BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig11606

Length=1417
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP01995.1|  unnamed protein product                                486   1e-167   Coffea canephora [robusta coffee]
ref|XP_009588225.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    472   2e-162   Nicotiana tomentosiformis
ref|XP_008452092.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    471   4e-162   Cucumis melo [Oriental melon]
ref|XP_007046882.1|  Gamma carbonic anhydrase 1, CA1                    471   6e-162   Theobroma cacao [chocolate]
ref|XP_009772840.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    471   6e-162   Nicotiana sylvestris
ref|XP_002282021.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    471   6e-162   Vitis vinifera
gb|KJB17752.1|  hypothetical protein B456_003G013500                    471   8e-162   Gossypium raimondii
gb|KHG23300.1|  hypothetical protein F383_08437                         470   1e-161   Gossypium arboreum [tree cotton]
ref|XP_010265678.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    470   2e-161   Nelumbo nucifera [Indian lotus]
ref|XP_010102071.1|  hypothetical protein L484_009014                   470   2e-161   Morus notabilis
ref|XP_006346962.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    469   2e-161   Solanum tuberosum [potatoes]
ref|XP_004146498.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    468   6e-161   Cucumis sativus [cucumbers]
gb|KJB43468.1|  hypothetical protein B456_007G201900                    468   1e-160   Gossypium raimondii
ref|XP_010263617.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    468   1e-160   Nelumbo nucifera [Indian lotus]
ref|XP_004233530.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    467   3e-160   
gb|KHG00707.1|  hypothetical protein F383_22748                         466   8e-160   Gossypium arboreum [tree cotton]
gb|KJB12032.1|  hypothetical protein B456_002G126800                    466   9e-160   Gossypium raimondii
ref|XP_010061298.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    465   2e-159   Eucalyptus grandis [rose gum]
ref|XP_010029770.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    465   2e-159   Eucalyptus grandis [rose gum]
ref|XP_012071891.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    465   2e-159   Jatropha curcas
ref|XP_008444737.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    464   3e-159   Cucumis melo [Oriental melon]
ref|XP_012071886.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    464   5e-159   Jatropha curcas
ref|XP_004152688.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    464   5e-159   Cucumis sativus [cucumbers]
ref|XP_010922032.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    463   1e-158   Elaeis guineensis
ref|XP_002510412.1|  Protein yrdA, putative                             462   1e-158   Ricinus communis
ref|XP_009391607.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    462   1e-158   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007204711.1|  hypothetical protein PRUPE_ppa009928mg             462   2e-158   Prunus persica
ref|XP_006878532.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    462   3e-158   Amborella trichopoda
ref|XP_002302024.1|  transcription factor APFI family protein           462   3e-158   Populus trichocarpa [western balsam poplar]
ref|XP_006466826.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    462   3e-158   Citrus sinensis [apfelsine]
ref|XP_008338081.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    461   4e-158   
ref|XP_006425642.1|  hypothetical protein CICLE_v10026267mg             461   5e-158   Citrus clementina [clementine]
ref|XP_002510411.1|  Protein yrdA, putative                             461   9e-158   Ricinus communis
ref|XP_006386210.1|  hypothetical protein POPTR_0002s03550g             461   1e-157   
ref|XP_008241708.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    460   2e-157   Prunus mume [ume]
ref|XP_007017577.1|  Gamma carbonic anhydrase 1, CA1                    460   2e-157   
ref|XP_006435021.1|  hypothetical protein CICLE_v10002155mg             459   2e-157   Citrus clementina [clementine]
ref|XP_009371625.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    459   2e-157   Pyrus x bretschneideri [bai li]
ref|XP_008338249.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    459   5e-157   Malus domestica [apple tree]
ref|XP_009590737.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    459   5e-157   Nicotiana tomentosiformis
ref|XP_008786862.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    459   5e-157   Phoenix dactylifera
ref|XP_009799511.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    459   5e-157   Nicotiana sylvestris
ref|XP_009340721.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    458   8e-157   Pyrus x bretschneideri [bai li]
ref|NP_001275071.1|  transcription factor APFI-like                     458   9e-157   Solanum tuberosum [potatoes]
ref|XP_002306878.1|  transcription factor APFI family protein           458   9e-157   Populus trichocarpa [western balsam poplar]
ref|XP_010931534.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    459   2e-156   Elaeis guineensis
ref|XP_006383176.1|  hypothetical protein POPTR_0005s12280g             456   4e-156   Populus trichocarpa [western balsam poplar]
ref|XP_011007461.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    456   5e-156   Populus euphratica
ref|XP_010113421.1|  hypothetical protein L484_026755                   456   9e-156   Morus notabilis
ref|XP_011074556.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    455   9e-156   Sesamum indicum [beniseed]
ref|XP_011083204.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    454   2e-155   Sesamum indicum [beniseed]
ref|XP_008788543.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    453   7e-155   Phoenix dactylifera
ref|XP_009386943.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    452   2e-154   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009399949.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    452   2e-154   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDP07494.1|  unnamed protein product                                451   4e-154   Coffea canephora [robusta coffee]
gb|KCW68228.1|  hypothetical protein EUGRSUZ_F01883                     451   5e-154   Eucalyptus grandis [rose gum]
ref|XP_010538097.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    451   7e-154   Tarenaya hassleriana [spider flower]
ref|XP_004291863.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    450   1e-153   Fragaria vesca subsp. vesca
ref|XP_011011740.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    450   1e-153   Populus euphratica
gb|AFK45344.1|  unknown                                                 449   2e-153   Medicago truncatula
ref|XP_009799510.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    449   3e-153   Nicotiana sylvestris
ref|NP_564091.1|  gamma carbonic anhydrase 1                            449   5e-153   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007222873.1|  hypothetical protein PRUPE_ppa009923mg             449   5e-153   Prunus persica
ref|XP_008220827.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    448   5e-153   Prunus mume [ume]
ref|XP_004232424.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    448   5e-153   Solanum lycopersicum
ref|XP_004287879.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    448   6e-153   Fragaria vesca subsp. vesca
dbj|BAD43151.1|  unknown protein                                        447   1e-152   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006340643.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    447   2e-152   Solanum tuberosum [potatoes]
gb|AAM61583.1|  unknown                                                 447   2e-152   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009365039.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    447   2e-152   Pyrus x bretschneideri [bai li]
ref|XP_009336133.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    447   3e-152   Pyrus x bretschneideri [bai li]
gb|AFK48594.1|  unknown                                                 446   7e-152   Lotus japonicus
ref|XP_003523810.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    445   2e-151   Glycine max [soybeans]
ref|XP_010679758.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    444   2e-151   Beta vulgaris subsp. vulgaris [field beet]
dbj|BAD44607.1|  unknown protein                                        443   7e-151   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009365536.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    443   8e-151   Pyrus x bretschneideri [bai li]
gb|AFK46651.1|  unknown                                                 442   1e-150   Lotus japonicus
ref|XP_008388037.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    441   7e-150   Malus domestica [apple tree]
ref|XP_008364986.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    440   1e-149   
ref|XP_008810436.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    440   1e-149   Phoenix dactylifera
ref|XP_006305516.1|  hypothetical protein CARUB_v10009987mg             439   2e-149   Capsella rubella
ref|XP_006644073.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    438   5e-149   Oryza brachyantha
ref|XP_010523601.1|  PREDICTED: gamma carbonic anhydrase 2, mitoc...    437   1e-148   Tarenaya hassleriana [spider flower]
gb|KFK44104.1|  hypothetical protein AALP_AA1G216400                    437   1e-148   Arabis alpina [alpine rockcress]
ref|XP_002890347.1|  F18O14.34                                          437   3e-148   
ref|XP_003612060.1|  Transcription factor APFI-like protein             436   4e-148   Medicago truncatula
ref|NP_001241093.1|  uncharacterized protein LOC100805278               436   6e-148   Glycine max [soybeans]
ref|NP_001042763.1|  Os01g0283100                                       434   2e-147   
gb|AAF79435.1|AC025808_17  F18O14.34                                    435   3e-147   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009110271.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    433   5e-147   Brassica rapa
emb|CDM82924.1|  unnamed protein product                                433   5e-147   Triticum aestivum [Canadian hard winter wheat]
ref|XP_003567426.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    433   5e-147   Brachypodium distachyon [annual false brome]
ref|XP_002455477.1|  hypothetical protein SORBIDRAFT_03g011540          433   5e-147   Sorghum bicolor [broomcorn]
emb|CDX96658.1|  BnaA08g22010D                                          433   6e-147   
gb|EEC70424.1|  hypothetical protein OsI_01428                          432   9e-147   Oryza sativa Indica Group [Indian rice]
ref|XP_003517218.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    432   2e-146   Glycine max [soybeans]
emb|CDX83758.1|  BnaC08g18870D                                          432   2e-146   
ref|XP_008655471.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    431   2e-146   
ref|XP_011083663.1|  PREDICTED: gamma carbonic anhydrase 2, mitoc...    430   1e-145   Sesamum indicum [beniseed]
ref|XP_010459631.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    429   1e-145   Camelina sativa [gold-of-pleasure]
gb|KHN36089.1|  Hypothetical protein glysoja_003212                     429   2e-145   Glycine soja [wild soybean]
ref|XP_003537599.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    429   3e-145   Glycine max [soybeans]
ref|XP_010477178.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    428   4e-145   
gb|ACU19296.1|  unknown                                                 428   6e-145   Glycine max [soybeans]
gb|ACU23675.1|  unknown                                                 427   8e-145   Glycine max [soybeans]
ref|XP_010498381.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    427   1e-144   Camelina sativa [gold-of-pleasure]
ref|XP_004512067.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    427   1e-144   Cicer arietinum [garbanzo]
gb|EYU31197.1|  hypothetical protein MIMGU_mgv1a012119mg                426   2e-144   Erythranthe guttata [common monkey flower]
ref|XP_004967660.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    426   2e-144   Setaria italica
ref|XP_007156970.1|  hypothetical protein PHAVU_002G032600g             424   1e-143   Phaseolus vulgaris [French bean]
ref|XP_010679759.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    419   1e-141   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009612501.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    419   2e-141   Nicotiana tomentosiformis
ref|XP_006393603.1|  hypothetical protein EUTSA_v10011707mg             419   3e-141   Eutrema salsugineum [saltwater cress]
ref|XP_008672300.1|  PREDICTED: uncharacterized protein LOC100217...    418   3e-141   Zea mays [maize]
gb|KEH36170.1|  gamma carbonic anhydrase-like protein                   417   8e-141   Medicago truncatula
gb|ACG35255.1|  transcription factor APFI                               415   5e-140   Zea mays [maize]
ref|XP_009771198.1|  PREDICTED: gamma carbonic anhydrase 2, mitoc...    415   8e-140   Nicotiana sylvestris
gb|AFK41197.1|  unknown                                                 413   3e-139   Medicago truncatula
ref|XP_004238283.1|  PREDICTED: gamma carbonic anhydrase 2, mitoc...    413   4e-139   Solanum lycopersicum
ref|NP_175159.1|  gamma carbonic anhydrase 2                            412   2e-138   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006341958.1|  PREDICTED: gamma carbonic anhydrase 2, mitoc...    411   3e-138   Solanum tuberosum [potatoes]
ref|NP_001066265.1|  Os12g0169700                                       411   3e-138   
gb|EYU45182.1|  hypothetical protein MIMGU_mgv1a011728mg                409   9e-138   Erythranthe guttata [common monkey flower]
ref|XP_002463275.1|  hypothetical protein SORBIDRAFT_02g041030          409   1e-137   Sorghum bicolor [broomcorn]
ref|XP_006663861.1|  PREDICTED: gamma carbonic anhydrase 2, mitoc...    409   2e-137   Oryza brachyantha
ref|NP_001169012.1|  uncharacterized protein LOC100382844               409   2e-137   Zea mays [maize]
emb|CDY67628.1|  BnaCnng55730D                                          409   3e-137   Brassica napus [oilseed rape]
gb|AAK28403.1|AF249876_1  transcription factor APFI                     408   3e-137   Arabidopsis thaliana [mouse-ear cress]
gb|EPS71345.1|  hypothetical protein M569_03414                         407   4e-137   Genlisea aurea
ref|XP_010500247.1|  PREDICTED: gamma carbonic anhydrase 2, mitoc...    408   4e-137   Camelina sativa [gold-of-pleasure]
emb|CDY47592.1|  BnaC08g04620D                                          408   4e-137   Brassica napus [oilseed rape]
gb|ABK26184.1|  unknown                                                 407   1e-136   Picea sitchensis
ref|XP_004958498.1|  PREDICTED: gamma carbonic anhydrase 2, mitoc...    405   3e-136   Setaria italica
ref|XP_010484635.1|  PREDICTED: gamma carbonic anhydrase 3, mitoc...    404   8e-136   Camelina sativa [gold-of-pleasure]
emb|CDY17034.1|  BnaA08g03980D                                          405   9e-136   Brassica napus [oilseed rape]
ref|XP_010444788.1|  PREDICTED: gamma carbonic anhydrase 3, mitoc...    404   1e-135   Camelina sativa [gold-of-pleasure]
gb|EAZ04886.1|  hypothetical protein OsI_27068                          403   3e-135   Oryza sativa Indica Group [Indian rice]
ref|XP_006393845.1|  hypothetical protein EUTSA_v10004794mg             402   3e-135   Eutrema salsugineum [saltwater cress]
ref|XP_006304043.1|  hypothetical protein CARUB_v10009842mg             404   4e-135   
gb|KFK36155.1|  hypothetical protein AALP_AA4G085200                    403   4e-135   Arabis alpina [alpine rockcress]
ref|XP_010550419.1|  PREDICTED: gamma carbonic anhydrase 3, mitoc...    402   4e-135   Tarenaya hassleriana [spider flower]
ref|XP_003562574.1|  PREDICTED: gamma carbonic anhydrase 2, mitoc...    402   5e-135   Brachypodium distachyon [annual false brome]
ref|XP_009145039.1|  PREDICTED: gamma carbonic anhydrase 2, mitoc...    402   8e-135   Brassica rapa
dbj|BAB39954.1|  OSJNBa0004B13.8                                        401   1e-134   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009107430.1|  PREDICTED: LOW QUALITY PROTEIN: gamma carbon...    402   1e-134   
ref|NP_569036.1|  gamma carbonic anhydrase 3                            401   1e-134   Arabidopsis thaliana [mouse-ear cress]
dbj|BAK01732.1|  predicted protein                                      400   3e-134   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010465384.1|  PREDICTED: gamma carbonic anhydrase 3, mitoc...    399   7e-134   Camelina sativa [gold-of-pleasure]
ref|NP_001060439.1|  Os07g0642900                                       400   7e-134   
emb|CDY23649.1|  BnaA05g17800D                                          398   4e-133   Brassica napus [oilseed rape]
ref|XP_002865062.1|  gamma CA3                                          394   1e-131   
gb|AFK09615.1|  gamma carbonic anhydrase 3                              393   3e-131   Arabidopsis kamchatica
ref|NP_001078808.1|  gamma carbonic anhydrase 3                         392   4e-131   Arabidopsis thaliana [mouse-ear cress]
gb|KCW68230.1|  hypothetical protein EUGRSUZ_F01883                     387   1e-129   Eucalyptus grandis [rose gum]
gb|EPS62312.1|  hypothetical protein M569_12479                         388   3e-129   Genlisea aurea
gb|AFK09616.1|  gamma carbonic anhydrase 3                              387   4e-129   Arabidopsis halleri subsp. gemmifera
gb|AFK09618.1|  gamma carbonic anhydrase 3                              385   2e-128   Arabidopsis lyrata subsp. lyrata
gb|ADQ43216.1|  GAMMA CA3/carbonate dehydratase                         382   2e-127   Schrenkiella parvula
ref|XP_009103523.1|  PREDICTED: gamma carbonic anhydrase 3, mitoc...    382   2e-127   Brassica rapa
emb|CDY45234.1|  BnaA07g12560D                                          382   4e-127   Brassica napus [oilseed rape]
gb|KJB43471.1|  hypothetical protein B456_007G201900                    380   1e-126   Gossypium raimondii
emb|CDY30772.1|  BnaC07g16720D                                          378   1e-125   Brassica napus [oilseed rape]
gb|KFK28325.1|  hypothetical protein AALP_AA8G501300                    377   4e-125   Arabis alpina [alpine rockcress]
gb|KJB17751.1|  hypothetical protein B456_003G013500                    374   1e-124   Gossypium raimondii
emb|CDY50984.1|  BnaC02g48920D                                          375   3e-124   Brassica napus [oilseed rape]
gb|ACU22925.1|  unknown                                                 372   9e-124   Glycine max [soybeans]
gb|ACJ85087.1|  unknown                                                 370   7e-123   Medicago truncatula
gb|ACG33606.1|  transcription factor APFI                               364   2e-120   Zea mays [maize]
ref|XP_002894036.1|  hypothetical protein ARALYDRAFT_891497             358   6e-118   
emb|CDY55089.1|  BnaA02g34770D                                          358   6e-118   Brassica napus [oilseed rape]
tpg|DAA63887.1|  TPA: hypothetical protein ZEAMMB73_753225              358   6e-118   
ref|XP_002968991.1|  hypothetical protein SELMODRAFT_145865             358   1e-117   Selaginella moellendorffii
ref|XP_006305517.1|  hypothetical protein CARUB_v10009987mg             353   4e-116   
gb|AFW79497.1|  hypothetical protein ZEAMMB73_562884                    348   1e-114   
gb|EMT05784.1|  hypothetical protein F775_31542                         338   2e-110   
gb|KJB12033.1|  hypothetical protein B456_002G126800                    335   9e-110   Gossypium raimondii
ref|XP_007204710.1|  hypothetical protein PRUPE_ppa009928mg             332   9e-109   
ref|XP_007136608.1|  hypothetical protein PHAVU_009G0592001g            325   3e-106   Phaseolus vulgaris [French bean]
emb|CBI17490.3|  unnamed protein product                                327   3e-106   Vitis vinifera
ref|XP_003612061.1|  Transcription factor APFI-like protein             325   1e-105   
ref|NP_001185039.1|  gamma carbonic anhydrase 1                         322   2e-104   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001137016.1|  uncharacterized protein LOC100217184               320   2e-103   Zea mays [maize]
tpg|DAA54233.1|  TPA: hypothetical protein ZEAMMB73_935334              319   3e-103   
dbj|BAB10927.1|  ferripyochelin-binding protein-like                    318   7e-103   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001776500.1|  predicted protein                                  318   4e-102   
ref|XP_001754319.1|  predicted protein                                  317   1e-101   
gb|KJB43469.1|  hypothetical protein B456_007G201900                    307   5e-99    Gossypium raimondii
ref|XP_001758123.1|  predicted protein                                  310   8e-99    
gb|KHG18626.1|  Protein YrdA                                            306   2e-98    Gossypium arboreum [tree cotton]
gb|KCW68231.1|  hypothetical protein EUGRSUZ_F01883                     302   8e-97    Eucalyptus grandis [rose gum]
ref|XP_002504597.1|  predicted protein                                  301   1e-95    Micromonas commoda
ref|XP_008672301.1|  PREDICTED: uncharacterized protein LOC100217...    298   5e-95    Zea mays [maize]
ref|XP_010463232.1|  PREDICTED: gamma carbonic anhydrase 2, mitoc...    295   3e-94    
gb|KDO84603.1|  hypothetical protein CISIN_1g0242241mg                  293   1e-93    Citrus sinensis [apfelsine]
ref|XP_003059787.1|  predicted protein                                  283   8e-89    Micromonas pusilla CCMP1545
gb|AFK40628.1|  unknown                                                 279   7e-88    Lotus japonicus
gb|ACV52585.1|  transcription factor APFI-like protein                  272   8e-86    Nicotiana benthamiana
gb|AJW81216.1|  gamma type carbonic anhydrase                           263   3e-81    Lobosphaera incisa
ref|XP_006416491.1|  hypothetical protein EUTSA_v10008724mg             254   6e-78    
ref|XP_011398885.1|  Uncharacterized protein F751_3627                  250   5e-76    Auxenochlorella protothecoides
gb|KHN45864.1|  Hypothetical protein glysoja_023087                     248   5e-76    Glycine soja [wild soybean]
ref|XP_007136607.1|  hypothetical protein PHAVU_009G0592001g            244   3e-75    Phaseolus vulgaris [French bean]
ref|XP_005649920.1|  trimeric LpxA-like protein                         245   2e-74    Coccomyxa subellipsoidea C-169
ref|XP_005644680.1|  gamma-carbonic anhydrase                           243   6e-73    Coccomyxa subellipsoidea C-169
ref|XP_006279533.1|  hypothetical protein CARUB_v10028265mg             239   1e-72    
ref|XP_005847553.1|  hypothetical protein CHLNCDRAFT_35390              240   7e-72    Chlorella variabilis
gb|AFK37757.1|  unknown                                                 236   9e-72    Medicago truncatula
ref|XP_008871299.1|  hypothetical protein H310_07655                    230   1e-68    Aphanomyces invadans
ref|XP_005703463.1|  hypothetical protein Gasu_55130                    228   4e-67    Galdieria sulphuraria
gb|KDO22056.1|  hypothetical protein SPRG_12043                         224   3e-66    Saprolegnia parasitica CBS 223.65
ref|XP_008608997.1|  hypothetical protein SDRG_05080                    224   3e-66    Saprolegnia diclina VS20
ref|XP_009831264.1|  hypothetical protein H257_07436                    224   4e-66    Aphanomyces astaci
ref|XP_005536976.1|  transcription factor APFI                          225   9e-66    Cyanidioschyzon merolae strain 10D
emb|CCI47075.1|  unnamed protein product                                220   1e-64    Albugo candida
ref|XP_002673591.1|  gamma carbonic dehydratase                         220   3e-64    Naegleria gruberi strain NEG-M
ref|XP_005850191.1|  hypothetical protein CHLNCDRAFT_20587              214   2e-62    Chlorella variabilis
emb|CCA20868.1|  conserved hypothetical protein                         213   6e-62    Albugo laibachii Nc14
ref|XP_009523979.1|  hypothetical protein PHYSODRAFT_285582             213   1e-61    Phytophthora sojae
gb|KDD73982.1|  hypothetical protein H632_c1679p0                       212   3e-61    Helicosporidium sp. ATCC 50920
ref|XP_002908534.1|  conserved hypothetical protein                     211   5e-61    Phytophthora infestans T30-4
ref|XP_008890951.1|  hypothetical protein PPTG_01107                    211   6e-61    Phytophthora parasitica INRA-310
gb|AAU93943.1|  gamma-carbonic anhydrase                                211   7e-61    Helicosporidium sp. ex Simulium jonesi
dbj|GAM24838.1|  hypothetical protein SAMD00019534_080130               209   4e-60    Acytostelium subglobosum LB1
ref|XP_001696746.1|  gamma carbonic anhydrase                           210   7e-60    Chlamydomonas reinhardtii
gb|ETI49161.1|  hypothetical protein F443_06919                         207   2e-59    Phytophthora parasitica P1569
ref|XP_008903478.1|  hypothetical protein PPTG_09984                    206   5e-59    Phytophthora parasitica INRA-310
ref|XP_009149442.1|  PREDICTED: LOW QUALITY PROTEIN: gamma carbon...    203   7e-59    
ref|XP_010649292.1|  PREDICTED: gamma carbonic anhydrase 2, mitoc...    202   1e-58    
ref|XP_009821152.1|  hypothetical protein H257_00264                    204   2e-58    Aphanomyces astaci
ref|XP_011398930.1|  Uncharacterized protein F751_3672                  204   2e-58    Auxenochlorella protothecoides
ref|XP_009516211.1|  hypothetical protein PHYSODRAFT_537494             204   3e-58    Phytophthora sojae
ref|XP_008862851.1|  hypothetical protein H310_01513                    203   5e-58    Aphanomyces invadans
ref|XP_008610617.1|  hypothetical protein SDRG_06605                    202   2e-57    Saprolegnia diclina VS20
gb|KIY95938.1|  transferase                                             202   2e-57    Monoraphidium neglectum
ref|XP_002997211.1|  conserved hypothetical protein                     201   2e-57    Phytophthora infestans T30-4
ref|XP_002956125.1|  hypothetical protein VOLCADRAFT_83469              203   4e-57    Volvox carteri f. nagariensis
ref|WP_025898515.1|  carbonic anhydrase                                 196   2e-56    Sneathiella glossodoripedis
emb|CCI50078.1|  unnamed protein product                                197   9e-56    Albugo candida
emb|CCA17668.1|  conserved hypothetical protein                         197   1e-55    Albugo laibachii Nc14
ref|WP_002727628.1|  carbonic anhydrase                                 191   2e-54    Phaeospirillum molischianum
ref|WP_021132357.1|  carbonic anhydrase/acetyltransferase               191   2e-54    Phaeospirillum fulvum
dbj|BAF32946.1|  putative gamma-type carbonic anhydrase                 190   3e-53    Pleurochrysis haptonemofera
ref|XP_636871.1|  trimeric LpxA-like domain-containing protein          190   4e-53    Dictyostelium discoideum AX4
ref|XP_005766975.1|  gamma carbonic anhydrase                           189   5e-53    Emiliania huxleyi CCMP1516
ref|XP_005713311.1|  carbonic anhydrase, gamma type                     191   5e-53    Chondrus crispus [carageen]
ref|XP_002948065.1|  hypothetical protein VOLCADRAFT_73531              189   6e-53    Volvox carteri f. nagariensis
ref|WP_044828700.1|  carbonic anhydrase                                 187   6e-53    Thalassospira sp. HJ
ref|WP_007091625.1|  MULTISPECIES: carbonic anhydrase                   187   8e-53    Thalassospira
dbj|GAM26691.1|  hypothetical protein SAMD00019534_098660               189   2e-52    Acytostelium subglobosum LB1
gb|EKF07893.1|  carbonic anhydrase/acetyltransferase                    186   2e-52    Thalassospira profundimaris WP0211
ref|WP_033067257.1|  carbonic anhydrase                                 186   3e-52    Thalassospira australica
ref|WP_040823796.1|  carbonic anhydrase                                 185   4e-52    
ref|XP_004351419.1|  trimeric LpxA-like domain-containing protein       187   4e-52    Cavenderia fasciculata
ref|XP_004333657.1|  GAMMA CA3 (GAMMA CARBONIC ANHYDRASE 3), puta...    188   8e-52    Acanthamoeba castellanii str. Neff
emb|CBK21456.2|  unnamed protein product                                185   1e-51    Blastocystis hominis
ref|WP_028791231.1|  carbonic anhydrase                                 184   1e-51    Thalassospira lucentensis
ref|WP_024080899.1|  putative hexapeptide repeat acetyltransferase      184   1e-51    Magnetospirillum gryphiswaldense
ref|WP_028096230.1|  carbonic anhydrase                                 184   2e-51    Dongia sp. URHE0060
ref|XP_001703237.1|  gamma carbonic anhydrase                           185   2e-51    Chlamydomonas reinhardtii
gb|EWM27773.1|  Trimeric LpxA                                           186   2e-51    Nannochloropsis gaditana
ref|WP_040475708.1|  carbonic anhydrase                                 182   6e-51    
ref|WP_011384197.1|  carbonic anhydrase                                 182   7e-51    Magnetospirillum magneticum
gb|EME71085.1|  carbonic anhydrase/acetyltransferase                    182   8e-51    Magnetospirillum caucaseum
emb|CBN79571.1|  gamma carbonic anhydrase                               185   1e-50    Ectocarpus siliculosus
ref|WP_014857207.1|  acetyltransferase                                  181   2e-50    Melioribacter roseus
gb|KDD72217.1|  hypothetical protein H632_c3683p0                       182   4e-50    Helicosporidium sp. ATCC 50920
ref|WP_008944647.1|  carbonic anhydrase                                 178   2e-49    Oceanibaculum indicum
ref|XP_010461522.1|  PREDICTED: gamma carbonic anhydrase 2, mitoc...    176   2e-49    Camelina sativa [gold-of-pleasure]
ref|WP_014102582.1|  carbonic anhydrase                                 178   2e-49    Micavibrio aeruginosavorus
ref|WP_044578399.1|  hypothetical protein                               177   5e-49    Rickettsiales bacterium Ac37b
ref|WP_007547159.1|  acetyltransferase                                  177   6e-49    Sulfurihydrogenibium yellowstonense
ref|WP_012459916.1|  acetyltransferase                                  177   6e-49    Sulfurihydrogenibium sp. YO3AOP1
ref|WP_015718917.1|  acetyltransferase                                  177   7e-49    Geobacter sp. M18
ref|WP_041046278.1|  carbonic anhydrase                                 176   7e-49    Wolbachia endosymbiont of Cimex lectularius
ref|WP_012531949.1|  acetyltransferase                                  176   8e-49    Geobacter bemidjiensis
ref|WP_026842119.1|  transferase                                        176   9e-49    Geobacter bremensis
ref|WP_020593264.1|  hypothetical protein                               177   1e-48    Kiloniella laminariae
gb|EWM28838.1|  Trimeric LpxA                                           179   1e-48    Nannochloropsis gaditana
ref|WP_038012874.1|  carbonic anhydrase                                 176   1e-48    
ref|WP_015467349.1|  carbonic anhydrase, family 3                       176   1e-48    
ref|WP_015838795.1|  acetyltransferase                                  176   1e-48    
ref|WP_027289020.1|  carbonic anhydrase                                 176   1e-48    
ref|WP_009867839.1|  Carbonic anhydrase/acetyltransferase, isoleu...    175   2e-48    
emb|CDR78889.1|  hexapeptide transferase family protein,hypotheti...    175   2e-48    
ref|WP_010962614.1|  MULTISPECIES: carbonic anhydrase                   175   2e-48    
ref|WP_007548882.1|  MULTISPECIES: carbonic anhydrase                   175   3e-48    
ref|XP_003289169.1|  hypothetical protein DICPUDRAFT_48414              177   4e-48    
ref|XP_011860441.1|  PREDICTED: gamma carbonic anhydrase 2, mitoc...    174   4e-48    
gb|ABD46435.1|  hexapeptide transferase family protein                  174   6e-48    
ref|WP_012675364.1|  acetyltransferase                                  174   7e-48    
ref|WP_041391656.1|  carbonic anhydrase                                 174   8e-48    
ref|WP_015588968.1|  Hexapeptide transferase family protein             174   8e-48    
gb|EFA76939.1|  trimeric LpxA-like domain-containing protein            175   9e-48    
ref|WP_034842867.1|  carbonic anhydrase                                 173   1e-47    
gb|ACT69043.1|  hexapeptide transferase family protein                  174   1e-47    
ref|WP_044194011.1|  carbonic anhydrase                                 173   2e-47    
ref|WP_041917455.1|  carbonic anhydrase                                 173   2e-47    
ref|WP_028794944.1|  carbonic anhydrase                                 173   2e-47    
ref|WP_007302594.1|  MULTISPECIES: carbonic anhydrase                   173   2e-47    
ref|WP_029013145.1|  carbonic anhydrase                                 172   2e-47    
ref|WP_046021744.1|  carbonic anhydrase                                 172   3e-47    
ref|XP_005706870.1|  hypothetical protein Gasu_22590                    175   3e-47    
ref|WP_038538794.1|  hypothetical protein                               172   3e-47    
ref|WP_014415395.1|  carbonic anhydrase                                 172   3e-47    
ref|WP_041351328.1|  carbonic anhydrase                                 172   3e-47    
pdb|3IXC|A  Chain A, Crystal Structure Of Hexapeptide Transferase...    172   4e-47    
dbj|BAK64770.1|  conserved hypothetical protein                         172   4e-47    
ref|WP_011451237.1|  carbonic anhydrase                                 172   4e-47    
ref|WP_012674376.1|  acetyltransferase                                  171   6e-47    
ref|WP_038251016.1|  carbonic anhydrase                                 171   7e-47    
gb|EOA62647.1|  hexapeptide transferase family protein                  171   8e-47    
ref|WP_014745465.1|  carbonic anhydrase                                 172   1e-46    
emb|CEG20404.1|  Carbonic anhydrases/Acetyltransferase, isoleucin...    170   2e-46    
ref|WP_015588396.1|  Hexapeptide transferase family protein             170   2e-46    
ref|WP_006961722.1|  carbonic anhydrase, family 3                       170   2e-46    
ref|WP_006012476.1|  carbonic anhydrase                                 169   3e-46    
ref|WP_011256488.1|  carbonic anhydrase                                 170   3e-46    
ref|WP_039455831.1|  hypothetical protein                               169   3e-46    
ref|WP_019014984.1|  hypothetical protein                               169   4e-46    
ref|WP_045170748.1|  carbonic anhydrase                                 169   4e-46    
ref|WP_017532531.1|  carbonic anhydrase                                 169   4e-46    
ref|WP_019052663.1|  hypothetical protein                               170   5e-46    
ref|WP_024072448.1|  carbonic anhydrase                                 169   5e-46    
gb|KDO84602.1|  hypothetical protein CISIN_1g0242242mg                  166   6e-46    
ref|WP_029522898.1|  transferase                                        169   6e-46    
ref|WP_010404888.1|  carbonic anhydrase                                 169   6e-46    
ref|WP_011390173.1|  carbonic anhydrase                                 169   6e-46    
ref|XP_002179677.1|  predicted protein                                  169   7e-46    
emb|CBN75766.1|  putative carbonic anhydrase                            170   7e-46    
ref|WP_008289121.1|  acetyltransferase                                  169   7e-46    
ref|WP_042083557.1|  carbonic anhydrase                                 169   9e-46    
ref|WP_007673447.1|  carbonic anhydrase                                 168   1e-45    
ref|WP_017184183.1|  hypothetical protein                               169   1e-45    
ref|WP_014804134.1|  acetyltransferase                                  168   1e-45    
ref|WP_028951275.1|  transferase                                        167   1e-45    
ref|WP_045664443.1|  carbonic anhydrase                                 168   1e-45    
ref|WP_042445259.1|  carbonic anhydrase                                 168   1e-45    
dbj|BAI74729.1|  carbonic anhydrase/acetyltransferase                   168   1e-45    
ref|WP_026986265.1|  carbonic anhydrase                                 168   2e-45    
ref|WP_009542213.1|  carbonic anhydrase, family 3                       168   2e-45    
ref|WP_022726936.1|  carbonic anhydrase                                 167   2e-45    
ref|WP_029520498.1|  transferase                                        167   2e-45    
ref|WP_040848085.1|  hypothetical protein                               167   2e-45    
gb|AAL08813.1|AF308663_1  hypothetical ferripyochelin binding pro...    167   2e-45    
ref|WP_045774933.1|  hypothetical protein                               167   3e-45    
ref|XP_002290563.1|  predicted protein                                  171   3e-45    
ref|WP_026873762.1|  carbonic anhydrase                                 167   3e-45    
ref|WP_011155500.1|  carbonic anhydrase                                 166   4e-45    
ref|WP_006010492.1|  carbonic anhydrase                                 166   4e-45    
ref|WP_044564502.1|  carbonic anhydrase                                 167   4e-45    
ref|WP_028465013.1|  carbonic anhydrase                                 166   5e-45    
ref|WP_010881079.1|  acetyltransferase                                  166   5e-45    
ref|WP_037263136.1|  carbonic anhydrase                                 166   5e-45    
ref|WP_041878427.1|  hypothetical protein                               166   5e-45    
ref|WP_006312037.1|  carbonic anhydrase, family 3                       166   5e-45    
ref|WP_043288165.1|  carbonic anhydrase                                 166   6e-45    
ref|YP_546585.1|  carbonic anhydrase family 3                           166   6e-45    
ref|WP_021802336.1|  hexapeptide repeat-containing transferase          166   7e-45    
ref|WP_012525566.1|  acetyltransferase                                  166   8e-45    
ref|WP_041963596.1|  acetyltransferase                                  166   8e-45    
ref|WP_039673101.1|  acetyltransferase                                  166   9e-45    
ref|WP_012632885.1|  acetyltransferase                                  166   9e-45    
ref|WP_020403893.1|  hypothetical protein                               166   1e-44    
ref|WP_045805168.1|  carbonic anhydrase                                 165   1e-44    
ref|WP_019644631.1|  hypothetical protein                               166   1e-44    
ref|WP_044425610.1|  carbonic anhydrase                                 165   1e-44    
ref|WP_013459351.1|  acetyltransferase                                  165   1e-44    
ref|WP_013779035.1|  hypothetical protein                               165   1e-44    
ref|WP_002579471.1|  hypothetical protein                               165   1e-44    
ref|WP_011255915.1|  carbonic anhydrase                                 165   2e-44    
ref|WP_011443735.1|  carbonic anhydrase                                 165   2e-44    
ref|WP_027308041.1|  hypothetical protein                               164   2e-44    
ref|WP_045584238.1|  carbonic anhydrase                                 165   2e-44    
ref|WP_026893964.1|  hypothetical protein                               164   2e-44    
ref|WP_035762541.1|  transferase                                        164   2e-44    
ref|WP_014967886.1|  hypothetical protein                               164   3e-44    
ref|WP_022679800.1|  carbonic anhydrase                                 164   4e-44    
ref|WP_028167811.1|  carbonic anhydrase                                 164   4e-44    
ref|WP_011421405.1|  acetyltransferase                                  164   4e-44    
ref|WP_043151366.1|  carbonic anhydrase                                 164   4e-44    
ref|WP_042698554.1|  carbonic anhydrase                                 164   4e-44    
ref|WP_012991920.1|  acetyltransferase                                  164   5e-44    
ref|WP_008069326.1|  carbonic anhydrase                                 164   5e-44    
ref|WP_011304966.1|  carbonic anhydrase                                 164   5e-44    
dbj|GAO04895.1|  protein YrdA                                           164   5e-44    
ref|WP_035291537.1|  hypothetical protein                               163   5e-44    
ref|WP_008102791.1|  carbonic anhydrase                                 163   6e-44    
ref|WP_013275402.1|  hypothetical protein                               163   6e-44    
ref|WP_037959567.1|  acetyltransferase                                  163   6e-44    
ref|WP_007473220.1|  acetyltransferase                                  163   8e-44    
ref|WP_035673275.1|  carbonic anhydrase                                 163   1e-43    
ref|WP_038528172.1|  carbonic anhydrase                                 163   1e-43    
gb|EZQ08771.1|  carbonic anhydrase                                      162   1e-43    
ref|WP_018128352.1|  hypothetical protein                               163   1e-43    
ref|WP_023839484.1|  carbonic anhydrase                                 163   1e-43    
ref|WP_041958185.1|  acetyltransferase                                  162   1e-43    
ref|WP_041811026.1|  carbonic anhydrase                                 162   2e-43    
ref|WP_033926467.1|  carbonic anhydrase                                 162   2e-43    
ref|WP_040498742.1|  acetyltransferase                                  162   2e-43    
emb|CCC97995.1|  conserved protein of unknown function                  162   2e-43    
ref|WP_006156211.1|  carbonic anhydrase                                 162   2e-43    
ref|WP_004212025.1|  hypothetical protein                               162   2e-43    
gb|EEO26483.1|  bacterial transferase hexapeptide repeat protein        162   2e-43    
emb|CAI45895.1|  putative transcription factor APF1-like protein        165   2e-43    
ref|XP_005850061.1|  hypothetical protein CHLNCDRAFT_34352              163   2e-43    
ref|XP_004368305.1|  gamma carbonic anhydrase                           165   3e-43    
ref|WP_027852014.1|  anhydrase                                          162   3e-43    
ref|WP_042701660.1|  carbonic anhydrase                                 162   3e-43    
ref|WP_017670191.1|  hypothetical protein                               162   3e-43    
ref|WP_008286511.1|  acetyltransferase                                  161   3e-43    
ref|WP_033917060.1|  acetyltransferase                                  161   4e-43    
ref|WP_011951931.1|  MULTISPECIES: carbonic anhydrase                   161   4e-43    
ref|WP_017502329.1|  carbonic anhydrase                                 162   4e-43    
ref|WP_038558699.1|  carbonic anhydrase                                 161   4e-43    
gb|EMT05905.1|  hypothetical protein F775_31227                         158   4e-43    
ref|WP_039333376.1|  carbonic anhydrase                                 161   4e-43    
ref|WP_010203259.1|  anhydrase                                          161   4e-43    
ref|WP_022678453.1|  carbonic anhydrase                                 161   5e-43    
ref|WP_013638500.1|  acetyltransferase                                  160   5e-43    
ref|WP_002862421.1|  acetyltransferase                                  161   6e-43    
ref|WP_030572426.1|  anhydrase                                          161   6e-43    
ref|WP_008907439.1|  hypothetical protein                               160   6e-43    
ref|WP_015652928.1|  hypothetical protein                               160   6e-43    
ref|WP_041148764.1|  acetyltransferase                                  161   6e-43    
ref|WP_011937143.1|  acetyltransferase                                  160   7e-43    
gb|ETA79460.1|  carbonic anhydrase                                      160   7e-43    
ref|WP_011312944.1|  hypothetical protein                               161   7e-43    
ref|WP_024021755.1|  carbonic anhydrase                                 161   7e-43    
ref|WP_034327444.1|  acetyltransferase                                  160   7e-43    
ref|WP_041865421.1|  carbonic anhydrase                                 160   8e-43    
ref|WP_043334892.1|  carbonic anhydrase                                 160   8e-43    
ref|WP_005007542.1|  putative Transferase, hexapeptide repeat pro...    160   8e-43    
ref|WP_043363635.1|  carbonic anhydrase                                 160   8e-43    
gb|AGH50458.1|  carbonic anhydrase                                      160   9e-43    
dbj|GAO39555.1|  hypothetical protein SCH01S_34_00080                   160   9e-43    
ref|WP_035921995.1|  carbonic anhydrase                                 160   9e-43    
ref|WP_037507860.1|  carbonic anhydrase                                 161   9e-43    
ref|WP_002857575.1|  acetyltransferase                                  160   9e-43    
ref|WP_034224390.1|  carbonic anhydrase                                 160   1e-42    
ref|WP_021194724.1|  hypothetical protein                               160   1e-42    
ref|WP_014187883.1|  carbonic anhydrase                                 160   1e-42    
ref|WP_040907986.1|  hypothetical protein                               160   1e-42    
ref|WP_007278575.1|  anhydrase                                          160   1e-42    
ref|WP_034212652.1|  carbonic anhydrase                                 160   1e-42    
ref|WP_010337969.1|  carbonic anhydrase                                 160   1e-42    
ref|WP_002890627.1|  acetyltransferase                                  160   1e-42    
ref|WP_037475946.1|  carbonic anhydrase                                 160   1e-42    
ref|WP_008518447.1|  anhydrase                                          159   2e-42    
ref|WP_011989591.1|  acetyltransferase                                  160   2e-42    
ref|WP_002867133.1|  acetyltransferase                                  160   2e-42    
ref|WP_030358647.1|  MULTISPECIES: anhydrase                            160   2e-42    
ref|WP_037948129.1|  acetyltransferase                                  159   2e-42    
ref|WP_002861022.1|  acetyltransferase                                  160   2e-42    
ref|WP_015681936.1|  transferase hexapeptide repeat protein             159   2e-42    
ref|WP_007234200.1|  anhydrase                                          160   2e-42    
ref|WP_011713109.1|  anhydrase                                          160   2e-42    
ref|WP_002933739.1|  acetyltransferase                                  160   2e-42    
dbj|BAI68573.1|  putative carbonic anhydrase/acetyltransferase          160   2e-42    
ref|WP_025345345.1|  acetyltransferase                                  159   2e-42    
ref|WP_014189001.1|  carbonic anhydrase                                 160   2e-42    
ref|WP_043837486.1|  carbonic anhydrase                                 159   2e-42    
ref|WP_027251697.1|  anhydrase                                          159   2e-42    
ref|WP_034879021.1|  anhydrase                                          159   2e-42    
ref|WP_031556442.1|  carbonic anhydrase                                 159   2e-42    
ref|WP_034964099.1|  acetyltransferase                                  159   2e-42    
ref|WP_038815933.1|  acetyltransferase                                  159   2e-42    
ref|WP_002851622.1|  acetyltransferase                                  159   2e-42    
ref|WP_014462531.1|  acetyltransferase                                  159   2e-42    
ref|WP_012663737.1|  acetyltransferase                                  159   2e-42    
ref|WP_012857370.1|  acetyltransferase                                  159   2e-42    
ref|WP_011876861.1|  anhydrase                                          159   3e-42    
gb|KEI43879.1|  anhydrase                                               159   3e-42    
ref|WP_004505474.1|  transferase hexapeptide repeat protein             159   3e-42    
ref|WP_002866371.1|  acetyltransferase                                  159   3e-42    
ref|WP_015027264.1|  acetyltransferase                                  159   3e-42    
ref|WP_027279711.1|  carbonic anhydrase                                 159   3e-42    
ref|WP_037331584.1|  anhydrase                                          159   3e-42    
ref|WP_010127464.1|  carbonic anhydrase                                 159   3e-42    
ref|WP_018662316.1|  carbonic anhydrase, family 3                       158   3e-42    
ref|WP_029551776.1|  hypothetical protein                               159   3e-42    
ref|WP_037466843.1|  carbonic anhydrase                                 159   3e-42    
gb|EJK68540.1|  hypothetical protein THAOC_10267                        162   3e-42    
ref|WP_025306369.1|  hypothetical protein                               159   3e-42    
ref|WP_039927404.1|  acetyltransferase                                  158   5e-42    
ref|WP_029665451.1|  hypothetical protein                               158   5e-42    
emb|CBK23474.2|  unnamed protein product                                160   5e-42    
ref|WP_002869479.1|  acetyltransferase                                  158   6e-42    
ref|WP_004451262.1|  hypothetical protein                               158   6e-42    
ref|WP_002874478.1|  acetyltransferase                                  158   6e-42    
ref|WP_009019187.1|  anhydrase                                          158   6e-42    
ref|WP_012975468.1|  carbonic anhydrase                                 158   6e-42    
ref|WP_002872936.1|  acetyltransferase                                  158   6e-42    
ref|WP_035161340.1|  acetyltransferase                                  157   6e-42    
ref|WP_040095463.1|  hypothetical protein                               158   6e-42    
ref|WP_028862390.1|  anhydrase                                          158   7e-42    
gb|EMY68298.1|  transferase hexapeptide repeat protein                  158   7e-42    
ref|WP_004786007.1|  acetyltransferase                                  158   7e-42    
ref|WP_002860623.1|  acetyltransferase                                  158   7e-42    
gb|AAS48195.1|  mitochondrial NADH:ubiquinone oxidoreductase 27 k...    159   8e-42    
ref|WP_002874919.1|  acetyltransferase                                  158   8e-42    



>emb|CDP01995.1| unnamed protein product [Coffea canephora]
Length=271

 Score =   486 bits (1250),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 237/271 (87%), Positives = 250/271 (92%), Gaps = 8/271 (3%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MGSLGRA YTVGFWIRETGQALDRLGCRLQGNYYF EQLSRHR LMN+FDK P V ++AF
Sbjct  1    MGSLGRAIYTVGFWIRETGQALDRLGCRLQGNYYFQEQLSRHRTLMNIFDKAPVVDKDAF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSASI+GDVQVGR SSIWYGCVLRGDVNS+SIGTGTNIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   VAPSASIVGDVQVGRSSSIWYGCVLRGDVNSISIGTGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            IIG+NVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAM+AAGALVRQNTRIPCGEV
Sbjct  121  IIGDNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KDE  867
            WGGNPAKFLRKLT+EEIAFISQSALNYSNL Q HAAENAK  DE EFEKVLRKK   KDE
Sbjct  181  WGGNPAKFLRKLTDEEIAFISQSALNYSNLAQVHAAENAKGFDEIEFEKVLRKKFARKDE  240

Query  868  DNDSILGVVRETPPDLILPNN-----APKAS  945
            + DS+LGVVRETPP+LILP+N     APKAS
Sbjct  241  EYDSMLGVVRETPPELILPDNVLPDKAPKAS  271



>ref|XP_009588225.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Nicotiana 
tomentosiformis]
Length=268

 Score =   472 bits (1215),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 228/268 (85%), Positives = 246/268 (92%), Gaps = 5/268 (2%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LG+A YTVGFWIRETGQA+DRLGCRLQGNYYFHE LSRHR LMNLFDKVP V ++AF
Sbjct  1    MGTLGKAIYTVGFWIRETGQAMDRLGCRLQGNYYFHEHLSRHRTLMNLFDKVPMVAKDAF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSAS+IGDV VGR++SIWYGCVLRGDVNS+SIG GTNIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   VAPSASLIGDVHVGRNASIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDG VVEKNAM+AAGALVRQ TRIPCGEV
Sbjct  121  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGAVVEKNAMVAAGALVRQKTRIPCGEV  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KDE  867
            WGGNPA+FLRKLTEEEIAFISQSA NY+NL Q HAAENAKS D  EFEKVLRKK   KDE
Sbjct  181  WGGNPARFLRKLTEEEIAFISQSAANYTNLAQVHAAENAKSFDAIEFEKVLRKKFARKDE  240

Query  868  DNDSILGVVRETPPDLILPNN--APKAS  945
            + DS+LGV R+TPP+LILP+N  APKAS
Sbjct  241  EYDSMLGVDRQTPPELILPDNIQAPKAS  268



>ref|XP_008452092.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial [Cucumis 
melo]
Length=271

 Score =   471 bits (1213),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 223/261 (85%), Positives = 244/261 (93%), Gaps = 3/261 (1%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LG+A YTVGFWIRETGQALDRLGCRLQGNYYF EQLSRHR LMN+FDK P ++++AF
Sbjct  1    MGTLGKAIYTVGFWIRETGQALDRLGCRLQGNYYFQEQLSRHRTLMNIFDKAPVINKDAF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSASIIGDVQVGR SSIWYGCVLRGDVNS+S+G+GTNIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   VAPSASIIGDVQVGRMSSIWYGCVLRGDVNSISVGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            IIG+NVTVGHSAVLHGCT+EDEAFVGMGATLLDGV VEK+AM+AAGALVRQNTRIPCGEV
Sbjct  121  IIGDNVTVGHSAVLHGCTIEDEAFVGMGATLLDGVYVEKHAMVAAGALVRQNTRIPCGEV  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KDE  867
            WGGNPAKFLRKLTEEE+AFISQSA+NYSNL Q HAAEN KS DE EFEKVLRKK   +DE
Sbjct  181  WGGNPAKFLRKLTEEEMAFISQSAINYSNLSQVHAAENVKSFDEIEFEKVLRKKFARRDE  240

Query  868  DNDSILGVVRETPPDLILPNN  930
            D DS+LGVVRETP +LILP+N
Sbjct  241  DYDSMLGVVRETPSELILPDN  261



>ref|XP_007046882.1| Gamma carbonic anhydrase 1, CA1 [Theobroma cacao]
 gb|EOX91039.1| Gamma carbonic anhydrase 1, CA1 [Theobroma cacao]
Length=271

 Score =   471 bits (1213),  Expect = 6e-162, Method: Compositional matrix adjust.
 Identities = 226/261 (87%), Positives = 244/261 (93%), Gaps = 3/261 (1%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LG+A Y+VGFWIRETGQALDRLGCRLQGNYYF EQLSRHR LMN+F+K P V R+AF
Sbjct  1    MGTLGKAIYSVGFWIRETGQALDRLGCRLQGNYYFQEQLSRHRTLMNVFNKAPVVDRDAF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSASIIGDVQVGR SSIWYGCVLRGDVNS+SIG+GTNIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   VAPSASIIGDVQVGRGSSIWYGCVLRGDVNSISIGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            IIG+NVTVGHSAVLHGCTVEDEAFVGMGATLLDGV VEK+AM+AAGALVRQNTRIPCGEV
Sbjct  121  IIGSNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVYVEKHAMVAAGALVRQNTRIPCGEV  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KDE  867
            WGGNPAKFLRKLTEEE+AFISQSALNYSNL Q HAAENAKS DE EFEKVLRKK   +DE
Sbjct  181  WGGNPAKFLRKLTEEEMAFISQSALNYSNLAQVHAAENAKSFDEIEFEKVLRKKFARRDE  240

Query  868  DNDSILGVVRETPPDLILPNN  930
            + DS+LGVVRE PP+LILP+N
Sbjct  241  EYDSMLGVVREMPPELILPDN  261



>ref|XP_009772840.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Nicotiana 
sylvestris]
Length=268

 Score =   471 bits (1212),  Expect = 6e-162, Method: Compositional matrix adjust.
 Identities = 228/268 (85%), Positives = 246/268 (92%), Gaps = 5/268 (2%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LG+A YTVGFWIRETGQA+DRLGCRLQGNYYFHE LSRHR LMNLFDKVP V ++AF
Sbjct  1    MGTLGKAIYTVGFWIRETGQAMDRLGCRLQGNYYFHEHLSRHRTLMNLFDKVPMVAKDAF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSAS+IGDV VGR++SIWYGCVLRGDVNS+SIG GTNIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   VAPSASLIGDVHVGRNASIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDG VVEKNAM+AAGALVRQNTRIP GEV
Sbjct  121  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGAVVEKNAMVAAGALVRQNTRIPSGEV  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KDE  867
            WGGNPA+FLRKLTEEEIAFISQSA NY+NL Q HAAENAKS D  EFEKVLRKK   KDE
Sbjct  181  WGGNPARFLRKLTEEEIAFISQSAANYTNLAQVHAAENAKSFDAIEFEKVLRKKFARKDE  240

Query  868  DNDSILGVVRETPPDLILPNN--APKAS  945
            + DS+LGV R+TPP+LILP+N  APKAS
Sbjct  241  EYDSMLGVDRQTPPELILPDNIQAPKAS  268



>ref|XP_002282021.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial [Vitis vinifera]
 emb|CAN79636.1| hypothetical protein VITISV_014473 [Vitis vinifera]
 emb|CBI19719.3| unnamed protein product [Vitis vinifera]
Length=272

 Score =   471 bits (1212),  Expect = 6e-162, Method: Compositional matrix adjust.
 Identities = 228/271 (84%), Positives = 248/271 (92%), Gaps = 8/271 (3%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LG+A YTVGFWIRETGQA+DRLGCRLQGNYYF EQ+SRHR LMNLFDK P V ++AF
Sbjct  1    MGTLGKAIYTVGFWIRETGQAIDRLGCRLQGNYYFLEQISRHRTLMNLFDKAPIVDKDAF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSASIIGDVQVGR SSIWYGCVLRGDVNS+S+G+GTNIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   VAPSASIIGDVQVGRGSSIWYGCVLRGDVNSISVGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            IIG+NVTVGHSAVLHGCTVEDEAFVGMGATLLDG +VEK+AM+AAGALVRQNTRIPCGEV
Sbjct  121  IIGDNVTVGHSAVLHGCTVEDEAFVGMGATLLDGSIVEKHAMVAAGALVRQNTRIPCGEV  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KDE  867
            WGGNPAKFLRKLT+EEIAFISQSA+NYSNL Q HAAENAK  DE EFEKVLRKK   +DE
Sbjct  181  WGGNPAKFLRKLTDEEIAFISQSAINYSNLAQVHAAENAKPFDEIEFEKVLRKKFARRDE  240

Query  868  DNDSILGVVRETPPDLILPNN-----APKAS  945
            D DS+LGVVRETPP+LILP+N     APK S
Sbjct  241  DYDSMLGVVRETPPELILPDNILPDKAPKVS  271



>gb|KJB17752.1| hypothetical protein B456_003G013500 [Gossypium raimondii]
Length=271

 Score =   471 bits (1211),  Expect = 8e-162, Method: Compositional matrix adjust.
 Identities = 225/261 (86%), Positives = 244/261 (93%), Gaps = 3/261 (1%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LG+A YTVGFW+RETGQALDRLGCRLQGNYYF EQLSRHR LMN+FDK P V R+AF
Sbjct  1    MGTLGKAIYTVGFWVRETGQALDRLGCRLQGNYYFQEQLSRHRTLMNVFDKAPFVDRDAF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSAS+IGDVQVGR SSIWYGCVLRGDVNS+SIG+GTNIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   VAPSASVIGDVQVGRGSSIWYGCVLRGDVNSISIGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            IIG+NVTVGHSAVLHGCTVEDEAFVGMGATLLDGV VEK+AM+AAGALVRQNTRIPCGEV
Sbjct  121  IIGSNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVYVEKHAMVAAGALVRQNTRIPCGEV  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KDE  867
            WGGNPAKFLRKLTEEE+AFISQSALNYSNL Q HAAEN KS DE EFEK+LRKK   +DE
Sbjct  181  WGGNPAKFLRKLTEEEMAFISQSALNYSNLAQVHAAENGKSFDEIEFEKMLRKKFARRDE  240

Query  868  DNDSILGVVRETPPDLILPNN  930
            + DS+LGVVRETPP+LILP+N
Sbjct  241  EYDSMLGVVRETPPELILPDN  261



>gb|KHG23300.1| hypothetical protein F383_08437 [Gossypium arboreum]
Length=271

 Score =   470 bits (1210),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 225/261 (86%), Positives = 244/261 (93%), Gaps = 3/261 (1%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LG+A YTVGFWIRETGQ LDRLGCRLQGNYYF EQLSRHR LMN+FDK P V R+AF
Sbjct  1    MGTLGKAIYTVGFWIRETGQTLDRLGCRLQGNYYFQEQLSRHRTLMNVFDKAPVVDRDAF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSAS+IGDVQVGR SSIWYGCVLRGDVN++SIG+GTNIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   VAPSASVIGDVQVGRGSSIWYGCVLRGDVNNISIGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            IIG+NVTVGHSAVLHGCTVEDEAFVGMGATLLDGV VEK+AM+AAGALVRQNTRIPCGEV
Sbjct  121  IIGSNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVYVEKHAMVAAGALVRQNTRIPCGEV  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KDE  867
            WGGNPAKFLRKLTEEE+AFISQSALNYSNL Q HAAENAKS DE EFEK+LRKK   +DE
Sbjct  181  WGGNPAKFLRKLTEEEMAFISQSALNYSNLAQVHAAENAKSFDEIEFEKMLRKKFARRDE  240

Query  868  DNDSILGVVRETPPDLILPNN  930
            + DS+LGVVRETPP+LILP+N
Sbjct  241  EYDSMLGVVRETPPELILPDN  261



>ref|XP_010265678.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial [Nelumbo 
nucifera]
Length=271

 Score =   470 bits (1209),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 225/267 (84%), Positives = 245/267 (92%), Gaps = 4/267 (1%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LG+A YTVGFWIRETGQALDRLGCRLQGNYYF EQLSRHR LMN+FDK P V ++ F
Sbjct  1    MGTLGKAIYTVGFWIRETGQALDRLGCRLQGNYYFQEQLSRHRTLMNIFDKAPVVDKDTF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSASIIGDVQVGR SSIWYGCVLRGDVNS+S+G+GTNIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   VAPSASIIGDVQVGRGSSIWYGCVLRGDVNSISVGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            IIG+NVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEK+AM+AAGALVRQNTRIPCGE+
Sbjct  121  IIGDNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKHAMVAAGALVRQNTRIPCGEI  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KDE  867
            WGGNPAKFLRKLTEEEIAFISQSA+NYSNL Q HAAENAK+ DE E EKVLRKK   +DE
Sbjct  181  WGGNPAKFLRKLTEEEIAFISQSAINYSNLAQAHAAENAKTFDEIELEKVLRKKFARRDE  240

Query  868  DNDSILGVVRETPPDLILPNNA-PKAS  945
            + DS+LGVVRE PP LILP++  PK S
Sbjct  241  EYDSMLGVVREVPPQLILPDSILPKES  267



>ref|XP_010102071.1| hypothetical protein L484_009014 [Morus notabilis]
 gb|EXB91921.1| hypothetical protein L484_009014 [Morus notabilis]
Length=272

 Score =   470 bits (1209),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 228/271 (84%), Positives = 246/271 (91%), Gaps = 8/271 (3%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LG+A YTVGFWIRETGQA+DRLGCRLQGNYYF EQLSRHR LMN+FDK P V ++AF
Sbjct  1    MGTLGKAIYTVGFWIRETGQAIDRLGCRLQGNYYFQEQLSRHRTLMNIFDKAPVVDKDAF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSASIIGDVQVGR SSIWYGCVLRGDVN +SIG GTNIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   VAPSASIIGDVQVGRGSSIWYGCVLRGDVNGISIGAGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            IIG+NVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAM+AAGALVRQNTRIP GEV
Sbjct  121  IIGDNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPFGEV  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KDE  867
            WGGNPAKFLRKLTEEE+AF+SQSA NYSNL Q HAAENAK  DE EFEKVLRKK   +DE
Sbjct  181  WGGNPAKFLRKLTEEEMAFVSQSATNYSNLAQVHAAENAKPFDEIEFEKVLRKKFAHRDE  240

Query  868  DNDSILGVVRETPPDLILPNN-----APKAS  945
            + DS+LGVVRETPP+L+LP+N     APKAS
Sbjct  241  EYDSMLGVVRETPPELVLPDNILPDKAPKAS  271



>ref|XP_006346962.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial isoform 
X1 [Solanum tuberosum]
 ref|XP_006346963.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial isoform 
X2 [Solanum tuberosum]
 ref|XP_006346964.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial isoform 
X3 [Solanum tuberosum]
Length=268

 Score =   469 bits (1208),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 225/267 (84%), Positives = 246/267 (92%), Gaps = 5/267 (2%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LG+A YTVGFWIRETGQA+DRLGCRLQGNYYFHEQLSRHR LMNLF+K P V ++AF
Sbjct  1    MGTLGKAIYTVGFWIRETGQAIDRLGCRLQGNYYFHEQLSRHRTLMNLFNKAPMVDKDAF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSAS+IGDV VGR++SIWYGCVLRGDVNS+SIG G+NIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   VAPSASLIGDVHVGRNASIWYGCVLRGDVNSISIGAGSNIQDNSLVHVAKSNLSGKVLPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDG VVEKNAM+AAGALVRQNTRIPCGEV
Sbjct  121  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGAVVEKNAMVAAGALVRQNTRIPCGEV  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KDE  867
            WGGNPA+FLRKLT+EEIAFIS+SA NYSNL Q HA ENAKS D  EFEKVLRKK   KDE
Sbjct  181  WGGNPARFLRKLTQEEIAFISESAANYSNLAQVHAGENAKSFDAIEFEKVLRKKFARKDE  240

Query  868  DNDSILGVVRETPPDLILPNN--APKA  942
            + DS+LGVVRETPP+L+LP+N  APKA
Sbjct  241  EYDSMLGVVRETPPELVLPDNIQAPKA  267



>ref|XP_004146498.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial [Cucumis 
sativus]
 gb|KGN53299.1| hypothetical protein Csa_4G046620 [Cucumis sativus]
Length=271

 Score =   468 bits (1205),  Expect = 6e-161, Method: Compositional matrix adjust.
 Identities = 221/261 (85%), Positives = 242/261 (93%), Gaps = 3/261 (1%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LG+A YTVGFWIRETGQALDRLGCRLQGNYYF EQLSRHR LMN+FDK P V ++AF
Sbjct  1    MGTLGKAIYTVGFWIRETGQALDRLGCRLQGNYYFQEQLSRHRTLMNIFDKAPVVDKDAF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSASIIGDVQVGR SSIWYGCVLRGDVNS+S+G+GTNIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   VAPSASIIGDVQVGRGSSIWYGCVLRGDVNSISVGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            IIG+NVTVGHSAVLHGCT+EDEAFVGMGATLLDGV VEK+AM+AAGALVRQNTR+PCGEV
Sbjct  121  IIGDNVTVGHSAVLHGCTIEDEAFVGMGATLLDGVYVEKHAMVAAGALVRQNTRVPCGEV  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KDE  867
            WGGNPAKFLRKLTEEE+ FISQSA+NYSNL Q HAAEN KS DE E EKVLRKK   +DE
Sbjct  181  WGGNPAKFLRKLTEEEMVFISQSAINYSNLSQVHAAENVKSFDEIELEKVLRKKFARRDE  240

Query  868  DNDSILGVVRETPPDLILPNN  930
            D DS+LGVVRETPP+L+LP+N
Sbjct  241  DYDSMLGVVRETPPELVLPDN  261



>gb|KJB43468.1| hypothetical protein B456_007G201900 [Gossypium raimondii]
 gb|KJB43470.1| hypothetical protein B456_007G201900 [Gossypium raimondii]
Length=271

 Score =   468 bits (1204),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 226/271 (83%), Positives = 247/271 (91%), Gaps = 8/271 (3%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LG+A +TVGFWIRETGQALDRLGCRLQGNYYF EQLSRHR LMN+FDK P V R+AF
Sbjct  1    MGTLGKAIHTVGFWIRETGQALDRLGCRLQGNYYFQEQLSRHRTLMNVFDKAPIVDRDAF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSAS+IGDVQVGR SSIWYGCVLRGDVNS+SIG+GTNIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   VAPSASVIGDVQVGRSSSIWYGCVLRGDVNSISIGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            IIG+NVTVGHSAVLHGCTVEDEAFVGMGATLLDGV VEK+AM+AAGALVRQNTRIPCGEV
Sbjct  121  IIGSNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVYVEKHAMVAAGALVRQNTRIPCGEV  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KDE  867
            WGGNPAKFLRKLTEEE+ FISQSALNY+NL Q HAAENAKS DE E E +LRKK   +DE
Sbjct  181  WGGNPAKFLRKLTEEEMTFISQSALNYTNLAQVHAAENAKSFDEIELETMLRKKFARRDE  240

Query  868  DNDSILGVVRETPPDLILPNN-----APKAS  945
            + DS+LGVVRETPP+LILP+N     APKA+
Sbjct  241  EYDSMLGVVRETPPELILPDNIIPDKAPKAA  271



>ref|XP_010263617.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial [Nelumbo 
nucifera]
Length=271

 Score =   468 bits (1203),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 226/271 (83%), Positives = 246/271 (91%), Gaps = 8/271 (3%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LG+A YTVGFWIRETGQALDRLGCRLQGNYYF EQLSRHR LMN+FDK P V ++AF
Sbjct  1    MGTLGKAIYTVGFWIRETGQALDRLGCRLQGNYYFQEQLSRHRTLMNIFDKAPVVDKDAF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSASIIGDVQVGR SSIWYGCVLRGDVNS+S+G+GTNIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   VAPSASIIGDVQVGRGSSIWYGCVLRGDVNSISVGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            IIG+NVT+GHSAVLHGCTVEDEAFVGMGA LLDGVVVEKN+M+AAGALVRQNTRIP GEV
Sbjct  121  IIGDNVTIGHSAVLHGCTVEDEAFVGMGAVLLDGVVVEKNSMVAAGALVRQNTRIPYGEV  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KDE  867
            WGGNPAKFLRKLTEEEIAFISQSA+NYSNL Q HAAENAK+ DE E EKVLRKK   +DE
Sbjct  181  WGGNPAKFLRKLTEEEIAFISQSAINYSNLAQVHAAENAKTFDEIELEKVLRKKFARRDE  240

Query  868  DNDSILGVVRETPPDLILPNN-----APKAS  945
            + DS+LGVVRE PP LILP+N     +PKAS
Sbjct  241  EYDSMLGVVREVPPQLILPDNILPKESPKAS  271



>ref|XP_004233530.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial [Solanum 
lycopersicum]
Length=268

 Score =   467 bits (1201),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 224/267 (84%), Positives = 245/267 (92%), Gaps = 5/267 (2%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LG+A YTVGFWIRETGQA+DRLGCRLQGNYYFHEQLSRHR LMNLF+K P+V ++AF
Sbjct  1    MGTLGKAIYTVGFWIRETGQAIDRLGCRLQGNYYFHEQLSRHRTLMNLFNKTPTVDKDAF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSAS+IGDV VGR++SIWYGCVLRGDVNS+SIG G+NIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   VAPSASLIGDVHVGRNASIWYGCVLRGDVNSISIGAGSNIQDNSLVHVAKSNLSGKVLPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDG VVEKNAM+AAGALVRQNTRIPCGEV
Sbjct  121  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGAVVEKNAMVAAGALVRQNTRIPCGEV  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KDE  867
            WGGNPA+FLRKLT+EEIAFIS+SA NYSNL Q HA ENAKS D  EFEK LRKK   KDE
Sbjct  181  WGGNPARFLRKLTQEEIAFISESAANYSNLAQVHAGENAKSFDAIEFEKALRKKFAHKDE  240

Query  868  DNDSILGVVRETPPDLILPNN--APKA  942
            + DS+LGVVRETPP+L+LP N  APKA
Sbjct  241  EYDSMLGVVRETPPELVLPVNIQAPKA  267



>gb|KHG00707.1| hypothetical protein F383_22748 [Gossypium arboreum]
Length=271

 Score =   466 bits (1198),  Expect = 8e-160, Method: Compositional matrix adjust.
 Identities = 225/271 (83%), Positives = 246/271 (91%), Gaps = 8/271 (3%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LG+A YTVGFWIRETGQALDRLGCRLQGNYYF EQLSRHR LMN+FDK P V R+AF
Sbjct  1    MGTLGKAIYTVGFWIRETGQALDRLGCRLQGNYYFQEQLSRHRTLMNVFDKAPIVDRDAF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSAS+IGDV+VGR SSIWYGCVLRGDVNS+SIG+GTNIQDNSLVHVAKSNL+ KVLPT
Sbjct  61   VAPSASVIGDVKVGRSSSIWYGCVLRGDVNSISIGSGTNIQDNSLVHVAKSNLSRKVLPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            IIG+NVTVGHSAVLHGCTVEDEAFVGMGATLLDGV VEK+AM+AAGALVRQNTRIPCGEV
Sbjct  121  IIGSNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVYVEKHAMVAAGALVRQNTRIPCGEV  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KDE  867
            WGGNPAKFLRKLTEEE+ FISQSALNY+NL Q HAAENAKS DE E E +LRKK   +DE
Sbjct  181  WGGNPAKFLRKLTEEEMTFISQSALNYTNLAQVHAAENAKSFDEIELEMMLRKKFARRDE  240

Query  868  DNDSILGVVRETPPDLILPNN-----APKAS  945
            + DS+LGVVRETPP+LILP+N     APKA+
Sbjct  241  EYDSMLGVVRETPPELILPDNIIPDKAPKAA  271



>gb|KJB12032.1| hypothetical protein B456_002G126800 [Gossypium raimondii]
Length=273

 Score =   466 bits (1198),  Expect = 9e-160, Method: Compositional matrix adjust.
 Identities = 224/261 (86%), Positives = 242/261 (93%), Gaps = 3/261 (1%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MGSLG+A YTVGFWIRETGQALDRLGCRLQGNY+F EQLSRHR LMNLFDK P V ++AF
Sbjct  1    MGSLGKAIYTVGFWIRETGQALDRLGCRLQGNYFFQEQLSRHRTLMNLFDKSPLVDKDAF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSAS+IGDVQVGR SSIWYGCVLRGDVNS+S+G+GTNIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   VAPSASVIGDVQVGRGSSIWYGCVLRGDVNSISVGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
             IGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEK+AM+AAGALVRQNTRIP GEV
Sbjct  121  NIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKHAMVAAGALVRQNTRIPAGEV  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRK---KKDE  867
            WGGNPAKFLRKLTEEEI+FISQSA NY+NL Q HAAENAK  DE EFEKVLRK   K+DE
Sbjct  181  WGGNPAKFLRKLTEEEISFISQSATNYTNLAQVHAAENAKPFDEIEFEKVLRKKFAKRDE  240

Query  868  DNDSILGVVRETPPDLILPNN  930
            + DS+LGVVRETPP+LILP+N
Sbjct  241  EYDSMLGVVRETPPELILPDN  261



>ref|XP_010061298.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial [Eucalyptus 
grandis]
 gb|KCW68229.1| hypothetical protein EUGRSUZ_F01883 [Eucalyptus grandis]
Length=273

 Score =   465 bits (1196),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 225/269 (84%), Positives = 244/269 (91%), Gaps = 8/269 (3%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LGRA YTVGFW+RETGQALDRLGCRLQGNYYF EQLSRHR LMN+FDK P V ++AF
Sbjct  1    MGTLGRAIYTVGFWVRETGQALDRLGCRLQGNYYFQEQLSRHRTLMNIFDKAPVVDKDAF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSASIIGDVQVGR SSIWYGCVLRGDVNS+S+G+GTNIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   VAPSASIIGDVQVGRGSSIWYGCVLRGDVNSISVGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            IIG+NVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEK+ M+A GALVRQNTRIP GEV
Sbjct  121  IIGDNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKHGMVAGGALVRQNTRIPAGEV  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KDE  867
            WGGNPAKFLRKLTEEE+AFI+QSA NYSNL Q HAAENAK  DE EFEKVLRKK   +DE
Sbjct  181  WGGNPAKFLRKLTEEEVAFITQSATNYSNLAQVHAAENAKPFDEIEFEKVLRKKFARRDE  240

Query  868  DNDSILGVVRETPPDLILPNN-----APK  939
            + DS+LGVVRETPP+LILP+N     APK
Sbjct  241  EYDSMLGVVRETPPELILPDNVLPGKAPK  269



>ref|XP_010029770.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial [Eucalyptus 
grandis]
 gb|KCW56730.1| hypothetical protein EUGRSUZ_I02417 [Eucalyptus grandis]
Length=271

 Score =   465 bits (1196),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 219/261 (84%), Positives = 243/261 (93%), Gaps = 3/261 (1%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LG+A Y+VGFWIRETGQALDRLGCRLQG+YYF EQLSRHR LMN+FDK P + ++ F
Sbjct  1    MGTLGKAIYSVGFWIRETGQALDRLGCRLQGSYYFQEQLSRHRTLMNVFDKAPVIDKDVF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSASIIGD+Q+GR SSIWYGCVLRGDVN++SIG GTNIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   VAPSASIIGDIQIGRGSSIWYGCVLRGDVNNISIGAGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            IIG+NVTVGHSAVLHGCTVEDEAFVGMGATLLDGV VEK+AM+AAGALVRQNTR+PCGEV
Sbjct  121  IIGDNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVYVEKHAMVAAGALVRQNTRVPCGEV  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KDE  867
            WGGNPAKFLRKLTEEE+AFISQSA+NYSNL Q HAAENAKS DE EFEKVLRKK   +DE
Sbjct  181  WGGNPAKFLRKLTEEEMAFISQSAVNYSNLAQVHAAENAKSFDEIEFEKVLRKKFARRDE  240

Query  868  DNDSILGVVRETPPDLILPNN  930
            + DS+LGVVRETPP+LILP+N
Sbjct  241  EYDSMLGVVRETPPELILPDN  261



>ref|XP_012071891.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial [Jatropha 
curcas]
 gb|KDP38527.1| hypothetical protein JCGZ_04452 [Jatropha curcas]
Length=271

 Score =   465 bits (1196),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 226/270 (84%), Positives = 246/270 (91%), Gaps = 8/270 (3%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LG+A YTVGFWIRETGQALDRLGCRLQGNYYF EQLSRHR LMN+F+K P V +EAF
Sbjct  1    MGTLGKAIYTVGFWIRETGQALDRLGCRLQGNYYFQEQLSRHRTLMNVFNKAPVVDKEAF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSASIIGDVQVGR SSIWYGCVLRGDVN++SIG GTNIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   VAPSASIIGDVQVGRGSSIWYGCVLRGDVNNISIGAGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            ++G+NVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEK+AM+AAGALVRQNTRIP GEV
Sbjct  121  LVGDNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKHAMVAAGALVRQNTRIPAGEV  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KDE  867
            WGGNPA FLRKLT+EEIAFISQSA+NYSNL Q HAAENAK  DE EFEKVLRKK   +DE
Sbjct  181  WGGNPANFLRKLTDEEIAFISQSAINYSNLAQVHAAENAKPFDEIEFEKVLRKKFARRDE  240

Query  868  DNDSILGVVRETPPDLILPNN-----APKA  942
            + DS+LGVVRETPP+LILP+N     APKA
Sbjct  241  EYDSMLGVVRETPPELILPDNVLPDKAPKA  270



>ref|XP_008444737.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial [Cucumis 
melo]
Length=273

 Score =   464 bits (1195),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 221/261 (85%), Positives = 242/261 (93%), Gaps = 3/261 (1%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LGRA YTVGFWIRETGQA+DRLGCRLQG Y+F EQLSRHR LMN+FDK P V ++AF
Sbjct  1    MGTLGRAIYTVGFWIRETGQAIDRLGCRLQGRYFFQEQLSRHRTLMNVFDKAPVVDKDAF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSASIIGDVQVGR SSIWYGCVLRGDVNS+S+G+GTNIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   VAPSASIIGDVQVGRGSSIWYGCVLRGDVNSISVGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            IIG+NVT+GHSAV+HGCTVEDEAFVGMGATLLDGVVVEKNAM+AAGALVRQNT+IP GEV
Sbjct  121  IIGDNVTIGHSAVIHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTKIPSGEV  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KDE  867
            WGGNPAKFLRKLT+EEIAFISQSA NY NL Q HAAENAKS DE EFEKVLRKK   +DE
Sbjct  181  WGGNPAKFLRKLTDEEIAFISQSATNYLNLAQVHAAENAKSFDEIEFEKVLRKKFARRDE  240

Query  868  DNDSILGVVRETPPDLILPNN  930
            D DS+LG+VRETPP+LILP+N
Sbjct  241  DYDSMLGIVRETPPELILPDN  261



>ref|XP_012071886.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Jatropha 
curcas]
 gb|KDP38522.1| hypothetical protein JCGZ_04447 [Jatropha curcas]
Length=272

 Score =   464 bits (1193),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 225/271 (83%), Positives = 243/271 (90%), Gaps = 8/271 (3%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LG+A YTVGFWIRETGQALDRLGCR QGNYYF EQLSRHR LMN+FDK P V +EAF
Sbjct  1    MGTLGKAIYTVGFWIRETGQALDRLGCRFQGNYYFQEQLSRHRTLMNIFDKAPVVDKEAF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSASIIGDVQVGR SS+WYGCVLRGDVNS+S+G GTNIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   VAPSASIIGDVQVGRGSSVWYGCVLRGDVNSISVGAGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            IIG+NVTVGHSAVLHGCTVEDEAFVGMGATLLDGV VEK+AM+AAGALVRQNTRIP GEV
Sbjct  121  IIGDNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVFVEKHAMVAAGALVRQNTRIPAGEV  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KDE  867
            WGGNPAKFLRKLT+EEIAFISQSA NYSNL Q HAAENAK  DE EFEK+LRKK   +DE
Sbjct  181  WGGNPAKFLRKLTDEEIAFISQSAANYSNLAQVHAAENAKPFDEIEFEKLLRKKFARRDE  240

Query  868  DNDSILGVVRETPPDLI-----LPNNAPKAS  945
            + DS+LGVVRETPP+LI     LPN AP A+
Sbjct  241  EYDSMLGVVRETPPELILPDKVLPNKAPLAA  271



>ref|XP_004152688.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial [Cucumis 
sativus]
 gb|KGN62616.1| hypothetical protein Csa_2G361800 [Cucumis sativus]
Length=273

 Score =   464 bits (1193),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 221/261 (85%), Positives = 242/261 (93%), Gaps = 3/261 (1%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LG+A YTVGFWIRETGQA+DRLGCRLQG Y+F EQLSRHR LMN+FDK P V ++AF
Sbjct  1    MGTLGKAIYTVGFWIRETGQAIDRLGCRLQGRYFFQEQLSRHRTLMNVFDKAPVVDKDAF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSASIIGDVQVGR SSIWYGCVLRGDVNS+S+G+GTNIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   VAPSASIIGDVQVGRGSSIWYGCVLRGDVNSISVGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            IIG+NVT+GHSAV+HGCTVEDEAFVGMGATLLDGVVVEKNAM+AAGALVRQNT+IP GEV
Sbjct  121  IIGDNVTIGHSAVIHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTKIPSGEV  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KDE  867
            WGGNPAKFLRKLT+EEIAFISQSA NY NL Q HAAENAKS DE EFEKVLRKK   +DE
Sbjct  181  WGGNPAKFLRKLTDEEIAFISQSATNYLNLSQVHAAENAKSFDEIEFEKVLRKKFARRDE  240

Query  868  DNDSILGVVRETPPDLILPNN  930
            D DS+LGVVRETPP+LILP+N
Sbjct  241  DYDSMLGVVRETPPELILPDN  261



>ref|XP_010922032.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Elaeis 
guineensis]
Length=272

 Score =   463 bits (1191),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 222/271 (82%), Positives = 246/271 (91%), Gaps = 8/271 (3%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LG+A YTVGFWIRETGQA+DRLGCRLQGNYYF EQLSRHR  MN++DKVP+V ++AF
Sbjct  1    MGTLGKAIYTVGFWIRETGQAIDRLGCRLQGNYYFQEQLSRHRTFMNIYDKVPNVDKDAF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSAS+IGDVQVGR SSIWYGCVLRGDVNS+ +G+GTNIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   VAPSASVIGDVQVGRGSSIWYGCVLRGDVNSIHVGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            IIG+NVTVGHSAVLHGCTVEDEAFVGMGA LLDGVVVEK+ M+AAGALVRQNT+IPCGEV
Sbjct  121  IIGDNVTVGHSAVLHGCTVEDEAFVGMGAVLLDGVVVEKHGMVAAGALVRQNTKIPCGEV  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KDE  867
            WGGNPAKFLRKLTEEEIAFISQSA NYSNL Q HAAENAK+ DE EFEKVLRKK   +DE
Sbjct  181  WGGNPAKFLRKLTEEEIAFISQSATNYSNLAQVHAAENAKTFDEIEFEKVLRKKYARRDE  240

Query  868  DNDSILGVVRETPPDLILPNN-----APKAS  945
            + DS+LGVVRE PP+LILP+N     +PK S
Sbjct  241  EYDSMLGVVREVPPELILPDNILPNKSPKPS  271



>ref|XP_002510412.1| Protein yrdA, putative [Ricinus communis]
 gb|EEF52599.1| Protein yrdA, putative [Ricinus communis]
Length=271

 Score =   462 bits (1190),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 223/270 (83%), Positives = 244/270 (90%), Gaps = 8/270 (3%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LGRA Y++GFWIRETGQALDRLGCRLQGNYYF EQLSRHR LMN+FDK P V ++AF
Sbjct  1    MGTLGRAIYSIGFWIRETGQALDRLGCRLQGNYYFQEQLSRHRTLMNVFDKAPVVDKDAF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSASIIGDVQVGR +SIWYGCVLRGDVNS+SIG+GTNIQDN+LVHVAKSNL+GKVLPT
Sbjct  61   VAPSASIIGDVQVGRGASIWYGCVLRGDVNSISIGSGTNIQDNTLVHVAKSNLSGKVLPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            IIG+NVTVGHSAVLHGCTVEDEAFVGMG TLLDGVVVEKNAM+AAGALVRQNT+IP GEV
Sbjct  121  IIGDNVTVGHSAVLHGCTVEDEAFVGMGTTLLDGVVVEKNAMVAAGALVRQNTKIPAGEV  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KDE  867
            WGGNPA+FLRKLT+EEIAFI QSA NYSNL Q HA ENAK  DE EFEKVLRKK   +DE
Sbjct  181  WGGNPARFLRKLTDEEIAFIMQSATNYSNLAQVHATENAKPFDEIEFEKVLRKKFARRDE  240

Query  868  DNDSILGVVRETPPDLILPNN-----APKA  942
            + DS+LGVVRETPP+LILP+N     APKA
Sbjct  241  EYDSMLGVVRETPPELILPDNVLPDKAPKA  270



>ref|XP_009391607.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Musa 
acuminata subsp. malaccensis]
Length=274

 Score =   462 bits (1190),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 223/271 (82%), Positives = 245/271 (90%), Gaps = 8/271 (3%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LGRA Y+VGFWIRETGQALDRLGCRLQGNYYF EQLSRHR LMN+FDKVP+VH++AF
Sbjct  1    MGTLGRAIYSVGFWIRETGQALDRLGCRLQGNYYFQEQLSRHRTLMNVFDKVPNVHKDAF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSAS+IGDVQVG+ SSIWYGCVLRGDVNS+ +G+GTNIQDNSLVHVAKSNLTGKVLPT
Sbjct  61   VAPSASVIGDVQVGQGSSIWYGCVLRGDVNSIHVGSGTNIQDNSLVHVAKSNLTGKVLPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            IIG+NVTVGH+AVLHGCTVEDE FVGMG+ LLDGVVVEK+ M+AAGALVRQNTRIPCGEV
Sbjct  121  IIGDNVTVGHNAVLHGCTVEDETFVGMGSVLLDGVVVEKHGMVAAGALVRQNTRIPCGEV  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KDE  867
            WGGNPAKFLRKLT+EEIAFISQSA NY+NL Q HAAENAKS DE EFEKVLRKK   +DE
Sbjct  181  WGGNPAKFLRKLTDEEIAFISQSATNYANLAQVHAAENAKSFDEIEFEKVLRKKFARRDE  240

Query  868  DNDSILGVVRETP-----PDLILPNNAPKAS  945
            + DS+LGVVRE P     PD ILPN +PK S
Sbjct  241  EYDSMLGVVREVPQELILPDNILPNKSPKPS  271



>ref|XP_007204711.1| hypothetical protein PRUPE_ppa009928mg [Prunus persica]
 gb|EMJ05910.1| hypothetical protein PRUPE_ppa009928mg [Prunus persica]
Length=271

 Score =   462 bits (1189),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 222/271 (82%), Positives = 243/271 (90%), Gaps = 8/271 (3%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LGRA YTVGFWIRETGQA+DRLG RLQGNYYF EQLSRHR LMN+FDK P V ++AF
Sbjct  1    MGTLGRAIYTVGFWIRETGQAIDRLGSRLQGNYYFQEQLSRHRTLMNVFDKAPVVDKDAF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSASI+G VQVGR SSIWYGCVLRGDVNS+SIG+GTNIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   VAPSASIVGQVQVGRGSSIWYGCVLRGDVNSISIGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            +IG+NVTVGHSAVLHGCTVEDEAFVGM ATLLDGV VEK+AM+AAGALVRQNTRIPCGEV
Sbjct  121  VIGDNVTVGHSAVLHGCTVEDEAFVGMAATLLDGVYVEKHAMVAAGALVRQNTRIPCGEV  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KDE  867
            WGGNPAKFLRKLTEEE+AFISQSA+NYSNL Q HAAENAKSLDE EFEKVLRKK   +DE
Sbjct  181  WGGNPAKFLRKLTEEEMAFISQSAINYSNLAQAHAAENAKSLDEIEFEKVLRKKFARRDE  240

Query  868  DNDSILGVVRETP-----PDLILPNNAPKAS  945
            + DS+LG+VRETP     PD +LP   PK +
Sbjct  241  EYDSMLGIVRETPAEITLPDNVLPGKVPKTA  271



>ref|XP_006878532.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial [Amborella 
trichopoda]
 gb|ERM94677.1| hypothetical protein AMTR_s00011p00224870 [Amborella trichopoda]
Length=273

 Score =   462 bits (1189),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 220/261 (84%), Positives = 240/261 (92%), Gaps = 3/261 (1%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LG+A YTVGFWIRETGQALDRLGCRLQGNYYF EQLSRHR LMN+FDKVP V ++AF
Sbjct  1    MGTLGKAIYTVGFWIRETGQALDRLGCRLQGNYYFQEQLSRHRTLMNIFDKVPHVDKDAF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSAS+IGDV+VG  SSIWYGCVLRGDVNS+S+GTGTNIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   VAPSASVIGDVKVGHGSSIWYGCVLRGDVNSISVGTGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            IIG+NVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEK+ M+AAGALVRQNT+IPCGEV
Sbjct  121  IIGDNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKHGMVAAGALVRQNTKIPCGEV  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KDE  867
            WGGNPAKFLRKLTEEEIAFISQSA NY NL Q HAAENAK  +E EFEKVLRKK   KDE
Sbjct  181  WGGNPAKFLRKLTEEEIAFISQSATNYMNLAQVHAAENAKPFEEIEFEKVLRKKFARKDE  240

Query  868  DNDSILGVVRETPPDLILPNN  930
              DS+LG+VRE PP+L+LP+N
Sbjct  241  AYDSMLGIVREVPPELVLPDN  261



>ref|XP_002302024.1| transcription factor APFI family protein [Populus trichocarpa]
 ref|XP_011028863.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial [Populus 
euphratica]
 gb|ABK95146.1| unknown [Populus trichocarpa]
 gb|EEE81297.1| transcription factor APFI family protein [Populus trichocarpa]
Length=271

 Score =   462 bits (1188),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 222/261 (85%), Positives = 241/261 (92%), Gaps = 3/261 (1%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LGRA YTVGFWIRETGQALDRLG RLQGNYYF EQLSRHR LMN+FDK P V ++AF
Sbjct  1    MGTLGRAIYTVGFWIRETGQALDRLGGRLQGNYYFQEQLSRHRTLMNIFDKAPVVDKDAF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSAS+IGDVQVG+ SSIWYGCVLRGDVNS+S+G+GTNIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   VAPSASVIGDVQVGKGSSIWYGCVLRGDVNSISVGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            IIG+NVTVGHSAV+HGCTVEDEAFVGMGATLLDGVVVEK+AM+AAGALVRQNTRIP GEV
Sbjct  121  IIGDNVTVGHSAVVHGCTVEDEAFVGMGATLLDGVVVEKHAMVAAGALVRQNTRIPTGEV  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRK---KKDE  867
            WGGNPAKFLRKLT+EEIAFI+QSA NYSNL Q HAAENAK  DE EFEKVLRK   KKDE
Sbjct  181  WGGNPAKFLRKLTDEEIAFIAQSATNYSNLAQVHAAENAKPFDEIEFEKVLRKKFAKKDE  240

Query  868  DNDSILGVVRETPPDLILPNN  930
            + DS+LGVVRE PP+LILPNN
Sbjct  241  EYDSMLGVVRELPPELILPNN  261



>ref|XP_006466826.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Citrus 
sinensis]
 gb|KDO70974.1| hypothetical protein CISIN_1g024153mg [Citrus sinensis]
Length=271

 Score =   462 bits (1188),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 219/261 (84%), Positives = 243/261 (93%), Gaps = 3/261 (1%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LG+A Y+VGFWIRETGQALDRLGCRLQGNYYF EQLSRHR LMN+FDK P V+++ F
Sbjct  1    MGTLGKAIYSVGFWIRETGQALDRLGCRLQGNYYFQEQLSRHRTLMNIFDKAPVVNKDVF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            +APSASIIGDVQVGR SSIWYGCVLRGDVNS+SIG+GTNIQDNSLVHVAKSNL GKVLPT
Sbjct  61   LAPSASIIGDVQVGRGSSIWYGCVLRGDVNSISIGSGTNIQDNSLVHVAKSNLAGKVLPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            IIG+NVTVGHSAVLHGCTVEDEAFVGMGATLLDGV VEK+AM+AAGALVRQNT+IPCGEV
Sbjct  121  IIGDNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVYVEKHAMVAAGALVRQNTKIPCGEV  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KDE  867
            WGGNPA+FLRKLTEEE+AFISQSA+NYSNL + HAAENAKS DE EFEK+LRKK   +DE
Sbjct  181  WGGNPARFLRKLTEEEMAFISQSAINYSNLARVHAAENAKSFDEIEFEKLLRKKFARRDE  240

Query  868  DNDSILGVVRETPPDLILPNN  930
            + DS+LGVVRETP +LILP+N
Sbjct  241  EYDSMLGVVRETPAELILPDN  261



>ref|XP_008338081.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial [Malus domestica]
Length=268

 Score =   461 bits (1187),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 224/268 (84%), Positives = 242/268 (90%), Gaps = 5/268 (2%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LGRA YTVGFWIRETGQA+DRLG RLQGNYYF EQLSRHR LMN+FDK P V +EAF
Sbjct  1    MGTLGRAIYTVGFWIRETGQAIDRLGSRLQGNYYFQEQLSRHRTLMNVFDKAPVVDKEAF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSASIIG VQVGR SSIWYGCVLRGD NS+SIG+GTNIQDNSLVHVAKSNLTGKVLPT
Sbjct  61   VAPSASIIGQVQVGRGSSIWYGCVLRGDANSISIGSGTNIQDNSLVHVAKSNLTGKVLPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            IIG+NVTVGHSAVLHGCTVEDEAFVGM ATLLDGV VEK+AM+AAGALVRQNTRIPCGEV
Sbjct  121  IIGDNVTVGHSAVLHGCTVEDEAFVGMAATLLDGVYVEKHAMVAAGALVRQNTRIPCGEV  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KDE  867
            WGGNPAKFLRKLTE+E+AFISQSALNYSNL Q HAAENAK LDE EF+KVLRKK   +DE
Sbjct  181  WGGNPAKFLRKLTEDEMAFISQSALNYSNLAQVHAAENAKPLDEIEFQKVLRKKFARRDE  240

Query  868  DNDSILGVVRETPPDLILPNNA--PKAS  945
            + DS+LGV RETP +  LP+NA  PKA+
Sbjct  241  EYDSMLGVTRETPAETTLPDNASPPKAA  268



>ref|XP_006425642.1| hypothetical protein CICLE_v10026267mg [Citrus clementina]
 gb|ESR38882.1| hypothetical protein CICLE_v10026267mg [Citrus clementina]
Length=271

 Score =   461 bits (1187),  Expect = 5e-158, Method: Compositional matrix adjust.
 Identities = 219/261 (84%), Positives = 242/261 (93%), Gaps = 3/261 (1%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LG+A Y+VGFWIRETGQALDRLGCRLQGNYYF EQLSRHR LMN+FDK P V ++ F
Sbjct  1    MGTLGKAIYSVGFWIRETGQALDRLGCRLQGNYYFQEQLSRHRTLMNIFDKAPVVDKDVF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            +APSASIIGDVQVGR SSIWYGCVLRGDVNS+SIG+GTNIQDNSLVHVAKSNL GKVLPT
Sbjct  61   LAPSASIIGDVQVGRGSSIWYGCVLRGDVNSISIGSGTNIQDNSLVHVAKSNLAGKVLPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            IIG+NVTVGHSAVLHGCTVEDEAFVGMGATLLDGV VEK+AM+AAGALVRQNT+IPCGEV
Sbjct  121  IIGDNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVYVEKHAMVAAGALVRQNTKIPCGEV  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KDE  867
            WGGNPA+FLRKLTEEE+AFISQSA+NYSNL + HAAENAKS DE EFEK+LRKK   +DE
Sbjct  181  WGGNPARFLRKLTEEEMAFISQSAINYSNLARVHAAENAKSFDEIEFEKLLRKKFARRDE  240

Query  868  DNDSILGVVRETPPDLILPNN  930
            + DS+LGVVRETP +LILP+N
Sbjct  241  EYDSMLGVVRETPAELILPDN  261



>ref|XP_002510411.1| Protein yrdA, putative [Ricinus communis]
 gb|EEF52598.1| Protein yrdA, putative [Ricinus communis]
Length=271

 Score =   461 bits (1185),  Expect = 9e-158, Method: Compositional matrix adjust.
 Identities = 219/261 (84%), Positives = 240/261 (92%), Gaps = 3/261 (1%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LGRA YTVGFWIRETGQALDRLGCR QG+YYF EQLSRHR LMN+FDK P V ++AF
Sbjct  1    MGTLGRAIYTVGFWIRETGQALDRLGCRFQGSYYFQEQLSRHRTLMNIFDKAPMVDKDAF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSASIIGDVQVG+ +SIWYGCVLRGDVNS+S+G GTNIQDNSLVHVAKSNL+GKV+PT
Sbjct  61   VAPSASIIGDVQVGKGASIWYGCVLRGDVNSISVGAGTNIQDNSLVHVAKSNLSGKVIPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            IIG+NVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEK+ M+AAGALVRQNT+IP GEV
Sbjct  121  IIGDNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKHGMVAAGALVRQNTKIPAGEV  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KDE  867
            WGGNPAKFLRKLT+EEIAFISQSA NYSNL Q HAAENAK  DE EFEKVLRKK   +DE
Sbjct  181  WGGNPAKFLRKLTDEEIAFISQSATNYSNLAQVHAAENAKPFDEIEFEKVLRKKFARRDE  240

Query  868  DNDSILGVVRETPPDLILPNN  930
            + DS+LGVVRETPP+LILP+N
Sbjct  241  EYDSMLGVVRETPPELILPDN  261



>ref|XP_006386210.1| hypothetical protein POPTR_0002s03550g [Populus trichocarpa]
 gb|ERP64007.1| hypothetical protein POPTR_0002s03550g [Populus trichocarpa]
Length=285

 Score =   461 bits (1185),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 222/261 (85%), Positives = 241/261 (92%), Gaps = 3/261 (1%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LGRA YTVGFWIRETGQALDRLG RLQGNYYF EQLSRHR LMN+FDK P V ++AF
Sbjct  15   MGTLGRAIYTVGFWIRETGQALDRLGGRLQGNYYFQEQLSRHRTLMNIFDKAPVVDKDAF  74

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSAS+IGDVQVG+ SSIWYGCVLRGDVNS+S+G+GTNIQDNSLVHVAKSNL+GKVLPT
Sbjct  75   VAPSASVIGDVQVGKGSSIWYGCVLRGDVNSISVGSGTNIQDNSLVHVAKSNLSGKVLPT  134

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            IIG+NVTVGHSAV+HGCTVEDEAFVGMGATLLDGVVVEK+AM+AAGALVRQNTRIP GEV
Sbjct  135  IIGDNVTVGHSAVVHGCTVEDEAFVGMGATLLDGVVVEKHAMVAAGALVRQNTRIPTGEV  194

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRK---KKDE  867
            WGGNPAKFLRKLT+EEIAFI+QSA NYSNL Q HAAENAK  DE EFEKVLRK   KKDE
Sbjct  195  WGGNPAKFLRKLTDEEIAFIAQSATNYSNLAQVHAAENAKPFDEIEFEKVLRKKFAKKDE  254

Query  868  DNDSILGVVRETPPDLILPNN  930
            + DS+LGVVRE PP+LILPNN
Sbjct  255  EYDSMLGVVRELPPELILPNN  275



>ref|XP_008241708.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial [Prunus 
mume]
Length=271

 Score =   460 bits (1183),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 221/271 (82%), Positives = 242/271 (89%), Gaps = 8/271 (3%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LGRA YTVGFWIRETGQA+DRLG RLQGNYYF EQLSRHR LMN+FDK P V ++AF
Sbjct  1    MGTLGRAIYTVGFWIRETGQAIDRLGSRLQGNYYFQEQLSRHRTLMNVFDKAPVVDKDAF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSASI+G VQVGR SSIWYGCVLRGDVNS+SIG+GTNIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   VAPSASIVGQVQVGRGSSIWYGCVLRGDVNSISIGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            +IG+NVTVGHSAVLHGCTVEDEAFVGM ATLLDGV VEK+AM+AAGALVRQNTRIPCGEV
Sbjct  121  VIGDNVTVGHSAVLHGCTVEDEAFVGMAATLLDGVYVEKHAMVAAGALVRQNTRIPCGEV  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KDE  867
            WGGNPAKFLRKLTEEE+ FISQSA+NYSNL Q HAAENAKSLDE EFEKVL+KK   +DE
Sbjct  181  WGGNPAKFLRKLTEEEMTFISQSAINYSNLAQAHAAENAKSLDEIEFEKVLQKKFARRDE  240

Query  868  DNDSILGVVRETP-----PDLILPNNAPKAS  945
            + DS+LGVVRETP     PD +LP   PK +
Sbjct  241  EYDSMLGVVRETPAEITLPDNVLPGKVPKTA  271



>ref|XP_007017577.1| Gamma carbonic anhydrase 1, CA1 [Theobroma cacao]
 gb|EOY14802.1| Gamma carbonic anhydrase 1, CA1 [Theobroma cacao]
Length=273

 Score =   460 bits (1183),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 219/261 (84%), Positives = 242/261 (93%), Gaps = 3/261 (1%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LG+A YTVGFWIRETGQALDRLGCRLQG+Y F EQ+SRHR LMN+FDK P V ++AF
Sbjct  1    MGTLGKAVYTVGFWIRETGQALDRLGCRLQGSYLFQEQISRHRTLMNIFDKAPVVDKDAF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSAS+IGDVQVGR SSIWYG VLRGDVNS+S+G+GTNIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   VAPSASVIGDVQVGRGSSIWYGSVLRGDVNSISVGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            IIG+NVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEK+AM+AAGALVRQNTRIP GE+
Sbjct  121  IIGDNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKHAMVAAGALVRQNTRIPTGEI  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KDE  867
            WGGNPAKFLRKLT+EEIAFISQSA NYSNL Q HAAENAK+ DE EFEKVLRKK   +DE
Sbjct  181  WGGNPAKFLRKLTDEEIAFISQSATNYSNLAQVHAAENAKAFDEIEFEKVLRKKFAHRDE  240

Query  868  DNDSILGVVRETPPDLILPNN  930
            + DS+LGVVRETPP+LILP+N
Sbjct  241  EYDSMLGVVRETPPELILPDN  261



>ref|XP_006435021.1| hypothetical protein CICLE_v10002155mg [Citrus clementina]
 ref|XP_006473528.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Citrus 
sinensis]
 gb|ESR48261.1| hypothetical protein CICLE_v10002155mg [Citrus clementina]
Length=270

 Score =   459 bits (1182),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 219/261 (84%), Positives = 242/261 (93%), Gaps = 3/261 (1%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LGRA YTVGFWIRETGQALDRLGCRLQGNYYF EQLSRHR LMN+FDK P+V ++AF
Sbjct  1    MGTLGRAVYTVGFWIRETGQALDRLGCRLQGNYYFQEQLSRHRTLMNIFDKAPAVDKDAF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSASIIGDVQVGR SSIWYGCVLRGDVNS+S+G+GTNIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   VAPSASIIGDVQVGRGSSIWYGCVLRGDVNSISVGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
             IG+NVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVE++ M+AAG+LVRQNTRIP GEV
Sbjct  121  TIGDNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVERHGMVAAGSLVRQNTRIPSGEV  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KDE  867
            WGGNPAKFLRKLT+EEIAFISQSA NYSNL Q HAAENAKS DE EFEKVLRKK   +DE
Sbjct  181  WGGNPAKFLRKLTDEEIAFISQSATNYSNLAQVHAAENAKSFDEIEFEKVLRKKFARRDE  240

Query  868  DNDSILGVVRETPPDLILPNN  930
            + DS+LGVVRETP ++I+P++
Sbjct  241  EYDSMLGVVRETPQEIIVPDS  261



>ref|XP_009371625.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Pyrus 
x bretschneideri]
Length=268

 Score =   459 bits (1182),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 223/268 (83%), Positives = 243/268 (91%), Gaps = 5/268 (2%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LGRA YTVGFWIRETGQA+DRLG RLQGNYYF EQLSRHR LMN+FDK P V +EAF
Sbjct  1    MGTLGRAIYTVGFWIRETGQAIDRLGSRLQGNYYFQEQLSRHRTLMNVFDKAPVVDKEAF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSASIIG VQVGR SSIWYGCVLRGD NSVSIG+GTNIQDNSLVHVAKSNLTGKVLPT
Sbjct  61   VAPSASIIGQVQVGRGSSIWYGCVLRGDANSVSIGSGTNIQDNSLVHVAKSNLTGKVLPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            IIG+NVTVGHSAVLHGCTVEDEAFVG+ ATLLDGV VEK+AM+AAGALVRQNTRIPCGEV
Sbjct  121  IIGDNVTVGHSAVLHGCTVEDEAFVGVAATLLDGVYVEKHAMVAAGALVRQNTRIPCGEV  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KDE  867
            WGGNPAKFLRKLTE+E+AFISQSALNYSNL Q HAAENAK LDE EF+KVLRKK   +DE
Sbjct  181  WGGNPAKFLRKLTEDEMAFISQSALNYSNLAQVHAAENAKPLDEIEFQKVLRKKFARRDE  240

Query  868  DNDSILGVVRETPPDLILPNNA--PKAS  945
            + DS+LGV+RETP +  LP+NA  P+A+
Sbjct  241  EYDSMLGVIRETPAETTLPDNASPPRAA  268



>ref|XP_008338249.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial [Malus domestica]
Length=268

 Score =   459 bits (1180),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 222/268 (83%), Positives = 242/268 (90%), Gaps = 5/268 (2%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LGRA YTVGFWIRETGQA+DRLG RLQGNYYF EQLSRHR LMN+FDK P V +EAF
Sbjct  1    MGTLGRAIYTVGFWIRETGQAIDRLGSRLQGNYYFQEQLSRHRTLMNVFDKAPVVDKEAF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSASIIG VQVGR SSIWYGCVLRGDVNS+SIG+GTNIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   VAPSASIIGQVQVGRGSSIWYGCVLRGDVNSISIGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            IIG+NVTVGHSAVLHGCTVEDEAFVGM ATLLDGV VEK+AM+AAGALVRQNTRIPCGEV
Sbjct  121  IIGDNVTVGHSAVLHGCTVEDEAFVGMAATLLDGVYVEKHAMVAAGALVRQNTRIPCGEV  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KDE  867
            WGGNPAKFLRKLTE+E+AFISQSALNYSNL Q HAAENAK LDE EFEK LRKK   +DE
Sbjct  181  WGGNPAKFLRKLTEDEMAFISQSALNYSNLAQVHAAENAKPLDEIEFEKALRKKFGRRDE  240

Query  868  DNDSILGVVRETPPDLILPNNA--PKAS  945
            + DS+LGV RETP ++ LP+N   PK++
Sbjct  241  EYDSMLGVTRETPAEITLPDNVLPPKSA  268



>ref|XP_009590737.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Nicotiana 
tomentosiformis]
Length=271

 Score =   459 bits (1180),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 217/271 (80%), Positives = 242/271 (89%), Gaps = 8/271 (3%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MGS G+A YTVGFWIRETGQALDRLGCRLQGNYYFHE LSRHR LMNLFDKVP V ++AF
Sbjct  1    MGSAGKAIYTVGFWIRETGQALDRLGCRLQGNYYFHEHLSRHRTLMNLFDKVPVVEKDAF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSASI+GDV +GR +SIWYGCVLRGDVNSV IG GTN+QDNSL+HVAKSN++G+VLPT
Sbjct  61   VAPSASIVGDVHIGRSASIWYGCVLRGDVNSVIIGAGTNVQDNSLIHVAKSNVSGRVLPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
             IG NVT+GHSAVLHGCTVEDEAF+GMGAT+LDG VVEKN+M+AAGALVRQ TRIPCGEV
Sbjct  121  TIGKNVTIGHSAVLHGCTVEDEAFIGMGATVLDGAVVEKNSMVAAGALVRQKTRIPCGEV  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KDE  867
            WGGNPA+FLRKLTEEEI FISQSA+NYSNL Q HAAENAK LDE EFEKVLRKK   K+E
Sbjct  181  WGGNPARFLRKLTEEEIMFISQSAMNYSNLAQAHAAENAKKLDEIEFEKVLRKKFIRKEE  240

Query  868  DNDSILGVVRETPPDLILPNN-----APKAS  945
            + DS+LG VR+TPP+L+LP+N     APKAS
Sbjct  241  EYDSMLGGVRDTPPELVLPDNALPDKAPKAS  271



>ref|XP_008786862.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Phoenix 
dactylifera]
Length=272

 Score =   459 bits (1180),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 220/271 (81%), Positives = 244/271 (90%), Gaps = 8/271 (3%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LG+A YTVGFWIRETGQA+DRLGCRLQGNYYF EQLSRHR LMN+FDK+P V ++AF
Sbjct  1    MGTLGKAIYTVGFWIRETGQAIDRLGCRLQGNYYFQEQLSRHRTLMNIFDKLPKVDKDAF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSAS+IGDVQVG  SSIWYGCVLRGDVNS+ +GTGTNIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   VAPSASVIGDVQVGGGSSIWYGCVLRGDVNSIRVGTGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            IIG+NVT+GHSAVLHGCTVEDEAFVGMGA LLDGVVVEK+ M+AAG+LVRQN +IPCGEV
Sbjct  121  IIGDNVTIGHSAVLHGCTVEDEAFVGMGAILLDGVVVEKHGMVAAGSLVRQNAKIPCGEV  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KDE  867
            WGGNPAKFLRKLTEEEIAFISQSA NYSNL Q HAAENAK+ DE EFEKVLRKK   +DE
Sbjct  181  WGGNPAKFLRKLTEEEIAFISQSAANYSNLAQVHAAENAKTFDEIEFEKVLRKKYARRDE  240

Query  868  DNDSILGVVRETPPDLILPNN-----APKAS  945
            + DS+LGVVRE PP+LILP+N     +PK S
Sbjct  241  EYDSMLGVVREVPPELILPDNILPNKSPKPS  271



>ref|XP_009799511.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like isoform 
X2 [Nicotiana sylvestris]
Length=271

 Score =   459 bits (1180),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 216/271 (80%), Positives = 243/271 (90%), Gaps = 8/271 (3%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MGS G+A YTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHR LMNLFDKVP V ++AF
Sbjct  1    MGSAGKAIYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRTLMNLFDKVPVVEKDAF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSASI+GDV +GR +SIWYGCVLRGDVN+VSIG GTN+QDNSL+HVAKSN++G+VLPT
Sbjct  61   VAPSASIVGDVHIGRSASIWYGCVLRGDVNNVSIGAGTNVQDNSLIHVAKSNISGRVLPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
             IG NVT+GHSAVLHGCTVEDEAF+G GAT+LDG VVEKN+M+AAGALVRQNTRIPCGEV
Sbjct  121  TIGKNVTIGHSAVLHGCTVEDEAFIGTGATVLDGAVVEKNSMVAAGALVRQNTRIPCGEV  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KDE  867
            WGGNPA+FLRKLTEEEI FISQSA+NYSNL Q HAAENAK LD+ EFEKVLRKK   K+E
Sbjct  181  WGGNPARFLRKLTEEEIMFISQSAMNYSNLAQAHAAENAKKLDDIEFEKVLRKKFTRKEE  240

Query  868  DNDSILGVVRETPPDLILPNN-----APKAS  945
            + DS+LG VR+TPP+ +LP+N     APKAS
Sbjct  241  EYDSMLGGVRDTPPEFVLPDNVLPDKAPKAS  271



>ref|XP_009340721.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial [Pyrus x 
bretschneideri]
Length=268

 Score =   458 bits (1178),  Expect = 8e-157, Method: Compositional matrix adjust.
 Identities = 222/268 (83%), Positives = 242/268 (90%), Gaps = 5/268 (2%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LGRA YTVGFWIRETGQA+DRLG RLQGNYYF EQLSRHR LMN+FDK P V +EAF
Sbjct  1    MGTLGRAVYTVGFWIRETGQAIDRLGSRLQGNYYFQEQLSRHRTLMNVFDKAPVVDKEAF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSASIIG VQVGR SSIWYGCVLRGDVNS+SIG+GTNIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   VAPSASIIGQVQVGRGSSIWYGCVLRGDVNSISIGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            IIG+NVTVGHSAVLHGCTVEDEAFVGM ATLLDGV VEK+AM+AAGALVRQNTRIPCGEV
Sbjct  121  IIGDNVTVGHSAVLHGCTVEDEAFVGMAATLLDGVYVEKHAMVAAGALVRQNTRIPCGEV  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KDE  867
            WGGNPAKFLRKLTE+E+AFISQSALNYSNL Q HAAENAK LDE EFEK LRKK   +DE
Sbjct  181  WGGNPAKFLRKLTEDEMAFISQSALNYSNLAQVHAAENAKPLDEIEFEKALRKKFGRRDE  240

Query  868  DNDSILGVVRETPPDLILPNNA--PKAS  945
            + DS+LGV RETP ++ LP+N   PK++
Sbjct  241  EYDSMLGVTRETPAEITLPDNVLPPKSA  268



>ref|NP_001275071.1| transcription factor APFI-like [Solanum tuberosum]
 gb|ABB86281.1| transcription factor APFI-like [Solanum tuberosum]
Length=268

 Score =   458 bits (1178),  Expect = 9e-157, Method: Compositional matrix adjust.
 Identities = 219/267 (82%), Positives = 242/267 (91%), Gaps = 5/267 (2%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LG+A YTVGFWIRETGQA+DRLGCRLQGNYYFHEQLSRHR LMNLF+K P V ++AF
Sbjct  1    MGTLGKASYTVGFWIRETGQAIDRLGCRLQGNYYFHEQLSRHRTLMNLFNKAPMVDKDAF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSAS+IGDV VGR++SIWYGCVLRGDVNS+SIG G+NIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   VAPSASLIGDVHVGRNASIWYGCVLRGDVNSISIGAGSNIQDNSLVHVAKSNLSGKVLPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAM+AAGALVRQNTRIPCGEV
Sbjct  121  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIPCGEV  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KDE  867
            WGGNPA+FLRKLT+EE+ ++     NYSNL Q HA ENAKS D  EFEKVLRKK   KDE
Sbjct  181  WGGNPARFLRKLTQEELLYLGSQPANYSNLAQVHAGENAKSFDAIEFEKVLRKKFARKDE  240

Query  868  DNDSILGVVRETPPDLILPNN--APKA  942
            + DS+LGVVRETPP+L+LP+N  APKA
Sbjct  241  EYDSMLGVVRETPPELVLPDNIQAPKA  267



>ref|XP_002306878.1| transcription factor APFI family protein [Populus trichocarpa]
 gb|EEE93874.1| transcription factor APFI family protein [Populus trichocarpa]
Length=271

 Score =   458 bits (1178),  Expect = 9e-157, Method: Compositional matrix adjust.
 Identities = 222/270 (82%), Positives = 241/270 (89%), Gaps = 8/270 (3%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LGRA Y VGFW+RETGQALDRLGCRLQGNYYF EQLSRHR LMN+FDK P V ++AF
Sbjct  1    MGTLGRAIYAVGFWVRETGQALDRLGCRLQGNYYFQEQLSRHRTLMNIFDKAPVVDKDAF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAP AS+IGDV VGR SSIWYGCVLRGDVNS+S+G+GTNIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   VAPGASVIGDVLVGRGSSIWYGCVLRGDVNSISVGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            IIG+NVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEK+AM+AAGALVRQNTRIP GEV
Sbjct  121  IIGDNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKHAMVAAGALVRQNTRIPTGEV  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRK---KKDE  867
            WGGNPAKFLRKLT+EE+AFI+QSA NYSNL Q HAAENAK  DE EFEKVLRK   KKDE
Sbjct  181  WGGNPAKFLRKLTDEEVAFIAQSATNYSNLAQVHAAENAKPFDEIEFEKVLRKKFAKKDE  240

Query  868  DNDSILGVVRETPPDLILPNNA-----PKA  942
            + DS+LGVVRE PP+LILP N      PKA
Sbjct  241  EYDSMLGVVRELPPELILPKNVLPDKEPKA  270



>ref|XP_010931534.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Elaeis 
guineensis]
Length=325

 Score =   459 bits (1182),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 221/271 (82%), Positives = 245/271 (90%), Gaps = 8/271 (3%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LG+A YTVGFWIRETGQA+DRLGCRLQGNYYF EQLSRHR LMN+FDKVP V ++AF
Sbjct  54   MGTLGKAIYTVGFWIRETGQAIDRLGCRLQGNYYFQEQLSRHRTLMNIFDKVPQVDKDAF  113

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSAS+IGDVQVG  SSIWYGCVLRGDVNS+ +G+GTN+QDNSLVHVAKSN++GKVLPT
Sbjct  114  VAPSASVIGDVQVGGGSSIWYGCVLRGDVNSIRVGSGTNVQDNSLVHVAKSNISGKVLPT  173

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            IIG+NVTVGHSAVLHGCTVEDEAFVGMGA LLDGVVVEK+ M+AAGALVRQNT+IPCGEV
Sbjct  174  IIGDNVTVGHSAVLHGCTVEDEAFVGMGAILLDGVVVEKHGMVAAGALVRQNTKIPCGEV  233

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KDE  867
            WGGNPAKFLRKLTEEEIAFISQSA NYSNL Q HAAENAK+ DE EFEKVLRKK   +DE
Sbjct  234  WGGNPAKFLRKLTEEEIAFISQSATNYSNLAQVHAAENAKTFDEIEFEKVLRKKYARRDE  293

Query  868  DNDSILGVVRETPPDLILPNN-----APKAS  945
            + DS+LGVVRE PP+LILP+N     +PK S
Sbjct  294  EYDSMLGVVREVPPELILPDNILPDKSPKPS  324



>ref|XP_006383176.1| hypothetical protein POPTR_0005s12280g [Populus trichocarpa]
 gb|ERP60973.1| hypothetical protein POPTR_0005s12280g [Populus trichocarpa]
Length=271

 Score =   456 bits (1174),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 221/271 (82%), Positives = 243/271 (90%), Gaps = 8/271 (3%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LGRA Y+VGFWIRETGQALDRLGCRLQGNYYF EQLSRHR LMN+FDK P V ++AF
Sbjct  1    MGTLGRAIYSVGFWIRETGQALDRLGCRLQGNYYFQEQLSRHRTLMNVFDKAPVVEKDAF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSASI G+V VGR SSIWYGCVLRGDVNS+S+G+GTNIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   VAPSASITGNVHVGRSSSIWYGCVLRGDVNSISVGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            IIG+NV+VGHSAVLHGCTVEDEAFVG GATLLDGV VEK+AM+AAGALVRQNTRIP GEV
Sbjct  121  IIGDNVSVGHSAVLHGCTVEDEAFVGTGATLLDGVCVEKHAMVAAGALVRQNTRIPSGEV  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KDE  867
            WGGNPAKFLRKLTEEE+AFISQSALNY+NL Q HAAENAK  DE EFEKVL KK   +DE
Sbjct  181  WGGNPAKFLRKLTEEEMAFISQSALNYANLAQVHAAENAKGFDEIEFEKVLHKKFARRDE  240

Query  868  DNDSILGVVRETPPDLILPNN-----APKAS  945
            + +S+LGVVRETPP+LILPNN      PKA+
Sbjct  241  EYESMLGVVRETPPELILPNNMMPDKMPKAA  271



>ref|XP_011007461.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Populus 
euphratica]
Length=271

 Score =   456 bits (1173),  Expect = 5e-156, Method: Compositional matrix adjust.
 Identities = 222/270 (82%), Positives = 240/270 (89%), Gaps = 8/270 (3%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LGRA Y VGFW+RETGQALDRLGCRLQGNYYF EQLSRHR LMN+FDK P V ++AF
Sbjct  1    MGTLGRAIYAVGFWVRETGQALDRLGCRLQGNYYFQEQLSRHRTLMNIFDKAPVVDKDAF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAP AS+IGDV VGR SSIWYGCVLRGDVNS+S+G+GTNIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   VAPGASVIGDVLVGRGSSIWYGCVLRGDVNSISVGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            IIG+NVTVGHSAVLHGCTVEDEAFVGMGA LLDGVVVEK+AM+AAGALVRQNTRIP GEV
Sbjct  121  IIGDNVTVGHSAVLHGCTVEDEAFVGMGAILLDGVVVEKHAMVAAGALVRQNTRIPTGEV  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRK---KKDE  867
            WGGNPAKFLRKLT+EEIAFI+QSA NYSNL Q HAAENAK  DE EFEKVLRK   KKDE
Sbjct  181  WGGNPAKFLRKLTDEEIAFIAQSATNYSNLAQVHAAENAKPFDEIEFEKVLRKKFAKKDE  240

Query  868  DNDSILGVVRETPPDLILPNNA-----PKA  942
            + DS+LGVVRE PP+LILP N      PKA
Sbjct  241  EYDSMLGVVRELPPELILPKNVLPDKEPKA  270



>ref|XP_010113421.1| hypothetical protein L484_026755 [Morus notabilis]
 gb|EXC35448.1| hypothetical protein L484_026755 [Morus notabilis]
Length=271

 Score =   456 bits (1172),  Expect = 9e-156, Method: Compositional matrix adjust.
 Identities = 217/261 (83%), Positives = 243/261 (93%), Gaps = 3/261 (1%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LG+A YTVGFWIRETGQA+DRLGCRLQGNY+F EQLSRHR LMN+FDK P+V ++AF
Sbjct  1    MGTLGKAIYTVGFWIRETGQAIDRLGCRLQGNYHFQEQLSRHRTLMNVFDKAPAVDKDAF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSAS+IGDVQVGR SSIWYGCVLRGDVNS+SIG+GTNIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   VAPSASVIGDVQVGRGSSIWYGCVLRGDVNSISIGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            IIG+NVTVGH+AVLHGCTVEDEAFVGMGATLLDGV VE++AM+AAGALVRQNTRIP GEV
Sbjct  121  IIGDNVTVGHAAVLHGCTVEDEAFVGMGATLLDGVFVERHAMVAAGALVRQNTRIPYGEV  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KDE  867
            WGGNPAKFLRKLTEEEIAFIS+SA+NY+NL   HAAEN+KS DE EFEKVLRKK   +DE
Sbjct  181  WGGNPAKFLRKLTEEEIAFISESAVNYTNLALVHAAENSKSFDEIEFEKVLRKKFAHRDE  240

Query  868  DNDSILGVVRETPPDLILPNN  930
            + D +LGVVRETPP+LILP+N
Sbjct  241  EYDLMLGVVRETPPELILPDN  261



>ref|XP_011074556.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial [Sesamum 
indicum]
Length=272

 Score =   455 bits (1171),  Expect = 9e-156, Method: Compositional matrix adjust.
 Identities = 216/261 (83%), Positives = 240/261 (92%), Gaps = 3/261 (1%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MGSLGRA YT+G W+RETGQA+DRLGCRLQGNYYF EQLSRHR LMNLFDK P V R+AF
Sbjct  1    MGSLGRAVYTLGLWVRETGQAMDRLGCRLQGNYYFQEQLSRHRTLMNLFDKSPVVDRDAF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSAS+IGDVQVG+ SSIWYGCVLRGDVNS+S+G+GTNIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   VAPSASLIGDVQVGQGSSIWYGCVLRGDVNSISVGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            IIG+NVT+GHSAV+HGCT+EDEAFVGMGATLLDGVVVE+NAM+AAGALVRQNTRIP GEV
Sbjct  121  IIGDNVTIGHSAVIHGCTIEDEAFVGMGATLLDGVVVERNAMVAAGALVRQNTRIPFGEV  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KDE  867
            W GNPAKFLRKLT+EEIAFISQSA NY NL + HAAENAKS DE EFEKVLRKK   +DE
Sbjct  181  WAGNPAKFLRKLTDEEIAFISQSATNYINLAKVHAAENAKSFDEIEFEKVLRKKFARRDE  240

Query  868  DNDSILGVVRETPPDLILPNN  930
            + DS+LGV RETPP+L+LP+N
Sbjct  241  EYDSMLGVHRETPPELVLPDN  261



>ref|XP_011083204.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial [Sesamum 
indicum]
Length=265

 Score =   454 bits (1168),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 218/266 (82%), Positives = 244/266 (92%), Gaps = 4/266 (2%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MGS GRAFYTVGFWIRETGQALDRLG RLQGNY+F EQLSRHR LMN+FDKVP V ++AF
Sbjct  1    MGSFGRAFYTVGFWIRETGQALDRLGSRLQGNYFFQEQLSRHRTLMNVFDKVPVVDKDAF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSASI+GDV VGR SSIWYGCVLRGDVNS+SIG+GTNIQDNSLVHVAKSNL+GKVLP 
Sbjct  61   VAPSASIVGDVHVGRGSSIWYGCVLRGDVNSISIGSGTNIQDNSLVHVAKSNLSGKVLPI  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            +IG+NVTVGHSAVLHGCTVEDE+FVGMGATLLDGVVVEK+AM+AAGALVRQNTRIP GEV
Sbjct  121  LIGDNVTVGHSAVLHGCTVEDESFVGMGATLLDGVVVEKHAMVAAGALVRQNTRIPAGEV  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KDE  867
            WGGNPA+FLRKLTE+EIAFISQSA+NY+NL Q HA+ENAK  D+ EFEKVLRKK   +DE
Sbjct  181  WGGNPARFLRKLTEDEIAFISQSAINYANLAQVHASENAKGFDKVEFEKVLRKKFASRDE  240

Query  868  DNDSILGVVRETPPDLILPNNAPKAS  945
            + DS+LGVVR+TPP+L+  NN PKA+
Sbjct  241  EYDSMLGVVRQTPPELVHSNN-PKAA  265



>ref|XP_008788543.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Phoenix 
dactylifera]
Length=272

 Score =   453 bits (1166),  Expect = 7e-155, Method: Compositional matrix adjust.
 Identities = 215/261 (82%), Positives = 238/261 (91%), Gaps = 3/261 (1%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LG+A YTVGFWIRETGQA+DRLGCRLQGNYYF EQLSRHR LMN+FDKVP V ++AF
Sbjct  1    MGTLGKAIYTVGFWIRETGQAIDRLGCRLQGNYYFQEQLSRHRTLMNIFDKVPIVDKDAF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSAS+IGDVQVG+ SSIWYGCVLRGDVN + +G+GTNIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   VAPSASVIGDVQVGQGSSIWYGCVLRGDVNRIRVGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            IIG+NVT+GHSAVLHGCTVEDE FVGMGA LLDGVVVEK+ M+AAGALVRQNT+IPCGEV
Sbjct  121  IIGDNVTIGHSAVLHGCTVEDETFVGMGAVLLDGVVVEKHGMVAAGALVRQNTKIPCGEV  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KDE  867
            WGGNPAKFLRKLTEEEIAFISQSA NYSNL Q HAAENAK+ D+ E EK LRKK   +DE
Sbjct  181  WGGNPAKFLRKLTEEEIAFISQSATNYSNLAQVHAAENAKAFDDIELEKGLRKKYARRDE  240

Query  868  DNDSILGVVRETPPDLILPNN  930
            D DS+LGVVRE PP+LILP+N
Sbjct  241  DYDSMLGVVREVPPELILPDN  261



>ref|XP_009386943.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Musa 
acuminata subsp. malaccensis]
Length=272

 Score =   452 bits (1162),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 217/271 (80%), Positives = 241/271 (89%), Gaps = 8/271 (3%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LGRA YTVGFWIRETGQA+DRLGCRLQGNY F EQLSRHR LMN+FDKVP+VH+ AF
Sbjct  1    MGTLGRAIYTVGFWIRETGQAIDRLGCRLQGNYLFQEQLSRHRTLMNIFDKVPNVHKGAF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAP AS+IGDVQVG+ SSIWYGCVLRGDVNS+ +G+ TNIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   VAPGASVIGDVQVGQGSSIWYGCVLRGDVNSIHVGSSTNIQDNSLVHVAKSNLSGKVLPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            IIG+NVT+GHS VLHGCTVEDEAFVGMGA LLDGVVVEK+ M+AAGALVRQNTRIPCGEV
Sbjct  121  IIGDNVTIGHSVVLHGCTVEDEAFVGMGAVLLDGVVVEKHGMVAAGALVRQNTRIPCGEV  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KDE  867
            WGGNPA+FLRKLTEEE+AFISQSA NY+NL Q HA ENAKS DE EFEKVL KK   +DE
Sbjct  181  WGGNPARFLRKLTEEEVAFISQSATNYTNLAQVHAVENAKSFDEIEFEKVLHKKFARRDE  240

Query  868  DNDSILGVVRETPPDLILPNN-----APKAS  945
            + DS+LGVVRE PP+LILP+N     +PK S
Sbjct  241  EYDSMLGVVREVPPELILPDNVLPDKSPKPS  271



>ref|XP_009399949.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Musa 
acuminata subsp. malaccensis]
Length=272

 Score =   452 bits (1162),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 215/261 (82%), Positives = 238/261 (91%), Gaps = 3/261 (1%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LGRA Y VG WIRETGQA+DRLGCRLQGNY F EQLSRHR LMN+FDKVP+VH++AF
Sbjct  1    MGTLGRAIYAVGCWIRETGQAIDRLGCRLQGNYLFQEQLSRHRTLMNIFDKVPNVHKDAF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSAS+IGDV VG+ SSIWYGCVLRGDVNS+ IG+GTNIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   VAPSASVIGDVHVGQGSSIWYGCVLRGDVNSIHIGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            IIG+NVTVGHSAVLHGCTVEDEAFVGMGA LLDG VVEK+ M+AAGALVRQNTRIPCGEV
Sbjct  121  IIGDNVTVGHSAVLHGCTVEDEAFVGMGAVLLDGAVVEKHGMVAAGALVRQNTRIPCGEV  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KDE  867
            WGGNPAKFLRKLT+EE+AFIS+SA NY+NL Q HAAEN KS DE EFEKVLRKK   +DE
Sbjct  181  WGGNPAKFLRKLTDEEVAFISESAANYANLAQVHAAENVKSFDEIEFEKVLRKKFARRDE  240

Query  868  DNDSILGVVRETPPDLILPNN  930
            + DS+LGVVRE PP+LILP+N
Sbjct  241  EYDSMLGVVREVPPELILPDN  261



>emb|CDP07494.1| unnamed protein product [Coffea canephora]
Length=279

 Score =   451 bits (1161),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 217/268 (81%), Positives = 240/268 (90%), Gaps = 10/268 (4%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LGRA YTVGFWIRETGQALDRLGCRLQGNYYF EQLSRHR LMN+FDK P V +EAF
Sbjct  1    MGTLGRAVYTVGFWIRETGQALDRLGCRLQGNYYFQEQLSRHRTLMNIFDKAPLVDKEAF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSASIIGDVQVGR SSIWYGCVLRGDVNS+++G+GTNIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   VAPSASIIGDVQVGRGSSIWYGCVLRGDVNSITVGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGE-  693
            IIG+NVT+GHSAVLHGCTVEDEAFVGMGA LLDG V+EK+AM+AAGALVRQN RIP G+ 
Sbjct  121  IIGDNVTIGHSAVLHGCTVEDEAFVGMGAALLDGAVLEKHAMVAAGALVRQNMRIPSGQA  180

Query  694  ------VWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRK  855
                  VWGGNPAKFLRKL++EEIAFISQSA NY NL Q HAAENAKS DE EFEKVLRK
Sbjct  181  IILIFRVWGGNPAKFLRKLSDEEIAFISQSATNYCNLAQVHAAENAKSFDEIEFEKVLRK  240

Query  856  K---KDEDNDSILGVVRETPPDLILPNN  930
            K   +DE+ DS+LGV+RETPP+L+LP+N
Sbjct  241  KYSRRDEEYDSMLGVIRETPPELVLPDN  268



>gb|KCW68228.1| hypothetical protein EUGRSUZ_F01883 [Eucalyptus grandis]
Length=269

 Score =   451 bits (1160),  Expect = 5e-154, Method: Compositional matrix adjust.
 Identities = 221/269 (82%), Positives = 240/269 (89%), Gaps = 12/269 (4%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LGRA YTVGFW+RETGQALDRLGCRLQGNYYF EQLSRHR LMN+FDK P V ++AF
Sbjct  1    MGTLGRAIYTVGFWVRETGQALDRLGCRLQGNYYFQEQLSRHRTLMNIFDKAPVVDKDAF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSASIIGDVQVGR SSIWYGCVLRGDVNS+S+G+GTNIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   VAPSASIIGDVQVGRGSSIWYGCVLRGDVNSISVGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            IIG+NVTV    VLHGCTVEDEAFVGMGATLLDGVVVEK+ M+A GALVRQNTRIP GEV
Sbjct  121  IIGDNVTV----VLHGCTVEDEAFVGMGATLLDGVVVEKHGMVAGGALVRQNTRIPAGEV  176

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KDE  867
            WGGNPAKFLRKLTEEE+AFI+QSA NYSNL Q HAAENAK  DE EFEKVLRKK   +DE
Sbjct  177  WGGNPAKFLRKLTEEEVAFITQSATNYSNLAQVHAAENAKPFDEIEFEKVLRKKFARRDE  236

Query  868  DNDSILGVVRETPPDLILPNN-----APK  939
            + DS+LGVVRETPP+LILP+N     APK
Sbjct  237  EYDSMLGVVRETPPELILPDNVLPGKAPK  265



>ref|XP_010538097.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Tarenaya 
hassleriana]
Length=277

 Score =   451 bits (1160),  Expect = 7e-154, Method: Compositional matrix adjust.
 Identities = 216/261 (83%), Positives = 237/261 (91%), Gaps = 3/261 (1%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MGSLGRA YTVGFWIRETGQALDRLGCRLQGN+YF EQLSRHR LMN+FDK PSV ++AF
Sbjct  1    MGSLGRAIYTVGFWIRETGQALDRLGCRLQGNHYFREQLSRHRTLMNVFDKAPSVDKDAF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSAS+IGDVQ+G  SSIWYGCVLRGDVN +S+G+ TNIQDNSLVHVAKSN++GKVLPT
Sbjct  61   VAPSASVIGDVQIGGGSSIWYGCVLRGDVNGISVGSWTNIQDNSLVHVAKSNISGKVLPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            IIG+NVT+GHSAVLHGCT+EDEAFVGMGATLLDGVVVEK+AM+AAGALVRQNT IP GEV
Sbjct  121  IIGDNVTIGHSAVLHGCTIEDEAFVGMGATLLDGVVVEKHAMVAAGALVRQNTIIPSGEV  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KDE  867
            WGGNPA+FLRKLT+EEIAFI QSA NYSNL Q HAAENAK  DE EFEK LRKK   KDE
Sbjct  181  WGGNPARFLRKLTDEEIAFICQSATNYSNLAQVHAAENAKPFDEIEFEKALRKKYARKDE  240

Query  868  DNDSILGVVRETPPDLILPNN  930
            D DS+LG+VRETPP LILP+N
Sbjct  241  DYDSMLGIVRETPPQLILPDN  261



>ref|XP_004291863.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial [Fragaria 
vesca subsp. vesca]
Length=272

 Score =   450 bits (1157),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 216/261 (83%), Positives = 237/261 (91%), Gaps = 3/261 (1%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LGRA YTVGFWIRETGQA+DRLG RLQG+YYF EQLSRHR LMN+FDK P V ++AF
Sbjct  1    MGTLGRAIYTVGFWIRETGQAVDRLGSRLQGSYYFKEQLSRHRTLMNIFDKAPVVDKDAF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSAS+IGDVQVG+ SSIWYGCVLRGDVN++ IG GTNIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   VAPSASVIGDVQVGKGSSIWYGCVLRGDVNNIVIGAGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            IIG+NVTVGHSAV+HGCTVEDEAFVGMGATLLDGVVVEK+AM+AAGALVRQNTRIP GEV
Sbjct  121  IIGDNVTVGHSAVVHGCTVEDEAFVGMGATLLDGVVVEKHAMVAAGALVRQNTRIPSGEV  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KDE  867
            W GNPAKFLRKLT+EEIAFISQSA NY NL Q HAAEN KS DE EFEKVLRKK   +DE
Sbjct  181  WAGNPAKFLRKLTDEEIAFISQSATNYVNLAQVHAAENGKSFDEIEFEKVLRKKFARRDE  240

Query  868  DNDSILGVVRETPPDLILPNN  930
            + DS+LGVVRE PP+LILP+N
Sbjct  241  EYDSMLGVVREIPPELILPDN  261



>ref|XP_011011740.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Populus 
euphratica]
 ref|XP_011011741.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Populus 
euphratica]
 ref|XP_011011742.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Populus 
euphratica]
Length=271

 Score =   450 bits (1157),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 220/271 (81%), Positives = 241/271 (89%), Gaps = 8/271 (3%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LGRA Y+VGFWIRETGQALDRLGCRLQGNYYF EQLSRHR LMN+FDK P V ++AF
Sbjct  1    MGTLGRAIYSVGFWIRETGQALDRLGCRLQGNYYFKEQLSRHRTLMNVFDKAPVVEKDAF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSASI G+V VGR SSIWYGCVLRGDVNSVS+G+GTNIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   VAPSASITGNVHVGRGSSIWYGCVLRGDVNSVSVGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            IIG+NV+VGHSAVLHGCTVED +FVG GATLLDGV VEK+AM+AAGALVRQNTRIP GEV
Sbjct  121  IIGDNVSVGHSAVLHGCTVEDASFVGPGATLLDGVCVEKHAMVAAGALVRQNTRIPSGEV  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KDE  867
            WGGNPAKFLRKLTEEE+AFISQSALNY+NL Q HAAENAK  DE EFEKVL KK   +DE
Sbjct  181  WGGNPAKFLRKLTEEEMAFISQSALNYANLAQVHAAENAKGFDEIEFEKVLCKKFARRDE  240

Query  868  DNDSILGVVRETPPDLILPNNA-----PKAS  945
            + DS+LG VRETPP+LILPNN      PKA+
Sbjct  241  EYDSMLGAVRETPPELILPNNMMPDKIPKAA  271



>gb|AFK45344.1| unknown [Medicago truncatula]
 gb|KEH40168.1| gamma carbonic anhydrase-like protein [Medicago truncatula]
Length=272

 Score =   449 bits (1156),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 214/267 (80%), Positives = 241/267 (90%), Gaps = 4/267 (1%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LG+A Y+VGFWIRETGQA+DRLG RLQGNYYF EQLSRHR LMN+FDK P V ++AF
Sbjct  1    MGTLGKAIYSVGFWIRETGQAIDRLGSRLQGNYYFQEQLSRHRTLMNVFDKAPVVDKDAF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            +APSAS+IGDV +GR SSIWYGCV+RGDVN++S+G+GTNIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   IAPSASVIGDVHIGRGSSIWYGCVMRGDVNNISVGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            IIG+NVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEK+AM+AAGALVRQN+RIP GEV
Sbjct  121  IIGDNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKHAMVAAGALVRQNSRIPSGEV  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KDE  867
            W GNPAKFLR+LT EEI FISQSA+NYSNL Q HAAENAK  DE EFEKVLRKK   KDE
Sbjct  181  WAGNPAKFLRELTAEEILFISQSAINYSNLAQVHAAENAKPFDEIEFEKVLRKKFARKDE  240

Query  868  DNDSILGVVRETPPDLILPNNA-PKAS  945
            + DS+LGVVRE PP+LILP+N  PK +
Sbjct  241  EYDSMLGVVREIPPELILPDNVLPKQT  267



>ref|XP_009799510.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like isoform 
X1 [Nicotiana sylvestris]
Length=284

 Score =   449 bits (1156),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 216/284 (76%), Positives = 243/284 (86%), Gaps = 21/284 (7%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MGS G+A YTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHR LMNLFDKVP V ++AF
Sbjct  1    MGSAGKAIYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRTLMNLFDKVPVVEKDAF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSASI+GDV +GR +SIWYGCVLRGDVN+VSIG GTN+QDNSL+HVAKSN++G+VLPT
Sbjct  61   VAPSASIVGDVHIGRSASIWYGCVLRGDVNNVSIGAGTNVQDNSLIHVAKSNISGRVLPT  120

Query  517  IIGNNVTVGHSAVLHGCTVED-------------EAFVGMGATLLDGVVVEKNAMIAAGA  657
             IG NVT+GHSAVLHGCTVED             EAF+G GAT+LDG VVEKN+M+AAGA
Sbjct  121  TIGKNVTIGHSAVLHGCTVEDEAFIGTGATVLDXEAFIGTGATVLDGAVVEKNSMVAAGA  180

Query  658  LVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEF  837
            LVRQNTRIPCGEVWGGNPA+FLRKLTEEEI FISQSA+NYSNL Q HAAENAK LD+ EF
Sbjct  181  LVRQNTRIPCGEVWGGNPARFLRKLTEEEIMFISQSAMNYSNLAQAHAAENAKKLDDIEF  240

Query  838  EKVLRKK---KDEDNDSILGVVRETPPDLILPNN-----APKAS  945
            EKVLRKK   K+E+ DS+LG VR+TPP+ +LP+N     APKAS
Sbjct  241  EKVLRKKFTRKEEEYDSMLGGVRDTPPEFVLPDNVLPDKAPKAS  284



>ref|NP_564091.1| gamma carbonic anhydrase 1 [Arabidopsis thaliana]
 sp|Q9FWR5.1|GCA1_ARATH RecName: Full=Gamma carbonic anhydrase 1, mitochondrial; Short=AtCA1; 
Short=GAMMA CA1; Flags: Precursor [Arabidopsis thaliana]
 gb|AAF98404.1|AC024609_5 Unknown protein [Arabidopsis thaliana]
 dbj|BAD44650.1| unknown protein [Arabidopsis thaliana]
 dbj|BAF01128.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE29870.1| gamma carbonic anhydrase 1 [Arabidopsis thaliana]
Length=275

 Score =   449 bits (1154),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 215/261 (82%), Positives = 237/261 (91%), Gaps = 3/261 (1%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LGRAFY+VGFWIRETGQALDRLGCRLQG  YF EQLSRHR LMN+FDK P V +EAF
Sbjct  1    MGTLGRAFYSVGFWIRETGQALDRLGCRLQGKNYFREQLSRHRTLMNVFDKAPIVDKEAF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSAS+IGDV +GR SSIWYGCVLRGDVN+VS+G+GTNIQDNSLVHVAKSNL+GKV PT
Sbjct  61   VAPSASVIGDVHIGRGSSIWYGCVLRGDVNTVSVGSGTNIQDNSLVHVAKSNLSGKVHPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            IIG+NVT+GHSAVLHGCTVEDE F+GMGATLLDGVVVEK+ M+AAGALVRQNTRIP GEV
Sbjct  121  IIGDNVTIGHSAVLHGCTVEDETFIGMGATLLDGVVVEKHGMVAAGALVRQNTRIPSGEV  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KDE  867
            WGGNPA+FLRKLT+EEIAFISQSA NYSNL Q HAAENAK L+  EFEKVLRKK   KDE
Sbjct  181  WGGNPARFLRKLTDEEIAFISQSATNYSNLAQAHAAENAKPLNVIEFEKVLRKKHALKDE  240

Query  868  DNDSILGVVRETPPDLILPNN  930
            + DS+LG+VRETPP+L LPNN
Sbjct  241  EYDSMLGIVRETPPELNLPNN  261



>ref|XP_007222873.1| hypothetical protein PRUPE_ppa009923mg [Prunus persica]
 gb|EMJ24072.1| hypothetical protein PRUPE_ppa009923mg [Prunus persica]
Length=272

 Score =   449 bits (1154),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 214/261 (82%), Positives = 237/261 (91%), Gaps = 3/261 (1%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LGR  YTVGFWIRETGQA+DRLG RLQG+YYF EQLSRHR LMN+FDK P V ++ F
Sbjct  1    MGTLGRVIYTVGFWIRETGQAVDRLGSRLQGSYYFKEQLSRHRTLMNIFDKAPVVDKDVF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSAS+IGDVQVGR SSIWYGCVLRGDVN++ +G+GTNIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   VAPSASVIGDVQVGRGSSIWYGCVLRGDVNNIVVGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            IIG+NVTVGHSAV+HGCTVEDEAFVGMGATLLDGVVVEK+AM+AAGALVRQNTRIP GEV
Sbjct  121  IIGDNVTVGHSAVIHGCTVEDEAFVGMGATLLDGVVVEKHAMVAAGALVRQNTRIPSGEV  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KDE  867
            WGGNPAKFLRKLT+EE AFISQSA NY+NL Q HAAEN KS DE EFEKVLRKK   +DE
Sbjct  181  WGGNPAKFLRKLTDEEKAFISQSATNYTNLAQVHAAENGKSFDEIEFEKVLRKKFARRDE  240

Query  868  DNDSILGVVRETPPDLILPNN  930
            + DS+LGVVRE PP+LILP+N
Sbjct  241  EYDSMLGVVREIPPELILPDN  261



>ref|XP_008220827.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial [Prunus 
mume]
Length=272

 Score =   448 bits (1153),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 217/269 (81%), Positives = 240/269 (89%), Gaps = 8/269 (3%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LGR  YTVGFWIRETGQA+DRLG RLQG+YYF EQLSRHR LMN+FDK P V ++ F
Sbjct  1    MGTLGRVIYTVGFWIRETGQAVDRLGSRLQGSYYFKEQLSRHRTLMNIFDKAPVVDKDVF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSAS+IGDVQVGR SSIWYGCVLRGDVN++ +G+GTNIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   VAPSASVIGDVQVGRGSSIWYGCVLRGDVNNIVVGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            IIG+NVTVGHSAV+HGCTVEDEAFVGMGATLLDGVVVEK+AM+AAGALVRQNTRIP GEV
Sbjct  121  IIGDNVTVGHSAVIHGCTVEDEAFVGMGATLLDGVVVEKHAMVAAGALVRQNTRIPSGEV  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KDE  867
            WGGNPAKFLRKLT+EE AFISQSA NY+NL Q HAAEN KS DE EFEKVLRKK   +DE
Sbjct  181  WGGNPAKFLRKLTDEEKAFISQSATNYTNLAQVHAAENGKSFDEIEFEKVLRKKFARRDE  240

Query  868  DNDSILGVVRETPPDLILPNN-----APK  939
            + DS+LGVVRE PP+LILP+N     APK
Sbjct  241  EYDSMLGVVREIPPELILPDNVLPDKAPK  269



>ref|XP_004232424.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Solanum 
lycopersicum]
Length=270

 Score =   448 bits (1153),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 218/271 (80%), Positives = 240/271 (89%), Gaps = 9/271 (3%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MGS  +A YTVGFWIRETGQALDRLGCRLQGNYYF E LSRHR LMNLFDKVP V ++AF
Sbjct  1    MGSAMKAIYTVGFWIRETGQALDRLGCRLQGNYYFQEHLSRHRTLMNLFDKVPVVEKDAF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSASIIGDV +GR +SIWYGCVLRGDVNSVSIG GTN+QDNSL+HVAKSN++GKVLPT
Sbjct  61   VAPSASIIGDVHIGRSASIWYGCVLRGDVNSVSIGAGTNVQDNSLIHVAKSNISGKVLPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            IIG NVT+GHSAVLHGCTVEDEAF+GMGAT+LDG VVEKNAM+AAGA VRQNTRIP GEV
Sbjct  121  IIGKNVTIGHSAVLHGCTVEDEAFIGMGATVLDGAVVEKNAMVAAGAHVRQNTRIPFGEV  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KDE  867
            WGGNPA+FLRKLTEEEIAFIS+SA NYSNL Q HAAENAK LD+ EFEKVLRKK   KDE
Sbjct  181  WGGNPARFLRKLTEEEIAFISESAANYSNLAQVHAAENAKELDKIEFEKVLRKKLARKDE  240

Query  868  DNDSILGVVRETPPDLILPNN-----APKAS  945
            + DS+LG V ETPP+L+LP++     APKAS
Sbjct  241  EYDSMLG-VSETPPELVLPDSSLPDKAPKAS  270



>ref|XP_004287879.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial [Fragaria 
vesca subsp. vesca]
Length=269

 Score =   448 bits (1152),  Expect = 6e-153, Method: Compositional matrix adjust.
 Identities = 217/269 (81%), Positives = 238/269 (88%), Gaps = 6/269 (2%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LGRA YTVGFWIRETGQA+DRLG RLQGNY+F EQLSRHR LMN+FDK P V +EAF
Sbjct  1    MGTLGRAVYTVGFWIRETGQAIDRLGSRLQGNYFFKEQLSRHRTLMNVFDKAPEVDKEAF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSASIIG VQVGR SSIWYGCVLRGD NS+SIG+GTNIQDNSLVHVAKSNL GKVLPT
Sbjct  61   VAPSASIIGQVQVGRGSSIWYGCVLRGDANSISIGSGTNIQDNSLVHVAKSNLDGKVLPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            IIG+NVTVGHSAVLHGCTVEDEAFVGM ATLLDGV VEK+AM+AAGALVRQNTRIPCGEV
Sbjct  121  IIGDNVTVGHSAVLHGCTVEDEAFVGMAATLLDGVYVEKHAMVAAGALVRQNTRIPCGEV  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KDE  867
            WGGNPAKFLRKLTE+E+AFISQSA+NY+NL Q HAAENAK LD  EFEKVLRKK   +DE
Sbjct  181  WGGNPAKFLRKLTEDEMAFISQSAINYANLAQVHAAENAKELDSVEFEKVLRKKFGRRDE  240

Query  868  DNDSILGVVRETPPDLILPNNA---PKAS  945
            D D++  VVR+T P+  LP+N    PKA+
Sbjct  241  DYDTMFEVVRQTSPEATLPDNVGPPPKAA  269



>dbj|BAD43151.1| unknown protein [Arabidopsis thaliana]
Length=275

 Score =   447 bits (1151),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 214/261 (82%), Positives = 237/261 (91%), Gaps = 3/261 (1%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LGRAFY+VGFWIRETGQALDRLGCRLQG  YF EQLSRHR LMN+FDK P V +EAF
Sbjct  1    MGTLGRAFYSVGFWIRETGQALDRLGCRLQGKNYFREQLSRHRTLMNVFDKAPIVDKEAF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSAS+IGDV +GR SSIWYGCVLRGDVN+VS+G+GTNIQDNSLVHVAKSNL+GKV PT
Sbjct  61   VAPSASVIGDVHIGRGSSIWYGCVLRGDVNTVSVGSGTNIQDNSLVHVAKSNLSGKVHPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            IIG+NVT+GHSAVLHGCTVEDE F+GMGATLLDGVVVEK+ M+AAGALVRQNTRIP GEV
Sbjct  121  IIGDNVTIGHSAVLHGCTVEDETFIGMGATLLDGVVVEKHGMVAAGALVRQNTRIPSGEV  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KDE  867
            WGGNPA+FLRKLT+EEIAFISQSA NYSNL Q HAAENAK L+  EFEKVLRKK   +DE
Sbjct  181  WGGNPARFLRKLTDEEIAFISQSATNYSNLAQAHAAENAKPLNVIEFEKVLRKKHALRDE  240

Query  868  DNDSILGVVRETPPDLILPNN  930
            + DS+LG+VRETPP+L LPNN
Sbjct  241  EYDSMLGIVRETPPELNLPNN  261



>ref|XP_006340643.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like isoform 
X1 [Solanum tuberosum]
Length=270

 Score =   447 bits (1150),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 218/271 (80%), Positives = 240/271 (89%), Gaps = 9/271 (3%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MGS  +A YTVGFWIRETGQALDRLGCRLQGNYYF E LSRHR LMNLFDKVP V ++AF
Sbjct  1    MGSAMKAIYTVGFWIRETGQALDRLGCRLQGNYYFQEHLSRHRTLMNLFDKVPVVEKDAF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSASIIGDV +GR +SIWYGCVLRGDVNSVSIG GTN+QDNSL+HVAKSN++GKVLPT
Sbjct  61   VAPSASIIGDVHIGRSASIWYGCVLRGDVNSVSIGAGTNVQDNSLIHVAKSNISGKVLPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            IIG NVT+GHSAVLHGCTVEDEAF+GMGAT+LDG VVEKNAM+AAGA VRQNTRIP GEV
Sbjct  121  IIGKNVTIGHSAVLHGCTVEDEAFIGMGATVLDGAVVEKNAMVAAGAHVRQNTRIPFGEV  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KDE  867
            WGGNPA+FLRKLTEEEIAFIS+SA NYSNL Q HAAENAK LD+ EFEKVLRKK   KDE
Sbjct  181  WGGNPARFLRKLTEEEIAFISESAANYSNLAQVHAAENAKELDKIEFEKVLRKKLARKDE  240

Query  868  DNDSILGVVRETPPDLILPNN-----APKAS  945
            + DS+LG V ETPP+L+LP++     APKAS
Sbjct  241  EYDSMLG-VGETPPELVLPDSSLPDKAPKAS  270



>gb|AAM61583.1| unknown [Arabidopsis thaliana]
Length=275

 Score =   447 bits (1150),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 214/261 (82%), Positives = 237/261 (91%), Gaps = 3/261 (1%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LGRAFY+VGFWIRETGQALDRLGCRLQG  YF EQLSRHR LMN+FDK P V ++AF
Sbjct  1    MGTLGRAFYSVGFWIRETGQALDRLGCRLQGKNYFREQLSRHRTLMNVFDKAPIVDKDAF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSAS+IGDV +GR SSIWYGCVLRGDVN+VS+G+GTNIQDNSLVHVAKSNL+GKV PT
Sbjct  61   VAPSASVIGDVHIGRGSSIWYGCVLRGDVNTVSVGSGTNIQDNSLVHVAKSNLSGKVHPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            IIG+NVT+GHSAVLHGCTVEDE F+GMGATLLDGVVVEK+ M+AAGALVRQNTRIP GEV
Sbjct  121  IIGDNVTIGHSAVLHGCTVEDETFIGMGATLLDGVVVEKHGMVAAGALVRQNTRIPSGEV  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KDE  867
            WGGNPA+FLRKLT+EEIAFISQSA NYSNL Q HAAENAK L+  EFEKVLRKK   KDE
Sbjct  181  WGGNPARFLRKLTDEEIAFISQSATNYSNLAQAHAAENAKPLNVIEFEKVLRKKHALKDE  240

Query  868  DNDSILGVVRETPPDLILPNN  930
            + DS+LG+VRETPP+L LPNN
Sbjct  241  EYDSMLGIVRETPPELNLPNN  261



>ref|XP_009365039.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Pyrus 
x bretschneideri]
Length=272

 Score =   447 bits (1149),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 214/261 (82%), Positives = 235/261 (90%), Gaps = 3/261 (1%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LGRA YTVGFWIRETGQA+DRLG  LQG YYF EQLSRHR LMN+FDK P V ++ F
Sbjct  1    MGTLGRAIYTVGFWIRETGQAIDRLGSSLQGGYYFKEQLSRHRTLMNVFDKAPVVDKDVF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSASIIGDVQVGR SSIWYGCVLRGDVN++ +G+GTNIQDNSLVHVAKSNLTGKVLPT
Sbjct  61   VAPSASIIGDVQVGRGSSIWYGCVLRGDVNNIVVGSGTNIQDNSLVHVAKSNLTGKVLPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            IIG+NVTVGHSAV+HGCTVEDEAFVGMGATLLDGVVVEK+AM+AAG+LVRQNT+IP GEV
Sbjct  121  IIGDNVTVGHSAVIHGCTVEDEAFVGMGATLLDGVVVEKHAMVAAGSLVRQNTKIPSGEV  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KDE  867
            W GNPAKFLRKLT+EEIAFISQSA NY+NL Q HAAEN KS DE EFEK LRKK   KDE
Sbjct  181  WAGNPAKFLRKLTDEEIAFISQSATNYTNLAQVHAAENVKSFDEIEFEKALRKKFAHKDE  240

Query  868  DNDSILGVVRETPPDLILPNN  930
            + DS+LGVVRE PP+LILP+N
Sbjct  241  EYDSMLGVVREIPPELILPDN  261



>ref|XP_009336133.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Pyrus 
x bretschneideri]
Length=272

 Score =   447 bits (1149),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 213/261 (82%), Positives = 235/261 (90%), Gaps = 3/261 (1%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LGRA YTVGFWIRETGQA+DRLG  LQG YYF EQLSRHR LMN+FDK P V ++ F
Sbjct  1    MGTLGRAIYTVGFWIRETGQAIDRLGSSLQGGYYFKEQLSRHRTLMNVFDKAPVVDKDVF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSASIIGDVQVGR SSIWYGCVLRGDVN++ +G+GTNIQDNSLVHVAKSNLTGKVLPT
Sbjct  61   VAPSASIIGDVQVGRGSSIWYGCVLRGDVNNIVVGSGTNIQDNSLVHVAKSNLTGKVLPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            IIG+NVTVGHSAV+HGCTVEDEAFVGMGATLLDGVV+EK+AM+AAG+LVRQNT+IP GEV
Sbjct  121  IIGDNVTVGHSAVIHGCTVEDEAFVGMGATLLDGVVIEKHAMVAAGSLVRQNTKIPSGEV  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KDE  867
            W GNPAKFLRKLT+EEIAFISQSA NY+NL Q HAAEN KS DE EFEK LRKK   KDE
Sbjct  181  WAGNPAKFLRKLTDEEIAFISQSATNYTNLAQVHAAENVKSFDEIEFEKALRKKFAHKDE  240

Query  868  DNDSILGVVRETPPDLILPNN  930
            + DS+LGVVRE PP+LILP+N
Sbjct  241  EYDSMLGVVREIPPELILPDN  261



>gb|AFK48594.1| unknown [Lotus japonicus]
Length=273

 Score =   446 bits (1146),  Expect = 7e-152, Method: Compositional matrix adjust.
 Identities = 211/261 (81%), Positives = 235/261 (90%), Gaps = 3/261 (1%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LGRA Y+VGFWIRETGQA+DRLG RLQG Y+  EQLSRHR LMN+FDK P+V ++ F
Sbjct  1    MGTLGRAIYSVGFWIRETGQAIDRLGSRLQGGYFIQEQLSRHRTLMNIFDKAPTVDKDVF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSAS+IGDVQVG+ SSIWYG VLRGDVNS+ +G+GTNIQDNSLVHVAKSNL GKVLPT
Sbjct  61   VAPSASVIGDVQVGKGSSIWYGTVLRGDVNSIRVGSGTNIQDNSLVHVAKSNLGGKVLPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            IIGNNVTVGHSAVLHGCTVEDEAFVGMGA LLDGVVVEKNAM+AAGALVRQNT++P GEV
Sbjct  121  IIGNNVTVGHSAVLHGCTVEDEAFVGMGAILLDGVVVEKNAMVAAGALVRQNTKVPSGEV  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KDE  867
            W GNPAKFLRKLT+EEIAFISQSA NY+NL Q HAAEN+KS DE EFEKVLRKK   +DE
Sbjct  181  WAGNPAKFLRKLTDEEIAFISQSATNYTNLAQVHAAENSKSFDEIEFEKVLRKKFARRDE  240

Query  868  DNDSILGVVRETPPDLILPNN  930
            D DS++GVVRE PP+LILP+N
Sbjct  241  DYDSMIGVVREIPPELILPDN  261



>ref|XP_003523810.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial [Glycine 
max]
 gb|KHN45863.1| Hypothetical protein glysoja_023086 [Glycine soja]
Length=276

 Score =   445 bits (1144),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 213/261 (82%), Positives = 234/261 (90%), Gaps = 3/261 (1%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LGRA Y+VG WIRETGQA+DRLG RLQG YYF EQLSRHR LMN+FDK P V ++ F
Sbjct  1    MGTLGRAIYSVGNWIRETGQAIDRLGSRLQGGYYFQEQLSRHRTLMNIFDKAPVVDKDVF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSAS+IGDVQ+GR SSIWYG VLRGDVNS+ +G GTNIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   VAPSASVIGDVQLGRGSSIWYGVVLRGDVNSIRVGNGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            IIG+NVTVGHSAV+HGCTVEDEAFVGMGA LLDGVVVEKNAM+AAGALVRQNTRIP GEV
Sbjct  121  IIGDNVTVGHSAVIHGCTVEDEAFVGMGAILLDGVVVEKNAMVAAGALVRQNTRIPSGEV  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KDE  867
            W GNPAKFLRKLT+EEIAFISQSA NY+NL Q HAAEN+KS DE EFEKVLRKK   KDE
Sbjct  181  WAGNPAKFLRKLTDEEIAFISQSATNYTNLAQVHAAENSKSFDEIEFEKVLRKKFARKDE  240

Query  868  DNDSILGVVRETPPDLILPNN  930
            + DS+LGVVRE PP+LILP+N
Sbjct  241  EYDSMLGVVREIPPELILPDN  261



>ref|XP_010679758.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial [Beta vulgaris 
subsp. vulgaris]
Length=272

 Score =   444 bits (1142),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 209/261 (80%), Positives = 238/261 (91%), Gaps = 3/261 (1%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LGRA YTVGFWIRETGQA+DRLGCRLQGNYYF EQLSRHR LMN+FDK P + ++ F
Sbjct  1    MGTLGRAIYTVGFWIRETGQAIDRLGCRLQGNYYFQEQLSRHRTLMNVFDKKPLIDKQTF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSAS+IGDVQ+G  SSIWYGCVLRGDVN++SIG+GTNIQDNSLVHVAK+N+ GKVLPT
Sbjct  61   VAPSASVIGDVQIGCGSSIWYGCVLRGDVNNISIGSGTNIQDNSLVHVAKTNVAGKVLPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            IIG+NVTVGHSA+LHGCTV+DEAFVGMGATLLDGVVVEK+AM+AAGALVRQNTRIP G+V
Sbjct  121  IIGDNVTVGHSAILHGCTVDDEAFVGMGATLLDGVVVEKHAMVAAGALVRQNTRIPSGQV  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KDE  867
            WGGNPAKFLR LTEEEIAFI++SA NYSNL + HAAEN K  +E EFEKVLRKK   KDE
Sbjct  181  WGGNPAKFLRNLTEEEIAFIAESATNYSNLARVHAAENDKGFEEIEFEKVLRKKYARKDE  240

Query  868  DNDSILGVVRETPPDLILPNN  930
            + DS++G+VRETPP+LILP+N
Sbjct  241  EYDSMIGIVRETPPELILPDN  261



>dbj|BAD44607.1| unknown protein [Arabidopsis thaliana]
Length=275

 Score =   443 bits (1140),  Expect = 7e-151, Method: Compositional matrix adjust.
 Identities = 213/261 (82%), Positives = 235/261 (90%), Gaps = 3/261 (1%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LGRAFY+VGFWI ETGQALDRLGCRLQG  YF EQLSRHR  MN+FDK P V +EAF
Sbjct  1    MGTLGRAFYSVGFWILETGQALDRLGCRLQGKNYFREQLSRHRTQMNVFDKAPIVDKEAF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSAS+IGDV +GR SSIWYGCVLRGDVN+VS+G+GTNIQDNSLVHVAKSNL+GKV PT
Sbjct  61   VAPSASVIGDVHIGRGSSIWYGCVLRGDVNTVSVGSGTNIQDNSLVHVAKSNLSGKVHPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            IIG+NVT+GHSAVLHGCTVEDE F+GMGATLLDGVVVEK+ M+AAGALVRQNTRIP GEV
Sbjct  121  IIGDNVTIGHSAVLHGCTVEDETFIGMGATLLDGVVVEKHGMVAAGALVRQNTRIPSGEV  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KDE  867
            WGGNPA+FLRKLT+EEIAFISQSA NYSNL Q HAAENAK L+  EFEKVLRKK   KDE
Sbjct  181  WGGNPARFLRKLTDEEIAFISQSATNYSNLAQAHAAENAKPLNVIEFEKVLRKKHALKDE  240

Query  868  DNDSILGVVRETPPDLILPNN  930
            + DS+LG+VRETPP+L LPNN
Sbjct  241  EYDSMLGIVRETPPELNLPNN  261



>ref|XP_009365536.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial [Pyrus x 
bretschneideri]
Length=272

 Score =   443 bits (1139),  Expect = 8e-151, Method: Compositional matrix adjust.
 Identities = 211/261 (81%), Positives = 234/261 (90%), Gaps = 3/261 (1%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LGRA YTVGFWIRETGQA+DRLG  LQG+YYF EQLSRHR LMN+FDK P V ++ F
Sbjct  1    MGTLGRAIYTVGFWIRETGQAIDRLGSSLQGSYYFKEQLSRHRTLMNVFDKAPVVDKDVF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSAS+IGDVQVGR SSIWYGCVLRGDVN++ +G+GTNIQDNSLVHVAKSNL+GK LPT
Sbjct  61   VAPSASVIGDVQVGRGSSIWYGCVLRGDVNNIVVGSGTNIQDNSLVHVAKSNLSGKALPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            IIG+NVTVGHSAV+HGCTVEDEAFVGMGATLLDGVVVEK+AM+AAG+LVRQNTRIP GEV
Sbjct  121  IIGDNVTVGHSAVIHGCTVEDEAFVGMGATLLDGVVVEKHAMVAAGSLVRQNTRIPSGEV  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KDE  867
            W GNPAKFLRKLT+EE AFISQSA NY+NL Q HAAEN KS DE EFEK LRKK   KDE
Sbjct  181  WAGNPAKFLRKLTDEEKAFISQSATNYTNLAQVHAAENVKSFDEIEFEKALRKKYAHKDE  240

Query  868  DNDSILGVVRETPPDLILPNN  930
            + DS+LGVVRE PP+LILP+N
Sbjct  241  EYDSMLGVVREIPPELILPDN  261



>gb|AFK46651.1| unknown [Lotus japonicus]
Length=273

 Score =   442 bits (1138),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 210/261 (80%), Positives = 235/261 (90%), Gaps = 3/261 (1%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LGRA Y+VGFWIRETGQA+DRLG RLQG Y+  EQLSRHR LMN+FDK P+V ++ F
Sbjct  1    MGTLGRAIYSVGFWIRETGQAIDRLGSRLQGGYFILEQLSRHRTLMNIFDKAPTVDKDVF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSAS+IGDVQVG+ SSIWYG VLRGDV+S+ +G+GTNIQDNSLVHVAKSNL GKVLPT
Sbjct  61   VAPSASVIGDVQVGKGSSIWYGTVLRGDVSSIRVGSGTNIQDNSLVHVAKSNLGGKVLPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            IIGNNVTVGHSAVLHGCTVEDEAFVGMGA LLDGVVVEKNAM+AAGALVRQNT++P GEV
Sbjct  121  IIGNNVTVGHSAVLHGCTVEDEAFVGMGAILLDGVVVEKNAMVAAGALVRQNTKVPSGEV  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KDE  867
            W GNPAKFLRKLT+EEIAFISQSA NY+NL Q HAAEN+KS DE EFEKVLRKK   +DE
Sbjct  181  WAGNPAKFLRKLTDEEIAFISQSATNYTNLAQVHAAENSKSFDEIEFEKVLRKKFARRDE  240

Query  868  DNDSILGVVRETPPDLILPNN  930
            D DS++GVVRE PP+LILP+N
Sbjct  241  DYDSMIGVVREIPPELILPDN  261



>ref|XP_008388037.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial [Malus domestica]
Length=272

 Score =   441 bits (1133),  Expect = 7e-150, Method: Compositional matrix adjust.
 Identities = 210/261 (80%), Positives = 235/261 (90%), Gaps = 3/261 (1%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LGRA YTVGFWIRETGQA+DRLG  LQG+YYF EQLS+HR LMN+F+K P V ++ F
Sbjct  1    MGTLGRAIYTVGFWIRETGQAIDRLGSSLQGSYYFKEQLSQHRTLMNVFNKAPVVDKDVF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSASIIGDVQVGR SSIWYGCVLRGDVN++ +G GTNIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   VAPSASIIGDVQVGRGSSIWYGCVLRGDVNNIVVGYGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            IIG+NVTVGHSAV+HGCTVEDEAFVGMGATLLDGVVVEK+AM+AAG+LVRQNT+IP GEV
Sbjct  121  IIGDNVTVGHSAVIHGCTVEDEAFVGMGATLLDGVVVEKHAMVAAGSLVRQNTKIPSGEV  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KDE  867
            W GNPAKFLRKLT+EEIAFI+QSA NY+NL Q HAAEN KS DE EFEK LRKK   KDE
Sbjct  181  WAGNPAKFLRKLTDEEIAFITQSATNYTNLAQVHAAENVKSFDEIEFEKALRKKFAHKDE  240

Query  868  DNDSILGVVRETPPDLILPNN  930
            + DS+LGVVRE PP+LILP+N
Sbjct  241  EYDSMLGVVREIPPELILPDN  261



>ref|XP_008364986.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Malus 
domestica]
Length=272

 Score =   440 bits (1131),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 210/261 (80%), Positives = 233/261 (89%), Gaps = 3/261 (1%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LGRA YTVGFWIRETGQA+DRLG  LQG+YYF EQLSRHR LMN+FDK P V ++ F
Sbjct  1    MGTLGRAIYTVGFWIRETGQAIDRLGSSLQGSYYFKEQLSRHRTLMNVFDKAPVVDKDVF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSAS+IGDVQVGR SSIWYGCVLRGDVN++ +G+GTNIQDNSLVHVAKSNL GKVLPT
Sbjct  61   VAPSASVIGDVQVGRGSSIWYGCVLRGDVNNIVVGSGTNIQDNSLVHVAKSNLNGKVLPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            IIG+NVTVGHSAV+HGCTVEDEAFVGMGATLLDGVVVEK+AM+AAG+LVRQNTRIP GEV
Sbjct  121  IIGDNVTVGHSAVIHGCTVEDEAFVGMGATLLDGVVVEKHAMVAAGSLVRQNTRIPSGEV  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KDE  867
            W GNPAKFLR LT+EE +FISQSA NY+NL Q HAAEN KS DE EFEK LRKK   KDE
Sbjct  181  WAGNPAKFLRXLTDEEKSFISQSATNYTNLAQVHAAENVKSFDEIEFEKALRKKYAHKDE  240

Query  868  DNDSILGVVRETPPDLILPNN  930
            + DS+LGVVRE PP+LILP+N
Sbjct  241  EYDSMLGVVREIPPELILPDN  261



>ref|XP_008810436.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Phoenix 
dactylifera]
Length=272

 Score =   440 bits (1131),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 212/271 (78%), Positives = 241/271 (89%), Gaps = 8/271 (3%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LGRA Y VGFWIRETGQA+DRLGCR QGNYYF EQLSRHR LMN+FDKVP+VH++AF
Sbjct  1    MGTLGRAIYAVGFWIRETGQAIDRLGCRFQGNYYFQEQLSRHRTLMNIFDKVPNVHKDAF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSAS++GDVQVG+ SSIWYGCVLRGDVNS+ IG+GTNIQDNSLVHVAKSN++G+VL T
Sbjct  61   VAPSASVMGDVQVGQGSSIWYGCVLRGDVNSIRIGSGTNIQDNSLVHVAKSNVSGRVLRT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            IIG+NVTVGHSAVLHGCTVEDEAFVG+GATLLDGVVVEK+ M+AAGALVRQNT+IP  EV
Sbjct  121  IIGDNVTVGHSAVLHGCTVEDEAFVGIGATLLDGVVVEKHGMVAAGALVRQNTKIPGREV  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KDE  867
            WGGNPAKFLRKLTEEEIAFISQSA NYSNL Q HAAENAK  D+ EF+KVL KK   +DE
Sbjct  181  WGGNPAKFLRKLTEEEIAFISQSATNYSNLAQVHAAENAKPFDDIEFKKVLHKKFARRDE  240

Query  868  DNDSILGVVRETPPDLILPNN-----APKAS  945
            + DS+LGV+ E PP+LILP++     +PK S
Sbjct  241  EYDSMLGVIHEVPPELILPDDVMPDKSPKPS  271



>ref|XP_006305516.1| hypothetical protein CARUB_v10009987mg [Capsella rubella]
 gb|EOA38414.1| hypothetical protein CARUB_v10009987mg [Capsella rubella]
Length=275

 Score =   439 bits (1130),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 209/261 (80%), Positives = 235/261 (90%), Gaps = 3/261 (1%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LGRAFY+VGFWIRETGQALDRLGCRLQG  YF EQLSRHR LMN+FDK P V + AF
Sbjct  1    MGTLGRAFYSVGFWIRETGQALDRLGCRLQGKNYFREQLSRHRTLMNVFDKAPIVDKTAF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSAS+IGDVQ+GR SSIWYGCVLRGD N+VS+G+GTNIQDNSLVHVAKSNL+GKV PT
Sbjct  61   VAPSASVIGDVQIGRGSSIWYGCVLRGDANTVSVGSGTNIQDNSLVHVAKSNLSGKVHPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            IIG+NVT+GHSAVLHGCTVE++ F+GMGATLLDGVVVE++ M+AAGALVRQNTRIP GEV
Sbjct  121  IIGDNVTIGHSAVLHGCTVENQTFIGMGATLLDGVVVEEHGMVAAGALVRQNTRIPSGEV  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KDE  867
            WGGNPA+FLRKLT+EEIAFIS+SA NYSNL Q HAAENAK L+  EFEKVLRKK   KDE
Sbjct  181  WGGNPARFLRKLTDEEIAFISESATNYSNLAQAHAAENAKPLNAIEFEKVLRKKHAGKDE  240

Query  868  DNDSILGVVRETPPDLILPNN  930
            + DS+LG+VRETP +L LPNN
Sbjct  241  EYDSMLGIVRETPSELNLPNN  261



>ref|XP_006644073.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Oryza 
brachyantha]
Length=263

 Score =   438 bits (1126),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 205/262 (78%), Positives = 234/262 (89%), Gaps = 3/262 (1%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            M  LG+AFY VGFWIRETGQALDRLGCRLQGNY+FHEQLSRHR LMN+FDK P VHR+AF
Sbjct  1    MAGLGKAFYAVGFWIRETGQALDRLGCRLQGNYFFHEQLSRHRTLMNIFDKTPHVHRDAF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSAS+IGDVQVG+ +SIWYGCVLRGD N+V IG+GTNIQDNSLVHVAKSNL+GKV PT
Sbjct  61   VAPSASLIGDVQVGQGASIWYGCVLRGDANNVQIGSGTNIQDNSLVHVAKSNLSGKVFPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            IIG+NVTVGHSAVL GCTVEDEAFVGMGATLLDGVVVEK+ M+AAG+LVRQNTRIPCGEV
Sbjct  121  IIGDNVTVGHSAVLQGCTVEDEAFVGMGATLLDGVVVEKHGMVAAGSLVRQNTRIPCGEV  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KDE  867
            WGGNPAKFLRKLT+ EIAFI +SA NYS+L + HAAENAK +++ EFEK+LRKK   +DE
Sbjct  181  WGGNPAKFLRKLTDSEIAFIKESASNYSSLAKAHAAENAKPVEKIEFEKLLRKKSAHQDE  240

Query  868  DNDSILGVVRETPPDLILPNNA  933
            ++DS++G  RE PP+L  P+ A
Sbjct  241  EHDSVIGATREVPPELAPPSPA  262



>ref|XP_010523601.1| PREDICTED: gamma carbonic anhydrase 2, mitochondrial-like [Tarenaya 
hassleriana]
Length=276

 Score =   437 bits (1125),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 208/261 (80%), Positives = 234/261 (90%), Gaps = 3/261 (1%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LGRA YTVGFWIRETGQALDRLG RLQG++Y  EQLSRHR LMN+FDK P V ++AF
Sbjct  1    MGTLGRAIYTVGFWIRETGQALDRLGYRLQGSHYLQEQLSRHRTLMNVFDKAPLVDKDAF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSAS+IGDVQ  R SSIWYGCVLRGDVN +S+G+ TNIQDN+LVHVAKSN++GKVLPT
Sbjct  61   VAPSASVIGDVQXXRASSIWYGCVLRGDVNGISVGSRTNIQDNALVHVAKSNISGKVLPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            IIG+NVTVGHSAV+HGCT+EDEAFVGMGATLLDGVVVEK+AM+AAGALVRQNTRIP  EV
Sbjct  121  IIGDNVTVGHSAVIHGCTIEDEAFVGMGATLLDGVVVEKHAMVAAGALVRQNTRIPSREV  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KDE  867
            WGGNPAKFLRKLT+EEIAFISQSA NY+NL Q HAAENAKS +E EFEK LRKK   KDE
Sbjct  181  WGGNPAKFLRKLTDEEIAFISQSATNYTNLAQVHAAENAKSFEEIEFEKALRKKYANKDE  240

Query  868  DNDSILGVVRETPPDLILPNN  930
            + D+++GVVRE PP LILP+N
Sbjct  241  EYDAMIGVVREVPPQLILPDN  261



>gb|KFK44104.1| hypothetical protein AALP_AA1G216400 [Arabis alpina]
Length=275

 Score =   437 bits (1125),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 206/261 (79%), Positives = 234/261 (90%), Gaps = 3/261 (1%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LGRAFY+VGFWIRETGQALDRLGCRLQG   F EQLSRHR LMN+FDK P VH+EAF
Sbjct  1    MGTLGRAFYSVGFWIRETGQALDRLGCRLQGKNCFREQLSRHRTLMNVFDKSPIVHKEAF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSAS+IGDVQ+GR SSIWYGCVLRGDVN+V++G+GTNIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   VAPSASVIGDVQIGRGSSIWYGCVLRGDVNTVTVGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            IIG+NVT+GHSAVLHGCTVEDE  +GMGATLLDGVVVEK++++AAGALVRQNTRIP GE+
Sbjct  121  IIGDNVTIGHSAVLHGCTVEDETLIGMGATLLDGVVVEKHSIVAAGALVRQNTRIPAGEI  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KDE  867
            WGGNPA+FLRKL E+E  F S SA+ YSN+ Q HAAENAK L+  EFEKVLRKK   KDE
Sbjct  181  WGGNPARFLRKLKEKEFDFFSTSAITYSNIAQAHAAENAKPLNAIEFEKVLRKKYGRKDE  240

Query  868  DNDSILGVVRETPPDLILPNN  930
            + DS+LG+VRETPP+L LPNN
Sbjct  241  EYDSMLGIVRETPPELKLPNN  261



>ref|XP_002890347.1| F18O14.34 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66606.1| F18O14.34 [Arabidopsis lyrata subsp. lyrata]
Length=299

 Score =   437 bits (1125),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 214/285 (75%), Positives = 238/285 (84%), Gaps = 27/285 (9%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQ----------------------  270
            MG++GRAFY+VGFWIRETGQALDRLGCRLQG  YF EQ                      
Sbjct  1    MGTVGRAFYSVGFWIRETGQALDRLGCRLQGKNYFREQRKLLRNSSFHSDFEFVVSTAFT  60

Query  271  --LSRHRVLMNLFDKVPSVHREAFVAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGT  444
              +SRHR LMN+FDK P V +EAFVAPSAS+IGDVQ+GR SSIWYGCVLRGDVN+VS+G+
Sbjct  61   QLISRHRTLMNVFDKAPIVDKEAFVAPSASVIGDVQIGRGSSIWYGCVLRGDVNTVSVGS  120

Query  445  GTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVV  624
            GTNIQDNSLVHVAKSNL+GKV PTIIG+NVT+GHSAVLHGCTVEDE F+GMGATLLDGVV
Sbjct  121  GTNIQDNSLVHVAKSNLSGKVHPTIIGDNVTIGHSAVLHGCTVEDETFIGMGATLLDGVV  180

Query  625  VEKNAMIAAGALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAA  804
            VEK+ M+AAGALVRQNTRIP GEVWGGNPA+FLRKLT+EEIAFISQSA NYSNL Q HAA
Sbjct  181  VEKHGMVAAGALVRQNTRIPSGEVWGGNPARFLRKLTDEEIAFISQSATNYSNLAQAHAA  240

Query  805  ENAKSLDENEFEKVLRKK---KDEDNDSILGVVRETPPDLILPNN  930
            ENAK L+  EFEKVLRKK   KDE+ DS+LG+VRETPP+L LPNN
Sbjct  241  ENAKPLNAIEFEKVLRKKHAQKDEEYDSMLGIVRETPPELNLPNN  285



>ref|XP_003612060.1| Transcription factor APFI-like protein [Medicago truncatula]
 gb|AES95018.1| gamma carbonic anhydrase-like protein [Medicago truncatula]
Length=270

 Score =   436 bits (1121),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 208/270 (77%), Positives = 238/270 (88%), Gaps = 7/270 (3%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LGRAFYTVGFWIRETGQA+DRLG RLQGNY+F EQLSRHR LMN++DKVP VH++AF
Sbjct  1    MGTLGRAFYTVGFWIRETGQAIDRLGSRLQGNYFFQEQLSRHRPLMNVYDKVPYVHKDAF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            +APSASI GDVQ+G  SSIWYGCVLRGDVN+++IG+ TNIQDNSLVHVAKSNL+G+VLPT
Sbjct  61   IAPSASITGDVQIGHASSIWYGCVLRGDVNNITIGSSTNIQDNSLVHVAKSNLSGRVLPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            IIG+NVTVGHSAVL GCTVEDEAF+GMGATLLDGV VEK+AM+AAGALVRQNTRIPCGEV
Sbjct  121  IIGDNVTVGHSAVLQGCTVEDEAFIGMGATLLDGVHVEKHAMVAAGALVRQNTRIPCGEV  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK--KDED  870
            WGGNPA+FLRKLTE+E+ F SQSALNYSNL Q HAAENAK LDE EF KVL KK  + ++
Sbjct  181  WGGNPARFLRKLTEDEMTFFSQSALNYSNLAQAHAAENAKKLDETEFVKVLGKKFVRPDE  240

Query  871  NDSILGVVRETPPDLILPNN-----APKAS  945
             DS+L  V +TPP++  P+N     APKAS
Sbjct  241  VDSVLNAVGDTPPEITPPDNAALDKAPKAS  270



>ref|NP_001241093.1| uncharacterized protein LOC100805278 [Glycine max]
 gb|ACU23511.1| unknown [Glycine max]
 gb|KHN22241.1| Hypothetical protein glysoja_021997 [Glycine soja]
Length=273

 Score =   436 bits (1120),  Expect = 6e-148, Method: Compositional matrix adjust.
 Identities = 210/261 (80%), Positives = 231/261 (89%), Gaps = 3/261 (1%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LGRA Y+VG WIR TGQA+DRLG  LQG YY  EQLSRHR LM++FDK P V  + F
Sbjct  1    MGTLGRAIYSVGNWIRGTGQAIDRLGSLLQGGYYVQEQLSRHRTLMDIFDKAPVVDEDVF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSAS+IGDVQ+GR SSIWYG VLRGDVNS+ +GTGTNIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   VAPSASVIGDVQLGRGSSIWYGVVLRGDVNSIRVGTGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            IIGNNVTVGHSAV+HGCTVEDEAFVGMGA LLDGVVVEKNAM+AAGALVRQNTRIP GEV
Sbjct  121  IIGNNVTVGHSAVIHGCTVEDEAFVGMGAILLDGVVVEKNAMVAAGALVRQNTRIPSGEV  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KDE  867
            W GNPAKFLRKLT+EEIAFISQSA NY+NL Q HA+EN+KS DE EFEKVLRKK   KDE
Sbjct  181  WAGNPAKFLRKLTDEEIAFISQSATNYTNLAQVHASENSKSYDEIEFEKVLRKKYARKDE  240

Query  868  DNDSILGVVRETPPDLILPNN  930
            + DS+LGVVRE PP+LILP+N
Sbjct  241  EYDSMLGVVREIPPELILPDN  261



>ref|NP_001042763.1| Os01g0283100 [Oryza sativa Japonica Group]
 dbj|BAD82610.1| putative gamma-carbonic anhydrase [Oryza sativa Japonica Group]
 dbj|BAF04677.1| Os01g0283100 [Oryza sativa Japonica Group]
 dbj|BAG96503.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87611.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG92644.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00769.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE54348.1| hypothetical protein OsJ_01333 [Oryza sativa Japonica Group]
Length=263

 Score =   434 bits (1115),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 202/262 (77%), Positives = 231/262 (88%), Gaps = 3/262 (1%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            M  LG+AFY VGFWIRETGQALDRLGCRLQGNYYFHEQLSRHR LMN+FDK P VHR+AF
Sbjct  1    MAGLGKAFYAVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRTLMNIFDKTPHVHRDAF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSAS+IGD+QVG+ +SIWYGCVLRGD N+V IG+GTNIQDNSLVHVAKSNL+GKV PT
Sbjct  61   VAPSASLIGDIQVGQGASIWYGCVLRGDANNVQIGSGTNIQDNSLVHVAKSNLSGKVFPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            IIG+NVTVGHSAVL GCTVEDEAFVGMGATLLDGVVVEK+ M+AAGALVRQNTRIPCGEV
Sbjct  121  IIGDNVTVGHSAVLQGCTVEDEAFVGMGATLLDGVVVEKHGMVAAGALVRQNTRIPCGEV  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KDE  867
            WGGNPAKFLRKLT++EI FI +SA NYS L + HAAENAK +++ EFEK+ RKK   +DE
Sbjct  181  WGGNPAKFLRKLTDDEITFIKESASNYSTLAKAHAAENAKPVEKTEFEKLFRKKSAHQDE  240

Query  868  DNDSILGVVRETPPDLILPNNA  933
            ++DS++G  RE  P+L   ++A
Sbjct  241  EHDSMIGATREVTPELTPSSSA  262



>gb|AAF79435.1|AC025808_17 F18O14.34 [Arabidopsis thaliana]
Length=298

 Score =   435 bits (1118),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 214/284 (75%), Positives = 237/284 (83%), Gaps = 26/284 (9%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQ----------------------  270
            MG+LGRAFY+VGFWIRETGQALDRLGCRLQG  YF EQ                      
Sbjct  1    MGTLGRAFYSVGFWIRETGQALDRLGCRLQGKNYFREQRKILRNSIFHSDFEFVKSEEFR  60

Query  271  -LSRHRVLMNLFDKVPSVHREAFVAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTG  447
             +SRHR LMN+FDK P V +EAFVAPSAS+IGDV +GR SSIWYGCVLRGDVN+VS+G+G
Sbjct  61   LVSRHRTLMNVFDKAPIVDKEAFVAPSASVIGDVHIGRGSSIWYGCVLRGDVNTVSVGSG  120

Query  448  TNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVV  627
            TNIQDNSLVHVAKSNL+GKV PTIIG+NVT+GHSAVLHGCTVEDE F+GMGATLLDGVVV
Sbjct  121  TNIQDNSLVHVAKSNLSGKVHPTIIGDNVTIGHSAVLHGCTVEDETFIGMGATLLDGVVV  180

Query  628  EKNAMIAAGALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAE  807
            EK+ M+AAGALVRQNTRIP GEVWGGNPA+FLRKLT+EEIAFISQSA NYSNL Q HAAE
Sbjct  181  EKHGMVAAGALVRQNTRIPSGEVWGGNPARFLRKLTDEEIAFISQSATNYSNLAQAHAAE  240

Query  808  NAKSLDENEFEKVLRKK---KDEDNDSILGVVRETPPDLILPNN  930
            NAK L+  EFEKVLRKK   KDE+ DS+LG+VRETPP+L LPNN
Sbjct  241  NAKPLNVIEFEKVLRKKHALKDEEYDSMLGIVRETPPELNLPNN  284



>ref|XP_009110271.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial [Brassica 
rapa]
Length=269

 Score =   433 bits (1114),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 207/260 (80%), Positives = 233/260 (90%), Gaps = 3/260 (1%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LGRAFY+VGFWIRETGQALDRLGCRLQG   F EQLSRHR LMN+FDK P V +EAF
Sbjct  1    MGTLGRAFYSVGFWIRETGQALDRLGCRLQGKNCFREQLSRHRTLMNVFDKAPIVDKEAF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSAS+IG+VQ+GR SSIWYGCVLRGDVN+VS+G+GTNIQDNSLVHVAKSNL+GKV PT
Sbjct  61   VAPSASVIGNVQIGRGSSIWYGCVLRGDVNTVSVGSGTNIQDNSLVHVAKSNLSGKVPPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            IIG+NVT+GHSAVLHGCTVEDEAF+GMGATLLDGVVVEK+A++AAGALVRQNTRIP GE+
Sbjct  121  IIGDNVTIGHSAVLHGCTVEDEAFIGMGATLLDGVVVEKHALVAAGALVRQNTRIPSGEI  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KDE  867
            WGGNPAKFLRKL  +EI FI  SA NYSNL + HAAENAK L+  EFEKVLRK+   KDE
Sbjct  181  WGGNPAKFLRKLKSKEIDFIPVSAENYSNLAKAHAAENAKPLNAIEFEKVLRKRYAAKDE  240

Query  868  DNDSILGVVRETPPDLILPN  927
            + DS+LG+VRETPP+L LPN
Sbjct  241  EYDSMLGIVRETPPELKLPN  260



>emb|CDM82924.1| unnamed protein product [Triticum aestivum]
Length=262

 Score =   433 bits (1113),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 201/260 (77%), Positives = 232/260 (89%), Gaps = 3/260 (1%)
 Frame = +1

Query  166  LGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAP  345
            + +AFY VGFWIRETGQALDRLGCRLQGNY+FHEQ+SRHR LMN+FDK P VH+EAFVAP
Sbjct  1    MAKAFYAVGFWIRETGQALDRLGCRLQGNYFFHEQISRHRTLMNIFDKAPHVHKEAFVAP  60

Query  346  SASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIG  525
            SAS+IGDV+VG+ SSIWYGC+LRGD N+V +G+GTNIQDNS+VHVAKSNL+GKV PTIIG
Sbjct  61   SASLIGDVEVGQGSSIWYGCILRGDANNVQVGSGTNIQDNSVVHVAKSNLSGKVFPTIIG  120

Query  526  NNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEVWGG  705
            +NVTVGHSAVL GCTVEDEAFVGMGATLLDGVVVEK+ M+AAGALVRQNTRIPCGEVWGG
Sbjct  121  DNVTVGHSAVLQGCTVEDEAFVGMGATLLDGVVVEKHGMVAAGALVRQNTRIPCGEVWGG  180

Query  706  NPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KDEDND  876
            NPAKFLRKLT+EEIAFI++SA NYSNL + HA ENAK L++ +FEKVLRKK   +D ++D
Sbjct  181  NPAKFLRKLTDEEIAFIAESAANYSNLAKAHAVENAKPLEKIDFEKVLRKKFAHQDNEHD  240

Query  877  SILGVVRETPPDLILPNNAP  936
            S+L V RE PP+L  P+  P
Sbjct  241  SMLSVTREVPPELAPPSPTP  260



>ref|XP_003567426.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Brachypodium 
distachyon]
Length=260

 Score =   433 bits (1113),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 205/259 (79%), Positives = 231/259 (89%), Gaps = 3/259 (1%)
 Frame = +1

Query  166  LGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAP  345
            + +AFY VGFWIRETGQALDRLG RLQGNY+FHEQ+SRHR LMN+FDK P VHREAFVAP
Sbjct  1    MAKAFYAVGFWIRETGQALDRLGSRLQGNYFFHEQISRHRTLMNIFDKAPYVHREAFVAP  60

Query  346  SASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIG  525
            SAS+IGDVQVG+ SSIWYGCVLRGD N+V IG+GTNIQDNS+VHVAKSNL+GKV PTIIG
Sbjct  61   SASLIGDVQVGQGSSIWYGCVLRGDANNVQIGSGTNIQDNSVVHVAKSNLSGKVFPTIIG  120

Query  526  NNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEVWGG  705
            +NVTVGHSAVL GCTVEDEAFVGMGATLLDGVVVEK+ M+AAGALVRQNTRIPCGEVWGG
Sbjct  121  DNVTVGHSAVLQGCTVEDEAFVGMGATLLDGVVVEKHGMVAAGALVRQNTRIPCGEVWGG  180

Query  706  NPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRK---KKDEDND  876
            NPAKFLRKLT+EEIAFI++SA NYSNL + HA ENAK L++ EFEKVLRK   ++DE+ D
Sbjct  181  NPAKFLRKLTDEEIAFIAESAANYSNLAKAHAVENAKPLEKIEFEKVLRKRFARQDEEYD  240

Query  877  SILGVVRETPPDLILPNNA  933
            S+LGV RE  P+L  P+ A
Sbjct  241  SMLGVTREAHPELTPPSPA  259



>ref|XP_002455477.1| hypothetical protein SORBIDRAFT_03g011540 [Sorghum bicolor]
 gb|EES00597.1| hypothetical protein SORBIDRAFT_03g011540 [Sorghum bicolor]
Length=263

 Score =   433 bits (1113),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 204/262 (78%), Positives = 231/262 (88%), Gaps = 3/262 (1%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            M  LG+A Y VGFWIRETGQALDRLGCRLQG Y+FHEQ+SRHR +MN+FDK P VH++AF
Sbjct  1    MAGLGKAMYAVGFWIRETGQALDRLGCRLQGKYFFHEQISRHRTIMNIFDKTPHVHKDAF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSAS+IGDVQVG  +SIWYGCVLRGD N++ IG+GTNIQDNSLVHVAKSNL+GKV PT
Sbjct  61   VAPSASLIGDVQVGPGASIWYGCVLRGDANNIQIGSGTNIQDNSLVHVAKSNLSGKVFPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            IIGNNVTVGHSAVL GCTVEDEAFVGMGATLLDGVVVEK+ M+AAGALVRQNTRIPCGEV
Sbjct  121  IIGNNVTVGHSAVLQGCTVEDEAFVGMGATLLDGVVVEKHGMVAAGALVRQNTRIPCGEV  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KDE  867
            WGGNPAKFLRKLT++EIAFI++SA NYS+L + HA ENAK L++ EFEKVLRKK   +DE
Sbjct  181  WGGNPAKFLRKLTDDEIAFIAESAANYSSLSKVHAIENAKPLEKIEFEKVLRKKFAHQDE  240

Query  868  DNDSILGVVRETPPDLILPNNA  933
            + DS +GV RE PP+L  PN A
Sbjct  241  EYDSSIGVTREAPPELTSPNPA  262



>emb|CDX96658.1| BnaA08g22010D [Brassica napus]
Length=269

 Score =   433 bits (1113),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 207/260 (80%), Positives = 233/260 (90%), Gaps = 3/260 (1%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LGRAFY+VGFWIRETGQALDRLGCRLQG   F EQLSRHR LMN+FDK P V +EAF
Sbjct  1    MGTLGRAFYSVGFWIRETGQALDRLGCRLQGKNCFREQLSRHRTLMNVFDKAPIVDKEAF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSAS+IG+VQ+GR SSIWYGCVLRGDVN+VS+G+GTNIQDNSLVHVAKSNL+GKV PT
Sbjct  61   VAPSASVIGNVQIGRGSSIWYGCVLRGDVNTVSVGSGTNIQDNSLVHVAKSNLSGKVPPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            IIG+NVT+GHSAVLHGCTVEDEAF+GMGATLLDGVVVEK+A++AAGALVRQNTRIP GE+
Sbjct  121  IIGDNVTIGHSAVLHGCTVEDEAFIGMGATLLDGVVVEKHALVAAGALVRQNTRIPSGEI  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KDE  867
            WGGNPAKFLRKL  +EI FI  SA NYSNL + HAAENAK L+  EFEKVLRK+   KDE
Sbjct  181  WGGNPAKFLRKLKSKEIDFIPVSAENYSNLAKAHAAENAKPLNAIEFEKVLRKRYAAKDE  240

Query  868  DNDSILGVVRETPPDLILPN  927
            + DS+LG+VRETPP+L LPN
Sbjct  241  EYDSMLGIVRETPPELKLPN  260



>gb|EEC70424.1| hypothetical protein OsI_01428 [Oryza sativa Indica Group]
Length=263

 Score =   432 bits (1111),  Expect = 9e-147, Method: Compositional matrix adjust.
 Identities = 201/262 (77%), Positives = 230/262 (88%), Gaps = 3/262 (1%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            M  LG+AFY VGFWIRETGQALDRLGCRLQGNYYFHEQLSRHR LMN+FDK P VHR+AF
Sbjct  1    MAGLGKAFYAVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRTLMNIFDKTPHVHRDAF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSAS+IGD+QVG+ +SIWYGCVLRGD N+V IG+GTNIQDNSLVHVAKSNL+GKV PT
Sbjct  61   VAPSASLIGDIQVGQGASIWYGCVLRGDANNVQIGSGTNIQDNSLVHVAKSNLSGKVFPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            IIG+NVTVGHSAVL GCTVEDEAFVGMGATLLDGVVVEK+ M+AAGALVRQNTRIPCGEV
Sbjct  121  IIGDNVTVGHSAVLQGCTVEDEAFVGMGATLLDGVVVEKHGMVAAGALVRQNTRIPCGEV  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KDE  867
            WGGNPAKFLRKLT++EI FI +SA NYS L + HA ENAK +++ EFEK+ RKK   +DE
Sbjct  181  WGGNPAKFLRKLTDDEITFIKESASNYSTLAKAHATENAKPVEKTEFEKLFRKKSAHQDE  240

Query  868  DNDSILGVVRETPPDLILPNNA  933
            ++DS++G  RE  P+L   ++A
Sbjct  241  EHDSMIGATREVTPELTPSSSA  262



>ref|XP_003517218.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Glycine 
max]
Length=270

 Score =   432 bits (1110),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 211/270 (78%), Positives = 234/270 (87%), Gaps = 8/270 (3%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LGR FY VGFWIRETGQA+DRLG RLQGNY F EQLSRHR LMNLFDK PSVHR+AF
Sbjct  1    MGTLGRVFYAVGFWIRETGQAIDRLGSRLQGNYLFQEQLSRHRPLMNLFDKAPSVHRDAF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSAS++GDV VG  SSIWYGCVLRGDVNS++IG+GTNIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   VAPSASLLGDVHVGPASSIWYGCVLRGDVNSITIGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            IIG+NVTVGHSAVL GCTVEDEAF+GMGATLLDGV VEK+AM+AAGALVRQNTRIP GEV
Sbjct  121  IIGDNVTVGHSAVLQGCTVEDEAFIGMGATLLDGVYVEKHAMVAAGALVRQNTRIPYGEV  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KDE  867
            WGGNPA+FLRKLTE+E+ F SQSALNYSNL Q HAAENAK LDE EF KVL KK   + E
Sbjct  181  WGGNPARFLRKLTEDEMTFFSQSALNYSNLAQAHAAENAKGLDETEFVKVLYKKFARRGE  240

Query  868  DNDSILGVVRETPPDLILPNN-----APKA  942
            +  S+LG V+ETP +L +P+N      PKA
Sbjct  241  EYHSVLGGVQETPAELNVPDNVLLDKVPKA  270



>emb|CDX83758.1| BnaC08g18870D [Brassica napus]
Length=269

 Score =   432 bits (1110),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 207/261 (79%), Positives = 233/261 (89%), Gaps = 3/261 (1%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LGRAFY+VGFWIRETGQALDRLGCRLQG   F EQLSRHR LMN+FDK P V +EAF
Sbjct  1    MGTLGRAFYSVGFWIRETGQALDRLGCRLQGKNCFREQLSRHRTLMNVFDKAPIVDKEAF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSAS+IG+VQ+GR SSIWYGCVLRGDVN+VS+G+GTNIQDNSLVHVAKSNL+GKV  T
Sbjct  61   VAPSASVIGNVQIGRGSSIWYGCVLRGDVNTVSVGSGTNIQDNSLVHVAKSNLSGKVPAT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            IIG+NVT+GHSAVLHGCTVEDEAF+GMGATLLDGVVVEK+A++AAGALVRQNTRIP GE+
Sbjct  121  IIGDNVTIGHSAVLHGCTVEDEAFIGMGATLLDGVVVEKHALVAAGALVRQNTRIPSGEI  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KDE  867
            WGGNPAKFLRKL  +EI FI  SA NYSNL + HAAENAK L+  EFEKVLRK+   KDE
Sbjct  181  WGGNPAKFLRKLKSKEIDFIPVSAENYSNLAKAHAAENAKPLNAIEFEKVLRKRYAAKDE  240

Query  868  DNDSILGVVRETPPDLILPNN  930
            + DS+LG+VRETPP+L LPNN
Sbjct  241  EYDSMLGIVRETPPELKLPNN  261



>ref|XP_008655471.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Zea 
mays]
 gb|AFW79496.1| hypothetical protein ZEAMMB73_562884 [Zea mays]
Length=263

 Score =   431 bits (1108),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 202/262 (77%), Positives = 232/262 (89%), Gaps = 3/262 (1%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            M  LG+A Y VGFWIRETGQALDRLGCRLQG Y+FHEQ+SRHR +MN+FDK P VHR+AF
Sbjct  1    MAGLGKAMYAVGFWIRETGQALDRLGCRLQGKYFFHEQISRHRTIMNIFDKTPHVHRDAF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSAS+IGDVQVG+ +SIWYGCVLRGD N++ IG+GTNIQDNSLVHVAKSNL+GKV PT
Sbjct  61   VAPSASLIGDVQVGQGASIWYGCVLRGDANNIQIGSGTNIQDNSLVHVAKSNLSGKVFPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            IIGNNVT+GHSAVL GCTVEDEAFVGMGATLLDGVVV K+ M+AAG+LVRQNTRIPCGEV
Sbjct  121  IIGNNVTIGHSAVLQGCTVEDEAFVGMGATLLDGVVVGKHGMVAAGSLVRQNTRIPCGEV  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KDE  867
            WGGNPAKFLRKLT++EIAFI++SA NYSNL + HAAENAK L++ EFEKVLRKK   +DE
Sbjct  181  WGGNPAKFLRKLTDDEIAFITESASNYSNLSKVHAAENAKPLEKIEFEKVLRKKFAHQDE  240

Query  868  DNDSILGVVRETPPDLILPNNA  933
            + DS +G+ R +PP+L  PN A
Sbjct  241  EYDSSIGITRGSPPELTSPNPA  262



>ref|XP_011083663.1| PREDICTED: gamma carbonic anhydrase 2, mitochondrial [Sesamum 
indicum]
Length=272

 Score =   430 bits (1105),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 204/261 (78%), Positives = 234/261 (90%), Gaps = 3/261 (1%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MGSLGRA YT+G WIR TGQA+DR+GCRLQG+YYF EQLSRHR LM+L DK P V ++AF
Sbjct  1    MGSLGRAIYTLGNWIRVTGQAVDRVGCRLQGSYYFQEQLSRHRTLMDLLDKSPVVDKDAF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            +AP AS+IGDVQVG+ SSIWYG VLRGDVNS+ +G+GTNIQDNSLVHVAKSNL GK LPT
Sbjct  61   IAPGASVIGDVQVGQGSSIWYGSVLRGDVNSIHVGSGTNIQDNSLVHVAKSNLGGKELPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            IIGNNVT+GHSAV+HGCT+EDEAFVGMGATLLDGVVVEK+AM+AAG+LVRQNTR+P GEV
Sbjct  121  IIGNNVTIGHSAVIHGCTIEDEAFVGMGATLLDGVVVEKHAMVAAGSLVRQNTRVPYGEV  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KDE  867
            W GNPAKFLRKLT+EEIAFISQSA NY NL + HAAENAKS +E EFEK+LRKK   +DE
Sbjct  181  WAGNPAKFLRKLTDEEIAFISQSATNYINLAKVHAAENAKSFEEIEFEKMLRKKFARRDE  240

Query  868  DNDSILGVVRETPPDLILPNN  930
            + DS++GVVRETPP+LILP+N
Sbjct  241  EYDSMIGVVRETPPELILPDN  261



>ref|XP_010459631.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial isoform 
X1 [Camelina sativa]
 ref|XP_010459632.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial isoform 
X2 [Camelina sativa]
Length=269

 Score =   429 bits (1104),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 208/264 (79%), Positives = 233/264 (88%), Gaps = 4/264 (2%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LGRAFY+VGFWIRETGQALDRLGCRLQG  YF EQLSRHR LMN+FDK P V + AF
Sbjct  1    MGTLGRAFYSVGFWIRETGQALDRLGCRLQGKNYFREQLSRHRTLMNVFDKAPIVDKGAF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSAS+IGDVQ+GR SSIWYGCVLRGD N+VS+G+GTNIQDNSLVHVAKSNL+GKV PT
Sbjct  61   VAPSASVIGDVQIGRGSSIWYGCVLRGDANTVSVGSGTNIQDNSLVHVAKSNLSGKVHPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            IIG+NVT+GHSAVLHGCTVE+E F+GMGATLLDGVVVEK+ M+AAGALVRQNTRIP GEV
Sbjct  121  IIGDNVTIGHSAVLHGCTVENETFIGMGATLLDGVVVEKHGMVAAGALVRQNTRIPSGEV  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KDE  867
            WGGNPA+FLRKLT+EEIAFI++SA NYSNL Q HAAENAK L+  EFEKVLRKK   KDE
Sbjct  181  WGGNPARFLRKLTDEEIAFIAESATNYSNLAQAHAAENAKPLNAIEFEKVLRKKHAQKDE  240

Query  868  DNDSILGVVRETPPDLILPNNAPK  939
            + DS+LG VRETP + I P+   K
Sbjct  241  EYDSMLGSVRETPNN-IQPDKETK  263



>gb|KHN36089.1| Hypothetical protein glysoja_003212 [Glycine soja]
Length=270

 Score =   429 bits (1103),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 210/270 (78%), Positives = 233/270 (86%), Gaps = 8/270 (3%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LGR FY VGFWIRETGQA+DRLG RLQGNY F EQLSRHR LMNLFDK PSVHR+AF
Sbjct  1    MGTLGRVFYAVGFWIRETGQAIDRLGSRLQGNYLFQEQLSRHRPLMNLFDKAPSVHRDAF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSAS++GDV VG  SSIWYGCVLRGDVNS++IG+GTNIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   VAPSASLLGDVHVGPASSIWYGCVLRGDVNSITIGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            IIG+NVTVGHSAVL GCTVEDEAF+GMGATLL GV VEK+AM+AAGALVRQNTRIP GEV
Sbjct  121  IIGDNVTVGHSAVLQGCTVEDEAFIGMGATLLGGVYVEKHAMVAAGALVRQNTRIPYGEV  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KDE  867
            WGGNPA+FLRKLTE+E+ F SQSALNYSNL Q HAAENAK LDE EF KVL KK   + E
Sbjct  181  WGGNPARFLRKLTEDEMTFFSQSALNYSNLAQAHAAENAKGLDETEFVKVLYKKFARRGE  240

Query  868  DNDSILGVVRETPPDLILPNN-----APKA  942
            +  S+LG V+ETP +L +P+N      PKA
Sbjct  241  EYHSVLGGVQETPAELNVPDNVLLDKVPKA  270



>ref|XP_003537599.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Glycine 
max]
 gb|KHN41952.1| Hypothetical protein glysoja_003692 [Glycine soja]
Length=270

 Score =   429 bits (1102),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 210/270 (78%), Positives = 232/270 (86%), Gaps = 8/270 (3%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LGRAFY VGFWIRETGQA+DRLG RLQGNY F EQLSRHR LMNLFDK PSVHR+AF
Sbjct  1    MGTLGRAFYAVGFWIRETGQAIDRLGSRLQGNYLFQEQLSRHRPLMNLFDKAPSVHRDAF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSAS++GDV VG  SSIWYGCVLRGDVNS++IG+GTNIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   VAPSASLLGDVHVGPASSIWYGCVLRGDVNSITIGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            IIG+NVTVGHSAVL GCTVEDEAF+GMGATLLDGV VEK+AM+AAGALVRQNTRIP GEV
Sbjct  121  IIGDNVTVGHSAVLQGCTVEDEAFIGMGATLLDGVYVEKHAMVAAGALVRQNTRIPYGEV  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKKKDEDND  876
            WGGNPA+FLRKLTE+E+ F SQSALNYSNL Q H+AENAK LDE EF KVL KK     D
Sbjct  181  WGGNPARFLRKLTEDEMTFFSQSALNYSNLAQAHSAENAKGLDETEFVKVLHKKFARHGD  240

Query  877  ---SILGVVRETPPDL-----ILPNNAPKA  942
               S+LG V+ETP +L     +L +  PKA
Sbjct  241  EYHSVLGGVQETPTELKSSDNVLLDKVPKA  270



>ref|XP_010477178.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Camelina 
sativa]
 ref|XP_010477179.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Camelina 
sativa]
Length=269

 Score =   428 bits (1101),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 207/264 (78%), Positives = 232/264 (88%), Gaps = 4/264 (2%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LGRAFY+VGFWIRETGQALDRLGCRLQG  YF EQLSRHR LMN+FDK P V + AF
Sbjct  1    MGTLGRAFYSVGFWIRETGQALDRLGCRLQGKNYFREQLSRHRTLMNVFDKAPIVDKGAF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSAS+IGDVQ+GR SSIWYGCVLRGD NSVS+G+GTNIQDNSL+HVAKSNL+GKV PT
Sbjct  61   VAPSASVIGDVQIGRGSSIWYGCVLRGDANSVSVGSGTNIQDNSLLHVAKSNLSGKVHPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            IIG+NVT+GHSAVLHGCTVE+E F+GMGATLLDGVVVEK+ M+AAGALVRQNTRIP GEV
Sbjct  121  IIGDNVTIGHSAVLHGCTVENETFIGMGATLLDGVVVEKHGMVAAGALVRQNTRIPSGEV  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KDE  867
            WGGNPA+FLRKLT+EEIAFI++SA NYSNL Q HAAENAK L+  EFEKVLRKK   KDE
Sbjct  181  WGGNPARFLRKLTDEEIAFIAESATNYSNLAQAHAAENAKPLNAIEFEKVLRKKHAQKDE  240

Query  868  DNDSILGVVRETPPDLILPNNAPK  939
            + DS+LG  RETP + I P+   K
Sbjct  241  EYDSMLGSARETPNN-IQPDKETK  263



>gb|ACU19296.1| unknown [Glycine max]
Length=270

 Score =   428 bits (1100),  Expect = 6e-145, Method: Compositional matrix adjust.
 Identities = 210/270 (78%), Positives = 232/270 (86%), Gaps = 8/270 (3%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LGRAFY VGFWIRETGQA+DRLG RLQGNY F EQLSRHR LMNLFDK PSVHR+AF
Sbjct  1    MGTLGRAFYAVGFWIRETGQAIDRLGSRLQGNYLFQEQLSRHRPLMNLFDKAPSVHRDAF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSAS++GDV VG  SSIWYGCVLRGDVNS++IG+GTNIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   VAPSASLLGDVHVGPASSIWYGCVLRGDVNSITIGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            IIG+NVTVGHSAVL GCTVEDEAF+GMGATLLDGV VEK+AM+AAGALVRQNTRIP GEV
Sbjct  121  IIGDNVTVGHSAVLQGCTVEDEAFIGMGATLLDGVYVEKHAMVAAGALVRQNTRIPYGEV  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKKKDEDND  876
            WGGNPA+FLRKLTE+E+ F SQSALNYSNL Q H+AENAK LDE EF KVL KK     D
Sbjct  181  WGGNPARFLRKLTEDEMTFFSQSALNYSNLAQAHSAENAKGLDETEFVKVLHKKFVRHGD  240

Query  877  ---SILGVVRETPPDL-----ILPNNAPKA  942
               S+LG V+ETP +L     +L +  PKA
Sbjct  241  EYHSVLGGVQETPTELKFSDNVLLDKVPKA  270



>gb|ACU23675.1| unknown [Glycine max]
Length=270

 Score =   427 bits (1099),  Expect = 8e-145, Method: Compositional matrix adjust.
 Identities = 209/270 (77%), Positives = 232/270 (86%), Gaps = 8/270 (3%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LGR FY VGFWIRETGQA+DRLG RLQGNY F EQLSRHR LMNLFDK PSVHR+AF
Sbjct  1    MGTLGRVFYAVGFWIRETGQAIDRLGSRLQGNYLFQEQLSRHRPLMNLFDKAPSVHRDAF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSAS++GDV VG  SSIWYGCVLRGDVNS++IG+GTNIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   VAPSASLLGDVHVGPASSIWYGCVLRGDVNSITIGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            IIG+NVTVGHSAVL GCTVEDEAF+GMG TLLDGV VEK+A +AAGALVRQNTRIP GEV
Sbjct  121  IIGDNVTVGHSAVLQGCTVEDEAFIGMGVTLLDGVYVEKHATVAAGALVRQNTRIPYGEV  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KDE  867
            WGGNPA+FLRKLTE+E+ F SQSALNYSNL Q HAAENAK LDE EF KVL KK   + E
Sbjct  181  WGGNPARFLRKLTEDEMTFFSQSALNYSNLAQAHAAENAKGLDETEFLKVLYKKFARRGE  240

Query  868  DNDSILGVVRETPPDLILPNN-----APKA  942
            +  S+LG V+ETP +L +P+N      PKA
Sbjct  241  EYHSVLGGVQETPAELDVPDNVLLDKVPKA  270



>ref|XP_010498381.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Camelina 
sativa]
Length=269

 Score =   427 bits (1098),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 207/264 (78%), Positives = 232/264 (88%), Gaps = 4/264 (2%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LGRAFY+VGFWIRETGQALDRLGCRLQG  YF EQLSRHR LMN+FDK P V + AF
Sbjct  1    MGTLGRAFYSVGFWIRETGQALDRLGCRLQGKNYFREQLSRHRTLMNVFDKTPIVDKGAF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSAS+IGDVQ+GR SSIWYGCVLRGD N+VS+G+GTNIQDNSLVHVAKSNL+GKV PT
Sbjct  61   VAPSASVIGDVQIGRGSSIWYGCVLRGDANTVSVGSGTNIQDNSLVHVAKSNLSGKVHPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            IIG+NVT+GHSAVLHGCTVE+E F+GMGATLLDGVVVEK+ M+AAGALVRQNT IP GEV
Sbjct  121  IIGDNVTIGHSAVLHGCTVENETFIGMGATLLDGVVVEKHGMVAAGALVRQNTTIPSGEV  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KDE  867
            WGGNPA+FLRKLT+EEIAFI++SA NYSNL Q HAAENAK L+  EFEKVLRKK   KDE
Sbjct  181  WGGNPARFLRKLTDEEIAFIAESATNYSNLAQAHAAENAKPLNAIEFEKVLRKKHAQKDE  240

Query  868  DNDSILGVVRETPPDLILPNNAPK  939
            + DS+LG VRETP + I P+   K
Sbjct  241  EYDSMLGSVRETPNN-IQPDKETK  263



>ref|XP_004512067.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Cicer 
arietinum]
Length=269

 Score =   427 bits (1098),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 205/269 (76%), Positives = 235/269 (87%), Gaps = 7/269 (3%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LG+AFYTVGFWIRETGQA+DRLG RLQGNY+F EQLSRHR LMN+F+K P VH++AF
Sbjct  1    MGTLGKAFYTVGFWIRETGQAIDRLGSRLQGNYFFQEQLSRHRPLMNVFNKTPYVHKDAF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            +APSASI GDVQ+G+ SSIWYGCVLRGDVNS++IG+ TNIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   IAPSASITGDVQIGQSSSIWYGCVLRGDVNSITIGSSTNIQDNSLVHVAKSNLSGKVLPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            IIG+NVTVGHSAVL GCTVEDEAF+GMGATLLDGV VEK+AM+AAGALVRQNTRIPCGEV
Sbjct  121  IIGDNVTVGHSAVLQGCTVEDEAFIGMGATLLDGVYVEKHAMVAAGALVRQNTRIPCGEV  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK--KDED  870
            WGGNPA+FLRKL+E+E+ F SQSALNYSNL Q HAAENAK LDE EF KVL KK  + ++
Sbjct  181  WGGNPARFLRKLSEDEMTFFSQSALNYSNLAQAHAAENAKKLDETEFVKVLGKKSVRLDE  240

Query  871  NDSILGVVRETPPDLILPNN-----APKA  942
            +  I G V ETP ++ LP+N      PKA
Sbjct  241  HGLIQGDVHETPQEINLPDNVVLDKVPKA  269



>gb|EYU31197.1| hypothetical protein MIMGU_mgv1a012119mg [Erythranthe guttata]
Length=261

 Score =   426 bits (1095),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 207/262 (79%), Positives = 229/262 (87%), Gaps = 5/262 (2%)
 Frame = +1

Query  166  LGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAP  345
            LGR+  TVGFWIRETGQALDRLGCRLQGNY+F EQLSRHR LMNLFDK P V ++ FVAP
Sbjct  3    LGRSICTVGFWIRETGQALDRLGCRLQGNYFFQEQLSRHRTLMNLFDKAPFVQKDVFVAP  62

Query  346  SASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIG  525
            SASIIGDV VG +SSIWYGCV+RGDVN VSIG+GTNIQDNSLVHVAKSNL GKVLPT+IG
Sbjct  63   SASIIGDVHVGSNSSIWYGCVVRGDVNKVSIGSGTNIQDNSLVHVAKSNLYGKVLPTLIG  122

Query  526  NNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEVWGG  705
            +NVTVGHSA+LHGCTVEDEAFVGMGATLLDGVVVEK+AM+AAGALVRQNTRIP GE+WGG
Sbjct  123  DNVTVGHSAILHGCTVEDEAFVGMGATLLDGVVVEKHAMVAAGALVRQNTRIPSGEIWGG  182

Query  706  NPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK--KDEDNDS  879
            NPAKFLRKLT++EIAFI+QSA+NYS L Q HAAENAK L++ EFEKVL KK  +D + D 
Sbjct  183  NPAKFLRKLTDDEIAFIAQSAINYSKLAQAHAAENAKELEKIEFEKVLHKKLHQDAEYDL  242

Query  880  ILGVVRETPPDLILPNNAPKAS  945
             L VVRE  P+LI    AP AS
Sbjct  243  TLAVVREATPELI---KAPSAS  261



>ref|XP_004967660.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Setaria 
italica]
Length=263

 Score =   426 bits (1095),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 201/262 (77%), Positives = 228/262 (87%), Gaps = 3/262 (1%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            M  LG+A Y VGFWIRETGQALDRLGCRLQGNY+FHEQ+SRHR LMN+FDK P VHR+AF
Sbjct  1    MAGLGKAMYAVGFWIRETGQALDRLGCRLQGNYFFHEQISRHRTLMNIFDKTPHVHRDAF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSAS+IGDVQVG  +SIWYGCVLRGD N++ IG+GTNIQDNSLVHVAKSNL+GKV PT
Sbjct  61   VAPSASLIGDVQVGPGASIWYGCVLRGDANNIQIGSGTNIQDNSLVHVAKSNLSGKVFPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            IIG NVTVGHSAVL GCT+EDEAFVGMGATLLDGV+VEK+ M+AAGALVRQNTRIP GEV
Sbjct  121  IIGENVTVGHSAVLQGCTIEDEAFVGMGATLLDGVIVEKHGMVAAGALVRQNTRIPSGEV  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KDE  867
            WGGNPAKFLRKLT++EIAFI++SA NY +L + HAAENAK L++ EFEKVL KK   +DE
Sbjct  181  WGGNPAKFLRKLTDDEIAFIAESAANYFSLSKEHAAENAKPLEKVEFEKVLPKKFAHQDE  240

Query  868  DNDSILGVVRETPPDLILPNNA  933
            + DS +GV RE PP+L  P  A
Sbjct  241  EYDSTIGVTREAPPELTPPTPA  262



>ref|XP_007156970.1| hypothetical protein PHAVU_002G032600g [Phaseolus vulgaris]
 gb|ESW28964.1| hypothetical protein PHAVU_002G032600g [Phaseolus vulgaris]
Length=270

 Score =   424 bits (1091),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 210/270 (78%), Positives = 232/270 (86%), Gaps = 8/270 (3%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LGRAFY VGFWIRETGQA+DRLG RLQGNY F EQLSRHR LMNLFDK PSVH++AF
Sbjct  1    MGTLGRAFYAVGFWIRETGQAIDRLGSRLQGNYLFQEQLSRHRPLMNLFDKGPSVHKDAF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSAS++GDV VG  SSIWYGCVLRGDVN + IG+GTNIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   VAPSASLLGDVHVGPASSIWYGCVLRGDVNGIVIGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            IIG+NVTVGHSAVL GCTVEDEAF+GMGATLLDGV VEK+AM+AAGALVRQNTRIP GEV
Sbjct  121  IIGDNVTVGHSAVLQGCTVEDEAFIGMGATLLDGVYVEKHAMVAAGALVRQNTRIPYGEV  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KDE  867
            WGGNPA+FLRKLTE+E+ F SQSALNYSNL Q HA ENAK L+E EF KVL KK   + E
Sbjct  181  WGGNPARFLRKLTEDEMTFFSQSALNYSNLAQAHADENAKELEETEFVKVLHKKFAPRGE  240

Query  868  DNDSILGVVRETPPDLILPNN-----APKA  942
            + DSILG  +ETP +L L +N     APKA
Sbjct  241  EYDSILGGGQETPAELNLQDNVLLDKAPKA  270



>ref|XP_010679759.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Beta 
vulgaris subsp. vulgaris]
Length=255

 Score =   419 bits (1076),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 198/244 (81%), Positives = 221/244 (91%), Gaps = 3/244 (1%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LGRA YTVGFW+RE+GQALDRLGCRLQGNY+F EQLSRHR LMN+FDK P V +EAF
Sbjct  1    MGTLGRAVYTVGFWVRESGQALDRLGCRLQGNYFFQEQLSRHRTLMNVFDKKPMVDKEAF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSASIIGDV++G  SSIWYGC+LRGDVN +SIG+GTNIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   VAPSASIIGDVRIGHRSSIWYGCILRGDVNFISIGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            IIG+NVTVGHSAVLHGCTVEDEAF+G GATLLDGV+VEK+ M+AAG+LVRQNTRIPCGEV
Sbjct  121  IIGDNVTVGHSAVLHGCTVEDEAFIGTGATLLDGVLVEKHGMVAAGSLVRQNTRIPCGEV  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KDE  867
            W GNPAKFLR LTEEE+AFIS SA NYSNL Q HAAENAKS DE EF+KVLRK+   KDE
Sbjct  181  WAGNPAKFLRNLTEEEMAFISLSASNYSNLAQVHAAENAKSFDETEFQKVLRKRYTPKDE  240

Query  868  DNDS  879
            + +S
Sbjct  241  EYNS  244



>ref|XP_009612501.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Nicotiana 
tomentosiformis]
Length=273

 Score =   419 bits (1077),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 197/261 (75%), Positives = 231/261 (89%), Gaps = 3/261 (1%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LG+A Y++G  +R TGQALDR+G RLQG+ Y  E LSRHR LMN+FDK P V ++ F
Sbjct  1    MGTLGKAIYSLGAIVRATGQALDRIGNRLQGSSYLEEHLSRHRTLMNIFDKAPVVDKDVF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAP AS+IGDV VGR+SSIWYGCVLRGDVNS+S+G+GTNIQDNSLVHVAKSN++ KVLPT
Sbjct  61   VAPGASVIGDVHVGRNSSIWYGCVLRGDVNSISVGSGTNIQDNSLVHVAKSNISQKVLPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            IIGNNVTVGHSAV+HGCT+EDEAF+GMGATLLDGV VEK+AM+AAGALVRQNTRIP GEV
Sbjct  121  IIGNNVTVGHSAVVHGCTIEDEAFIGMGATLLDGVHVEKHAMVAAGALVRQNTRIPSGEV  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRK---KKDE  867
            W GNPAKFLRKLT+EEIAFI+QSA NY NL + HAAEN+KS DE EFEK+LRK   K+DE
Sbjct  181  WAGNPAKFLRKLTDEEIAFIAQSATNYCNLARVHAAENSKSFDEIEFEKMLRKKYAKRDE  240

Query  868  DNDSILGVVRETPPDLILPNN  930
            + DS++GVVRETPP+L+LP+N
Sbjct  241  EYDSMIGVVRETPPELVLPDN  261



>ref|XP_006393603.1| hypothetical protein EUTSA_v10011707mg [Eutrema salsugineum]
 gb|ESQ30889.1| hypothetical protein EUTSA_v10011707mg [Eutrema salsugineum]
Length=276

 Score =   419 bits (1076),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 199/261 (76%), Positives = 230/261 (88%), Gaps = 3/261 (1%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LGRA YTVG WIR TGQALDR+G RLQG+ YF E LSRHR LMN+FDK P V ++ F
Sbjct  1    MGTLGRAIYTVGNWIRGTGQALDRVGSRLQGSPYFQEHLSRHRTLMNVFDKSPLVDKDVF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSAS+IGDVQ+G+ SSIWYGCVLRGDVN++S+G+GTNIQDNSLVHVAK+NL+GKV PT
Sbjct  61   VAPSASVIGDVQIGKRSSIWYGCVLRGDVNNISVGSGTNIQDNSLVHVAKTNLSGKVQPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            IIG+NVTVGHSAV+HGCTVEDEAFVGMGATLLDGVVVEK+AM+AA ALV++NTRIP GEV
Sbjct  121  IIGDNVTVGHSAVIHGCTVEDEAFVGMGATLLDGVVVEKHAMVAAAALVKENTRIPSGEV  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KDE  867
            WGGNPAKF+RKLT+EEI +IS+SA NY NL   HAAEN+KS DE E E+ LRKK   KDE
Sbjct  181  WGGNPAKFMRKLTDEEIEYISKSAENYINLAHIHAAENSKSFDEIEVERALRKKYARKDE  240

Query  868  DNDSILGVVRETPPDLILPNN  930
            D DS+LG+VRETP +LILP+N
Sbjct  241  DYDSMLGIVRETPAELILPDN  261



>ref|XP_008672300.1| PREDICTED: uncharacterized protein LOC100217184 isoform X1 [Zea 
mays]
 gb|ACN28454.1| unknown [Zea mays]
 tpg|DAA54232.1| TPA: transcription factor APFI [Zea mays]
Length=262

 Score =   418 bits (1075),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 197/261 (75%), Positives = 225/261 (86%), Gaps = 2/261 (1%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            M  LG+A Y VGFWIRETGQALDRLGCRLQG Y+FHEQ+SRHR +MN+FDK P VH++AF
Sbjct  1    MAGLGKAMYAVGFWIRETGQALDRLGCRLQGKYFFHEQISRHRTIMNIFDKTPHVHKDAF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSAS+IGDVQVG  +SIWYGCVLRGD N + IG+GTNIQDNSL+HVAKSNL+GKV PT
Sbjct  61   VAPSASLIGDVQVGSGASIWYGCVLRGDANIIQIGSGTNIQDNSLIHVAKSNLSGKVFPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
             IGNNVTVGHSAVL GCTVEDEAFVG+GATLLDGVVVEK+ M+AAGALVRQNTRIPCGEV
Sbjct  121  TIGNNVTVGHSAVLQGCTVEDEAFVGIGATLLDGVVVEKHGMVAAGALVRQNTRIPCGEV  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK--KDED  870
            WGGNPAKFLRKLT++EI+FI++SA NYSNL + HAAENAK L++ EFEKVL KK    ++
Sbjct  181  WGGNPAKFLRKLTDDEISFIAESAANYSNLSKVHAAENAKPLEKIEFEKVLGKKFAHQDE  240

Query  871  NDSILGVVRETPPDLILPNNA  933
             DS +GV    PP+L  PN A
Sbjct  241  YDSSIGVAEGAPPELTSPNPA  261



>gb|KEH36170.1| gamma carbonic anhydrase-like protein [Medicago truncatula]
Length=272

 Score =   417 bits (1073),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 201/261 (77%), Positives = 230/261 (88%), Gaps = 4/261 (2%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LGRA Y+VG  IR+TGQA+DRLG  LQG Y   EQLSRHR ++N+FDK P + ++ F
Sbjct  1    MGTLGRAIYSVGQLIRKTGQAVDRLGSHLQGGY-IEEQLSRHRTVLNIFDKAPVIDKDVF  59

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSA++IGDVQ+G+ SSIWYG VLRGDVN + IG+GTN+QDNSLVHVAKSNL+GKVLPT
Sbjct  60   VAPSAAVIGDVQIGKGSSIWYGSVLRGDVNIIRIGSGTNLQDNSLVHVAKSNLSGKVLPT  119

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            IIG+NVTVGHSAVLHGCTVEDEAFVGMGA LLDGVVVEKNAM+AAGALVRQNT+IP GEV
Sbjct  120  IIGDNVTVGHSAVLHGCTVEDEAFVGMGAILLDGVVVEKNAMVAAGALVRQNTKIPSGEV  179

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KDE  867
            W GNPAKFLRKLT+EEIAFISQSA NY+NL Q HAAEN+KS +E EFEKVLRKK   KDE
Sbjct  180  WAGNPAKFLRKLTDEEIAFISQSATNYTNLAQVHAAENSKSYEEIEFEKVLRKKYATKDE  239

Query  868  DNDSILGVVRETPPDLILPNN  930
            + DS+LGVVRE PP+LILP+N
Sbjct  240  EYDSMLGVVREIPPELILPDN  260



>gb|ACG35255.1| transcription factor APFI [Zea mays]
Length=262

 Score =   415 bits (1066),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 196/261 (75%), Positives = 224/261 (86%), Gaps = 2/261 (1%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            M  LG+A Y VGFWIRETGQALDRLGCRLQG Y+FHEQ+SRHR +MN+FDK P VH++AF
Sbjct  1    MAGLGKAMYAVGFWIRETGQALDRLGCRLQGKYFFHEQISRHRTIMNIFDKTPHVHKDAF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSAS+IGDVQVG  +SIWYGCVLRGD N + IG+GTNIQDNSL+HVAKSNL+GKV PT
Sbjct  61   VAPSASLIGDVQVGSGASIWYGCVLRGDANIIQIGSGTNIQDNSLIHVAKSNLSGKVFPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
             IGNNVTV HSAVL GCTVEDEAFVG+GATLLDGVVVEK+ M+AAGALVRQNTRIPCGEV
Sbjct  121  TIGNNVTVCHSAVLQGCTVEDEAFVGIGATLLDGVVVEKHGMVAAGALVRQNTRIPCGEV  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK--KDED  870
            WGGNPAKFLRKLT++EI+FI++SA NYSNL + HAAENAK L++ EFEKVL KK    ++
Sbjct  181  WGGNPAKFLRKLTDDEISFIAESAANYSNLSKVHAAENAKPLEKIEFEKVLGKKFAHQDE  240

Query  871  NDSILGVVRETPPDLILPNNA  933
             DS +GV    PP+L  PN A
Sbjct  241  YDSSIGVTEGAPPELTSPNPA  261



>ref|XP_009771198.1| PREDICTED: gamma carbonic anhydrase 2, mitochondrial [Nicotiana 
sylvestris]
Length=273

 Score =   415 bits (1066),  Expect = 8e-140, Method: Compositional matrix adjust.
 Identities = 195/261 (75%), Positives = 230/261 (88%), Gaps = 3/261 (1%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LG+A Y++G  +R TGQALDR+G RLQG+ Y  E LSRHR LMN+ DK P V ++ F
Sbjct  1    MGTLGKAIYSLGSIVRATGQALDRVGNRLQGSSYLEEHLSRHRTLMNILDKAPVVDKDVF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAP AS+IGDV VGR+SSIWYGCVLRGDVNS+S+G+G+NIQDNSLVHVAKSN++ KVLPT
Sbjct  61   VAPGASVIGDVHVGRNSSIWYGCVLRGDVNSISVGSGSNIQDNSLVHVAKSNISQKVLPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            IIGNNVTVGHSAV+HGCT+EDEAF+GMGATLLDGV VEK+AM+AAGALVRQNTRIP GEV
Sbjct  121  IIGNNVTVGHSAVVHGCTIEDEAFIGMGATLLDGVHVEKHAMVAAGALVRQNTRIPSGEV  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRK---KKDE  867
            W GNPAKFLRKLT+EEIAFI+QSA NY NL + HAAEN+KS DE EFEK+LRK   K+DE
Sbjct  181  WAGNPAKFLRKLTDEEIAFIAQSATNYCNLARVHAAENSKSFDEIEFEKMLRKKYAKRDE  240

Query  868  DNDSILGVVRETPPDLILPNN  930
            + DS++GVVRETPP+L+LP+N
Sbjct  241  EYDSMIGVVRETPPELVLPDN  261



>gb|AFK41197.1| unknown [Medicago truncatula]
Length=272

 Score =   413 bits (1062),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 199/261 (76%), Positives = 228/261 (87%), Gaps = 4/261 (2%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LGRA Y+ G  IR+TGQA+DRLG  LQG Y   EQLSRHR ++N+FDK P + ++ F
Sbjct  1    MGTLGRAIYSAGQLIRKTGQAVDRLGSHLQGGY-IEEQLSRHRTVLNIFDKAPVIDKDVF  59

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSA++IGDVQ+G+ SSIWYG VLRGDVN + IG+GTN+QDNSLVHVAKSNL+G VLPT
Sbjct  60   VAPSAAVIGDVQIGKGSSIWYGSVLRGDVNIIRIGSGTNLQDNSLVHVAKSNLSGMVLPT  119

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            IIG+NVTVGHSAVLHGCTVEDEAFVGMGA LLDGVVVEKNAM+AAGALVRQNT+IP GEV
Sbjct  120  IIGDNVTVGHSAVLHGCTVEDEAFVGMGAILLDGVVVEKNAMVAAGALVRQNTKIPSGEV  179

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KDE  867
            W GNPAKFLRKLT+EEIAFISQSA NY+NL Q HAAEN+KS +E EFEKVLRKK   KDE
Sbjct  180  WAGNPAKFLRKLTDEEIAFISQSATNYTNLAQVHAAENSKSYEEIEFEKVLRKKYATKDE  239

Query  868  DNDSILGVVRETPPDLILPNN  930
            + DS+LGVVRE PP+LILP+N
Sbjct  240  EYDSMLGVVREIPPELILPDN  260



>ref|XP_004238283.1| PREDICTED: gamma carbonic anhydrase 2, mitochondrial [Solanum 
lycopersicum]
Length=273

 Score =   413 bits (1061),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 194/261 (74%), Positives = 231/261 (89%), Gaps = 3/261 (1%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LG+A Y++G  +R TG+ALDR+G RLQG+ +  E LSRHR LMN+FDK P V ++ F
Sbjct  1    MGTLGKAIYSLGSIVRATGKALDRVGNRLQGSSHIEEHLSRHRTLMNVFDKAPVVDKDVF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAP AS+IGDV VGR+SSIWYGCVLRGDVNS+S+G+GTNIQDNSLVHVAKSN++ KVLPT
Sbjct  61   VAPGASVIGDVHVGRNSSIWYGCVLRGDVNSISVGSGTNIQDNSLVHVAKSNISQKVLPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            IIGNNVTVGHSAV+HGCT+EDEAF+GMGATLLDGV VEK+AM+AAGALV+QNTRIP GEV
Sbjct  121  IIGNNVTVGHSAVVHGCTIEDEAFIGMGATLLDGVHVEKHAMVAAGALVKQNTRIPSGEV  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRK---KKDE  867
            W GNPAKFLRKLT+EEIAFI+QSA NY NL + HAAEN+KS DE EFEK+LRK   K+DE
Sbjct  181  WAGNPAKFLRKLTDEEIAFIAQSATNYCNLARVHAAENSKSFDEIEFEKMLRKKYAKRDE  240

Query  868  DNDSILGVVRETPPDLILPNN  930
            + DS++GVVRETPP+L+LP+N
Sbjct  241  EYDSMIGVVRETPPELVLPDN  261



>ref|NP_175159.1| gamma carbonic anhydrase 2 [Arabidopsis thaliana]
 sp|Q9C6B3.1|GCA2_ARATH RecName: Full=Gamma carbonic anhydrase 2, mitochondrial; Short=AtCA2; 
Short=GAMMA CA2; AltName: Full=Transcription factor 
APFI; Flags: Precursor [Arabidopsis thaliana]
 gb|AAG52641.1|AC079677_5 unknown protein; 6976-8939 [Arabidopsis thaliana]
 gb|AAK76653.1| unknown protein [Arabidopsis thaliana]
 gb|AAM44984.1| unknown protein [Arabidopsis thaliana]
 gb|AEE32144.1| gamma carbonic anhydrase 2 [Arabidopsis thaliana]
Length=278

 Score =   412 bits (1058),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 193/261 (74%), Positives = 231/261 (89%), Gaps = 3/261 (1%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LGRA YTVG WIR TGQALDR+G  LQG++   E LSRHR LMN+FDK P V ++ F
Sbjct  1    MGTLGRAIYTVGNWIRGTGQALDRVGSLLQGSHRIEEHLSRHRTLMNVFDKSPLVDKDVF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSAS+IGDVQ+G+ SSIWYGCVLRGDVN++S+G+GTNIQDN+LVHVAK+N++GKVLPT
Sbjct  61   VAPSASVIGDVQIGKGSSIWYGCVLRGDVNNISVGSGTNIQDNTLVHVAKTNISGKVLPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            +IG+NVTVGHSAV+HGCTVED+AFVGMGATLLDGVVVEK+AM+AAG+LV+QNTRIP GEV
Sbjct  121  LIGDNVTVGHSAVIHGCTVEDDAFVGMGATLLDGVVVEKHAMVAAGSLVKQNTRIPSGEV  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KDE  867
            WGGNPAKF+RKLT+EEI +ISQSA NY NL Q HA+EN+KS ++ E E+ LRKK   KDE
Sbjct  181  WGGNPAKFMRKLTDEEIVYISQSAKNYINLAQIHASENSKSFEQIEVERALRKKYARKDE  240

Query  868  DNDSILGVVRETPPDLILPNN  930
            D DS+LG+ RETPP+LILP+N
Sbjct  241  DYDSMLGITRETPPELILPDN  261



>ref|XP_006341958.1| PREDICTED: gamma carbonic anhydrase 2, mitochondrial-like [Solanum 
tuberosum]
Length=273

 Score =   411 bits (1056),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 192/261 (74%), Positives = 231/261 (89%), Gaps = 3/261 (1%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LG+A Y++G  +R TG+ALDR+G RLQG+ +  E LSRHR LMN+FDK P V ++ F
Sbjct  1    MGTLGKAIYSLGSIVRATGKALDRVGNRLQGSSHIEEHLSRHRTLMNIFDKAPVVDKDVF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAP A++IGDV VGR+SSIWYGCVLRGDVNS+S+G+GTNIQDNSLVHVAKSN++ KVLPT
Sbjct  61   VAPGATVIGDVHVGRNSSIWYGCVLRGDVNSISVGSGTNIQDNSLVHVAKSNISQKVLPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            IIGNNVTVGHSAV+HGCT+EDEAF+GMGATLLDGV VEK+AM+AAG+LV+QNTRIP GEV
Sbjct  121  IIGNNVTVGHSAVVHGCTIEDEAFIGMGATLLDGVHVEKHAMVAAGSLVKQNTRIPSGEV  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRK---KKDE  867
            W GNPAKFLRKLT+EEIAFI+QSA NY NL + HAAEN+KS DE EFEK+LRK   K+DE
Sbjct  181  WAGNPAKFLRKLTDEEIAFIAQSATNYCNLARVHAAENSKSFDEIEFEKMLRKKYAKRDE  240

Query  868  DNDSILGVVRETPPDLILPNN  930
            + DS++GVVRETPP+L+LP+N
Sbjct  241  EYDSMIGVVRETPPELVLPDN  261



>ref|NP_001066265.1| Os12g0169700 [Oryza sativa Japonica Group]
 gb|ABA95932.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF29284.1| Os12g0169700 [Oryza sativa Japonica Group]
 gb|EAY82406.1| hypothetical protein OsI_37621 [Oryza sativa Indica Group]
 gb|EAZ19787.1| hypothetical protein OsJ_35366 [Oryza sativa Japonica Group]
 dbj|BAG96313.1| unnamed protein product [Oryza sativa Japonica Group]
Length=273

 Score =   411 bits (1056),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 194/261 (74%), Positives = 227/261 (87%), Gaps = 3/261 (1%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LGRA YTVG WIR TGQA+DRLG  +QG     EQLSRHR +MN+F+K P VH++ F
Sbjct  1    MGTLGRAIYTVGKWIRGTGQAMDRLGSTIQGGLRVEEQLSRHRTIMNIFEKEPRVHKDVF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSA++IGDV++G  SSIWYG +LRGDVNS+ IG+G+NIQDNSLVHVAK+N++GKVLPT
Sbjct  61   VAPSAAVIGDVEIGHGSSIWYGSILRGDVNSIHIGSGSNIQDNSLVHVAKANISGKVLPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            IIGNNVT+GHSAVLH CTVEDEAFVGMGATLLDGVVVEK++M+ AG+LV+QNTRIP GEV
Sbjct  121  IIGNNVTIGHSAVLHACTVEDEAFVGMGATLLDGVVVEKHSMVGAGSLVKQNTRIPSGEV  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KDE  867
            W GNPAKFLRKLTEEEIAFI+QSA NY NL Q HAAEN+K+ DE E EK+LRKK   KDE
Sbjct  181  WVGNPAKFLRKLTEEEIAFIAQSATNYINLAQVHAAENSKTFDEIELEKMLRKKYAHKDE  240

Query  868  DNDSILGVVRETPPDLILPNN  930
            + DS+LGVVRE PP+LILP+N
Sbjct  241  EYDSMLGVVREIPPELILPDN  261



>gb|EYU45182.1| hypothetical protein MIMGU_mgv1a011728mg [Erythranthe guttata]
Length=272

 Score =   409 bits (1052),  Expect = 9e-138, Method: Compositional matrix adjust.
 Identities = 194/261 (74%), Positives = 227/261 (87%), Gaps = 3/261 (1%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LG+A YT+G WIR TG+A+D++G  LQG+ Y  E LSRHR LM +FDK P V ++AF
Sbjct  1    MGTLGKAVYTLGNWIRGTGKAMDKVGSLLQGSSYIEEHLSRHRTLMEIFDKSPVVDKDAF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            +AP AS+IGDVQVG+ +SIWYG VLRGDVNS+SIG GTNIQDNSLVHVAKSNL+G VLPT
Sbjct  61   IAPGASVIGDVQVGQGASIWYGSVLRGDVNSISIGYGTNIQDNSLVHVAKSNLSGNVLPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            IIGNNVTVGHSAV+HGCT+EDEAFVGMGATLLDGVVVEK+AM+AAG+LVRQNTRIP GEV
Sbjct  121  IIGNNVTVGHSAVIHGCTIEDEAFVGMGATLLDGVVVEKHAMVAAGSLVRQNTRIPSGEV  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KDE  867
            W GNPAKFLRKLT+EEIAFISQSA NY NL + HAAEN KS DE + EK+LRKK   +DE
Sbjct  181  WAGNPAKFLRKLTDEEIAFISQSATNYINLAKVHAAENTKSFDEIQLEKMLRKKFARRDE  240

Query  868  DNDSILGVVRETPPDLILPNN  930
            D +S++G+VRE PP+LILP+N
Sbjct  241  DYESMIGIVREIPPELILPDN  261



>ref|XP_002463275.1| hypothetical protein SORBIDRAFT_02g041030 [Sorghum bicolor]
 gb|EER99796.1| hypothetical protein SORBIDRAFT_02g041030 [Sorghum bicolor]
Length=273

 Score =   409 bits (1052),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 194/261 (74%), Positives = 226/261 (87%), Gaps = 3/261 (1%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LGRA +TVG WIR TGQA+DRLG  LQG     EQ+SRHR +MN+F+K P +HR+ F
Sbjct  1    MGTLGRAIFTVGKWIRGTGQAMDRLGSTLQGGLRVEEQVSRHRTIMNIFEKEPKIHRDVF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSA++IGDV++G  SSIWYG +LRGDVNS+ IG+GTNIQDNSLVHVAK+N +GKVLPT
Sbjct  61   VAPSAAVIGDVEIGHGSSIWYGSILRGDVNSIHIGSGTNIQDNSLVHVAKANFSGKVLPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            IIG+NVTVGHSAVLH CT+EDEAFVGMGATLLDGV+VEK++M+ AG+LV+QNTRIP GEV
Sbjct  121  IIGSNVTVGHSAVLHACTIEDEAFVGMGATLLDGVLVEKHSMVGAGSLVKQNTRIPSGEV  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KDE  867
            W GNPAKFLRKLTEEEIAFI+QSA NY NL Q HAAENAKS DE E EK+LRKK   KDE
Sbjct  181  WVGNPAKFLRKLTEEEIAFIAQSATNYINLAQVHAAENAKSFDEIELEKMLRKKYAHKDE  240

Query  868  DNDSILGVVRETPPDLILPNN  930
            + DS+LGVVRE PP+LILP+N
Sbjct  241  EYDSMLGVVREIPPELILPDN  261



>ref|XP_006663861.1| PREDICTED: gamma carbonic anhydrase 2, mitochondrial-like [Oryza 
brachyantha]
Length=273

 Score =   409 bits (1051),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 191/261 (73%), Positives = 228/261 (87%), Gaps = 3/261 (1%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LGRA YTVG WIR TGQA+DRLG  +QG     EQLSRHR +MN+F+K P +H++ F
Sbjct  1    MGTLGRAIYTVGKWIRGTGQAMDRLGSTIQGGLRVEEQLSRHRTIMNIFEKEPRIHKDVF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSA++IGDV++G  SSIWYG +LRGDVNS+ IG+GTNIQDNSLVHV+K+N++GKVLPT
Sbjct  61   VAPSAAVIGDVEIGHGSSIWYGSILRGDVNSIHIGSGTNIQDNSLVHVSKANISGKVLPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            IIG+NVT+GHSAVLH CT+EDEAFVGMGATLLDGVVVEK++M+ AG+LV+QNTRIP GEV
Sbjct  121  IIGSNVTIGHSAVLHACTIEDEAFVGMGATLLDGVVVEKHSMVGAGSLVKQNTRIPSGEV  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KDE  867
            W GNPAKFLRKLTEEE+AFI+QSA+NY NL Q HAAENAK+ DE E EK+LRKK   KDE
Sbjct  181  WVGNPAKFLRKLTEEEMAFIAQSAMNYINLAQVHAAENAKTFDEIELEKMLRKKFAHKDE  240

Query  868  DNDSILGVVRETPPDLILPNN  930
            + DS+LGVVRE PP+LILP+N
Sbjct  241  EYDSMLGVVREIPPELILPDN  261



>ref|NP_001169012.1| uncharacterized protein LOC100382844 [Zea mays]
 gb|ACN31405.1| unknown [Zea mays]
Length=273

 Score =   409 bits (1050),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 193/261 (74%), Positives = 226/261 (87%), Gaps = 3/261 (1%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LGRA +TVG WIR TGQA+DRLG  +QG     EQ+SRHR +MN+F+K P +HR+ F
Sbjct  1    MGTLGRAIFTVGKWIRGTGQAMDRLGSTIQGGLRVEEQVSRHRTIMNIFEKEPRIHRDVF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSA++IGDV++G  SSIWYG +LRGDVNS+ IG+GTNIQDNSLVHV+K+N++GKVLPT
Sbjct  61   VAPSAAVIGDVEIGHGSSIWYGSILRGDVNSIHIGSGTNIQDNSLVHVSKANISGKVLPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            IIG+NVTVGHSAVLH CT+EDEAFVGMGATLLDGVVVEK++M+ AG+LV+QNTRIP GEV
Sbjct  121  IIGSNVTVGHSAVLHACTIEDEAFVGMGATLLDGVVVEKHSMVGAGSLVKQNTRIPSGEV  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KDE  867
            W GNPAKFLRKLTEEEIAFI+QSA NY NL Q HAAENAKS DE E EK+LRKK   KDE
Sbjct  181  WVGNPAKFLRKLTEEEIAFIAQSATNYINLAQVHAAENAKSFDEIELEKMLRKKYAHKDE  240

Query  868  DNDSILGVVRETPPDLILPNN  930
            + DS+LGVVRE PP LILP+N
Sbjct  241  EYDSMLGVVREIPPQLILPDN  261



>emb|CDY67628.1| BnaCnng55730D [Brassica napus]
Length=276

 Score =   409 bits (1050),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 194/261 (74%), Positives = 229/261 (88%), Gaps = 3/261 (1%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LGRA YTVG WIR +GQALDR+G  LQG++ F E LSRHR LMN+FDK P V ++ F
Sbjct  1    MGTLGRAIYTVGKWIRGSGQALDRVGSLLQGSHRFEEHLSRHRTLMNVFDKSPLVDKDVF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSAS+IGDVQ+G+ SSIWYGCVLRGDVN++S+G+GTNIQDNSLVHVAK+NL GKVLPT
Sbjct  61   VAPSASVIGDVQIGKGSSIWYGCVLRGDVNNISVGSGTNIQDNSLVHVAKTNLGGKVLPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
             IG+NVTVGHSAV+HGCTVED+AFVGMGATLLDGVVVE +AM+AAG++V++NTRIP GEV
Sbjct  121  TIGDNVTVGHSAVIHGCTVEDDAFVGMGATLLDGVVVETHAMVAAGSIVKENTRIPSGEV  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KDE  867
            WGGNPAKF+RKLT+EEIA+IS+SA NY NL   HAAEN+KS DE E E+ LRKK   KDE
Sbjct  181  WGGNPAKFMRKLTDEEIAYISKSAENYINLAHIHAAENSKSFDEIEVERALRKKYARKDE  240

Query  868  DNDSILGVVRETPPDLILPNN  930
            D DS+LG+VRETP +LILP+N
Sbjct  241  DYDSMLGIVRETPAELILPDN  261



>gb|AAK28403.1|AF249876_1 transcription factor APFI [Arabidopsis thaliana]
Length=278

 Score =   408 bits (1049),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 191/261 (73%), Positives = 230/261 (88%), Gaps = 3/261 (1%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LGRA YTVG WIR TGQALDR+G  LQG++   E LSRHR LMN+FDK P V ++ F
Sbjct  1    MGTLGRAIYTVGNWIRGTGQALDRVGSLLQGSHRIEEHLSRHRTLMNVFDKSPLVDKDVF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSAS+IGDVQ+G+ SSIWYGCVLRGDVN++S+G+GTNIQDN+LVHVAK+ ++GKVLPT
Sbjct  61   VAPSASVIGDVQIGKGSSIWYGCVLRGDVNNISVGSGTNIQDNTLVHVAKTTISGKVLPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            +IG+NVTVGHSAV+HGCTVED+AFVGMGATLLDGVVVEK+AM+AAG+LV+QNTRIP GEV
Sbjct  121  LIGDNVTVGHSAVIHGCTVEDDAFVGMGATLLDGVVVEKHAMVAAGSLVKQNTRIPSGEV  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KDE  867
            WGGNPAKF+R+LT+EEI +ISQSA NY NL Q HA+EN+KS ++ E E+ LRKK   KDE
Sbjct  181  WGGNPAKFMRELTDEEIVYISQSAKNYINLAQIHASENSKSFEQIEVERALRKKYARKDE  240

Query  868  DNDSILGVVRETPPDLILPNN  930
            D DS+LG+ RETPP+LILP+N
Sbjct  241  DYDSMLGITRETPPELILPDN  261



>gb|EPS71345.1| hypothetical protein M569_03414 [Genlisea aurea]
Length=249

 Score =   407 bits (1046),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 195/234 (83%), Positives = 210/234 (90%), Gaps = 0/234 (0%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            M SLG+AFYTVGFWIRETGQALDRLG RLQGNY+F EQLSRHR LMNLFDKVP VH++AF
Sbjct  1    MASLGKAFYTVGFWIRETGQALDRLGSRLQGNYHFQEQLSRHRTLMNLFDKVPVVHKDAF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSASI GDV +G  SSIWYGCVLRGD   V IGTGTNIQDNSLVHVAKSNLTGKVLPT
Sbjct  61   VAPSASITGDVHIGGGSSIWYGCVLRGDAKHVGIGTGTNIQDNSLVHVAKSNLTGKVLPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            +IGNNVTVGHSAVL GCTVEDEAFVGMGATLLDGVVVEK+AM+AAGALVRQNTRIP GE+
Sbjct  121  VIGNNVTVGHSAVLQGCTVEDEAFVGMGATLLDGVVVEKHAMVAAGALVRQNTRIPSGEI  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK  858
            WGGNPAKFLRKLT +EIAFI +SA NY+NL + HAAENAK  D+ E EKVL+KK
Sbjct  181  WGGNPAKFLRKLTADEIAFIPKSADNYANLARIHAAENAKDFDKAELEKVLQKK  234



>ref|XP_010500247.1| PREDICTED: gamma carbonic anhydrase 2, mitochondrial [Camelina 
sativa]
 ref|XP_010479124.1| PREDICTED: gamma carbonic anhydrase 2, mitochondrial [Camelina 
sativa]
Length=278

 Score =   408 bits (1049),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 192/261 (74%), Positives = 229/261 (88%), Gaps = 3/261 (1%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LGRA YTVG WIR TGQALDR+G  LQG++   E LSRHR LMN+F K P V ++ F
Sbjct  1    MGTLGRAIYTVGNWIRGTGQALDRVGSLLQGSHRIEEHLSRHRTLMNVFGKSPLVDKDVF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSAS+IGDVQ+G+ SSIWYGCVLRGDVN++S+G+GTNIQDN+LVHVAK+N++GKVLPT
Sbjct  61   VAPSASVIGDVQIGKSSSIWYGCVLRGDVNNISVGSGTNIQDNTLVHVAKTNISGKVLPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            +IG+NVTVGHSAV+HGCTVED+AFVGMGATLLDGVVVEK+AM+AAG+LV+QNTRIP GEV
Sbjct  121  LIGDNVTVGHSAVIHGCTVEDDAFVGMGATLLDGVVVEKHAMVAAGSLVKQNTRIPSGEV  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KDE  867
            WGGNPAKF+RKLT+EEI +ISQSA NY NL Q HA+EN+KS D+ E EK LR+K   KDE
Sbjct  181  WGGNPAKFMRKLTDEEIEYISQSAKNYINLAQIHASENSKSFDQIEVEKALRRKYARKDE  240

Query  868  DNDSILGVVRETPPDLILPNN  930
            D DS+LG+ RE PP+LILP+N
Sbjct  241  DYDSMLGITREIPPELILPDN  261



>emb|CDY47592.1| BnaC08g04620D [Brassica napus]
Length=276

 Score =   408 bits (1048),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 194/261 (74%), Positives = 229/261 (88%), Gaps = 3/261 (1%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LGR  YTVG WIR +GQALDR+G  LQG++   E LSRHR LM++FDK P V ++ F
Sbjct  1    MGTLGRVIYTVGNWIRGSGQALDRVGSILQGSHRLEEHLSRHRTLMSVFDKSPLVDKDVF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSAS+IGDVQ+G+ SSIWYGCVLRGDVN++S+G+GTNIQDNSLVHVAK+NL+GKVLPT
Sbjct  61   VAPSASVIGDVQIGKGSSIWYGCVLRGDVNNISVGSGTNIQDNSLVHVAKTNLSGKVLPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
             IG+NVTVGHSAV+HGCTVEDEAFVGMGATLLDGVVVEK+AM+AAG+LVR+NTRIP GEV
Sbjct  121  TIGDNVTVGHSAVIHGCTVEDEAFVGMGATLLDGVVVEKHAMVAAGSLVRENTRIPSGEV  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KDE  867
            WGGNPAKF+RKLT+EEIA+IS+SA NY NL   HAAEN+KS +E E E+ LRKK   KDE
Sbjct  181  WGGNPAKFMRKLTDEEIAYISKSAENYINLAHIHAAENSKSFEEIEVERALRKKYARKDE  240

Query  868  DNDSILGVVRETPPDLILPNN  930
            D DS+LG+VRETP +LILP+N
Sbjct  241  DYDSMLGIVRETPAELILPDN  261



>gb|ABK26184.1| unknown [Picea sitchensis]
Length=273

 Score =   407 bits (1045),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 192/260 (74%), Positives = 224/260 (86%), Gaps = 3/260 (1%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LG+  Y  GF IRETGQA+DR GCRLQGN+ F EQLSRHR LMN+F+K PS+HR+ F
Sbjct  1    MGTLGKVIYMAGFLIRETGQAIDRFGCRLQGNHGFQEQLSRHRTLMNIFEKAPSLHRDVF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSA+++GDV+VG+ SSIWYG VLRGDVNS+ +G+GTNIQDN+LVHVAK+N++GKVLPT
Sbjct  61   VAPSAAVMGDVKVGQGSSIWYGSVLRGDVNSIMVGSGTNIQDNTLVHVAKTNISGKVLPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            IIGN VT+GH AVLHGCTVEDEAFVGMGATLLDGVV+EKNAM+AAG+LVRQN RIP GEV
Sbjct  121  IIGNKVTIGHGAVLHGCTVEDEAFVGMGATLLDGVVLEKNAMVAAGSLVRQNARIPSGEV  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KDE  867
            W GNPAKFLRKLT+EEI FI QSALNY NL + HA ENAKS DE E  KVLRKK   + +
Sbjct  181  WAGNPAKFLRKLTDEEIEFILQSALNYQNLAEMHARENAKSYDEIEAYKVLRKKLARQSD  240

Query  868  DNDSILGVVRETPPDLILPN  927
            D DS LGVVRE PP+L++P+
Sbjct  241  DYDSHLGVVREFPPELVVPD  260



>ref|XP_004958498.1| PREDICTED: gamma carbonic anhydrase 2, mitochondrial-like [Setaria 
italica]
Length=273

 Score =   405 bits (1042),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 192/261 (74%), Positives = 226/261 (87%), Gaps = 3/261 (1%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LGRA +TVG WIR TGQA+DRLG  LQG     EQ+SRHR +MN+F+K P +HR+ F
Sbjct  1    MGTLGRAIFTVGKWIRGTGQAMDRLGSTLQGGLRVEEQVSRHRTIMNIFEKEPRIHRDVF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSA++IGDV++G  SSIWYG +LRGDVNS+ IG+GTNIQDNSLVHV++SN++ KVLPT
Sbjct  61   VAPSAAVIGDVEIGHGSSIWYGSILRGDVNSIHIGSGTNIQDNSLVHVSRSNISRKVLPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            IIG+NVTVGHSAVLH CT+EDEAFVGMGATLLDGVVVEK++M+ AG+LV+QNTRIP GEV
Sbjct  121  IIGSNVTVGHSAVLHACTIEDEAFVGMGATLLDGVVVEKHSMVGAGSLVKQNTRIPSGEV  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KDE  867
            W GNPAKFLRKLTEEEIAFI+QSA NY NL Q HAAEN+KS DE E EK+LRKK   KDE
Sbjct  181  WVGNPAKFLRKLTEEEIAFIAQSATNYINLAQVHAAENSKSFDEIELEKMLRKKYAHKDE  240

Query  868  DNDSILGVVRETPPDLILPNN  930
            + DS+LGVVRE PP+LILP+N
Sbjct  241  EYDSMLGVVREIPPELILPDN  261



>ref|XP_010484635.1| PREDICTED: gamma carbonic anhydrase 3, mitochondrial-like [Camelina 
sativa]
Length=258

 Score =   404 bits (1038),  Expect = 8e-136, Method: Compositional matrix adjust.
 Identities = 194/265 (73%), Positives = 223/265 (84%), Gaps = 9/265 (3%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG++GRAFY+VGFWIRETGQALDRLGCRLQG  +F EQLSRHR LMN+FDK P+V ++AF
Sbjct  1    MGTMGRAFYSVGFWIRETGQALDRLGCRLQGKNHFREQLSRHRTLMNVFDKAPNVDKKAF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAP+ASI GDV VGR SSIWYGCVLRGD NS+S+G GTNIQDN+LVHVAKSNL+GKVLPT
Sbjct  61   VAPNASITGDVHVGRGSSIWYGCVLRGDANSISVGAGTNIQDNTLVHVAKSNLSGKVLPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            IIGNNVTVGHSAVLHGCTVEDEA++G  AT+LDG  VEK+AM+A+GALVRQNTRIP GEV
Sbjct  121  IIGNNVTVGHSAVLHGCTVEDEAYIGTSATVLDGAHVEKHAMVASGALVRQNTRIPSGEV  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK--KDED  870
            WGGNPA+FLRK+TEEE  F S SA  YSNL Q HA ENAK+LDE EF+K+L KK  +D +
Sbjct  181  WGGNPARFLRKVTEEERVFFSSSAAEYSNLGQVHATENAKNLDETEFKKLLNKKNTRDSE  240

Query  871  NDSILGVVRETPPDLILPNNAPKAS  945
             DS+L        D+ LP N PKA+
Sbjct  241  YDSLL-------DDVTLPENVPKAA  258



>emb|CDY17034.1| BnaA08g03980D [Brassica napus]
Length=276

 Score =   405 bits (1040),  Expect = 9e-136, Method: Compositional matrix adjust.
 Identities = 192/261 (74%), Positives = 227/261 (87%), Gaps = 3/261 (1%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LGR  YTVG WIR +GQALDR+G  LQG++   E LSRHR LM++FDK P V ++ F
Sbjct  1    MGTLGRVIYTVGNWIRGSGQALDRVGSLLQGSHRLEEHLSRHRTLMSVFDKSPLVDKDVF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSAS+IGDVQ+G+ SSIWYGCVLRGDVN++S+G+GTNIQDNSLVHVAK+NL GKVLPT
Sbjct  61   VAPSASVIGDVQIGKGSSIWYGCVLRGDVNNISVGSGTNIQDNSLVHVAKTNLAGKVLPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
             IG+NVTVGHSAV+HGCTVEDEAFVGMGATLLDGVVVEK+AM+AAG+LVR+NTRIP GEV
Sbjct  121  TIGDNVTVGHSAVIHGCTVEDEAFVGMGATLLDGVVVEKHAMVAAGSLVRENTRIPSGEV  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KDE  867
            WGGNPAKF+RKLT+EE+A+IS+SA NY NL   HAAEN+KS +E E E+ LRKK   KDE
Sbjct  181  WGGNPAKFMRKLTDEEVAYISKSAENYINLAHIHAAENSKSFEEIEVERALRKKYARKDE  240

Query  868  DNDSILGVVRETPPDLILPNN  930
            D DS+LG+VRE P +LILP+N
Sbjct  241  DYDSMLGIVREIPAELILPDN  261



>ref|XP_010444788.1| PREDICTED: gamma carbonic anhydrase 3, mitochondrial [Camelina 
sativa]
Length=258

 Score =   404 bits (1037),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 194/265 (73%), Positives = 222/265 (84%), Gaps = 9/265 (3%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG++GRAFY+VGFWIRETGQALDRLGCRLQG  +F EQLSRHR LMN+FDK P+V + AF
Sbjct  1    MGTMGRAFYSVGFWIRETGQALDRLGCRLQGKNHFREQLSRHRTLMNVFDKAPNVDKGAF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAP+ASI GDV VGR SSIWYGCVLRGD NS+S+G GTNIQDN+LVHVAKSNL+GKVLPT
Sbjct  61   VAPNASITGDVHVGRGSSIWYGCVLRGDANSISVGAGTNIQDNTLVHVAKSNLSGKVLPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            IIGNNVTVGHSAVLHGCTVEDEA++G  AT+LDG  VEK+AM+A+GALVRQNTRIP GEV
Sbjct  121  IIGNNVTVGHSAVLHGCTVEDEAYIGTSATVLDGAHVEKHAMVASGALVRQNTRIPSGEV  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK--KDED  870
            WGGNPA+FLRK+TEEE  F S SA  YSNL Q HA ENAK+LDE EF+K+L KK  +D +
Sbjct  181  WGGNPARFLRKVTEEERVFFSSSAAEYSNLGQVHATENAKNLDETEFKKLLNKKNARDSE  240

Query  871  NDSILGVVRETPPDLILPNNAPKAS  945
             DS+L        D+ LP N PKA+
Sbjct  241  YDSVL-------DDITLPENVPKAA  258



>gb|EAZ04886.1| hypothetical protein OsI_27068 [Oryza sativa Indica Group]
Length=273

 Score =   403 bits (1036),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 189/261 (72%), Positives = 223/261 (85%), Gaps = 3/261 (1%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LGRA YTVG WIR TGQA+DRLG  +QG     EQLSRHR +MN+F+K P +H++ F
Sbjct  1    MGTLGRAIYTVGKWIRGTGQAMDRLGSTIQGGLRVEEQLSRHRTIMNIFEKEPRIHKDVF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSA++IGDV++G  SSIWYG +LRGDVNS+ IG GTNIQDNSLVHV+K+N++GKVLPT
Sbjct  61   VAPSAAVIGDVEIGHGSSIWYGSILRGDVNSIHIGAGTNIQDNSLVHVSKANISGKVLPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            IIGN VT+GHSAVLH C VEDEAFVGMGATLLDGVVVEK++M+ AG+LV+QNTRIP GEV
Sbjct  121  IIGNRVTIGHSAVLHACIVEDEAFVGMGATLLDGVVVEKHSMVGAGSLVKQNTRIPSGEV  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KDE  867
            W GNPAKFLRKLTEEE+ FI+QSA NY NL Q HAAENAK+ DE E EK+LRKK   KDE
Sbjct  181  WVGNPAKFLRKLTEEEMTFIAQSATNYINLAQVHAAENAKTFDEIELEKMLRKKFAHKDE  240

Query  868  DNDSILGVVRETPPDLILPNN  930
            + DS+LGV+RE PP+LILP+N
Sbjct  241  EYDSMLGVIREIPPELILPDN  261



>ref|XP_006393845.1| hypothetical protein EUTSA_v10004794mg [Eutrema salsugineum]
 gb|ABB45859.1| hypothetical protein [Eutrema halophilum]
 gb|ESQ31131.1| hypothetical protein EUTSA_v10004794mg [Eutrema salsugineum]
Length=258

 Score =   402 bits (1034),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 192/265 (72%), Positives = 222/265 (84%), Gaps = 9/265 (3%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG++GRA Y+VGFWIRETGQALDRLGCRLQG  +F EQLSRHR LMN+FDK PSV ++AF
Sbjct  1    MGTMGRALYSVGFWIRETGQALDRLGCRLQGKNHFREQLSRHRTLMNVFDKAPSVDKQAF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSASI GDV VGR SSIWYGCVLRGD NS+++G GTNIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   VAPSASITGDVHVGRGSSIWYGCVLRGDANSITVGAGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            +IG+NVT+GHSAVLHGCTVEDEA++G  AT+LDG  VEK AM+A+GALVRQNTRIP GEV
Sbjct  121  VIGDNVTIGHSAVLHGCTVEDEAYIGTSATVLDGAHVEKQAMVASGALVRQNTRIPSGEV  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK--KDED  870
            WGGNPA+FLRK+TEEE AF S SA++YSNL Q HAAEN K+LDE +F+K+L KK  +D +
Sbjct  181  WGGNPARFLRKVTEEERAFFSSSAVDYSNLAQVHAAENTKNLDETDFKKLLHKKNSRDAE  240

Query  871  NDSILGVVRETPPDLILPNNAPKAS  945
             DS L        DL L  N PKA+
Sbjct  241  YDSQLN-------DLALSENVPKAA  258



>ref|XP_006304043.1| hypothetical protein CARUB_v10009842mg, partial [Capsella rubella]
 gb|EOA36941.1| hypothetical protein CARUB_v10009842mg, partial [Capsella rubella]
Length=306

 Score =   404 bits (1039),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 190/261 (73%), Positives = 228/261 (87%), Gaps = 3/261 (1%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LGRA YTVG WIR TGQALDR+G  LQG++   E LSRHR LMN+FDK P V ++ F
Sbjct  29   MGTLGRAIYTVGNWIRGTGQALDRVGSLLQGSHRIEEHLSRHRTLMNVFDKSPLVDKDVF  88

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAP AS+IGDVQ+G+ SSIWYGCVLRGDVN++S+G+GTNIQDN+LVHVAK+N++GKVLPT
Sbjct  89   VAPGASVIGDVQIGKGSSIWYGCVLRGDVNNISVGSGTNIQDNTLVHVAKTNISGKVLPT  148

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            +IG+NVTVGHSAV+HGCTVED+AFVGMGATLLDGVVVEK+AM+AAG+LV+QNTRIP GEV
Sbjct  149  LIGDNVTVGHSAVIHGCTVEDDAFVGMGATLLDGVVVEKHAMVAAGSLVKQNTRIPSGEV  208

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KDE  867
            WGGNPAKF+RKLT+EE+ +ISQSA NY NL Q HA+EN+KS D+ E E+ LRKK   KDE
Sbjct  209  WGGNPAKFMRKLTDEEVEYISQSAKNYINLAQIHASENSKSFDQIEVERALRKKYARKDE  268

Query  868  DNDSILGVVRETPPDLILPNN  930
            D DS+LG+ RE P +LILP+N
Sbjct  269  DYDSMLGITREIPAELILPDN  289



>gb|KFK36155.1| hypothetical protein AALP_AA4G085200 [Arabis alpina]
Length=276

 Score =   403 bits (1036),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 194/261 (74%), Positives = 224/261 (86%), Gaps = 3/261 (1%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LGR  YTVG  IR TGQALDR+G  LQG + F E LSRHR LMN+FDK P V ++ F
Sbjct  1    MGTLGRVIYTVGKAIRVTGQALDRVGSTLQGGHRFEEHLSRHRTLMNVFDKSPLVDKDVF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSAS+IGDVQ+G+ SSIWYGCVLRGDVN++SIG+GTNIQDNSLVHVAK+NL+ K LPT
Sbjct  61   VAPSASVIGDVQIGKGSSIWYGCVLRGDVNNISIGSGTNIQDNSLVHVAKTNLSNKSLPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
             IG+NVT+GHSAV+H CTVEDEAFVGMGATLLDGVVVEK+AM+AAG+LV+ NTRIP GEV
Sbjct  121  TIGDNVTIGHSAVIHACTVEDEAFVGMGATLLDGVVVEKHAMVAAGSLVKGNTRIPSGEV  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KDE  867
            WGGNPAKF+RKLT+EEI +IS+SA NY NL Q HAAEN KS +E E E+ LRKK   KDE
Sbjct  181  WGGNPAKFMRKLTDEEIDYISKSAENYINLAQIHAAENTKSFEEIEVERALRKKFANKDE  240

Query  868  DNDSILGVVRETPPDLILPNN  930
            D DS+LGVVRETPP+LILP+N
Sbjct  241  DYDSMLGVVRETPPELILPDN  261



>ref|XP_010550419.1| PREDICTED: gamma carbonic anhydrase 3, mitochondrial [Tarenaya 
hassleriana]
Length=265

 Score =   402 bits (1034),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 196/264 (74%), Positives = 220/264 (83%), Gaps = 10/264 (4%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LG+AFY VGFWIRETGQALDRLGCRLQGNYYF E+LSRHR LMN+FDK PSV ++AF
Sbjct  1    MGTLGKAFYNVGFWIRETGQALDRLGCRLQGNYYFREELSRHRTLMNVFDKAPSVDKDAF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSAS+IGDV+VG  SSIWYGCVLRGD NS+S+G GTNIQDNSLVHVAKSNLTGKVLPT
Sbjct  61   VAPSASVIGDVRVGHGSSIWYGCVLRGDANSISVGAGTNIQDNSLVHVAKSNLTGKVLPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            IIG+NVT+GH AVLHGCT+EDEAF+G  ATLLDG  VEK+AM+A+GALVRQNTRIP GEV
Sbjct  121  IIGDNVTIGHGAVLHGCTIEDEAFIGTSATLLDGAYVEKHAMVASGALVRQNTRIPSGEV  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KDE  867
            WGGNPA+FLRKLTEEE A IS+SAL+YSNL Q HAAE AK  +E EF KV+ KK    D 
Sbjct  181  WGGNPARFLRKLTEEETALISRSALDYSNLAQVHAAEFAKKYEEVEFMKVVNKKFAHPDG  240

Query  868  DNDSILGVVRETPPDLILPNNAPK  939
            + DS       TP +L  P N  K
Sbjct  241  EYDS-------TPTELAPPENVVK  257



>ref|XP_003562574.1| PREDICTED: gamma carbonic anhydrase 2, mitochondrial [Brachypodium 
distachyon]
Length=275

 Score =   402 bits (1034),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 193/271 (71%), Positives = 229/271 (85%), Gaps = 8/271 (3%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LGRA YTVG WIR TGQA+DRLG  +QG     E +SRHR +M +F+K P ++++ F
Sbjct  1    MGTLGRAIYTVGKWIRGTGQAMDRLGSAVQGGLRAEEHVSRHRTIMGIFEKEPRINKDVF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSA++IGDV++G  SSIWYG +LRGDVN++ IG+G+NIQDNSLVHV+KSN++GKVLPT
Sbjct  61   VAPSAAVIGDVEIGHGSSIWYGSILRGDVNTIQIGSGSNIQDNSLVHVSKSNISGKVLPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            IIGN VTVGHSAVLH CT+EDEAFVGMGATLLDGVVVEK++M+ AG+LV+QNTRIP GEV
Sbjct  121  IIGNKVTVGHSAVLHACTIEDEAFVGMGATLLDGVVVEKHSMVGAGSLVKQNTRIPSGEV  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KDE  867
            W GNPAKFLRKLTEEEIAFI+QSA NY NL Q HAAENAKS DE E EK+LRKK   KDE
Sbjct  181  WVGNPAKFLRKLTEEEIAFIAQSATNYFNLAQVHAAENAKSFDEIELEKMLRKKFAHKDE  240

Query  868  DNDSILGVVRETPPDLILPNN-----APKAS  945
            + DS+LGVVRE PP+LILP+N     APKA+
Sbjct  241  EYDSMLGVVREIPPELILPDNILPDKAPKAA  271



>ref|XP_009145039.1| PREDICTED: gamma carbonic anhydrase 2, mitochondrial [Brassica 
rapa]
Length=276

 Score =   402 bits (1033),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 191/261 (73%), Positives = 227/261 (87%), Gaps = 3/261 (1%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LGRA YTVG WIR +GQALDR+G  LQG++ F E LSRHR LMN+FDK P V ++ F
Sbjct  1    MGTLGRAIYTVGKWIRGSGQALDRVGSLLQGSHRFEEHLSRHRTLMNVFDKSPLVDKDVF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSAS++GDVQ+G+ SSIWYGCVLRGDVN++S+G+GTNIQDNSLVHVAK+NL GKV PT
Sbjct  61   VAPSASVLGDVQIGKGSSIWYGCVLRGDVNNISVGSGTNIQDNSLVHVAKTNLGGKVSPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
             IG+NVTVGHSAV+HGCTVED+AFVGMGATLLDGVVVE +AM+AAG++V++NTRIP  EV
Sbjct  121  TIGDNVTVGHSAVIHGCTVEDDAFVGMGATLLDGVVVETHAMVAAGSIVKENTRIPSREV  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KDE  867
            WGGNPAKF+RKLT+EEIA+IS+SA NY NL   HAAEN+KS DE E E+ LRKK   KDE
Sbjct  181  WGGNPAKFMRKLTDEEIAYISKSAENYINLAHIHAAENSKSFDEIEVERALRKKYARKDE  240

Query  868  DNDSILGVVRETPPDLILPNN  930
            D DS+LG+VRETP +LILP+N
Sbjct  241  DYDSMLGIVRETPAELILPDN  261



>dbj|BAB39954.1| OSJNBa0004B13.8 [Oryza sativa Japonica Group]
Length=257

 Score =   401 bits (1030),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 191/262 (73%), Positives = 222/262 (85%), Gaps = 9/262 (3%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            M  LG+AFY VGFWIRETGQALDRLGCRLQGNYYFHEQLSRHR LMN+FDK P VHR+AF
Sbjct  1    MAGLGKAFYAVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRTLMNIFDKTPHVHRDAF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSAS+IGD+QVG+ +SIWYGCVLRGD N+V IG+GTNIQDNSLVHVAKSNL+GKV PT
Sbjct  61   VAPSASLIGDIQVGQGASIWYGCVLRGDANNVQIGSGTNIQDNSLVHVAKSNLSGKVFPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            IIG+NVTVGHSAVL GCTVEDEAFVGMGATLLDGVVVEK+ M+AAGAL+         +V
Sbjct  121  IIGDNVTVGHSAVLQGCTVEDEAFVGMGATLLDGVVVEKHGMVAAGALLYWI------QV  174

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KDE  867
            WGGNPAKFLRKLT++EI FI +SA NYS L + HAAENAK +++ EFEK+ RKK   +DE
Sbjct  175  WGGNPAKFLRKLTDDEITFIKESASNYSTLAKAHAAENAKPVEKTEFEKLFRKKSAHQDE  234

Query  868  DNDSILGVVRETPPDLILPNNA  933
            ++DS++G  RE  P+L   ++A
Sbjct  235  EHDSMIGATREVTPELTPSSSA  256



>ref|XP_009107430.1| PREDICTED: LOW QUALITY PROTEIN: gamma carbonic anhydrase 2, mitochondrial-like 
[Brassica rapa]
Length=276

 Score =   402 bits (1032),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 192/261 (74%), Positives = 226/261 (87%), Gaps = 3/261 (1%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LGR  YTVG WI  +GQALDR+G  L G++   E LSRHR LM++FDK P V ++ F
Sbjct  1    MGTLGRVIYTVGNWICGSGQALDRIGSLLXGSHRLEEHLSRHRTLMSVFDKSPLVDKDVF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSAS+IGDVQ+G+ SSIWYGCVLRGDVN++S+G+GTNIQDNSLVHVAK+NL GKVLPT
Sbjct  61   VAPSASVIGDVQIGKGSSIWYGCVLRGDVNNISVGSGTNIQDNSLVHVAKTNLAGKVLPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
             IG+NVTVGHSAV+HGCTVEDEAFVGMGATLLDGVVVEK+AM+AAG+LVR+NTRIP GEV
Sbjct  121  TIGDNVTVGHSAVIHGCTVEDEAFVGMGATLLDGVVVEKHAMVAAGSLVRENTRIPSGEV  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KDE  867
            WGGNPAKF+RKLT+EEIA+IS+SA NY NL   HAAEN+KS +E E E+ LRKK   KDE
Sbjct  181  WGGNPAKFMRKLTDEEIAYISKSAENYINLAHIHAAENSKSFEEIEIERALRKKYARKDE  240

Query  868  DNDSILGVVRETPPDLILPNN  930
            D DS+LG+VRETP +LILP+N
Sbjct  241  DYDSMLGIVRETPAELILPDN  261



>ref|NP_569036.1| gamma carbonic anhydrase 3 [Arabidopsis thaliana]
 sp|Q94AU7.1|GCA3_ARATH RecName: Full=Gamma carbonic anhydrase 3, mitochondrial; Short=AtCA3; 
Short=GAMMA CA3; Flags: Precursor [Arabidopsis thaliana]
 gb|AAK76458.1| putative ferripyochelin-binding protein [Arabidopsis thaliana]
 gb|AAL85116.1| putative ferripyochelin-binding protein [Arabidopsis thaliana]
 gb|AAM64929.1| ferripyochelin-binding protein-like [Arabidopsis thaliana]
 gb|AED98222.1| gamma carbonic anhydrase 3 [Arabidopsis thaliana]
Length=258

 Score =   401 bits (1030),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 190/265 (72%), Positives = 223/265 (84%), Gaps = 9/265 (3%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG++G+AFY+VGFWIRETGQALDRLGCRLQG  +F EQLSRHR LMN+FDK P+V + AF
Sbjct  1    MGTMGKAFYSVGFWIRETGQALDRLGCRLQGKNHFREQLSRHRTLMNVFDKTPNVDKGAF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAP+AS+ GDV VGR SSIWYGCVLRGD NS+S+G GTNIQDN+LVHVAK+NL+GKVLPT
Sbjct  61   VAPNASLSGDVHVGRGSSIWYGCVLRGDANSISVGAGTNIQDNALVHVAKTNLSGKVLPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            +IG+NVT+GHSAVLHGCTVEDEA++G  AT+LDG  VEK+AM+A+GALVRQNTRIP GEV
Sbjct  121  VIGDNVTIGHSAVLHGCTVEDEAYIGTSATVLDGAHVEKHAMVASGALVRQNTRIPSGEV  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK--KDED  870
            WGGNPAKFLRK+TEEE  F S SA+ YSNL Q HA ENAK+LDE EF+K+L KK  +D +
Sbjct  181  WGGNPAKFLRKVTEEERVFFSSSAVEYSNLAQAHATENAKNLDEAEFKKLLNKKNARDTE  240

Query  871  NDSILGVVRETPPDLILPNNAPKAS  945
             DS+L        DL LP N PKA+
Sbjct  241  YDSVL-------DDLTLPENVPKAA  258



>dbj|BAK01732.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=257

 Score =   400 bits (1027),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 185/231 (80%), Positives = 210/231 (91%), Gaps = 0/231 (0%)
 Frame = +1

Query  166  LGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAP  345
            + +AFY VG WIRETGQALDRLGCRLQGNY+FHEQ+SRHR LMN+FDK P VH+EAFVAP
Sbjct  1    MTKAFYAVGLWIRETGQALDRLGCRLQGNYFFHEQISRHRTLMNIFDKAPHVHKEAFVAP  60

Query  346  SASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIG  525
            SAS+IGDV+VG  SSIWYGCVLRGD N+V +G+GTNIQDNS+VHVAKSNL+GKV PTIIG
Sbjct  61   SASLIGDVEVGPGSSIWYGCVLRGDANNVQVGSGTNIQDNSVVHVAKSNLSGKVFPTIIG  120

Query  526  NNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEVWGG  705
            +NVTVGHSAVL GCTVEDEAFVGMGATLLDGVVVEK+ M+AAGALVRQNTRIPCGEVWGG
Sbjct  121  DNVTVGHSAVLQGCTVEDEAFVGMGATLLDGVVVEKHGMVAAGALVRQNTRIPCGEVWGG  180

Query  706  NPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK  858
            NPAKFLRKLT+EEI FI +S+ NYSNL + HA E+AK +++ +FEKVLRKK
Sbjct  181  NPAKFLRKLTDEEIGFIGESSANYSNLARAHAVESAKPMEKIDFEKVLRKK  231



>ref|XP_010465384.1| PREDICTED: gamma carbonic anhydrase 3, mitochondrial-like [Camelina 
sativa]
Length=258

 Score =   399 bits (1025),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 191/265 (72%), Positives = 221/265 (83%), Gaps = 9/265 (3%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG++GRAFY+VGFWIRETGQALDRLGCRLQG  +F EQLSRHR LMN+FDK PSV + AF
Sbjct  1    MGTMGRAFYSVGFWIRETGQALDRLGCRLQGKNHFREQLSRHRTLMNVFDKSPSVDKGAF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAP+ASI GDV VGR SSIWYGCVLRGD NS+S+G GTNIQDN+LVHVAKSNL+GKVLPT
Sbjct  61   VAPNASITGDVHVGRGSSIWYGCVLRGDANSISVGAGTNIQDNTLVHVAKSNLSGKVLPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            +IG+NVTVGHSAVLH CTVEDEA++G  AT+LDG  +EK+AM+A+GALVRQNTRIP GEV
Sbjct  121  VIGDNVTVGHSAVLHRCTVEDEAYIGTSATVLDGAHIEKHAMVASGALVRQNTRIPSGEV  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK--KDED  870
            WGGNPA+FLRK+TEEE  F S SA  YSNL Q HA ENAK+LDE EF+K+L KK  +D +
Sbjct  181  WGGNPARFLRKVTEEERVFFSSSAAEYSNLGQVHATENAKNLDETEFKKLLNKKNTRDSE  240

Query  871  NDSILGVVRETPPDLILPNNAPKAS  945
             DS+L        D+ LP N PKA+
Sbjct  241  YDSVL-------DDITLPENVPKAA  258



>ref|NP_001060439.1| Os07g0642900 [Oryza sativa Japonica Group]
 dbj|BAC16488.1| putative transcription factor APFI [Oryza sativa Japonica Group]
 dbj|BAD30257.1| putative transcription factor APFI [Oryza sativa Japonica Group]
 dbj|BAF22353.1| Os07g0642900 [Oryza sativa Japonica Group]
 gb|EAZ40840.1| hypothetical protein OsJ_25319 [Oryza sativa Japonica Group]
 dbj|BAG87352.1| unnamed protein product [Oryza sativa Japonica Group]
Length=273

 Score =   400 bits (1027),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 187/261 (72%), Positives = 223/261 (85%), Gaps = 3/261 (1%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LGRA YT G WIR TGQA+DRLG  +QG     EQL RHR +MN+F+K P +H++ F
Sbjct  1    MGTLGRAIYTAGKWIRGTGQAMDRLGSTIQGGLRVDEQLPRHRTIMNIFEKEPRIHKDVF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSA++IGD+++G  SSIWYG +LRGDVNS+ IG GTNIQDNSLVHV+K+N++GKVLPT
Sbjct  61   VAPSAAVIGDIEIGHGSSIWYGSILRGDVNSIHIGVGTNIQDNSLVHVSKANISGKVLPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            IIGN+VT+GHSAVLH C VEDEAFVGMGATLLDGVVVEK++M+ AG+LV+QNTRIP GEV
Sbjct  121  IIGNSVTIGHSAVLHACIVEDEAFVGMGATLLDGVVVEKHSMVGAGSLVKQNTRIPSGEV  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KDE  867
            W GNPAKFLRKLTEEE+AFI+QSA NY NL Q HAAENAK+ DE E EK+LRKK   KDE
Sbjct  181  WVGNPAKFLRKLTEEEMAFIAQSATNYINLAQVHAAENAKTFDEIELEKMLRKKFAHKDE  240

Query  868  DNDSILGVVRETPPDLILPNN  930
            + DS+LGVVRE PP+LILP++
Sbjct  241  EYDSMLGVVREIPPELILPDS  261



>emb|CDY23649.1| BnaA05g17800D [Brassica napus]
Length=277

 Score =   398 bits (1022),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 191/262 (73%), Positives = 227/262 (87%), Gaps = 4/262 (2%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LGRA YTVG WIR +GQALDR+G  LQG++ F E LSRHR LMN+FDK P V ++ F
Sbjct  1    MGTLGRAIYTVGKWIRGSGQALDRVGSLLQGSHRFEEHLSRHRTLMNVFDKSPLVDKDVF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSAS++GDVQ+G+ SSIWYGCVLRGDVN++S+G+GTNIQDNSLVHVAK+NL GKV PT
Sbjct  61   VAPSASVLGDVQIGKGSSIWYGCVLRGDVNNISVGSGTNIQDNSLVHVAKTNLGGKVSPT  120

Query  517  IIGNNVTV-GHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGE  693
             IG+NVTV GHSAV+HGCTVED+AFVGMGATLLDGVVVE +AM+AAG++V++NTRIP  E
Sbjct  121  TIGDNVTVAGHSAVIHGCTVEDDAFVGMGATLLDGVVVETHAMVAAGSIVKENTRIPSRE  180

Query  694  VWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KD  864
            VWGGNPAKF+RKLT+EEIA+IS+SA NY NL   HAAEN+KS DE E E+ LRKK   KD
Sbjct  181  VWGGNPAKFMRKLTDEEIAYISKSAENYINLAHIHAAENSKSFDEIEVERALRKKYARKD  240

Query  865  EDNDSILGVVRETPPDLILPNN  930
            ED DS+LG+VRETP +LILP+N
Sbjct  241  EDYDSMLGIVRETPAELILPDN  262



>ref|XP_002865062.1| gamma CA3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41321.1| gamma CA3 [Arabidopsis lyrata subsp. lyrata]
Length=269

 Score =   394 bits (1011),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 192/276 (70%), Positives = 222/276 (80%), Gaps = 20/276 (7%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG++G+AFY VGFWIRETGQALDRLGCRLQG  +F EQLSRHR LMN+FDK PSV + AF
Sbjct  1    MGTMGKAFYNVGFWIRETGQALDRLGCRLQGKNHFREQLSRHRTLMNVFDKAPSVDKGAF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLR-----------GDVNSVSIGTGTNIQDNSLVHVA  483
            VAP+ASI GDV VGR SSIWYGCVLR           GD NS+S+G GTNIQDN+LVHVA
Sbjct  61   VAPNASITGDVHVGRGSSIWYGCVLRDIPIDLTIYSAGDANSISVGAGTNIQDNALVHVA  120

Query  484  KSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALV  663
            K+NL+GKVLPT+IG+NVT+GHSAVLHGCTVEDEA++G  AT+LDG  VEK+AM+A+GALV
Sbjct  121  KTNLSGKVLPTVIGDNVTIGHSAVLHGCTVEDEAYIGTSATVLDGAHVEKHAMVASGALV  180

Query  664  RQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEK  843
            RQNTRIP GEVWGGNPAKFLRK+TEEE  F S SA+ YSNL Q HA ENAK+LDE EF+K
Sbjct  181  RQNTRIPSGEVWGGNPAKFLRKVTEEERVFFSSSAVEYSNLAQVHATENAKNLDEAEFKK  240

Query  844  VLRKK--KDEDNDSILGVVRETPPDLILPNNAPKAS  945
            +L KK  +D + DS+L        DL LP N PKA+
Sbjct  241  LLNKKNARDTEYDSVL-------DDLTLPENVPKAA  269



>gb|AFK09615.1| gamma carbonic anhydrase 3 [Arabidopsis kamchatica]
 gb|AFK09617.1| gamma carbonic anhydrase 3 [Arabidopsis halleri subsp. halleri]
Length=269

 Score =   393 bits (1009),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 191/276 (69%), Positives = 222/276 (80%), Gaps = 20/276 (7%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG++G+AFY VGFWIRETGQALDRLGCRLQG  +F EQLSRHR LMN+FDK PSV + AF
Sbjct  1    MGTMGKAFYNVGFWIRETGQALDRLGCRLQGKNHFREQLSRHRTLMNVFDKAPSVDKGAF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLR-----------GDVNSVSIGTGTNIQDNSLVHVA  483
            VAP+ASI GDV VGR SSIWYGCVLR           GD NS+++G GTNIQDN+LVHVA
Sbjct  61   VAPNASITGDVHVGRGSSIWYGCVLRDIPVDLTTYSAGDANSITVGAGTNIQDNALVHVA  120

Query  484  KSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALV  663
            K+NL+GKVLPT+IG+NVT+GHSAVLHGCTVEDEA++G  AT+LDG  VEK+AM+A+GALV
Sbjct  121  KTNLSGKVLPTVIGDNVTIGHSAVLHGCTVEDEAYIGTSATVLDGAHVEKHAMVASGALV  180

Query  664  RQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEK  843
            RQNTRIP GEVWGGNPAKFLRK+TEEE  F S SA+ YSNL Q HA ENAK+LDE EF+K
Sbjct  181  RQNTRIPSGEVWGGNPAKFLRKVTEEERVFFSSSAVEYSNLAQVHATENAKNLDEAEFKK  240

Query  844  VLRKK--KDEDNDSILGVVRETPPDLILPNNAPKAS  945
            +L KK  +D + DS+L        DL LP N PKA+
Sbjct  241  LLNKKNARDTEYDSVL-------DDLTLPENVPKAA  269



>ref|NP_001078808.1| gamma carbonic anhydrase 3 [Arabidopsis thaliana]
 gb|AED98223.1| gamma carbonic anhydrase 3 [Arabidopsis thaliana]
Length=269

 Score =   392 bits (1008),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 190/276 (69%), Positives = 223/276 (81%), Gaps = 20/276 (7%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG++G+AFY+VGFWIRETGQALDRLGCRLQG  +F EQLSRHR LMN+FDK P+V + AF
Sbjct  1    MGTMGKAFYSVGFWIRETGQALDRLGCRLQGKNHFREQLSRHRTLMNVFDKTPNVDKGAF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLR-----------GDVNSVSIGTGTNIQDNSLVHVA  483
            VAP+AS+ GDV VGR SSIWYGCVLR           GD NS+S+G GTNIQDN+LVHVA
Sbjct  61   VAPNASLSGDVHVGRGSSIWYGCVLRDIPFDLMTDSAGDANSISVGAGTNIQDNALVHVA  120

Query  484  KSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALV  663
            K+NL+GKVLPT+IG+NVT+GHSAVLHGCTVEDEA++G  AT+LDG  VEK+AM+A+GALV
Sbjct  121  KTNLSGKVLPTVIGDNVTIGHSAVLHGCTVEDEAYIGTSATVLDGAHVEKHAMVASGALV  180

Query  664  RQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEK  843
            RQNTRIP GEVWGGNPAKFLRK+TEEE  F S SA+ YSNL Q HA ENAK+LDE EF+K
Sbjct  181  RQNTRIPSGEVWGGNPAKFLRKVTEEERVFFSSSAVEYSNLAQAHATENAKNLDEAEFKK  240

Query  844  VLRKK--KDEDNDSILGVVRETPPDLILPNNAPKAS  945
            +L KK  +D + DS+L        DL LP N PKA+
Sbjct  241  LLNKKNARDTEYDSVL-------DDLTLPENVPKAA  269



>gb|KCW68230.1| hypothetical protein EUGRSUZ_F01883 [Eucalyptus grandis]
Length=241

 Score =   387 bits (995),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 191/235 (81%), Positives = 209/235 (89%), Gaps = 8/235 (3%)
 Frame = +1

Query  259  FHEQLSRHRVLMNLFDKVPSVHREAFVAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSI  438
             H  +SRHR LMN+FDK P V ++AFVAPSASIIGDVQVGR SSIWYGCVLRGDVNS+S+
Sbjct  3    IHLSVSRHRTLMNIFDKAPVVDKDAFVAPSASIIGDVQVGRGSSIWYGCVLRGDVNSISV  62

Query  439  GTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDG  618
            G+GTNIQDNSLVHVAKSNL+GKVLPTIIG+NVTVGHSAVLHGCTVEDEAFVGMGATLLDG
Sbjct  63   GSGTNIQDNSLVHVAKSNLSGKVLPTIIGDNVTVGHSAVLHGCTVEDEAFVGMGATLLDG  122

Query  619  VVVEKNAMIAAGALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGH  798
            VVVEK+ M+A GALVRQNTRIP GEVWGGNPAKFLRKLTEEE+AFI+QSA NYSNL Q H
Sbjct  123  VVVEKHGMVAGGALVRQNTRIPAGEVWGGNPAKFLRKLTEEEVAFITQSATNYSNLAQVH  182

Query  799  AAENAKSLDENEFEKVLRKK---KDEDNDSILGVVRETPPDLILPNN-----APK  939
            AAENAK  DE EFEKVLRKK   +DE+ DS+LGVVRETPP+LILP+N     APK
Sbjct  183  AAENAKPFDEIEFEKVLRKKFARRDEEYDSMLGVVRETPPELILPDNVLPGKAPK  237



>gb|EPS62312.1| hypothetical protein M569_12479, partial [Genlisea aurea]
Length=267

 Score =   388 bits (996),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 181/261 (69%), Positives = 223/261 (85%), Gaps = 3/261 (1%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LG+A Y +G WIR  GQA+DRLG  +QG Y+  E +S+HR L+ L +K P V ++AF
Sbjct  1    MGTLGKAVYRLGSWIRVAGQAVDRLGSTVQGGYFVPETISKHRTLLALSEKTPIVDKDAF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            +APS+S+IGDVQVG  SSIWYG VLRGDVNS+S+GTGTNIQDNSLVHVAKSN+ GK LPT
Sbjct  61   IAPSSSVIGDVQVGSGSSIWYGAVLRGDVNSISVGTGTNIQDNSLVHVAKSNIGGKELPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            IIGNNVTVGHSAV+HGCT++DEAF+GMGATLLDGV VEK++M+ AG+LVRQNTRIP GE+
Sbjct  121  IIGNNVTVGHSAVIHGCTIDDEAFIGMGATLLDGVTVEKHSMVGAGSLVRQNTRIPYGEI  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KDE  867
            W GNPAKFLRKLT+EEI+FISQSA+NY NL + HAAEN+KS +E + EK LRKK   +DE
Sbjct  181  WAGNPAKFLRKLTDEEISFISQSAVNYINLAKVHAAENSKSNEEIDLEKALRKKFARRDE  240

Query  868  DNDSILGVVRETPPDLILPNN  930
            + DS++G++RETP +LILP+N
Sbjct  241  EYDSMIGIIRETPQELILPDN  261



>gb|AFK09616.1| gamma carbonic anhydrase 3 [Arabidopsis halleri subsp. gemmifera]
Length=269

 Score =   387 bits (995),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 189/276 (68%), Positives = 220/276 (80%), Gaps = 20/276 (7%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG++G+AFY VGFWIRETGQALDRLGCRLQG  +F EQLS HR LMN+FDK PSV + AF
Sbjct  1    MGTMGKAFYNVGFWIRETGQALDRLGCRLQGKNHFREQLSTHRTLMNVFDKAPSVDKGAF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLR-----------GDVNSVSIGTGTNIQDNSLVHVA  483
            VAP+ASI GDV VGR SSIWYGCVLR           GD NS+++G  TNIQDN+LVHVA
Sbjct  61   VAPNASITGDVHVGRGSSIWYGCVLRDIPVDLTTYSAGDANSITVGARTNIQDNALVHVA  120

Query  484  KSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALV  663
            K+NL+GKVLPT+IG+NVT+GHSAVLHGCTVEDEA++G  AT+LDG  VEK+AM+A+GALV
Sbjct  121  KTNLSGKVLPTVIGDNVTIGHSAVLHGCTVEDEAYIGTSATVLDGAHVEKHAMVASGALV  180

Query  664  RQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEK  843
            RQNTRIP GEVWGGNPAKFLRK+TEEE  F S SA+ YSNL Q HA ENAK+LDE EF+K
Sbjct  181  RQNTRIPSGEVWGGNPAKFLRKVTEEERVFFSSSAVEYSNLAQVHATENAKNLDEAEFKK  240

Query  844  VLRKK--KDEDNDSILGVVRETPPDLILPNNAPKAS  945
            +L KK  +D + DS+L        DL LP N PKA+
Sbjct  241  LLNKKNARDTEYDSVL-------DDLTLPENVPKAA  269



>gb|AFK09618.1| gamma carbonic anhydrase 3 [Arabidopsis lyrata subsp. lyrata]
Length=268

 Score =   385 bits (990),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 190/276 (69%), Positives = 221/276 (80%), Gaps = 21/276 (8%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG++G+AFY VGFWIRETG+ALDRLGCRLQG  +F EQLSRHR LMN+FDK PSV + AF
Sbjct  1    MGTMGKAFYNVGFWIRETGRALDRLGCRLQGKNHFREQLSRHRTLMNVFDKAPSVDKGAF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLR-----------GDVNSVSIGTGTNIQDNSLVHVA  483
            VAP+ASI GDV VGR  SIWYGCVLR           GD NS+S+G GTNIQDN+LVHVA
Sbjct  61   VAPNASITGDVHVGR-GSIWYGCVLRDIPIDLTIYSAGDANSISVGAGTNIQDNALVHVA  119

Query  484  KSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALV  663
            K+NL+GKVLPT+IG+NVT+GHSAVLHGCTVEDEA++G  AT+LDG  VEK+AM+A+GALV
Sbjct  120  KTNLSGKVLPTVIGDNVTIGHSAVLHGCTVEDEAYIGTSATVLDGAHVEKHAMVASGALV  179

Query  664  RQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEK  843
            RQNTRIP GEVWGGNPAKFLRK+TEEE  F S SA+ YSNL Q HA ENAK+LDE EF+K
Sbjct  180  RQNTRIPSGEVWGGNPAKFLRKVTEEERVFFSSSAVEYSNLAQVHATENAKNLDEAEFKK  239

Query  844  VLRKK--KDEDNDSILGVVRETPPDLILPNNAPKAS  945
            +L KK  +D + DS+L        DL LP N PKA+
Sbjct  240  LLNKKNARDTEYDSVL-------DDLTLPENVPKAA  268



>gb|ADQ43216.1| GAMMA CA3/carbonate dehydratase [Schrenkiella parvula]
Length=255

 Score =   382 bits (982),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 188/265 (71%), Positives = 221/265 (83%), Gaps = 12/265 (5%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG++GRAFY+VGFWIRETGQALDRLGCRLQG  +F EQ SRHR LMN+FDK PSV +EAF
Sbjct  1    MGTMGRAFYSVGFWIRETGQALDRLGCRLQGKNHFREQ-SRHRTLMNVFDKAPSVDKEAF  59

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSASIIGDV VGR SSIWYGCVLR D NS+S+G GTNIQDNSLVHVAKSNL+GKVLPT
Sbjct  60   VAPSASIIGDVHVGRGSSIWYGCVLR-DANSISVGAGTNIQDNSLVHVAKSNLSGKVLPT  118

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            +IG+NVT+ HSAVLHGCTVED+A++G  AT+LDG  VEK AM+A+GALVRQNTRIP GEV
Sbjct  119  VIGDNVTI-HSAVLHGCTVEDKAYIGASATVLDGAHVEKQAMVASGALVRQNTRIPSGEV  177

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK--KDED  870
            WGGNPA+F+RK+TE+E  F S SA++YSNL + H AENAK+LDE +F+K+L KK  +D +
Sbjct  178  WGGNPARFMRKVTEDERTFFSSSAVDYSNLAKVHVAENAKNLDETDFKKLLYKKNARDAE  237

Query  871  NDSILGVVRETPPDLILPNNAPKAS  945
             DS+L        DL L  N PKA+
Sbjct  238  YDSVLN-------DLNLSENVPKAA  255



>ref|XP_009103523.1| PREDICTED: gamma carbonic anhydrase 3, mitochondrial [Brassica 
rapa]
Length=253

 Score =   382 bits (981),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 180/260 (69%), Positives = 213/260 (82%), Gaps = 9/260 (3%)
 Frame = +1

Query  166  LGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAP  345
            +G+A Y+VGFWIRETGQALDRLGCRLQG  +F EQLSRHR LMN+FDK PSV ++AFVAP
Sbjct  3    MGKALYSVGFWIRETGQALDRLGCRLQGKNHFREQLSRHRTLMNVFDKAPSVDKQAFVAP  62

Query  346  SASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIG  525
            SAS+IG+V VG  SSIWYGCVLRGD NS+S+G GTNIQDN+LVHVAKSNL+GKVLPT+IG
Sbjct  63   SASLIGNVHVGPASSIWYGCVLRGDANSISVGAGTNIQDNTLVHVAKSNLSGKVLPTLIG  122

Query  526  NNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEVWGG  705
            +NVT+GHSAVLHGCTVEDEA++G  AT+LDG  VEK AM+ +GALVRQNTRIP GEVWGG
Sbjct  123  DNVTIGHSAVLHGCTVEDEAYIGASATVLDGAHVEKQAMVESGALVRQNTRIPSGEVWGG  182

Query  706  NPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKKKDEDNDSIL  885
            NPA+F+RK+TEEE AF S SA++YSNL Q H AEN K+LDE +F+K+L KK   D +   
Sbjct  183  NPARFMRKVTEEEKAFFSSSAVDYSNLAQVHTAENTKNLDETDFKKLLYKKNARDAEY--  240

Query  886  GVVRETPPDLILPNNAPKAS  945
                    DL L  N PK++
Sbjct  241  -------DDLSLSENVPKSA  253



>emb|CDY45234.1| BnaA07g12560D [Brassica napus]
Length=253

 Score =   382 bits (980),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 180/260 (69%), Positives = 213/260 (82%), Gaps = 9/260 (3%)
 Frame = +1

Query  166  LGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAP  345
            +G+A Y+VGFWIRETGQALDRLGCRLQG  +F EQLSRHR LMN+FDK PSV ++AFVAP
Sbjct  3    MGKALYSVGFWIRETGQALDRLGCRLQGKNHFREQLSRHRTLMNVFDKAPSVDKQAFVAP  62

Query  346  SASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIG  525
            SAS+IG+V VG  SSIWYGCVLRGD NS+S+G GTNIQDN+LVHVAKSNL+GKVLPT+IG
Sbjct  63   SASLIGNVHVGPASSIWYGCVLRGDANSISVGAGTNIQDNTLVHVAKSNLSGKVLPTLIG  122

Query  526  NNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEVWGG  705
            +NVT+GHSAVLHGCTVEDEA++G  AT+LDG  VEK AM+ +GALVRQNT+IP GEVWGG
Sbjct  123  DNVTIGHSAVLHGCTVEDEAYIGASATVLDGAHVEKQAMVESGALVRQNTKIPSGEVWGG  182

Query  706  NPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKKKDEDNDSIL  885
            NPA+FLRK+TEEE AF S SA++YSNL Q H AEN K+LDE +F+K+L KK   D +   
Sbjct  183  NPARFLRKVTEEEKAFFSSSAVDYSNLAQVHTAENTKNLDETDFKKLLYKKNARDAEY--  240

Query  886  GVVRETPPDLILPNNAPKAS  945
                    DL L  N PK++
Sbjct  241  -------DDLSLSENVPKSA  253



>gb|KJB43471.1| hypothetical protein B456_007G201900 [Gossypium raimondii]
Length=226

 Score =   380 bits (975),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 187/226 (83%), Positives = 205/226 (91%), Gaps = 8/226 (4%)
 Frame = +1

Query  292  MNLFDKVPSVHREAFVAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSL  471
            MN+FDK P V R+AFVAPSAS+IGDVQVGR SSIWYGCVLRGDVNS+SIG+GTNIQDNSL
Sbjct  1    MNVFDKAPIVDRDAFVAPSASVIGDVQVGRSSSIWYGCVLRGDVNSISIGSGTNIQDNSL  60

Query  472  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  651
            VHVAKSNL+GKVLPTIIG+NVTVGHSAVLHGCTVEDEAFVGMGATLLDGV VEK+AM+AA
Sbjct  61   VHVAKSNLSGKVLPTIIGSNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVYVEKHAMVAA  120

Query  652  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  831
            GALVRQNTRIPCGEVWGGNPAKFLRKLTEEE+ FISQSALNY+NL Q HAAENAKS DE 
Sbjct  121  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEMTFISQSALNYTNLAQVHAAENAKSFDEI  180

Query  832  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPNN-----APKAS  945
            E E +LRKK   +DE+ DS+LGVVRETPP+LILP+N     APKA+
Sbjct  181  ELETMLRKKFARRDEEYDSMLGVVRETPPELILPDNIIPDKAPKAA  226



>emb|CDY30772.1| BnaC07g16720D [Brassica napus]
Length=257

 Score =   378 bits (970),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 180/262 (69%), Positives = 216/262 (82%), Gaps = 9/262 (3%)
 Frame = +1

Query  166  LGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAP  345
            +GRA Y+VGFWIRETGQALDRLGCRLQG  +F EQLSRHR LMN+FDK PSV ++AFVAP
Sbjct  3    MGRALYSVGFWIRETGQALDRLGCRLQGKNHFREQLSRHRTLMNVFDKSPSVDKQAFVAP  62

Query  346  SASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIG  525
            SAS+IG+V VG  SSIWYGCVLRGD NS+S+G GTNIQDN+LVHVAKSNL+GKVLPT+IG
Sbjct  63   SASLIGNVHVGPASSIWYGCVLRGDANSISVGAGTNIQDNTLVHVAKSNLSGKVLPTLIG  122

Query  526  NNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEVWGG  705
            +NVT+GHSAVLHGCTV+D +++G  AT+LDG  VEK AM+ +GALVRQNTRIP GEVWGG
Sbjct  123  DNVTIGHSAVLHGCTVDDGSYIGASATVLDGAHVEKQAMVESGALVRQNTRIPSGEVWGG  182

Query  706  NPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK--KDEDNDS  879
            NPA+FLRK+TEEE AF S SA++ SNL Q HA EN K+LDE +F+K+L KK  +D + DS
Sbjct  183  NPARFLRKVTEEEKAFFSSSAVDCSNLAQAHAGENTKNLDETDFKKLLYKKNSRDAEYDS  242

Query  880  ILGVVRETPPDLILPNNAPKAS  945
            +L        DL L  + PK++
Sbjct  243  VL-------SDLSLSEHVPKSA  257



>gb|KFK28325.1| hypothetical protein AALP_AA8G501300 [Arabis alpina]
Length=257

 Score =   377 bits (967),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 175/237 (74%), Positives = 203/237 (86%), Gaps = 0/237 (0%)
 Frame = +1

Query  166  LGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAP  345
            + +AFY+VGFWIRETGQALDRLGCRLQG  +F EQLSRHR LMN+FDK PSV + AFVAP
Sbjct  1    MAKAFYSVGFWIRETGQALDRLGCRLQGKNHFREQLSRHRTLMNVFDKAPSVDKGAFVAP  60

Query  346  SASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIG  525
            SASI GDV VGR SSIWYGCVLRGD NS+S+G GT+IQDN+L+HVAKSNL+GKVLPT+IG
Sbjct  61   SASITGDVNVGRGSSIWYGCVLRGDANSISVGAGTSIQDNALIHVAKSNLSGKVLPTVIG  120

Query  526  NNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEVWGG  705
            +NVT+GHSAVLHGCTVEDEA++   AT+LDG  VEK+AM+A GALVRQNTRIP GEVWGG
Sbjct  121  DNVTIGHSAVLHGCTVEDEAYISASATVLDGAHVEKHAMVAPGALVRQNTRIPSGEVWGG  180

Query  706  NPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKKKDEDND  876
            NPA FLRK+TEEE AF S SA++ S L Q HAAENAK+LDE +F+K+L KK   D +
Sbjct  181  NPAGFLRKVTEEEKAFFSSSAVDNSKLAQAHAAENAKNLDETDFKKLLYKKNARDTE  237



>gb|KJB17751.1| hypothetical protein B456_003G013500 [Gossypium raimondii]
Length=229

 Score =   374 bits (961),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 187/261 (72%), Positives = 202/261 (77%), Gaps = 45/261 (17%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LG+A YTVGFW+RETGQALDRLGCRLQGNYYF EQLSRHR LMN+FDK P V R+AF
Sbjct  1    MGTLGKAIYTVGFWVRETGQALDRLGCRLQGNYYFQEQLSRHRTLMNVFDKAPFVDRDAF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSAS+IGDVQVGR SSIWYGCVLRG                                 
Sbjct  61   VAPSASVIGDVQVGRGSSIWYGCVLRG---------------------------------  87

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
                     HSAVLHGCTVEDEAFVGMGATLLDGV VEK+AM+AAGALVRQNTRIPCGEV
Sbjct  88   ---------HSAVLHGCTVEDEAFVGMGATLLDGVYVEKHAMVAAGALVRQNTRIPCGEV  138

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KDE  867
            WGGNPAKFLRKLTEEE+AFISQSALNYSNL Q HAAEN KS DE EFEK+LRKK   +DE
Sbjct  139  WGGNPAKFLRKLTEEEMAFISQSALNYSNLAQVHAAENGKSFDEIEFEKMLRKKFARRDE  198

Query  868  DNDSILGVVRETPPDLILPNN  930
            + DS+LGVVRETPP+LILP+N
Sbjct  199  EYDSMLGVVRETPPELILPDN  219



>emb|CDY50984.1| BnaC02g48920D [Brassica napus]
Length=260

 Score =   375 bits (962),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 181/265 (68%), Positives = 219/265 (83%), Gaps = 9/265 (3%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            M S+GRA Y+VGFWIRETGQALDRLGCRLQG  +F EQLSRHR LMN+FDK P V +EA 
Sbjct  1    MASMGRALYSVGFWIRETGQALDRLGCRLQGKNHFREQLSRHRTLMNVFDKAPIVDKEAL  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSASIIG+V +G  SSIWYGCVLRGD N++++G GTNIQDNSLVHVAKSNL GKVLPT
Sbjct  61   VAPSASIIGNVHLGPGSSIWYGCVLRGDANTITVGAGTNIQDNSLVHVAKSNLNGKVLPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            +IG+NVT+G+SAVLHGCT+EDE+++G  AT+LDG  VEK+A++ +G+LVRQNTRIP GEV
Sbjct  121  LIGDNVTIGNSAVLHGCTLEDESYIGASATVLDGAHVEKHAIVESGSLVRQNTRIPSGEV  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK--KDED  870
            WGGNPA+FLRK+TEEE AF S SA++YSNL Q HAA+N K+LDE +F+K+L KK  +D +
Sbjct  181  WGGNPARFLRKVTEEERAFFSTSAMDYSNLAQVHAAQNTKNLDETDFKKLLYKKNARDAE  240

Query  871  NDSILGVVRETPPDLILP-NNAPKA  942
             DS+L        DL L  N+ PKA
Sbjct  241  YDSLLN------DDLTLSENHLPKA  259



>gb|ACU22925.1| unknown [Glycine max]
Length=211

 Score =   372 bits (954),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 175/210 (83%), Positives = 191/210 (91%), Gaps = 0/210 (0%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LGRA Y+VG WIRETGQA+DRLG RL G YYF EQLSRHR LMN+FDK P V ++ F
Sbjct  1    MGTLGRAIYSVGNWIRETGQAIDRLGSRLHGGYYFQEQLSRHRTLMNIFDKAPVVDKDVF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSAS+IGDVQ+GR SSIWYG VLRGDVNS+ +G GTNIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   VAPSASVIGDVQLGRGSSIWYGVVLRGDVNSIRVGNGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            IIG+NVTVGHSAV+HGCTVEDEAFVGMGA LLDGVVVEKNAM+AAGALVRQNTRIP GEV
Sbjct  121  IIGDNVTVGHSAVIHGCTVEDEAFVGMGAILLDGVVVEKNAMVAAGALVRQNTRIPSGEV  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNL  786
            W GNPAKFLRKLT+EEIAFISQSA NY+NL
Sbjct  181  WAGNPAKFLRKLTDEEIAFISQSATNYTNL  210



>gb|ACJ85087.1| unknown [Medicago truncatula]
Length=226

 Score =   370 bits (949),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 176/227 (78%), Positives = 201/227 (89%), Gaps = 1/227 (0%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LGRA Y+VG  IR+TGQA+DRLG  LQG Y   EQLSRHR ++N+FDK P + ++ F
Sbjct  1    MGTLGRAIYSVGQLIRKTGQAVDRLGSHLQGGY-IEEQLSRHRTVLNIFDKAPVIDKDVF  59

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSA++IGDVQ+G+ SSIWYG VLRGDVN + IG+GTN+QDNSLVHVAKSNL+GKVLPT
Sbjct  60   VAPSAAVIGDVQIGKGSSIWYGSVLRGDVNIIRIGSGTNLQDNSLVHVAKSNLSGKVLPT  119

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            IIG+NVTVGHSAVLHGCTVEDEAFVGMGA LLDGVVVEKNAM+AAGALVRQNT+IP GEV
Sbjct  120  IIGDNVTVGHSAVLHGCTVEDEAFVGMGAILLDGVVVEKNAMVAAGALVRQNTKIPSGEV  179

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEF  837
            W GNPAKFLRKLT+EEIAFISQSA NY+NL Q HAAEN+KS +E EF
Sbjct  180  WAGNPAKFLRKLTDEEIAFISQSATNYTNLAQVHAAENSKSYEEIEF  226



>gb|ACG33606.1| transcription factor APFI [Zea mays]
Length=250

 Score =   364 bits (935),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 174/236 (74%), Positives = 201/236 (85%), Gaps = 2/236 (1%)
 Frame = +1

Query  232  GCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAPSASIIGDVQVGRHSSIWYGCVL  411
            G R  G Y+FHEQ+SRHR +MN+FDK P VH++AFVAPSAS+IGDVQVG  +SIWYGCVL
Sbjct  14   GRRGGGKYFFHEQISRHRTIMNIFDKTPHVHKDAFVAPSASLIGDVQVGSGASIWYGCVL  73

Query  412  RGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFV  591
            RGD N + IG+GTNIQDNSL+HVAKSNL+GKV PT IGNNVTVGHSAVL GCTVEDEAFV
Sbjct  74   RGDANIIQIGSGTNIQDNSLIHVAKSNLSGKVFPTTIGNNVTVGHSAVLQGCTVEDEAFV  133

Query  592  GMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSAL  771
            G+GATLLDGVVVEK+ M+AAGALVRQNTRIPCGEVWGGNPAKFLRKLT++EI+FI++SA 
Sbjct  134  GIGATLLDGVVVEKHGMVAAGALVRQNTRIPCGEVWGGNPAKFLRKLTDDEISFIAESAA  193

Query  772  NYSNLKQGHAAENAKSLDENEFEKVLRKK--KDEDNDSILGVVRETPPDLILPNNA  933
            NYSNL + HAAENAK L++ EFEKVL KK    ++ DS +GV    PP+L  PN A
Sbjct  194  NYSNLSKVHAAENAKPLEKIEFEKVLGKKFAHQDEYDSSIGVTEGAPPELTSPNPA  249



>ref|XP_002894036.1| hypothetical protein ARALYDRAFT_891497 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70295.1| hypothetical protein ARALYDRAFT_891497 [Arabidopsis lyrata subsp. 
lyrata]
Length=255

 Score =   358 bits (920),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 176/261 (67%), Positives = 209/261 (80%), Gaps = 26/261 (10%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LGRA YTVG WIR TGQALDR+G  LQG++   E LSRHR LMN+FDK P V ++ F
Sbjct  1    MGTLGRAIYTVGNWIRGTGQALDRVGSLLQGSHRIEEHLSRHRTLMNVFDKSPLVDKDVF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSAS+IGDVQ+G+ SSIWYGCVLRGDVN++S+G+GTNIQDN+LVHVAK+N++GKVLPT
Sbjct  61   VAPSASVIGDVQIGKGSSIWYGCVLRGDVNNISVGSGTNIQDNTLVHVAKTNISGKVLPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            +IG+NVTVGHSAV+HGCTVEDEAFVGMGATLLDGVVVEK+AM+AAG+LV+QNTRIP GE 
Sbjct  121  LIGDNVTVGHSAVIHGCTVEDEAFVGMGATLLDGVVVEKHAMVAAGSLVKQNTRIPSGE-  179

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KDE  867
                                  SA NY NL Q HA+EN+KS D+ E E+ LRKK   KDE
Sbjct  180  ----------------------SAKNYINLAQIHASENSKSFDQIEVERALRKKYARKDE  217

Query  868  DNDSILGVVRETPPDLILPNN  930
            D DS+LG+ RETPP+LILP+N
Sbjct  218  DYDSMLGITRETPPELILPDN  238



>emb|CDY55089.1| BnaA02g34770D [Brassica napus]
Length=258

 Score =   358 bits (920),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 174/260 (67%), Positives = 213/260 (82%), Gaps = 4/260 (2%)
 Frame = +1

Query  166  LGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAP  345
            +GRA Y+VGFWIRETGQALDRLGCRLQG  +F EQLSRHR LMN+FDK P V ++AFVAP
Sbjct  1    MGRALYSVGFWIRETGQALDRLGCRLQGKNHFREQLSRHRTLMNVFDKAPLVDKDAFVAP  60

Query  346  SASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIG  525
            SASIIG+V +G  SSIWYGCVLRGD N++++G GTNIQDNSLVHVAKSNL GKVLPT+IG
Sbjct  61   SASIIGNVHLGPGSSIWYGCVLRGDANTITVGAGTNIQDNSLVHVAKSNLNGKVLPTLIG  120

Query  526  NNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEVWGG  705
            +NVT+ +SA+L GCT+EDE+++G  AT+LDG  VEK+A++ +GALVR NTRIP GEVWGG
Sbjct  121  DNVTIRNSALLLGCTLEDESYIGASATVLDGAHVEKHAIVESGALVRHNTRIPSGEVWGG  180

Query  706  NPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKKKDEDNDSIL  885
            NPA+FLRK+TEEE AF S SA++YSNL Q HAAEN ++LDE +F K+L KKK  D +   
Sbjct  181  NPARFLRKVTEEERAFFSTSAVDYSNLAQVHAAENTENLDETDFNKLLYKKKARDAEYDS  240

Query  886  GVVRETPPDLILP-NNAPKA  942
             ++ +   DL L  N+ PKA
Sbjct  241  PLLND---DLTLSENHLPKA  257



>tpg|DAA63887.1| TPA: hypothetical protein ZEAMMB73_753225 [Zea mays]
Length=239

 Score =   358 bits (918),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 169/223 (76%), Positives = 198/223 (89%), Gaps = 3/223 (1%)
 Frame = +1

Query  271  LSRHRVLMNLFDKVPSVHREAFVAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGT  450
            +SRHR +MN+F+K P +HR+ FVAPSA++IGDV++G  SSIWYG +LRGDVNS+ IG+GT
Sbjct  5    VSRHRTIMNIFEKEPRIHRDVFVAPSAAVIGDVEIGHGSSIWYGSILRGDVNSIHIGSGT  64

Query  451  NIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVE  630
            NIQDNSLVHV+K+N++GKVLPTIIG+NVTVGHSAVLH CT+EDEAFVGMGATLLDGVVVE
Sbjct  65   NIQDNSLVHVSKANISGKVLPTIIGSNVTVGHSAVLHACTIEDEAFVGMGATLLDGVVVE  124

Query  631  KNAMIAAGALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAEN  810
            K++M+ AG+LV+QNTRIP GEVW GNPAKFLRKLTEEEIAFI+QSA NY NL Q HAAEN
Sbjct  125  KHSMVGAGSLVKQNTRIPSGEVWVGNPAKFLRKLTEEEIAFIAQSATNYINLAQVHAAEN  184

Query  811  AKSLDENEFEKVLRKK---KDEDNDSILGVVRETPPDLILPNN  930
            AKS DE E EK+LRKK   KDE+ DS+LGVVRE PP LILP+N
Sbjct  185  AKSFDEIELEKMLRKKYAHKDEEYDSMLGVVREIPPQLILPDN  227



>ref|XP_002968991.1| hypothetical protein SELMODRAFT_145865 [Selaginella moellendorffii]
 ref|XP_002990654.1| hypothetical protein SELMODRAFT_448100 [Selaginella moellendorffii]
 gb|EFJ08286.1| hypothetical protein SELMODRAFT_448100 [Selaginella moellendorffii]
 gb|EFJ30107.1| hypothetical protein SELMODRAFT_145865 [Selaginella moellendorffii]
Length=266

 Score =   358 bits (919),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 172/261 (66%), Positives = 204/261 (78%), Gaps = 2/261 (1%)
 Frame = +1

Query  169  GRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAPS  348
            GRA Y +GFWIRETGQALDRLGCR+QGNY F EQL+RHR LMNL+DK P V    F+APS
Sbjct  3    GRALYQIGFWIRETGQALDRLGCRIQGNYIFREQLNRHRTLMNLYDKKPEVMENVFIAPS  62

Query  349  ASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGN  528
            A++IGDV V   SSIWYGCVLRGDVN + +G GTNIQDN+LVHVA++ ++GKV PTIIG+
Sbjct  63   ATLIGDVSVAGGSSIWYGCVLRGDVNEIRVGYGTNIQDNTLVHVARTGMSGKVAPTIIGD  122

Query  529  NVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEVWGGN  708
             VT+GH+AVLH CTV+DE+FVGMGATLLDGV VEK AM+ AG+LV QNTRIP GE+W GN
Sbjct  123  AVTIGHNAVLHACTVDDESFVGMGATLLDGVYVEKGAMVGAGSLVTQNTRIPSGEIWAGN  182

Query  709  PAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK--KDEDNDSI  882
            PA+FLR LTEEE +FI++SA NYSNL   HA EN K  DE E +KVLRKK     + D+ 
Sbjct  183  PARFLRNLTEEETSFITKSAENYSNLAIVHAQENEKYSDEIEEDKVLRKKWCYQLEEDNY  242

Query  883  LGVVRETPPDLILPNNAPKAS  945
            LGV+R+ P  +     A K S
Sbjct  243  LGVMRQAPFQMPFGVKAVKRS  263



>ref|XP_006305517.1| hypothetical protein CARUB_v10009987mg [Capsella rubella]
 gb|EOA38415.1| hypothetical protein CARUB_v10009987mg [Capsella rubella]
Length=230

 Score =   353 bits (905),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 170/216 (79%), Positives = 194/216 (90%), Gaps = 3/216 (1%)
 Frame = +1

Query  292  MNLFDKVPSVHREAFVAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSL  471
            MN+FDK P V + AFVAPSAS+IGDVQ+GR SSIWYGCVLRGD N+VS+G+GTNIQDNSL
Sbjct  1    MNVFDKAPIVDKTAFVAPSASVIGDVQIGRGSSIWYGCVLRGDANTVSVGSGTNIQDNSL  60

Query  472  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  651
            VHVAKSNL+GKV PTIIG+NVT+GHSAVLHGCTVE++ F+GMGATLLDGVVVE++ M+AA
Sbjct  61   VHVAKSNLSGKVHPTIIGDNVTIGHSAVLHGCTVENQTFIGMGATLLDGVVVEEHGMVAA  120

Query  652  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  831
            GALVRQNTRIP GEVWGGNPA+FLRKLT+EEIAFIS+SA NYSNL Q HAAENAK L+  
Sbjct  121  GALVRQNTRIPSGEVWGGNPARFLRKLTDEEIAFISESATNYSNLAQAHAAENAKPLNAI  180

Query  832  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPNN  930
            EFEKVLRKK   KDE+ DS+LG+VRETP +L LPNN
Sbjct  181  EFEKVLRKKHAGKDEEYDSMLGIVRETPSELNLPNN  216



>gb|AFW79497.1| hypothetical protein ZEAMMB73_562884 [Zea mays]
Length=218

 Score =   348 bits (893),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 167/217 (77%), Positives = 193/217 (89%), Gaps = 3/217 (1%)
 Frame = +1

Query  292  MNLFDKVPSVHREAFVAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSL  471
            MN+FDK P VHR+AFVAPSAS+IGDVQVG+ +SIWYGCVLRGD N++ IG+GTNIQDNSL
Sbjct  1    MNIFDKTPHVHRDAFVAPSASLIGDVQVGQGASIWYGCVLRGDANNIQIGSGTNIQDNSL  60

Query  472  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  651
            VHVAKSNL+GKV PTIIGNNVT+GHSAVL GCTVEDEAFVGMGATLLDGVVV K+ M+AA
Sbjct  61   VHVAKSNLSGKVFPTIIGNNVTIGHSAVLQGCTVEDEAFVGMGATLLDGVVVGKHGMVAA  120

Query  652  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  831
            G+LVRQNTRIPCGEVWGGNPAKFLRKLT++EIAFI++SA NYSNL + HAAENAK L++ 
Sbjct  121  GSLVRQNTRIPCGEVWGGNPAKFLRKLTDDEIAFITESASNYSNLSKVHAAENAKPLEKI  180

Query  832  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPNNA  933
            EFEKVLRKK   +DE+ DS +G+ R +PP+L  PN A
Sbjct  181  EFEKVLRKKFAHQDEEYDSSIGITRGSPPELTSPNPA  217



>gb|EMT05784.1| hypothetical protein F775_31542 [Aegilops tauschii]
Length=229

 Score =   338 bits (867),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 166/229 (72%), Positives = 194/229 (85%), Gaps = 8/229 (3%)
 Frame = +1

Query  292  MNLFDKVPSVHREAFVAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSL  471
            M++FDK P ++++ FVAPSAS+IGDV++G  SSIWYG VLRGDVNS+ IG+G+NIQDNSL
Sbjct  1    MSIFDKEPRINKDVFVAPSASVIGDVEIGHGSSIWYGSVLRGDVNSIRIGSGSNIQDNSL  60

Query  472  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  651
            VHVAK+N++GKVLPTIIG+NVTVGHSAVLH CT+EDEAFVGMGATLLDGVVVEK++M+ A
Sbjct  61   VHVAKTNISGKVLPTIIGSNVTVGHSAVLHACTIEDEAFVGMGATLLDGVVVEKHSMVGA  120

Query  652  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  831
            G+LV+QNTRIP GEVW GNPAKFLRKLTEEEI FI+QSA NY NL   HA EN+KS DE 
Sbjct  121  GSLVKQNTRIPSGEVWVGNPAKFLRKLTEEEITFIAQSAANYINLAHVHATENSKSFDEI  180

Query  832  EFEKVLRKK---KDEDNDSILGVVRETPPDLILPNN-----APKAS*AQ  954
            E EK LRKK   KDE+ DS+LGVVRE PP LILP+N     APKA+ A 
Sbjct  181  ELEKKLRKKFAHKDEEYDSMLGVVREIPPQLILPDNILPDKAPKAAVAH  229



>gb|KJB12033.1| hypothetical protein B456_002G126800 [Gossypium raimondii]
Length=194

 Score =   335 bits (859),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 160/180 (89%), Positives = 171/180 (95%), Gaps = 0/180 (0%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MGSLG+A YTVGFWIRETGQALDRLGCRLQGNY+F EQLSRHR LMNLFDK P V ++AF
Sbjct  1    MGSLGKAIYTVGFWIRETGQALDRLGCRLQGNYFFQEQLSRHRTLMNLFDKSPLVDKDAF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSAS+IGDVQVGR SSIWYGCVLRGDVNS+S+G+GTNIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   VAPSASVIGDVQVGRGSSIWYGCVLRGDVNSISVGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
             IGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEK+AM+AAGALVRQNTRIP GEV
Sbjct  121  NIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKHAMVAAGALVRQNTRIPAGEV  180



>ref|XP_007204710.1| hypothetical protein PRUPE_ppa009928mg [Prunus persica]
 gb|EMJ05909.1| hypothetical protein PRUPE_ppa009928mg [Prunus persica]
Length=190

 Score =   332 bits (852),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 157/185 (85%), Positives = 171/185 (92%), Gaps = 0/185 (0%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LGRA YTVGFWIRETGQA+DRLG RLQGNYYF EQLSRHR LMN+FDK P V ++AF
Sbjct  1    MGTLGRAIYTVGFWIRETGQAIDRLGSRLQGNYYFQEQLSRHRTLMNVFDKAPVVDKDAF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSASI+G VQVGR SSIWYGCVLRGDVNS+SIG+GTNIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   VAPSASIVGQVQVGRGSSIWYGCVLRGDVNSISIGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            +IG+NVTVGHSAVLHGCTVEDEAFVGM ATLLDGV VEK+AM+AAGALVRQNTRIPCGEV
Sbjct  121  VIGDNVTVGHSAVLHGCTVEDEAFVGMAATLLDGVYVEKHAMVAAGALVRQNTRIPCGEV  180

Query  697  WGGNP  711
               +P
Sbjct  181  CQSSP  185



>ref|XP_007136608.1| hypothetical protein PHAVU_009G0592001g, partial [Phaseolus vulgaris]
 ref|XP_007136613.1| hypothetical protein PHAVU_009G0594000g, partial [Phaseolus vulgaris]
 gb|ESW08602.1| hypothetical protein PHAVU_009G0592001g, partial [Phaseolus vulgaris]
 gb|ESW08607.1| hypothetical protein PHAVU_009G0594000g, partial [Phaseolus vulgaris]
Length=179

 Score =   325 bits (834),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 152/179 (85%), Positives = 167/179 (93%), Gaps = 0/179 (0%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LGRA Y+VGFWIRETGQA+DRLG RLQG Y+F EQLSRHR LMN+FDK P V ++AF
Sbjct  1    MGTLGRAIYSVGFWIRETGQAIDRLGSRLQGGYFFQEQLSRHRTLMNIFDKAPVVDKDAF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSAS+IGDVQVGR SSIWYGCVLRGDVNS+ +G+GTNIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   VAPSASVIGDVQVGRGSSIWYGCVLRGDVNSIRVGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGE  693
            +IG+NVTVGHSAVLHGCTVEDEAFVGMGA LLDGVVVEKNAM+AAGALVRQNTRIP GE
Sbjct  121  VIGDNVTVGHSAVLHGCTVEDEAFVGMGAVLLDGVVVEKNAMVAAGALVRQNTRIPSGE  179



>emb|CBI17490.3| unnamed protein product [Vitis vinifera]
Length=228

 Score =   327 bits (839),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 158/218 (72%), Positives = 187/218 (86%), Gaps = 5/218 (2%)
 Frame = +1

Query  292  MNLFDKVPSVHREAFV--APSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDN  465
            MNLFDK P V ++A V  AP+AS+IGDV+VG+ SSIWYGCVLRGDVNS+SIG+GTNI+DN
Sbjct  1    MNLFDKAPVVAKDASVSVAPTASVIGDVKVGQRSSIWYGCVLRGDVNSISIGSGTNIEDN  60

Query  466  SLVHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMI  645
            +LVHVA+S+L+GKVLPT IG+ VT+GH AVLHGCTVE+EAF+GMGATLLDG  VEK+AM+
Sbjct  61   ALVHVARSSLSGKVLPTTIGDTVTIGHGAVLHGCTVENEAFIGMGATLLDGAFVEKHAMV  120

Query  646  AAGALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLD  825
            AAG LV Q+TRIPCGEVW GNPA+FLRKLTEEEIAFISQSA+NYSNL Q HA ENA S D
Sbjct  121  AAGVLVLQDTRIPCGEVWAGNPARFLRKLTEEEIAFISQSAINYSNLAQVHAKENANSFD  180

Query  826  ENEFEKVLRKK---KDEDNDSILGVVRETPPDLILPNN  930
            E  +EKVLRKK    + D  +++ V RETPP+LILP+N
Sbjct  181  EIAYEKVLRKKFAYPETDYAALVSVDRETPPELILPDN  218



>ref|XP_003612061.1| Transcription factor APFI-like protein [Medicago truncatula]
 gb|AES95019.1| gamma carbonic anhydrase-like protein [Medicago truncatula]
Length=201

 Score =   325 bits (833),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 151/180 (84%), Positives = 170/180 (94%), Gaps = 0/180 (0%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LGRAFYTVGFWIRETGQA+DRLG RLQGNY+F EQLSRHR LMN++DKVP VH++AF
Sbjct  1    MGTLGRAFYTVGFWIRETGQAIDRLGSRLQGNYFFQEQLSRHRPLMNVYDKVPYVHKDAF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            +APSASI GDVQ+G  SSIWYGCVLRGDVN+++IG+ TNIQDNSLVHVAKSNL+G+VLPT
Sbjct  61   IAPSASITGDVQIGHASSIWYGCVLRGDVNNITIGSSTNIQDNSLVHVAKSNLSGRVLPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            IIG+NVTVGHSAVL GCTVEDEAF+GMGATLLDGV VEK+AM+AAGALVRQNTRIPCGEV
Sbjct  121  IIGDNVTVGHSAVLQGCTVEDEAFIGMGATLLDGVHVEKHAMVAAGALVRQNTRIPCGEV  180



>ref|NP_001185039.1| gamma carbonic anhydrase 1 [Arabidopsis thaliana]
 gb|AEE29871.1| gamma carbonic anhydrase 1 [Arabidopsis thaliana]
Length=220

 Score =   322 bits (825),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 151/179 (84%), Positives = 166/179 (93%), Gaps = 0/179 (0%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LGRAFY+VGFWIRETGQALDRLGCRLQG  YF EQLSRHR LMN+FDK P V +EAF
Sbjct  1    MGTLGRAFYSVGFWIRETGQALDRLGCRLQGKNYFREQLSRHRTLMNVFDKAPIVDKEAF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSAS+IGDV +GR SSIWYGCVLRGDVN+VS+G+GTNIQDNSLVHVAKSNL+GKV PT
Sbjct  61   VAPSASVIGDVHIGRGSSIWYGCVLRGDVNTVSVGSGTNIQDNSLVHVAKSNLSGKVHPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGE  693
            IIG+NVT+GHSAVLHGCTVEDE F+GMGATLLDGVVVEK+ M+AAGALVRQNTRIP GE
Sbjct  121  IIGDNVTIGHSAVLHGCTVEDETFIGMGATLLDGVVVEKHGMVAAGALVRQNTRIPSGE  179



>ref|NP_001137016.1| uncharacterized protein LOC100217184 [Zea mays]
 gb|ACF83081.1| unknown [Zea mays]
Length=222

 Score =   320 bits (820),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 151/204 (74%), Positives = 173/204 (85%), Gaps = 4/204 (2%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            M  LG+A Y VGFWIRETGQALDRLGCRLQG Y+FHEQ+SRHR +MN+FDK P VH++AF
Sbjct  1    MAGLGKAMYAVGFWIRETGQALDRLGCRLQGKYFFHEQISRHRTIMNIFDKTPHVHKDAF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSAS+IGDVQVG  +SIWYGCVLRGD N + IG+GTNIQDNSL+HVAKSNL+GKV PT
Sbjct  61   VAPSASLIGDVQVGSGASIWYGCVLRGDANIIQIGSGTNIQDNSLIHVAKSNLSGKVFPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
             IGNNVTVGHSAVL GCTVEDEAFVG+GATLLDGVVVEK+ M+AAGALVRQNTRIPCGEV
Sbjct  121  TIGNNVTVGHSAVLQGCTVEDEAFVGIGATLLDGVVVEKHGMVAAGALVRQNTRIPCGEV  180

Query  697  WGGNPA----KFLRKLTEEEIAFI  756
               +      +FL K ++  + F+
Sbjct  181  EHTSSTVLCFEFLIKPSQAPLPFL  204



>tpg|DAA54233.1| TPA: hypothetical protein ZEAMMB73_935334 [Zea mays]
Length=222

 Score =   319 bits (818),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 147/180 (82%), Positives = 163/180 (91%), Gaps = 0/180 (0%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            M  LG+A Y VGFWIRETGQALDRLGCRLQG Y+FHEQ+SRHR +MN+FDK P VH++AF
Sbjct  1    MAGLGKAMYAVGFWIRETGQALDRLGCRLQGKYFFHEQISRHRTIMNIFDKTPHVHKDAF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSAS+IGDVQVG  +SIWYGCVLRGD N + IG+GTNIQDNSL+HVAKSNL+GKV PT
Sbjct  61   VAPSASLIGDVQVGSGASIWYGCVLRGDANIIQIGSGTNIQDNSLIHVAKSNLSGKVFPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
             IGNNVTVGHSAVL GCTVEDEAFVG+GATLLDGVVVEK+ M+AAGALVRQNTRIPCGEV
Sbjct  121  TIGNNVTVGHSAVLQGCTVEDEAFVGIGATLLDGVVVEKHGMVAAGALVRQNTRIPCGEV  180



>dbj|BAB10927.1| ferripyochelin-binding protein-like [Arabidopsis thaliana]
Length=213

 Score =   318 bits (815),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 154/220 (70%), Positives = 182/220 (83%), Gaps = 9/220 (4%)
 Frame = +1

Query  292  MNLFDKVPSVHREAFVAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSL  471
            MN+FDK P+V + AFVAP+AS+ GDV VGR SSIWYGCVLRGD NS+S+G GTNIQDN+L
Sbjct  1    MNVFDKTPNVDKGAFVAPNASLSGDVHVGRGSSIWYGCVLRGDANSISVGAGTNIQDNAL  60

Query  472  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  651
            VHVAK+NL+GKVLPT+IG+NVT+GHSAVLHGCTVEDEA++G  AT+LDG  VEK+AM+A+
Sbjct  61   VHVAKTNLSGKVLPTVIGDNVTIGHSAVLHGCTVEDEAYIGTSATVLDGAHVEKHAMVAS  120

Query  652  GALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  831
            GALVRQNTRIP GEVWGGNPAKFLRK+TEEE  F S SA+ YSNL Q HA ENAK+LDE 
Sbjct  121  GALVRQNTRIPSGEVWGGNPAKFLRKVTEEERVFFSSSAVEYSNLAQAHATENAKNLDEA  180

Query  832  EFEKVLRKK--KDEDNDSILGVVRETPPDLILPNNAPKAS  945
            EF+K+L KK  +D + DS+L        DL LP N PKA+
Sbjct  181  EFKKLLNKKNARDTEYDSVL-------DDLTLPENVPKAA  213



>ref|XP_001776500.1| predicted protein [Physcomitrella patens]
 gb|EDQ58633.1| predicted protein [Physcomitrella patens]
Length=268

 Score =   318 bits (815),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 143/261 (55%), Positives = 205/261 (79%), Gaps = 3/261 (1%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LGR  +++G   R TGQALDRLG RLQG   F +++S+H+ ++++FDK P +   AF
Sbjct  1    MGTLGRVVFSLGKAARTTGQALDRLGSRLQGGNTFKDEVSKHQTVLSIFDKKPVIEESAF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAP AS++G+V++G+ SS+WYGCVLRGDV+ + +G+ TNIQDN++VHVAK+N++G V PT
Sbjct  61   VAPGASVVGEVEIGKQSSVWYGCVLRGDVHHIKVGSETNIQDNTVVHVAKTNVSGNVEPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            +IGN VT+GH++VLH CTVEDE+FVGMG+T+LDG VVEK AM+AAG++V Q TR+P G++
Sbjct  121  VIGNRVTIGHNSVLHACTVEDESFVGMGSTILDGAVVEKGAMVAAGSVVTQRTRVPSGQI  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KDE  867
            W G+PAKFLR+LT+EE + +S++A+ Y +L + HA+EN K+  E E +K LR+K   + +
Sbjct  181  WAGSPAKFLRELTDEERSSLSENAILYMDLAEVHASENRKTAGEIEADKALRRKWEIQSD  240

Query  868  DNDSILGVVRETPPDLILPNN  930
            D DS LG+VR   P++  PN 
Sbjct  241  DYDSHLGIVRSKRPEIHFPNK  261



>ref|XP_001754319.1| predicted protein [Physcomitrella patens]
 gb|EDQ80769.1| predicted protein [Physcomitrella patens]
Length=248

 Score =   317 bits (811),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 147/217 (68%), Positives = 170/217 (78%), Gaps = 0/217 (0%)
 Frame = +1

Query  172  RAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAPSA  351
            RA YTVGFWIRETGQALDR GCRLQGNY F E+LSRH+ L NLFDK P V  +AFVAPSA
Sbjct  4    RALYTVGFWIRETGQALDRAGCRLQGNYVFREELSRHKTLFNLFDKKPVVAEDAFVAPSA  63

Query  352  SIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNN  531
            S++GDVQVG  SSIWYGCVLRGD + + +G+ TNIQD+SLV V  S   G   P +IGN 
Sbjct  64   SLVGDVQVGPKSSIWYGCVLRGDASGIRVGSETNIQDHSLVSVGGSRFGGGHAPAVIGNR  123

Query  532  VTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEVWGGNP  711
            VT+GHSAV+H CTVEDEAFVGMGATL+DGVVVEK A +AAG+LV +NTRIP G++W GNP
Sbjct  124  VTIGHSAVIHACTVEDEAFVGMGATLMDGVVVEKGAFVAAGSLVTENTRIPAGQIWAGNP  183

Query  712  AKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSL  822
            AKFLR+L  +E +FI +S  NYS L   HA  N KS 
Sbjct  184  AKFLRELKGDETSFIPKSTDNYSELAAAHAEANVKSF  220



>gb|KJB43469.1| hypothetical protein B456_007G201900 [Gossypium raimondii]
Length=188

 Score =   307 bits (787),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 155/189 (82%), Positives = 170/189 (90%), Gaps = 10/189 (5%)
 Frame = +1

Query  403  CVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDE  582
            CV  GDVNS+SIG+GTNIQDNSLVHVAKSNL+GKVLPTIIG+NVTVGHSAVLHGCTVEDE
Sbjct  2    CV--GDVNSISIGSGTNIQDNSLVHVAKSNLSGKVLPTIIGSNVTVGHSAVLHGCTVEDE  59

Query  583  AFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQ  762
            AFVGMGATLLDGV VEK+AM+AAGALVRQNTRIPCGEVWGGNPAKFLRKLTEEE+ FISQ
Sbjct  60   AFVGMGATLLDGVYVEKHAMVAAGALVRQNTRIPCGEVWGGNPAKFLRKLTEEEMTFISQ  119

Query  763  SALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KDEDNDSILGVVRETPPDLILPNN-  930
            SALNY+NL Q HAAENAKS DE E E +LRKK   +DE+ DS+LGVVRETPP+LILP+N 
Sbjct  120  SALNYTNLAQVHAAENAKSFDEIELETMLRKKFARRDEEYDSMLGVVRETPPELILPDNI  179

Query  931  ----APKAS  945
                APKA+
Sbjct  180  IPDKAPKAA  188



>ref|XP_001758123.1| predicted protein [Physcomitrella patens]
 gb|EDQ76945.1| predicted protein [Physcomitrella patens]
Length=268

 Score =   310 bits (793),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 140/261 (54%), Positives = 199/261 (76%), Gaps = 3/261 (1%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LGR  +++G   R TGQALDRLG RLQG Y F +++S+H+ ++ +F+K P +   AF
Sbjct  1    MGTLGRVVFSLGKAARSTGQALDRLGSRLQGGYVFKDEVSKHQTILGIFNKKPVIEESAF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAP AS++G+VQ+G +SSIWYGCVLRGDV+ + +G  +NIQDN++V+V K+N++  + PT
Sbjct  61   VAPGASVVGEVQIGENSSIWYGCVLRGDVHQIKVGAESNIQDNTVVNVPKTNVSSSIEPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            IIGN VT+GH++VLH CTVEDE+FVGMG+T+LDG VVEK AM+AAG++V + TR+P G++
Sbjct  121  IIGNRVTIGHNSVLHACTVEDESFVGMGSTILDGAVVEKGAMVAAGSVVAEKTRVPSGQI  180

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KDE  867
            W G+PAKFLR LT EE + ++ +A  Y++L + HA EN K+  + E +K LR+K   + +
Sbjct  181  WAGSPAKFLRDLTAEERSSLTVNASIYTDLAEVHAFENRKTAGDIEADKALRRKWEIQSD  240

Query  868  DNDSILGVVRETPPDLILPNN  930
            D DS LG+VR   PD+  PNN
Sbjct  241  DYDSHLGIVRSKKPDIAFPNN  261



>gb|KHG18626.1| Protein YrdA [Gossypium arboreum]
 gb|KHG19737.1| Protein YrdA [Gossypium arboreum]
Length=191

 Score =   306 bits (783),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 150/175 (86%), Positives = 163/175 (93%), Gaps = 3/175 (2%)
 Frame = +1

Query  415  GDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVG  594
            GDVNS+S+G+GTNIQDNSLVHVAKSNL+GKVLPT IGNNVTVGHSAVLHGCTVEDEAFVG
Sbjct  5    GDVNSISVGSGTNIQDNSLVHVAKSNLSGKVLPTNIGNNVTVGHSAVLHGCTVEDEAFVG  64

Query  595  MGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALN  774
            MGATLLDGVVVEK+AM+AAGALVRQNTRIP GEVWGGNPAKFLRKLTEEEIAFISQSA N
Sbjct  65   MGATLLDGVVVEKHAMVAAGALVRQNTRIPAGEVWGGNPAKFLRKLTEEEIAFISQSATN  124

Query  775  YSNLKQGHAAENAKSLDENEFEKVLRK---KKDEDNDSILGVVRETPPDLILPNN  930
            Y+NL Q HAAENAK  DE EFEK+LRK   K+DE+ DS+LGVVRETPP+LILP+N
Sbjct  125  YTNLAQVHAAENAKPFDEIEFEKILRKKFAKRDEEYDSMLGVVRETPPELILPDN  179



>gb|KCW68231.1| hypothetical protein EUGRSUZ_F01883 [Eucalyptus grandis]
Length=209

 Score =   302 bits (774),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 152/185 (82%), Positives = 166/185 (90%), Gaps = 8/185 (4%)
 Frame = +1

Query  409  LRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAF  588
            L GDVNS+S+G+GTNIQDNSLVHVAKSNL+GKVLPTIIG+NVTVGHSAVLHGCTVEDEAF
Sbjct  21   LSGDVNSISVGSGTNIQDNSLVHVAKSNLSGKVLPTIIGDNVTVGHSAVLHGCTVEDEAF  80

Query  589  VGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSA  768
            VGMGATLLDGVVVEK+ M+A GALVRQNTRIP GEVWGGNPAKFLRKLTEEE+AFI+QSA
Sbjct  81   VGMGATLLDGVVVEKHGMVAGGALVRQNTRIPAGEVWGGNPAKFLRKLTEEEVAFITQSA  140

Query  769  LNYSNLKQGHAAENAKSLDENEFEKVLRKK---KDEDNDSILGVVRETPPDLILPNN---  930
             NYSNL Q HAAENAK  DE EFEKVLRKK   +DE+ DS+LGVVRETPP+LILP+N   
Sbjct  141  TNYSNLAQVHAAENAKPFDEIEFEKVLRKKFARRDEEYDSMLGVVRETPPELILPDNVLP  200

Query  931  --APK  939
              APK
Sbjct  201  GKAPK  205



>ref|XP_002504597.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO65855.1| predicted protein [Micromonas sp. RCC299]
Length=254

 Score =   301 bits (771),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 136/247 (55%), Positives = 186/247 (75%), Gaps = 3/247 (1%)
 Frame = +1

Query  166  LGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAP  345
            + R  +++G  +RETGQALDR+GC +QG+  F E +S+HR +M +++K P++ R  F+AP
Sbjct  1    MSRFMFSIGTVLRETGQALDRIGCSMQGSNAFREAISKHRTIMGIYEKTPALPRAGFIAP  60

Query  346  SASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIG  525
            SAS+IGDV +G  SS+WYG VLRGDVNS+ IG+ TNIQDN+++HVAK+N+ G   PTIIG
Sbjct  61   SASVIGDVTIGEKSSVWYGAVLRGDVNSIRIGSQTNIQDNTVIHVAKTNVGGVAAPTIIG  120

Query  526  NNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEVWGG  705
            + VTVGH+A+LH CTV+D+AFVGMGAT++DG VVE  AM+AAGALV   T +P G++W G
Sbjct  121  DRVTVGHNAILHACTVKDDAFVGMGATVMDGAVVESGAMVAAGALVTPGTVVPTGQLWAG  180

Query  706  NPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLR---KKKDEDND  876
             PAKF+R++T EE AF   SA  Y+ +   HAAEN KS +E E++K  R   +++D D D
Sbjct  181  APAKFMREMTAEEKAFTVTSAETYAEVGAVHAAENDKSFEELEYDKAARRMARERDPDYD  240

Query  877  SILGVVR  897
            S LG+ R
Sbjct  241  SHLGIER  247



>ref|XP_008672301.1| PREDICTED: uncharacterized protein LOC100217184 isoform X2 [Zea 
mays]
 tpg|DAA54234.1| TPA: hypothetical protein ZEAMMB73_935334 [Zea mays]
Length=214

 Score =   298 bits (763),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 157/261 (60%), Positives = 179/261 (69%), Gaps = 50/261 (19%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            M  LG+A Y VGFWIRETGQALDRLGCRLQG  YF  +                      
Sbjct  1    MAGLGKAMYAVGFWIRETGQALDRLGCRLQGK-YFFHE----------------------  37

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
                                     + D N + IG+GTNIQDNSL+HVAKSNL+GKV PT
Sbjct  38   -------------------------QRDANIIQIGSGTNIQDNSLIHVAKSNLSGKVFPT  72

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
             IGNNVTVGHSAVL GCTVEDEAFVG+GATLLDGVVVEK+ M+AAGALVRQNTRIPCGEV
Sbjct  73   TIGNNVTVGHSAVLQGCTVEDEAFVGIGATLLDGVVVEKHGMVAAGALVRQNTRIPCGEV  132

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK--KDED  870
            WGGNPAKFLRKLT++EI+FI++SA NYSNL + HAAENAK L++ EFEKVL KK    ++
Sbjct  133  WGGNPAKFLRKLTDDEISFIAESAANYSNLSKVHAAENAKPLEKIEFEKVLGKKFAHQDE  192

Query  871  NDSILGVVRETPPDLILPNNA  933
             DS +GV    PP+L  PN A
Sbjct  193  YDSSIGVAEGAPPELTSPNPA  213



>ref|XP_010463232.1| PREDICTED: gamma carbonic anhydrase 2, mitochondrial-like [Camelina 
sativa]
Length=195

 Score =   295 bits (755),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 137/180 (76%), Positives = 163/180 (91%), Gaps = 0/180 (0%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LGRA YTVG WIR TGQALDR+G  LQG++   E LSRHR LMN+F K P V ++ F
Sbjct  1    MGTLGRAIYTVGNWIRGTGQALDRVGSLLQGSHRIEEHLSRHRTLMNVFGKSPLVDKDVF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSAS+IGDVQ+G+ SSIWYGCVLRGDVN++S+G+GTNIQDN+LVHVAK+N++GKVLPT
Sbjct  61   VAPSASVIGDVQIGKSSSIWYGCVLRGDVNNISVGSGTNIQDNTLVHVAKTNISGKVLPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            +IG+NVTVGHSAV+HGCTVED+AFVGMGATLLDGVVVEK+AM+AAG+LV+QNTRIP GEV
Sbjct  121  LIGDNVTVGHSAVIHGCTVEDDAFVGMGATLLDGVVVEKHAMVAAGSLVKQNTRIPSGEV  180



>gb|KDO84603.1| hypothetical protein CISIN_1g0242241mg, partial [Citrus sinensis]
Length=183

 Score =   293 bits (751),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 143/174 (82%), Positives = 161/174 (93%), Gaps = 3/174 (2%)
 Frame = +1

Query  418  DVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGM  597
            DVNS+S+G+GTNIQDNSLVHVAKSNL+GKVLPT IG+NVTVGHSAVLHGCTVEDEAFVGM
Sbjct  1    DVNSISVGSGTNIQDNSLVHVAKSNLSGKVLPTTIGDNVTVGHSAVLHGCTVEDEAFVGM  60

Query  598  GATLLDGVVVEKNAMIAAGALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNY  777
            GATLLDGVVVE++ M+AAG+LVRQNTRIP GEVWGGNPAKFLRKLT+EEIAFISQSA NY
Sbjct  61   GATLLDGVVVERHGMVAAGSLVRQNTRIPSGEVWGGNPAKFLRKLTDEEIAFISQSATNY  120

Query  778  SNLKQGHAAENAKSLDENEFEKVLRKK---KDEDNDSILGVVRETPPDLILPNN  930
            SNL Q HAAENAKS DE EFEKVLRKK   +DE+ DS+LGVVRETP ++I+P++
Sbjct  121  SNLAQVHAAENAKSFDEIEFEKVLRKKFARRDEEYDSMLGVVRETPQEIIVPDS  174



>ref|XP_003059787.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH55739.1| predicted protein [Micromonas pusilla CCMP1545]
Length=255

 Score =   283 bits (725),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 130/247 (53%), Positives = 179/247 (72%), Gaps = 3/247 (1%)
 Frame = +1

Query  166  LGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAP  345
            + R  + +G  +RETGQALDR+GC  QG+  F E +S+HR +  +++KVP +    FVAP
Sbjct  1    MARVMHALGTALRETGQALDRIGCSFQGSNVFREAISKHRTIQQIYEKVPKLPAAGFVAP  60

Query  346  SASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIG  525
            SAS+IGDV +G +SS+WYG VLRGDVN VSIG+ TNIQDN++VHVAK+N+ G  LPT+IG
Sbjct  61   SASVIGDVTIGENSSVWYGAVLRGDVNPVSIGSFTNIQDNAVVHVAKTNVGGVSLPTVIG  120

Query  526  NNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEVWGG  705
            + VTVGH+A++H CT++D+AF+GMGAT++DG  VE  AM+AAGALV   T +P G++W G
Sbjct  121  DRVTVGHNAIIHACTIKDDAFIGMGATVMDGATVEAGAMVAAGALVTPGTTVPSGQLWAG  180

Query  706  NPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRK---KKDEDND  876
             PA+ +R++T EE AF   SA  Y+ + + HA E  K  +E E +K  R+   ++D D D
Sbjct  181  APARMMREMTAEEKAFTKTSAETYAAVGEVHAEECGKGFEEIEHDKAARRMALERDPDYD  240

Query  877  SILGVVR  897
            S LGV R
Sbjct  241  SHLGVRR  247



>gb|AFK40628.1| unknown [Lotus japonicus]
Length=193

 Score =   279 bits (713),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 132/161 (82%), Positives = 145/161 (90%), Gaps = 0/161 (0%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LGRA Y+VGFWIRETGQA+DRLG RLQG Y+  EQLSRHR LMN+FDK P+V ++ F
Sbjct  1    MGTLGRAIYSVGFWIRETGQAIDRLGSRLQGGYFIQEQLSRHRTLMNIFDKAPTVDKDVF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSAS+IGDVQVG+ SSIWYG VLRGDVNS+ +G+GTNIQDNSLVHVAKSNL GKVLPT
Sbjct  61   VAPSASVIGDVQVGKGSSIWYGTVLRGDVNSIRVGSGTNIQDNSLVHVAKSNLGGKVLPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNA  639
            IIGNNVTVGHSAVLHGCTVEDEAFVGMGA LLDGVVVEK  
Sbjct  121  IIGNNVTVGHSAVLHGCTVEDEAFVGMGAILLDGVVVEKKC  161


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +3

Query  624  CREKCHDCCWCSCETEYKDSLWRGLGRKSCQVLKETH  734
              +KCH CCW  CETEYK S+WRG+GR+S +V ++ H
Sbjct  157  VEKKCHGCCWSPCETEYKGSIWRGMGRQSSKVPEKAH  193



>gb|ACV52585.1| transcription factor APFI-like protein, partial [Nicotiana benthamiana]
Length=152

 Score =   272 bits (695),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 125/152 (82%), Positives = 141/152 (93%), Gaps = 0/152 (0%)
 Frame = +1

Query  280  HRVLMNLFDKVPSVHREAFVAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQ  459
            HR LMNLFDKVP V ++AFVAPSASI+GDV +G  +SIWYGCVLRGDVNSVSIG GTN+Q
Sbjct  1    HRTLMNLFDKVPVVDKDAFVAPSASIVGDVHIGHSASIWYGCVLRGDVNSVSIGAGTNVQ  60

Query  460  DNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNA  639
            DNSL+HVAKSN++G+V PT IG NVT+GHSAVLHGCTVEDEAF+GMGAT+LDG VVEKN+
Sbjct  61   DNSLIHVAKSNISGRVSPTTIGKNVTIGHSAVLHGCTVEDEAFIGMGATVLDGAVVEKNS  120

Query  640  MIAAGALVRQNTRIPCGEVWGGNPAKFLRKLT  735
            M+AAGALVRQNTRIPCGEVWGGNPA+FLRKLT
Sbjct  121  MVAAGALVRQNTRIPCGEVWGGNPARFLRKLT  152



>gb|AJW81216.1| gamma type carbonic anhydrase [Lobosphaera incisa]
Length=228

 Score =   263 bits (672),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 125/215 (58%), Positives = 156/215 (73%), Gaps = 0/215 (0%)
 Frame = +1

Query  178  FYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAPSASI  357
             Y VGFWIRETGQALDR+GCRLQ N  F E+L RHR +MNL  + P V   AFVAPSAS+
Sbjct  5    LYQVGFWIRETGQALDRVGCRLQNNKAFVEELWRHRPVMNLSTRKPDVQPSAFVAPSASV  64

Query  358  IGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVT  537
            IG V +G++SS+WYGCVLRGD+  +S+G  +N+QD ++V    + L  +   T IG NVT
Sbjct  65   IGQVTLGKNSSVWYGCVLRGDMGHISVGENSNLQDGTVVRTVATYLASRPAGTHIGKNVT  124

Query  538  VGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEVWGGNPAK  717
            VGH A L+GCT+EDE+ +GMGATLL+GV VEKNAM+AAGA+V+  T +P GEVWGGNPA+
Sbjct  125  VGHFATLNGCTIEDESLIGMGATLLEGVRVEKNAMVAAGAVVQPQTVVPSGEVWGGNPAR  184

Query  718  FLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSL  822
            FLR L  EE +F+  SA  Y+ L   H  E  K L
Sbjct  185  FLRALKPEEKSFMVTSADKYAALAGEHKQETEKPL  219



>ref|XP_006416491.1| hypothetical protein EUTSA_v10008724mg [Eutrema salsugineum]
 gb|ESQ34844.1| hypothetical protein EUTSA_v10008724mg [Eutrema salsugineum]
Length=221

 Score =   254 bits (649),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 120/163 (74%), Positives = 136/163 (83%), Gaps = 0/163 (0%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            MG+LGRAFY+VGFWIRETGQALDRLGCRLQG   F EQLSRHR LMN+FDK P V +EAF
Sbjct  1    MGTLGRAFYSVGFWIRETGQALDRLGCRLQGKNCFREQLSRHRTLMNVFDKAPIVDKEAF  60

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAPSAS+IGDVQ+GR SSIWYGCVLRGD N+V++G+GTNIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   VAPSASVIGDVQIGRGSSIWYGCVLRGDANTVTVGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMI  645
            IIG+NVT+GHSAVLHGCTV      G     L G   ++ A +
Sbjct  121  IIGDNVTIGHSAVLHGCTVRIRPLSGWVRHFLTGSWSKRMAWL  163



>ref|XP_011398885.1| Uncharacterized protein F751_3627 [Auxenochlorella protothecoides]
 gb|KFM25989.1| Uncharacterized protein F751_3627 [Auxenochlorella protothecoides]
Length=237

 Score =   250 bits (638),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 119/221 (54%), Positives = 156/221 (71%), Gaps = 0/221 (0%)
 Frame = +1

Query  163  SLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVA  342
            SLG   Y +GF +RETGQALDR+G RLQG+Y F E+L+R R L NLF+  PS+  +AFVA
Sbjct  8    SLGYVVYRLGFALRETGQALDRVGSRLQGSYAFREELNRARPLQNLFNLKPSLGTDAFVA  67

Query  343  PSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTII  522
            P+AS+IGDV +G  SS++YG VLR D  S+ +G GTNIQD SL+  A  ++      T I
Sbjct  68   PNASVIGDVTLGPRSSVFYGSVLRADSGSIKVGAGTNIQDGSLIRTAPQSIDEHAADTTI  127

Query  523  GNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEVWG  702
            G NVT+GH   +HG T+EDE  VGMGA L  G VV K AM+AAGA+V   T IP G++WG
Sbjct  128  GANVTIGHQVSMHGVTLEDEVLVGMGAVLSHGTVVRKGAMVAAGAVVPPGTEIPAGQIWG  187

Query  703  GNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLD  825
            GNPA+FLR L + E +F+++SA +Y N+ + H  EN+ SL+
Sbjct  188  GNPARFLRDLKDNESSFLAESAEHYVNVAKNHIKENSGSLE  228



>gb|KHN45864.1| Hypothetical protein glysoja_023087, partial [Glycine soja]
Length=203

 Score =   248 bits (634),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 139/229 (61%), Positives = 159/229 (69%), Gaps = 34/229 (15%)
 Frame = +1

Query  271  LSRHRVLMNLFDKVPSVHREAFVAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGT  450
            +SRH  LMN+FDK P V ++AFVAPSAS++           WYGCVLRG +         
Sbjct  1    VSRHLTLMNIFDKAPVVDKDAFVAPSASVV-----------WYGCVLRGQLPGACCKVKF  49

Query  451  NIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLL-DGVVV  627
              +      VA ++          G NVTVGHSAVLHGCTVEDEAFVGMGA LL DGV+V
Sbjct  50   KWEG-----VAYNDW---------GYNVTVGHSAVLHGCTVEDEAFVGMGAILLLDGVIV  95

Query  628  EKNAMIAAGALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAE  807
            EKNAM+A GALVRQNTRIP GEVW GNPAKFLRKLT+EEIAFISQSA NY+NL Q HAAE
Sbjct  96   EKNAMVAVGALVRQNTRIPSGEVWAGNPAKFLRKLTDEEIAFISQSAANYTNLAQVHAAE  155

Query  808  NAKSLDENEFEKVLRKK----KDEDNDSILGVVRETPPDLILPNNAPKA  942
            N+KS DE EFEKVL +K    KDE+ DS+L VV    PD +LP+ A KA
Sbjct  156  NSKSFDEIEFEKVLLRKKFARKDEEYDSMLDVV----PDNVLPDKAEKA  200



>ref|XP_007136607.1| hypothetical protein PHAVU_009G0592001g, partial [Phaseolus vulgaris]
 gb|ESW08601.1| hypothetical protein PHAVU_009G0592001g, partial [Phaseolus vulgaris]
Length=134

 Score =   244 bits (623),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 116/134 (87%), Positives = 127/134 (95%), Gaps = 0/134 (0%)
 Frame = +1

Query  292  MNLFDKVPSVHREAFVAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSL  471
            MN+FDK P V ++AFVAPSAS+IGDVQVGR SSIWYGCVLRGDVNS+ +G+GTNIQDNSL
Sbjct  1    MNIFDKAPVVDKDAFVAPSASVIGDVQVGRGSSIWYGCVLRGDVNSIRVGSGTNIQDNSL  60

Query  472  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  651
            VHVAKSNL+GKVLPT+IG+NVTVGHSAVLHGCTVEDEAFVGMGA LLDGVVVEKNAM+AA
Sbjct  61   VHVAKSNLSGKVLPTVIGDNVTVGHSAVLHGCTVEDEAFVGMGAVLLDGVVVEKNAMVAA  120

Query  652  GALVRQNTRIPCGE  693
            GALVRQNTRIP GE
Sbjct  121  GALVRQNTRIPSGE  134



>ref|XP_005649920.1| trimeric LpxA-like protein [Coccomyxa subellipsoidea C-169]
 gb|EIE25376.1| trimeric LpxA-like protein [Coccomyxa subellipsoidea C-169]
Length=219

 Score =   245 bits (625),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 123/209 (59%), Positives = 150/209 (72%), Gaps = 0/209 (0%)
 Frame = +1

Query  187  VGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAPSASIIGD  366
            +GF IRETGQALDRLGCRLQGN  F E + +HR +M+L  K  S+   AFVAPSA++IGD
Sbjct  8    LGFIIRETGQALDRLGCRLQGNNAFLEDVFQHRTVMSLGGKKASIGDGAFVAPSAAVIGD  67

Query  367  VQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGH  546
            V +G+ SSIWYG VLRGD  +++IG  TN+QDN  V  +K+ L G    T IGN+VTVGH
Sbjct  68   VTLGKRSSIWYGTVLRGDEGAITIGDNTNLQDNVSVRTSKAFLGGHAGATSIGNSVTVGH  127

Query  547  SAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEVWGGNPAKFLR  726
            S +L   T+EDEA +GMGATLL+GV VEK A +AAGA+V   T IP GE+WGGNPAK LR
Sbjct  128  SVLLDTVTIEDEALIGMGATLLEGVKVEKGAQVAAGAVVSPGTVIPSGELWGGNPAKLLR  187

Query  727  KLTEEEIAFISQSALNYSNLKQGHAAENA  813
             L  EE AFIS+SA  Y+ L   H  E +
Sbjct  188  PLKPEEAAFISKSAQTYAELGAKHLKETS  216



>ref|XP_005644680.1| gamma-carbonic anhydrase [Coccomyxa subellipsoidea C-169]
 gb|EIE20136.1| gamma-carbonic anhydrase [Coccomyxa subellipsoidea C-169]
Length=263

 Score =   243 bits (619),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 127/249 (51%), Positives = 167/249 (67%), Gaps = 3/249 (1%)
 Frame = +1

Query  163  SLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVA  342
            S  + F   G   R+TGQ LD +G ++QG Y + E +  H+ L     K P++   AFVA
Sbjct  2    SAQKIFKLFGSVARQTGQTLDSIGLKIQGQYGYKEGVPTHQTLQGYLGKRPTLGTGAFVA  61

Query  343  PSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTII  522
            P+AS+IGDV++G +SS+WYG VLRGDVN + +G  TNIQD   VHVA+ N  GKV PT I
Sbjct  62   PNASVIGDVKLGNNSSVWYGAVLRGDVNHIVVGNNTNIQDGVTVHVARHNPQGKVAPTTI  121

Query  523  GNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEVWG  702
            GNNVTVGH A++H  TVED   VGMGAT+LDGV V+K +++AAGA+V     +P GEVW 
Sbjct  122  GNNVTVGHGAIIHAATVEDNVLVGMGATILDGVTVQKGSVVAAGAVVTPGKTVPSGEVWA  181

Query  703  GNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRK---KKDEDN  873
            GNPAK LRKL EEE  FI+Q+A +Y+ L   HAAEN K ++E   +   R+   ++  D 
Sbjct  182  GNPAKMLRKLEEEEAGFIAQAANDYAALAAVHAAENGKGMEEILLDNARREDRARRSLDY  241

Query  874  DSILGVVRE  900
            DS +GV R+
Sbjct  242  DSHMGVERD  250



>ref|XP_006279533.1| hypothetical protein CARUB_v10028265mg, partial [Capsella rubella]
 gb|EOA12431.1| hypothetical protein CARUB_v10028265mg, partial [Capsella rubella]
Length=177

 Score =   239 bits (610),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 128/226 (57%), Positives = 146/226 (65%), Gaps = 51/226 (23%)
 Frame = +1

Query  274  SRHRVLMNLFDKVPSVHREAFVAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTN  453
            SRHR LMN+FDK PSV + AFVAP+ASI GDV VGR SSIWYGCVLR             
Sbjct  1    SRHRTLMNVFDKSPSVDKGAFVAPNASITGDVHVGRGSSIWYGCVLR-------------  47

Query  454  IQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEK  633
                                         GHSAVLHGCTVEDEA++G  AT+LDG  VEK
Sbjct  48   -----------------------------GHSAVLHGCTVEDEAYIGTSATVLDGAHVEK  78

Query  634  NAMIAAGALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENA  813
            +AM+A+GALVRQNTRIP GEVWGGNPAKFLRK+TEEE  F S SA+ YSNL Q HA ENA
Sbjct  79   HAMVASGALVRQNTRIPSGEVWGGNPAKFLRKVTEEERVFFSSSAVEYSNLAQVHATENA  138

Query  814  KSLDENEFEKVLRKK--KDEDNDSILGVVRETPPDLILPNNAPKAS  945
            K+LDE EF+ +L KK  +D + DS+L        DL LP N PKA+
Sbjct  139  KNLDETEFKTLLNKKNARDTEYDSVLD-------DLTLPENVPKAA  177



>ref|XP_005847553.1| hypothetical protein CHLNCDRAFT_35390 [Chlorella variabilis]
 gb|EFN55451.1| hypothetical protein CHLNCDRAFT_35390 [Chlorella variabilis]
Length=261

 Score =   240 bits (612),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 126/251 (50%), Positives = 165/251 (66%), Gaps = 6/251 (2%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  336
            M  L RA  T G  +R  G+ALD LG  +QG+  + E L++ + +     K P +    F
Sbjct  1    MSVLTRA--TAGL-LRGLGRALDGLGSAVQGSGAYKETLNKAQSVQAFAGKRPQLADSVF  57

Query  337  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  516
            VAP+AS++GDV++G  +SIWYG V+RGDVNSV IG  TN+QDN LVHVAK N+ GK LPT
Sbjct  58   VAPNASVVGDVKIGSGASIWYGAVVRGDVNSVVIGDRTNVQDNVLVHVAKHNMAGKALPT  117

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
             IG+NVT+G  A +H  T+ED   VGMGA ++DG  VE  +++AAGALV   T IP G+V
Sbjct  118  QIGSNVTIGPGATIHAATIEDCVVVGMGAVIMDGAKVESKSVVAAGALVPPGTVIPSGQV  177

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRK---KKDE  867
            W G+PAKFLR L E+E+ F+S +A +YS L   HA ENAKS +E E +K  R     +D 
Sbjct  178  WAGSPAKFLRNLIEDEVQFVSAAADSYSQLALLHAEENAKSFEEVEADKARRADRISRDP  237

Query  868  DNDSILGVVRE  900
            D D   GV R+
Sbjct  238  DYDEQQGVARD  248



>gb|AFK37757.1| unknown [Medicago truncatula]
Length=149

 Score =   236 bits (601),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 113/144 (78%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = +1

Query  292  MNLFDKVPSVHREAFVAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSL  471
            MN+FDK P V ++AF+APSAS+IGDV +GR SSIWYGCV+RGDVN++S+G+GTNIQDNSL
Sbjct  1    MNVFDKAPVVGKDAFIAPSASVIGDVHIGRGSSIWYGCVMRGDVNNISVGSGTNIQDNSL  60

Query  472  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  651
            VHVAKSNL+GKVLPTIIG+NVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEK+AM+AA
Sbjct  61   VHVAKSNLSGKVLPTIIGDNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKHAMVAA  120

Query  652  GALVRQNTRIPCGEVWGGNPAKFL  723
            GALVRQN+RIP     G   +K L
Sbjct  121  GALVRQNSRIPSRRGLGRQSSKVL  144



>ref|XP_008871299.1| hypothetical protein H310_07655 [Aphanomyces invadans]
 gb|ETW00274.1| hypothetical protein H310_07655 [Aphanomyces invadans]
Length=235

 Score =   230 bits (587),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 104/212 (49%), Positives = 153/212 (72%), Gaps = 0/212 (0%)
 Frame = +1

Query  172  RAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAPSA  351
            +A Y +G  +RETGQA+DRLG R+ G+    E+ SRHR +M L+DKVP +  +++VAP+A
Sbjct  3    KAIYQLGRAVRETGQAVDRLGLRVLGSNLHREKFSRHRQVMALYDKVPMIAHDSWVAPNA  62

Query  352  SIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNN  531
            S+IGDV++   SSIWYG V+RGD+N VSIG  TNIQD +++H + +   G    T IGNN
Sbjct  63   SVIGDVEICNDSSIWYGVVIRGDLNKVSIGNRTNIQDRAVIHTSSTTTPGLAPGTSIGNN  122

Query  532  VTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEVWGGNP  711
            VTVGH A+L+ CT+E+   VGMG+ +LDG +VE N+++AAG +V    RIP G++W G+P
Sbjct  123  VTVGHGAILYSCTIENNVLVGMGSIVLDGALVESNSILAAGTVVPPGRRIPSGQLWAGSP  182

Query  712  AKFLRKLTEEEIAFISQSALNYSNLKQGHAAE  807
            A+F+R ++E+E+A + + A  Y+ L + H+ E
Sbjct  183  AQFVRDVSEDEVADLVKQATEYTKLAETHSEE  214



>ref|XP_005703463.1| hypothetical protein Gasu_55130 [Galdieria sulphuraria]
 gb|EME26943.1| hypothetical protein Gasu_55130 [Galdieria sulphuraria]
Length=280

 Score =   228 bits (581),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 109/234 (47%), Positives = 161/234 (69%), Gaps = 6/234 (3%)
 Frame = +1

Query  184  TVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAPSASIIG  363
            T G  +R++GQALD++G + QG Y + E LSRH  +  + DK P +  + FVAP+AS+IG
Sbjct  10   TTGNLLRKSGQALDKVGEQFQGVYAYKELLSRHHRMRAILDKKPLLSSQVFVAPNASVIG  69

Query  364  DVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSN------LTGKVLPTIIG  525
             V++G +SS+WYG ++RGDV SVSIG  TN+QD + +H++K +      L      T+IG
Sbjct  70   TVELGPNSSVWYGAIVRGDVASVSIGENTNVQDRACIHLSKGDSMFQGGLLNNCTETVIG  129

Query  526  NNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEVWGG  705
            + V++GH A++HG  ++DE  VGMGA LL+G  + K+A++ +GA+V +   IP GE+W G
Sbjct  130  SRVSIGHGAIIHGAHIQDECMVGMGAILLEGCKISKHAIVGSGAVVPRKAIIPTGELWAG  189

Query  706  NPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKKKDE  867
            +PA+F+RKL  EEI  I QSA +Y+NL   HA E +KSL+E E +K+ RK + E
Sbjct  190  SPARFVRKLLTEEIDAILQSAEDYTNLAAAHAVECSKSLEEIESDKIARKLRSE  243



>gb|KDO22056.1| hypothetical protein SPRG_12043 [Saprolegnia parasitica CBS 223.65]
Length=236

 Score =   224 bits (572),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 101/214 (47%), Positives = 151/214 (71%), Gaps = 0/214 (0%)
 Frame = +1

Query  166  LGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAP  345
            L +  + +G  +RETGQA+DRLG R+ G+    E+ SRHR +MNL+DKVPSV  +++VAP
Sbjct  2    LRKVTFELGRCVRETGQAMDRLGLRVLGSNEAREKFSRHRQIMNLYDKVPSVAYDSWVAP  61

Query  346  SASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIG  525
            +AS+IGDV++   +S+WYG V+RGD+N VSIG  TNIQD +++H + +   G      IG
Sbjct  62   NASVIGDVEICNDASVWYGVVIRGDLNKVSIGNRTNIQDRTVIHTSSTTTPGLAPGASIG  121

Query  526  NNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEVWGG  705
            N+VTVGH  +L+ CT+E+   +GMG+ +LDG +VE N+++AAG +V    RIP G++W G
Sbjct  122  NDVTVGHGCILYSCTIENNCLIGMGSIVLDGALVESNSILAAGTVVPPGRRIPSGQLWAG  181

Query  706  NPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAE  807
            +PA+++R +TE+EIA ++  A  Y  L   H+ E
Sbjct  182  SPAQYVRDVTEDEIADLTNQAKEYKKLADTHSDE  215



>ref|XP_008608997.1| hypothetical protein SDRG_05080 [Saprolegnia diclina VS20]
 gb|EQC37477.1| hypothetical protein SDRG_05080 [Saprolegnia diclina VS20]
Length=236

 Score =   224 bits (571),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 101/214 (47%), Positives = 151/214 (71%), Gaps = 0/214 (0%)
 Frame = +1

Query  166  LGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAP  345
            L +  + +G  +RETGQA+DRLG R+ G+    E+ SRHR +MNL+DKVPSV  +++VAP
Sbjct  2    LRKVTFELGRCVRETGQAMDRLGLRVLGSNEAREKFSRHRQIMNLYDKVPSVAYDSWVAP  61

Query  346  SASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIG  525
            +AS+IGDV++   +S+WYG V+RGD+N VSIG  TNIQD +++H + +   G      IG
Sbjct  62   NASVIGDVEICNDASVWYGVVIRGDLNKVSIGNRTNIQDRTVIHTSSTTTPGLAPGASIG  121

Query  526  NNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEVWGG  705
            N+VTVGH  +L+ CT+E+   +GMG+ +LDG +VE N+++AAG +V    RIP G++W G
Sbjct  122  NDVTVGHGCILYSCTIENNCLIGMGSIVLDGALVESNSILAAGTVVPPGRRIPSGQLWAG  181

Query  706  NPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAE  807
            +PA+++R +TE+EIA ++  A  Y  L   H+ E
Sbjct  182  SPAQYVRDVTEDEIADLTNQAKEYKKLADTHSDE  215



>ref|XP_009831264.1| hypothetical protein H257_07436 [Aphanomyces astaci]
 gb|ETV79423.1| hypothetical protein H257_07436 [Aphanomyces astaci]
Length=235

 Score =   224 bits (571),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 100/212 (47%), Positives = 151/212 (71%), Gaps = 0/212 (0%)
 Frame = +1

Query  172  RAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAPSA  351
            +A + +G  +RETGQA+DRLG R+ G+    E+ SRHR +M L+DK P +  +++VAP+A
Sbjct  3    KAIFELGRAVRETGQAVDRLGLRVLGSSLHREKFSRHRQIMALYDKAPVIAHDSWVAPNA  62

Query  352  SIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNN  531
            S+IGDV++   SS+WYG V+RGD+N VSIG  TNIQD +++H + +   G    T IGNN
Sbjct  63   SVIGDVEICNDSSVWYGVVIRGDLNKVSIGNRTNIQDRAVIHTSSTTTPGLAPGTSIGNN  122

Query  532  VTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEVWGGNP  711
            VTVGH A+L+ CT+E+   VGMG+ +LDG +VE N+++AAG +V    RIP  ++W G+P
Sbjct  123  VTVGHGAILYSCTIENNVLVGMGSIVLDGALVESNSILAAGTVVPPGRRIPSNQLWAGSP  182

Query  712  AKFLRKLTEEEIAFISQSALNYSNLKQGHAAE  807
            AK++R ++E+E+A + + A  Y+ L + H+ E
Sbjct  183  AKYVRDVSEDEVADLVKQASEYTKLAETHSDE  214



>ref|XP_005536976.1| transcription factor APFI [Cyanidioschyzon merolae strain 10D]
 dbj|BAM80940.1| transcription factor APFI [Cyanidioschyzon merolae strain 10D]
Length=303

 Score =   225 bits (574),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 119/255 (47%), Positives = 163/255 (64%), Gaps = 11/255 (4%)
 Frame = +1

Query  157  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQL--SRHRVLMNLFDKVPSVHRE  330
            M    R  Y +G+  RETGQALDR GC LQGN+ + E L  SRHR +MNL D+ P +  +
Sbjct  1    MSVFRRFLYHLGYLARETGQALDRAGCFLQGNFAYREALYLSRHRQIMNLVDRKPIISPQ  60

Query  331  A-FVAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKV  507
              F+AP+A+IIGDV +G  SS+WYG V+RGDVN V IG  TN+QD +++HVA     GK+
Sbjct  61   VQFIAPNAAIIGDVAIGAASSVWYGAVIRGDVNKVVIGERTNVQDRAVIHVASGG--GKL  118

Query  508  ---LPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTR  678
               LPT IGN VT+GH A+LH C VED+A VGMGA +LDG  VE  A+I AG+++   T 
Sbjct  119  ERALPTFIGNEVTIGHGAILHACAVEDQAVVGMGAIVLDGSRVESGAVIGAGSVLPPGTV  178

Query  679  IPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKS---LDENEFEKVL  849
            +  G++W G PA+F+R ++ EE    +     Y  L + HA E  K+   LD  +   +L
Sbjct  179  VGAGQLWLGTPARFVRLVSAEEKQQFAVQCSQYVELAKMHATECGKTPDQLDAEQMAALL  238

Query  850  RKKKDEDNDSILGVV  894
             +++ ED  S LG++
Sbjct  239  WEERSEDYLSSLGLL  253



>emb|CCI47075.1| unnamed protein product [Albugo candida]
Length=236

 Score =   220 bits (561),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 97/209 (46%), Positives = 149/209 (71%), Gaps = 0/209 (0%)
 Frame = +1

Query  181  YTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAPSASII  360
            + VG   RETGQALDR+G ++ GN  + EQ SRHR ++NL+DK P++  + +VAP+A++I
Sbjct  7    FKVGRAFRETGQALDRVGLKVLGNNSYKEQFSRHRQIINLYDKQPAIAHDVWVAPNATVI  66

Query  361  GDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTV  540
            GDV++   +S+WY  V+RGD+N+V+IG  TN+QD +++H +K N  G    T IGNNVT+
Sbjct  67   GDVEICNDASVWYNVVIRGDLNAVTIGNRTNVQDRTVIHTSKENSPGVPAGTSIGNNVTI  126

Query  541  GHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEVWGGNPAKF  720
            GH  VL+ CT+E+ + +GMG+ +LDG ++E N +I AG++V    RIP G++W GNPAK+
Sbjct  127  GHGCVLYSCTIENTSLIGMGSIILDGALIESNTIIGAGSVVPPGARIPSGQLWVGNPAKY  186

Query  721  LRKLTEEEIAFISQSALNYSNLKQGHAAE  807
            +R +T++E+  I + A  Y  +   H+AE
Sbjct  187  VRDITDDEVQDIIRQAKEYQAIALTHSAE  215



>ref|XP_002673591.1| gamma carbonic dehydratase [Naegleria gruberi]
 gb|EFC40847.1| gamma carbonic dehydratase [Naegleria gruberi]
Length=257

 Score =   220 bits (560),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 111/219 (51%), Positives = 145/219 (66%), Gaps = 8/219 (4%)
 Frame = +1

Query  181  YTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAPSASII  360
            + +G   RE G+A+DR+GC LQG+  + E L+R R +M   +  PSV   +F+AP+AS+I
Sbjct  10   HLIGSLFREAGEAMDRVGCFLQGSLAYKEDLNRTRRVMKFKNFKPSVQPSSFIAPNASVI  69

Query  361  GDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKV---LPTIIGNN  531
            G V +G +SS+WY  V+RGDVNS+ IG  TNIQD  ++H      TGKV    PTIIGNN
Sbjct  70   GSVSLGPNSSVWYNVVIRGDVNSIQIGENTNIQDRVIIHC-----TGKVGHEKPTIIGNN  124

Query  532  VTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEVWGGNP  711
            VTV   A+LH CT+EDE+++G GAT+LDG VV + AMIA GA+V   T +P GE+W G P
Sbjct  125  VTVESGAILHACTLEDESYIGFGATVLDGAVVGRGAMIAPGAVVTPGTIVPGGEIWAGVP  184

Query  712  AKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDE  828
            AK LR+LT EE   I +SA   S L Q H  E  K  +E
Sbjct  185  AKKLRELTPEEQESIKKSAAELSELAQVHKQEQDKEFEE  223



>ref|XP_005850191.1| hypothetical protein CHLNCDRAFT_20587 [Chlorella variabilis]
 gb|EFN58089.1| hypothetical protein CHLNCDRAFT_20587 [Chlorella variabilis]
Length=230

 Score =   214 bits (546),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 115/228 (50%), Positives = 154/228 (68%), Gaps = 0/228 (0%)
 Frame = +1

Query  166  LGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAP  345
            + R  + VG  +RETG ALDR G  LQG++ F E+LSRHR L  L  K PS+  + FVAP
Sbjct  1    MSRVLHAVGKALRETGLALDRAGATLQGSFAFREELSRHRSLAPLGGKSPSLGLDVFVAP  60

Query  346  SASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIG  525
            SA++IGDV++G ++S++YG V+R D  S+SIG  +N+QD  ++  A + L+G    T IG
Sbjct  61   SAAVIGDVKLGDNASVFYGSVIRADSGSISIGDKSNVQDGCVIRTASAFLSGHSADTTIG  120

Query  526  NNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEVWGG  705
              VT+GH A LHGCTV D A +GM +TLL+G  VE  AM+AAGA+V   T +  GE+WGG
Sbjct  121  RMVTIGHQASLHGCTVGDRALIGMNSTLLEGCSVEDGAMVAAGAVVAPGTVVKAGEIWGG  180

Query  706  NPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVL  849
            NPA FLRKL  EE  F+ +SA +Y+ L   HAAE  KSL++   +K L
Sbjct  181  NPAVFLRKLKPEEGKFLPESANHYARLAAEHAAETTKSLEQIAADKGL  228



>emb|CCA20868.1| conserved hypothetical protein [Albugo laibachii Nc14]
Length=236

 Score =   213 bits (542),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 96/209 (46%), Positives = 146/209 (70%), Gaps = 0/209 (0%)
 Frame = +1

Query  181  YTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAPSASII  360
            + VG   RETGQALDR+G R+     + EQ SRHR ++NL DK P++  + +VAP+A++I
Sbjct  7    FKVGRAFRETGQALDRVGLRVLEKNSYKEQFSRHRQIINLSDKRPTIAHDVWVAPNATVI  66

Query  361  GDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTV  540
            GDV++   +S+WY  V+RGD+N+V+IG  TN+QD +++H +K    G    T IGNNVT+
Sbjct  67   GDVEICNDASVWYNVVIRGDLNAVTIGNRTNVQDRTVIHTSKDTSPGIPAGTSIGNNVTI  126

Query  541  GHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEVWGGNPAKF  720
            GH  VL+ CT+E+ + +GMG+ +LDG +VE N +I AG++V   TRIP G++W GNPAK+
Sbjct  127  GHGCVLYSCTIENTSLIGMGSIILDGALVESNTIIGAGSVVPPGTRIPSGQLWVGNPAKY  186

Query  721  LRKLTEEEIAFISQSALNYSNLKQGHAAE  807
            +R +T++E+  I + +  Y  +   H+AE
Sbjct  187  VRDITDDEVQDIIRQSNEYQAIALTHSAE  215



>ref|XP_009523979.1| hypothetical protein PHYSODRAFT_285582 [Phytophthora sojae]
 gb|EGZ21262.1| hypothetical protein PHYSODRAFT_285582 [Phytophthora sojae]
Length=236

 Score =   213 bits (541),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 95/214 (44%), Positives = 147/214 (69%), Gaps = 0/214 (0%)
 Frame = +1

Query  166  LGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAP  345
            + +  + +G  +RETGQALDRLG R+  +  F E+ SRHR +M L+DK P +  + +VAP
Sbjct  2    MRKVTFELGRCVRETGQALDRLGLRVLNDNSFKEKFSRHRQVMALYDKRPKIAHDVWVAP  61

Query  346  SASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIG  525
            +A+++GDV++   +S++Y  V+RGD+N V IG  TN+QD +++H A S   G      IG
Sbjct  62   NATVVGDVEICNDASVFYNVVIRGDLNQVRIGNRTNVQDRTVIHTASSTSPGLAPGANIG  121

Query  526  NNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEVWGG  705
            N+VT+GH   L+ CTVE+ A +GMG+ +LDG +VE N +IAAG++V    RIP G++W G
Sbjct  122  NDVTIGHGCTLYSCTVENNALIGMGSIILDGALVESNTVIAAGSVVPPGRRIPSGQLWAG  181

Query  706  NPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAE  807
            NPAK++R L+++E+A I++ A  Y ++   H+ E
Sbjct  182  NPAKYVRDLSDDEVADITKQASEYKSIASTHSDE  215



>gb|KDD73982.1| hypothetical protein H632_c1679p0 [Helicosporidium sp. ATCC 50920]
Length=251

 Score =   212 bits (539),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 109/234 (47%), Positives = 149/234 (64%), Gaps = 13/234 (6%)
 Frame = +1

Query  166  LGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAP  345
            LG  FY +GF +RETGQALDR+G R++G++ F E+L+R R LMN+F K P + RE FVAP
Sbjct  9    LGYVFYRLGFALRETGQALDRVGSRMEGSWAFREELNRSRTLMNIFHKKPELGRETFVAP  68

Query  346  SASIIGDVQVGRHSSIWYGCVLRGDVNS-------------VSIGTGTNIQDNSLVHVAK  486
            SAS+IG V +G  +S++YG VLR +V+S             +++G  TNIQD  ++    
Sbjct  69   SASLIGRVTLGDQASVFYGSVLRDNVSSPPLPTPSTADKGRITVGPRTNIQDGVVIRTGP  128

Query  487  SNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVR  666
              L      T++G++VTVGH A LHG  V D   VGMGA L  GVV+E  +M+AA A+V 
Sbjct  129  GCLGEHKCDTVLGSDVTVGHLAALHGARVGDGCLVGMGAVLGHGVVMEPGSMVAANAVVA  188

Query  667  QNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDE  828
              T +  G+VWGGNPA+F+R L   E AF+ +SA +Y  +   H  EN  SL+E
Sbjct  189  PGTTVSAGQVWGGNPARFVRDLKPSEAAFLPESARHYVFVAAEHRNENGASLEE  242



>ref|XP_002908534.1| conserved hypothetical protein [Phytophthora infestans T30-4]
 gb|EEY61617.1| conserved hypothetical protein [Phytophthora infestans T30-4]
Length=236

 Score =   211 bits (536),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 94/214 (44%), Positives = 147/214 (69%), Gaps = 0/214 (0%)
 Frame = +1

Query  166  LGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAP  345
            + +  + +G  +RETGQALDRLG R+  +  F E+ SRHR +M L+DK P +  + +VAP
Sbjct  2    MRKVTFELGRCVRETGQALDRLGLRVLNDNSFKEKFSRHRQVMALYDKRPRIAHDVWVAP  61

Query  346  SASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIG  525
            +A+++GDV++   +S++Y  V+RGD+N V IG  TN+QD +++H A S   G      IG
Sbjct  62   NATVVGDVEICNDASVFYNVVIRGDLNQVRIGNRTNVQDRTVIHTASSTSPGLAPGANIG  121

Query  526  NNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEVWGG  705
            N+VT+GH   L+ CTVE+ + +GMG+ +LDG +VE N +IAAG++V    RIP G++W G
Sbjct  122  NDVTIGHGCTLYSCTVENNSLIGMGSIILDGALVESNTIIAAGSVVPPGRRIPSGQLWAG  181

Query  706  NPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAE  807
            NPAK++R L+++E+A I++ A  Y ++   H+ E
Sbjct  182  NPAKYVRDLSDDEVADIAKQASEYKSIASTHSDE  215



>ref|XP_008890951.1| hypothetical protein PPTG_01107 [Phytophthora parasitica INRA-310]
 gb|ETI56121.1| hypothetical protein F443_01293 [Phytophthora parasitica P1569]
 gb|ETK95912.1| hypothetical protein L915_01223 [Phytophthora parasitica]
 gb|ETL49292.1| hypothetical protein L916_01206 [Phytophthora parasitica]
 gb|ETM02344.1| hypothetical protein L917_01180 [Phytophthora parasitica]
 gb|ETM55585.1| hypothetical protein L914_01223 [Phytophthora parasitica]
 gb|ETN24946.1| hypothetical protein PPTG_01107 [Phytophthora parasitica INRA-310]
 gb|ETO84854.1| hypothetical protein F444_01295 [Phytophthora parasitica P1976]
 gb|ETP25915.1| hypothetical protein F441_01271 [Phytophthora parasitica CJ01A1]
 gb|ETP53918.1| hypothetical protein F442_01235 [Phytophthora parasitica P10297]
Length=236

 Score =   211 bits (536),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 93/214 (43%), Positives = 147/214 (69%), Gaps = 0/214 (0%)
 Frame = +1

Query  166  LGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAP  345
            + +  + +G  +RETGQALDRLG R+  +  F E+ SRHR +M L+DK P +  + +VAP
Sbjct  2    MRKVTFELGRCVRETGQALDRLGLRVLNDNSFKEKFSRHRQVMALYDKRPKIAHDVWVAP  61

Query  346  SASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIG  525
            +A+++GDV++   +S++Y  V+RGD+N V IG  TN+QD +++H A S   G      IG
Sbjct  62   NATVVGDVEICNDASVFYNVVIRGDLNQVRIGNRTNVQDRTVIHTASSTSPGLAPGANIG  121

Query  526  NNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEVWGG  705
            N+VT+GH   L+ CT+E+ + +GMG+ +LDG +VE N +IAAG++V    RIP G++W G
Sbjct  122  NDVTIGHGCTLYSCTIENNSLIGMGSIILDGALVESNTIIAAGSVVPPGRRIPPGQLWAG  181

Query  706  NPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAE  807
            NPAK++R L+++E+A I++ A  Y ++   H+ E
Sbjct  182  NPAKYVRDLSDDEVADITKQASEYKSIASTHSDE  215



>gb|AAU93943.1| gamma-carbonic anhydrase, partial [Helicosporidium sp. ex Simulium 
jonesi]
Length=246

 Score =   211 bits (536),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 102/214 (48%), Positives = 145/214 (68%), Gaps = 0/214 (0%)
 Frame = +1

Query  199  IRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAPSASIIGDVQVG  378
            +R  G+A++ +G  +QG   + E L++ + L+    K PS+  E FVAPSAS+IGDV++G
Sbjct  1    LRGLGKAVESIGVMMQGTLAYRETLNKSQTLLTYNAKRPSLAAEVFVAPSASVIGDVKIG  60

Query  379  RHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAVL  558
              SS+WYG V+RGDV SVSIG+ T++QDN++VHVAK N    +  T IG++VTVGH AV+
Sbjct  61   ASSSVWYGAVVRGDVGSVSIGSHTSVQDNAMVHVAKHNAQNTLRGTSIGSHVTVGHGAVV  120

Query  559  HGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEVWGGNPAKFLRKLTE  738
            H  T+ED  FVG GAT++DG  V++ A++AAG+L+     +P GEVW G PAK LR L  
Sbjct  121  HAATLEDGCFVGAGATVMDGATVQRGAVLAAGSLLAPGASVPAGEVWAGVPAKKLRGLAP  180

Query  739  EEIAFISQSALNYSNLKQGHAAENAKSLDENEFE  840
             E A+++ +A  YS L + HA E AK  +  E +
Sbjct  181  GEQAYLASAAEEYSALAKVHAGECAKGFNAVELD  214



>dbj|GAM24838.1| hypothetical protein SAMD00019534_080130 [Acytostelium subglobosum 
LB1]
Length=244

 Score =   209 bits (531),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 97/218 (44%), Positives = 143/218 (66%), Gaps = 0/218 (0%)
 Frame = +1

Query  163  SLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVA  342
            S+    Y +G  IR TG++LD+LGC LQGNY + E LSRH  +  L  KV S+ +E+F+A
Sbjct  4    SMKNIIYLIGDSIRSTGKSLDKLGCNLQGNYSYMENLSRHSRVTPLRGKVASLGKESFIA  63

Query  343  PSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTII  522
            PS+ +IG+V++G  SS+WY  VLR DVNS+ +G  T I D ++VH +  N      PT++
Sbjct  64   PSSCVIGNVEIGTKSSVWYNTVLRADVNSIVVGNETVISDRTVVHCSSENGPKGAQPTVV  123

Query  523  GNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEVWG  702
            GN V VG  A+LH C +ED+ ++G G+ + DG VVEK A + AG+LV    R+P  ++WG
Sbjct  124  GNRVFVGPGAILHACVIEDDVYIGPGSAVFDGAVVEKGAHLEAGSLVTAGKRVPANQIWG  183

Query  703  GNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAK  816
            G+PA+F+R+++ +E    SQ   + S L Q H A+ +K
Sbjct  184  GSPARFVREISSKEKEQHSQLINDNSKLAQEHDAQTSK  221



>ref|XP_001696746.1| gamma carbonic anhydrase [Chlamydomonas reinhardtii]
 gb|AAR82949.1| putative gamma carbonic anhydrase [Chlamydomonas reinhardtii]
 gb|AAR82950.1| putative gamma carbonic anhydrase [Chlamydomonas reinhardtii]
 gb|AAS48197.1| mitochondrial NADH:ubiquinone oxidoreductase 32 kDa subunit [Chlamydomonas 
reinhardtii]
 gb|EDP00854.1| gamma carbonic anhydrase [Chlamydomonas reinhardtii]
Length=312

 Score =   210 bits (535),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 109/256 (43%), Positives = 151/256 (59%), Gaps = 28/256 (11%)
 Frame = +1

Query  178  FYTVGFWIRETGQALDRLGCRLQG-----------NYYFHEQLSRHRVLMNLFDKVPSV-  321
             Y +G   R  G ALD LG  +QG           N  F     +  V +N    VP+  
Sbjct  29   LYGLGSLFRGVGAALDELGSMVQGPQGSVKDHVQPNLAFAPVHRKPDVPVNAGQVVPAPP  88

Query  322  ----------------HREAFVAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTN  453
                            H  AFVA +A+++G+V++G  SS+WYG VLRGDVN + +G  +N
Sbjct  89   AAARTLKIKEVVVPNKHSTAFVAANANVLGNVKLGAGSSVWYGAVLRGDVNGIEVGANSN  148

Query  454  IQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEK  633
            IQDN++VHV+K ++ G   PT+IGNNVT+GH+A +H CT+ED   VGMGAT+LDG  V+ 
Sbjct  149  IQDNAIVHVSKYSMDGTARPTVIGNNVTIGHAATVHACTIEDNCLVGMGATVLDGATVKS  208

Query  634  NAMIAAGALVRQNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENA  813
             +++AAGA+V  NT IP G+VW G+PAKFLR L  EE +FI +SA  Y+ L   H  E +
Sbjct  209  GSIVAAGAVVPPNTTIPSGQVWAGSPAKFLRHLEPEEASFIGKSASCYAELSAIHKFEQS  268

Query  814  KSLDENEFEKVLRKKK  861
            K+ +E   E  + K +
Sbjct  269  KTFEEQYTESCIIKDR  284



>gb|ETI49161.1| hypothetical protein F443_06919 [Phytophthora parasitica P1569]
 gb|ETK89052.1| hypothetical protein L915_06794 [Phytophthora parasitica]
 gb|ETL42459.1| hypothetical protein L916_06736 [Phytophthora parasitica]
 gb|ETL95631.1| hypothetical protein L917_06603 [Phytophthora parasitica]
 gb|ETM48826.1| hypothetical protein L914_06698 [Phytophthora parasitica]
 gb|ETO77896.1| hypothetical protein F444_06984 [Phytophthora parasitica P1976]
 gb|ETP18931.1| hypothetical protein F441_06922 [Phytophthora parasitica CJ01A1]
Length=251

 Score =   207 bits (527),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 105/244 (43%), Positives = 153/244 (63%), Gaps = 15/244 (6%)
 Frame = +1

Query  190  GFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAPSASIIGDV  369
            G  IR  GQ +DR+G  L+G + + E L+     +    + P      FVAP+AS+IGDV
Sbjct  7    GKAIRSLGQTIDRVGVSLEGKFTYTEHLNPSTRAVKNLGRSPKFEESVFVAPNASVIGDV  66

Query  370  QVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHS  549
            +VG+ SSIWY   +RGDVN ++IG  TNIQD ++VHVAK +   K +PT IG+NVTVG +
Sbjct  67   KVGKGSSIWYNATVRGDVNHITIGENTNIQDQAVVHVAKIH---KDIPTKIGSNVTVGPA  123

Query  550  AVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEVWGGNPAKFLRK  729
            A++H CT++D   +G GA +LDG VV   ++I AG++V +  ++P G++W G PA++LR 
Sbjct  124  AIVHACTIQDHCIIGTGAQVLDGAVVGAKSIITAGSIVTKGKQVPSGQLWSGVPARYLRD  183

Query  730  LTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFE----KVLR--------KKKDEDN  873
            LT EE  F+ Q +  Y+ L + HA E AK+ +E E +    K+LR        +K DE  
Sbjct  184  LTAEETQFMQQCSAEYTQLAEQHAEECAKTFEEYEADTERYKILRDVGETGLPQKGDERE  243

Query  874  DSIL  885
            D+ L
Sbjct  244  DTGL  247



>ref|XP_008903478.1| hypothetical protein PPTG_09984 [Phytophthora parasitica INRA-310]
 gb|ETN10960.1| hypothetical protein PPTG_09984 [Phytophthora parasitica INRA-310]
 gb|ETP46878.1| hypothetical protein F442_06954 [Phytophthora parasitica P10297]
Length=251

 Score =   206 bits (524),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 105/244 (43%), Positives = 153/244 (63%), Gaps = 15/244 (6%)
 Frame = +1

Query  190  GFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAPSASIIGDV  369
            G  IR  GQ +DR+G  L+G + + E L+     +    + P      FVAP+AS+IGDV
Sbjct  7    GKAIRSLGQTIDRVGVSLEGKFTYTEHLNPSTRAVKNLGRSPKFEEGVFVAPNASVIGDV  66

Query  370  QVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHS  549
            +VG+ SSIWY   +RGDVN ++IG  TNIQD ++VHVAK +   K +PT IG+NVTVG +
Sbjct  67   KVGKGSSIWYNATVRGDVNHITIGENTNIQDQAVVHVAKIH---KDIPTKIGSNVTVGPA  123

Query  550  AVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEVWGGNPAKFLRK  729
            A++H CT++D   +G GA +LDG VV   ++I AG++V +  ++P G++W G PA++LR 
Sbjct  124  AIVHACTIQDHCIIGTGAQVLDGAVVGAKSIITAGSIVTKGKQVPSGQLWSGVPARYLRD  183

Query  730  LTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFE----KVLR--------KKKDEDN  873
            LT EE  F+ Q +  Y+ L + HA E AK+ +E E +    K+LR        +K DE  
Sbjct  184  LTAEETQFMQQCSAEYTQLAEQHAEECAKTFEEYEADTERYKILRDVGETGLPQKGDERE  243

Query  874  DSIL  885
            D+ L
Sbjct  244  DTGL  247



>ref|XP_009149442.1| PREDICTED: LOW QUALITY PROTEIN: gamma carbonic anhydrase 1, mitochondrial 
[Brassica rapa]
Length=191

 Score =   203 bits (517),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 113/185 (61%), Positives = 137/185 (74%), Gaps = 19/185 (10%)
 Frame = +1

Query  385  SSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAVLHG  564
            +S+W       DVN+VS+G+GTNIQDNSLVHVAKS L GKV PTIIG+NV +GHSA+LHG
Sbjct  9    TSVW-------DVNTVSVGSGTNIQDNSLVHVAKSYLIGKVPPTIIGDNVIIGHSALLHG  61

Query  565  CTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTR--IPCGE-VWGGNPAKFLRKLT  735
            CTVEDEAF+ MGATLLDGVVVEK+ M+AAGA +   T   +P GE +WGGNP KFLRKL 
Sbjct  62   CTVEDEAFIRMGATLLDGVVVEKHDMVAAGACLFDKTLEFLPSGEKIWGGNPVKFLRKL-  120

Query  736  EEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKKKDEDNDSILGVVRETPPDL  915
            EE   F+ +SA NY NL + HAAENAK L+  EFEK    +KDE+ D++L      PP+L
Sbjct  121  EETDXFLPKSAENYPNLAKAHAAENAKPLNAIEFEK---GQKDEEYDAML-----XPPEL  172

Query  916  ILPNN  930
             L +N
Sbjct  173  KLSDN  177



>ref|XP_010649292.1| PREDICTED: gamma carbonic anhydrase 2, mitochondrial-like [Vitis 
vinifera]
Length=173

 Score =   202 bits (514),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 99/141 (70%), Positives = 114/141 (81%), Gaps = 3/141 (2%)
 Frame = +1

Query  517  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEV  696
            +I N    GH AVLHGCTVE+EAF+GMGATLLDG  VEK+AM+AAG LV Q+TRIPCGEV
Sbjct  23   MISNLNWTGHGAVLHGCTVENEAFIGMGATLLDGAFVEKHAMVAAGVLVLQDTRIPCGEV  82

Query  697  WGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKK---KDE  867
            W GNPA+FLRKLTEEEIAFISQSA+NYSNL Q HA ENA S DE  +EKVLRKK    + 
Sbjct  83   WAGNPARFLRKLTEEEIAFISQSAINYSNLAQVHAKENANSFDEIAYEKVLRKKFAYPET  142

Query  868  DNDSILGVVRETPPDLILPNN  930
            D  +++ V RETPP+LILP+N
Sbjct  143  DYAALVSVDRETPPELILPDN  163



>ref|XP_009821152.1| hypothetical protein H257_00264 [Aphanomyces astaci]
 gb|ETV88752.1| hypothetical protein H257_00264 [Aphanomyces astaci]
Length=249

 Score =   204 bits (520),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 98/226 (43%), Positives = 146/226 (65%), Gaps = 3/226 (1%)
 Frame = +1

Query  187  VGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAPSASIIGD  366
            +G  +R  GQ LD++G  ++G   + E+L     L+      P++    FVAP+AS+IG+
Sbjct  4    LGNTLRAFGQKLDKVGVSIEGALTYTERLVPSTRLVKFAGHKPTLAATTFVAPNASVIGE  63

Query  367  VQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGH  546
            V +G+ SS+WYG  +RGDVN+++IG  TNIQD ++VH AK        PTIIGNNVT+G 
Sbjct  64   VSIGQGSSVWYGATVRGDVNTITIGDNTNIQDQAVVHAAK---IANDFPTIIGNNVTIGP  120

Query  547  SAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEVWGGNPAKFLR  726
            +A++H   + ++  +G GA +LDG VV +N+++ AG++V Q   +P G++W G PA+ +R
Sbjct  121  NAIIHAAKISNQCIIGTGAQVLDGAVVGENSIVTAGSIVTQGKNVPAGQLWSGIPARAVR  180

Query  727  KLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKKKD  864
             LT EEI FI Q +L+Y  L + HA E AKS +E E +K  RK  D
Sbjct  181  DLTSEEIEFIKQCSLDYVELSEAHAVEAAKSFEEIEADKEKRKILD  226



>ref|XP_011398930.1| Uncharacterized protein F751_3672 [Auxenochlorella protothecoides]
 gb|KFM26034.1| Uncharacterized protein F751_3672 [Auxenochlorella protothecoides]
Length=232

 Score =   204 bits (518),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 101/203 (50%), Positives = 140/203 (69%), Gaps = 0/203 (0%)
 Frame = +1

Query  178  FYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAPSASI  357
              ++G  +R TG+A+D LG  LQG+  + E LS+ + ++      P++    F+APSAS+
Sbjct  5    LKSLGSVVRSTGKAIDSLGLALQGSLGYRETLSKAQTVLPYAGAKPAIADSVFIAPSASV  64

Query  358  IGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVT  537
            IG+V +G  SS+WYG VLRGDVNS+S+G  TNIQDN LVHVAK N   + LPT IG++VT
Sbjct  65   IGNVTLGSGSSVWYGTVLRGDVNSISVGEKTNIQDNVLVHVAKHNAAHQELPTRIGSSVT  124

Query  538  VGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEVWGGNPAK  717
            VGH AV+H  T+ D   +GMGA ++DG VVE  +++AAGALV   T +P G+VW G+PA+
Sbjct  125  VGHGAVIHAATLGDRVVIGMGAVVMDGAVVEPESIVAAGALVTPGTVVPSGQVWAGSPAR  184

Query  718  FLRKLTEEEIAFISQSALNYSNL  786
            FLR L   E  FI+ +A +Y+ L
Sbjct  185  FLRDLAPGEAEFIAAAAEDYARL  207



>ref|XP_009516211.1| hypothetical protein PHYSODRAFT_537494 [Phytophthora sojae]
 gb|EGZ28936.1| hypothetical protein PHYSODRAFT_537494 [Phytophthora sojae]
Length=251

 Score =   204 bits (519),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 100/225 (44%), Positives = 145/225 (64%), Gaps = 7/225 (3%)
 Frame = +1

Query  190  GFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAPSASIIGDV  369
            G  IR  GQ +DR+G  L+G   + E L+     +    + P      FVAP+AS+IGDV
Sbjct  7    GKAIRSLGQTIDRVGVSLEGKLTYTEHLNPSTRAVKNLGRAPKFEEGVFVAPNASVIGDV  66

Query  370  QVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHS  549
            +VG+ SSIWY   +RGDVN ++IG  TNIQD ++VHVAK +   + +PT IGNNVTVG +
Sbjct  67   KVGKGSSIWYNATVRGDVNHITIGENTNIQDQAVVHVAKIH---QDIPTKIGNNVTVGPN  123

Query  550  AVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEVWGGNPAKFLRK  729
            A++H CT++D   +G GA +LDG VV   +++ AG++V    ++P G++W G PA++LR 
Sbjct  124  AIVHACTIQDHCIIGTGAQVLDGAVVGAKSIVTAGSIVTMGKQVPSGQLWSGVPARYLRD  183

Query  730  LTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFE----KVLR  852
            LT EE+ F+ Q +  Y+ L + HA E AKS +E E +    K+LR
Sbjct  184  LTAEEMQFMQQCSAEYTQLAEQHAEECAKSFEEYEADTERFKILR  228



>ref|XP_008862851.1| hypothetical protein H310_01513 [Aphanomyces invadans]
 gb|ETW09046.1| hypothetical protein H310_01513 [Aphanomyces invadans]
Length=249

 Score =   203 bits (517),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 98/226 (43%), Positives = 146/226 (65%), Gaps = 3/226 (1%)
 Frame = +1

Query  187  VGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAPSASIIGD  366
            +G  +R  GQ LD++G  ++G   + E+L     L+N     P++    FVAP+AS+IG+
Sbjct  4    IGNTLRAFGQKLDKVGVSIEGALSYTERLVPSTRLVNHGGHKPALASTTFVAPNASVIGE  63

Query  367  VQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGH  546
            V +G+ SS+WYG  +RGDVN+++IG  TNIQD ++VH AK        PTIIGNNVT+G 
Sbjct  64   VSIGQGSSVWYGATVRGDVNAITIGDNTNIQDQAVVHAAK---IANDFPTIIGNNVTIGP  120

Query  547  SAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEVWGGNPAKFLR  726
             A++H   + ++  +G GA +LDG VV +N++I AG++V Q   +P G++W G PA+ +R
Sbjct  121  KAIIHAAKISNQCIIGTGAQVLDGAVVGENSIITAGSIVTQGKSVPAGQLWSGIPARAVR  180

Query  727  KLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKKKD  864
             LT EEI FI Q +L+Y  L + H+ E +KS +E E +K  RK  D
Sbjct  181  DLTTEEIEFIKQCSLDYVELSEAHSVEASKSFEEIEADKEKRKILD  226



>ref|XP_008610617.1| hypothetical protein SDRG_06605 [Saprolegnia diclina VS20]
 gb|EQC35855.1| hypothetical protein SDRG_06605 [Saprolegnia diclina VS20]
Length=249

 Score =   202 bits (513),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 98/227 (43%), Positives = 149/227 (66%), Gaps = 5/227 (2%)
 Frame = +1

Query  187  VGFWIRETGQALDRLGCRLQGNYYFHEQL-SRHRVLMNLFDKVPSVHREAFVAPSASIIG  363
            +G  +R  GQ+LD++G  L+G   + E+L    R++ N  +K P +   AFVAP+AS++G
Sbjct  4    LGKTLRSLGQSLDKVGVALEGRLTYTERLVPSTRLVANAGNK-PVLAEGAFVAPNASVVG  62

Query  364  DVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVG  543
            +V +G+ SS+WYG  +RGDVN ++IG  TN+QD +++H AK        PT+IGNNVT+G
Sbjct  63   EVSIGKGSSVWYGATVRGDVNHITIGDNTNVQDQAVIHAAK---IANDFPTVIGNNVTIG  119

Query  544  HSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEVWGGNPAKFL  723
             SAV+H C + ++  +G GA +LDG  V +N++I AG++V    ++P G++W G PA+ +
Sbjct  120  PSAVIHACKISNQCIIGTGAQVLDGAEVGENSIITAGSIVTMGKKVPAGQLWSGIPARPV  179

Query  724  RKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKKKD  864
            R LT +EI FI Q +L+Y  L + HA E AK+  + E EK  RK  D
Sbjct  180  RDLTSDEIEFIKQCSLDYVQLSEVHAGETAKTFAQIELEKENRKIMD  226



>gb|KIY95938.1| transferase [Monoraphidium neglectum]
Length=283

 Score =   202 bits (515),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 107/248 (43%), Positives = 149/248 (60%), Gaps = 13/248 (5%)
 Frame = +1

Query  166  LGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKV------PSVHR  327
            LG+  Y +G  +R TG+ALD +G  +QG Y    +L  +   + L          P    
Sbjct  18   LGKVLYGIGSVLRGTGKALDSVGSSIQGPYGVQAELPPNTAWLPLIANPQVSIVEPVKGP  77

Query  328  EAFVAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKS-NLTGK  504
            + FVA +A+I+G+V +G+ SSIWYG  LRGDVN+++IG  TNIQDN ++HVA+    T  
Sbjct  78   DVFVAQNATILGNVSIGKGSSIWYGATLRGDVNAITIGERTNIQDNVVIHVARHVPSTAA  137

Query  505  VLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  684
               T+IG+NVTV H A++H  T+ D   VGMGATLLDGV +E  +++AAGA+V     I 
Sbjct  138  PRATVIGSNVTVAHGALVHAATIGDGCLVGMGATLLDGVTLEPGSVVAAGAVVPPGAVIK  197

Query  685  CGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEF------EKV  846
             G++W G PAK LR ++ EE +F+ QSA NY+ L Q H  EN K  +E         E+ 
Sbjct  198  TGQIWAGAPAKLLRTVSAEEASFLVQSADNYAKLAQAHKTENGKVFEELVLDATIAGERA  257

Query  847  LRKKKDED  870
             R+K D D
Sbjct  258  WREKTDSD  265



>ref|XP_002997211.1| conserved hypothetical protein [Phytophthora infestans T30-4]
 gb|EEY69573.1| conserved hypothetical protein [Phytophthora infestans T30-4]
Length=251

 Score =   201 bits (512),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 104/244 (43%), Positives = 152/244 (62%), Gaps = 15/244 (6%)
 Frame = +1

Query  190  GFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAPSASIIGDV  369
            G  IR  GQ +DR+G  L+G   + E L+     +    + P      FVAP+A++IGDV
Sbjct  7    GKAIRSLGQTIDRVGVSLEGKLAYTEHLNPSTRAVKNLGRSPKFEEGVFVAPNAAVIGDV  66

Query  370  QVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHS  549
            +VG+ SSIWY   +RGDVN ++IG  TNIQD ++VHVAK +   K +PT IGNNVTVG +
Sbjct  67   KVGKGSSIWYNATVRGDVNHITIGENTNIQDQAVVHVAKIH---KDIPTKIGNNVTVGPA  123

Query  550  AVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEVWGGNPAKFLRK  729
            A++H CT++D   +G GA +LDG VV   ++I AG++V +  ++P G++W G PA++LR 
Sbjct  124  AIVHACTIQDHCIIGTGAQVLDGAVVGAKSIITAGSIVTKGKQVPSGQLWSGVPARYLRD  183

Query  730  LTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFE----KVLR--------KKKDEDN  873
            LT EE  F+ Q +  Y+ L + +A E AK+ +E E +    K+LR        +K DE  
Sbjct  184  LTAEETQFMQQCSSEYAQLAEQYADECAKTFEEYEADTERYKILRDVGETGLPQKGDERE  243

Query  874  DSIL  885
            D+ L
Sbjct  244  DTGL  247



>ref|XP_002956125.1| hypothetical protein VOLCADRAFT_83469 [Volvox carteri f. nagariensis]
 gb|EFJ42865.1| hypothetical protein VOLCADRAFT_83469 [Volvox carteri f. nagariensis]
Length=313

 Score =   203 bits (516),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 111/263 (42%), Positives = 151/263 (57%), Gaps = 29/263 (11%)
 Frame = +1

Query  160  GSLGRAFYTVGFWIRETGQALDRLGCRLQGNY-YFHEQLSRHRVLMNLFDK---------  309
            G +    Y +G  +R  G ALD LG  +QG      E +  +     +  K         
Sbjct  23   GFVESTLYGLGSVLRGVGIALDELGSMIQGPQGAIKEHVQPNLAFAPVHRKPDVPVGAGQ  82

Query  310  ------------------VPSVHREAFVAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVS  435
                              +P+ H  AFVA +A+++G+V++G +SSIWYG VLRGDVN + 
Sbjct  83   VVPAPAAAARTLKVKEMVIPNKHSTAFVAANANVLGNVKIGANSSIWYGAVLRGDVNGIF  142

Query  436  IGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLD  615
            +G  TNIQDN + HV+K +L G    T IGNNVT+GH A +H CT+ED   VGMGAT+LD
Sbjct  143  VGNNTNIQDNVVAHVSKYSLDGDARTTTIGNNVTIGHGATVHACTIEDNCLVGMGATILD  202

Query  616  GVVVEKNAMIAAGALVRQNTRIPCG-EVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQ  792
            G  V+K A++AAGA+V   T IP G +VW G+PAKFLR L  EE AFI++SA NYS L  
Sbjct  203  GATVKKGAIVAAGAVVPPKTVIPSGQQVWAGSPAKFLRNLEPEEEAFIARSAANYSELSA  262

Query  793  GHAAENAKSLDENEFEKVLRKKK  861
             H  E +K+ +E   E  + + +
Sbjct  263  IHKFEQSKTFEEQFVEMAIMRDR  285



>ref|WP_025898515.1| carbonic anhydrase [Sneathiella glossodoripedis]
Length=173

 Score =   196 bits (499),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/160 (56%), Positives = 122/160 (76%), Gaps = 5/160 (3%)
 Frame = +1

Query  313  PSVHREAFVAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSN  492
            PS     FVAPSA +IGDV++G  SSIW+ CV+RGDVNS+ IG  +NIQD +++HV+   
Sbjct  13   PSFDDTVFVAPSADVIGDVEIGEGSSIWFNCVVRGDVNSIRIGKRSNIQDGTVIHVSNGT  72

Query  493  LTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQN  672
                  P +IG++V VGH+ ++HGCT+EDE+FVGMGAT+LDG VVE  AM+AAGAL+  N
Sbjct  73   H-----PAVIGDDVLVGHNCIIHGCTLEDESFVGMGATVLDGAVVESGAMVAAGALLTPN  127

Query  673  TRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQ  792
             R+P GE+WGG+PAKFLRKL++EE+A ++  A +Y+ L Q
Sbjct  128  KRVPTGELWGGSPAKFLRKLSDEEVANLTSGAKHYAELAQ  167



>emb|CCI50078.1| unnamed protein product [Albugo candida]
Length=254

 Score =   197 bits (502),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 101/234 (43%), Positives = 148/234 (63%), Gaps = 7/234 (3%)
 Frame = +1

Query  166  LGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAP  345
            L      +G  IR  GQ+LDR G  L+G+  + E L+     +N   + P +   AF+AP
Sbjct  2    LKNGLEAIGKSIRSFGQSLDRTGVLLEGSASYTEHLNPSTRCVNNAGRRPKLEAAAFIAP  61

Query  346  SASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIG  525
            +AS+IG+V VG  SS+WYG  LRGD+N ++IG  TN+ D +++HVAK +   + +PTIIG
Sbjct  62   NASVIGEVNVGSGSSVWYGATLRGDINHITIGNHTNVLDAAIIHVAKIH---RDIPTIIG  118

Query  526  NNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEVWGG  705
            N+VT+G S+++H CT+     +G G  +LDG VVE  +++AAG++V     I  G++W G
Sbjct  119  NHVTIGPSSIIHACTIGSNCIIGTGTQILDGSVVESESVVAAGSIVTYGKVISSGQLWSG  178

Query  706  NPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDE----NEFEKVLRK  855
             PA+++R LT EE AFI QSA+ Y+ L   HA E  KSL+E    NE  K+L +
Sbjct  179  VPARYVRDLTTEEKAFIKQSAIEYAELSLIHAKECEKSLEEIVAANERSKILEE  232



>emb|CCA17668.1| conserved hypothetical protein [Albugo laibachii Nc14]
Length=254

 Score =   197 bits (501),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 94/221 (43%), Positives = 146/221 (66%), Gaps = 3/221 (1%)
 Frame = +1

Query  166  LGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAP  345
            L   F  +G  IR  GQ+LDR G  L+GN  + E L+     ++   + P +   AF+AP
Sbjct  2    LKNGFEAIGKSIRSFGQSLDRTGVLLEGNASYIEHLNPSTRCVSNAGRRPKMEAAAFIAP  61

Query  346  SASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIG  525
            +AS+IG+V +G+ SS+WYG  LRGD+N ++IG  TN+ +++++HVAK +   + +PTI+G
Sbjct  62   NASVIGEVTIGKGSSVWYGATLRGDINHITIGENTNVLESAIIHVAKIH---RDIPTIVG  118

Query  526  NNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEVWGG  705
            N+VT+G S+++H CT+     +G G+ +LDG VVE ++++AAG++V     +  G++W G
Sbjct  119  NHVTIGPSSIIHACTIGSNCIIGTGSQILDGSVVESDSIVAAGSIVTYGKVVSSGQLWSG  178

Query  706  NPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDE  828
             PA+++R LT EE AFI QSA+ Y+ L   HA E  KSL E
Sbjct  179  TPARYVRDLTSEEKAFIKQSAVEYAGLSLIHAKECDKSLQE  219



>ref|WP_002727628.1| carbonic anhydrase [Phaeospirillum molischianum]
 emb|CCG40950.1| Protein yrdA [Phaeospirillum molischianum DSM 120]
Length=174

 Score =   191 bits (486),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 89/162 (55%), Positives = 120/162 (74%), Gaps = 5/162 (3%)
 Frame = +1

Query  307  KVPSVHREAFVAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAK  486
            ++P +   AF+AP+A++IGDV +G  SSIW+GC+LRGDVN + IG  TNIQD +++HV +
Sbjct  11   RLPEIDATAFIAPNATVIGDVTIGAESSIWFGCILRGDVNEIRIGARTNIQDGTVIHVTR  70

Query  487  SNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVR  666
                 +   T IG+++T+GH+AVLHGCT+ED  F+GMGA LLDGVVVE+ AMIAAGA+V 
Sbjct  71   -----RTFGTNIGSDITIGHAAVLHGCTLEDCCFIGMGAVLLDGVVVEREAMIAAGAVVT  125

Query  667  QNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQ  792
               RI  GE+WGGNPA+ LR LTE++ A    SA NY+ L +
Sbjct  126  PGKRIRTGELWGGNPARLLRPLTEQDRAHFPISAANYTELSR  167



>ref|WP_021132357.1| carbonic anhydrase/acetyltransferase [Phaeospirillum fulvum]
 gb|EPY01605.1| carbonic anhydrase/acetyltransferase [Phaeospirillum fulvum MGU-K5]
Length=174

 Score =   191 bits (485),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 87/162 (54%), Positives = 120/162 (74%), Gaps = 5/162 (3%)
 Frame = +1

Query  307  KVPSVHREAFVAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAK  486
            ++P +   AF+AP+A++IG+V +G  SSIW+GC+LRGDVN + IG  TNIQD +++HV +
Sbjct  11   RLPEIDATAFIAPNATVIGEVTIGAESSIWFGCILRGDVNQIRIGERTNIQDGTVIHVTR  70

Query  487  SNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVR  666
                 K   T IG+++T+GH+AVLHGCT+ED  F+GMGA LLDGVVVE+ AM+AAGA+V 
Sbjct  71   -----KTFGTFIGSDITIGHAAVLHGCTLEDCCFIGMGAVLLDGVVVEREAMVAAGAVVT  125

Query  667  QNTRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQ  792
               R+  GE+WGGNPA+ LR LTE++ A    SA NY+ L +
Sbjct  126  PGKRVKSGELWGGNPARLLRPLTEQDRAHFPVSAANYTELAR  167



>dbj|BAF32946.1| putative gamma-type carbonic anhydrase [Pleurochrysis haptonemofera]
Length=234

 Score =   190 bits (483),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 92/214 (43%), Positives = 136/214 (64%), Gaps = 0/214 (0%)
 Frame = +1

Query  166  LGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAP  345
            L R    VG  +R+TGQA++R+GCR Q N+ F+E   RHR +MNL+D+ P V + AF+AP
Sbjct  2    LKRVAVGVGKALRDTGQAIERMGCRAQDNFIFNEPYCRHRAVMNLYDQRPRVAQGAFIAP  61

Query  346  SASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIG  525
            +A++IG+V +   +SIWYG V+RGD +++ IG  ++I D S+V  +  N TG    T IG
Sbjct  62   NAAVIGNVDIEPRTSIWYGAVIRGDQSNIFIGGESSIGDRSVVQSSTVNPTGFSARTCIG  121

Query  526  NNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEVWGG  705
            + V +G   VL  CT+ED   +G G  + +G ++E  AM+  G++V Q  R+P GEV+ G
Sbjct  122  DWVKIGQGCVLRACTIEDYCQIGDGCIVQEGALIENGAMLEPGSVVPQGARVPAGEVYAG  181

Query  706  NPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAE  807
            NPA F+RKL++EEI    + A    +L   H  E
Sbjct  182  NPATFVRKLSKEEIEEFGEYAEEVCDLAAKHLDE  215



>ref|XP_636871.1| trimeric LpxA-like domain-containing protein [Dictyostelium discoideum 
AX4]
 sp|Q54JC2.1|Y2881_DICDI RecName: Full=Uncharacterized protein DDB_G0288155 [Dictyostelium 
discoideum]
 gb|EAL63365.1| trimeric LpxA-like domain-containing protein [Dictyostelium discoideum 
AX4]
Length=246

 Score =   190 bits (483),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 95/235 (40%), Positives = 148/235 (63%), Gaps = 4/235 (2%)
 Frame = +1

Query  178  FYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAPSASI  357
            F  +G  ++ TG  L R GC++QG+Y + E+L+RH  L    D  P V +++F+AP+ASI
Sbjct  7    FGILGEVVKNTGLILHRTGCKMQGDYAYVEKLNRHTRLTAFGDNAPIVGQKSFIAPNASI  66

Query  358  IGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVT  537
            IGDV +G+ SSIWY  VLRGDVNS+ IG  T + D ++VH + +   G   PT IG+ V 
Sbjct  67   IGDVVIGKESSIWYNAVLRGDVNSIHIGDKTVVSDRTVVHCSSNGPLGP-KPTQIGDKVY  125

Query  538  VGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEVWGGNPAK  717
            +G  +++H  T+  E+F+G G+TL DG VVEKN  + AG+L+     I  GE WGG+PAK
Sbjct  126  IGPGSIVHAATILGESFIGTGSTLCDGSVVEKNGFLEAGSLLTAGKTIKSGEYWGGSPAK  185

Query  718  FLRKLT---EEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKKKDEDN  873
            F+R++T   E ++  I +  +N S   +   +++AK L+ +  +K ++ +   D+
Sbjct  186  FIRQVTKDDESQLEKIIEQNINLSEQHEKQTSKSAKELNNDLLQKYVKNRTRSDH  240



>ref|XP_005766975.1| gamma carbonic anhydrase [Emiliania huxleyi CCMP1516]
 gb|ABG37688.1| gamma carbonic anhydrase [Emiliania huxleyi]
 gb|EOD14546.1| gamma carbonic anhydrase [Emiliania huxleyi CCMP1516]
Length=235

 Score =   189 bits (481),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 100/214 (47%), Positives = 138/214 (64%), Gaps = 0/214 (0%)
 Frame = +1

Query  166  LGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAP  345
            + R    VG  +R+TGQA++R+G R Q N+ F E++ RHR LMNLFD+ P +    FVAP
Sbjct  1    MKRVLVGVGKALRDTGQAVERMGMRAQDNWIFQEKICRHRALMNLFDQRPKLRPSVFVAP  60

Query  346  SASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIG  525
            +AS+IG+V V   SSIWYG V+RGD + V IG  ++I D S+V  A  N TG    T IG
Sbjct  61   NASLIGNVSVMDESSIWYGAVVRGDQSPVDIGGKSSIGDRSVVLSASVNPTGFAAKTSIG  120

Query  526  NNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEVWGG  705
            + VTVG   VL GCTV++ A VG G  + +G +VE + ++ AG+++     +P GEV GG
Sbjct  121  DWVTVGQGCVLRGCTVDNFAVVGDGCVIGEGALVETHGVLEAGSVLPAGGLVPRGEVHGG  180

Query  706  NPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAE  807
            NPA F+RKL ++EIA I + A + S   + HA E
Sbjct  181  NPAAFVRKLEKDEIAAIEKKAEDVSMSAKKHADE  214



>ref|XP_005713311.1| carbonic anhydrase, gamma type [Chondrus crispus]
 emb|CDF33509.1| carbonic anhydrase, gamma type [Chondrus crispus]
Length=263

 Score =   191 bits (484),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 100/246 (41%), Positives = 144/246 (59%), Gaps = 13/246 (5%)
 Frame = +1

Query  166  LGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAP  345
            + RA Y  G  IRETGQALDR+G RLQG Y F EQLSRHR +MNL D  P +  + F+AP
Sbjct  1    MRRAAYAAGMMIRETGQALDRVGSRLQGKYAFIEQLSRHRQVMNLRDSKPIISSDVFLAP  60

Query  346  SASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIG  525
            SAS+IG+V++   SS+WYG V+RGD   V+IG    +QD +++H           P+ +G
Sbjct  61   SASVIGNVELHASSSVWYGAVIRGDTGPVTIGERAAVQDRAVIHA----------PSRVG  110

Query  526  NNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEVWGG  705
               T+   AV+    V   + VG  A +  G VV   +M+A G+ V   T I  GE+W G
Sbjct  111  AAATISCGAVVEAAAVGPNSVVGPAAVIAKGAVVGAGSMVAPGSYVAPGTEIADGELWSG  170

Query  706  NPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKV---LRKKKDEDND  876
             PA   R L+ +E   I Q++++ +NL   HA E  K+ ++ E EK+   L  ++ ED +
Sbjct  171  VPAVRERTLSAQEQEAIKQASIDMANLASAHATEAGKTHEQIEAEKLRQELLDERSEDYN  230

Query  877  SILGVV  894
            S +G++
Sbjct  231  SHMGLI  236



>ref|XP_002948065.1| hypothetical protein VOLCADRAFT_73531 [Volvox carteri f. nagariensis]
 gb|EFJ51053.1| hypothetical protein VOLCADRAFT_73531 [Volvox carteri f. nagariensis]
Length=229

 Score =   189 bits (480),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 96/221 (43%), Positives = 135/221 (61%), Gaps = 5/221 (2%)
 Frame = +1

Query  178  FYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAPSASI  357
             + VGF +RE+G AL+R+GCRLQG Y F E+LSRH  ++ +  + PS+ + A+VAPS  +
Sbjct  11   LHRVGFAMRESGLALERVGCRLQGIYSFEEKLSRHASVLPMRYETPSIAKSAWVAPSGML  70

Query  358  IGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVT  537
             G+V +G  SS+WYG ++RGD   V++G  +NIQD + V  A         P  IGNNV+
Sbjct  71   SGNVSIGEGSSVWYGAIVRGDFQPVTVGNNSNIQDAAYVGAASEFSP----PVNIGNNVS  126

Query  538  VGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEVWGGNPAK  717
            VGH AVL GCT+ D   VG+ A + + V V+  A+IAAGA V +   +P GEVW GNPAK
Sbjct  127  VGHGAVLKGCTIGDNVLVGINAVISENVEVQSGAVIAAGAYVEEGAVVPSGEVWAGNPAK  186

Query  718  FLRKLTEEEIAFISQSALNYSNLKQGHAA-ENAKSLDENEF  837
             LR + E E+ ++      Y+ L   H       SL + E+
Sbjct  187  KLRDVREGEVEYLKSLPGRYTELAGEHKGIMKVLSLKQKEY  227



>ref|WP_044828700.1| carbonic anhydrase [Thalassospira sp. HJ]
 gb|KJE35273.1| carbonic anhydrase [Thalassospira sp. HJ]
Length=175

 Score =   187 bits (475),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 87/173 (50%), Positives = 123/173 (71%), Gaps = 9/173 (5%)
 Frame = +1

Query  313  PSVHREAFVAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSN  492
            P++   AF+AP+A+IIGDV++G  + IW+GCV+RGDV+ + IG+ TNIQD ++VHVAK  
Sbjct  10   PTIDETAFIAPNATIIGDVEIGAETGIWFGCVIRGDVHEIRIGSRTNIQDMTMVHVAKGK  69

Query  493  LTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQN  672
                   T IG++VT+GHSA++H CT+ED +FVGMGAT++DG V+E+  M+ A AL+   
Sbjct  70   FG-----TYIGDDVTIGHSAIIHACTLEDRSFVGMGATVMDGCVIEQGGMLGANALLAPG  124

Query  673  TRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  831
             RIP GE+W G PA+ +R LT+EEI F   SA  Y++L Q    E  KS+ E+
Sbjct  125  KRIPAGELWAGVPARKVRDLTQEEIEFFKVSADRYADLAQ----EYVKSIPED  173



>ref|WP_007091625.1| MULTISPECIES: carbonic anhydrase [Thalassospira]
 gb|KEO58829.1| carbonic anhydrase [Thalassospira permensis NBRC 106175]
 gb|AJD51718.1| carbonic anhydrase/acetyltransferase [Thalassospira xiamenensis 
M-5 = DSM 17429]
Length=177

 Score =   187 bits (475),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 85/160 (53%), Positives = 118/160 (74%), Gaps = 5/160 (3%)
 Frame = +1

Query  313  PSVHREAFVAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSN  492
            P++   AF+AP+A+IIGDV++G  + IW+GCV+RGDV+ + IG+ TNIQD ++VHVAK  
Sbjct  10   PTIDETAFIAPNATIIGDVEIGAETGIWFGCVIRGDVHEIRIGSRTNIQDLTMVHVAKGK  69

Query  493  LTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQN  672
                   T IG++VT+GHSAV+H CT+ED +FVGM AT++DG V+E+ AM+ AGAL+   
Sbjct  70   FG-----TYIGDDVTIGHSAVIHACTLEDRSFVGMSATVMDGCVIEQGAMLGAGALLAPG  124

Query  673  TRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQ  792
             RIP GE+W G PA+ +R LT+EEI F   SA  Y++L Q
Sbjct  125  KRIPAGELWAGVPARKVRDLTQEEIEFFKVSADRYADLAQ  164



>dbj|GAM26691.1| hypothetical protein SAMD00019534_098660 [Acytostelium subglobosum 
LB1]
Length=242

 Score =   189 bits (479),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 99/253 (39%), Positives = 152/253 (60%), Gaps = 18/253 (7%)
 Frame = +1

Query  178  FYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAPSASI  357
            F  +G  IR TG+ALDRLGC +QGNY + E+L+RH  +M     +  + REAF+AP++S+
Sbjct  6    FAVLGDSIRSTGKALDRLGCSIQGNYAYIEKLNRHSRVMPFRGNIAHLGREAFIAPNSSV  65

Query  358  IGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVT  537
            IG V++G  SS+WY  VLRGD N++ IGT + I D ++++  +         T IG NV 
Sbjct  66   IGSVRIGHQSSVWYNTVLRGDTNAIIIGTNSIISDRTVINATRDK------QTTIGTNVY  119

Query  538  VGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIPCGEVWGGNPAK  717
            VG  A+L+GC+++    +G G+ +L+GV +E  A + AG++V  NT +P  +VWGG+PA+
Sbjct  120  VGPGAILNGCSIDSNVVIGTGSIVLEGVRIESGASLEAGSIVPANTVVPQNQVWGGSPAR  179

Query  718  FLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDENEFEKVLRKKKDEDNDSILGVVR  897
            F+R  T+E++A       ++S L Q H  +N KS           K+   D   +    R
Sbjct  180  FIRPATQEDVANRELLLDDHSTLAQEHEVQNLKSA----------KELHTDTLDVYANRR  229

Query  898  ETPPDLILPNNAP  936
            E P ++I  +NAP
Sbjct  230  ERPENVI--HNAP  240



>gb|EKF07893.1| carbonic anhydrase/acetyltransferase [Thalassospira profundimaris 
WP0211]
Length=175

 Score =   186 bits (472),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 87/173 (50%), Positives = 123/173 (71%), Gaps = 9/173 (5%)
 Frame = +1

Query  313  PSVHREAFVAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSN  492
            P++   AF+AP+A+IIGDV++G  + IW+GCV+RGDV+ + IG+ TNIQD ++VHVAK  
Sbjct  10   PTIDETAFIAPNATIIGDVEIGAETGIWFGCVIRGDVHEIRIGSRTNIQDLTMVHVAKGK  69

Query  493  LTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQN  672
                   T IG++VT+GHSA++H CT+ED +FVGMGAT++DG V+E+  M+ A AL+   
Sbjct  70   FG-----TYIGDDVTIGHSAIIHACTLEDRSFVGMGATVMDGCVIEQGGMLGANALLAPG  124

Query  673  TRIPCGEVWGGNPAKFLRKLTEEEIAFISQSALNYSNLKQGHAAENAKSLDEN  831
             RIP GE+W G PA+ +R LT+EEI F   SA  Y++L Q    E  KS+ E+
Sbjct  125  KRIPAGELWAGVPARKVRNLTQEEIEFFKVSADRYADLAQ----EYVKSVPED  173



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4242035923026