = 0/76 (0%)
 Frame = +3

Query  459  GACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVPLALQL  638
            GACVDLLGGLV +G+GDPAVN+CCP+LKGLVE+EAAACLCTTLK+KAL+L++YVP+ALQL
Sbjct  1    GACVDLLGGLVKIGIGDPAVNKCCPLLKGLVEVEAAACLCTTLKLKALDLNLYVPVALQL  60

Query  639  LVTCGKTPPPGYTCAL  686
            L+TCGK PPPGYTC++
Sbjct  61   LLTCGKNPPPGYTCSI  76



>gb|ABS79456.1| At2g10940-like protein, partial [Arabidopsis halleri subsp. halleri]
 gb|ABS79483.1| At2g10940-like protein, partial [Arabidopsis lyrata subsp. petraea]
 gb|ABS79489.1| At2g10940-like protein, partial [Arabidopsis lyrata subsp. petraea]
 gb|ABS79490.1| At2g10940-like protein, partial [Arabidopsis lyrata subsp. petraea]
 gb|ABS79491.1| At2g10940-like protein, partial [Arabidopsis lyrata subsp. petraea]
 gb|ABS79494.1| At2g10940-like protein, partial [Arabidopsis lyrata subsp. petraea]
 gb|ABS79495.1| At2g10940-like protein, partial [Arabidopsis lyrata subsp. petraea]
Length=76

 Score =   100 bits (248),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 62/76 (82%), Positives = 74/76 (97%), Gaps = 0/76 (0%)
 Frame = +3

Query  459  GACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVPLALQL  638
            GACVDLLGGLV +GLGDPAVN+CCP+LKGLVE+EAAACLCTTLK+KAL+L++YVP+ALQL
Sbjct  1    GACVDLLGGLVKIGLGDPAVNKCCPLLKGLVEVEAAACLCTTLKLKALDLNLYVPVALQL  60

Query  639  LVTCGKTPPPGYTCAL  686
            L+TCGK PPPGYTC++
Sbjct  61   LLTCGKNPPPGYTCSI  76



>gb|ABS79484.1| At2g10940-like protein, partial [Arabidopsis lyrata subsp. petraea]
Length=74

 Score =   100 bits (248),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/59 (80%), Positives = 58/59 (98%), Gaps = 0/59 (0%)
 Frame = +3

Query  510  PAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVPLALQLLVTCGKTPPPGYTCAL  686
            PAVN+CCP+LKGLVE+EAAACLCTTLK+KAL+L++YVP+ALQLL+TCGK PPPGYTC++
Sbjct  15   PAVNKCCPLLKGLVEVEAAACLCTTLKLKALDLNLYVPVALQLLLTCGKNPPPGYTCSI  73



>ref|XP_010467159.1| PREDICTED: 36.4 kDa proline-rich protein-like [Camelina sativa]
Length=298

 Score =   105 bits (263),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 66/82 (80%), Positives = 76/82 (93%), Gaps = 0/82 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            IDTLKLGACVDLLGGLV +GLGD  VN+CCP+LKGLVE+EAAACLCTTLKIKAL+L +YV
Sbjct  217  IDTLKLGACVDLLGGLVKIGLGDATVNKCCPLLKGLVEVEAAACLCTTLKIKALDLKLYV  276

Query  621  PLALQLLVTCGKTPPPGYTCAL  686
            P+A QLL+TCGK PPPGYTC++
Sbjct  277  PVAFQLLLTCGKNPPPGYTCSI  298



>gb|ABS79457.1| At2g10940-like protein, partial [Arabidopsis lyrata subsp. petraea]
 gb|ABS79458.1| At2g10940-like protein, partial [Arabidopsis lyrata subsp. petraea]
Length=73

 Score = 99.8 bits (247),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/59 (80%), Positives = 58/59 (98%), Gaps = 0/59 (0%)
 Frame = +3

Query  510  PAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVPLALQLLVTCGKTPPPGYTCAL  686
            PAVN+CCP+LKGLVE+EAAACLCTTLK+KAL+L++YVP+ALQLL+TCGK PPPGYTC++
Sbjct  15   PAVNKCCPLLKGLVEVEAAACLCTTLKLKALDLNLYVPVALQLLLTCGKNPPPGYTCSI  73



>gb|ABS79461.1| At2g10940-like protein, partial [Arabidopsis lyrata subsp. petraea]
 gb|ABS79462.1| At2g10940-like protein, partial [Arabidopsis lyrata subsp. petraea]
 gb|ABS79463.1| At2g10940-like protein, partial [Arabidopsis lyrata subsp. petraea]
 gb|ABS79464.1| At2g10940-like protein, partial [Arabidopsis lyrata subsp. petraea]
 gb|ABS79465.1| At2g10940-like protein, partial [Arabidopsis lyrata subsp. petraea]
 gb|ABS79466.1| At2g10940-like protein, partial [Arabidopsis lyrata subsp. petraea]
 gb|ABS79467.1| At2g10940-like protein, partial [Arabidopsis lyrata subsp. petraea]
 gb|ABS79468.1| At2g10940-like protein, partial [Arabidopsis lyrata subsp. petraea]
 gb|ABS79469.1| At2g10940-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ABS79470.1| At2g10940-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ABS79471.1| At2g10940-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ABS79472.1| At2g10940-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ABS79473.1| At2g10940-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ABS79478.1| At2g10940-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ABS79479.1| At2g10940-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ABS79480.1| At2g10940-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ABS79481.1| At2g10940-like protein, partial [Arabidopsis lyrata subsp. petraea]
 gb|ABS79482.1| At2g10940-like protein, partial [Arabidopsis lyrata subsp. petraea]
 gb|ABS79485.1| At2g10940-like protein, partial [Arabidopsis lyrata subsp. petraea]
 gb|ABS79486.1| At2g10940-like protein, partial [Arabidopsis lyrata subsp. petraea]
 gb|ABS79487.1| At2g10940-like protein, partial [Arabidopsis lyrata subsp. petraea]
 gb|ABS79488.1| At2g10940-like protein, partial [Arabidopsis lyrata subsp. petraea]
 gb|ABS79493.1| At2g10940-like protein, partial [Arabidopsis lyrata subsp. petraea]
 gb|ABS79496.1| At2g10940-like protein, partial [Arabidopsis lyrata subsp. petraea]
 gb|ABS79497.1| At2g10940-like protein, partial [Arabidopsis lyrata subsp. petraea]
Length=70

 Score = 99.8 bits (247),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/59 (80%), Positives = 58/59 (98%), Gaps = 0/59 (0%)
 Frame = +3

Query  510  PAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVPLALQLLVTCGKTPPPGYTCAL  686
            PAVN+CCP+LKGLVE+EAAACLCTTLK+KAL+L++YVP+ALQLL+TCGK PPPGYTC++
Sbjct  12   PAVNKCCPLLKGLVEVEAAACLCTTLKLKALDLNLYVPVALQLLLTCGKNPPPGYTCSI  70



>gb|ABS79476.1| At2g10940-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ABS79477.1| At2g10940-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ABS79492.1| At2g10940-like protein, partial [Arabidopsis lyrata subsp. petraea]
Length=72

 Score = 99.8 bits (247),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/59 (80%), Positives = 58/59 (98%), Gaps = 0/59 (0%)
 Frame = +3

Query  510  PAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVPLALQLLVTCGKTPPPGYTCAL  686
            PAVN+CCP+LKGLVE+EAAACLCTTLK+KAL+L++YVP+ALQLL+TCGK PPPGYTC++
Sbjct  14   PAVNKCCPLLKGLVEVEAAACLCTTLKLKALDLNLYVPVALQLLLTCGKNPPPGYTCSI  72



>gb|ABS79459.1| At2g10940-like protein, partial [Arabidopsis lyrata subsp. petraea]
 gb|ABS79460.1| At2g10940-like protein, partial [Arabidopsis lyrata subsp. petraea]
 gb|ABS79474.1| At2g10940-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ABS79475.1| At2g10940-like protein, partial [Arabidopsis lyrata subsp. lyrata]
Length=74

 Score = 99.4 bits (246),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/59 (80%), Positives = 58/59 (98%), Gaps = 0/59 (0%)
 Frame = +3

Query  510  PAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVPLALQLLVTCGKTPPPGYTCAL  686
            PAVN+CCP+LKGLVE+EAAACLCTTLK+KAL+L++YVP+ALQLL+TCGK PPPGYTC++
Sbjct  16   PAVNKCCPLLKGLVEVEAAACLCTTLKLKALDLNLYVPVALQLLLTCGKNPPPGYTCSI  74



>ref|XP_006855688.1| PREDICTED: 36.4 kDa proline-rich protein [Amborella trichopoda]
 gb|ERN17155.1| hypothetical protein AMTR_s00044p00134830 [Amborella trichopoda]
Length=275

 Score =   102 bits (255),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 76/80 (95%), Gaps = 0/80 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            ID LKLGACVDLLGGLVHVGLGDPAVNECCP+L GLVELEAA CLCTT+K+K LNL+I++
Sbjct  193  IDALKLGACVDLLGGLVHVGLGDPAVNECCPVLAGLVELEAALCLCTTIKLKLLNLNIFL  252

Query  621  PLALQLLVTCGKTPPPGYTC  680
            P+AL+LL+TCGK+PPPG+TC
Sbjct  253  PIALELLITCGKSPPPGFTC  272



>ref|XP_009390999.1| PREDICTED: 36.4 kDa proline-rich protein-like [Musa acuminata 
subsp. malaccensis]
Length=196

 Score =   100 bits (248),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 55/82 (67%), Positives = 75/82 (91%), Gaps = 0/82 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            +DT+++GACVDLLGGLV V +GDP VN+CCP+L+GL+ELEAA CLCT+++++ LN++IY+
Sbjct  114  VDTIRIGACVDLLGGLVRVVIGDPVVNQCCPLLQGLLELEAAVCLCTSIRLRLLNINIYL  173

Query  621  PLALQLLVTCGKTPPPGYTCAL  686
            PLALQLL+TCG TPPPG+TC +
Sbjct  174  PLALQLLITCGITPPPGFTCTV  195



>gb|EYU25259.1| hypothetical protein MIMGU_mgv1a020004mg, partial [Erythranthe 
guttata]
Length=144

 Score = 94.4 bits (233),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 69/82 (84%), Positives = 78/82 (95%), Gaps = 0/82 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            ID+LKLGACVDLLGGLVH+GLGDPA NECCPI+ GLVE+EAA CLCTTLKIKALNL+IY+
Sbjct  63   IDSLKLGACVDLLGGLVHIGLGDPAANECCPIISGLVEIEAAVCLCTTLKIKALNLNIYL  122

Query  621  PLALQLLVTCGKTPPPGYTCAL  686
            PLALQLL+TCGK PPPGYTC++
Sbjct  123  PLALQLLLTCGKAPPPGYTCSI  144



>dbj|BAK07129.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=352

 Score = 97.8 bits (242),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 61/82 (74%), Positives = 77/82 (94%), Gaps = 0/82 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            +DTLKLGACVDLLGGLVH+GLGDP VN+CCP+L+GL ELEAAACLCTT+++K LN+++ +
Sbjct  271  VDTLKLGACVDLLGGLVHIGLGDPVVNQCCPLLEGLAELEAAACLCTTIRLKLLNINLVL  330

Query  621  PLALQLLVTCGKTPPPGYTCAL  686
            PLA+QLL+TCGKTPP GYTC++
Sbjct  331  PLAVQLLLTCGKTPPRGYTCSI  352



>ref|XP_006409710.1| hypothetical protein EUTSA_v10022809mg [Eutrema salsugineum]
 gb|ESQ51163.1| hypothetical protein EUTSA_v10022809mg [Eutrema salsugineum]
Length=209

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 69/82 (84%), Positives = 79/82 (96%), Gaps = 0/82 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            IDTLKLGACVDLLGGLV +GLGDPAVN+CCP+LKGLVE+EAAACLCTTLK+KALNL +YV
Sbjct  128  IDTLKLGACVDLLGGLVKIGLGDPAVNKCCPLLKGLVEVEAAACLCTTLKLKALNLKLYV  187

Query  621  PLALQLLVTCGKTPPPGYTCAL  686
            P+ALQLL+TCGK PPPGYTC++
Sbjct  188  PVALQLLLTCGKNPPPGYTCSI  209



>ref|XP_006385727.1| hypothetical protein POPTR_0003s11060g [Populus trichocarpa]
 gb|ERP63524.1| hypothetical protein POPTR_0003s11060g [Populus trichocarpa]
Length=234

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            I+ LKLGACVD+LGGLVHVGLG+P  N CCP+LKGL+ELEAA CLCT++++K LNL+I++
Sbjct  152  INALKLGACVDVLGGLVHVGLGNPVENVCCPVLKGLLELEAAICLCTSIRLKLLNLTIFI  211

Query  621  PLALQLLVTCGKTPPPGYTC  680
            PLALQ+L+TCG+TPPPG+ C
Sbjct  212  PLALQVLITCGQTPPPGFVC  231



>ref|XP_011033954.1| PREDICTED: 36.4 kDa proline-rich protein [Populus euphratica]
Length=249

 Score = 95.1 bits (235),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            I+ LKLGACVD+LGGLVHVGLG+P  N CCP+LKGL+ELEAA CLCT++++K LNL+I++
Sbjct  167  INALKLGACVDVLGGLVHVGLGNPVENVCCPVLKGLLELEAAICLCTSIRLKLLNLTIFI  226

Query  621  PLALQLLVTCGKTPPPGYTC  680
            PLALQ+L+TCG+TPPPG+ C
Sbjct  227  PLALQVLITCGQTPPPGFVC  246



>ref|XP_010533777.1| PREDICTED: LOW QUALITY PROTEIN: 36.4 kDa proline-rich protein 
[Tarenaya hassleriana]
Length=270

 Score = 95.1 bits (235),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            ID LKLGACVD+LGGL+H+GLG+P  N CCP+L+GL+ELEAA CLCTT+++K LNL+I++
Sbjct  187  IDALKLGACVDVLGGLIHIGLGNPVENVCCPVLQGLLELEAAVCLCTTIRLKLLNLNIFI  246

Query  621  PLALQLLVTCGKTPPPGYTC  680
            PLALQ L+TCG TPPPG+ C
Sbjct  247  PLALQALITCGMTPPPGFVC  266



>ref|XP_006409711.1| hypothetical protein EUTSA_v10022809mg [Eutrema salsugineum]
 ref|XP_006409712.1| hypothetical protein EUTSA_v10022809mg [Eutrema salsugineum]
 dbj|BAJ33620.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ51164.1| hypothetical protein EUTSA_v10022809mg [Eutrema salsugineum]
 gb|ESQ51165.1| hypothetical protein EUTSA_v10022809mg [Eutrema salsugineum]
Length=266

 Score = 94.7 bits (234),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 69/82 (84%), Positives = 79/82 (96%), Gaps = 0/82 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            IDTLKLGACVDLLGGLV +GLGDPAVN+CCP+LKGLVE+EAAACLCTTLK+KALNL +YV
Sbjct  185  IDTLKLGACVDLLGGLVKIGLGDPAVNKCCPLLKGLVEVEAAACLCTTLKLKALNLKLYV  244

Query  621  PLALQLLVTCGKTPPPGYTCAL  686
            P+ALQLL+TCGK PPPGYTC++
Sbjct  245  PVALQLLLTCGKNPPPGYTCSI  266



>dbj|BAA19128.1| unnamed protein product [Daucus carota]
Length=347

 Score = 95.9 bits (237),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            +D LKLGACVD+LGGLVHVGLGDP VN+CCP+L GLVELEAA CLCTT+K+  LN++I +
Sbjct  266  LDALKLGACVDVLGGLVHVGLGDPNVNKCCPVLAGLVELEAAVCLCTTIKLSLLNINIAL  325

Query  621  PLALQLLVTCGKTPPPGYTC  680
            P+ALQLL+TCGKTPPPG+TC
Sbjct  326  PVALQLLITCGKTPPPGFTC  345



>ref|XP_004151037.2| PREDICTED: 36.4 kDa proline-rich protein [Cucumis sativus]
 gb|KGN55879.1| hypothetical protein Csa_3G026150 [Cucumis sativus]
Length=262

 Score = 94.4 bits (233),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            ID LKLG CVD+LGGLVH+GLG+P  N CCP+L GL+ELEAA CLCTTL+IK LNL+I++
Sbjct  180  IDALKLGLCVDVLGGLVHIGLGNPVENACCPVLGGLLELEAAVCLCTTLRIKLLNLNIFI  239

Query  621  PLALQLLVTCGKTPPPGYTC  680
            PLALQ L+TCGK PPPG+ C
Sbjct  240  PLALQALITCGKNPPPGFVC  259



>ref|XP_012087162.1| PREDICTED: 36.4 kDa proline-rich protein [Jatropha curcas]
 gb|KDP25646.1| hypothetical protein JCGZ_20802 [Jatropha curcas]
Length=235

 Score = 93.6 bits (231),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            I+ LKLGACVD+LGGLVHVGLG+P  N CCP++KGL+ELEAA CLCTT+++K LN++I++
Sbjct  153  INALKLGACVDVLGGLVHVGLGNPVENVCCPVIKGLLELEAAVCLCTTIRLKLLNINIFI  212

Query  621  PLALQLLVTCGKTPPPGYTC  680
            PLALQ+L+TCGK PPPG+ C
Sbjct  213  PLALQVLITCGKNPPPGFVC  232



>ref|XP_010093707.1| hypothetical protein L484_019048 [Morus notabilis]
 gb|EXB54487.1| hypothetical protein L484_019048 [Morus notabilis]
Length=258

 Score = 94.0 bits (232),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            ID LKLG C+D+LGGLVH+GLGDP  N CCP+L GL+ELEAA CLCT ++IK LNL+I++
Sbjct  176  IDALKLGLCLDVLGGLVHIGLGDPVQNTCCPVLGGLLELEAAVCLCTAIRIKLLNLNIFI  235

Query  621  PLALQLLVTCGKTPPPGYTC  680
            PLALQ+L+TCGKTPPPG+ C
Sbjct  236  PLALQVLITCGKTPPPGFVC  255



>ref|XP_008238563.1| PREDICTED: 36.4 kDa proline-rich protein [Prunus mume]
Length=268

 Score = 94.0 bits (232),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            ID LKLG CVD+LGGLVH+GLG+P  N CCPIL GL+ELEAA CLCTT+K+K LNL+I++
Sbjct  186  IDALKLGLCVDVLGGLVHIGLGNPVENACCPILGGLLELEAAICLCTTIKLKLLNLNIFI  245

Query  621  PLALQLLVTCGKTPPPGYTC  680
            PLALQ L+TCGKTPPPG+ C
Sbjct  246  PLALQALITCGKTPPPGFVC  265



>ref|XP_003608742.1| Proline rich protein [Medicago truncatula]
 gb|AES90939.1| protease inhibitor/seed storage/LTP family protein [Medicago 
truncatula]
Length=189

 Score = 92.4 bits (228),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            ID LKLG C+D+LGG+VHV +G+P  N CCP+++GLV+LEAA CLCT ++ K LNL+I++
Sbjct  107  IDALKLGLCLDVLGGVVHVVIGNPLKNVCCPVIQGLVDLEAAICLCTAIRAKVLNLNIFL  166

Query  621  PLALQLLVTCGKTPPPGYTC  680
            PLALQ+L+TCGKTPPPG+ C
Sbjct  167  PLALQVLITCGKTPPPGFVC  186



>ref|XP_006477233.1| PREDICTED: 36.4 kDa proline-rich protein-like [Citrus sinensis]
Length=240

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            I+ LKLG CVD+LGGLVH+GLG+P  N CCP+LKGL+ELEAA CLCTT+++K LNL+I++
Sbjct  158  INALKLGLCVDVLGGLVHIGLGNPVENACCPVLKGLLELEAAICLCTTIRLKLLNLNIFI  217

Query  621  PLALQLLVTCGKTPPPGYTC  680
            PLALQ L+TCGKTPPPG+ C
Sbjct  218  PLALQALITCGKTPPPGFVC  237



>gb|KDO61487.1| hypothetical protein CISIN_1g026333mg [Citrus sinensis]
Length=240

 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            I+ LKLG C+D+LGGLVH+GLG+P  N CCP+LKGL+ELEAA CLCTT+++K LNL+I++
Sbjct  158  INALKLGLCLDVLGGLVHIGLGNPVENACCPVLKGLLELEAAICLCTTIRLKLLNLNIFI  217

Query  621  PLALQLLVTCGKTPPPGYTC  680
            PLALQ L+TCGKTPPPG+ C
Sbjct  218  PLALQALITCGKTPPPGFVC  237



>emb|CDX81428.1| BnaC09g08390D [Brassica napus]
Length=256

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 68/82 (83%), Positives = 78/82 (95%), Gaps = 0/82 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            IDTLKLGACVDLLGGLV +GLGDPA N+CCP+LKGLVE+EAAACLCTTLK+KALNL +YV
Sbjct  175  IDTLKLGACVDLLGGLVKIGLGDPAANKCCPLLKGLVEVEAAACLCTTLKLKALNLKLYV  234

Query  621  PLALQLLVTCGKTPPPGYTCAL  686
            P+ALQLL+TCGK PPPGYTC++
Sbjct  235  PVALQLLLTCGKNPPPGYTCSI  256



>ref|XP_010933687.1| PREDICTED: 36.4 kDa proline-rich protein-like [Elaeis guineensis]
Length=154

 Score = 91.3 bits (225),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 55/82 (67%), Positives = 67/82 (82%), Gaps = 0/82 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
             D LKLG C+D+LGGLVH+GLG P  N CCP+L+GL+ELEAA CLCT +K++ LNL IY+
Sbjct  72   FDILKLGLCLDVLGGLVHLGLGKPVENVCCPVLQGLLELEAAVCLCTAIKLRVLNLDIYI  131

Query  621  PLALQLLVTCGKTPPPGYTCAL  686
            PLALQ+L+TCGK PP GY C L
Sbjct  132  PLALQVLITCGKDPPRGYACPL  153



>ref|XP_007211118.1| hypothetical protein PRUPE_ppa025269mg [Prunus persica]
 gb|EMJ12317.1| hypothetical protein PRUPE_ppa025269mg [Prunus persica]
Length=262

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            ID LKLG CVD+LGGLVH+GLG+P  N CCPIL GL+ELEAA CLCTT+K+K LNL+I++
Sbjct  180  IDALKLGLCVDVLGGLVHIGLGNPVENACCPILGGLLELEAAICLCTTIKLKLLNLNIFI  239

Query  621  PLALQLLVTCGKTPPPGYTC  680
            PLALQ L+TCGKTPPPG+ C
Sbjct  240  PLALQALITCGKTPPPGFVC  259



>ref|XP_008448869.1| PREDICTED: 36.4 kDa proline-rich protein [Cucumis melo]
Length=229

 Score = 92.8 bits (229),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            ID LKLG CVD+LGGLVH+GLG+P  N CCP+L GL+ELEAA CLCTTL+IK LNL+I++
Sbjct  147  IDALKLGLCVDVLGGLVHIGLGNPVENACCPVLGGLLELEAAICLCTTLRIKLLNLNIFI  206

Query  621  PLALQLLVTCGKTPPPGYTC  680
            PLALQ L+TCGK PPPG+ C
Sbjct  207  PLALQALITCGKNPPPGFVC  226



>ref|XP_006440348.1| hypothetical protein CICLE_v10021835mg [Citrus clementina]
 gb|ESR53588.1| hypothetical protein CICLE_v10021835mg [Citrus clementina]
Length=252

 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            I+ LKLG C+D+LGGLVH+GLG+P  N CCP+LKGL+ELEAA CLCTT+++K LNL+I++
Sbjct  170  INALKLGLCLDVLGGLVHIGLGNPVENACCPVLKGLLELEAAICLCTTIRLKLLNLNIFI  229

Query  621  PLALQLLVTCGKTPPPGYTC  680
            PLALQ L+TCGKTPPPG+ C
Sbjct  230  PLALQALITCGKTPPPGFVC  249



>ref|XP_010533129.1| PREDICTED: 36.4 kDa proline-rich protein [Tarenaya hassleriana]
Length=251

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 67/82 (82%), Positives = 79/82 (96%), Gaps = 0/82 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            +DTLKLGACVDLLGGLV +GLGDPAVN+CCP++KGL E+EAAACLCTTLK+KALNL +YV
Sbjct  170  VDTLKLGACVDLLGGLVKIGLGDPAVNKCCPLVKGLAEVEAAACLCTTLKLKALNLKLYV  229

Query  621  PLALQLLVTCGKTPPPGYTCAL  686
            P+ALQLLV+CGKTPPPG+TC+L
Sbjct  230  PVALQLLVSCGKTPPPGFTCSL  251



>ref|XP_009333634.1| PREDICTED: 36.4 kDa proline-rich protein-like [Pyrus x bretschneideri]
Length=255

 Score = 92.8 bits (229),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            ID LKLG CVD+LGGLVH+GLG+P  N CCP+L GL+ELEAA CLCTT+++K LNL+I++
Sbjct  173  IDALKLGLCVDVLGGLVHIGLGNPVENACCPVLGGLLELEAAICLCTTIRLKLLNLNIFI  232

Query  621  PLALQLLVTCGKTPPPGYTC  680
            PLALQ L+TCGKTPPPG+ C
Sbjct  233  PLALQALITCGKTPPPGFVC  252



>ref|XP_008376234.1| PREDICTED: 36.4 kDa proline-rich protein [Malus domestica]
Length=259

 Score = 92.8 bits (229),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            ID LKLG CVD+LGGLVH+GLG+P  N CCP+L GL+ELEAA CLCTT+++K LNL+I++
Sbjct  177  IDALKLGLCVDVLGGLVHIGLGNPVENACCPVLGGLLELEAAICLCTTIRLKLLNLNIFI  236

Query  621  PLALQLLVTCGKTPPPGYTC  680
            PLALQ L+TCGKTPPPG+ C
Sbjct  237  PLALQALITCGKTPPPGFVC  256



>ref|XP_009112260.1| PREDICTED: 36.4 kDa proline-rich protein [Brassica rapa]
Length=254

 Score = 92.8 bits (229),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 68/82 (83%), Positives = 78/82 (95%), Gaps = 0/82 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            IDTLKLGACVDLLGGLV +GLGDPA N+CCP+LKGLVE+EAAACLCTTLK+KALNL +YV
Sbjct  173  IDTLKLGACVDLLGGLVKIGLGDPAANKCCPLLKGLVEVEAAACLCTTLKLKALNLKLYV  232

Query  621  PLALQLLVTCGKTPPPGYTCAL  686
            P+ALQLL+TCGK PPPGYTC++
Sbjct  233  PVALQLLLTCGKNPPPGYTCSI  254



>emb|CDY18576.1| BnaA09g08190D [Brassica napus]
Length=280

 Score = 92.8 bits (229),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 68/82 (83%), Positives = 78/82 (95%), Gaps = 0/82 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            IDTLKLGACVDLLGGLV +GLGDPA N+CCP+LKGLVE+EAAACLCTTLK+KALNL +YV
Sbjct  199  IDTLKLGACVDLLGGLVKIGLGDPAANKCCPLLKGLVEVEAAACLCTTLKLKALNLKLYV  258

Query  621  PLALQLLVTCGKTPPPGYTCAL  686
            P+ALQLL+TCGK PPPGYTC++
Sbjct  259  PVALQLLLTCGKNPPPGYTCSI  280



>ref|XP_009397643.1| PREDICTED: 36.4 kDa proline-rich protein-like [Musa acuminata 
subsp. malaccensis]
Length=156

 Score = 90.1 bits (222),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 69/82 (84%), Gaps = 0/82 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            +D LKLG C+D+LGGLVHVGLG PA N CCP+L+GL+ELEAA CLCT +K++ L+L IY+
Sbjct  74   LDILKLGLCLDVLGGLVHVGLGKPAENVCCPVLQGLLELEAATCLCTAIKLRLLDLDIYI  133

Query  621  PLALQLLVTCGKTPPPGYTCAL  686
            PLALQ+L+TCGK P PGY C L
Sbjct  134  PLALQVLITCGKDPAPGYLCPL  155



>ref|XP_008796818.1| PREDICTED: 36.4 kDa proline-rich protein-like [Phoenix dactylifera]
Length=152

 Score = 89.7 bits (221),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 55/82 (67%), Positives = 67/82 (82%), Gaps = 0/82 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
             D LKLG C+D+LGGLVHVGLG P  N CCP+L+GL+ELEAA CLCT +K++ LNL IY+
Sbjct  70   FDILKLGLCLDVLGGLVHVGLGKPVENVCCPVLQGLLELEAAVCLCTAIKLRVLNLDIYI  129

Query  621  PLALQLLVTCGKTPPPGYTCAL  686
            PLALQ+L+TCGK PP G+ C L
Sbjct  130  PLALQVLITCGKDPPQGHVCPL  151



>ref|XP_004298649.1| PREDICTED: 36.4 kDa proline-rich protein [Fragaria vesca subsp. 
vesca]
Length=226

 Score = 91.3 bits (225),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            ID LKLG CVD+LGGLVH+GLG+P  N CCP+L+GL+ELEAA CLCTT+++K LNL+I++
Sbjct  144  IDALKLGLCVDVLGGLVHIGLGNPVENACCPVLQGLLELEAAICLCTTIRLKLLNLNIFI  203

Query  621  PLALQLLVTCGKTPPPGYTC  680
            PLALQ L+TCG TPPPG+ C
Sbjct  204  PLALQALITCGITPPPGFVC  223



>ref|XP_009397885.1| PREDICTED: 36.4 kDa proline-rich protein-like [Musa acuminata 
subsp. malaccensis]
Length=171

 Score = 89.7 bits (221),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 55/82 (67%), Positives = 67/82 (82%), Gaps = 0/82 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            +D LKLG C+D+LGGLVH+G G+PA N CCP+L GL+ELEAA CLCT +K++ LNL IY+
Sbjct  89   LDHLKLGLCLDVLGGLVHLGAGNPAENVCCPVLHGLLELEAAVCLCTAIKLRILNLDIYI  148

Query  621  PLALQLLVTCGKTPPPGYTCAL  686
            PLALQLL+TCGK PP G  C L
Sbjct  149  PLALQLLITCGKNPPSGSLCPL  170



>ref|XP_003525816.1| PREDICTED: 36.4 kDa proline-rich protein-like [Glycine max]
 gb|KHN04349.1| 36.4 kDa proline-rich protein [Glycine soja]
Length=179

 Score = 89.7 bits (221),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            +D LKLG C+D+LGGLVHVG+G+P  N CCP+++GL++LEAA CLCT ++ K LNLSI++
Sbjct  96   VDALKLGLCLDVLGGLVHVGIGNPVENVCCPVIQGLLDLEAAICLCTVIRAKLLNLSIFL  155

Query  621  PLALQLLVTCGKTPPPGYTC  680
            P+ALQ+LVTCGKTPPPG+ C
Sbjct  156  PIALQVLVTCGKTPPPGFVC  175



>emb|CBI34143.3| unnamed protein product [Vitis vinifera]
Length=135

 Score = 88.6 bits (218),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            IDTLKLGACVDLLGGLVH+G+G  A + CCP+L+GLV+L+AA CLCT +K+K LN++I +
Sbjct  54   IDTLKLGACVDLLGGLVHIGIGSSAKDTCCPVLQGLVDLDAAVCLCTAIKVKLLNVNIII  113

Query  621  PLALQLLVTCGKTPPPGYTC  680
            P+ALQ+LV CGKTPP G+ C
Sbjct  114  PIALQVLVGCGKTPPSGFQC  133



>ref|XP_010913319.1| PREDICTED: 36.4 kDa proline-rich protein [Elaeis guineensis]
Length=215

 Score = 90.5 bits (223),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 63/82 (77%), Positives = 78/82 (95%), Gaps = 0/82 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            +D+LKLGACVDLLGGLVH+G+GDP VN+CCP+L+GLVE+EAA CLCTT+K+K LN++IY+
Sbjct  134  VDSLKLGACVDLLGGLVHIGIGDPVVNQCCPLLQGLVEIEAAVCLCTTIKLKLLNINIYL  193

Query  621  PLALQLLVTCGKTPPPGYTCAL  686
            PLALQLL+TCGKTPPPGYTC +
Sbjct  194  PLALQLLLTCGKTPPPGYTCTI  215



>emb|CBI31905.3| unnamed protein product [Vitis vinifera]
Length=163

 Score = 88.6 bits (218),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 54/88 (61%), Positives = 73/88 (83%), Gaps = 0/88 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            ++ +KLGACVD+LGGLVH+GLG+P  N CCP+L GL+ELEAA CLCT +++K LNL+I++
Sbjct  74   VNAIKLGACVDVLGGLVHIGLGNPVENVCCPVLGGLLELEAAVCLCTAIRLKLLNLNIFI  133

Query  621  PLALQLLVTCGKTPPPGYTCAL*TTLPL  704
            P+AL+ L+TCGKTPPPG+ C     +PL
Sbjct  134  PIALEALITCGKTPPPGFVCPPLYMIPL  161



>ref|XP_004516835.1| PREDICTED: 36.4 kDa proline-rich protein-like [Cicer arietinum]
Length=155

 Score = 88.6 bits (218),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            ID LKLG C+D+LGG+VHVG+G+P  + CCP+++GLV+LEAA CLCT ++ K LNL+I++
Sbjct  73   IDALKLGVCLDVLGGVVHVGIGNPVESVCCPVIEGLVDLEAAICLCTVIRAKLLNLNIFL  132

Query  621  PLALQLLVTCGKTPPPGYTC  680
            PLALQLL+TCGK PPPG+ C
Sbjct  133  PLALQLLITCGKNPPPGFLC  152



>ref|XP_007013549.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein isoform 3, partial [Theobroma cacao]
 ref|XP_007013550.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein isoform 3, partial [Theobroma cacao]
 gb|EOY31168.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein isoform 3, partial [Theobroma cacao]
 gb|EOY31169.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein isoform 3, partial [Theobroma cacao]
Length=259

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 70/82 (85%), Positives = 77/82 (94%), Gaps = 0/82 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            IDTLKLGACVDLLGGLVH+ +GDP VNECCP+L GLVELEAA CLCTTLK+K LNL+IYV
Sbjct  178  IDTLKLGACVDLLGGLVHIVIGDPVVNECCPVLSGLVELEAAVCLCTTLKLKLLNLNIYV  237

Query  621  PLALQLLVTCGKTPPPGYTCAL  686
            PLALQLL+TCGKTPPPGYTC+L
Sbjct  238  PLALQLLITCGKTPPPGYTCSL  259



>ref|XP_011002407.1| PREDICTED: 36.4 kDa proline-rich protein isoform X3 [Populus 
euphratica]
Length=180

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            I+TLKLGACVD+LGGLVH+G+G  A NECCP+L+GLV+L+AA+CLCT +K K LN+++ +
Sbjct  99   INTLKLGACVDVLGGLVHIGIGRSAKNECCPVLEGLVDLDAASCLCTVIKAKLLNINLII  158

Query  621  PLALQLLVTCGKTPPPGYTC  680
            P+AL++L  CGKTPPPG+ C
Sbjct  159  PIALEVLADCGKTPPPGFKC  178



>ref|XP_006841160.1| PREDICTED: 36.4 kDa proline-rich protein [Amborella trichopoda]
 gb|ERN02835.1| hypothetical protein AMTR_s00086p00153720 [Amborella trichopoda]
Length=196

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 56/79 (71%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = +3

Query  444  DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  623
            D LKLGACVD+LGGLVHVGLGDP  N CCP+L+GL+ELEAA CLC  +++K LNLSI++P
Sbjct  115  DALKLGACVDVLGGLVHVGLGDPVANTCCPVLQGLLELEAAVCLCMNIRLKVLNLSIFIP  174

Query  624  LALQLLVTCGKTPPPGYTC  680
            LALQ+LVTCG  PP G+ C
Sbjct  175  LALQVLVTCGMKPPEGFVC  193



>emb|CDY12951.1| BnaA09g13230D [Brassica napus]
Length=276

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            I+ LKLGACVD+LGGL+H+GLG+P  N CCP+L+GL+ELEAA CLCTT+++K LNL+I++
Sbjct  193  INALKLGACVDVLGGLIHIGLGNPVENVCCPVLQGLLELEAAVCLCTTIRLKLLNLNIFI  252

Query  621  PLALQLLVTCGKTPPPGYTC  680
            PLALQ L+TCG  PPPG+ C
Sbjct  253  PLALQALITCGINPPPGFIC  272



>ref|XP_011081226.1| PREDICTED: LOW QUALITY PROTEIN: 36.4 kDa proline-rich protein 
[Sesamum indicum]
Length=260

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            ID LKLG C+D+LGGLVHVG+G+P  N CCP+++GL+ELEAA CLCTT+++K LNL++++
Sbjct  178  IDALKLGLCLDVLGGLVHVGIGNPIENICCPVIQGLLELEAAICLCTTIRLKLLNLNVFL  237

Query  621  PLALQLLVTCGKTPPPGYTC  680
            PLALQ+L TCG TPPPG+ C
Sbjct  238  PLALQVLATCGLTPPPGFVC  257



>ref|XP_011002403.1| PREDICTED: 36.4 kDa proline-rich protein isoform X1 [Populus 
euphratica]
Length=193

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            I+TLKLGACVD+LGGLVH+G+G  A NECCP+L+GLV+L+AA+CLCT +K K LN+++ +
Sbjct  112  INTLKLGACVDVLGGLVHIGIGRSAKNECCPVLEGLVDLDAASCLCTVIKAKLLNINLII  171

Query  621  PLALQLLVTCGKTPPPGYTC  680
            P+AL++L  CGKTPPPG+ C
Sbjct  172  PIALEVLADCGKTPPPGFKC  191



>emb|CDY70376.1| BnaCnng68070D [Brassica napus]
Length=286

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            I+ LKLGACVD+LGGL+H+GLG+P  N CCP+L+GL+ELEAA CLCTT+++K LNL+I++
Sbjct  203  INALKLGACVDVLGGLIHIGLGNPVENVCCPVLQGLLELEAAVCLCTTIRLKLLNLNIFI  262

Query  621  PLALQLLVTCGKTPPPGYTC  680
            PLALQ L+TCG  PPPG+ C
Sbjct  263  PLALQALITCGINPPPGFIC  282



>ref|XP_009113073.1| PREDICTED: 36.4 kDa proline-rich protein [Brassica rapa]
Length=306

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            I+ LKLGACVD+LGGL+H+GLG+P  N CCP+L+GL+ELEAA CLCTT+++K LNL+I++
Sbjct  223  INALKLGACVDVLGGLIHIGLGNPVENVCCPVLQGLLELEAAVCLCTTIRLKLLNLNIFI  282

Query  621  PLALQLLVTCGKTPPPGYTC  680
            PLALQ L+TCG  PPPG+ C
Sbjct  283  PLALQALITCGINPPPGFIC  302



>ref|XP_003549908.1| PREDICTED: 36.4 kDa proline-rich protein-like [Glycine max]
 gb|KHN09803.1| 36.4 kDa proline-rich protein [Glycine soja]
Length=178

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            ID LKLG C+D+LGGLVHVG+G+P  N CCP+++GL++LEAA CLCT ++ K LNL+I++
Sbjct  95   IDALKLGLCLDVLGGLVHVGIGNPVENVCCPVIQGLLDLEAAICLCTVIRAKLLNLNIFL  154

Query  621  PLALQLLVTCGKTPPPGYTC  680
            PLALQLLVTCGKT PPG+ C
Sbjct  155  PLALQLLVTCGKTAPPGFVC  174



>ref|XP_007013548.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY31167.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein isoform 1 [Theobroma cacao]
Length=213

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 70/82 (85%), Positives = 77/82 (94%), Gaps = 0/82 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            IDTLKLGACVDLLGGLVH+ +GDP VNECCP+L GLVELEAA CLCTTLK+K LNL+IYV
Sbjct  132  IDTLKLGACVDLLGGLVHIVIGDPVVNECCPVLSGLVELEAAVCLCTTLKLKLLNLNIYV  191

Query  621  PLALQLLVTCGKTPPPGYTCAL  686
            PLALQLL+TCGKTPPPGYTC+L
Sbjct  192  PLALQLLITCGKTPPPGYTCSL  213



>ref|XP_010430304.1| PREDICTED: LOW QUALITY PROTEIN: 36.4 kDa proline-rich protein 
[Camelina sativa]
Length=299

 Score = 90.1 bits (222),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            I+ LKLGACVD+LGGL+H+GLG+P  N CCP+L+GL+ELEAA CLCTT+++K LNL+I++
Sbjct  216  INALKLGACVDVLGGLIHIGLGNPVENVCCPVLQGLLELEAAVCLCTTIRLKLLNLNIFI  275

Query  621  PLALQLLVTCGKTPPPGYTC  680
            PLALQ L+TCG  PPPG+ C
Sbjct  276  PLALQALITCGINPPPGFVC  295



>ref|XP_010418242.1| PREDICTED: 36.4 kDa proline-rich protein-like [Camelina sativa]
Length=300

 Score = 90.1 bits (222),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            I+ LKLGACVD+LGGL+H+GLG+P  N CCP+L+GL+ELEAA CLCTT+++K LNL+I++
Sbjct  217  INALKLGACVDVLGGLIHIGLGNPVENVCCPVLQGLLELEAAVCLCTTIRLKLLNLNIFI  276

Query  621  PLALQLLVTCGKTPPPGYTC  680
            PLALQ L+TCG  PPPG+ C
Sbjct  277  PLALQALITCGINPPPGFVC  296



>ref|XP_006657183.1| PREDICTED: 36.4 kDa proline-rich protein-like [Oryza brachyantha]
Length=197

 Score = 88.2 bits (217),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 64/82 (78%), Positives = 78/82 (95%), Gaps = 0/82 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            +D+LK+GACVDLLGGLVHVG+GDP VN+CCP+L+GLVELEAA CLCTT+K+K LN++IY+
Sbjct  116  VDSLKIGACVDLLGGLVHVGIGDPVVNKCCPLLEGLVELEAAVCLCTTIKLKLLNINIYL  175

Query  621  PLALQLLVTCGKTPPPGYTCAL  686
            PLALQLL+TCGK PPPGYTCA+
Sbjct  176  PLALQLLLTCGKNPPPGYTCAI  197



>ref|XP_009418218.1| PREDICTED: 36.4 kDa proline-rich protein-like [Musa acuminata 
subsp. malaccensis]
Length=235

 Score = 88.6 bits (218),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 62/82 (76%), Positives = 77/82 (94%), Gaps = 0/82 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            +DTLK+GACVDLLGGLVH+G+GDP VN CCP+L+GLVE+EAA CLCT++K+K LN++IY+
Sbjct  154  VDTLKVGACVDLLGGLVHIGIGDPVVNRCCPLLQGLVEIEAAVCLCTSIKLKLLNINIYL  213

Query  621  PLALQLLVTCGKTPPPGYTCAL  686
            PLALQLL+TCGKTPPPGYTC +
Sbjct  214  PLALQLLLTCGKTPPPGYTCTI  235



>ref|XP_011002408.1| PREDICTED: 36.4 kDa proline-rich protein isoform X4 [Populus 
euphratica]
Length=167

 Score = 87.4 bits (215),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            IDTLKLGACVD+LGGL+HVG+G  A +ECCP+L+GLV+L+AA CLCT +K K LN+++ +
Sbjct  86   IDTLKLGACVDVLGGLIHVGIGSSAKDECCPLLEGLVDLDAALCLCTAIKAKLLNINLII  145

Query  621  PLALQLLVTCGKTPPPGYTC  680
            P+AL+LLV CGKTPP G+ C
Sbjct  146  PIALELLVDCGKTPPEGFKC  165



>ref|XP_002271658.2| PREDICTED: 36.4 kDa proline-rich protein-like [Vitis vinifera]
Length=236

 Score = 88.6 bits (218),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            ++ +KLGACVD+LGGLVH+GLG+P  N CCP+L GL+ELEAA CLCT +++K LNL+I++
Sbjct  154  VNAIKLGACVDVLGGLVHIGLGNPVENVCCPVLGGLLELEAAVCLCTAIRLKLLNLNIFI  213

Query  621  PLALQLLVTCGKTPPPGYTC  680
            P+AL+ L+TCGKTPPPG+ C
Sbjct  214  PIALEALITCGKTPPPGFVC  233



>gb|EYU30299.1| hypothetical protein MIMGU_mgv11b015559mg, partial [Erythranthe 
guttata]
Length=226

 Score = 88.6 bits (218),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            I+ LKLG C+D+LGGL+H+G+GDP  N CCP+L+GL+ELEAA CLCTT+++K LNL+I++
Sbjct  66   INALKLGLCLDVLGGLIHIGIGDPIENICCPVLQGLLELEAAICLCTTIRLKLLNLNIFL  125

Query  621  PLALQLLVTCGKTPPPGYTC  680
            PLALQ+L TCG TPPPG+ C
Sbjct  126  PLALQVLATCGLTPPPGFVC  145



>ref|XP_006391857.1| hypothetical protein EUTSA_v10023531mg [Eutrema salsugineum]
 gb|ESQ29143.1| hypothetical protein EUTSA_v10023531mg [Eutrema salsugineum]
Length=373

 Score = 90.5 bits (223),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            I+ LKLGACVD+LGGL+H+GLG+P  N CCP+L+GL+ELEAA CLCTT+++K LNL+I++
Sbjct  290  INALKLGACVDVLGGLIHIGLGNPVENVCCPVLQGLLELEAAICLCTTIRLKLLNLNIFI  349

Query  621  PLALQLLVTCGKTPPPGYTC  680
            PLALQ L+TCG TPPPG+ C
Sbjct  350  PLALQALITCGLTPPPGFVC  369



>ref|XP_002531954.1| lipid binding protein, putative [Ricinus communis]
 gb|EEF30436.1| lipid binding protein, putative [Ricinus communis]
Length=246

 Score = 88.6 bits (218),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 72/82 (88%), Positives = 78/82 (95%), Gaps = 0/82 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            IDTLKLGACVDLLGGLVH+GLGDP VN+CCP+L+GLVELEAA CLCTTLK+K LNL+IYV
Sbjct  165  IDTLKLGACVDLLGGLVHIGLGDPVVNQCCPVLQGLVELEAAVCLCTTLKLKLLNLNIYV  224

Query  621  PLALQLLVTCGKTPPPGYTCAL  686
            PLALQLLVTCGKTPPPGYTC L
Sbjct  225  PLALQLLVTCGKTPPPGYTCTL  246



>ref|XP_002264442.1| PREDICTED: 36.4 kDa proline-rich protein-like [Vitis vinifera]
Length=184

 Score = 87.4 bits (215),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            IDTLKLGACVDLLGGLVHVG+G  A + CCP+L+GLV+ ++A CLCTT+K K LN++I +
Sbjct  103  IDTLKLGACVDLLGGLVHVGIGSSAKDTCCPVLQGLVDSDSALCLCTTIKAKLLNVNIII  162

Query  621  PLALQLLVTCGKTPPPGYTC  680
            P+ALQ+LV CGKTPPPG+ C
Sbjct  163  PIALQVLVDCGKTPPPGFQC  182



>gb|KJB51915.1| hypothetical protein B456_008G237700 [Gossypium raimondii]
Length=224

 Score = 88.2 bits (217),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            ++ LKLG CVD+LGGLVH+GLGDP  N CCP+L GL+ELEAA CLCT +++K LNL+I++
Sbjct  142  VNALKLGLCVDVLGGLVHIGLGDPVENACCPVLGGLLELEAAVCLCTAIRLKLLNLNIFI  201

Query  621  PLALQLLVTCGKTPPPGYTC  680
            PLALQ L+TCGK PPPG+ C
Sbjct  202  PLALQALITCGKNPPPGFIC  221



>emb|CAN80711.1| hypothetical protein VITISV_033378 [Vitis vinifera]
Length=261

 Score = 89.0 bits (219),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            ++ +KLGACVD+LGGLVH+GLG+P  N CCP+L GL+ELEAA CLCT +++K LNL+I++
Sbjct  154  VNAIKLGACVDVLGGLVHIGLGNPVENVCCPVLGGLLELEAAVCLCTAIRLKLLNLNIFI  213

Query  621  PLALQLLVTCGKTPPPGYTC  680
            P+AL+ L+TCGKTPPPG+ C
Sbjct  214  PIALEALITCGKTPPPGFVC  233



>emb|CDP09933.1| unnamed protein product [Coffea canephora]
Length=283

 Score = 89.0 bits (219),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            I+ LKLG C+D+LGGL+HVG+G+P  N CCP+L+GL+ELEAA CLCTT+++K LNL+I++
Sbjct  200  INALKLGLCLDVLGGLIHVGIGNPVENVCCPVLQGLLELEAAICLCTTIRLKLLNLNIFL  259

Query  621  PLALQLLVTCGKTPPPGYTC  680
            PLALQ+L+TCG TPPPG+ C
Sbjct  260  PLALQVLITCGLTPPPGFVC  279



>gb|KFK25908.1| hypothetical protein AALP_AA8G178300 [Arabis alpina]
Length=333

 Score = 89.7 bits (221),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            I+ LKLGACVD+LGGL+H+GLG+P  N CCP+L GL+ELEAA CLCTT+++K LN++I++
Sbjct  250  INALKLGACVDVLGGLIHIGLGNPVENVCCPVLGGLLELEAAVCLCTTIRLKLLNINIFI  309

Query  621  PLALQLLVTCGKTPPPGYTC  680
            PLALQ L+TCG TPPPG+ C
Sbjct  310  PLALQALITCGITPPPGFVC  329



>ref|XP_006380877.1| hypothetical protein POPTR_0006s01020g [Populus trichocarpa]
 gb|ERP58674.1| hypothetical protein POPTR_0006s01020g [Populus trichocarpa]
Length=184

 Score = 87.4 bits (215),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            IDTLKLGACVD+LGGL+H+G+G  A +ECCP+L+GLV+L+AA CLCT +K K LN+++ +
Sbjct  103  IDTLKLGACVDVLGGLIHIGIGSSAKDECCPLLEGLVDLDAAVCLCTVIKAKLLNINLIL  162

Query  621  PLALQLLVTCGKTPPPGYTC  680
            P+AL+LLV CGKTPP G+ C
Sbjct  163  PIALELLVDCGKTPPEGFKC  182



>ref|XP_010258986.1| PREDICTED: 36.4 kDa proline-rich protein-like [Nelumbo nucifera]
Length=225

 Score = 88.2 bits (217),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            I+ LKLG C+D+LGGLVHVGLG+P  N CCP+L GL+ELEAA CLCT +++K LNL+IY+
Sbjct  143  INALKLGLCLDVLGGLVHVGLGNPVENTCCPVLGGLLELEAAVCLCTGIRLKLLNLNIYI  202

Query  621  PLALQLLVTCGKTPPPGYTC  680
            PLA++ L+TCGK PPPGY C
Sbjct  203  PLAIKALITCGKNPPPGYVC  222



>ref|XP_004242756.1| PREDICTED: 36.4 kDa proline-rich protein-like [Solanum lycopersicum]
Length=138

 Score = 86.3 bits (212),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 68/82 (83%), Positives = 79/82 (96%), Gaps = 0/82 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            IDT+KLGACVDLLGGLVH+GLG+P VNECCPI++GLVE+EAA CLCTTLK+K LNL++YV
Sbjct  57   IDTIKLGACVDLLGGLVHIGLGNPVVNECCPIIEGLVEIEAAVCLCTTLKLKLLNLNLYV  116

Query  621  PLALQLLVTCGKTPPPGYTCAL  686
            PLALQLL+TCGKTPPPGYTC+L
Sbjct  117  PLALQLLLTCGKTPPPGYTCSL  138



>ref|XP_007155642.1| hypothetical protein PHAVU_003G219000g [Phaseolus vulgaris]
 gb|ESW27636.1| hypothetical protein PHAVU_003G219000g [Phaseolus vulgaris]
Length=171

 Score = 87.0 bits (214),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            ID LKLG C+D+LGGLVHVG+G P  N CCP ++GL++LEAA CLCT ++ K L L+I++
Sbjct  88   IDALKLGLCLDVLGGLVHVGIGKPVENVCCPFIQGLLDLEAAICLCTVIRAKVLKLNIFL  147

Query  621  PLALQLLVTCGKTPPPGYTC  680
            P+ALQ+L+TCGKTPPPG+ C
Sbjct  148  PIALQVLITCGKTPPPGFVC  167



>gb|AAL02329.1| proline-rich protein 1 [Vitis vinifera]
Length=189

 Score = 87.4 bits (215),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 53/79 (67%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = +3

Query  444  DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  623
            DTLKLGACVDLLGGLVH+G+G  A + CCP+L+GLV+L+AA CLCT +K+K LN++I +P
Sbjct  109  DTLKLGACVDLLGGLVHIGIGSSAKDTCCPVLQGLVDLDAAVCLCTAIKVKLLNVNIIIP  168

Query  624  LALQLLVTCGKTPPPGYTC  680
            +ALQ+LV CGKTPP G+ C
Sbjct  169  IALQVLVGCGKTPPSGFQC  187



>gb|EPS72593.1| hypothetical protein M569_02163, partial [Genlisea aurea]
Length=152

 Score = 86.3 bits (212),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 50/80 (63%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            ID LKLG C+D+LGGLVHVG+G+P  N CCP++ GL+E+EAA CLCTT++++ LN+++++
Sbjct  70   IDALKLGLCLDVLGGLVHVGIGNPVENMCCPVIGGLLEVEAAICLCTTIRLRLLNVNVFL  129

Query  621  PLALQLLVTCGKTPPPGYTC  680
            PLALQ+LVTCG  PPPG+ C
Sbjct  130  PLALQVLVTCGLNPPPGFVC  149



>ref|XP_006358307.1| PREDICTED: 36.4 kDa proline-rich protein-like [Solanum tuberosum]
Length=137

 Score = 85.9 bits (211),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 68/82 (83%), Positives = 79/82 (96%), Gaps = 0/82 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            IDT+KLGACVDLLGGLVH+GLG+P VNECCPI++GLVE+EAA CLCTTLK+K LNL++YV
Sbjct  56   IDTIKLGACVDLLGGLVHIGLGNPVVNECCPIIEGLVEIEAAVCLCTTLKLKLLNLNLYV  115

Query  621  PLALQLLVTCGKTPPPGYTCAL  686
            PLALQLL+TCGKTPPPGYTC+L
Sbjct  116  PLALQLLLTCGKTPPPGYTCSL  137



>gb|ABK95045.1| unknown [Populus trichocarpa]
Length=179

 Score = 86.7 bits (213),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            IDTLKLGACVD+LGGL+H+G+G  A +ECCP+L+GLV+L+AA CLCT +K K LN+++ +
Sbjct  98   IDTLKLGACVDVLGGLIHIGIGSSAKDECCPLLEGLVDLDAAVCLCTVIKAKLLNINLIL  157

Query  621  PLALQLLVTCGKTPPPGYTC  680
            P+AL+LLV CGKTPP G+ C
Sbjct  158  PIALELLVDCGKTPPEGFKC  177



>ref|XP_011002404.1| PREDICTED: 36.4 kDa proline-rich protein isoform X2 [Populus 
euphratica]
 ref|XP_011002405.1| PREDICTED: 36.4 kDa proline-rich protein isoform X2 [Populus 
euphratica]
Length=182

 Score = 86.7 bits (213),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            IDTLKLGACVD+LGGL+HVG+G  A +ECCP+L+GLV+L+AA CLCT +K K LN+++ +
Sbjct  101  IDTLKLGACVDVLGGLIHVGIGSSAKDECCPLLEGLVDLDAALCLCTAIKAKLLNINLII  160

Query  621  PLALQLLVTCGKTPPPGYTC  680
            P+AL+LLV CGKTPP G+ C
Sbjct  161  PIALELLVDCGKTPPEGFKC  180



>ref|XP_004965761.1| PREDICTED: 36.4 kDa proline-rich protein-like [Setaria italica]
Length=298

 Score = 88.6 bits (218),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 66/81 (81%), Positives = 77/81 (95%), Gaps = 0/81 (0%)
 Frame = +3

Query  444  DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  623
            D+LKLGACVDLLGGLVHVGLGDP VN+CCP+L+GLVELEAA CLCTT+K+K LN++IY+P
Sbjct  218  DSLKLGACVDLLGGLVHVGLGDPVVNKCCPVLEGLVELEAAVCLCTTIKLKLLNINIYLP  277

Query  624  LALQLLVTCGKTPPPGYTCAL  686
            LALQLL+TCGKTPPPGYTC +
Sbjct  278  LALQLLLTCGKTPPPGYTCTV  298



>ref|XP_008795904.1| PREDICTED: 36.4 kDa proline-rich protein-like, partial [Phoenix 
dactylifera]
Length=200

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 62/81 (77%), Positives = 76/81 (94%), Gaps = 0/81 (0%)
 Frame = +3

Query  444  DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  623
            D+LKLGACVDLLGGLVH+G+GDP  N+CCP+L+GLVE+EAA CLCTT+K+K LN++IY+P
Sbjct  120  DSLKLGACVDLLGGLVHIGIGDPVANQCCPLLQGLVEIEAAVCLCTTIKLKLLNINIYLP  179

Query  624  LALQLLVTCGKTPPPGYTCAL  686
            LALQLL+TCGKTPPPGYTC +
Sbjct  180  LALQLLLTCGKTPPPGYTCTI  200



>ref|XP_009607969.1| PREDICTED: 36.4 kDa proline-rich protein-like [Nicotiana tomentosiformis]
Length=141

 Score = 85.5 bits (210),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 67/82 (82%), Positives = 79/82 (96%), Gaps = 0/82 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            IDTLKLGACVDLLGGLVH+G+G+P +NECCPI++GLVE+EAA CLCTTLK+K LNL++YV
Sbjct  60   IDTLKLGACVDLLGGLVHIGIGNPVINECCPIIQGLVEIEAAVCLCTTLKLKLLNLNLYV  119

Query  621  PLALQLLVTCGKTPPPGYTCAL  686
            PLALQLL+TCGKTPPPGYTC+L
Sbjct  120  PLALQLLLTCGKTPPPGYTCSL  141



>emb|CAN77497.1| hypothetical protein VITISV_040680 [Vitis vinifera]
Length=182

 Score = 86.3 bits (212),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            IDTLKLGACVDLLGGLVHVG+G  A + CCP+L+GLV+ ++A CLCTT+K K LN++I +
Sbjct  101  IDTLKLGACVDLLGGLVHVGIGSSAKDTCCPVLQGLVDSDSALCLCTTIKAKLLNVNIII  160

Query  621  PLALQLLVTCGKTPPPGYTC  680
            P+ALQ+LV CGKTPPPG+ C
Sbjct  161  PIALQVLVDCGKTPPPGFQC  180



>ref|XP_010047989.1| PREDICTED: 36.4 kDa proline-rich protein-like isoform X2 [Eucalyptus 
grandis]
Length=256

 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 72/82 (88%), Positives = 78/82 (95%), Gaps = 0/82 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            IDTLKLGACVDLLGGLVH+GLGDP VN+CCP+L+GLVELEAA CLCTTLK+K LNL+IYV
Sbjct  175  IDTLKLGACVDLLGGLVHIGLGDPVVNQCCPVLQGLVELEAAVCLCTTLKLKLLNLNIYV  234

Query  621  PLALQLLVTCGKTPPPGYTCAL  686
            PLALQLLVTCGKTPPPGYTC L
Sbjct  235  PLALQLLVTCGKTPPPGYTCTL  256



>ref|XP_009365676.1| PREDICTED: 36.4 kDa proline-rich protein [Pyrus x bretschneideri]
Length=184

 Score = 86.3 bits (212),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            IDTLKLGACVD+LGGL+HVG+G  A + CCP+L+GLV+L+AA CLCTT+K K LN+++ +
Sbjct  103  IDTLKLGACVDVLGGLIHVGIGSSAKDACCPVLQGLVDLDAAICLCTTIKAKLLNVNLII  162

Query  621  PLALQLLVTCGKTPPPGYTC  680
            P+ALQ+L+ CGKTPP G+ C
Sbjct  163  PIALQVLIACGKTPPSGFQC  182



>ref|XP_008380324.1| PREDICTED: 36.4 kDa proline-rich protein-like [Malus domestica]
Length=252

 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            IDTLKLGACVD+LGGL+H+G+G  A + CCP+L+GLV+L+AA CLCTT+K K LN+++ +
Sbjct  171  IDTLKLGACVDVLGGLIHIGIGSSAKDACCPVLQGLVDLDAAICLCTTIKAKLLNINLII  230

Query  621  PLALQLLVTCGKTPPPGYTC  680
            P+ALQ+L+ CGKTPP G+ C
Sbjct  231  PIALQVLIDCGKTPPSGFQC  250



>ref|XP_010473466.1| PREDICTED: 36.4 kDa proline-rich protein-like [Camelina sativa]
Length=291

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            I+ L LGACVD+LGGL+H+GLG+P  N CCP+L+GL+ELEAA CLCTT+++K LNL+I++
Sbjct  208  INALNLGACVDVLGGLIHIGLGNPVENVCCPVLQGLLELEAAVCLCTTIRLKLLNLNIFI  267

Query  621  PLALQLLVTCGKTPPPGYTC  680
            PLALQ L+TCG  PPPG+ C
Sbjct  268  PLALQALITCGINPPPGFVC  287



>ref|XP_002520567.1| Repetitive proline-rich cell wall protein 2 precursor, putative 
[Ricinus communis]
 gb|EEF41800.1| Repetitive proline-rich cell wall protein 2 precursor, putative 
[Ricinus communis]
Length=299

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            IDTLKLGACVD+LGGL+H+G+G  A + CCP+L+GLV+L+AA CLCTT+K K LNL+I +
Sbjct  218  IDTLKLGACVDVLGGLIHIGIGSSAKDACCPVLQGLVDLDAALCLCTTIKAKLLNLNIII  277

Query  621  PLALQLLVTCGKTPPPGYTC  680
            P+AL++LV CGK PPPG+ C
Sbjct  278  PIALEVLVDCGKNPPPGFQC  297



>ref|XP_009785634.1| PREDICTED: 36.4 kDa proline-rich protein-like [Nicotiana sylvestris]
Length=141

 Score = 85.1 bits (209),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 67/82 (82%), Positives = 79/82 (96%), Gaps = 0/82 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            IDTLKLGACVDLLGGLVH+G+G+P +NECCPI++GLVE+EAA CLCTTLK+K LNL++YV
Sbjct  60   IDTLKLGACVDLLGGLVHIGIGNPVINECCPIIQGLVEIEAAVCLCTTLKLKLLNLNLYV  119

Query  621  PLALQLLVTCGKTPPPGYTCAL  686
            PLALQLL+TCGKTPPPGYTC+L
Sbjct  120  PLALQLLLTCGKTPPPGYTCSL  141



>ref|XP_007039885.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Theobroma cacao]
 gb|EOY24386.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Theobroma cacao]
Length=239

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            ++ LKLG CVD+LGGLVH+GLG+P  N CCP+L GL+ELEAA CLCT +++K LNL+I++
Sbjct  157  VNALKLGLCVDVLGGLVHIGLGNPVENACCPVLGGLLELEAAVCLCTAIRLKLLNLTIFI  216

Query  621  PLALQLLVTCGKTPPPGYTC  680
            PLALQ L+TCGK PPPG+ C
Sbjct  217  PLALQALITCGKNPPPGFVC  236



>ref|XP_010047988.1| PREDICTED: 36.4 kDa proline-rich protein-like isoform X1 [Eucalyptus 
grandis]
 gb|KCW80060.1| hypothetical protein EUGRSUZ_C01388 [Eucalyptus grandis]
 gb|KCW80061.1| hypothetical protein EUGRSUZ_C01388 [Eucalyptus grandis]
Length=266

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 72/82 (88%), Positives = 78/82 (95%), Gaps = 0/82 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            IDTLKLGACVDLLGGLVH+GLGDP VN+CCP+L+GLVELEAA CLCTTLK+K LNL+IYV
Sbjct  185  IDTLKLGACVDLLGGLVHIGLGDPVVNQCCPVLQGLVELEAAVCLCTTLKLKLLNLNIYV  244

Query  621  PLALQLLVTCGKTPPPGYTCAL  686
            PLALQLLVTCGKTPPPGYTC L
Sbjct  245  PLALQLLVTCGKTPPPGYTCTL  266



>ref|XP_008368547.1| PREDICTED: 36.4 kDa proline-rich protein-like [Malus domestica]
Length=188

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            IDTLKLGACVD+LGGL+H+G+G  A + CCP+L+GLV+L+AA CLCTT+K K LN+++ +
Sbjct  107  IDTLKLGACVDVLGGLIHIGIGSSAKDACCPVLQGLVDLDAAICLCTTIKAKLLNVNLII  166

Query  621  PLALQLLVTCGKTPPPGYTC  680
            P+ALQ+L+ CGKTPP G+ C
Sbjct  167  PIALQVLIACGKTPPSGFQC  186



>ref|XP_007155053.1| hypothetical protein PHAVU_003G169100g [Phaseolus vulgaris]
 gb|ESW27047.1| hypothetical protein PHAVU_003G169100g [Phaseolus vulgaris]
Length=210

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 70/82 (85%), Positives = 79/82 (96%), Gaps = 0/82 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            IDTLKLGACVDLLGGLVHVG+GDPA N+CCP+L+GLVELEAAACLCTTLK+K LNL+IYV
Sbjct  129  IDTLKLGACVDLLGGLVHVGVGDPAANQCCPVLQGLVELEAAACLCTTLKLKLLNLNIYV  188

Query  621  PLALQLLVTCGKTPPPGYTCAL  686
            P+ALQLLV CGK+PPPGYTC+L
Sbjct  189  PIALQLLVACGKSPPPGYTCSL  210


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +3

Query  33   MEVSKVTALLLISMLFISSATPILACGSCGKP  128
            ME SK+ A L +SMLFISSATPIL CG CGKP
Sbjct  1    MESSKIHAYLFLSMLFISSATPILGCGYCGKP  32



>ref|XP_002888023.1| hypothetical protein ARALYDRAFT_475096 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64282.1| hypothetical protein ARALYDRAFT_475096, partial [Arabidopsis 
lyrata subsp. lyrata]
Length=289

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 69/78 (88%), Gaps = 0/78 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            I+ LKLGACVD+LGGL+H+GLG+P  N CCP+L+GL+ELEAA CLCTT+++K LNL+I++
Sbjct  211  INALKLGACVDVLGGLIHIGLGNPVENVCCPVLQGLLELEAAVCLCTTIRLKLLNLNIFI  270

Query  621  PLALQLLVTCGKTPPPGY  674
            PLALQ L+TCG  PPPG+
Sbjct  271  PLALQALITCGINPPPGF  288



>gb|AFK39919.1| unknown [Lotus japonicus]
Length=228

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 70/82 (85%), Positives = 80/82 (98%), Gaps = 0/82 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            IDTLKLG+CVDLLGGL+H+GLGDPAVN+CCP+L+GLVE+EAAACLCTTLK+K LNL+IYV
Sbjct  147  IDTLKLGSCVDLLGGLIHIGLGDPAVNKCCPVLQGLVEVEAAACLCTTLKLKLLNLNIYV  206

Query  621  PLALQLLVTCGKTPPPGYTCAL  686
            PLALQLLV CGKTPPPGYTC+L
Sbjct  207  PLALQLLVACGKTPPPGYTCSL  228



>ref|XP_003631735.1| PREDICTED: 36.4 kDa proline-rich protein [Vitis vinifera]
Length=310

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            IDTLKLGACVDLLGGLVH+G+G  A + CCP+L+GLV+L+AA CLCT +K+K LN++I +
Sbjct  229  IDTLKLGACVDLLGGLVHIGIGSSAKDTCCPVLQGLVDLDAAVCLCTAIKVKLLNVNIII  288

Query  621  PLALQLLVTCGKTPPPGYTC  680
            P+ALQ+LV CGKTPP G+ C
Sbjct  289  PIALQVLVGCGKTPPSGFQC  308



>ref|NP_001058178.1| Os06g0643500 [Oryza sativa Japonica Group]
 dbj|BAD37369.1| putative cell wall protein [Oryza sativa Japonica Group]
 dbj|BAF20092.1| Os06g0643500 [Oryza sativa Japonica Group]
 gb|EAZ37794.1| hypothetical protein OsJ_22130 [Oryza sativa Japonica Group]
 dbj|BAG96223.1| unnamed protein product [Oryza sativa Japonica Group]
Length=255

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 62/82 (76%), Positives = 78/82 (95%), Gaps = 0/82 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            +D+LK+GACVDLLGGLVHVG+GDP VN+CCP+L+GLVELEAA CLCTT+++K LN++IY+
Sbjct  174  VDSLKIGACVDLLGGLVHVGIGDPVVNKCCPLLEGLVELEAAVCLCTTIRLKLLNINIYL  233

Query  621  PLALQLLVTCGKTPPPGYTCAL  686
            PLALQLL+TCGK PPPGYTC++
Sbjct  234  PLALQLLLTCGKNPPPGYTCSI  255



>ref|XP_008342310.1| PREDICTED: 36.4 kDa proline-rich protein [Malus domestica]
 ref|XP_008353628.1| PREDICTED: 36.4 kDa proline-rich protein-like [Malus domestica]
Length=213

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            IDTLKLGACVD+LGGL+H+G+G  A + CCP+L+GLV+L+AA CLCTT+K K LN+++ +
Sbjct  132  IDTLKLGACVDVLGGLIHIGIGSSAKDXCCPVLQGLVDLDAAICLCTTIKAKLLNVNLII  191

Query  621  PLALQLLVTCGKTPPPGYTC  680
            P+ALQ+L+ CGKTPP G+ C
Sbjct  192  PIALQVLIACGKTPPSGFQC  211



>gb|AFK49537.1| unknown [Medicago truncatula]
 gb|AES91603.2| Lipid transfer protein [Medicago truncatula]
Length=234

 Score = 86.3 bits (212),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 70/82 (85%), Positives = 79/82 (96%), Gaps = 0/82 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            IDTLKLGACVDLLGGLVH+GLGDP VN+CCP+L+GL E+EAAACLCTTLK+K LNL+IYV
Sbjct  153  IDTLKLGACVDLLGGLVHIGLGDPVVNKCCPVLQGLAEIEAAACLCTTLKLKLLNLNIYV  212

Query  621  PLALQLLVTCGKTPPPGYTCAL  686
            PLALQLL+TCGKTPPPGYTC+L
Sbjct  213  PLALQLLLTCGKTPPPGYTCSL  234



>gb|ACJ84260.1| unknown [Medicago truncatula]
Length=234

 Score = 85.9 bits (211),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 70/82 (85%), Positives = 79/82 (96%), Gaps = 0/82 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            IDTLKLGACVDLLGGLVH+GLGDP VN+CCP+L+GL E+EAAACLCTTLK+K LNL+IYV
Sbjct  153  IDTLKLGACVDLLGGLVHIGLGDPVVNKCCPVLQGLAEIEAAACLCTTLKLKLLNLNIYV  212

Query  621  PLALQLLVTCGKTPPPGYTCAL  686
            PLALQLL+TCGKTPPPGYTC+L
Sbjct  213  PLALQLLLTCGKTPPPGYTCSL  234



>gb|KJB27067.1| hypothetical protein B456_004G2756001, partial [Gossypium raimondii]
Length=152

 Score = 84.3 bits (207),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 68/82 (83%), Positives = 75/82 (91%), Gaps = 0/82 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            IDTLKLGACVDLLGG VHVG+GDP VN CCP+LKGLVELEAA CLCTTLK+K LNL IY 
Sbjct  71   IDTLKLGACVDLLGGAVHVGVGDPVVNACCPVLKGLVELEAAVCLCTTLKLKLLNLKIYA  130

Query  621  PLALQLLVTCGKTPPPGYTCAL  686
            P+ALQLL++CGKTPPPGYTC+L
Sbjct  131  PIALQLLISCGKTPPPGYTCSL  152



>emb|CAA75594.1| MtN4 [Medicago truncatula]
Length=249

 Score = 86.3 bits (212),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 50/80 (63%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            ID LKLGACVD+LGGL+H+G+G  A   CCP+L+GLV+L+AA CLCTT+++K LN+++ +
Sbjct  167  IDALKLGACVDVLGGLIHIGIGGSAKQTCCPLLQGLVDLDAAICLCTTIRLKLLNINLVI  226

Query  621  PLALQLLVTCGKTPPPGYTC  680
            PLALQ+L+ CGKTPP G+ C
Sbjct  227  PLALQVLIDCGKTPPEGFKC  246



>ref|XP_010055512.1| PREDICTED: 36.4 kDa proline-rich protein isoform X2 [Eucalyptus 
grandis]
Length=265

 Score = 86.3 bits (212),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            I+ LKLG C+D+LGGLVH+G+G+P  N CCP+L+GL+ELEAA CLCT +++K LNL+I++
Sbjct  183  INALKLGLCLDVLGGLVHIGIGNPVENVCCPVLQGLLELEAAICLCTAIRLKLLNLNIFI  242

Query  621  PLALQLLVTCGKTPPPGYTC  680
            PLALQ+L TCG TPPPG+ C
Sbjct  243  PLALQVLATCGITPPPGFVC  262



>ref|NP_176439.1| bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Arabidopsis thaliana]
 gb|AAD43607.1|AC005698_6 T3P18.6 [Arabidopsis thaliana]
 gb|AAK76636.1| putative proline-rich cell wall protein [Arabidopsis thaliana]
 gb|AAL85077.1| putative proline-rich cell wall protein [Arabidopsis thaliana]
 gb|AAM65121.1| putative proline-rich cell wall protein [Arabidopsis thaliana]
 gb|AEE33972.1| bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Arabidopsis thaliana]
Length=297

 Score = 86.7 bits (213),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            I+ LKLGACVD+LGGL+H+GLG+P  N CCP+L+GL+ELEAA CLCTT+++K LNL+I++
Sbjct  214  INALKLGACVDVLGGLIHIGLGNPVENVCCPVLQGLLELEAAVCLCTTIRLKLLNLNIFI  273

Query  621  PLALQLLVTCGKTPPPGYTC  680
            PLALQ L+TCG  PP G+ C
Sbjct  274  PLALQALITCGINPPSGFVC  293



>ref|XP_009595816.1| PREDICTED: 36.4 kDa proline-rich protein [Nicotiana tomentosiformis]
Length=260

 Score = 86.3 bits (212),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            ID LKLG C+D+LGGLVH+G+G+P  + CCP+L+GL+ELEAA CLCTT+++K LNL+I++
Sbjct  177  IDALKLGLCLDVLGGLVHIGIGNPVEHICCPVLQGLLELEAAICLCTTIRLKLLNLNIFL  236

Query  621  PLALQLLVTCGKTPPPGYTC  680
            PLAL +L TCG TPPPG+ C
Sbjct  237  PLALSVLATCGLTPPPGFIC  256



>emb|CAA49341.1| ADR11 [Glycine max]
Length=151

 Score = 84.0 bits (206),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 69/82 (84%), Positives = 78/82 (95%), Gaps = 0/82 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            IDTLKLGACVDLLGGLVH+GLGDP  N+CCP+L+GLVE+EAA CLCTTLK+K LNL+IYV
Sbjct  70   IDTLKLGACVDLLGGLVHIGLGDPVANQCCPVLQGLVEVEAAVCLCTTLKLKLLNLNIYV  129

Query  621  PLALQLLVTCGKTPPPGYTCAL  686
            PLALQLLVTCGK+PPPGYTC+L
Sbjct  130  PLALQLLVTCGKSPPPGYTCSL  151



>gb|KHN15055.1| 36.4 kDa proline-rich protein, partial [Glycine soja]
Length=153

 Score = 84.0 bits (206),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 69/82 (84%), Positives = 78/82 (95%), Gaps = 0/82 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            IDTLKLGACVDLLGGLVH+GLGDP  N+CCP+L+GLVE+EAA CLCTTLK+K LNL+IYV
Sbjct  72   IDTLKLGACVDLLGGLVHIGLGDPVANQCCPVLQGLVEVEAAVCLCTTLKLKLLNLNIYV  131

Query  621  PLALQLLVTCGKTPPPGYTCAL  686
            PLALQLLVTCGK+PPPGYTC+L
Sbjct  132  PLALQLLVTCGKSPPPGYTCSL  153



>gb|KJB37623.1| hypothetical protein B456_006G213000 [Gossypium raimondii]
Length=203

 Score = 85.1 bits (209),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 51/82 (62%), Positives = 67/82 (82%), Gaps = 0/82 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            ++ LKLG CVD+LGGL H+GLG+P  N CCP+L GL+ELEAA CLCT +++K LN++I++
Sbjct  121  VNALKLGLCVDVLGGLGHIGLGNPVENACCPVLGGLLELEAAVCLCTAIRLKLLNINIFI  180

Query  621  PLALQLLVTCGKTPPPGYTCAL  686
            PLALQ L+TCGK PP G+ C L
Sbjct  181  PLALQALITCGKNPPTGFICPL  202



>ref|XP_010055511.1| PREDICTED: 36.4 kDa proline-rich protein isoform X1 [Eucalyptus 
grandis]
 gb|KCW71993.1| hypothetical protein EUGRSUZ_E00446 [Eucalyptus grandis]
Length=276

 Score = 86.3 bits (212),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            I+ LKLG C+D+LGGLVH+G+G+P  N CCP+L+GL+ELEAA CLCT +++K LNL+I++
Sbjct  194  INALKLGLCLDVLGGLVHIGIGNPVENVCCPVLQGLLELEAAICLCTAIRLKLLNLNIFI  253

Query  621  PLALQLLVTCGKTPPPGYTC  680
            PLALQ+L TCG TPPPG+ C
Sbjct  254  PLALQVLATCGITPPPGFVC  273



>ref|XP_010093116.1| hypothetical protein L484_009307 [Morus notabilis]
 gb|EXB53568.1| hypothetical protein L484_009307 [Morus notabilis]
Length=279

 Score = 86.3 bits (212),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            IDTLKLGACVD+LGGL+H+G+G  A + CCP+L+GLV L+AA CLCTT+K K LN++I +
Sbjct  198  IDTLKLGACVDVLGGLIHIGIGSSAKDTCCPVLQGLVGLDAALCLCTTIKAKLLNINIIL  257

Query  621  PLALQLLVTCGKTPPPGYTC  680
            P+ALQL+V CGKT PPG+ C
Sbjct  258  PIALQLIVDCGKTAPPGFQC  277



>ref|XP_010687917.1| PREDICTED: 36.4 kDa proline-rich protein [Beta vulgaris subsp. 
vulgaris]
Length=274

 Score = 85.9 bits (211),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 63/82 (77%), Positives = 75/82 (91%), Gaps = 0/82 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            ID LKLGACVDLLGGLVH+GLGDPAVN+CCPIL+GL   EA  CLCT+LK+K LNL++YV
Sbjct  193  IDILKLGACVDLLGGLVHIGLGDPAVNKCCPILQGLASAEAGVCLCTSLKLKLLNLNLYV  252

Query  621  PLALQLLVTCGKTPPPGYTCAL  686
            P+ALQLL+TCGKTPPPG+TC++
Sbjct  253  PIALQLLLTCGKTPPPGFTCSV  274



>ref|XP_011100461.1| PREDICTED: LOW QUALITY PROTEIN: 36.4 kDa proline-rich protein-like 
[Sesamum indicum]
Length=268

 Score = 85.9 bits (211),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            IDTLKLGACVD+LGGLVH+G+G  A   CCP+L+GLV+L+AA CLCTT+K K LN++I +
Sbjct  187  IDTLKLGACVDVLGGLVHIGIGSSAKATCCPVLQGLVDLDAAICLCTTIKAKLLNINIIL  246

Query  621  PLALQLLVTCGKTPPPGYTC  680
            P+AL++LV CGKTPP G+ C
Sbjct  247  PIALEVLVDCGKTPPSGFQC  266



>ref|XP_006355521.1| PREDICTED: 36.4 kDa proline-rich protein-like, partial [Solanum 
tuberosum]
Length=231

 Score = 85.1 bits (209),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            ID LKLG C+D+LGGLVH+G+G+P  + CCP+L+GL+ELEAA CLCTT+++K LNL+I++
Sbjct  148  IDALKLGLCLDVLGGLVHIGIGNPVEHICCPVLQGLLELEAAICLCTTIRLKLLNLNIFL  207

Query  621  PLALQLLVTCGKTPPPGYTC  680
            PLAL +L TCG TPPPG+ C
Sbjct  208  PLALSVLATCGLTPPPGFVC  227



>ref|XP_003549740.1| PREDICTED: 36.4 kDa proline-rich protein [Glycine max]
Length=190

 Score = 84.3 bits (207),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 69/82 (84%), Positives = 78/82 (95%), Gaps = 0/82 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            IDTLKLGACVDLLGGLVH+GLGDP  N+CCP+L+GLVE+EAA CLCTTLK+K LNL+IYV
Sbjct  109  IDTLKLGACVDLLGGLVHIGLGDPVANQCCPVLQGLVEVEAAVCLCTTLKLKLLNLNIYV  168

Query  621  PLALQLLVTCGKTPPPGYTCAL  686
            PLALQLLVTCGK+PPPGYTC+L
Sbjct  169  PLALQLLVTCGKSPPPGYTCSL  190



>ref|XP_004508457.1| PREDICTED: 36.4 kDa proline-rich protein-like [Cicer arietinum]
Length=257

 Score = 85.1 bits (209),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 69/82 (84%), Positives = 79/82 (96%), Gaps = 0/82 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            I+TLKLGACVDLLGGLVH+G+GDP VN+CCP+L+GLVELEAAACLCTTLK+K LNL+IYV
Sbjct  176  INTLKLGACVDLLGGLVHIGVGDPVVNQCCPVLQGLVELEAAACLCTTLKLKLLNLNIYV  235

Query  621  PLALQLLVTCGKTPPPGYTCAL  686
            PLALQLL+ CGKTPPPGYTC+L
Sbjct  236  PLALQLLLACGKTPPPGYTCSL  257



>ref|XP_004245751.1| PREDICTED: 36.4 kDa proline-rich protein [Solanum lycopersicum]
Length=292

 Score = 85.5 bits (210),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            ID LKLG C+D+LGGLVH+G+G+P  + CCP+L+GL+ELEAA CLCTT+++K LNL+I++
Sbjct  209  IDALKLGLCLDVLGGLVHIGIGNPVEHICCPVLQGLLELEAAICLCTTIRLKLLNLNIFL  268

Query  621  PLALQLLVTCGKTPPPGYTC  680
            PLAL +L TCG TPPPG+ C
Sbjct  269  PLALSVLATCGLTPPPGFVC  288



>ref|XP_006301895.1| hypothetical protein CARUB_v10022370mg [Capsella rubella]
 gb|EOA34793.1| hypothetical protein CARUB_v10022370mg [Capsella rubella]
Length=307

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            I+ LKLGACVD+LGGL+H+GLG P  N CCP+L+GL+E+EAA CLCTT+++K LNL+I++
Sbjct  224  INALKLGACVDVLGGLIHIGLGKPVENVCCPVLQGLLEIEAAVCLCTTIRLKLLNLNIFI  283

Query  621  PLALQLLVTCGKTPPPGYTC  680
            PLALQ L+TCG  PP G+ C
Sbjct  284  PLALQALITCGINPPSGFVC  303



>ref|XP_010532493.1| PREDICTED: 36.4 kDa proline-rich protein-like [Tarenaya hassleriana]
Length=262

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 54/81 (67%), Positives = 68/81 (84%), Gaps = 1/81 (1%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNE-CCPILKGLVELEAAACLCTTLKIKALNLSIY  617
            IDTLKLGACVD+LGGL+H+GLG     E CCP+L GLV+L+AA CLCTT+K K LN+++ 
Sbjct  180  IDTLKLGACVDILGGLIHIGLGKSHAKEACCPVLGGLVDLDAAVCLCTTIKAKLLNINLI  239

Query  618  VPLALQLLVTCGKTPPPGYTC  680
            +P+AL+LLV CGKTPPPG+ C
Sbjct  240  IPIALELLVDCGKTPPPGFQC  260



>gb|EMS66044.1| 36.4 kDa proline-rich protein [Triticum urartu]
Length=122

 Score = 82.0 bits (201),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            ID LKL ACVD+L GLVH+ +G  A ++CCP+++G+ +L+AA CLCTT++ + LN++IY+
Sbjct  37   IDALKLNACVDVLSGLVHLVIGREARSKCCPLVQGVADLDAALCLCTTIRARVLNINIYL  96

Query  621  PLALQLLVTCGKTPPPGYTC  680
            P+AL+LL+TCGK PP G+ C
Sbjct  97   PVALRLLITCGKHPPNGFQC  116



>ref|XP_009759781.1| PREDICTED: 36.4 kDa proline-rich protein [Nicotiana sylvestris]
Length=323

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            ID LKLG C+D+LGGLVH+G+G+P  + CCP+L+GL+ELEAA CLCTT+++K LNL+I++
Sbjct  240  IDALKLGLCLDVLGGLVHIGIGNPVEHICCPVLQGLLELEAAICLCTTIRLKLLNLNIFL  299

Query  621  PLALQLLVTCGKTPPPGYTC  680
            PLAL +L TCG TPPPG+ C
Sbjct  300  PLALSVLATCGLTPPPGFIC  319



>gb|EMT06542.1| 36.4 kDa proline-rich protein [Aegilops tauschii]
Length=114

 Score = 81.6 bits (200),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            ID LKL ACVD+L GLVH+ +G  A ++CCP+++G+ +L+AA CLCTT++ + LN++IY+
Sbjct  29   IDALKLNACVDVLSGLVHLVIGREARSKCCPLVQGVADLDAALCLCTTIRARVLNINIYL  88

Query  621  PLALQLLVTCGKTPPPGYTC  680
            P+AL+LL+TCGK PP G+ C
Sbjct  89   PVALRLLITCGKHPPNGFQC  108



>ref|XP_003609406.1| proline-rich protein [Medicago truncatula]
Length=271

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 69/80 (86%), Positives = 77/80 (96%), Gaps = 0/80 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            IDTLKLGACVDLLGGLVH+GLGDP VN+CCP+L+GL E+EAAACLCTTLK+K LNL+IYV
Sbjct  153  IDTLKLGACVDLLGGLVHIGLGDPVVNKCCPVLQGLAEIEAAACLCTTLKLKLLNLNIYV  212

Query  621  PLALQLLVTCGKTPPPGYTC  680
            PLALQLL+TCGKTPPPGYTC
Sbjct  213  PLALQLLLTCGKTPPPGYTC  232



>ref|XP_008788893.1| PREDICTED: 36.4 kDa proline-rich protein-like [Phoenix dactylifera]
Length=190

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 61/82 (74%), Positives = 78/82 (95%), Gaps = 0/82 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            +DTLKLGACVDLLGGLVH+G+GDP VN+CCP+L+GLVE+EAA CLCTT+++K LN+++Y+
Sbjct  109  VDTLKLGACVDLLGGLVHIGIGDPVVNKCCPLLEGLVEIEAAVCLCTTIRLKLLNINLYL  168

Query  621  PLALQLLVTCGKTPPPGYTCAL  686
            PLALQLL+TCGKTPPPG+TC +
Sbjct  169  PLALQLLLTCGKTPPPGFTCTI  190



>ref|XP_003542640.1| PREDICTED: 36.4 kDa proline-rich protein-like [Glycine max]
Length=227

 Score = 83.6 bits (205),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 69/82 (84%), Positives = 77/82 (94%), Gaps = 0/82 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            IDTLKLGACVDLLGGLVH+GLGDP  N+CCP+L+GLVELEAA CLCTTLK+K LNL+IYV
Sbjct  146  IDTLKLGACVDLLGGLVHIGLGDPVANQCCPVLQGLVELEAAVCLCTTLKLKLLNLNIYV  205

Query  621  PLALQLLVTCGKTPPPGYTCAL  686
            PLALQLLV CGK+PPPGYTC+L
Sbjct  206  PLALQLLVACGKSPPPGYTCSL  227



>ref|XP_008362354.1| PREDICTED: 36.4 kDa proline-rich protein-like, partial [Malus 
domestica]
Length=78

 Score = 80.1 bits (196),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 47/76 (62%), Positives = 65/76 (86%), Gaps = 0/76 (0%)
 Frame = +3

Query  453  KLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVPLAL  632
            KLGACVD+LGGL+H+G+G  A + CCP+L+GLV+L+AA CLCTT+K K LN+++ +P+AL
Sbjct  1    KLGACVDVLGGLIHIGIGSSAKDACCPVLQGLVDLDAAICLCTTIKAKLLNVNLIIPIAL  60

Query  633  QLLVTCGKTPPPGYTC  680
            Q+L+ CGKTPP G+ C
Sbjct  61   QVLIACGKTPPSGFQC  76



>gb|KCW47606.1| hypothetical protein EUGRSUZ_K01352, partial [Eucalyptus grandis]
Length=93

 Score = 80.1 bits (196),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 35/57 (61%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = +3

Query  513  AVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVPLALQLLVTCGKTPPPGYTCA  683
            A + CCP+L+GL++L+AA CLCTT+K K LN+SI +P+ALQ+L+ CGKTPP G+ CA
Sbjct  36   AKDTCCPVLQGLLDLDAAVCLCTTIKAKLLNISIVIPIALQVLIDCGKTPPSGFQCA  92



>gb|EYU42870.1| hypothetical protein MIMGU_mgv1a011120mg [Erythranthe guttata]
Length=292

 Score = 84.0 bits (206),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            IDTLKLGACVD+LGGLVH+G+G    N CCP+L+GLV+L+AA CLCT +K K LN++I +
Sbjct  211  IDTLKLGACVDVLGGLVHIGIGQSPKNACCPVLEGLVDLDAALCLCTAIKAKLLNINILI  270

Query  621  PLALQLLVTCGKTPPPGYTC  680
            P+ALQ+LV CGKTPP G+ C
Sbjct  271  PIALQVLVDCGKTPPYGFQC  290



>ref|XP_009135778.1| PREDICTED: 36.4 kDa proline-rich protein-like [Brassica rapa]
Length=261

 Score = 83.6 bits (205),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 53/81 (65%), Positives = 67/81 (83%), Gaps = 1/81 (1%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNE-CCPILKGLVELEAAACLCTTLKIKALNLSIY  617
            IDTLKLGACVD+LGGL+H+GLG     E CCP+L GLV+L+AA CLCTT+K K LN+ + 
Sbjct  179  IDTLKLGACVDVLGGLIHIGLGKTHAKEKCCPVLGGLVDLDAAVCLCTTIKAKLLNIDLI  238

Query  618  VPLALQLLVTCGKTPPPGYTC  680
            +P+AL++LV CGKTPPPG+ C
Sbjct  239  IPIALEVLVACGKTPPPGFKC  259



>gb|KFK25004.1| hypothetical protein AALP_AA8G053900 [Arabis alpina]
Length=352

 Score = 84.7 bits (208),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 54/81 (67%), Positives = 67/81 (83%), Gaps = 1/81 (1%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvgl-gdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIY  617
            IDTLKLGACVD+LGGL+H+GL    A  ECCP+L GLV+L+AA CLCTT+K K LNL + 
Sbjct  270  IDTLKLGACVDVLGGLIHIGLGKSHAKEECCPVLGGLVDLDAAVCLCTTIKAKLLNLDLI  329

Query  618  VPLALQLLVTCGKTPPPGYTC  680
            +P+AL+LL+ CGKTPPPG+ C
Sbjct  330  IPIALELLLDCGKTPPPGFKC  350



>ref|XP_010490020.1| PREDICTED: 36.4 kDa proline-rich protein [Camelina sativa]
Length=202

 Score = 82.0 bits (201),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 52/81 (64%), Positives = 68/81 (84%), Gaps = 1/81 (1%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvgl-gdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIY  617
            IDTLKLGACVD+LGGL+H+GL    A  ECCP+L GL++L+AA CLCTT+K K LN+++ 
Sbjct  120  IDTLKLGACVDVLGGLIHIGLGKSHAKEECCPVLGGLLDLDAAVCLCTTIKAKLLNINLI  179

Query  618  VPLALQLLVTCGKTPPPGYTC  680
            +P+AL+LL+ CGKTPPPG+ C
Sbjct  180  LPIALELLLDCGKTPPPGFKC  200



>ref|XP_006453085.1| hypothetical protein CICLE_v10009567mg [Citrus clementina]
 ref|XP_006474415.1| PREDICTED: 36.4 kDa proline-rich protein-like [Citrus sinensis]
 gb|ESR66325.1| hypothetical protein CICLE_v10009567mg [Citrus clementina]
 gb|KDO73488.1| hypothetical protein CISIN_1g029294mg [Citrus sinensis]
 gb|KDO73489.1| hypothetical protein CISIN_1g029294mg [Citrus sinensis]
Length=195

 Score = 82.0 bits (201),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 69/82 (84%), Positives = 77/82 (94%), Gaps = 0/82 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            IDTLKLGACVDLLGGLVH+GLGDP VN+CCP+L+GLVELEAA CLCTTLK+K LNL+IY+
Sbjct  114  IDTLKLGACVDLLGGLVHIGLGDPVVNQCCPVLQGLVELEAAVCLCTTLKLKLLNLNIYL  173

Query  621  PLALQLLVTCGKTPPPGYTCAL  686
            PLALQLLVTCGKTPP G+TC L
Sbjct  174  PLALQLLVTCGKTPPAGFTCTL  195


 Score = 49.7 bits (117),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 23/33 (70%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +3

Query  33   MEVSKVTALLLISMLFISSATPILACGSCGKPS  131
            M+ SK++ALL+I MLFIS+ATPIL CG+CGKP 
Sbjct  1    MDSSKLSALLIICMLFISTATPILGCGTCGKPH  33



>ref|XP_008464631.1| PREDICTED: 36.4 kDa proline-rich protein-like, partial [Cucumis 
melo]
Length=216

 Score = 82.4 bits (202),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            IDTLKLGACVDLLGGL+H+G+GD     CCP+L+GLV+L+AA CLCTT+K K LN+++ +
Sbjct  134  IDTLKLGACVDLLGGLIHIGIGDRTKQTCCPVLEGLVDLDAAVCLCTTIKAKLLNINLII  193

Query  621  PLALQLLVTCGKTPPPGYTC  680
            P+ALQ+L+ CGK PP G+ C
Sbjct  194  PIALQVLIDCGKHPPSGFQC  213



>ref|NP_001150138.1| 36.4 kDa proline-rich protein precursor [Zea mays]
 gb|ACG37997.1| 36.4 kDa proline-rich protein [Zea mays]
Length=263

 Score = 83.2 bits (204),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 64/81 (79%), Positives = 77/81 (95%), Gaps = 0/81 (0%)
 Frame = +3

Query  444  DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  623
            D+LKLGACVDLLGGLVHVGLGDP VN+CCP+L+GLVELEAA CLCTT+K++ LN+++Y+P
Sbjct  183  DSLKLGACVDLLGGLVHVGLGDPVVNQCCPVLEGLVELEAAVCLCTTIKLRLLNVNLYLP  242

Query  624  LALQLLVTCGKTPPPGYTCAL  686
            LALQLL+TCGKTPPPGYTC +
Sbjct  243  LALQLLLTCGKTPPPGYTCTV  263



>ref|XP_011001017.1| PREDICTED: 36.4 kDa proline-rich protein [Populus euphratica]
Length=359

 Score = 84.3 bits (207),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            IDTLKLGACVD+LGGLVH+G+G  A + CCP+L+GL++L+AA CLCTT+K K LN+SI +
Sbjct  278  IDTLKLGACVDVLGGLVHIGIGSSAKDACCPVLQGLLDLDAAICLCTTIKAKLLNISIII  337

Query  621  PLALQLLVTCGKTPPPGYTC  680
            P+AL++LV CGKTPP G+ C
Sbjct  338  PIALEVLVDCGKTPPEGFKC  357



>dbj|BAJ34557.1| unnamed protein product [Thellungiella halophila]
Length=335

 Score = 84.0 bits (206),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 53/81 (65%), Positives = 68/81 (84%), Gaps = 1/81 (1%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvgl-gdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIY  617
            IDTLKLGACVD+LGGL+H+GL    A  ECCP+L GLV+L+AA CLCTT+K K LN+++ 
Sbjct  253  IDTLKLGACVDVLGGLIHIGLGKSHAKEECCPVLGGLVDLDAAVCLCTTIKAKLLNINLI  312

Query  618  VPLALQLLVTCGKTPPPGYTC  680
            +P+AL+LL+ CGKTPPPG+ C
Sbjct  313  LPIALELLLDCGKTPPPGFKC  333



>ref|XP_011654010.1| PREDICTED: 36.4 kDa proline-rich protein [Cucumis sativus]
Length=244

 Score = 82.4 bits (202),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            IDTLKLGACVDLLGGL+H+G+GD     CCP+L+GLV+L+AA CLCTT+K K LN+++ +
Sbjct  162  IDTLKLGACVDLLGGLIHIGIGDRTKQTCCPVLEGLVDLDAAVCLCTTIKAKLLNINLII  221

Query  621  PLALQLLVTCGKTPPPGYTC  680
            P+ALQ+LV CGK PP G+ C
Sbjct  222  PIALQVLVDCGKHPPSGFQC  241



>ref|XP_002323166.2| hypothetical protein POPTR_0016s01720g [Populus trichocarpa]
 gb|EEF04927.2| hypothetical protein POPTR_0016s01720g [Populus trichocarpa]
Length=438

 Score = 85.1 bits (209),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            IDTLKLGACVD+LGGLVH+G+G  A + CCP+L+GL++L+AA CLCTT+K K LN+SI +
Sbjct  357  IDTLKLGACVDVLGGLVHIGIGSSAKDACCPVLQGLLDLDAAICLCTTIKAKLLNISIII  416

Query  621  PLALQLLVTCGKTPPPGYTC  680
            P+AL++LV CGKTPP G+ C
Sbjct  417  PIALEVLVDCGKTPPEGFKC  436



>ref|XP_004304516.1| PREDICTED: 36.4 kDa proline-rich protein [Fragaria vesca subsp. 
vesca]
Length=315

 Score = 83.6 bits (205),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            ID LKLGACVD+LGGL+HVG+G  A + CCP+L+GL++L+AA CLCTT+++K LN++I +
Sbjct  234  IDALKLGACVDVLGGLIHVGIGGNAKDACCPVLQGLLDLDAAICLCTTIRLKLLNINIII  293

Query  621  PLALQLLVTCGKTPPPGYTC  680
            PLALQ+L+ CGKTPP G+ C
Sbjct  294  PLALQVLIDCGKTPPDGFKC  313



>emb|CDP06245.1| unnamed protein product [Coffea canephora]
Length=399

 Score = 84.3 bits (207),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 53/81 (65%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            IDTLKLGACVDLLGGLVH+G+G    + CCP+L+GLV+L+AA CLCTT+K K LN++I +
Sbjct  317  IDTLKLGACVDLLGGLVHIGIGSNVKSTCCPVLEGLVDLDAAVCLCTTIKAKLLNINILI  376

Query  621  PLALQLLVTCGKTPPPGYTCA  683
            P+AL++LV CGKT PPG+ C+
Sbjct  377  PIALEVLVDCGKTAPPGFQCS  397



>emb|CAA47812.1| ptxA [Pisum sativum]
Length=352

 Score = 83.6 bits (205),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 50/80 (63%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            ID LKLGACVD+LGGL+H+G+G  A   CCP+L+GLV+L+AA CLCTT+++K LN+++ +
Sbjct  270  IDALKLGACVDVLGGLIHIGIGGSAKQTCCPLLQGLVDLDAAVCLCTTIRLKLLNINLVI  329

Query  621  PLALQLLVTCGKTPPPGYTC  680
            PLALQ+L+ CGKTPP G+ C
Sbjct  330  PLALQVLIDCGKTPPEGFKC  349



>ref|XP_003601475.1| Proline rich protein [Medicago truncatula]
 gb|AES71726.1| Lipid transfer protein [Medicago truncatula]
Length=338

 Score = 83.6 bits (205),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 50/80 (63%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            ID LKLGACVD+LGGL+H+G+G  A   CCP+L+GLV+L+AA CLCTT+++K LN+++ +
Sbjct  256  IDALKLGACVDVLGGLIHIGIGGSAKQTCCPLLQGLVDLDAAICLCTTIRLKLLNINLVI  315

Query  621  PLALQLLVTCGKTPPPGYTC  680
            PLALQ+L+ CGKTPP G+ C
Sbjct  316  PLALQVLIDCGKTPPEGFKC  335



>ref|XP_002437338.1| hypothetical protein SORBIDRAFT_10g025210 [Sorghum bicolor]
 gb|EER88705.1| hypothetical protein SORBIDRAFT_10g025210 [Sorghum bicolor]
Length=309

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 64/81 (79%), Positives = 77/81 (95%), Gaps = 0/81 (0%)
 Frame = +3

Query  444  DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  623
            D+LKLGACVDLLGGLVH+GLGDP VN+CCP+L+GLVELEAA CLCTT+K+K LN+++Y+P
Sbjct  229  DSLKLGACVDLLGGLVHIGLGDPVVNKCCPVLEGLVELEAAVCLCTTIKLKLLNINLYLP  288

Query  624  LALQLLVTCGKTPPPGYTCAL  686
            LALQLL+TCGKTPPPGYTC +
Sbjct  289  LALQLLLTCGKTPPPGYTCTI  309



>gb|ACF88427.1| unknown [Zea mays]
 gb|AFW87301.1| hypothetical protein ZEAMMB73_062722 [Zea mays]
 gb|AFW87302.1| hypothetical protein ZEAMMB73_062722 [Zea mays]
Length=304

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 63/81 (78%), Positives = 77/81 (95%), Gaps = 0/81 (0%)
 Frame = +3

Query  444  DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  623
            D+LKLGACVDLLGGLVH+GLGDP VN+CCP+L+GLVELEAA CLCTT+K++ LN+++Y+P
Sbjct  224  DSLKLGACVDLLGGLVHIGLGDPVVNKCCPVLEGLVELEAAVCLCTTIKLRLLNINLYLP  283

Query  624  LALQLLVTCGKTPPPGYTCAL  686
            LALQLL+TCGKTPPPGYTC +
Sbjct  284  LALQLLLTCGKTPPPGYTCTV  304



>dbj|BAE71274.1| hypothetical protein [Trifolium pratense]
Length=240

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 69/82 (84%), Positives = 77/82 (94%), Gaps = 0/82 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            IDTLKLGACVDLLGGLVH+GLGDP  N+CCPIL+GL E+EAAACLCTTLK+K LNL+IYV
Sbjct  159  IDTLKLGACVDLLGGLVHIGLGDPTANKCCPILQGLAEIEAAACLCTTLKLKLLNLNIYV  218

Query  621  PLALQLLVTCGKTPPPGYTCAL  686
            PLALQLL+ CGKTPPPGYTC+L
Sbjct  219  PLALQLLLACGKTPPPGYTCSL  240



>gb|EEC84097.1| hypothetical protein OsI_30410 [Oryza sativa Indica Group]
Length=246

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 46/80 (58%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            ID LKL ACVD+LGGL+H+ +G  A  +CCP+++G+ +L+AA CLCTT++ + LN++IY+
Sbjct  161  IDALKLNACVDVLGGLIHLVIGQKARAKCCPLVQGVADLDAALCLCTTIRARLLNINIYL  220

Query  621  PLALQLLVTCGKTPPPGYTC  680
            P+AL+LL+TCGK PPPG+ C
Sbjct  221  PVALELLITCGKHPPPGFKC  240



>ref|NP_001056927.1| Os06g0168700 [Oryza sativa Japonica Group]
 dbj|BAD67619.1| putative prolin rich protein [Oryza sativa Japonica Group]
 dbj|BAD67971.1| putative prolin rich protein [Oryza sativa Japonica Group]
 dbj|BAF18841.1| Os06g0168700 [Oryza sativa Japonica Group]
 dbj|BAG95000.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96181.1| unnamed protein product [Oryza sativa Japonica Group]
Length=246

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 46/80 (58%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            ID LKL ACVD+LGGL+H+ +G  A  +CCP+++G+ +L+AA CLCTT++ + LN++IY+
Sbjct  161  IDALKLNACVDVLGGLIHLVIGQKARAKCCPLVQGVADLDAALCLCTTIRARLLNINIYL  220

Query  621  PLALQLLVTCGKTPPPGYTC  680
            P+AL+LL+TCGK PPPG+ C
Sbjct  221  PVALELLITCGKHPPPGFKC  240



>emb|CAA57810.1| proline-rich-like protein [Asparagus officinalis]
Length=184

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 61/82 (74%), Positives = 77/82 (94%), Gaps = 0/82 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            +D LKLGACVDLLGGLVH+GLGDP VN+CCP+++GLVE+EAA CLCTT+++K LN+++Y+
Sbjct  103  LDALKLGACVDLLGGLVHIGLGDPVVNQCCPLIEGLVEIEAAVCLCTTIRLKLLNINLYL  162

Query  621  PLALQLLVTCGKTPPPGYTCAL  686
            PLALQLL+TCGKTPPPGYTC +
Sbjct  163  PLALQLLLTCGKTPPPGYTCTI  184



>ref|XP_011656197.1| PREDICTED: 36.4 kDa proline-rich protein-like [Cucumis sativus]
Length=404

 Score = 84.0 bits (206),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            IDTLKLGACVDLLGGL+H+G+GD     CCP+L+GLV+L+AA CLCTT+K K LN+++ +
Sbjct  322  IDTLKLGACVDLLGGLIHIGIGDRTKQTCCPVLEGLVDLDAAVCLCTTIKAKLLNINLII  381

Query  621  PLALQLLVTCGKTPPPGYTC  680
            P+ALQ+LV CGK PP G+ C
Sbjct  382  PIALQVLVDCGKHPPSGFQC  401



>ref|XP_008342311.1| PREDICTED: 36.4 kDa proline-rich protein-like [Malus domestica]
Length=311

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 50/80 (63%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            IDTLKLGACVD+LGGL+H+G+G  A + CCP+L+GLV+L+AA CLCTT+K K LN+++ +
Sbjct  230  IDTLKLGACVDVLGGLIHIGIGSXAKDXCCPVLQGLVDLDAAICLCTTIKAKLLNVNLII  289

Query  621  PLALQLLVTCGKTPPPGYTC  680
            P+ALQ+L+ CGKTP  G+ C
Sbjct  290  PIALQVLIDCGKTPLSGFQC  309



>gb|EAZ35967.1| hypothetical protein OsJ_20271 [Oryza sativa Japonica Group]
Length=258

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 46/80 (58%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            ID LKL ACVD+LGGL+H+ +G  A  +CCP+++G+ +L+AA CLCTT++ + LN++IY+
Sbjct  173  IDALKLNACVDVLGGLIHLVIGQKARAKCCPLVQGVADLDAALCLCTTIRARLLNINIYL  232

Query  621  PLALQLLVTCGKTPPPGYTC  680
            P+AL+LL+TCGK PPPG+ C
Sbjct  233  PVALELLITCGKHPPPGFKC  252



>ref|XP_003560341.1| PREDICTED: 36.4 kDa proline-rich protein-like [Brachypodium distachyon]
Length=274

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 64/82 (78%), Positives = 78/82 (95%), Gaps = 0/82 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            +D+LK+GACVDLLGGLVHVGLGDPAVN CCP+L GLVELEAA CLCTT+++K LN+++Y+
Sbjct  193  VDSLKIGACVDLLGGLVHVGLGDPAVNTCCPLLAGLVELEAAVCLCTTIRLKLLNINLYL  252

Query  621  PLALQLLVTCGKTPPPGYTCAL  686
            PLALQLL+TCGKTPPPGYTC++
Sbjct  253  PLALQLLLTCGKTPPPGYTCSV  274



>ref|XP_012081188.1| PREDICTED: 36.4 kDa proline-rich protein [Jatropha curcas]
 ref|XP_012081189.1| PREDICTED: 36.4 kDa proline-rich protein [Jatropha curcas]
 gb|KDP30246.1| hypothetical protein JCGZ_17028 [Jatropha curcas]
Length=218

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 67/82 (82%), Positives = 77/82 (94%), Gaps = 0/82 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            IDTLKLGACVDLLGGLVH+GLGDP VN+CCP+++GL  LEAA CLCTTLK+K LNL++YV
Sbjct  137  IDTLKLGACVDLLGGLVHIGLGDPVVNQCCPVIEGLAGLEAAVCLCTTLKLKLLNLNVYV  196

Query  621  PLALQLLVTCGKTPPPGYTCAL  686
            P+ALQLLVTCGKTPPPGYTC+L
Sbjct  197  PIALQLLVTCGKTPPPGYTCSL  218


 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 27/34 (79%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +3

Query  33   MEVSKVTALLLISMLFISSATPILACGSCGKPSH  134
            ME SK++ALLLI MLFISSA PIL CGSCGKP H
Sbjct  1    MESSKISALLLICMLFISSAAPILGCGSCGKPRH  34



>gb|ERN15013.1| hypothetical protein AMTR_s00032p00233360 [Amborella trichopoda]
Length=171

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 49/80 (61%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            ID LKLGACVDLLGGLVH+ +G+     CCP+++G+ +L+AA C CTT+K+KALNL++ +
Sbjct  91   IDALKLGACVDLLGGLVHLVIGEQVNKNCCPLVQGVADLDAALCFCTTIKVKALNLNVVL  150

Query  621  PLALQLLVTCGKTPPPGYTC  680
            PLALQ+LV CGK+ PPG+ C
Sbjct  151  PLALQVLVGCGKSVPPGFNC  170



>ref|XP_006853546.2| PREDICTED: 36.4 kDa proline-rich protein [Amborella trichopoda]
Length=178

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 49/80 (61%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            ID LKLGACVDLLGGLVH+ +G+     CCP+++G+ +L+AA C CTT+K+KALNL++ +
Sbjct  98   IDALKLGACVDLLGGLVHLVIGEQVNKNCCPLVQGVADLDAALCFCTTIKVKALNLNVVL  157

Query  621  PLALQLLVTCGKTPPPGYTC  680
            PLALQ+LV CGK+ PPG+ C
Sbjct  158  PLALQVLVGCGKSVPPGFNC  177



>gb|AGT16397.1| hypothetical protein SHCRBa_181_K17_R_210 [Saccharum hybrid cultivar 
R570]
Length=318

 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 64/81 (79%), Positives = 77/81 (95%), Gaps = 0/81 (0%)
 Frame = +3

Query  444  DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  623
            D+LKLGACVDLLGGLVH+GLGDP VN+CCP+L+GLVELEAA CLCTT+K+K LN+++Y+P
Sbjct  238  DSLKLGACVDLLGGLVHIGLGDPVVNKCCPVLEGLVELEAAVCLCTTIKLKLLNINLYLP  297

Query  624  LALQLLVTCGKTPPPGYTCAL  686
            LALQLL+TCGKTPPPGYTC +
Sbjct  298  LALQLLLTCGKTPPPGYTCTV  318



>ref|XP_002437917.1| hypothetical protein SORBIDRAFT_10g004790 [Sorghum bicolor]
 gb|EER89284.1| hypothetical protein SORBIDRAFT_10g004790 [Sorghum bicolor]
Length=324

 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            IDTLKL ACVD+L GL+H+ +G  A ++CCP+++G+ +L+AA CLCTT++++ LN++IY+
Sbjct  240  IDTLKLNACVDVLSGLIHLVIGQEARSKCCPLVQGIADLDAALCLCTTIRLRLLNINIYL  299

Query  621  PLALQLLVTCGKTPPPGYTC  680
            P+AL LL+TCGK PP G+ C
Sbjct  300  PIALNLLITCGKHPPSGFQC  319



>ref|NP_001144590.1| uncharacterized protein LOC100277605 precursor [Zea mays]
 gb|ACG41576.1| hypothetical protein [Zea mays]
Length=304

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 63/81 (78%), Positives = 77/81 (95%), Gaps = 0/81 (0%)
 Frame = +3

Query  444  DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  623
            D+LKLGACVDLLGGLVH+GLGDP VN+CCP+L+GLVELEAA CLCTT+K++ LN+++Y+P
Sbjct  224  DSLKLGACVDLLGGLVHIGLGDPVVNKCCPVLEGLVELEAAVCLCTTIKLRLLNINLYLP  283

Query  624  LALQLLVTCGKTPPPGYTCAL  686
            LALQLL+TCGKTPPPGYTC +
Sbjct  284  LALQLLLTCGKTPPPGYTCTV  304



>gb|AFH57274.1| proline-rich protein [Gossypium hirsutum]
Length=443

 Score = 84.0 bits (206),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 68/82 (83%), Positives = 74/82 (90%), Gaps = 0/82 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            IDTLKLGACVDLLGG VHVG+GDP VN CCP+LKGLVELEAA CLCTTLK+K LNL IY 
Sbjct  362  IDTLKLGACVDLLGGAVHVGVGDPVVNACCPVLKGLVELEAAVCLCTTLKLKLLNLKIYA  421

Query  621  PLALQLLVTCGKTPPPGYTCAL  686
            P+ALQLL+ CGKTPPPGYTC+L
Sbjct  422  PIALQLLIPCGKTPPPGYTCSL  443



>gb|AAD03487.1| proline-rich cell wall protein [Medicago sativa]
Length=381

 Score = 83.6 bits (205),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 50/80 (63%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            ID LKLGACVD+LGGL+H+G+G  A   CCP+L+GLV+L+AA CLCTT+++K LN+++ +
Sbjct  299  IDALKLGACVDVLGGLIHIGIGGSAKQTCCPLLQGLVDLDAAICLCTTIRLKLLNINLVI  358

Query  621  PLALQLLVTCGKTPPPGYTC  680
            PLALQ+L+ CGKTPP G+ C
Sbjct  359  PLALQVLIDCGKTPPEGFKC  378



>dbj|BAJ89958.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=265

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            ID LKL ACVD+L GLVH+ +G  A ++CCP+++G+ +L+AA CLCTT++ + LN++IY+
Sbjct  180  IDALKLNACVDVLSGLVHLVIGREARSKCCPLVQGVADLDAALCLCTTIRARVLNINIYL  239

Query  621  PLALQLLVTCGKTPPPGYTC  680
            P+AL+LL+TCGK PP G+ C
Sbjct  240  PVALRLLITCGKHPPNGFQC  259



>gb|AGT16919.1| proline-rich protein [Saccharum hybrid cultivar R570]
Length=344

 Score = 82.4 bits (202),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            IDTLKL ACVD+L GL+H+ +G  A ++CCP+++G+ +L+AA CLCTT++ + LN++IY+
Sbjct  260  IDTLKLNACVDVLSGLIHLVIGQEARSKCCPLVQGVADLDAALCLCTTIRARVLNINIYL  319

Query  621  PLALQLLVTCGKTPPPGYTC  680
            P+AL LL+TCGK PP G+ C
Sbjct  320  PIALNLLITCGKHPPSGFQC  339



>ref|XP_010420896.1| PREDICTED: 36.4 kDa proline-rich protein-like [Camelina sativa]
Length=429

 Score = 82.8 bits (203),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            IDTLKLGACVD+LGGLVH+G+G  A  +CCP+L+GLV+L+AAACLCTT+K K LN+ +  
Sbjct  46   IDTLKLGACVDVLGGLVHIGIGKSAKEKCCPLLEGLVDLDAAACLCTTIKAKLLNIELVF  105

Query  621  PLALQLLVTCGKTPPPGYTC  680
            P+AL++L+ CGK PPPG+ C
Sbjct  106  PIALEVLLGCGKKPPPGFQC  125


 Score = 82.8 bits (203),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            IDTLKLGACVD+LGGLVH+G+G  A  +CCP+L+GLV+L+AAACLCTT+K K LN+ +  
Sbjct  192  IDTLKLGACVDVLGGLVHIGIGKSAKEKCCPLLEGLVDLDAAACLCTTIKAKLLNIELVF  251

Query  621  PLALQLLVTCGKTPPPGYTC  680
            P+AL++L+ CGK PPPG+ C
Sbjct  252  PIALEVLLGCGKKPPPGFQC  271


 Score = 74.7 bits (182),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            I+ LKLGACVD+LGGL+H+G+G+ A  +CCP+L+GLV+L+AA CLCTT+K K LN+++ +
Sbjct  348  INPLKLGACVDVLGGLIHIGIGNNAKEKCCPVLEGLVDLDAAVCLCTTIKAKLLNINLIL  407

Query  621  PLALQLLVTCGKTPPPGYTC  680
            P+AL++L+ CGK PP G+ C
Sbjct  408  PIALEVLLDCGKKPPSGFKC  427



>dbj|BAJ88732.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=267

 Score = 80.5 bits (197),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 61/82 (74%), Positives = 77/82 (94%), Gaps = 0/82 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            +D+LK+GACVDLLGGLVHVGLGDP VN+CCP+L+GLVELEAA CLCTT+++K LN+++ +
Sbjct  186  VDSLKIGACVDLLGGLVHVGLGDPVVNKCCPLLQGLVELEAAVCLCTTIRLKLLNINLVL  245

Query  621  PLALQLLVTCGKTPPPGYTCAL  686
            PLALQLL+TCGKTPPP YTC++
Sbjct  246  PLALQLLLTCGKTPPPSYTCSI  267



>ref|XP_010466481.1| PREDICTED: 36.4 kDa proline-rich protein-like [Camelina sativa]
Length=246

 Score = 80.1 bits (196),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 50/80 (63%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            IDTLKLG+CVD+LGGLVH+G+G  A  +CCPI++GLV+L+AA CLCTT+K K LN+ +  
Sbjct  9    IDTLKLGSCVDVLGGLVHIGIGKSAKEKCCPIIEGLVDLDAAVCLCTTIKAKLLNVELVF  68

Query  621  PLALQLLVTCGKTPPPGYTC  680
            P+AL++L+ CGK PPPG+ C
Sbjct  69   PIALEVLLGCGKKPPPGFQC  88


 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            I+ LKLGACVD+LGGL+H+G+G+ A  +CCP+L+GLV+L+AA CLCTT+K K LN+++ +
Sbjct  165  INPLKLGACVDVLGGLIHIGIGNNAKEKCCPVLEGLVDLDAAVCLCTTIKAKLLNINLIL  224

Query  621  PLALQLLVTCGKTPPPGYTC  680
            P+AL++L+ CGK PP G+ C
Sbjct  225  PIALEVLLDCGKKPPSGFKC  244



>gb|AAF32353.1|AF220197_1 proline rich protein 2, partial [Vitis riparia]
Length=56

 Score = 75.9 bits (185),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +3

Query  519  NECCPILKGLVELEAAACLCTTLKIKALNLSIYVPLALQLLVTCGKTPPPGYTC  680
            + CCP+L+GLV+L+AA CLCT +K+K LN++I +P+ALQ+LV CGKTPP G+ C
Sbjct  1    DTCCPVLQGLVDLDAAVCLCTGIKVKLLNVNIIIPIALQVLVGCGKTPPSGFQC  54



>ref|XP_008785888.1| PREDICTED: 36.4 kDa proline-rich protein-like [Phoenix dactylifera]
Length=208

 Score = 79.3 bits (194),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            +DTLKLGACVDLLGGLVHVG+G  A   CCP+L+GL +L+AA CLCTT++ K LN++I +
Sbjct  125  VDTLKLGACVDLLGGLVHVGIGKKAKATCCPLLEGLADLDAALCLCTTIRAKLLNINIVL  184

Query  621  PLALQLLVTCGKTPPPGYTC  680
            P+AL+L++ CGK PP GY C
Sbjct  185  PIALELMIGCGKHPPSGYQC  204



>ref|XP_003564254.1| PREDICTED: 36.4 kDa proline-rich protein-like [Brachypodium distachyon]
Length=239

 Score = 79.7 bits (195),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            ID LKL ACVDLLGGLVH  +G  A ++CCP+++G+ +L+AA CLCTT++ + L ++IY+
Sbjct  154  IDALKLNACVDLLGGLVHAVIGKEARSKCCPLVQGVADLDAALCLCTTIRARLLGINIYL  213

Query  621  PLALQLLVTCGKTPPPGYTC  680
            P+AL+LL+TCGK PP G+TC
Sbjct  214  PVALRLLITCGKHPPNGFTC  233



>gb|EMT21385.1| 36.4 kDa proline-rich protein [Aegilops tauschii]
Length=232

 Score = 79.7 bits (195),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 61/82 (74%), Positives = 77/82 (94%), Gaps = 0/82 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            +D+LK+GACVDLLGGLVHVGLGDP VN+CCP+L+GLVELEAA CLCTT+++K LN+++ +
Sbjct  151  VDSLKIGACVDLLGGLVHVGLGDPVVNKCCPLLEGLVELEAAVCLCTTIRLKLLNINLVL  210

Query  621  PLALQLLVTCGKTPPPGYTCAL  686
            PLALQLL+TCGKTPP GYTC++
Sbjct  211  PLALQLLLTCGKTPPTGYTCSI  232



>ref|XP_004966695.1| PREDICTED: 36.4 kDa proline-rich protein-like [Setaria italica]
Length=296

 Score = 80.5 bits (197),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            ID LKL ACVD+L GL+H+ +G  A ++CCP+++G+ +L+AA CLCTT++ + LN++IY+
Sbjct  212  IDALKLNACVDVLSGLIHLVIGQEARSKCCPLVQGIADLDAALCLCTTIRARLLNINIYL  271

Query  621  PLALQLLVTCGKTPPPGYTC  680
            P+AL+LL+TCGK  PPG+ C
Sbjct  272  PVALELLITCGKHAPPGFKC  291



>ref|XP_009145429.1| PREDICTED: 36.4 kDa proline-rich protein-like [Brassica rapa]
Length=340

 Score = 81.3 bits (199),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 53/81 (65%), Positives = 67/81 (83%), Gaps = 1/81 (1%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglg-dPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIY  617
            IDTLKLGACVD+LGGL+H+GLG   A  ECCP+L GLV+L+AA CLCTT+K K L + + 
Sbjct  258  IDTLKLGACVDVLGGLIHIGLGGSSAKKECCPVLGGLVDLDAAVCLCTTIKAKLLIVDLI  317

Query  618  VPLALQLLVTCGKTPPPGYTC  680
            +P+AL+LL+ CGKTPPPG+ C
Sbjct  318  IPIALELLIDCGKTPPPGFKC  338



>ref|XP_010038743.1| PREDICTED: 36.4 kDa proline-rich protein-like [Eucalyptus grandis]
Length=225

 Score = 79.3 bits (194),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 35/57 (61%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = +3

Query  513  AVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVPLALQLLVTCGKTPPPGYTCA  683
            A + CCP+L+GL++L+AA CLCTT+K K LN+SI +P+ALQ+L+ CGKTPP G+ CA
Sbjct  168  AKDTCCPVLQGLLDLDAAVCLCTTIKAKLLNISIVIPIALQVLIDCGKTPPSGFQCA  224



>emb|CAA64425.1| cell wall-plasma membrane linker protein [Brassica napus]
Length=376

 Score = 81.3 bits (199),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 53/81 (65%), Positives = 67/81 (83%), Gaps = 1/81 (1%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglg-dPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIY  617
            IDTLKLGACVD+LGGL+H+GLG   A  ECCP+L GLV+L+AA CLCTT+K K L + + 
Sbjct  294  IDTLKLGACVDVLGGLIHIGLGGSSAKKECCPVLGGLVDLDAAVCLCTTIKAKLLIVDLI  353

Query  618  VPLALQLLVTCGKTPPPGYTC  680
            +P+AL+LL+ CGKTPPPG+ C
Sbjct  354  IPIALELLIDCGKTPPPGFKC  374



>ref|XP_010466478.1| PREDICTED: 36.4 kDa proline-rich protein-like isoform X1 [Camelina 
sativa]
 ref|XP_010466479.1| PREDICTED: 36.4 kDa proline-rich protein-like isoform X2 [Camelina 
sativa]
Length=371

 Score = 80.9 bits (198),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 52/81 (64%), Positives = 68/81 (84%), Gaps = 1/81 (1%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvgl-gdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIY  617
            IDTLKLGACVD+LGGL+H+GL    A  ECCP+L GL++L+AA CLCTT+K K LN+++ 
Sbjct  289  IDTLKLGACVDVLGGLIHIGLGKSHAKEECCPVLGGLLDLDAAVCLCTTIKAKLLNINLI  348

Query  618  VPLALQLLVTCGKTPPPGYTC  680
            +P+AL+LL+ CGKTPPPG+ C
Sbjct  349  LPIALELLLDCGKTPPPGFKC  369



>ref|XP_010510955.1| PREDICTED: 36.4 kDa proline-rich protein-like [Camelina sativa]
Length=358

 Score = 80.5 bits (197),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 52/81 (64%), Positives = 68/81 (84%), Gaps = 1/81 (1%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvgl-gdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIY  617
            IDTLKLGACVD+LGGL+H+GL    A  ECCP+L GL++L+AA CLCTT+K K LN+++ 
Sbjct  276  IDTLKLGACVDVLGGLIHIGLGKSHAKEECCPVLGGLLDLDAAVCLCTTIKAKLLNINLI  335

Query  618  VPLALQLLVTCGKTPPPGYTC  680
            +P+AL+LL+ CGKTPPPG+ C
Sbjct  336  LPIALELLLDCGKTPPPGFKC  356



>ref|XP_006856527.1| PREDICTED: 36.4 kDa proline-rich protein [Amborella trichopoda]
 gb|ERN17994.1| hypothetical protein AMTR_s00046p00138910 [Amborella trichopoda]
Length=240

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 49/82 (60%), Positives = 66/82 (80%), Gaps = 0/82 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            +D LKLGACVD+LGGLVHVGLG    +ECCP+++GL +++A  CLC ++++K LNL I+V
Sbjct  158  VDALKLGACVDMLGGLVHVGLGVHVADECCPLIQGLADIQATLCLCNSIRMKLLNLKIFV  217

Query  621  PLALQLLVTCGKTPPPGYTCAL  686
            PLAL+LLVTCG  PPP + C +
Sbjct  218  PLALKLLVTCGMNPPPDFACPM  239



>gb|AAC06386.1| proline rich protein, partial [Malus domestica]
Length=75

 Score = 75.1 bits (183),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 46/56 (82%), Gaps = 0/56 (0%)
 Frame = +3

Query  513  AVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVPLALQLLVTCGKTPPPGYTC  680
            A + CCP+L+GLV+L+AA CLCTT+K K LN+++ +P+ LQ+L+ CGKTPP G+ C
Sbjct  18   AKDACCPVLQGLVDLDAAICLCTTIKAKLLNINLIIPIVLQVLIDCGKTPPSGFQC  73



>ref|XP_002307866.2| hypothetical protein POPTR_0006s01030g [Populus trichocarpa]
 gb|EEE91389.2| hypothetical protein POPTR_0006s01030g [Populus trichocarpa]
Length=216

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 63/80 (79%), Gaps = 0/80 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            IDTLKLGACVD+LGGLVH+  G    +ECCP+L+G ++L+ A+CL   +K K LN+++ +
Sbjct  135  IDTLKLGACVDVLGGLVHIRTGSSVNDECCPVLEGFIDLDVASCLDIVIKAKLLNINLII  194

Query  621  PLALQLLVTCGKTPPPGYTC  680
            P+AL++L  CGKTPPPG+ C
Sbjct  195  PIALKVLAECGKTPPPGFKC  214



>gb|ACN36521.1| unknown [Zea mays]
Length=284

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            IDTLKL ACVD+L GL+H+ +G  A ++CCP+++G+ +L+AA CLCTT++ + LN++IY+
Sbjct  200  IDTLKLNACVDVLSGLIHLVIGQEARSKCCPLVQGVADLDAALCLCTTIRARLLNINIYL  259

Query  621  PLALQLLVTCGKTPPPGYTC  680
            P+AL LL+TCGK  P G+ C
Sbjct  260  PIALNLLITCGKHAPSGFQC  279



>gb|ACG39902.1| 36.4 kDa proline-rich protein [Zea mays]
Length=284

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            IDTLKL ACVD+L GL+H+ +G  A ++CCP+++G+ +L+AA CLCTT++ + LN++IY+
Sbjct  200  IDTLKLNACVDVLSGLIHLVIGQEARSKCCPLVQGVADLDAALCLCTTIRARLLNINIYL  259

Query  621  PLALQLLVTCGKTPPPGYTC  680
            P+AL LL+TCGK  P G+ C
Sbjct  260  PIALNLLITCGKHAPSGFQC  279



>ref|XP_009346908.1| PREDICTED: uncharacterized protein LOC103938610 [Pyrus x bretschneideri]
Length=662

 Score = 81.3 bits (199),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +3

Query  510  PAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVPLALQLLVTCGKTPPPGY  674
            P  N CCP+L GL+ELEAA CLCTT+ +K LN++I++PLA+Q L+TCGKTPPP +
Sbjct  55   PVENTCCPVLGGLLELEAAICLCTTIGLKLLNINIFIPLAVQALITCGKTPPPSF  109



>ref|XP_006655834.1| PREDICTED: 36.4 kDa proline-rich protein-like [Oryza brachyantha]
Length=218

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            ID LKL ACVD+LGGL+H+ +G  A  +CCP+++G+ +L+AA CLCTT++ + LN++IY+
Sbjct  134  IDALKLNACVDVLGGLIHLVIGQKAKAKCCPLVQGVADLDAALCLCTTIRARLLNINIYL  193

Query  621  PLALQLLVTCGKTPPPGYTC  680
            P+AL+LL+TCGK PP G+ C
Sbjct  194  PVALELLITCGKHPPEGFKC  213



>gb|ABK26093.1| unknown [Picea sitchensis]
Length=220

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            ID LKLGACVD+LGGLVHV LGD AVN+CCP+L+G++ LEAA CLCTT+K K LNL+I +
Sbjct  137  IDALKLGACVDVLGGLVHVSLGDSAVNQCCPLLQGVLSLEAALCLCTTIKAKLLNLNIIL  196

Query  621  PLALQLLVTCGKTPPPGYTC  680
            PLAL+LLV CG +PPPG+TC
Sbjct  197  PLALELLVFCGNSPPPGFTC  216



>ref|NP_001149720.1| hybrid proline-rich protein1 precursor [Zea mays]
 emb|CAA42959.1| proline rich protein [Zea mays]
 gb|ACG36519.1| 36.4 kDa proline-rich protein [Zea mays]
 gb|ACL52767.1| unknown [Zea mays]
 gb|AFW85655.1| hybrid proline-rich protein1 [Zea mays]
Length=301

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            IDTLKL ACVD+L GL+H+ +G  A ++CCP+++G+ +L+AA CLCTT++ + LN++IY+
Sbjct  217  IDTLKLNACVDVLSGLIHLVIGQEARSKCCPLVQGVADLDAALCLCTTIRARLLNINIYL  276

Query  621  PLALQLLVTCGKTPPPGYTC  680
            P+AL LL+TCGK  P G+ C
Sbjct  277  PIALNLLITCGKHAPSGFQC  296



>ref|XP_004502092.1| PREDICTED: repetitive proline-rich cell wall protein 2-like [Cicer 
arietinum]
Length=419

 Score = 80.5 bits (197),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 49/82 (60%), Positives = 69/82 (84%), Gaps = 1/82 (1%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNE-CCPILKGLVELEAAACLCTTLKIKALNLSIY  617
            ID LKLGACVD+LGGL+H+G+G  +  + CCP+L+GLV+L+AA CLCT++K+K LN+++ 
Sbjct  337  IDVLKLGACVDVLGGLIHIGIGGSSAKQTCCPLLQGLVDLDAALCLCTSIKLKLLNINLV  396

Query  618  VPLALQLLVTCGKTPPPGYTCA  683
            +P+ALQLL+ CGK PP G+ CA
Sbjct  397  IPIALQLLIDCGKNPPEGFKCA  418



>gb|ADW66157.1| proline-rich protein [Solanum nigrum]
Length=89

 Score = 75.1 bits (183),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 50/81 (62%), Positives = 65/81 (80%), Gaps = 1/81 (1%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            ID LKLGACVD+LGGL+H+G+G  A   CCP+L GLV+L+AA CLCTT+K+K LN++I +
Sbjct  7    IDALKLGACVDVLGGLIHIGIGGSAKQTCCPLLHGLVDLDAAICLCTTIKLKLLNINIIL  66

Query  621  PLALQLLV-TCGKTPPPGYTC  680
            P+ALQ+LV  CGK PP  + C
Sbjct  67   PIALQVLVDDCGKYPPKDFKC  87



>ref|XP_006853490.1| PREDICTED: 36.4 kDa proline-rich protein [Amborella trichopoda]
 gb|ERN14957.1| hypothetical protein AMTR_s00032p00211090 [Amborella trichopoda]
Length=172

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 64/80 (80%), Gaps = 0/80 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            IDTLKL ACVDLLGG+ H  +G+     CCP+++G+ +L+AA CLCTT++ KALNL++ +
Sbjct  92   IDTLKLAACVDLLGGVAHAVIGEEVKKGCCPLVQGVADLDAALCLCTTIRAKALNLNVVL  151

Query  621  PLALQLLVTCGKTPPPGYTC  680
            P+ALQ+L+ CGK+ PPG+ C
Sbjct  152  PIALQVLIGCGKSVPPGFQC  171



>gb|AAS20977.1| protease inhibitor/seed storage/lipid transfer protein [Hyacinthus 
orientalis]
Length=113

 Score = 75.5 bits (184),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 47/79 (59%), Positives = 65/79 (82%), Gaps = 3/79 (4%)
 Frame = +3

Query  444  DTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYVP  623
            +TLKLG C+D+LGG++H G   PAV +CCP++ GL  ++AAACLCT +K+KA  +++YVP
Sbjct  37   NTLKLGTCLDVLGGIIHAGD--PAV-DCCPLIAGLTSVQAAACLCTAIKLKAGGVNLYVP  93

Query  624  LALQLLVTCGKTPPPGYTC  680
            +A++LLVTCGK PPPGY C
Sbjct  94   IAVELLVTCGKKPPPGYKC  112



>gb|ABK24042.1| unknown [Picea sitchensis]
 gb|ABK26117.1| unknown [Picea sitchensis]
Length=197

 Score = 77.0 bits (188),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            ID LKLGACVD+LGGLVHV LGD AVN+CCP+L+G++ LEAA CLCTT+K K LNL+I +
Sbjct  114  IDALKLGACVDVLGGLVHVSLGDSAVNQCCPLLQGVLSLEAALCLCTTIKAKLLNLNIIL  173

Query  621  PLALQLLVTCGKTPPPGYTC  680
            PLAL+LLV CG +PPPG+TC
Sbjct  174  PLALELLVFCGNSPPPGFTC  193



>ref|XP_006652908.1| PREDICTED: 36.4 kDa proline-rich protein-like [Oryza brachyantha]
Length=251

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 52/81 (64%), Positives = 60/81 (74%), Gaps = 3/81 (4%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            ID LKLG CVDLLG  VH+G    A  +CCP++KG+  L AAACLCT +K K L+LSIYV
Sbjct  174  IDALKLGVCVDLLGNEVHIG---DAHVQCCPLVKGIAGLSAAACLCTAIKAKVLDLSIYV  230

Query  621  PLALQLLVTCGKTPPPGYTCA  683
            P+AL LLV CG   PPGYTCA
Sbjct  231  PIALSLLVNCGCDVPPGYTCA  251



>ref|XP_009380947.1| PREDICTED: 36.4 kDa proline-rich protein-like [Musa acuminata 
subsp. malaccensis]
Length=155

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 63/80 (79%), Gaps = 0/80 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            IDTLKL ACVDLLGGLVH  +G    ++CCP+++GL +L+AA CLCTT+K KAL++++ +
Sbjct  74   IDTLKLDACVDLLGGLVHAVIGQDTQDKCCPVIQGLADLDAALCLCTTIKAKALDINVLL  133

Query  621  PLALQLLVTCGKTPPPGYTC  680
            P+AL+LLV CGK  P  Y C
Sbjct  134  PIALELLVDCGKHVPSDYQC  153



>gb|ABR13301.1| putative proline-rich cell wall protein [Prunus dulcis]
Length=130

 Score = 75.1 bits (183),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            IDTLKLGACVD+LGGL+H+G+G  A + CCP+L+GLV+L+AA CLCTT+K K LN++I +
Sbjct  49   IDTLKLGACVDVLGGLIHIGIGSSAKDACCPVLQGLVDLDAAICLCTTIKAKLLNINIII  108

Query  621  PLALQLLVTCGKTPPPGYTC  680
            P+ALQ+L+ CGKTPP G+ C
Sbjct  109  PIALQVLIDCGKTPPSGFQC  128



>ref|XP_010490022.1| PREDICTED: 36.4 kDa proline-rich protein-like [Camelina sativa]
Length=137

 Score = 74.7 bits (182),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            I+ LKLGACVD+LGGL+H+G+G+ A  +CCPIL+GLV+L+AA CLCTT+K K LN+++ +
Sbjct  56   INPLKLGACVDVLGGLIHIGIGNNAKEKCCPILEGLVDLDAAVCLCTTIKAKLLNINLIL  115

Query  621  PLALQLLVTCGKTPPPGYTC  680
            P+AL++L+ CGK PP G+ C
Sbjct  116  PIALEVLLDCGKKPPSGFKC  135



>gb|EMS54619.1| 14 kDa proline-rich protein DC2.15 [Triticum urartu]
Length=113

 Score = 73.6 bits (179),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 51/82 (62%), Positives = 62/82 (76%), Gaps = 4/82 (5%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            IDTLKLG C+DLLG  +H+G    A  +CCP+++G+  L AAACLCT +K K LNL++YV
Sbjct  35   IDTLKLGVCLDLLGNELHIG---DASVKCCPLVEGIAGLTAAACLCTAIKAKVLNLALYV  91

Query  621  PLALQLLVT-CGKTPPPGYTCA  683
            PLALQLLV  CG   PPGYTCA
Sbjct  92   PLALQLLVNDCGCAVPPGYTCA  113



>gb|AAD11796.1| cell wall-plasma membrane linker protein homolog [Arabidopsis 
thaliana]
Length=306

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 50/81 (62%), Positives = 66/81 (81%), Gaps = 1/81 (1%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvgl-gdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIY  617
            IDTLKLGACVD+LGGL+H+GL    A  ECCP+L GL++L+AA CLCTT+K+K LN+ + 
Sbjct  224  IDTLKLGACVDVLGGLIHIGLGKSHAKAECCPVLGGLLDLDAAVCLCTTIKLKLLNIDLV  283

Query  618  VPLALQLLVTCGKTPPPGYTC  680
            +P+AL+LL+ CGKTPP  + C
Sbjct  284  LPIALELLLDCGKTPPSDFKC  304



>ref|XP_009414495.1| PREDICTED: 36.4 kDa proline-rich protein-like [Musa acuminata 
subsp. malaccensis]
Length=210

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 50/80 (63%), Positives = 62/80 (78%), Gaps = 0/80 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            IDTLKL ACVDLLGGLVHV +G     +CCP+L+GL +L+AA CLCTT+K KAL +SI +
Sbjct  128  IDTLKLDACVDLLGGLVHVIIGGDVTYQCCPVLEGLADLDAALCLCTTIKAKALGISILL  187

Query  621  PLALQLLVTCGKTPPPGYTC  680
            P+AL++LV CGK  P  Y C
Sbjct  188  PIALEVLVDCGKHVPSDYQC  207



>ref|XP_010680174.1| PREDICTED: 36.4 kDa proline-rich protein-like isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=493

 Score = 77.8 bits (190),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            IDTLKL ACVD+LGGL+H+G+G  A   CCPIL GLV L+AA CLCTT++ K LN++I +
Sbjct  410  IDTLKLNACVDVLGGLIHIGIGSGAKGACCPILGGLVGLDAAVCLCTTIRAKLLNINIIL  469

Query  621  PLALQLLVTCGKTPPPGYTC  680
            PLALQ+L  CGK+PPPG+ C
Sbjct  470  PLALQVLADCGKSPPPGFQC  489



>ref|XP_010680173.1| PREDICTED: 36.4 kDa proline-rich protein-like isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=553

 Score = 77.8 bits (190),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            IDTLKL ACVD+LGGL+H+G+G  A   CCPIL GLV L+AA CLCTT++ K LN++I +
Sbjct  470  IDTLKLNACVDVLGGLIHIGIGSGAKGACCPILGGLVGLDAAVCLCTTIRAKLLNINIIL  529

Query  621  PLALQLLVTCGKTPPPGYTC  680
            PLALQ+L  CGK+PPPG+ C
Sbjct  530  PLALQVLADCGKSPPPGFQC  549



>ref|XP_010914263.1| PREDICTED: 36.4 kDa proline-rich protein [Elaeis guineensis]
Length=183

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 64/80 (80%), Gaps = 0/80 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            IDTLKL ACVDLLGGLVHVG+G+    +CCP+L+GL +L+AA CLCTT+K K LN++I +
Sbjct  102  IDTLKLDACVDLLGGLVHVGIGEDEKEKCCPVLEGLADLDAALCLCTTIKAKVLNINIIL  161

Query  621  PLALQLLVTCGKTPPPGYTC  680
            P+AL+LLV CGK  P  Y C
Sbjct  162  PVALELLVDCGKHLPSDYQC  181



>gb|AAF75825.1|AF101789_1 proline-rich protein [Pinus taeda]
Length=139

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            ++ LKLGACVDLL GLVHVGLGDP VN+CCP+++G+  LEAA CLCTT++ K L+L++ +
Sbjct  57   LNALKLGACVDLLQGLVHVGLGDPVVNQCCPLIQGVAALEAALCLCTTIRAKVLSLNVLL  116

Query  621  PLALQLLVTCGKTPPPGYTC  680
            P+AL L+ +CG T PP + C
Sbjct  117  PIALSLVASCGLTVPPDFKC  136



>gb|AGW00930.1| PRP [Citrus trifoliata]
Length=176

 Score = 73.9 bits (180),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 51/82 (62%), Positives = 68/82 (83%), Gaps = 2/82 (2%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNL-SIY  617
            ID LKLGACVD+LGGL+H+GLGD A  +CCP+L+GL +L+AA CLCT +++KALNL ++ 
Sbjct  93   IDALKLGACVDVLGGLIHIGLGDSAKEKCCPLLQGLADLDAAVCLCTAIRLKALNLINLL  152

Query  618  VPLALQLLVT-CGKTPPPGYTC  680
            VP++LQ+LV  CGK PP G+ C
Sbjct  153  VPISLQVLVNDCGKYPPAGFQC  174



>ref|NP_188851.2| cell wall-plasma membrane linker protein [Arabidopsis thaliana]
 dbj|BAB03061.1| unnamed protein product [Arabidopsis thaliana]
 gb|ABN04755.1| At3g22120 [Arabidopsis thaliana]
 gb|AEE76592.1| cell wall-plasma membrane linker protein [Arabidopsis thaliana]
Length=334

 Score = 76.3 bits (186),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 50/81 (62%), Positives = 66/81 (81%), Gaps = 1/81 (1%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvgl-gdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIY  617
            IDTLKLGACVD+LGGL+H+GL    A  ECCP+L GL++L+AA CLCTT+K+K LN+ + 
Sbjct  252  IDTLKLGACVDVLGGLIHIGLGKSHAKAECCPVLGGLLDLDAAVCLCTTIKLKLLNIDLV  311

Query  618  VPLALQLLVTCGKTPPPGYTC  680
            +P+AL+LL+ CGKTPP  + C
Sbjct  312  LPIALELLLDCGKTPPSDFKC  332



>ref|NP_001054058.2| Os04g0644400 [Oryza sativa Japonica Group]
 dbj|BAF15972.2| Os04g0644400, partial [Oryza sativa Japonica Group]
Length=182

 Score = 73.9 bits (180),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 49/81 (60%), Positives = 59/81 (73%), Gaps = 3/81 (4%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            ID LKLG CVDLLG  VH+G    A   CCP++K +  L AAACLCT +K K L++SIY+
Sbjct  105  IDALKLGVCVDLLGNEVHIG---DAHVTCCPLVKDIAGLSAAACLCTAIKAKVLDISIYI  161

Query  621  PLALQLLVTCGKTPPPGYTCA  683
            P+AL+LLV CG   PPGYTCA
Sbjct  162  PIALKLLVNCGCDVPPGYTCA  182



>gb|ACU22880.1| unknown [Glycine max]
Length=207

 Score = 73.9 bits (180),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 52/81 (64%), Positives = 67/81 (83%), Gaps = 0/81 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            IDTLKLGACVD+LGGL+H+G+G  A   CCP+L GLV+L+AA CLCT ++ K LN++I +
Sbjct  125  IDTLKLGACVDVLGGLIHIGIGSSAQQTCCPVLAGLVDLDAAVCLCTIIRAKILNINIII  184

Query  621  PLALQLLVTCGKTPPPGYTCA  683
            P+ALQLL+ CGKTPP G+ CA
Sbjct  185  PIALQLLIDCGKTPPDGFKCA  205



>ref|XP_009621287.1| PREDICTED: 36.4 kDa proline-rich protein-like, partial [Nicotiana 
tomentosiformis]
Length=277

 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 49/81 (60%), Positives = 65/81 (80%), Gaps = 1/81 (1%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            ID LKLGACVD+LGGL+H+G+G  A   CCP+L GLV+L+AA CLCTT+++K LN++I +
Sbjct  194  IDALKLGACVDVLGGLIHIGIGGSAKQTCCPLLMGLVDLDAAICLCTTIRLKLLNINIIL  253

Query  621  PLALQLLV-TCGKTPPPGYTC  680
            P+ALQ+LV  CGK PP  + C
Sbjct  254  PIALQVLVDDCGKYPPKDFQC  274



>ref|XP_006429793.1| hypothetical protein CICLE_v10012789mg [Citrus clementina]
 gb|ESR43033.1| hypothetical protein CICLE_v10012789mg [Citrus clementina]
Length=206

 Score = 73.9 bits (180),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 51/82 (62%), Positives = 68/82 (83%), Gaps = 2/82 (2%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNL-SIY  617
            ID LKLGACVD+LGGL+H+GLGD A  +CCP+L+GL +L+AA CLCT +++KALNL ++ 
Sbjct  123  IDALKLGACVDVLGGLIHIGLGDSAKEKCCPLLQGLADLDAAVCLCTAIRLKALNLINLL  182

Query  618  VPLALQLLVT-CGKTPPPGYTC  680
            VP++LQ+LV  CGK PP G+ C
Sbjct  183  VPISLQVLVNDCGKYPPAGFQC  204



>ref|XP_010436582.1| PREDICTED: 36.4 kDa proline-rich protein-like, partial [Camelina 
sativa]
Length=230

 Score = 74.3 bits (181),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 51/81 (63%), Positives = 65/81 (80%), Gaps = 1/81 (1%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdP-AVNECCPILKGLVELEAAACLCTTLKIKALNLSIY  617
            ID LKLGACVD+LGGL+H+GLG   A  +CCP+L GLV L+AA CLCTT++ K LN+ + 
Sbjct  138  IDALKLGACVDVLGGLIHIGLGKTYAKAKCCPLLDGLVGLDAAICLCTTIRAKLLNIDLV  197

Query  618  VPLALQLLVTCGKTPPPGYTC  680
            +P+AL+LLV CGKTPP G+ C
Sbjct  198  IPIALELLVDCGKTPPRGFKC  218



>gb|KHN31117.1| 36.4 kDa proline-rich protein [Glycine soja]
Length=349

 Score = 76.3 bits (186),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 53/81 (65%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            IDTLKLGACVD+LGGL+H+G+G  A   CCP+L GLV+L+AA CLCTT++ K LN++I +
Sbjct  267  IDTLKLGACVDVLGGLIHIGIGSSAQQTCCPVLAGLVDLDAAVCLCTTIRAKILNINIII  326

Query  621  PLALQLLVTCGKTPPPGYTCA  683
            P+ALQLL+ CGKTPP G+ CA
Sbjct  327  PIALQLLIDCGKTPPDGFKCA  347



>ref|XP_010440330.1| PREDICTED: 36.4 kDa proline-rich protein [Camelina sativa]
Length=288

 Score = 75.1 bits (183),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 51/81 (63%), Positives = 65/81 (80%), Gaps = 1/81 (1%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdP-AVNECCPILKGLVELEAAACLCTTLKIKALNLSIY  617
            ID LKLGACVD+LGGL+H+GLG   A  +CCP+L GLV L+AA CLCTT++ K LN+ + 
Sbjct  197  IDALKLGACVDVLGGLIHIGLGKTYAKAKCCPLLDGLVGLDAAVCLCTTIRAKLLNIDLV  256

Query  618  VPLALQLLVTCGKTPPPGYTC  680
            +P+AL+LLV CGKTPP G+ C
Sbjct  257  IPIALELLVDCGKTPPRGFKC  277



>ref|XP_006492911.1| PREDICTED: 36.4 kDa proline-rich protein-like isoform X2 [Citrus 
sinensis]
Length=191

 Score = 73.6 bits (179),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 51/82 (62%), Positives = 68/82 (83%), Gaps = 2/82 (2%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNL-SIY  617
            ID LKLGACVD+LGGL+H+GLGD A  +CCP+L+GL +L+AA CLCT +++KALNL ++ 
Sbjct  108  IDALKLGACVDVLGGLIHIGLGDSAKEKCCPLLQGLADLDAAVCLCTAIRLKALNLINLL  167

Query  618  VPLALQLLVT-CGKTPPPGYTC  680
            VP++LQ+LV  CGK PP G+ C
Sbjct  168  VPISLQVLVNDCGKYPPAGFQC  189



>gb|ACU20743.1| unknown [Glycine max]
Length=229

 Score = 73.9 bits (180),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 65/77 (84%), Positives = 72/77 (94%), Gaps = 0/77 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            IDTLKLGACVDLLGGLVH+GLGDP  N+CCP+L+GLVELEAA CLCTTLK+K LNL+IYV
Sbjct  146  IDTLKLGACVDLLGGLVHIGLGDPVANQCCPVLQGLVELEAAVCLCTTLKLKLLNLNIYV  205

Query  621  PLALQLLVTCGKTPPPG  671
            PLALQLLV CGK+PPPG
Sbjct  206  PLALQLLVACGKSPPPG  222



>gb|KJB42884.1| hypothetical protein B456_007G172300 [Gossypium raimondii]
Length=283

 Score = 74.7 bits (182),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            IDTLKLGACVD+LGGLVH+G+G  A + CCP+L+GL++L+AA CLCTT+K K LN++I +
Sbjct  202  IDTLKLGACVDVLGGLVHIGIGSSAKDTCCPVLQGLLDLDAAICLCTTIKAKLLNINIII  261

Query  621  PLALQLLVTCGKTPPPGYTC  680
            P+ LQ+L+ CGKTPPPG+ C
Sbjct  262  PIGLQVLIDCGKTPPPGFQC  281



>ref|XP_003542174.1| PREDICTED: 36.4 kDa proline-rich protein-like [Glycine max]
Length=384

 Score = 75.9 bits (185),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 53/81 (65%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = +3

Query  441  IDTLKLGACvdllgglvhvglgdPAVNECCPILKGLVELEAAACLCTTLKIKALNLSIYV  620
            IDTLKLGACVD+LGGL+H+G+G  A   CCP+L GLV+L+AA CLCTT++ K LN++I +
Sbjct  302  IDTLKLGACVDVLGGLIHIGIGSSAQQTCCPVLAGLVDLDAAVCLCTTIRAKILNINIII  361

Query  621  PLALQLLVTCGKTPPPGYTCA  683
            P+ALQLL+ CGKTPP G+ CA
Sbjct  362  PIALQLLIDCGKTPPDGFKCA  382



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2652182888745