BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig11462

Length=938
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009796725.1|  PREDICTED: uncharacterized protein LOC104243262    180   9e-52   Nicotiana sylvestris
ref|XP_009587088.1|  PREDICTED: uncharacterized protein LOC104084...    179   1e-51   Nicotiana tomentosiformis
ref|XP_009587086.1|  PREDICTED: uncharacterized protein LOC104084...    170   1e-47   Nicotiana tomentosiformis
ref|XP_006353405.1|  PREDICTED: uncharacterized protein LOC102603...    168   3e-47   Solanum tuberosum [potatoes]
ref|XP_004240896.1|  PREDICTED: uncharacterized protein LOC101265648    166   1e-46   Solanum lycopersicum
ref|XP_003633434.1|  PREDICTED: uncharacterized protein LOC100253518    150   7e-41   Vitis vinifera
ref|XP_009761007.1|  PREDICTED: uncharacterized protein LOC104213009    149   4e-40   Nicotiana sylvestris
emb|CDP13949.1|  unnamed protein product                                149   9e-40   Coffea canephora [robusta coffee]
gb|EYU20083.1|  hypothetical protein MIMGU_mgv1a015205mg                141   6e-37   Erythranthe guttata [common monkey flower]
ref|XP_010031141.1|  PREDICTED: uncharacterized protein LOC104421024    140   1e-36   Eucalyptus grandis [rose gum]
ref|XP_010256999.1|  PREDICTED: uncharacterized protein LOC104597244    137   1e-35   Nelumbo nucifera [Indian lotus]
gb|KHG28253.1|  Putative sel1-like repeat-containing protein L18        136   2e-35   Gossypium arboreum [tree cotton]
ref|XP_008233834.1|  PREDICTED: uncharacterized protein LOC103332...    135   4e-35   Prunus mume [ume]
ref|XP_011076630.1|  PREDICTED: uncharacterized protein LOC105160829    136   4e-35   Sesamum indicum [beniseed]
ref|XP_007218537.1|  hypothetical protein PRUPE_ppa012708mg             135   6e-35   Prunus persica
gb|KJB77082.1|  hypothetical protein B456_012G119700                    131   2e-33   Gossypium raimondii
ref|XP_002520815.1|  conserved hypothetical protein                     129   1e-32   Ricinus communis
ref|XP_008233835.1|  PREDICTED: uncharacterized protein LOC103332...    128   2e-32   
ref|XP_002265642.1|  PREDICTED: uncharacterized protein LOC100243...    126   3e-32   Vitis vinifera
ref|XP_010921063.1|  PREDICTED: uncharacterized protein LOC105044761    128   5e-32   Elaeis guineensis
gb|ERM95583.1|  hypothetical protein AMTR_s00023p00110940               125   5e-32   Amborella trichopoda
ref|XP_011651843.1|  PREDICTED: uncharacterized protein LOC101206121    125   6e-32   Cucumis sativus [cucumbers]
ref|XP_010264502.1|  PREDICTED: uncharacterized protein LOC104602492    125   8e-32   
ref|XP_008442362.1|  PREDICTED: uncharacterized protein LOC103486254    125   1e-31   Cucumis melo [Oriental melon]
ref|XP_006828167.2|  PREDICTED: uncharacterized protein LOC18423503     126   1e-31   Amborella trichopoda
ref|XP_010039279.1|  PREDICTED: uncharacterized protein LOC104427...    124   3e-31   Eucalyptus grandis [rose gum]
ref|XP_008355547.1|  PREDICTED: uncharacterized protein LOC103419212    125   4e-31   Malus domestica [apple tree]
ref|XP_009369229.1|  PREDICTED: uncharacterized protein LOC103958662    125   5e-31   Pyrus x bretschneideri [bai li]
ref|XP_010039170.1|  PREDICTED: uncharacterized protein LOC104427...    124   7e-31   Eucalyptus grandis [rose gum]
ref|XP_009350684.1|  PREDICTED: uncharacterized protein LOC103942213    124   8e-31   Pyrus x bretschneideri [bai li]
gb|KCW88248.1|  hypothetical protein EUGRSUZ_A00636                     125   1e-30   Eucalyptus grandis [rose gum]
ref|XP_010091064.1|  hypothetical protein L484_021946                   128   2e-30   
ref|XP_006429512.1|  hypothetical protein CICLE_v10013155mg             122   2e-30   Citrus clementina [clementine]
ref|XP_007026543.1|  Uncharacterized protein TCM_021578                 123   3e-30   
ref|XP_007207508.1|  hypothetical protein PRUPE_ppa013808mg             121   3e-30   Prunus persica
ref|XP_002315124.1|  hypothetical protein POPTR_0010s18960g             122   3e-30   Populus trichocarpa [western balsam poplar]
ref|XP_006486231.1|  PREDICTED: uncharacterized protein LOC102630...    122   4e-30   
gb|EPS60291.1|  hypothetical protein M569_14514                         122   4e-30   Genlisea aurea
ref|XP_011077502.1|  PREDICTED: uncharacterized protein LOC105161501    120   5e-30   Sesamum indicum [beniseed]
ref|XP_012089743.1|  PREDICTED: polynucleotide 5'-hydroxyl-kinase...    122   6e-30   Jatropha curcas
ref|XP_004307701.1|  PREDICTED: uncharacterized protein LOC101294508    122   6e-30   Fragaria vesca subsp. vesca
ref|XP_007134617.1|  hypothetical protein PHAVU_010G062000g             120   7e-30   Phaseolus vulgaris [French bean]
ref|XP_011015169.1|  PREDICTED: uncharacterized protein LOC105118821    121   8e-30   Populus euphratica
ref|XP_008355552.1|  PREDICTED: uncharacterized protein LOC103419214    121   9e-30   Malus domestica [apple tree]
gb|EYU41977.1|  hypothetical protein MIMGU_mgv1a016033mg                121   9e-30   Erythranthe guttata [common monkey flower]
ref|XP_008782586.1|  PREDICTED: uncharacterized protein LOC103702077    121   1e-29   Phoenix dactylifera
ref|XP_012089744.1|  PREDICTED: uncharacterized protein LOC105648...    120   1e-29   Jatropha curcas
ref|XP_010695454.1|  PREDICTED: uncharacterized protein LOC104908080    121   2e-29   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010543693.1|  PREDICTED: uncharacterized protein LOC104816524    119   7e-29   Tarenaya hassleriana [spider flower]
ref|XP_007008833.1|  Uncharacterized protein TCM_042415                 119   7e-29   
ref|XP_009416310.1|  PREDICTED: uncharacterized protein LOC103996957    118   1e-28   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011095090.1|  PREDICTED: uncharacterized protein LOC105174627    117   2e-28   Sesamum indicum [beniseed]
ref|NP_001238121.1|  uncharacterized protein LOC100527831               116   2e-28   Glycine max [soybeans]
ref|XP_003623468.1|  hypothetical protein MTR_7g071210                  115   3e-28   Medicago truncatula
emb|CDX70156.1|  BnaA10g25050D                                          117   3e-28   
ref|XP_008370215.1|  PREDICTED: uncharacterized protein LOC103433...    117   3e-28   Malus domestica [apple tree]
ref|XP_009122145.1|  PREDICTED: uncharacterized protein LOC103846889    117   3e-28   Brassica rapa
ref|XP_006289188.1|  hypothetical protein CARUB_v10002629mg             117   3e-28   Capsella rubella
ref|XP_008370217.1|  PREDICTED: uncharacterized protein LOC103433...    115   4e-28   Malus domestica [apple tree]
ref|XP_004146456.1|  PREDICTED: uncharacterized protein LOC101213...    117   4e-28   Cucumis sativus [cucumbers]
ref|XP_008388305.1|  PREDICTED: uncharacterized protein LOC103450710    115   4e-28   
ref|XP_003522147.1|  PREDICTED: uncharacterized protein LOC100794...    115   6e-28   Glycine max [soybeans]
emb|CDX98838.1|  BnaC09g49970D                                          116   1e-27   
gb|KFK24957.1|  hypothetical protein AALP_AA8G047700                    115   1e-27   Arabis alpina [alpine rockcress]
gb|AAO42324.1|  unknown protein                                         115   1e-27   Arabidopsis thaliana [mouse-ear cress]
ref|NP_196155.2|  uncharacterized protein                               115   2e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006398999.1|  hypothetical protein EUTSA_v10014886mg             115   2e-27   Eutrema salsugineum [saltwater cress]
ref|XP_009373105.1|  PREDICTED: uncharacterized protein LOC103962...    114   4e-27   Pyrus x bretschneideri [bai li]
ref|XP_009373106.1|  PREDICTED: uncharacterized protein LOC103962...    113   4e-27   Pyrus x bretschneideri [bai li]
ref|XP_009373104.1|  PREDICTED: uncharacterized protein LOC103962...    114   4e-27   
ref|XP_010491070.1|  PREDICTED: uncharacterized protein LOC104768733    114   5e-27   Camelina sativa [gold-of-pleasure]
gb|ABK26779.1|  unknown                                                 113   1e-26   Picea sitchensis
ref|XP_010452441.1|  PREDICTED: uncharacterized protein LOC104734539    114   1e-26   Camelina sativa [gold-of-pleasure]
ref|XP_010683583.1|  PREDICTED: uncharacterized protein LOC104898233    111   1e-26   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010529121.1|  PREDICTED: uncharacterized protein LOC104806101    112   1e-26   Tarenaya hassleriana [spider flower]
ref|XP_010423476.1|  PREDICTED: uncharacterized protein LOC104708579    113   2e-26   Camelina sativa [gold-of-pleasure]
dbj|BAJ91570.1|  predicted protein                                      112   2e-26   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009402772.1|  PREDICTED: uncharacterized protein LOC103986477    112   2e-26   
ref|XP_008456900.1|  PREDICTED: uncharacterized protein LOC103496...    112   3e-26   Cucumis melo [Oriental melon]
ref|XP_004492521.1|  PREDICTED: uncharacterized protein LOC101512...    110   4e-26   Cicer arietinum [garbanzo]
ref|XP_006435843.1|  hypothetical protein CICLE_v10033159mg             110   5e-26   
ref|XP_007163593.1|  hypothetical protein PHAVU_001G247500g             111   5e-26   Phaseolus vulgaris [French bean]
ref|XP_009421407.1|  PREDICTED: uncharacterized protein LOC104000963    111   5e-26   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB77084.1|  hypothetical protein B456_012G119700                    110   5e-26   Gossypium raimondii
gb|KGN65322.1|  hypothetical protein Csa_1G324870                       109   6e-26   Cucumis sativus [cucumbers]
ref|NP_001144203.1|  uncharacterized protein LOC100277064               111   8e-26   Zea mays [maize]
ref|XP_008809978.1|  PREDICTED: uncharacterized protein LOC103721508    111   9e-26   
ref|XP_009421405.1|  PREDICTED: uncharacterized protein LOC104000960    108   1e-25   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003558119.1|  PREDICTED: uncharacterized protein LOC100845835    110   1e-25   Brachypodium distachyon [annual false brome]
ref|XP_003552182.1|  PREDICTED: uncharacterized protein LOC100779520    110   1e-25   Glycine max [soybeans]
gb|AAC28759.2|  expressed protein                                       108   2e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002879746.1|  hypothetical protein ARALYDRAFT_345628             109   2e-25   Arabidopsis lyrata subsp. lyrata
ref|XP_010509118.1|  PREDICTED: uncharacterized protein LOC104785576    109   2e-25   Camelina sativa [gold-of-pleasure]
gb|KJB67482.1|  hypothetical protein B456_010G193200                    109   3e-25   Gossypium raimondii
ref|NP_565889.2|  uncharacterized protein                               108   3e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009406892.1|  PREDICTED: uncharacterized protein LOC103989686    109   4e-25   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN31321.1|  hypothetical protein glysoja_022975                     109   4e-25   Glycine soja [wild soybean]
ref|XP_006295208.1|  hypothetical protein CARUB_v10024290mg             108   4e-25   Capsella rubella
gb|KFK36738.1|  hypothetical protein AALP_AA4G163100                    107   5e-25   Arabis alpina [alpine rockcress]
ref|XP_002265673.1|  PREDICTED: uncharacterized protein LOC100243...    107   5e-25   Vitis vinifera
ref|XP_010505467.1|  PREDICTED: uncharacterized protein LOC104782284    108   6e-25   Camelina sativa [gold-of-pleasure]
ref|XP_010517139.1|  PREDICTED: uncharacterized protein LOC104792...    107   9e-25   Camelina sativa [gold-of-pleasure]
gb|AAM62527.1|  unknown                                                 106   1e-24   Arabidopsis thaliana [mouse-ear cress]
gb|ACU23149.1|  unknown                                                 107   1e-24   Glycine max [soybeans]
gb|KHN04800.1|  hypothetical protein glysoja_031900                     107   1e-24   Glycine soja [wild soybean]
ref|XP_004146455.1|  PREDICTED: uncharacterized protein LOC101213...    108   2e-24   Cucumis sativus [cucumbers]
ref|XP_012091209.1|  PREDICTED: uncharacterized protein LOC105649227    107   2e-24   Jatropha curcas
gb|AFK39264.1|  unknown                                                 104   4e-24   Lotus japonicus
ref|XP_007140174.1|  hypothetical protein PHAVU_008G090100g             104   4e-24   Phaseolus vulgaris [French bean]
ref|XP_002312191.1|  hypothetical protein POPTR_0008s07490g             103   8e-24   Populus trichocarpa [western balsam poplar]
ref|XP_008456899.1|  PREDICTED: uncharacterized protein LOC103496...    106   9e-24   
ref|XP_006481131.1|  PREDICTED: uncharacterized protein LOC102610...    104   1e-23   Citrus sinensis [apfelsine]
ref|XP_004500530.1|  PREDICTED: uncharacterized protein LOC101512...    105   1e-23   
emb|CDY07730.1|  BnaA03g17810D                                          103   2e-23   Brassica napus [oilseed rape]
ref|XP_006374033.1|  hypothetical protein POPTR_0016s13640g             103   2e-23   Populus trichocarpa [western balsam poplar]
ref|XP_011032587.1|  PREDICTED: uncharacterized protein LOC105131358    103   2e-23   Populus euphratica
ref|XP_009133257.1|  PREDICTED: uncharacterized protein LOC103857...    103   3e-23   Brassica rapa
ref|XP_011005568.1|  PREDICTED: uncharacterized protein LOC105111778    102   3e-23   Populus euphratica
ref|XP_006654273.1|  PREDICTED: uncharacterized protein LOC102714375    102   4e-23   Oryza brachyantha
ref|XP_011655024.1|  PREDICTED: uncharacterized protein LOC101213...    102   4e-23   Cucumis sativus [cucumbers]
ref|NP_001238136.1|  uncharacterized protein LOC100527576               101   7e-23   Glycine max [soybeans]
ref|XP_004984894.1|  PREDICTED: myc-associated zinc finger protei...    103   7e-23   Setaria italica
ref|NP_974733.1|  uncharacterized protein                               102   1e-22   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001055251.1|  Os05g0342900                                       100   2e-22   
ref|XP_002465405.1|  hypothetical protein SORBIDRAFT_01g038090          102   4e-22   
ref|XP_004962417.1|  PREDICTED: uncharacterized protein LOC101777...  99.0    6e-22   Setaria italica
ref|NP_001049844.1|  Os03g0298600                                       100   9e-22   
gb|EEE58888.1|  hypothetical protein OsJ_10507                        99.8    2e-21   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006411058.1|  hypothetical protein EUTSA_v10017381mg           97.8    4e-21   Eutrema salsugineum [saltwater cress]
ref|XP_003601009.1|  hypothetical protein MTR_3g072010                97.8    5e-21   Medicago truncatula
ref|XP_006282317.1|  hypothetical protein CARUB_v10028606mg           95.9    9e-21   
ref|XP_006289773.1|  hypothetical protein CARUB_v10003374mg           95.9    1e-20   
gb|KDO44850.1|  hypothetical protein CISIN_1g032635mg                 94.0    6e-20   Citrus sinensis [apfelsine]
gb|KJB67484.1|  hypothetical protein B456_010G193200                  95.1    8e-20   Gossypium raimondii
ref|XP_010497949.1|  PREDICTED: uncharacterized protein LOC104775718  90.1    3e-19   
ref|XP_002871153.1|  hypothetical protein ARALYDRAFT_325170           93.2    3e-19   
dbj|BAB09979.1|  unnamed protein product                              93.2    4e-19   Arabidopsis thaliana [mouse-ear cress]
gb|KHN29550.1|  hypothetical protein glysoja_005274                   90.1    4e-18   Glycine soja [wild soybean]
gb|EMT09012.1|  hypothetical protein F775_27191                       88.6    9e-18   
gb|EMS50296.1|  hypothetical protein TRIUR3_29514                     90.1    3e-17   Triticum urartu
dbj|BAK02754.1|  predicted protein                                    86.3    5e-17   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010517140.1|  PREDICTED: uncharacterized protein LOC104792...  84.7    1e-16   Camelina sativa [gold-of-pleasure]
ref|NP_001143861.1|  uncharacterized protein LOC100276657             85.1    1e-16   
ref|XP_010529921.1|  PREDICTED: uncharacterized protein LOC104806634  85.5    2e-16   Tarenaya hassleriana [spider flower]
ref|NP_001142513.1|  hypothetical protein                             83.2    3e-16   Zea mays [maize]
ref|XP_008647657.1|  PREDICTED: uncharacterized protein LOC100276...  82.8    3e-16   
ref|XP_008654668.1|  PREDICTED: uncharacterized protein LOC100274...  82.8    3e-16   Zea mays [maize]
ref|XP_002439596.1|  hypothetical protein SORBIDRAFT_09g015880        82.4    4e-16   Sorghum bicolor [broomcorn]
gb|ACG31011.1|  hypothetical protein                                  81.3    1e-15   Zea mays [maize]
ref|XP_009133258.1|  PREDICTED: uncharacterized protein LOC103857...  81.6    2e-15   Brassica rapa
emb|CBI25405.3|  unnamed protein product                              72.8    5e-13   Vitis vinifera
emb|CBI18085.3|  unnamed protein product                              71.6    1e-12   Vitis vinifera
ref|XP_001778215.1|  predicted protein                                69.7    5e-11   
ref|XP_002526705.1|  hypothetical protein RCOM_0850070                67.4    2e-10   
ref|XP_005650064.1|  hypothetical protein COCSUDRAFT_32673            65.5    8e-10   Coccomyxa subellipsoidea C-169
ref|XP_001692982.1|  predicted protein                                65.9    9e-10   Chlamydomonas reinhardtii
gb|EEE63318.1|  hypothetical protein OsJ_18129                        63.5    3e-09   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002950802.1|  hypothetical protein VOLCADRAFT_120924           64.3    3e-09   Volvox carteri f. nagariensis
gb|KIY93418.1|  hypothetical protein MNEG_14545                       55.1    3e-06   Monoraphidium neglectum
ref|XP_009590059.1|  PREDICTED: uncharacterized protein LOC104087340  53.5    6e-06   
gb|KIY94194.1|  hypothetical protein MNEG_13768                       50.8    6e-05   Monoraphidium neglectum
ref|XP_002505403.1|  predicted protein                                52.4    6e-05   Micromonas commoda
ref|XP_003059675.1|  predicted protein                                51.6    1e-04   Micromonas pusilla CCMP1545
ref|XP_005850343.1|  hypothetical protein CHLNCDRAFT_142152           53.9    1e-04   Chlorella variabilis
ref|XP_002962942.1|  hypothetical protein SELMODRAFT_404377           51.6    7e-04   



>ref|XP_009796725.1| PREDICTED: uncharacterized protein LOC104243262 [Nicotiana sylvestris]
 ref|XP_009796726.1| PREDICTED: uncharacterized protein LOC104243262 [Nicotiana sylvestris]
Length=175

 Score =   180 bits (456),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 114/178 (64%), Positives = 137/178 (77%), Gaps = 6/178 (3%)
 Frame = +1

Query  91   MGKSVPSPTKLQDFARIIGSNTPRRR-PTQVKPPVSRTRSVSPAEGPKLKGLVGGlesps  267
            MGKSV SP ++QDFARII S+  R   PTQVKPP SR RSV  A   K + +VGG  S  
Sbjct  1    MGKSVLSPNRIQDFARIISSSNNRIHGPTQVKPPASRIRSVPSA---KSRAVVGGDSSER  57

Query  268  serrlrrN--KMeeessngnsseeQRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQV  441
              +   +N  +    S++  SS  Q+ +R+PLA+VV DCV+RWFQDTLKEAKAGDISMQV
Sbjct  58   RLKLRTKNMEEASSNSNSNTSSSNQQRQRVPLADVVADCVKRWFQDTLKEAKAGDISMQV  117

Query  442  LVGQMYFSGYGVSRDAQKGKawisrasrtrssawrVSDKRPGYNVSDSDSDDTAGEAK  615
            LVGQMY+SGYG+SRDAQKG+AWI+RAS++RSSAW+VSDKRPGYN SDSDSDDT  +AK
Sbjct  118  LVGQMYYSGYGISRDAQKGRAWINRASKSRSSAWKVSDKRPGYNASDSDSDDTVEDAK  175



>ref|XP_009587088.1| PREDICTED: uncharacterized protein LOC104084834 isoform X2 [Nicotiana 
tomentosiformis]
Length=175

 Score =   179 bits (454),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 113/178 (63%), Positives = 137/178 (77%), Gaps = 6/178 (3%)
 Frame = +1

Query  91   MGKSVPSPTKLQDFARIIGSNTPRRR-PTQVKPPVSRTRSVSPAEGPKLKGLVGGlesps  267
            MGKSVPSP ++QDFARII S+  R   PTQVKPP SR RS+  A   K + +VGG  S  
Sbjct  1    MGKSVPSPNRIQDFARIISSSNNRIHGPTQVKPPASRIRSLPSA---KSRAVVGGDSSER  57

Query  268  serrlrrN--KMeeessngnsseeQRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQV  441
              +   +N  +    S++  SS  Q+ +R+PLA+VV DCV+RWFQDTLKEAKAGDISMQV
Sbjct  58   RLKLKTKNMEEASSNSNSNTSSSNQQRQRVPLADVVADCVKRWFQDTLKEAKAGDISMQV  117

Query  442  LVGQMYFSGYGVSRDAQKGKawisrasrtrssawrVSDKRPGYNVSDSDSDDTAGEAK  615
            LVGQMY+SGYG+SRDAQKG+AWI+RAS++RSSAW+VSDKRPGYN SDSDSDDT  + K
Sbjct  118  LVGQMYYSGYGISRDAQKGRAWINRASKSRSSAWKVSDKRPGYNASDSDSDDTVEDPK  175



>ref|XP_009587086.1| PREDICTED: uncharacterized protein LOC104084834 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009587087.1| PREDICTED: uncharacterized protein LOC104084834 isoform X1 [Nicotiana 
tomentosiformis]
Length=189

 Score =   170 bits (430),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 113/192 (59%), Positives = 137/192 (71%), Gaps = 20/192 (10%)
 Frame = +1

Query  91   MGKSVPSPTKLQDFARIIGSNTPRRR-PTQVKPPVSRTRSVSPAEGPKLKGLVGGlesps  267
            MGKSVPSP ++QDFARII S+  R   PTQVKPP SR RS+  A   K + +VGG  S  
Sbjct  1    MGKSVPSPNRIQDFARIISSSNNRIHGPTQVKPPASRIRSLPSA---KSRAVVGGDSSER  57

Query  268  serrlrrN--KMeeessngnsseeQRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQV  441
              +   +N  +    S++  SS  Q+ +R+PLA+VV DCV+RWFQDTLKEAKAGDISMQV
Sbjct  58   RLKLKTKNMEEASSNSNSNTSSSNQQRQRVPLADVVADCVKRWFQDTLKEAKAGDISMQV  117

Query  442  LVGQMYFSGYGVSRDAQK--------------GKawisrasrtrssawrVSDKRPGYNVS  579
            LVGQMY+SGYG+SRDAQK              G+AWI+RAS++RSSAW+VSDKRPGYN S
Sbjct  118  LVGQMYYSGYGISRDAQKDVGNASTDRSIWVQGRAWINRASKSRSSAWKVSDKRPGYNAS  177

Query  580  DSDSDDTAGEAK  615
            DSDSDDT  + K
Sbjct  178  DSDSDDTVEDPK  189



>ref|XP_006353405.1| PREDICTED: uncharacterized protein LOC102603532 isoform X1 [Solanum 
tuberosum]
 ref|XP_006353406.1| PREDICTED: uncharacterized protein LOC102603532 isoform X2 [Solanum 
tuberosum]
Length=176

 Score =   168 bits (426),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 104/176 (59%), Positives = 130/176 (74%), Gaps = 3/176 (2%)
 Frame = +1

Query  91   MGKSVPSPTKLQDFARIIGSNTPRRRPTQVKPPVSRTRSVSPAEGPKLKGLVGG-lesps  267
            MGKS+PSP ++QDFARII SN  +R PTQVKP  SR RSV      K + +V G      
Sbjct  1    MGKSLPSPNRIQDFARIISSNRIQR-PTQVKP-ASRIRSVPSPVAAKFRAVVDGDSSERR  58

Query  268  serrlrrNKMeeessngnsseeQRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLV  447
             + +    +    S++ +++     RR+PLA+VV DCV+RWF DTLKEAKAGD +MQVLV
Sbjct  59   LKLKKNMEEASSNSNSNSNTSSSNQRRLPLADVVADCVKRWFHDTLKEAKAGDANMQVLV  118

Query  448  GQMYFSGYGVSRDAQKGKawisrasrtrssawrVSDKRPGYNVSDSDSDDTAGEAK  615
            GQMYFSGYG+S+DAQKG+AWI+RAS++RSSAW+VSDKRPGYN SDSDSDDT  + K
Sbjct  119  GQMYFSGYGISKDAQKGRAWITRASKSRSSAWKVSDKRPGYNASDSDSDDTVEDTK  174



>ref|XP_004240896.1| PREDICTED: uncharacterized protein LOC101265648 [Solanum lycopersicum]
Length=176

 Score =   166 bits (421),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 104/176 (59%), Positives = 130/176 (74%), Gaps = 3/176 (2%)
 Frame = +1

Query  91   MGKSVPSPTKLQDFARIIGSNTPRRRPTQVKPPVSRTRSVSPAEGPKLKGLVGGlespss  270
            MGKS+PSP ++QDFARII SN     PTQVKP  +R RSV      K + +V G  S   
Sbjct  1    MGKSLPSPNRIQDFARIINSNRIHH-PTQVKP-ATRIRSVPSPVAAKSRAVVDGDSSERR  58

Query  271  er-rlrrNKMeeessngnsseeQRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLV  447
             + +    +    S++ +++     RR+PLA+VV DCV+RWF DTLKEAKAGD +MQVLV
Sbjct  59   LKLKKNMEEASSNSNSNSNTSSSNQRRLPLADVVADCVKRWFHDTLKEAKAGDANMQVLV  118

Query  448  GQMYFSGYGVSRDAQKGKawisrasrtrssawrVSDKRPGYNVSDSDSDDTAGEAK  615
            GQMYFSGYG++RDAQKG+AWI+RAS++RSSAW+VSDKRPGYN SDSDSDDT  +AK
Sbjct  119  GQMYFSGYGIARDAQKGRAWITRASKSRSSAWKVSDKRPGYNASDSDSDDTVEDAK  174



>ref|XP_003633434.1| PREDICTED: uncharacterized protein LOC100253518 [Vitis vinifera]
 ref|XP_010658206.1| PREDICTED: uncharacterized protein LOC100253518 [Vitis vinifera]
Length=156

 Score =   150 bits (380),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 98/175 (56%), Positives = 119/175 (68%), Gaps = 19/175 (11%)
 Frame = +1

Query  91   MGKSVPSPTKLQDFARIIGSNTPRRRPTQVKPPVSRTRSVSPAEGPKLKGLVGGlespss  270
            MGKS+P+ T+LQ+FAR++ S    + P   KP +SR R VSP E  KL+G   G E    
Sbjct  1    MGKSLPTTTRLQEFARVVTSEK-FQSPKHAKP-ISRNR-VSPPETTKLRGARLGSERVRL  57

Query  271  errlrrNKMeeessngnsseeQRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVG  450
            +      +                RR+PLA+VV+DC +RWFQDTLKEAKAGD +MQVLVG
Sbjct  58   KMESSEGQ----------------RRMPLAQVVSDCAKRWFQDTLKEAKAGDTTMQVLVG  101

Query  451  QMYFSGYGVSRDAQKGKawisrasrtrssawrVSDKRPGYNVSDSDSDDTAGEAK  615
            QMYFSGYGVSRDAQKG+AWISRAS++RSSA +V DK PGYN SDSDSDD   + K
Sbjct  102  QMYFSGYGVSRDAQKGRAWISRASKSRSSALKVGDKHPGYNASDSDSDDLKNDEK  156



>ref|XP_009761007.1| PREDICTED: uncharacterized protein LOC104213009 [Nicotiana sylvestris]
 ref|XP_009761613.1| PREDICTED: uncharacterized protein LOC104213009 [Nicotiana sylvestris]
Length=162

 Score =   149 bits (376),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 107/175 (61%), Positives = 128/175 (73%), Gaps = 13/175 (7%)
 Frame = +1

Query  91   MGKSVPSPTKLQDFARIIGSNTPRRRPTQVKPPVSRTRSVSPAEGPKLKGLVGGlespss  270
            MGKS+P     Q FARII SN   R  ++++P +S T      E PK KG+ G     S 
Sbjct  1    MGKSLP-----QGFARIISSNRIHR-TSRIRPSISSTER----ETPKSKGVAG---ESSE  47

Query  271  errlrrNKMeeessngnsseeQRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVG  450
            +R   ++KMEEESSN NS      RR PLA+VV +CV+RWFQDTLKEAKAGD +MQVLVG
Sbjct  48   QRLKIKSKMEEESSNSNSKPLAEQRRHPLADVVGECVKRWFQDTLKEAKAGDTAMQVLVG  107

Query  451  QMYFSGYGVSRDAQKGKawisrasrtrssawrVSDKRPGYNVSDSDSDDTAGEAK  615
            QMY+SGYG+ RD QKG+AWI+RAS++RSSAW+VSDKRPGYNVSDSDSDDT  E K
Sbjct  108  QMYYSGYGIPRDPQKGRAWINRASKSRSSAWKVSDKRPGYNVSDSDSDDTVEETK  162



>emb|CDP13949.1| unnamed protein product [Coffea canephora]
Length=179

 Score =   149 bits (375),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 100/183 (55%), Positives = 128/183 (70%), Gaps = 12/183 (7%)
 Frame = +1

Query  91   MGKSVPSPTKLQDFARIIGSNTPRRRPTQVKPPVSRTRSVSPAEGPKLKGLVGGlespss  270
            MGKS+PSP  LQ+ +R+I +N   RR  QV P   R  ++S A+ P   GL G     S 
Sbjct  1    MGKSLPSPAALQELSRVISTNRLHRR--QV-PKSPRPTTLSSAQ-PPAAGLSGSRRLASK  56

Query  271  errlrrNKMe--------eessngnsseeQRLRRIPLAEVVTDCVRRWFQDTLKEAKAGD  426
            +++L + ++E          S++ ++S  ++ RRIPLAE V DCV+RWFQDTLKEAKAGD
Sbjct  57   DQQLPQLRLENKGMEGKKSTSNDNSTSASEQGRRIPLAEAVADCVKRWFQDTLKEAKAGD  116

Query  427  ISMQVLVGQMYFSGYGVSRDAQKGKawisrasrtrssawrVSDKRPGYNVSDSDSDDTAG  606
             +MQVLV QMY+SGYG+ RDAQKGK W++RASR RSS W+VSDK PGYN SDSDS+DT  
Sbjct  117  TAMQVLVSQMYYSGYGIPRDAQKGKTWMNRASRARSSVWKVSDKHPGYNASDSDSEDTKD  176

Query  607  EAK  615
            EAK
Sbjct  177  EAK  179



>gb|EYU20083.1| hypothetical protein MIMGU_mgv1a015205mg [Erythranthe guttata]
 gb|EYU20084.1| hypothetical protein MIMGU_mgv1a015205mg [Erythranthe guttata]
 gb|EYU20085.1| hypothetical protein MIMGU_mgv1a015205mg [Erythranthe guttata]
Length=165

 Score =   141 bits (355),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 101/180 (56%), Positives = 118/180 (66%), Gaps = 20/180 (11%)
 Frame = +1

Query  88   FMGKSVPSPTKLQDFARIIGS--NTPRRRPTQVKPPVSRTRSVSPAE--GPKLKGLVGGl  255
            FMGKS+PS  KLQ  AR + S  N   RR  Q+KP  S+ R +SP+   GP+        
Sbjct  2    FMGKSIPSSQKLQQIARFVASPDNGSNRR-AQLKP-ASKARPISPSNPTGPRT-------  52

Query  256  espsserrlrrNKMeeessngnsseeQRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISM  435
               S+ +    N+  E + N       R R  PLA+VV DCV+RWFQDTLKEAK GD SM
Sbjct  53   --GSNHQLKVDNRHMEAAENS-----DRQRMTPLADVVADCVKRWFQDTLKEAKNGDTSM  105

Query  436  QVLVGQMYFSGYGVSRDAQKGKawisrasrtrssawrVSDKRPGYNVSDSDSDDTAGEAK  615
            QVLVGQMY+SGYGV RD+QK KAWI+RASRTRSS W+V DK PGYN SDSDSDD   EAK
Sbjct  106  QVLVGQMYYSGYGVGRDSQKAKAWINRASRTRSSVWKVGDKHPGYNASDSDSDDPKEEAK  165



>ref|XP_010031141.1| PREDICTED: uncharacterized protein LOC104421024 [Eucalyptus grandis]
 ref|XP_010031142.1| PREDICTED: uncharacterized protein LOC104421024 [Eucalyptus grandis]
 ref|XP_010031143.1| PREDICTED: uncharacterized protein LOC104421024 [Eucalyptus grandis]
 gb|KCW50408.1| hypothetical protein EUGRSUZ_J00156 [Eucalyptus grandis]
 gb|KCW50409.1| hypothetical protein EUGRSUZ_J00156 [Eucalyptus grandis]
Length=171

 Score =   140 bits (354),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 99/175 (57%), Positives = 120/175 (69%), Gaps = 4/175 (2%)
 Frame = +1

Query  91   MGKSVPSPTKLQDFARIIGSNTPRRRPTQVKPPVSRTRSVSPAEGPKLKGLVGGlespss  270
            MGKS+PS T+LQDFAR + S+   R P Q KP +SR R VS  E  +  G  GG      
Sbjct  1    MGKSIPSATRLQDFARAVSSSDKLRLPKQAKP-ISRIR-VSTPETSRPGGSGGGGGGGGG  58

Query  271  errlrrNKMeeessngnsseeQRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVG  450
             R   + KME   +       +R  R+PLA+VV+DC RRWFQDTL+EAKAGD +MQVLVG
Sbjct  59   VRTDPKKKMEVGRAKSLEL--ERNTRLPLAQVVSDCARRWFQDTLREAKAGDGAMQVLVG  116

Query  451  QMYFSGYGVSRDAQKGKawisrasrtrssawrVSDKRPGYNVSDSDSDDTAGEAK  615
            QMY SGYGV RD QKG+AWI++AS+ RSS WRVSDK+PGYN SDSDS +  G+ K
Sbjct  117  QMYNSGYGVPRDPQKGRAWINKASKARSSVWRVSDKQPGYNASDSDSGEMDGDKK  171



>ref|XP_010256999.1| PREDICTED: uncharacterized protein LOC104597244 [Nelumbo nucifera]
Length=156

 Score =   137 bits (345),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 90/176 (51%), Positives = 117/176 (66%), Gaps = 21/176 (12%)
 Frame = +1

Query  91   MGKSVPSPTKLQDFARIIGSNTPRRRPTQVKPPVSRTRSVSPAEGPKLKGLVGGlespss  270
            MGKS+PS T+LQ+FA++  ++   + P   KP + ++ S SP       G  GG      
Sbjct  1    MGKSLPSTTRLQEFAKV--TSEKFKGPKHTKP-IQKSSSFSPEIAKS--GCGGGASKHLK  55

Query  271  errlrrNKMeeessngnsseeQRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVG  450
                                 +R  R+PL+EVV+DCV+RWFQDTLKEAKAGD +MQ+LVG
Sbjct  56   LTMENP---------------ERQTRVPLSEVVSDCVKRWFQDTLKEAKAGDSAMQILVG  100

Query  451  QMYFSGYGVSRDAQKGKawisrasrtrssawrVSDKRPGYNVSDSDSDDTA-GEAK  615
            QMY+SGYGV RDAQKG+AWI+RAS++RSSAW+VSDK PGYN SDSDS++   G+AK
Sbjct  101  QMYYSGYGVPRDAQKGRAWITRASKSRSSAWKVSDKHPGYNASDSDSEEEVKGDAK  156



>gb|KHG28253.1| Putative sel1-like repeat-containing protein L18 [Gossypium arboreum]
Length=149

 Score =   136 bits (343),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 90/178 (51%), Positives = 114/178 (64%), Gaps = 33/178 (19%)
 Frame = +1

Query  91   MGKSVPSPTKLQDFARIIGS----NTPRRRPTQVKPPVSRTRSVSPAEGPKLKGLVGGle  258
            MGKS+P  TKLQ  A++ G+    NT  + P   KP     R +S    P  K       
Sbjct  1    MGKSLPGATKLQHLAKVTGAAHHLNTTGKNP---KPTTLNRRIISEDNKPNSK-------  50

Query  259  spsserrlrrNKMeeessngnsseeQRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQ  438
                       KME  S++         +R+PL+EVV+DCV+RWF+DTLKEAKAGD++MQ
Sbjct  51   ----------KKMESSSAS---------QRLPLSEVVSDCVKRWFKDTLKEAKAGDVNMQ  91

Query  439  VLVGQMYFSGYGVSRDAQKGKawisrasrtrssawrVSDKRPGYNVSDSDSDDTAGEA  612
            VLVGQMY+SGYGV RDAQKG+ W++RASR RSS W+VSDK PGYN SDSDSD+  G++
Sbjct  92   VLVGQMYYSGYGVPRDAQKGRIWMTRASRLRSSVWKVSDKHPGYNASDSDSDEIKGDS  149



>ref|XP_008233834.1| PREDICTED: uncharacterized protein LOC103332851 isoform X1 [Prunus 
mume]
Length=157

 Score =   135 bits (341),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 87/175 (50%), Positives = 119/175 (68%), Gaps = 18/175 (10%)
 Frame = +1

Query  91   MGKSVPSPTKLQDFARIIGSNTPRRRPTQVKPPVSRTRSVSPAEGPKLKGLVGGlespss  270
            MGK++PS T+ Q+F R++ ++    RP + K  VS+ R +SP + PK +           
Sbjct  1    MGKALPSATRFQEFTRVVSADKLPGRPRRTKQ-VSQVR-ISPPQAPKSESF---------  49

Query  271  errlrrNKMeeessngnsseeQRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVG  450
                   +++ E         +   R+PLA VV+DCV+RWFQDTLKEAKAGD SMQVLVG
Sbjct  50   -------RVDPERIKLKMESSEGQGRVPLARVVSDCVKRWFQDTLKEAKAGDSSMQVLVG  102

Query  451  QMYFSGYGVSRDAQKGKawisrasrtrssawrVSDKRPGYNVSDSDSDDTAGEAK  615
            QMY+SGYGVSRDA+KG+AW++RAS++RSS W+VS+K PGYN SDS+SD+   +AK
Sbjct  103  QMYYSGYGVSRDAKKGQAWMNRASKSRSSVWKVSNKPPGYNASDSNSDELEEDAK  157



>ref|XP_011076630.1| PREDICTED: uncharacterized protein LOC105160829 [Sesamum indicum]
Length=163

 Score =   136 bits (342),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 89/163 (55%), Positives = 111/163 (68%), Gaps = 14/163 (9%)
 Frame = +1

Query  91   MGKSVPSPTKLQDFARIIGSNTPR-RRPTQVKPPVSRTRSVSPAEGPKLKGLVGGlesps  267
            MGKS+PS   LQ FAR+I S T R RR  Q++P VS+TR   P   P   G         
Sbjct  1    MGKSIPSAHNLQHFARVIASATTRPRRAAQLRP-VSKTR---PISSPDATG---------  47

Query  268  serrlrrNKMeeessngnsseeQRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLV  447
            S     + +++  +     +E    RR+PL+EVV DCV+RWFQDTLKEAK GDI+MQVLV
Sbjct  48   SRPDSHQLRLKAPARQMEDAENSERRRMPLSEVVADCVKRWFQDTLKEAKNGDIAMQVLV  107

Query  448  GQMYFSGYGVSRDAQKGKawisrasrtrssawrVSDKRPGYNV  576
            GQMY+SGYGV+RDAQKG+AWI+RAS++RSS W+V DK PGYN 
Sbjct  108  GQMYYSGYGVARDAQKGRAWINRASKSRSSVWKVGDKHPGYNA  150



>ref|XP_007218537.1| hypothetical protein PRUPE_ppa012708mg [Prunus persica]
 gb|EMJ19736.1| hypothetical protein PRUPE_ppa012708mg [Prunus persica]
Length=157

 Score =   135 bits (340),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 85/175 (49%), Positives = 119/175 (68%), Gaps = 18/175 (10%)
 Frame = +1

Query  91   MGKSVPSPTKLQDFARIIGSNTPRRRPTQVKPPVSRTRSVSPAEGPKLKGLVGGlespss  270
            MGK++P+ T+ Q+F R++ ++    RP + K  VS+ R +SP + PK +           
Sbjct  1    MGKALPTATRFQEFTRVVSADKLPGRPRRTKQ-VSQVR-ISPPQAPKSESF---------  49

Query  271  errlrrNKMeeessngnsseeQRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVG  450
                   +++ E         +   R+PLA VV+DCV+RWFQDTLKEAKAGD SMQVLVG
Sbjct  50   -------RVDPERIKLKMESSEGQSRVPLARVVSDCVKRWFQDTLKEAKAGDSSMQVLVG  102

Query  451  QMYFSGYGVSRDAQKGKawisrasrtrssawrVSDKRPGYNVSDSDSDDTAGEAK  615
            QMY+SGYGVSRDA+KG+AW++RAS++R+S W+VS+K PGYN SDS+SD+   +AK
Sbjct  103  QMYYSGYGVSRDAKKGQAWMNRASKSRTSVWKVSNKPPGYNASDSNSDELEEDAK  157



>gb|KJB77082.1| hypothetical protein B456_012G119700 [Gossypium raimondii]
 gb|KJB77083.1| hypothetical protein B456_012G119700 [Gossypium raimondii]
 gb|KJB77085.1| hypothetical protein B456_012G119700 [Gossypium raimondii]
Length=149

 Score =   131 bits (329),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 87/178 (49%), Positives = 112/178 (63%), Gaps = 33/178 (19%)
 Frame = +1

Query  91   MGKSVPSPTKLQDFARIIGS----NTPRRRPTQVKPPVSRTRSVSPAEGPKLKGLVGGle  258
            MGKS+P  TKLQ  A++ G+    NT  + P   KP     R +     P  K       
Sbjct  1    MGKSLPGATKLQHLAKVTGAAHHLNTTGKNP---KPTTLNRRIIGEDNKPNSK-------  50

Query  259  spsserrlrrNKMeeessngnsseeQRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQ  438
                       KME  S++         +R+PL+EVV+DCV+RWF+D+LKEAKAGD++MQ
Sbjct  51   ----------KKMESSSAS---------QRLPLSEVVSDCVKRWFKDSLKEAKAGDVNMQ  91

Query  439  VLVGQMYFSGYGVSRDAQKGKawisrasrtrssawrVSDKRPGYNVSDSDSDDTAGEA  612
            VLVGQMY+SGYGV RDAQKG+ W++RASR RSS W+VS K PGYN SDSDSD+  G++
Sbjct  92   VLVGQMYYSGYGVPRDAQKGRIWMTRASRLRSSVWKVSHKHPGYNASDSDSDEIKGDS  149



>ref|XP_002520815.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF41524.1| conserved hypothetical protein [Ricinus communis]
Length=159

 Score =   129 bits (325),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 90/174 (52%), Positives = 118/174 (68%), Gaps = 19/174 (11%)
 Frame = +1

Query  91   MGKSVPSPTKLQDFARIIGSNTPRRRPTQVKPPVSRTRSVSPAEGPKLKGLVGGlespss  270
            MGKS  S   LQ  A+I+  + P+ + +Q+  P  ++R V P +  +LK           
Sbjct  1    MGKSQFSTGDLQALAKIVSFHKPKPKKSQLIIPF-KSREVGPIDTDQLK-----------  48

Query  271  errlrrNKMeeessngnsseeQRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVG  450
                   KMEE SS+    + +   R+PL+ VV+DCVRRWFQDTLKEAKAGDISMQVLVG
Sbjct  49   -----VKKMEESSSSSLILDGKN--RLPLSNVVSDCVRRWFQDTLKEAKAGDISMQVLVG  101

Query  451  QMYFSGYGVSRDAQKGKawisrasrtrssawrVSDKRPGYNVSDSDSDDTAGEA  612
            QMYF+GYG+ +D+QKG+AWI+RAS++R SAW+VSDKRPGY  SDSDSD+   +A
Sbjct  102  QMYFNGYGIPKDSQKGRAWINRASKSRVSAWKVSDKRPGYAASDSDSDEGKDDA  155



>ref|XP_008233835.1| PREDICTED: uncharacterized protein LOC103332851 isoform X2 [Prunus 
mume]
Length=155

 Score =   128 bits (322),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 85/175 (49%), Positives = 116/175 (66%), Gaps = 20/175 (11%)
 Frame = +1

Query  91   MGKSVPSPTKLQDFARIIGSNTPRRRPTQVKPPVSRTRSVSPAEGPKLKGLVGGlespss  270
            MGK++PS T+ Q+F R++ ++    RP + K  VS+ R +SP + PK +           
Sbjct  1    MGKALPSATRFQEFTRVVSADKLPGRPRRTKQ-VSQVR-ISPPQAPKSESF---------  49

Query  271  errlrrNKMeeessngnsseeQRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVG  450
                   +++ E         +   R+PLA VV+DCV+RWFQDTLKEAKAGD SMQVLVG
Sbjct  50   -------RVDPERIKLKMESSEGQGRVPLARVVSDCVKRWFQDTLKEAKAGDSSMQVLVG  102

Query  451  QMYFSGYGVSRDAQKGKawisrasrtrssawrVSDKRPGYNVSDSDSDDTAGEAK  615
            QMY+SGYGVSRDA+K   W++RAS++RSS W+VS+K PGYN SDS+SD+   +AK
Sbjct  103  QMYYSGYGVSRDAKKA--WMNRASKSRSSVWKVSNKPPGYNASDSNSDELEEDAK  155



>ref|XP_002265642.1| PREDICTED: uncharacterized protein LOC100243041 isoform X1 [Vitis 
vinifera]
 ref|XP_003632590.1| PREDICTED: uncharacterized protein LOC100243041 isoform X1 [Vitis 
vinifera]
Length=100

 Score =   126 bits (316),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 67/90 (74%), Positives = 82/90 (91%), Gaps = 0/90 (0%)
 Frame = +1

Query  343  RRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisras  522
             R+PL+EVV+DCV+RWFQDTL+EAK+GD+SMQVLVGQMY+SGYGV RDAQKG+ W++RAS
Sbjct  11   HRVPLSEVVSDCVKRWFQDTLREAKSGDVSMQVLVGQMYYSGYGVPRDAQKGRVWMTRAS  70

Query  523  rtrssawrVSDKRPGYNVSDSDSDDTAGEA  612
            RTRSS W+VSDK PGYN SDSDSD+  G++
Sbjct  71   RTRSSVWKVSDKHPGYNASDSDSDELKGDS  100



>ref|XP_010921063.1| PREDICTED: uncharacterized protein LOC105044761 [Elaeis guineensis]
Length=169

 Score =   128 bits (321),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 80/179 (45%), Positives = 105/179 (59%), Gaps = 18/179 (10%)
 Frame = +1

Query  64   VIFLFCFCFMGKSVPSPTKLQDFARIIGSNTPRRRPTQVKPPVSRTRSVSPAEGPKLKGL  243
            ++ L    FMGK +PS   L++FAR+    T R R  + + P  R+ + S       +  
Sbjct  4    LVALRSLLFMGKRLPSAKSLEEFARVA---TERIRRGKHRKPALRSLASSKEAASVARAT  60

Query  244  VGGlespsserrlrrNKMeeessngnsseeQRLRRIPLAEVVTDCVRRWFQDTLKEAKAG  423
              G    +        +                RR+PL+EVV+DCVRRWFQD L+EAK G
Sbjct  61   AEGPRPAAHSMENGEREE---------------RRVPLSEVVSDCVRRWFQDALREAKNG  105

Query  424  DISMQVLVGQMYFSGYGVSRDAQKGKawisrasrtrssawrVSDKRPGYNVSDSDSDDT  600
            D +MQVLVGQMY SGYG  R+ QKGKAWI++AS+ RS+ W+VSDK PGYN SDSDSD+ 
Sbjct  106  DAAMQVLVGQMYHSGYGCPRNEQKGKAWIAKASKYRSTVWKVSDKHPGYNASDSDSDEV  164



>gb|ERM95583.1| hypothetical protein AMTR_s00023p00110940 [Amborella trichopoda]
Length=99

 Score =   125 bits (315),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 67/94 (71%), Positives = 80/94 (85%), Gaps = 0/94 (0%)
 Frame = +1

Query  334  QRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawis  513
            Q   R+PL+EVV DCV+RWFQDTLKEA+AGD SMQVLVGQMY+SGYG+ RDAQKG+AW++
Sbjct  6    QNHNRLPLSEVVADCVKRWFQDTLKEARAGDSSMQVLVGQMYYSGYGIPRDAQKGRAWLT  65

Query  514  rasrtrssawrVSDKRPGYNVSDSDSDDTAGEAK  615
            +AS+ RSS W+VSDK PGYN SDSDSD+   E K
Sbjct  66   KASKNRSSVWKVSDKHPGYNASDSDSDEQIKEQK  99



>ref|XP_011651843.1| PREDICTED: uncharacterized protein LOC101206121 [Cucumis sativus]
 ref|XP_011651844.1| PREDICTED: uncharacterized protein LOC101206121 [Cucumis sativus]
 ref|XP_011651845.1| PREDICTED: uncharacterized protein LOC101206121 [Cucumis sativus]
 gb|KGN58719.1| hypothetical protein Csa_3G730830 [Cucumis sativus]
Length=100

 Score =   125 bits (315),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 81/88 (92%), Gaps = 0/88 (0%)
 Frame = +1

Query  334  QRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawis  513
            + L R+PL+EVV+DCV+RWF+DTLKEAKAGDI+MQVLVGQMY+SGYGV RDAQKG+ W++
Sbjct  8    EALNRVPLSEVVSDCVKRWFKDTLKEAKAGDINMQVLVGQMYYSGYGVPRDAQKGRIWMT  67

Query  514  rasrtrssawrVSDKRPGYNVSDSDSDD  597
            +ASR+RSS W+VSDK PGYN SDSDSD+
Sbjct  68   KASRSRSSVWKVSDKHPGYNASDSDSDE  95



>ref|XP_010264502.1| PREDICTED: uncharacterized protein LOC104602492 [Nelumbo nucifera]
 ref|XP_010264503.1| PREDICTED: uncharacterized protein LOC104602492 [Nelumbo nucifera]
 ref|XP_010264504.1| PREDICTED: uncharacterized protein LOC104602492 [Nelumbo nucifera]
 ref|XP_010264505.1| PREDICTED: uncharacterized protein LOC104602492 [Nelumbo nucifera]
Length=100

 Score =   125 bits (314),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 73/96 (76%), Positives = 84/96 (88%), Gaps = 2/96 (2%)
 Frame = +1

Query  334  QRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawis  513
            +R  R+PL+EVV+DCVRRWFQDTLKEAKAGD  MQVLVGQMY+SGYGV RDAQKG+AWI+
Sbjct  5    ERQNRVPLSEVVSDCVRRWFQDTLKEAKAGDSGMQVLVGQMYYSGYGVPRDAQKGRAWIT  64

Query  514  rasrtrssawrVSDKRPGYNVSDSDSDDT--AGEAK  615
            RASR+RSS W+VSDK PGYN SDSDSD+   A +AK
Sbjct  65   RASRSRSSVWKVSDKHPGYNASDSDSDEEVKAADAK  100



>ref|XP_008442362.1| PREDICTED: uncharacterized protein LOC103486254 [Cucumis melo]
 ref|XP_008442363.1| PREDICTED: uncharacterized protein LOC103486254 [Cucumis melo]
 ref|XP_008442364.1| PREDICTED: uncharacterized protein LOC103486254 [Cucumis melo]
Length=100

 Score =   125 bits (313),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 66/86 (77%), Positives = 80/86 (93%), Gaps = 0/86 (0%)
 Frame = +1

Query  340  LRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisra  519
            L R+PL+EVV+DCV+RWF+DTLKEAKAGDI+MQVLVGQMY+SGYGV RDAQKG+ W+++A
Sbjct  10   LNRVPLSEVVSDCVKRWFKDTLKEAKAGDINMQVLVGQMYYSGYGVPRDAQKGRIWMTKA  69

Query  520  srtrssawrVSDKRPGYNVSDSDSDD  597
            SR+RSS W+VSDK PGYN SDSDSD+
Sbjct  70   SRSRSSVWKVSDKHPGYNASDSDSDE  95



>ref|XP_006828167.2| PREDICTED: uncharacterized protein LOC18423503 [Amborella trichopoda]
Length=142

 Score =   126 bits (316),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 67/94 (71%), Positives = 80/94 (85%), Gaps = 0/94 (0%)
 Frame = +1

Query  334  QRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawis  513
            Q   R+PL+EVV DCV+RWFQDTLKEA+AGD SMQVLVGQMY+SGYG+ RDAQKG+AW++
Sbjct  49   QNHNRLPLSEVVADCVKRWFQDTLKEARAGDSSMQVLVGQMYYSGYGIPRDAQKGRAWLT  108

Query  514  rasrtrssawrVSDKRPGYNVSDSDSDDTAGEAK  615
            +AS+ RSS W+VSDK PGYN SDSDSD+   E K
Sbjct  109  KASKNRSSVWKVSDKHPGYNASDSDSDEQIKEQK  142



>ref|XP_010039279.1| PREDICTED: uncharacterized protein LOC104427816 isoform X2 [Eucalyptus 
grandis]
Length=108

 Score =   124 bits (311),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 66/84 (79%), Positives = 79/84 (94%), Gaps = 0/84 (0%)
 Frame = +1

Query  346  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisrasr  525
            R+PL+EVV+DCV+RWF+DTLKEAKAGD++MQVLVGQMY+SGYGV RDAQKG+ WI++ASR
Sbjct  14   RVPLSEVVSDCVKRWFKDTLKEAKAGDVNMQVLVGQMYYSGYGVPRDAQKGRIWITKASR  73

Query  526  trssawrVSDKRPGYNVSDSDSDD  597
             RSS W+VSDKRPGYN SDSDSD+
Sbjct  74   IRSSVWKVSDKRPGYNASDSDSDE  97



>ref|XP_008355547.1| PREDICTED: uncharacterized protein LOC103419212 [Malus domestica]
Length=152

 Score =   125 bits (314),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 84/178 (47%), Positives = 111/178 (62%), Gaps = 29/178 (16%)
 Frame = +1

Query  91   MGKSVPSPTKLQDFARIIGSN-TPR-RRPTQV-KPPVSRTRSVSPAEGPKLKGLVGGles  261
            MGK++PSPT+ QD  RII ++  PR RR  QV +  +S  ++  P +  ++K        
Sbjct  1    MGKALPSPTRFQDLTRIIAADKLPRTRRAKQVSQVRISSPQTSKPVDPERVK--------  52

Query  262  psserrlrrNKMeeessngnsseeQRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQV  441
                                    +   R+PLA VV+DCVRRWFQDTLKEAKAGD SMQV
Sbjct  53   ------------------LRMESSEGRNRVPLARVVSDCVRRWFQDTLKEAKAGDSSMQV  94

Query  442  LVGQMYFSGYGVSRDAQKGKawisrasrtrssawrVSDKRPGYNVSDSDSDDTAGEAK  615
            LVGQMY SGYGV +D +KG AW+++AS++R+S W+VSDK PGYN SDS+SD+   + K
Sbjct  95   LVGQMYCSGYGVPKDPKKGHAWMNKASKSRASVWKVSDKPPGYNASDSNSDELKDDTK  152



>ref|XP_009369229.1| PREDICTED: uncharacterized protein LOC103958662 [Pyrus x bretschneideri]
Length=151

 Score =   125 bits (313),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 85/177 (48%), Positives = 108/177 (61%), Gaps = 28/177 (16%)
 Frame = +1

Query  91   MGKSVPSPTKLQDFARIIGSN-TPR-RRPTQVKPPVSRTRSVSPAEGPKLKGLVGGlesp  264
            MGK++P PT+ QD  RII ++  PR RR  QV    S+ R  SP   P            
Sbjct  1    MGKALPWPTRFQDLTRIIAADKLPRPRRAKQV----SQVRISSPQPKP------------  44

Query  265  sserrlrrNKMeeessngnsseeQRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVL  444
                      +  +         +   R+PLA VV+DCVRRWFQDTLKEAKAGD SMQVL
Sbjct  45   ----------VNPDRVKLRMESSEGQNRVPLARVVSDCVRRWFQDTLKEAKAGDSSMQVL  94

Query  445  VGQMYFSGYGVSRDAQKGKawisrasrtrssawrVSDKRPGYNVSDSDSDDTAGEAK  615
            VGQMY SGYGV +D +KG AW+++AS++R+S W+VSDK PGYN SDS+SD+   + K
Sbjct  95   VGQMYCSGYGVPKDPKKGHAWMNKASKSRASVWKVSDKPPGYNASDSNSDELKDDTK  151



>ref|XP_010039170.1| PREDICTED: uncharacterized protein LOC104427816 isoform X1 [Eucalyptus 
grandis]
 ref|XP_010039222.1| PREDICTED: uncharacterized protein LOC104427816 isoform X1 [Eucalyptus 
grandis]
Length=149

 Score =   124 bits (312),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 66/84 (79%), Positives = 79/84 (94%), Gaps = 0/84 (0%)
 Frame = +1

Query  346  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisrasr  525
            R+PL+EVV+DCV+RWF+DTLKEAKAGD++MQVLVGQMY+SGYGV RDAQKG+ WI++ASR
Sbjct  55   RVPLSEVVSDCVKRWFKDTLKEAKAGDVNMQVLVGQMYYSGYGVPRDAQKGRIWITKASR  114

Query  526  trssawrVSDKRPGYNVSDSDSDD  597
             RSS W+VSDKRPGYN SDSDSD+
Sbjct  115  IRSSVWKVSDKRPGYNASDSDSDE  138



>ref|XP_009350684.1| PREDICTED: uncharacterized protein LOC103942213 [Pyrus x bretschneideri]
Length=151

 Score =   124 bits (311),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 86/177 (49%), Positives = 109/177 (62%), Gaps = 28/177 (16%)
 Frame = +1

Query  91   MGKSVPSPTKLQDFARIIGSNT-PR-RRPTQVKPPVSRTRSVSPAEGPKLKGLVGGlesp  264
            MGK++P PT+ QD  RII ++  PR RR  QV    S+ R  SP   P            
Sbjct  1    MGKALPWPTRFQDLTRIIAADKFPRPRRAKQV----SQVRISSPQPKP------------  44

Query  265  sserrlrrNKMeeessngnsseeQRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVL  444
                      ++ E         +   R+PLA VV+DCVRRWFQDTLKEAKAGD SMQVL
Sbjct  45   ----------VDPERVKLRMDSSEGQNRVPLARVVSDCVRRWFQDTLKEAKAGDSSMQVL  94

Query  445  VGQMYFSGYGVSRDAQKGKawisrasrtrssawrVSDKRPGYNVSDSDSDDTAGEAK  615
            VGQMY SGYGV +D +KG AW+++AS++R+S W+VSDK PGYN SDS+SD+   + K
Sbjct  95   VGQMYCSGYGVPKDPKKGHAWMNKASKSRASVWKVSDKPPGYNASDSNSDELKDDTK  151



>gb|KCW88248.1| hypothetical protein EUGRSUZ_A00636 [Eucalyptus grandis]
 gb|KCW88249.1| hypothetical protein EUGRSUZ_A00636 [Eucalyptus grandis]
Length=180

 Score =   125 bits (313),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 66/84 (79%), Positives = 79/84 (94%), Gaps = 0/84 (0%)
 Frame = +1

Query  346  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisrasr  525
            R+PL+EVV+DCV+RWF+DTLKEAKAGD++MQVLVGQMY+SGYGV RDAQKG+ WI++ASR
Sbjct  86   RVPLSEVVSDCVKRWFKDTLKEAKAGDVNMQVLVGQMYYSGYGVPRDAQKGRIWITKASR  145

Query  526  trssawrVSDKRPGYNVSDSDSDD  597
             RSS W+VSDKRPGYN SDSDSD+
Sbjct  146  IRSSVWKVSDKRPGYNASDSDSDE  169



>ref|XP_010091064.1| hypothetical protein L484_021946 [Morus notabilis]
 gb|EXB42354.1| hypothetical protein L484_021946 [Morus notabilis]
Length=348

 Score =   128 bits (321),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 82/89 (92%), Gaps = 0/89 (0%)
 Frame = +1

Query  346  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisrasr  525
            R+PL+EVVTDCV+RWF+DTLKEAK+GDI+MQVLVGQMY+SGYGV RDAQKG+ WI+RASR
Sbjct  260  RLPLSEVVTDCVKRWFKDTLKEAKSGDINMQVLVGQMYYSGYGVPRDAQKGRIWITRASR  319

Query  526  trssawrVSDKRPGYNVSDSDSDDTAGEA  612
            TRSS W+VSDK PGYN SDSDSD+  G++
Sbjct  320  TRSSVWKVSDKHPGYNASDSDSDEPKGDS  348



>ref|XP_006429512.1| hypothetical protein CICLE_v10013155mg [Citrus clementina]
 ref|XP_006429513.1| hypothetical protein CICLE_v10013155mg [Citrus clementina]
 ref|XP_006481132.1| PREDICTED: uncharacterized protein LOC102610400 isoform X2 [Citrus 
sinensis]
 gb|ESR42752.1| hypothetical protein CICLE_v10013155mg [Citrus clementina]
 gb|ESR42753.1| hypothetical protein CICLE_v10013155mg [Citrus clementina]
 gb|KDO63289.1| hypothetical protein CISIN_1g033594mg [Citrus sinensis]
 gb|KDO63290.1| hypothetical protein CISIN_1g033594mg [Citrus sinensis]
 gb|KDO63291.1| hypothetical protein CISIN_1g033594mg [Citrus sinensis]
 gb|KDO63292.1| hypothetical protein CISIN_1g033594mg [Citrus sinensis]
Length=115

 Score =   122 bits (306),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 68/89 (76%), Positives = 80/89 (90%), Gaps = 0/89 (0%)
 Frame = +1

Query  346  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisrasr  525
            R+PL+EVV+DCV+RWF+DTLKEAK GDI+MQVLVGQMYFSGYGV+RDAQKG+ WISRASR
Sbjct  27   RVPLSEVVSDCVKRWFRDTLKEAKGGDINMQVLVGQMYFSGYGVARDAQKGRIWISRASR  86

Query  526  trssawrVSDKRPGYNVSDSDSDDTAGEA  612
            TRSS W+V +K PGYN SDSDSD+   E+
Sbjct  87   TRSSVWKVGEKHPGYNASDSDSDEMKEES  115



>ref|XP_007026543.1| Uncharacterized protein TCM_021578 [Theobroma cacao]
 gb|EOY07045.1| Uncharacterized protein TCM_021578 [Theobroma cacao]
Length=162

 Score =   123 bits (309),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 64/90 (71%), Positives = 81/90 (90%), Gaps = 0/90 (0%)
 Frame = +1

Query  343  RRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisras  522
            +R+PL++VV+DCV+RWF+DTLKEAKAGD++MQVLV QMY+SGYGV RDAQKG+ W++RAS
Sbjct  73   QRLPLSDVVSDCVKRWFKDTLKEAKAGDVNMQVLVSQMYYSGYGVPRDAQKGRIWMTRAS  132

Query  523  rtrssawrVSDKRPGYNVSDSDSDDTAGEA  612
            R RSS W+VSDK PGYN SDSDSD+  G++
Sbjct  133  RLRSSVWKVSDKHPGYNASDSDSDEMKGDS  162



>ref|XP_007207508.1| hypothetical protein PRUPE_ppa013808mg [Prunus persica]
 ref|XP_008244803.1| PREDICTED: uncharacterized protein LOC103342916 [Prunus mume]
 ref|XP_008244804.1| PREDICTED: uncharacterized protein LOC103342916 [Prunus mume]
 gb|EMJ08707.1| hypothetical protein PRUPE_ppa013808mg [Prunus persica]
Length=102

 Score =   121 bits (303),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 65/90 (72%), Positives = 81/90 (90%), Gaps = 0/90 (0%)
 Frame = +1

Query  343  RRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisras  522
             R+PL+EVV+DC++RWF+DTLKEAKAGDI+MQVLVGQMY++GYGV RDA  G+ WI+RAS
Sbjct  13   HRLPLSEVVSDCIKRWFKDTLKEAKAGDINMQVLVGQMYYNGYGVPRDAHMGRIWITRAS  72

Query  523  rtrssawrVSDKRPGYNVSDSDSDDTAGEA  612
            RTRSS W+VSDK+PGYN SDSDSD+  G++
Sbjct  73   RTRSSVWKVSDKQPGYNASDSDSDELKGDS  102



>ref|XP_002315124.1| hypothetical protein POPTR_0010s18960g [Populus trichocarpa]
 gb|EEF01295.1| hypothetical protein POPTR_0010s18960g [Populus trichocarpa]
Length=150

 Score =   122 bits (307),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 82/169 (49%), Positives = 112/169 (66%), Gaps = 22/169 (13%)
 Frame = +1

Query  91   MGKSVPSPTKLQDFARIIGSNTPRRRPTQVKPPVSRTRSVSPAEGPKLKGLVGGlespss  270
            MGKS+PS  KL + ++I+ S+ PR + + V  PV  +R   P+E                
Sbjct  1    MGKSLPSTGKLLELSKIVSSHKPRHKRSIV--PVVPSR---PSE----------------  39

Query  271  errlrrNKMeeessngnsseeQRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVG  450
              R+   +++ +    +S      +R+PL +VV+DC +RWF+DTLKEAK GDISMQVLVG
Sbjct  40   -VRVDSERLKVKKMEESSLILDGQKRVPLGQVVSDCAKRWFEDTLKEAKTGDISMQVLVG  98

Query  451  QMYFSGYGVSRDAQKGKawisrasrtrssawrVSDKRPGYNVSDSDSDD  597
            QMYF+GYGV +D +KG AWISRAS+ R+S W+VS+KRPGYN SDSDS+D
Sbjct  99   QMYFNGYGVPKDVEKGSAWISRASKRRASVWKVSNKRPGYNGSDSDSED  147



>ref|XP_006486231.1| PREDICTED: uncharacterized protein LOC102630879 isoform X1 [Citrus 
sinensis]
 ref|XP_006486232.1| PREDICTED: uncharacterized protein LOC102630879 isoform X2 [Citrus 
sinensis]
 ref|XP_006486233.1| PREDICTED: uncharacterized protein LOC102630879 isoform X3 [Citrus 
sinensis]
Length=160

 Score =   122 bits (307),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 87/180 (48%), Positives = 116/180 (64%), Gaps = 25/180 (14%)
 Frame = +1

Query  91   MGKSVPSP-TKLQDFARIIGSNTPRR----RPTQVKPPVSRTRSVSPAEGPKLKGLVGGl  255
            MGKS+ S  T L+D ARI+ S++P R    RP   KPP   T  VS     K + +V   
Sbjct  1    MGKSIASTVTTLRDLARIVSSSSPERLQRVRPRHSKPPP--TSVVSARSETKARPIV---  55

Query  256  espsserrlrrNKMeeessngnsseeQRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISM  435
                     ++ KM        + + Q+ +R+PL++VV+DCV+RWFQDTL+EAK GD +M
Sbjct  56   ---------KKPKM------NINWDTQQQQRVPLSQVVSDCVQRWFQDTLREAKNGDKAM  100

Query  436  QVLVGQMYFSGYGVSRDAQKGKawisrasrtrssawrVSDKRPGYNVSDSDSDDTAGEAK  615
            +VLVGQMY SGYGV+RD +KG AWI RA+ +RSSAW++ DK PGY  SDSDSD+  G+ K
Sbjct  101  EVLVGQMYLSGYGVARDEKKGHAWIKRAATSRSSAWKLRDKPPGYAASDSDSDELKGDTK  160



>gb|EPS60291.1| hypothetical protein M569_14514 [Genlisea aurea]
Length=161

 Score =   122 bits (307),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 87/176 (49%), Positives = 111/176 (63%), Gaps = 16/176 (9%)
 Frame = +1

Query  91   MGKSVPSPTKLQDFARIIGSNTPR-RRPTQVKPPVSRTRSVSPAEGPKLKGLVGGlesps  267
            MG+S+ SP     FARII S   R RR  Q K      R++S  E P   G         
Sbjct  1    MGRSIQSPQ----FARIIQSLGQRPRRSAQSKRQSEPVRTLSTPEPPASSG-------TG  49

Query  268  serrlrrNKMeeessngnsseeQRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLV  447
             + R+   +M+  + N       R +R+PL+EVV DCV+RWFQDTLKEA+ GD SMQ+L+
Sbjct  50   RKLRIDARRMDAAAENSE----NRQQRLPLSEVVADCVKRWFQDTLKEARNGDASMQLLL  105

Query  448  GQMYFSGYGVSRDAQKGKawisrasrtrssawrVSDKRPGYNVSDSDSDDTAGEAK  615
            GQMY++GYGV+RD QKG+A ISRAS+ RSS W++ DK PGYN SDSDSDD    +K
Sbjct  106  GQMYYNGYGVARDPQKGRACISRASKNRSSVWKIGDKHPGYNASDSDSDDLKQASK  161



>ref|XP_011077502.1| PREDICTED: uncharacterized protein LOC105161501 [Sesamum indicum]
 ref|XP_011077503.1| PREDICTED: uncharacterized protein LOC105161501 [Sesamum indicum]
Length=98

 Score =   120 bits (301),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 63/89 (71%), Positives = 80/89 (90%), Gaps = 0/89 (0%)
 Frame = +1

Query  346  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisrasr  525
            R+PL+ VV+DC++RWFQDTLKEA+ GDI+MQVLV QMY+SGYGV+RDA KG+ WI++ASR
Sbjct  10   RLPLSVVVSDCIKRWFQDTLKEARTGDINMQVLVAQMYYSGYGVARDANKGRIWITKASR  69

Query  526  trssawrVSDKRPGYNVSDSDSDDTAGEA  612
             RSS W+VS+KRPGYN SDSDSD+ AG++
Sbjct  70   MRSSVWKVSNKRPGYNASDSDSDEMAGDS  98



>ref|XP_012089743.1| PREDICTED: polynucleotide 5'-hydroxyl-kinase nol9 isoform X1 
[Jatropha curcas]
 gb|KDP22810.1| hypothetical protein JCGZ_00397 [Jatropha curcas]
Length=153

 Score =   122 bits (305),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 65/89 (73%), Positives = 81/89 (91%), Gaps = 0/89 (0%)
 Frame = +1

Query  346  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisrasr  525
            R+PL+EVV+DCV+RWF+DTLK+AK+GDI+MQVLV QMY+SGYGV RDAQKG+ W++RASR
Sbjct  65   RLPLSEVVSDCVKRWFKDTLKDAKSGDINMQVLVSQMYYSGYGVPRDAQKGRIWMTRASR  124

Query  526  trssawrVSDKRPGYNVSDSDSDDTAGEA  612
            TRSS W+VSDK PGYN SDSDSD+  G++
Sbjct  125  TRSSVWKVSDKHPGYNASDSDSDELKGDS  153



>ref|XP_004307701.1| PREDICTED: uncharacterized protein LOC101294508 [Fragaria vesca 
subsp. vesca]
Length=154

 Score =   122 bits (305),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 87/179 (49%), Positives = 106/179 (59%), Gaps = 29/179 (16%)
 Frame = +1

Query  91   MGKSVPSPTKLQDFARIIGSNTPRR--RPTQVK--PPVSRTRSVSPAEGPKLKGLVGGle  258
            MGKS+PS T+ Q+  RII S    R  RP QV+  PP +     S     +L GL     
Sbjct  1    MGKSLPSSTRFQNLTRIIASEKFSRPTRPIQVRVSPPQTAKTGTSLRVDSELVGL-----  55

Query  259  spsserrlrrNKMeeessngnsseeQRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQ  438
                       KME               R+PLA VV+DC +RWFQDTLKEAK GD +MQ
Sbjct  56   -----------KMESSEGQS---------RVPLARVVSDCAKRWFQDTLKEAKGGDTAMQ  95

Query  439  VLVGQMYFSGYGVSRDAQKGKawisrasrtrssawrVSDKRPGYNVSDSDSDDTAGEAK  615
            VLVGQMY SGYGV ++ +KG AWISRASR+R + W+VS K+PGY+ SDSDSD+    AK
Sbjct  96   VLVGQMYHSGYGVEKNPEKGHAWISRASRSRRAVWKVSQKQPGYHASDSDSDELEDVAK  154



>ref|XP_007134617.1| hypothetical protein PHAVU_010G062000g [Phaseolus vulgaris]
 gb|ESW06611.1| hypothetical protein PHAVU_010G062000g [Phaseolus vulgaris]
Length=100

 Score =   120 bits (301),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 65/88 (74%), Positives = 78/88 (89%), Gaps = 0/88 (0%)
 Frame = +1

Query  334  QRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawis  513
            +R  R+PL+EVV DCV+RWF+D LKEAKAGDI+MQVLVGQMY+SGYGV RDAQKG+ W++
Sbjct  8    ERSSRVPLSEVVADCVKRWFRDALKEAKAGDINMQVLVGQMYYSGYGVPRDAQKGRVWLT  67

Query  514  rasrtrssawrVSDKRPGYNVSDSDSDD  597
            +ASRTRSS W+V DK PGYN SDSDSD+
Sbjct  68   KASRTRSSVWKVGDKHPGYNASDSDSDE  95



>ref|XP_011015169.1| PREDICTED: uncharacterized protein LOC105118821 [Populus euphratica]
Length=150

 Score =   121 bits (304),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 83/169 (49%), Positives = 112/169 (66%), Gaps = 22/169 (13%)
 Frame = +1

Query  91   MGKSVPSPTKLQDFARIIGSNTPRRRPTQVKPPVSRTRSVSPAEGPKLKGLVGGlespss  270
            MGKS+PS  KL + ++I+ S+ PR + + V  PV  +R   P+E                
Sbjct  1    MGKSLPSTGKLLELSKIVSSHKPRHKKSIV--PVVPSR---PSE---------------I  40

Query  271  errlrrNKMeeessngnsseeQRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVG  450
                 R K+++   +    + Q+L  +PL +VV+DC +RWF+DTLKEAK GDISMQVLVG
Sbjct  41   RVDSERLKVKKMEESSLILDGQKL--VPLGQVVSDCAKRWFEDTLKEAKTGDISMQVLVG  98

Query  451  QMYFSGYGVSRDAQKGKawisrasrtrssawrVSDKRPGYNVSDSDSDD  597
            QMYF+GYGV +D +KG AWISRAS+ R+S W+VS+KRPGYN SDSDS+D
Sbjct  99   QMYFNGYGVPKDVEKGSAWISRASKRRASVWKVSNKRPGYNGSDSDSED  147



>ref|XP_008355552.1| PREDICTED: uncharacterized protein LOC103419214 [Malus domestica]
Length=151

 Score =   121 bits (304),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 83/175 (47%), Positives = 108/175 (62%), Gaps = 24/175 (14%)
 Frame = +1

Query  91   MGKSVPSPTKLQDFARIIGSNTPRRRPTQVKPPVSRTRSVSPAEGPKLKGLVGGlespss  270
            MGK++PS T+ QD  RII ++    RP +VK   S+ R  SP   P              
Sbjct  1    MGKALPSRTRFQDLTRIIAADK-LPRPRRVKQ-ASQVRISSPQPKP--------------  44

Query  271  errlrrNKMeeessngnsseeQRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVG  450
                    ++ E         +R  R+PLA  V+DCVRRWFQDTLKEA+AGD SMQVLVG
Sbjct  45   --------VDPERVKLRIESSERQNRVPLARKVSDCVRRWFQDTLKEARAGDSSMQVLVG  96

Query  451  QMYFSGYGVSRDAQKGKawisrasrtrssawrVSDKRPGYNVSDSDSDDTAGEAK  615
            QMY SGYGV +D +KG AW+++AS++R+S W+VSDK PGYN SDS+SD+   + K
Sbjct  97   QMYCSGYGVPKDPRKGHAWMNKASKSRASVWKVSDKPPGYNASDSNSDELKDDTK  151



>gb|EYU41977.1| hypothetical protein MIMGU_mgv1a016033mg [Erythranthe guttata]
Length=136

 Score =   121 bits (303),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 66/90 (73%), Positives = 78/90 (87%), Gaps = 0/90 (0%)
 Frame = +1

Query  343  RRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisras  522
            RR+PL++VV+DCV RWFQDTLKEAK GD+SMQVLVGQM+ SGYG+ RDA K + W+SRAS
Sbjct  47   RRVPLSDVVSDCVERWFQDTLKEAKTGDVSMQVLVGQMFNSGYGIPRDADKARTWMSRAS  106

Query  523  rtrssawrVSDKRPGYNVSDSDSDDTAGEA  612
            R RSS W+VS+KRPGYN SDSDSDD AG +
Sbjct  107  RVRSSVWKVSNKRPGYNASDSDSDDLAGNS  136



>ref|XP_008782586.1| PREDICTED: uncharacterized protein LOC103702077 [Phoenix dactylifera]
Length=155

 Score =   121 bits (304),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 78/181 (43%), Positives = 104/181 (57%), Gaps = 32/181 (18%)
 Frame = +1

Query  91   MGKSVPSPTKLQDFARIIGSNTPR----RRPTQVKPPVSRTRSVSPAEGPK--LKGLVGG  252
            MGK +PS   L++FAR+      R    +R  +         + + AEGP+  ++ +  G
Sbjct  1    MGKRLPSAKNLEEFARVATEGIRRAKHAKRALRSLASNKEAAARASAEGPRPAVQSMENG  60

Query  253  lespsserrlrrNKMeeessngnsseeQRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDIS  432
                                          RR+PL+EVV+DCVRRWFQD L+EAK GD +
Sbjct  61   EREE--------------------------RRVPLSEVVSDCVRRWFQDALREAKNGDAA  94

Query  433  MQVLVGQMYFSGYGVSRDAQKGKawisrasrtrssawrVSDKRPGYNVSDSDSDDTAGEA  612
            MQVLVGQMY SGYG  R+ QKGKAWI++AS+ RS+ W+VSDK PGYN SDSD+D+   + 
Sbjct  95   MQVLVGQMYHSGYGCPRNEQKGKAWIAKASKYRSAVWKVSDKHPGYNASDSDTDEVKDDV  154

Query  613  K  615
            K
Sbjct  155  K  155



>ref|XP_012089744.1| PREDICTED: uncharacterized protein LOC105648075 isoform X2 [Jatropha 
curcas]
Length=118

 Score =   120 bits (301),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 65/89 (73%), Positives = 81/89 (91%), Gaps = 0/89 (0%)
 Frame = +1

Query  346  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisrasr  525
            R+PL+EVV+DCV+RWF+DTLK+AK+GDI+MQVLV QMY+SGYGV RDAQKG+ W++RASR
Sbjct  30   RLPLSEVVSDCVKRWFKDTLKDAKSGDINMQVLVSQMYYSGYGVPRDAQKGRIWMTRASR  89

Query  526  trssawrVSDKRPGYNVSDSDSDDTAGEA  612
            TRSS W+VSDK PGYN SDSDSD+  G++
Sbjct  90   TRSSVWKVSDKHPGYNASDSDSDELKGDS  118



>ref|XP_010695454.1| PREDICTED: uncharacterized protein LOC104908080 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010695460.1| PREDICTED: uncharacterized protein LOC104908080 [Beta vulgaris 
subsp. vulgaris]
Length=160

 Score =   121 bits (303),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 86/174 (49%), Positives = 106/174 (61%), Gaps = 24/174 (14%)
 Frame = +1

Query  91   MGKSVPSPTKLQDFARIIGSNT--PRRRPTQVKPPVSRTRSVS---PAEGPKLKGLVGGl  255
            MGKS+PS   L++FARII S    P   P QVKP  +   S S    A  P     V   
Sbjct  1    MGKSLPSTAGLKNFARIITSEKIFP---PKQVKPTSNNKVSTSIPKSATEPTKMSRVDSA  57

Query  256  espsserrlrrNKMeeessngnsseeQRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISM  435
            +          ++                 R+PLAEVV+DC RRWFQDTLKEA+ GD +M
Sbjct  58   QLSLKMENSSVSRT----------------RVPLAEVVSDCARRWFQDTLKEARDGDTAM  101

Query  436  QVLVGQMYFSGYGVSRDAQKGKawisrasrtrssawrVSDKRPGYNVSDSDSDD  597
            QVLVGQMY SGYGV ++ +KG+ WI+RAS++RSSAWRVSDK+PGYN SDS+S D
Sbjct  102  QVLVGQMYNSGYGVPKNTEKGRTWITRASKSRSSAWRVSDKQPGYNASDSESQD  155



>ref|XP_010543693.1| PREDICTED: uncharacterized protein LOC104816524 [Tarenaya hassleriana]
 ref|XP_010543694.1| PREDICTED: uncharacterized protein LOC104816524 [Tarenaya hassleriana]
 ref|XP_010543696.1| PREDICTED: uncharacterized protein LOC104816524 [Tarenaya hassleriana]
Length=155

 Score =   119 bits (298),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 89/170 (52%), Positives = 111/170 (65%), Gaps = 19/170 (11%)
 Frame = +1

Query  91   MGKSVPSPTKLQDFARIIGSNTPRRRPTQVKPPVSRTRS-VSPAEGPKLKGLVGGlesps  267
            MGKS+    + Q+FA  + S  P R P  V  P SR +  +  +   +++ L        
Sbjct  1    MGKSILCTVRFQEFAIRLSSENPTR-PRSV--PTSRNKVFLRKSRETRVEDL--------  49

Query  268  serrlrrNKMeeessngnsseeQRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLV  447
                   N+++ E    NS       R+PLA+VV DCV+RWFQDTLKEAKAGD+ MQVLV
Sbjct  50   -------NRVKLEKKGSNSRSGPGPDRVPLAQVVDDCVKRWFQDTLKEAKAGDVGMQVLV  102

Query  448  GQMYFSGYGVSRDAQKGKawisrasrtrssawrVSDKRPGYNVSDSDSDD  597
            GQMY SGYGV +D QKG+AWI+RASRTRSSAW+VSDKRPGYN SDSDS+D
Sbjct  103  GQMYCSGYGVPKDEQKGRAWINRASRTRSSAWQVSDKRPGYNASDSDSND  152



>ref|XP_007008833.1| Uncharacterized protein TCM_042415 [Theobroma cacao]
 gb|EOY17643.1| Uncharacterized protein TCM_042415 [Theobroma cacao]
Length=157

 Score =   119 bits (298),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 89/176 (51%), Positives = 109/176 (62%), Gaps = 20/176 (11%)
 Frame = +1

Query  91   MGKSVPSPTKLQDFARIIGSNTPRRRPTQVKPPVSRTRSVSPAEGPKLKGL-VGGlesps  267
            MG+S+   TK QDFA+ + S+    RP  VKP  SR R V+  E   L G+ V       
Sbjct  1    MGRSILCTTKGQDFAKAVPSDK-LHRPKHVKP-TSRNR-VACQEKASLPGVRVDSERVKQ  57

Query  268  serrlrrNKMeeessngnsseeQRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLV  447
             E     ++                 RIPLA+VV+D V+ WFQD LKEAKAGD +MQVLV
Sbjct  58   KEMDSWGDR----------------DRIPLAQVVSDLVKGWFQDALKEAKAGDTNMQVLV  101

Query  448  GQMYFSGYGVSRDAQKGKawisrasrtrssawrVSDKRPGYNVSDSDSDDTAGEAK  615
            GQMY SG+GV +D QKG AWI +ASR+RSS W+VSDK PGYN SDSDSD+  G+AK
Sbjct  102  GQMYCSGFGVPKDVQKGLAWIGKASRSRSSVWKVSDKHPGYNASDSDSDELKGDAK  157



>ref|XP_009416310.1| PREDICTED: uncharacterized protein LOC103996957 [Musa acuminata 
subsp. malaccensis]
Length=153

 Score =   118 bits (296),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 80/169 (47%), Positives = 99/169 (59%), Gaps = 23/169 (14%)
 Frame = +1

Query  91   MGKSVPSPTKLQDFARIIGSNTPRRRPTQVKPPVSRTRSVSPAEGPKLKGLVGGlespss  270
            MGK +PSPT LQ +AR+                + R +   PA    LK L  G E  ++
Sbjct  1    MGKQLPSPTSLQRYARLAVET------------IRRAKIAKPA----LKSLASGKEEAAA  44

Query  271  errlrrNKMeeessngnsseeQRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVG  450
                   +  +E             R+PL +VV DC RRWFQD LKEA+AGD +MQVLVG
Sbjct  45   APSRGPGRWMDERERQQG-------RVPLKDVVADCTRRWFQDALKEARAGDAAMQVLVG  97

Query  451  QMYFSGYGVSRDAQKGKawisrasrtrssawrVSDKRPGYNVSDSDSDD  597
            QMY SGYGV R+ QK   WIS+AS+ RSS W+VSDKRPGYN SDSD+D+
Sbjct  98   QMYHSGYGVPRNEQKAYTWISKASKYRSSVWKVSDKRPGYNASDSDTDE  146



>ref|XP_011095090.1| PREDICTED: uncharacterized protein LOC105174627 [Sesamum indicum]
 ref|XP_011095091.1| PREDICTED: uncharacterized protein LOC105174627 [Sesamum indicum]
Length=137

 Score =   117 bits (293),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 65/91 (71%), Positives = 79/91 (87%), Gaps = 2/91 (2%)
 Frame = +1

Query  346  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisrasr  525
            R+PL+EVV+DC  RWFQDTLKEAKAGD++MQVLVGQMY+SGYGV +DA KGK W++RASR
Sbjct  47   RLPLSEVVSDCTERWFQDTLKEAKAGDVNMQVLVGQMYYSGYGVPKDADKGKFWMNRASR  106

Query  526  trssawrVSDKRPGYNVSDSD--SDDTAGEA  612
             RSS W++S KRPGYN SDSD  SD+ AG++
Sbjct  107  MRSSVWKLSHKRPGYNASDSDSESDELAGDS  137



>ref|NP_001238121.1| uncharacterized protein LOC100527831 [Glycine max]
 ref|XP_006572841.1| PREDICTED: uncharacterized protein LOC100527831 isoform X1 [Glycine 
max]
 gb|ACU17021.1| unknown [Glycine max]
 gb|KHN44844.1| hypothetical protein glysoja_024415 [Glycine soja]
Length=100

 Score =   116 bits (290),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 63/88 (72%), Positives = 76/88 (86%), Gaps = 0/88 (0%)
 Frame = +1

Query  334  QRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawis  513
            +R  R+ L+EVV DCV+RWF+D LKEAKAGDI+MQVLVGQMY+ GYGV RDAQKG+ W++
Sbjct  8    ERSERVALSEVVADCVKRWFRDALKEAKAGDINMQVLVGQMYYGGYGVPRDAQKGRVWLT  67

Query  514  rasrtrssawrVSDKRPGYNVSDSDSDD  597
            +ASRTRSS W+V DK PGYN SDSDSD+
Sbjct  68   KASRTRSSVWKVGDKHPGYNASDSDSDE  95



>ref|XP_003623468.1| hypothetical protein MTR_7g071210 [Medicago truncatula]
 gb|AES79686.1| hypothetical protein MTR_7g071210 [Medicago truncatula]
Length=100

 Score =   115 bits (289),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 61/85 (72%), Positives = 76/85 (89%), Gaps = 0/85 (0%)
 Frame = +1

Query  346  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisrasr  525
            R PL+ VV DCV+RWF+DTL+EAKAGD++MQ+LVGQMY SGYGV++DAQKGK W+++ASR
Sbjct  12   RFPLSGVVADCVKRWFKDTLREAKAGDVNMQILVGQMYCSGYGVAKDAQKGKLWLTKASR  71

Query  526  trssawrVSDKRPGYNVSDSDSDDT  600
             RSS W+V DKRPGYN SDSDSD++
Sbjct  72   VRSSVWKVGDKRPGYNASDSDSDES  96



>emb|CDX70156.1| BnaA10g25050D [Brassica napus]
Length=160

 Score =   117 bits (294),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 85/169 (50%), Positives = 105/169 (62%), Gaps = 12/169 (7%)
 Frame = +1

Query  91   MGKSVPSPTKLQDFARIIGSNTPRRRPTQVKPPVSRTRSVSPAEGPKLKGLVGGlespss  270
            MGKS+ S  +  + A  + S  P RRPT   PP ++   V  A   KL      ++   +
Sbjct  1    MGKSILSTVRFAELAIRLSSENPSRRPTT--PPRNKV-FVKKARETKLGDYSNLVKLEKA  57

Query  271  errlrrNKMeeessngnsseeQRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVG  450
                  N     S            R+PLA+VV DCVRRWFQDTLKEAK+GD+ MQVLVG
Sbjct  58   GSHSGSNPAPPGSDPT---------RVPLAQVVEDCVRRWFQDTLKEAKSGDVGMQVLVG  108

Query  451  QMYFSGYGVSRDAQKGKawisrasrtrssawrVSDKRPGYNVSDSDSDD  597
            QMY SGYG+ +D  KG+AWI++ASRTRSSAW+VSDK PGYN SDSDS+D
Sbjct  109  QMYCSGYGIPKDEHKGRAWINKASRTRSSAWQVSDKPPGYNASDSDSND  157



>ref|XP_008370215.1| PREDICTED: uncharacterized protein LOC103433722 isoform X1 [Malus 
domestica]
 ref|XP_008370216.1| PREDICTED: uncharacterized protein LOC103433722 isoform X1 [Malus 
domestica]
 ref|XP_008345560.1| PREDICTED: uncharacterized protein LOC103408493 isoform X1 [Malus 
domestica]
 ref|XP_008345561.1| PREDICTED: uncharacterized protein LOC103408493 isoform X1 [Malus 
domestica]
Length=151

 Score =   117 bits (293),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 63/90 (70%), Positives = 79/90 (88%), Gaps = 0/90 (0%)
 Frame = +1

Query  343  RRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisras  522
             R+PL+ VV+DC++RWF+DTLKEAKAGDI+MQVLVGQMY++GYGV RD   G+ WI+RAS
Sbjct  62   HRVPLSAVVSDCIKRWFKDTLKEAKAGDINMQVLVGQMYYNGYGVPRDDHMGRVWITRAS  121

Query  523  rtrssawrVSDKRPGYNVSDSDSDDTAGEA  612
            RTRSS W+VSDK+PGYN SDSDSD+  G++
Sbjct  122  RTRSSVWKVSDKQPGYNASDSDSDELKGDS  151



>ref|XP_009122145.1| PREDICTED: uncharacterized protein LOC103846889 [Brassica rapa]
Length=160

 Score =   117 bits (294),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 85/169 (50%), Positives = 105/169 (62%), Gaps = 12/169 (7%)
 Frame = +1

Query  91   MGKSVPSPTKLQDFARIIGSNTPRRRPTQVKPPVSRTRSVSPAEGPKLKGLVGGlespss  270
            MGKS+ S  +  + A  + S  P RRPT   PP ++   V  A   KL      ++   +
Sbjct  1    MGKSILSTVRFAELAIRLSSENPSRRPTT--PPRNKV-FVKKARETKLGDYSNLVKLEKA  57

Query  271  errlrrNKMeeessngnsseeQRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVG  450
                  N     S            R+PLA+VV DCVRRWFQDTLKEAK+GD+ MQVLVG
Sbjct  58   GSHSGSNPAPPGSDP---------NRVPLAQVVEDCVRRWFQDTLKEAKSGDVGMQVLVG  108

Query  451  QMYFSGYGVSRDAQKGKawisrasrtrssawrVSDKRPGYNVSDSDSDD  597
            QMY SGYG+ +D  KG+AWI++ASRTRSSAW+VSDK PGYN SDSDS+D
Sbjct  109  QMYCSGYGIPKDEHKGRAWINKASRTRSSAWQVSDKPPGYNASDSDSND  157



>ref|XP_006289188.1| hypothetical protein CARUB_v10002629mg [Capsella rubella]
 gb|EOA22086.1| hypothetical protein CARUB_v10002629mg [Capsella rubella]
Length=164

 Score =   117 bits (294),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 67/86 (78%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = +1

Query  340  LRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisra  519
            + RIPLA+VV DCVRRWFQDTLKEAK+GD+ MQVLVGQMY SGYG+S+D QKG+AWIS+A
Sbjct  76   INRIPLAQVVEDCVRRWFQDTLKEAKSGDVGMQVLVGQMYCSGYGISKDEQKGRAWISKA  135

Query  520  srtrssawrVSDKRPGYNVSDSDSDD  597
            SRTRS+AW+VS K PGYN SDSDS+D
Sbjct  136  SRTRSTAWQVSAKPPGYNASDSDSND  161



>ref|XP_008370217.1| PREDICTED: uncharacterized protein LOC103433722 isoform X2 [Malus 
domestica]
 ref|XP_008345562.1| PREDICTED: uncharacterized protein LOC103408493 isoform X2 [Malus 
domestica]
Length=106

 Score =   115 bits (289),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 63/90 (70%), Positives = 79/90 (88%), Gaps = 0/90 (0%)
 Frame = +1

Query  343  RRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisras  522
             R+PL+ VV+DC++RWF+DTLKEAKAGDI+MQVLVGQMY++GYGV RD   G+ WI+RAS
Sbjct  17   HRVPLSAVVSDCIKRWFKDTLKEAKAGDINMQVLVGQMYYNGYGVPRDDHMGRVWITRAS  76

Query  523  rtrssawrVSDKRPGYNVSDSDSDDTAGEA  612
            RTRSS W+VSDK+PGYN SDSDSD+  G++
Sbjct  77   RTRSSVWKVSDKQPGYNASDSDSDELKGDS  106



>ref|XP_004146456.1| PREDICTED: uncharacterized protein LOC101213931 isoform X2 [Cucumis 
sativus]
 gb|KGN50710.1| hypothetical protein Csa_5G218760 [Cucumis sativus]
Length=157

 Score =   117 bits (293),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 80/169 (47%), Positives = 109/169 (64%), Gaps = 21/169 (12%)
 Frame = +1

Query  91   MGKSVPSPTKLQDFARIIGSNTPRRRPTQVKPPVSRTRSVSPAEGPKLKGLVGGlespss  270
            M KS+PSP + Q FA+++ S+    +  Q +P  SR R+ SP+E P + G V        
Sbjct  1    MAKSLPSPARFQQFAKLVFSS----KNPQSQPKKSRIRA-SPSETP-ISGSV--------  46

Query  271  errlrrNKMeeessngnsseeQRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVG  450
                   ++  E +     EE+   R PLA+VV+DCV+RWFQDTLKEAKAGD SMQVLVG
Sbjct  47   -------RVISEPNKNKYMEEEEKNRTPLADVVSDCVKRWFQDTLKEAKAGDTSMQVLVG  99

Query  451  QMYFSGYGVSRDAQKGKawisrasrtrssawrVSDKRPGYNVSDSDSDD  597
            QM+ SGYGV ++ +KG AWI RAS+ ++S W+ SD+ PGY  +DS+S D
Sbjct  100  QMFCSGYGVPKNTKKGLAWIYRASKYQASVWKASDRHPGYLATDSESSD  148



>ref|XP_008388305.1| PREDICTED: uncharacterized protein LOC103450710 [Malus domestica]
 ref|XP_008388306.1| PREDICTED: uncharacterized protein LOC103450711 [Malus domestica]
Length=106

 Score =   115 bits (288),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 63/85 (74%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = +1

Query  343  RRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisras  522
             R+PL+ VV+DC++RWF+DTLKEAKAGDI+MQVLVGQMY++GYGV+RDA  G+ WI+RAS
Sbjct  17   HRVPLSAVVSDCIKRWFKDTLKEAKAGDINMQVLVGQMYYNGYGVARDAHMGRVWITRAS  76

Query  523  rtrssawrVSDKRPGYNVSDSDSDD  597
            RTRSSAW+V DK+PGYN SDSDSD+
Sbjct  77   RTRSSAWKVGDKQPGYNASDSDSDE  101



>ref|XP_003522147.1| PREDICTED: uncharacterized protein LOC100794599 isoform X1 [Glycine 
max]
 ref|XP_006576459.1| PREDICTED: uncharacterized protein LOC100794599 isoform X2 [Glycine 
max]
 ref|XP_006576460.1| PREDICTED: uncharacterized protein LOC100794599 isoform X3 [Glycine 
max]
 ref|XP_006576461.1| PREDICTED: uncharacterized protein LOC100794599 isoform X4 [Glycine 
max]
 ref|XP_006576462.1| PREDICTED: uncharacterized protein LOC100794599 isoform X5 [Glycine 
max]
 ref|XP_006576463.1| PREDICTED: uncharacterized protein LOC100794599 isoform X6 [Glycine 
max]
 gb|KHN33246.1| hypothetical protein glysoja_027933 [Glycine soja]
Length=100

 Score =   115 bits (287),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 62/88 (70%), Positives = 75/88 (85%), Gaps = 0/88 (0%)
 Frame = +1

Query  334  QRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawis  513
            +R  R+ L+EVV DCV+RWF+D LKEAKAGDI+MQVLVGQMY SGYGV RDAQKG+ W++
Sbjct  8    ERSGRVALSEVVADCVKRWFRDALKEAKAGDINMQVLVGQMYNSGYGVPRDAQKGRVWVT  67

Query  514  rasrtrssawrVSDKRPGYNVSDSDSDD  597
            +AS+ RSS W+V DK PGYN SDSDSD+
Sbjct  68   KASKARSSVWKVGDKHPGYNASDSDSDE  95



>emb|CDX98838.1| BnaC09g49970D [Brassica napus]
Length=160

 Score =   116 bits (290),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 65/84 (77%), Positives = 76/84 (90%), Gaps = 0/84 (0%)
 Frame = +1

Query  346  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisrasr  525
            R+PLA+VV DCVRRWFQDTLKEAK+GD+ MQVLVGQMY SGYG+ +D  KG+AWI++ASR
Sbjct  74   RVPLAQVVEDCVRRWFQDTLKEAKSGDVGMQVLVGQMYCSGYGIPKDEHKGRAWINKASR  133

Query  526  trssawrVSDKRPGYNVSDSDSDD  597
            TRSSAW+VSDK PGYN SDSDS+D
Sbjct  134  TRSSAWQVSDKPPGYNASDSDSND  157



>gb|KFK24957.1| hypothetical protein AALP_AA8G047700 [Arabis alpina]
Length=155

 Score =   115 bits (289),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 66/84 (79%), Positives = 76/84 (90%), Gaps = 0/84 (0%)
 Frame = +1

Query  346  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisrasr  525
            RIPLA+VV DCVRRWFQDTLKEAK+GD+ MQVLVGQMY SGYG+ +D  KG+AWI++ASR
Sbjct  69   RIPLAQVVEDCVRRWFQDTLKEAKSGDVGMQVLVGQMYCSGYGIPKDEHKGRAWINKASR  128

Query  526  trssawrVSDKRPGYNVSDSDSDD  597
            TRSSAW+VSDK PGYN SDSDS+D
Sbjct  129  TRSSAWQVSDKPPGYNASDSDSND  152



>gb|AAO42324.1| unknown protein [Arabidopsis thaliana]
 dbj|BAF00521.1| hypothetical protein [Arabidopsis thaliana]
Length=157

 Score =   115 bits (289),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 65/86 (76%), Positives = 77/86 (90%), Gaps = 0/86 (0%)
 Frame = +1

Query  340  LRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisra  519
            + R+PLA+VV DCVRRWFQDTLKEAK+GD+ MQVLVGQMY SGYG+ +D  KG+AWI++A
Sbjct  69   INRVPLAQVVEDCVRRWFQDTLKEAKSGDVGMQVLVGQMYCSGYGIPKDENKGRAWINKA  128

Query  520  srtrssawrVSDKRPGYNVSDSDSDD  597
            SRTRSSAW+VSDK PGYN SDSDS+D
Sbjct  129  SRTRSSAWQVSDKPPGYNASDSDSND  154



>ref|NP_196155.2| uncharacterized protein [Arabidopsis thaliana]
 gb|AED90864.1| uncharacterized protein AT5G05360 [Arabidopsis thaliana]
Length=163

 Score =   115 bits (289),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 65/86 (76%), Positives = 77/86 (90%), Gaps = 0/86 (0%)
 Frame = +1

Query  340  LRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisra  519
            + R+PLA+VV DCVRRWFQDTLKEAK+GD+ MQVLVGQMY SGYG+ +D  KG+AWI++A
Sbjct  75   INRVPLAQVVEDCVRRWFQDTLKEAKSGDVGMQVLVGQMYCSGYGIPKDENKGRAWINKA  134

Query  520  srtrssawrVSDKRPGYNVSDSDSDD  597
            SRTRSSAW+VSDK PGYN SDSDS+D
Sbjct  135  SRTRSSAWQVSDKPPGYNASDSDSND  160



>ref|XP_006398999.1| hypothetical protein EUTSA_v10014886mg [Eutrema salsugineum]
 gb|ESQ40452.1| hypothetical protein EUTSA_v10014886mg [Eutrema salsugineum]
Length=161

 Score =   115 bits (288),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 64/84 (76%), Positives = 76/84 (90%), Gaps = 0/84 (0%)
 Frame = +1

Query  346  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisrasr  525
            R+PLA+VV DCVRRWFQDTLKEAK+GD+ MQVLVGQMY SGYG+ +D  KG+AWI++ASR
Sbjct  75   RVPLAQVVEDCVRRWFQDTLKEAKSGDVGMQVLVGQMYCSGYGIPKDEHKGRAWINKASR  134

Query  526  trssawrVSDKRPGYNVSDSDSDD  597
            +RSSAW+VSDK PGYN SDSDS+D
Sbjct  135  SRSSAWQVSDKPPGYNASDSDSND  158



>ref|XP_009373105.1| PREDICTED: uncharacterized protein LOC103962156 isoform X2 [Pyrus 
x bretschneideri]
Length=153

 Score =   114 bits (286),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 62/90 (69%), Positives = 78/90 (87%), Gaps = 0/90 (0%)
 Frame = +1

Query  343  RRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisras  522
             R+PL+ VV+DC++RWF+DTLKEAK GDI+MQVLVGQMY++GYGV RD   G+ WI+RAS
Sbjct  64   HRVPLSAVVSDCIKRWFKDTLKEAKDGDINMQVLVGQMYYNGYGVPRDDHMGRVWITRAS  123

Query  523  rtrssawrVSDKRPGYNVSDSDSDDTAGEA  612
            RTRSS W+VSDK+PGYN SDSDSD+  G++
Sbjct  124  RTRSSVWKVSDKQPGYNASDSDSDELKGDS  153



>ref|XP_009373106.1| PREDICTED: uncharacterized protein LOC103962156 isoform X3 [Pyrus 
x bretschneideri]
 ref|XP_009373107.1| PREDICTED: uncharacterized protein LOC103962156 isoform X3 [Pyrus 
x bretschneideri]
Length=108

 Score =   113 bits (282),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 62/90 (69%), Positives = 78/90 (87%), Gaps = 0/90 (0%)
 Frame = +1

Query  343  RRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisras  522
             R+PL+ VV+DC++RWF+DTLKEAK GDI+MQVLVGQMY++GYGV RD   G+ WI+RAS
Sbjct  19   HRVPLSAVVSDCIKRWFKDTLKEAKDGDINMQVLVGQMYYNGYGVPRDDHMGRVWITRAS  78

Query  523  rtrssawrVSDKRPGYNVSDSDSDDTAGEA  612
            RTRSS W+VSDK+PGYN SDSDSD+  G++
Sbjct  79   RTRSSVWKVSDKQPGYNASDSDSDELKGDS  108



>ref|XP_009373104.1| PREDICTED: uncharacterized protein LOC103962156 isoform X1 [Pyrus 
x bretschneideri]
Length=159

 Score =   114 bits (286),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 62/90 (69%), Positives = 78/90 (87%), Gaps = 0/90 (0%)
 Frame = +1

Query  343  RRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisras  522
             R+PL+ VV+DC++RWF+DTLKEAK GDI+MQVLVGQMY++GYGV RD   G+ WI+RAS
Sbjct  70   HRVPLSAVVSDCIKRWFKDTLKEAKDGDINMQVLVGQMYYNGYGVPRDDHMGRVWITRAS  129

Query  523  rtrssawrVSDKRPGYNVSDSDSDDTAGEA  612
            RTRSS W+VSDK+PGYN SDSDSD+  G++
Sbjct  130  RTRSSVWKVSDKQPGYNASDSDSDELKGDS  159



>ref|XP_010491070.1| PREDICTED: uncharacterized protein LOC104768733 [Camelina sativa]
Length=167

 Score =   114 bits (286),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 65/86 (76%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = +1

Query  340  LRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisra  519
            + R+PLA+VV DCVRRWFQDTLK+AK+GD+ MQVLVGQMY SGYG+ +D QKG+AWIS+A
Sbjct  79   INRVPLAQVVEDCVRRWFQDTLKDAKSGDVGMQVLVGQMYCSGYGIPKDEQKGRAWISKA  138

Query  520  srtrssawrVSDKRPGYNVSDSDSDD  597
            SRTRSSAW+VS+K PGYN SDSDS+D
Sbjct  139  SRTRSSAWQVSEKPPGYNASDSDSND  164



>gb|ABK26779.1| unknown [Picea sitchensis]
Length=144

 Score =   113 bits (282),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 67/84 (80%), Gaps = 0/84 (0%)
 Frame = +1

Query  346  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisrasr  525
            R+PL EVV DC RRWFQD+LKEAKAGD  MQVLVGQMY SGYGV RD Q+GKAW  +A++
Sbjct  55   RLPLKEVVADCARRWFQDSLKEAKAGDTGMQVLVGQMYCSGYGVHRDIQRGKAWFQKAAK  114

Query  526  trssawrVSDKRPGYNVSDSDSDD  597
            +RS    +  KRPGYN S+SDSDD
Sbjct  115  SRSRVLNLVAKRPGYNASESDSDD  138



>ref|XP_010452441.1| PREDICTED: uncharacterized protein LOC104734539 [Camelina sativa]
Length=170

 Score =   114 bits (284),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 65/86 (76%), Positives = 77/86 (90%), Gaps = 0/86 (0%)
 Frame = +1

Query  340  LRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisra  519
            + R+PLA+VV DCVRRWFQDTLK+AK+GD+ MQVLVGQMY SGYG+ +D QKG+AWIS+A
Sbjct  82   INRVPLAQVVEDCVRRWFQDTLKDAKSGDVGMQVLVGQMYCSGYGIPKDEQKGRAWISKA  141

Query  520  srtrssawrVSDKRPGYNVSDSDSDD  597
            SRTRSSAW+VS K PGYN SDSDS+D
Sbjct  142  SRTRSSAWQVSSKPPGYNASDSDSND  167



>ref|XP_010683583.1| PREDICTED: uncharacterized protein LOC104898233 [Beta vulgaris 
subsp. vulgaris]
Length=104

 Score =   111 bits (278),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 65/90 (72%), Positives = 75/90 (83%), Gaps = 0/90 (0%)
 Frame = +1

Query  346  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisrasr  525
            R  L+EVV DCVRRWFQDTLKEAK GD++MQVLV QMY +GYGV +D QK KAW+SRASR
Sbjct  15   RKALSEVVADCVRRWFQDTLKEAKGGDVNMQVLVSQMYTAGYGVPKDTQKAKAWMSRASR  74

Query  526  trssawrVSDKRPGYNVSDSDSDDTAGEAK  615
             RSS WRVS+K PGYN SDSDSD+  G+A+
Sbjct  75   VRSSVWRVSEKHPGYNASDSDSDELMGDAR  104



>ref|XP_010529121.1| PREDICTED: uncharacterized protein LOC104806101 [Tarenaya hassleriana]
Length=145

 Score =   112 bits (281),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 70/84 (83%), Gaps = 0/84 (0%)
 Frame = +1

Query  343  RRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisras  522
            RR PL+ VV DC +RWF+DTL+EAKAGD  MQVLVGQMY++GYGV RDA+KG+ WI++AS
Sbjct  62   RRFPLSAVVADCAKRWFKDTLQEAKAGDTGMQVLVGQMYYTGYGVPRDARKGRLWITKAS  121

Query  523  rtrssawrVSDKRPGYNVSDSDSD  594
            + RSS W V DK PGYN SDSDSD
Sbjct  122  KIRSSVWSVKDKHPGYNASDSDSD  145



>ref|XP_010423476.1| PREDICTED: uncharacterized protein LOC104708579 [Camelina sativa]
Length=170

 Score =   113 bits (283),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 65/86 (76%), Positives = 77/86 (90%), Gaps = 0/86 (0%)
 Frame = +1

Query  340  LRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisra  519
            + R+PLA+VV DCVRRWFQDTLK+AK+GD+ MQVLVGQMY SGYG+ +D QKG+AWIS+A
Sbjct  82   INRVPLAQVVEDCVRRWFQDTLKDAKSGDVGMQVLVGQMYCSGYGIPKDEQKGRAWISKA  141

Query  520  srtrssawrVSDKRPGYNVSDSDSDD  597
            SRTRSSAW+VS K PGYN SDSDS+D
Sbjct  142  SRTRSSAWQVSSKPPGYNASDSDSND  167



>dbj|BAJ91570.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=159

 Score =   112 bits (281),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 60/90 (67%), Positives = 73/90 (81%), Gaps = 0/90 (0%)
 Frame = +1

Query  346  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisrasr  525
            R+PLAEVV DC +RWFQDTLKEA+AGD +MQVLVGQMY SGYGV+++  K + W+ +ASR
Sbjct  70   RVPLAEVVLDCTKRWFQDTLKEARAGDAAMQVLVGQMYRSGYGVNKNEHKSRIWMEKASR  129

Query  526  trssawrVSDKRPGYNVSDSDSDDTAGEAK  615
             RS+ W+V +KRPGYN SDSDSDD    AK
Sbjct  130  YRSTVWKVCNKRPGYNASDSDSDDVKETAK  159



>ref|XP_009402772.1| PREDICTED: uncharacterized protein LOC103986477, partial [Musa 
acuminata subsp. malaccensis]
Length=155

 Score =   112 bits (280),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 62/85 (73%), Positives = 70/85 (82%), Gaps = 0/85 (0%)
 Frame = +1

Query  346  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisrasr  525
            R+PL EVV DC RRWFQD LKEA+AGD  MQVLVGQMY SGYGV ++ QK  AWI++AS+
Sbjct  64   RVPLKEVVADCTRRWFQDALKEARAGDAGMQVLVGQMYHSGYGVLKNDQKADAWIAKASK  123

Query  526  trssawrVSDKRPGYNVSDSDSDDT  600
             RSS W+VSDKRPGYN SDSDSDD 
Sbjct  124  YRSSVWKVSDKRPGYNASDSDSDDN  148



>ref|XP_008456900.1| PREDICTED: uncharacterized protein LOC103496713 isoform X2 [Cucumis 
melo]
 ref|XP_008456901.1| PREDICTED: uncharacterized protein LOC103496713 isoform X2 [Cucumis 
melo]
Length=157

 Score =   112 bits (280),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 78/169 (46%), Positives = 108/169 (64%), Gaps = 21/169 (12%)
 Frame = +1

Query  91   MGKSVPSPTKLQDFARIIGSNTPRRRPTQVKPPVSRTRSVSPAEGPKLKGLVGGlespss  270
            M KS+PSPT+ Q FA+++ S+   + P    P  SR R+ SP+E P + G V        
Sbjct  1    MAKSLPSPTRFQQFAKLVFSSKNPQSP----PKKSRIRA-SPSETP-ISGSV--------  46

Query  271  errlrrNKMeeessngnsseeQRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVG  450
                   ++  E +     EE+   R PL++VV+DCV+RWFQDTLKEAKAGD SMQVLVG
Sbjct  47   -------RVILEPNKNKYMEEKEKNRTPLSDVVSDCVKRWFQDTLKEAKAGDTSMQVLVG  99

Query  451  QMYFSGYGVSRDAQKGKawisrasrtrssawrVSDKRPGYNVSDSDSDD  597
            QM+ SGYGV ++ +KG AWI RAS+ + S W+ S++ PGY  +DS+S +
Sbjct  100  QMFCSGYGVPKNTKKGLAWIYRASKYQPSVWKASERHPGYLATDSESSN  148



>ref|XP_004492521.1| PREDICTED: uncharacterized protein LOC101512157 isoform X1 [Cicer 
arietinum]
Length=100

 Score =   110 bits (274),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 75/84 (89%), Gaps = 0/84 (0%)
 Frame = +1

Query  346  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisrasr  525
            R+PL+ +V DCV+RWF+D L+EAKAGD++MQVLVGQMY++GYGV +DAQKG+ W+++ASR
Sbjct  12   RVPLSGMVADCVKRWFKDALREAKAGDVNMQVLVGQMYYNGYGVPKDAQKGRIWLTKASR  71

Query  526  trssawrVSDKRPGYNVSDSDSDD  597
             RSS W+V DKRPGYN SDSDS++
Sbjct  72   VRSSVWKVGDKRPGYNASDSDSEE  95



>ref|XP_006435843.1| hypothetical protein CICLE_v10033159mg [Citrus clementina]
 ref|XP_006435844.1| hypothetical protein CICLE_v10033159mg [Citrus clementina]
 gb|ESR49083.1| hypothetical protein CICLE_v10033159mg [Citrus clementina]
 gb|ESR49084.1| hypothetical protein CICLE_v10033159mg [Citrus clementina]
Length=101

 Score =   110 bits (274),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 79/94 (84%), Gaps = 0/94 (0%)
 Frame = +1

Query  334  QRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawis  513
            Q+ +R+PL++VV+DCV+RWFQDTL+EAK GD +M+VLVGQMY SGYGV+RD +KG AWI 
Sbjct  8    QQQQRVPLSQVVSDCVQRWFQDTLREAKNGDKAMEVLVGQMYLSGYGVARDEKKGHAWIK  67

Query  514  rasrtrssawrVSDKRPGYNVSDSDSDDTAGEAK  615
            RA+ +RSSAW++ DK PGY  SDSDSD+  G+ K
Sbjct  68   RAATSRSSAWKLRDKPPGYAASDSDSDELKGDTK  101



>ref|XP_007163593.1| hypothetical protein PHAVU_001G247500g [Phaseolus vulgaris]
 gb|ESW35587.1| hypothetical protein PHAVU_001G247500g [Phaseolus vulgaris]
Length=156

 Score =   111 bits (278),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 80/175 (46%), Positives = 98/175 (56%), Gaps = 22/175 (13%)
 Frame = +1

Query  91   MGKSVPSPTKLQDFARIIGSNTPRRRPTQVKPPVSRTRSVSPAEGPKLKGLVGGlespss  270
            MGK + S  +L++ +RI+ S  P  RP    P     RS +    P+     G       
Sbjct  1    MGKYLESAARLEELSRIVSSAKPNIRPKGTLP-----RSPNRVSTPRTATPFG-------  48

Query  271  errlrrNKMeeessngnsseeQRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVG  450
             +     KME               R PLA+VV DC +RWFQDTL+EAKAGD SMQVLVG
Sbjct  49   VKVELAEKMEPFEEC----------RTPLAKVVADCAKRWFQDTLREAKAGDTSMQVLVG  98

Query  451  QMYFSGYGVSRDAQKGKawisrasrtrssawrVSDKRPGYNVSDSDSDDTAGEAK  615
            QMY SGYGV RD QKG  WIS+A++ R+S W+V  KRPGY  SDSDS D   + K
Sbjct  99   QMYNSGYGVPRDPQKGHGWISKAAKNRNSVWKVCGKRPGYRASDSDSCDQENKDK  153



>ref|XP_009421407.1| PREDICTED: uncharacterized protein LOC104000963 [Musa acuminata 
subsp. malaccensis]
Length=142

 Score =   111 bits (277),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 73/172 (42%), Positives = 92/172 (53%), Gaps = 36/172 (21%)
 Frame = +1

Query  91   MGKSVPSPTKLQDFARIIGSNTPRRRPTQVKPPV---SRTRSVSPAEGPKLKGLVGGles  261
            MGK +P P  L+D AR        RR    KPP+   +  +  + A    L  L      
Sbjct  1    MGKRLPEPKSLEDVARYAADRI--RRTRVAKPPLRPAAWNKETTSASVMNLADLPEAS--  56

Query  262  psserrlrrNKMeeessngnsseeQRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQV  441
                                         +PL EVV DC RRWFQD LKEA++GD+SMQ+
Sbjct  57   -----------------------------VPLKEVVADCARRWFQDALKEARSGDVSMQI  87

Query  442  LVGQMYFSGYGVSRDAQKGKawisrasrtrssawrVSDKRPGYNVSDSDSDD  597
            LV QMY SGYGV+++ QK   WI++ASR RS+ W+VSDK PGYN SDSDSD+
Sbjct  88   LVAQMYHSGYGVAKNEQKANVWITKASRYRSAVWKVSDKHPGYNASDSDSDE  139



>gb|KJB77084.1| hypothetical protein B456_012G119700 [Gossypium raimondii]
Length=137

 Score =   110 bits (276),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 78/163 (48%), Positives = 100/163 (61%), Gaps = 33/163 (20%)
 Frame = +1

Query  91   MGKSVPSPTKLQDFARIIGS----NTPRRRPTQVKPPVSRTRSVSPAEGPKLKGLVGGle  258
            MGKS+P  TKLQ  A++ G+    NT  + P   KP     R +     P  K       
Sbjct  1    MGKSLPGATKLQHLAKVTGAAHHLNTTGKNP---KPTTLNRRIIGEDNKPNSK-------  50

Query  259  spsserrlrrNKMeeessngnsseeQRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQ  438
                       KME  S++         +R+PL+EVV+DCV+RWF+D+LKEAKAGD++MQ
Sbjct  51   ----------KKMESSSAS---------QRLPLSEVVSDCVKRWFKDSLKEAKAGDVNMQ  91

Query  439  VLVGQMYFSGYGVSRDAQKGKawisrasrtrssawrVSDKRPG  567
            VLVGQMY+SGYGV RDAQKG+ W++RASR RSS W+VS K PG
Sbjct  92   VLVGQMYYSGYGVPRDAQKGRIWMTRASRLRSSVWKVSHKHPG  134



>gb|KGN65322.1| hypothetical protein Csa_1G324870 [Cucumis sativus]
Length=85

 Score =   109 bits (272),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 58/78 (74%), Positives = 72/78 (92%), Gaps = 0/78 (0%)
 Frame = +1

Query  334  QRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawis  513
            + L R+PL+EVV+DCV+RWF+DTLKEAKAGDI+MQVLVGQMY+SGYGV RDAQKG+ W++
Sbjct  8    EALNRVPLSEVVSDCVKRWFKDTLKEAKAGDINMQVLVGQMYYSGYGVPRDAQKGRIWMT  67

Query  514  rasrtrssawrVSDKRPG  567
            +ASR+RSS W+VSDK PG
Sbjct  68   KASRSRSSVWKVSDKHPG  85



>ref|NP_001144203.1| uncharacterized protein LOC100277064 [Zea mays]
 gb|ACG38663.1| hypothetical protein [Zea mays]
 gb|ACG42742.1| hypothetical protein [Zea mays]
 gb|ACL54176.1| unknown [Zea mays]
 tpg|DAA44916.1| TPA: hypothetical protein ZEAMMB73_023403 [Zea mays]
Length=170

 Score =   111 bits (278),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 58/82 (71%), Positives = 71/82 (87%), Gaps = 0/82 (0%)
 Frame = +1

Query  346  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisrasr  525
            R+PLAEVV+DC RRWFQD LKEA+AGDI+MQVLVGQMY SGYGV+++  K + W+ +ASR
Sbjct  79   RVPLAEVVSDCTRRWFQDALKEARAGDITMQVLVGQMYRSGYGVNKNEHKARVWMEKASR  138

Query  526  trssawrVSDKRPGYNVSDSDS  591
             RS+ W+VS+KRPGYN SDSDS
Sbjct  139  YRSTVWKVSNKRPGYNASDSDS  160



>ref|XP_008809978.1| PREDICTED: uncharacterized protein LOC103721508 [Phoenix dactylifera]
 ref|XP_008809979.1| PREDICTED: uncharacterized protein LOC103721508 [Phoenix dactylifera]
 ref|XP_008809980.1| PREDICTED: uncharacterized protein LOC103721508 [Phoenix dactylifera]
Length=166

 Score =   111 bits (277),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 63/91 (69%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +1

Query  343  RRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisras  522
            RR+PL+EVV+DCVRRWFQD L EA+ GD  MQVLVGQMY SGYG  R+ QKGKAWI++AS
Sbjct  76   RRVPLSEVVSDCVRRWFQDALNEARTGDPGMQVLVGQMYHSGYGCPRNEQKGKAWIAKAS  135

Query  523  rtrssawrVSDKRPGYNVSDSDSDDTAGEAK  615
            R RS+AW+VS K PGYN SDSDSD+   + K
Sbjct  136  RYRSAAWKVSYKHPGYNASDSDSDEAKDDVK  166



>ref|XP_009421405.1| PREDICTED: uncharacterized protein LOC104000960 [Musa acuminata 
subsp. malaccensis]
Length=96

 Score =   108 bits (271),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 57/83 (69%), Positives = 68/83 (82%), Gaps = 0/83 (0%)
 Frame = +1

Query  349  IPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisrasrt  528
            +PL EVV DCVRRWFQD LKEA+AGD+SMQVLV QMY SGYGV+++ QK   WI++ASR 
Sbjct  11   VPLKEVVADCVRRWFQDALKEARAGDVSMQVLVAQMYHSGYGVAKNEQKANVWITKASRY  70

Query  529  rssawrVSDKRPGYNVSDSDSDD  597
            RS+  +VSDK PGYN SDS SD+
Sbjct  71   RSAVRKVSDKHPGYNASDSYSDE  93



>ref|XP_003558119.1| PREDICTED: uncharacterized protein LOC100845835 [Brachypodium 
distachyon]
Length=157

 Score =   110 bits (275),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 57/88 (65%), Positives = 72/88 (82%), Gaps = 0/88 (0%)
 Frame = +1

Query  334  QRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawis  513
            Q   R+PL EVV DC +RWFQD+LKEA+AGD +MQVLVGQMY SGYGV+++  K + W+ 
Sbjct  64   QEHERVPLGEVVLDCTKRWFQDSLKEARAGDAAMQVLVGQMYRSGYGVNKNEHKARIWME  123

Query  514  rasrtrssawrVSDKRPGYNVSDSDSDD  597
            +ASR RS+ W+VS+KRPGYN SDSD+DD
Sbjct  124  KASRYRSTVWKVSNKRPGYNASDSDTDD  151



>ref|XP_003552182.1| PREDICTED: uncharacterized protein LOC100779520 [Glycine max]
Length=159

 Score =   110 bits (275),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 81/167 (49%), Positives = 101/167 (60%), Gaps = 19/167 (11%)
 Frame = +1

Query  91   MGKSVPSPTKLQDFARIIGSNTPRRRPTQVKPPVSRTRSVSPAEGPKLKGLVGGlespss  270
            MGK + S  +L + +RI+ S     RP +  P     RS +    P+     G       
Sbjct  1    MGKYLESAARLAELSRIVSSAAKPNRPKRALP-----RSPNRVATPRSANPFGV------  49

Query  271  errlrrNKMeeessngnsseeQRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVG  450
                   K+E         EEQ+ R  PLA+VV+DC +RWFQDTLKEAKAGD +MQVLVG
Sbjct  50   -------KVEPAKKMEPLEEEQQCR-TPLAKVVSDCSKRWFQDTLKEAKAGDTTMQVLVG  101

Query  451  QMYFSGYGVSRDAQKGKawisrasrtrssawrVSDKRPGYNVSDSDS  591
            QMY+SGYGV+RD QKG AWIS+ASR R+S W++  KRPGY  SDSDS
Sbjct  102  QMYYSGYGVARDPQKGHAWISKASRNRNSVWKLCGKRPGYRASDSDS  148



>gb|AAC28759.2| expressed protein [Arabidopsis thaliana]
 gb|ABD38894.1| At2g38450 [Arabidopsis thaliana]
Length=105

 Score =   108 bits (269),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 75/84 (89%), Gaps = 0/84 (0%)
 Frame = +1

Query  343  RRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisras  522
            R +PL+ VV+DC +RWF+DTL+EAKAG+I+MQVL+GQMY+SGYGV +DA+KG+ WI++AS
Sbjct  20   RFVPLSSVVSDCAKRWFKDTLEEAKAGNITMQVLLGQMYYSGYGVPKDARKGRLWITKAS  79

Query  523  rtrssawrVSDKRPGYNVSDSDSD  594
            R RSS W+V DKRPGYN SDSDS+
Sbjct  80   RVRSSVWKVIDKRPGYNASDSDSE  103



>ref|XP_002879746.1| hypothetical protein ARALYDRAFT_345628 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56005.1| hypothetical protein ARALYDRAFT_345628 [Arabidopsis lyrata subsp. 
lyrata]
Length=139

 Score =   109 bits (272),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 74/83 (89%), Gaps = 0/83 (0%)
 Frame = +1

Query  343  RRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisras  522
            R +PL+ VV+DC +RWF+DTL+EAKAG+I+MQVL+GQMY+SGYGV +DA+KG+ WI++AS
Sbjct  54   RFVPLSSVVSDCAKRWFKDTLEEAKAGNITMQVLLGQMYYSGYGVPKDAKKGRLWITKAS  113

Query  523  rtrssawrVSDKRPGYNVSDSDS  591
            R RSS W+V DKRPGYN SDSDS
Sbjct  114  RVRSSVWKVKDKRPGYNASDSDS  136



>ref|XP_010509118.1| PREDICTED: uncharacterized protein LOC104785576 [Camelina sativa]
Length=142

 Score =   109 bits (272),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 75/84 (89%), Gaps = 0/84 (0%)
 Frame = +1

Query  343  RRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisras  522
            R +PL+ VV+DC +RWF+DTL+EAKAG+I+MQV++GQMY+SGYGV +DA+KG+ WI++AS
Sbjct  57   RFVPLSTVVSDCAKRWFKDTLEEAKAGNITMQVVLGQMYYSGYGVPKDAKKGRLWITKAS  116

Query  523  rtrssawrVSDKRPGYNVSDSDSD  594
            + RSS W+V DKRPGYN SDSDS+
Sbjct  117  KVRSSVWKVKDKRPGYNASDSDSE  140



>gb|KJB67482.1| hypothetical protein B456_010G193200 [Gossypium raimondii]
 gb|KJB67483.1| hypothetical protein B456_010G193200 [Gossypium raimondii]
Length=157

 Score =   109 bits (273),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 85/176 (48%), Positives = 106/176 (60%), Gaps = 20/176 (11%)
 Frame = +1

Query  91   MGKSVPSPTKLQDFARIIGSNTPRRRPTQVKPPVSRTRSVSPAEGPKLKGL-VGGlesps  267
            MGKS+   TK Q+FA+ + S+   R    VKP  SR R VS  E     G+ V       
Sbjct  1    MGKSIVCTTKGQEFAKAVPSDKLHR-AKHVKP-ASRNR-VSCREKAGPSGVRVNSERVKQ  57

Query  268  serrlrrNKMeeessngnsseeQRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLV  447
                   N                  RIPLA+VV++ V+ WFQ+ LKEAKAGD +MQVLV
Sbjct  58   KAMDTWGND----------------DRIPLAQVVSELVKGWFQEALKEAKAGDTNMQVLV  101

Query  448  GQMYFSGYGVSRDAQKGKawisrasrtrssawrVSDKRPGYNVSDSDSDDTAGEAK  615
            GQMY +GYGV +D QKG+AWIS+ASR+RSS W+VSDK PGYN SDSDSD+   +A+
Sbjct  102  GQMYCNGYGVPKDVQKGRAWISKASRSRSSVWKVSDKHPGYNASDSDSDELRDDAE  157



>ref|NP_565889.2| uncharacterized protein [Arabidopsis thaliana]
 gb|AEC09538.1| uncharacterized protein AT2G38450 [Arabidopsis thaliana]
Length=138

 Score =   108 bits (271),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 75/84 (89%), Gaps = 0/84 (0%)
 Frame = +1

Query  343  RRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisras  522
            R +PL+ VV+DC +RWF+DTL+EAKAG+I+MQVL+GQMY+SGYGV +DA+KG+ WI++AS
Sbjct  53   RFVPLSSVVSDCAKRWFKDTLEEAKAGNITMQVLLGQMYYSGYGVPKDARKGRLWITKAS  112

Query  523  rtrssawrVSDKRPGYNVSDSDSD  594
            R RSS W+V DKRPGYN SDSDS+
Sbjct  113  RVRSSVWKVIDKRPGYNASDSDSE  136



>ref|XP_009406892.1| PREDICTED: uncharacterized protein LOC103989686 [Musa acuminata 
subsp. malaccensis]
Length=155

 Score =   109 bits (272),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = +1

Query  346  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisrasr  525
            R+PL +VV DC RRWFQD LKEA+AGD +MQVLVGQMY +GYG++++ QK  AWI++AS 
Sbjct  65   RVPLRDVVADCTRRWFQDALKEARAGDAAMQVLVGQMYHNGYGIAKNEQKAHAWITKASN  124

Query  526  trssawrVSDKRPGYNVSDSDSDD  597
             RSS W+VSDKRPGYN SDSDS++
Sbjct  125  YRSSVWKVSDKRPGYNASDSDSEE  148



>gb|KHN31321.1| hypothetical protein glysoja_022975 [Glycine soja]
Length=159

 Score =   109 bits (272),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 61/82 (74%), Positives = 71/82 (87%), Gaps = 0/82 (0%)
 Frame = +1

Query  346  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisrasr  525
            R PLA+VV+DC +RWFQDTLKEAKAGD +MQVLVGQMY+SGYGV+RD QKG AWIS+ASR
Sbjct  67   RTPLAKVVSDCSKRWFQDTLKEAKAGDTTMQVLVGQMYYSGYGVARDPQKGHAWISKASR  126

Query  526  trssawrVSDKRPGYNVSDSDS  591
             R+S W++  KRPGY  SDSDS
Sbjct  127  NRNSVWKLCGKRPGYRASDSDS  148



>ref|XP_006295208.1| hypothetical protein CARUB_v10024290mg [Capsella rubella]
 gb|EOA28106.1| hypothetical protein CARUB_v10024290mg [Capsella rubella]
Length=137

 Score =   108 bits (270),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = +1

Query  343  RRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisras  522
            R +PL+ VV+DC +RWF+DTL+EAKAG+I+MQVL+GQMY SGYG+ +DA+KGK WI++AS
Sbjct  52   RFVPLSTVVSDCAKRWFKDTLEEAKAGNITMQVLLGQMYNSGYGIPKDAKKGKLWITKAS  111

Query  523  rtrssawrVSDKRPGYNVSDSDSD  594
            R RSS W+V DKRPGYN SDSDS+
Sbjct  112  RVRSSVWKVKDKRPGYNASDSDSE  135



>gb|KFK36738.1| hypothetical protein AALP_AA4G163100 [Arabis alpina]
Length=106

 Score =   107 bits (267),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = +1

Query  343  RRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisras  522
            R +PL+ VV+DC +RWF+DTL+EAK G+I+MQVL+GQMY+SGYGV +D++KG+ WI++AS
Sbjct  23   RYVPLSSVVSDCAKRWFKDTLEEAKGGNITMQVLLGQMYYSGYGVPKDSRKGRLWITKAS  82

Query  523  rtrssawrVSDKRPGYNVSDSDSD  594
            R RSS W+V DKRPGYN SDSDSD
Sbjct  83   RVRSSVWKVKDKRPGYNASDSDSD  106



>ref|XP_002265673.1| PREDICTED: uncharacterized protein LOC100243041 isoform X2 [Vitis 
vinifera]
Length=99

 Score =   107 bits (266),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 58/75 (77%), Positives = 70/75 (93%), Gaps = 0/75 (0%)
 Frame = +1

Query  343  RRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisras  522
             R+PL+EVV+DCV+RWFQDTL+EAK+GD+SMQVLVGQMY+SGYGV RDAQKG+ W++RAS
Sbjct  11   HRVPLSEVVSDCVKRWFQDTLREAKSGDVSMQVLVGQMYYSGYGVPRDAQKGRVWMTRAS  70

Query  523  rtrssawrVSDKRPG  567
            RTRSS W+VSDK PG
Sbjct  71   RTRSSVWKVSDKHPG  85



>ref|XP_010505467.1| PREDICTED: uncharacterized protein LOC104782284 [Camelina sativa]
Length=143

 Score =   108 bits (269),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 75/84 (89%), Gaps = 0/84 (0%)
 Frame = +1

Query  343  RRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisras  522
            R +PL+ VV+DC +RWF+DTL+EAKAG+I+MQV++GQMY+SGYGV +DA+KG+ WI++AS
Sbjct  58   RFVPLSTVVSDCAKRWFKDTLEEAKAGNITMQVVLGQMYYSGYGVPKDAKKGRLWITKAS  117

Query  523  rtrssawrVSDKRPGYNVSDSDSD  594
            R RSS W+V DKRPGYN SDSDS+
Sbjct  118  RVRSSVWKVKDKRPGYNASDSDSE  141



>ref|XP_010517139.1| PREDICTED: uncharacterized protein LOC104792648 isoform X1 [Camelina 
sativa]
Length=144

 Score =   107 bits (268),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 75/84 (89%), Gaps = 0/84 (0%)
 Frame = +1

Query  343  RRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisras  522
            R +PL+ VV+DC +RWF+DTL+EAKAG+I+MQV++GQMY+SGYGV +DA+KG+ WI++AS
Sbjct  59   RFVPLSTVVSDCAKRWFKDTLEEAKAGNITMQVVLGQMYYSGYGVPKDAKKGRLWITKAS  118

Query  523  rtrssawrVSDKRPGYNVSDSDSD  594
            R RSS W+V DKRPGYN SDSDS+
Sbjct  119  RVRSSVWKVKDKRPGYNASDSDSE  142



>gb|AAM62527.1| unknown [Arabidopsis thaliana]
Length=105

 Score =   106 bits (265),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = +1

Query  343  RRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisras  522
            R +PL+ VV+DC + WF+DTL+EAKAG+I+MQVL+GQMY+SGYGV +DA+KG+ WI++AS
Sbjct  20   RFVPLSSVVSDCAKXWFKDTLEEAKAGNITMQVLLGQMYYSGYGVPKDAKKGRLWITKAS  79

Query  523  rtrssawrVSDKRPGYNVSDSDSD  594
            R RSS W+V DKRPGYN SDSDS+
Sbjct  80   RVRSSVWKVIDKRPGYNASDSDSE  103



>gb|ACU23149.1| unknown [Glycine max]
Length=159

 Score =   107 bits (268),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 80/167 (48%), Positives = 100/167 (60%), Gaps = 19/167 (11%)
 Frame = +1

Query  91   MGKSVPSPTKLQDFARIIGSNTPRRRPTQVKPPVSRTRSVSPAEGPKLKGLVGGlespss  270
            MGK + S  +L + +RI+ S     RP +  P     RS +    P+     G       
Sbjct  1    MGKYLESAARLAELSRIVSSAAKPNRPKRALP-----RSPNRVATPRSANPFGV------  49

Query  271  errlrrNKMeeessngnsseeQRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVG  450
                   K+E         EEQ+ R  PLA+VV+DC +RWFQDTLKEAKAGD +MQVLVG
Sbjct  50   -------KVEPAKKMEPLEEEQQCR-TPLAKVVSDCSKRWFQDTLKEAKAGDTTMQVLVG  101

Query  451  QMYFSGYGVSRDAQKGKawisrasrtrssawrVSDKRPGYNVSDSDS  591
            QMY+SGYGV+RD QKG AWIS+ASR R+S W++  KRPGY  SD DS
Sbjct  102  QMYYSGYGVARDPQKGHAWISKASRNRNSVWKLCGKRPGYRASDFDS  148



>gb|KHN04800.1| hypothetical protein glysoja_031900 [Glycine soja]
Length=144

 Score =   107 bits (267),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 61/82 (74%), Positives = 68/82 (83%), Gaps = 0/82 (0%)
 Frame = +1

Query  346  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisrasr  525
            R PLA+VV DC +RWFQDTLKEAKAGD +MQVLVGQMY+SGYGV RD QKG  WIS+ASR
Sbjct  63   RTPLAKVVADCSKRWFQDTLKEAKAGDSAMQVLVGQMYYSGYGVPRDPQKGHVWISKASR  122

Query  526  trssawrVSDKRPGYNVSDSDS  591
             R+S W+V  KRPGY  SDSDS
Sbjct  123  NRNSVWKVCGKRPGYRASDSDS  144



>ref|XP_004146455.1| PREDICTED: uncharacterized protein LOC101213931 isoform X1 [Cucumis 
sativus]
Length=181

 Score =   108 bits (269),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 82/200 (41%), Positives = 116/200 (58%), Gaps = 30/200 (15%)
 Frame = +1

Query  91   MGKSVPSPTKLQDFARIIGSNTPRRRPTQVKPPVSRTRSVSPAEGPKLKGLVGGlespss  270
            M KS+PSP + Q FA+++ S+    +  Q +P  SR R+ SP+E P + G V        
Sbjct  1    MAKSLPSPARFQQFAKLVFSS----KNPQSQPKKSRIRA-SPSETP-ISGSV--------  46

Query  271  errlrrNKMeeessngnsseeQRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVG  450
                   ++  E +     EE+   R PLA+VV+DCV+RWFQDTLKEAKAGD SMQVLVG
Sbjct  47   -------RVISEPNKNKYMEEEEKNRTPLADVVSDCVKRWFQDTLKEAKAGDTSMQVLVG  99

Query  451  QMYFSGYGVSRDAQKGKawisrasrtrssawrVSDKRPGYNVSDSDSDDTAGEAK*EKMH  630
            QM+ SGYGV ++ +KG AWI RAS+ ++S W+ SD+ PG  +  S   +         +H
Sbjct  100  QMFCSGYGVPKNTKKGLAWIYRASKYQASVWKASDRHPGIQILQSLIGNNLST-----LH  154

Query  631  LLFKKNNGCSVFHAASPTSS  690
              F     CS+ + A+ + S
Sbjct  155  FYF----FCSLGYLATDSES  170



>ref|XP_012091209.1| PREDICTED: uncharacterized protein LOC105649227 [Jatropha curcas]
 gb|KDP21698.1| hypothetical protein JCGZ_03369 [Jatropha curcas]
Length=156

 Score =   107 bits (266),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 79/165 (48%), Positives = 103/165 (62%), Gaps = 31/165 (19%)
 Frame = +1

Query  91   MGKSVPSPTKLQDFARIIGSNTPRRRPT----QVKPPVSRTRSVSPAEGPKLKGLVGGle  258
            MGK +PS  ++Q+ ++I  S  P+RR T     +KP   R      A+  K+K       
Sbjct  1    MGKLLPSTGEIQELSKIFASCKPKRRKTVPLINLKPNEVRVN----AQPLKVK-------  49

Query  259  spsserrlrrNKMeeessngnsseeQRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQ  438
                       KM E S   +        R+PL++VV++CV+RWFQDTLKEAKAGDI+MQ
Sbjct  50   -----------KMGESSLCLDGQ-----NRVPLSQVVSECVKRWFQDTLKEAKAGDIAMQ  93

Query  439  VLVGQMYFSGYGVSRDAQKGKawisrasrtrssawrVSDKRPGYN  573
            VLVGQMY +GYGV +D QKG  WISRAS++R+SAW+V DKRPGYN
Sbjct  94   VLVGQMYCNGYGVPKDDQKGHGWISRASKSRASAWKVRDKRPGYN  138



>gb|AFK39264.1| unknown [Lotus japonicus]
Length=101

 Score =   104 bits (260),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 56/76 (74%), Positives = 68/76 (89%), Gaps = 0/76 (0%)
 Frame = +1

Query  346  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisrasr  525
            R+PL+EVV DCV+RWF+DTLKEAK GDI+MQVLVGQMY +GYGV +DAQKG+ W+++ASR
Sbjct  13   RVPLSEVVADCVKRWFKDTLKEAKGGDINMQVLVGQMYCTGYGVPKDAQKGRIWLTKASR  72

Query  526  trssawrVSDKRPGYN  573
             RSS W+V DKRPGYN
Sbjct  73   VRSSVWKVGDKRPGYN  88



>ref|XP_007140174.1| hypothetical protein PHAVU_008G090100g [Phaseolus vulgaris]
 gb|ESW12168.1| hypothetical protein PHAVU_008G090100g [Phaseolus vulgaris]
Length=94

 Score =   104 bits (260),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 56/89 (63%), Positives = 73/89 (82%), Gaps = 0/89 (0%)
 Frame = +1

Query  346  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisrasr  525
            R+PL++VV DC +RWF+DTLKEAKAGD++MQVLV QMY+ GYG+ +D QKG+ W+++ASR
Sbjct  6    RVPLSDVVADCAKRWFKDTLKEAKAGDVNMQVLVSQMYYHGYGIPKDGQKGRVWLTKASR  65

Query  526  trssawrVSDKRPGYNVSDSDSDDTAGEA  612
             RSS WRV  K PGYN SDS+SDD   ++
Sbjct  66   VRSSVWRVGRKPPGYNASDSESDDLENDS  94



>ref|XP_002312191.1| hypothetical protein POPTR_0008s07490g [Populus trichocarpa]
 gb|EEE89558.1| hypothetical protein POPTR_0008s07490g [Populus trichocarpa]
Length=102

 Score =   103 bits (258),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 55/77 (71%), Positives = 66/77 (86%), Gaps = 0/77 (0%)
 Frame = +1

Query  343  RRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisras  522
            +R+PL  VV+DC +RWFQDTLKEAK GDI+MQVLVGQMYF+GYGV +D +KG  W+SRAS
Sbjct  12   KRVPLGLVVSDCAKRWFQDTLKEAKTGDITMQVLVGQMYFNGYGVPKDVEKGSDWMSRAS  71

Query  523  rtrssawrVSDKRPGYN  573
            + R S W+VSDKRPGYN
Sbjct  72   KRRMSVWKVSDKRPGYN  88



>ref|XP_008456899.1| PREDICTED: uncharacterized protein LOC103496713 isoform X1 [Cucumis 
melo]
Length=181

 Score =   106 bits (264),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 83/200 (42%), Positives = 117/200 (59%), Gaps = 30/200 (15%)
 Frame = +1

Query  91   MGKSVPSPTKLQDFARIIGSNTPRRRPTQVKPPVSRTRSVSPAEGPKLKGLVGGlespss  270
            M KS+PSPT+ Q FA+++ S+   + P    P  SR R+ SP+E P + G V        
Sbjct  1    MAKSLPSPTRFQQFAKLVFSSKNPQSP----PKKSRIRA-SPSETP-ISGSV--------  46

Query  271  errlrrNKMeeessngnsseeQRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVG  450
                   ++  E +     EE+   R PL++VV+DCV+RWFQDTLKEAKAGD SMQVLVG
Sbjct  47   -------RVILEPNKNKYMEEKEKNRTPLSDVVSDCVKRWFQDTLKEAKAGDTSMQVLVG  99

Query  451  QMYFSGYGVSRDAQKGKawisrasrtrssawrVSDKRPGYNVSDSDSDDTAGEAK*EKMH  630
            QM+ SGYGV ++ +KG AWI RAS+ + S W+ S++ PG  +  S  D+    +      
Sbjct  100  QMFCSGYGVPKNTKKGLAWIYRASKYQPSVWKASERHPGIQIVRSLIDNNLSAS------  153

Query  631  LLFKKNNGCSVFHAASPTSS  690
             LF  N  CS+ + A+ + S
Sbjct  154  -LF--NFFCSLGYLATDSES  170



>ref|XP_006481131.1| PREDICTED: uncharacterized protein LOC102610400 isoform X1 [Citrus 
sinensis]
Length=116

 Score =   104 bits (259),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +1

Query  346  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisrasr  525
            R+PL+EVV+DCV+RWF+DTLKEAK GDI+MQVLVGQMYFSGYGV+RDAQKG+ WISRASR
Sbjct  27   RVPLSEVVSDCVKRWFRDTLKEAKGGDINMQVLVGQMYFSGYGVARDAQKGRIWISRASR  86

Query  526  trssawrVSDKRPG  567
            TRSS W+V +K PG
Sbjct  87   TRSSVWKVGEKHPG  100



>ref|XP_004500530.1| PREDICTED: uncharacterized protein LOC101512952 isoform X1 [Cicer 
arietinum]
 ref|XP_004500531.1| PREDICTED: uncharacterized protein LOC101512952 isoform X2 [Cicer 
arietinum]
 ref|XP_004500532.1| PREDICTED: uncharacterized protein LOC101512952 isoform X3 [Cicer 
arietinum]
 ref|XP_004500533.1| PREDICTED: uncharacterized protein LOC101512952 isoform X4 [Cicer 
arietinum]
Length=154

 Score =   105 bits (261),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 78/168 (46%), Positives = 97/168 (58%), Gaps = 24/168 (14%)
 Frame = +1

Query  91   MGKSVPSPTKLQDFARIIGSNTPRRRPTQVKPPVSRTRSVSPAEGPKLKGLVGGlespss  270
            MGKSV S  +L++ +R++ S+    RP   +P +S  R  +P                  
Sbjct  1    MGKSVESVIRLKELSRVVSSSAKSNRPKTTQP-ISPNRVTTPRTA---------------  44

Query  271  errlrrNKMeeessngnsseeQRLR-RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLV  447
                   K +         + + L  R PLA VV  C +RWFQDTLK AKAGD SMQVLV
Sbjct  45   -------KQDRTVKVEPPKKIEALESRTPLARVVAYCSKRWFQDTLKGAKAGDSSMQVLV  97

Query  448  GQMYFSGYGVSRDAQKGKawisrasrtrssawrVSDKRPGYNVSDSDS  591
            GQMY SGYGV RD QKG AWISRASR+R+  W+VS+K+PGY  SDSDS
Sbjct  98   GQMYNSGYGVPRDPQKGHAWISRASRSRNLVWKVSEKQPGYRASDSDS  145



>emb|CDY07730.1| BnaA03g17810D [Brassica napus]
Length=141

 Score =   103 bits (258),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 54/81 (67%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = +1

Query  349  IPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisrasrt  528
            +PL+ VV+DC +RWF+DTL+EAKAG+I+MQV++GQMY SGYGV +DA+KG+ WI++AS+ 
Sbjct  58   VPLSAVVSDCAKRWFEDTLEEAKAGNITMQVVLGQMYNSGYGVPKDARKGRVWITKASKV  117

Query  529  rssawrVSDKRPGYNVSDSDS  591
            RSS W+V +KRPGYN SDSDS
Sbjct  118  RSSVWKVMNKRPGYNASDSDS  138



>ref|XP_006374033.1| hypothetical protein POPTR_0016s13640g [Populus trichocarpa]
 gb|ERP51830.1| hypothetical protein POPTR_0016s13640g [Populus trichocarpa]
Length=145

 Score =   103 bits (258),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 54/76 (71%), Positives = 70/76 (92%), Gaps = 0/76 (0%)
 Frame = +1

Query  346  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisrasr  525
            R+PL++VV+DC++RWF+DTLKEAKAGDI+MQVLV QMY+SGYGV +D QKG+ W++RASR
Sbjct  55   RVPLSDVVSDCIKRWFKDTLKEAKAGDINMQVLVSQMYYSGYGVPKDEQKGRIWMTRASR  114

Query  526  trssawrVSDKRPGYN  573
            TRS  W+VS+K+PGYN
Sbjct  115  TRSWVWKVSNKQPGYN  130



>ref|XP_011032587.1| PREDICTED: uncharacterized protein LOC105131358 [Populus euphratica]
 ref|XP_011032588.1| PREDICTED: uncharacterized protein LOC105131358 [Populus euphratica]
 ref|XP_011032589.1| PREDICTED: uncharacterized protein LOC105131358 [Populus euphratica]
Length=145

 Score =   103 bits (258),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 54/76 (71%), Positives = 70/76 (92%), Gaps = 0/76 (0%)
 Frame = +1

Query  346  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisrasr  525
            R+PL++VV+DC++RWF+DTLKEAKAGDI+MQVLV QMY+SGYGV +D QKG+ W++RASR
Sbjct  55   RVPLSDVVSDCIKRWFKDTLKEAKAGDINMQVLVSQMYYSGYGVPKDEQKGRIWMTRASR  114

Query  526  trssawrVSDKRPGYN  573
            TRS  W+VS+K+PGYN
Sbjct  115  TRSWVWKVSNKQPGYN  130



>ref|XP_009133257.1| PREDICTED: uncharacterized protein LOC103857784 isoform X1 [Brassica 
rapa]
 emb|CDY14460.1| BnaC03g21350D [Brassica napus]
Length=141

 Score =   103 bits (257),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 54/81 (67%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = +1

Query  349  IPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisrasrt  528
            +PL+ VV+DC +RWF+DTL+EAKAG+I+MQV++GQMY SGYGV +DA+KG+ WI++AS+ 
Sbjct  58   VPLSAVVSDCAKRWFEDTLEEAKAGNITMQVVLGQMYNSGYGVPKDARKGRVWITKASKV  117

Query  529  rssawrVSDKRPGYNVSDSDS  591
            RSS W+V +KRPGYN SDSDS
Sbjct  118  RSSVWKVMNKRPGYNASDSDS  138



>ref|XP_011005568.1| PREDICTED: uncharacterized protein LOC105111778 [Populus euphratica]
 ref|XP_011005640.1| PREDICTED: uncharacterized protein LOC105111778 [Populus euphratica]
Length=102

 Score =   102 bits (254),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 54/77 (70%), Positives = 65/77 (84%), Gaps = 0/77 (0%)
 Frame = +1

Query  343  RRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisras  522
            +R+PL  VV+DC +RWFQD LKEAK GDI+MQVLVGQMYF+GYGV +D +KG  W+SRAS
Sbjct  12   KRVPLGLVVSDCAKRWFQDALKEAKTGDITMQVLVGQMYFNGYGVPKDVEKGSYWMSRAS  71

Query  523  rtrssawrVSDKRPGYN  573
            + R S W+VSDKRPGYN
Sbjct  72   KRRMSVWKVSDKRPGYN  88



>ref|XP_006654273.1| PREDICTED: uncharacterized protein LOC102714375 [Oryza brachyantha]
Length=105

 Score =   102 bits (254),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 57/90 (63%), Positives = 68/90 (76%), Gaps = 0/90 (0%)
 Frame = +1

Query  346  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisrasr  525
            R PL+EVV DCV+RWFQD LKEA+ GD +MQVLV QMY SGYG+ +   KG+AW  +ASR
Sbjct  15   RKPLSEVVGDCVQRWFQDALKEARRGDSAMQVLVAQMYHSGYGIPKSEHKGRAWAEKASR  74

Query  526  trssawrVSDKRPGYNVSDSDSDDTAGEAK  615
             R S W+V  KRPGYN SDSDSD+T  + K
Sbjct  75   YRPSVWKVGTKRPGYNASDSDSDETNNDEK  104



>ref|XP_011655024.1| PREDICTED: uncharacterized protein LOC101213931 isoform X3 [Cucumis 
sativus]
Length=126

 Score =   102 bits (255),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 62/135 (46%), Positives = 84/135 (62%), Gaps = 21/135 (16%)
 Frame = +1

Query  91   MGKSVPSPTKLQDFARIIGSNTPRRRPTQVKPPVSRTRSVSPAEGPKLKGLVGGlespss  270
            M KS+PSP + Q FA+++ S+    +  Q +P  SR R+ SP+E P + G V        
Sbjct  1    MAKSLPSPARFQQFAKLVFSS----KNPQSQPKKSRIRA-SPSETP-ISGSV--------  46

Query  271  errlrrNKMeeessngnsseeQRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVG  450
                   ++  E +     EE+   R PLA+VV+DCV+RWFQDTLKEAKAGD SMQVLVG
Sbjct  47   -------RVISEPNKNKYMEEEEKNRTPLADVVSDCVKRWFQDTLKEAKAGDTSMQVLVG  99

Query  451  QMYFSGYGVSRDAQK  495
            QM+ SGYGV ++ +K
Sbjct  100  QMFCSGYGVPKNTKK  114



>ref|NP_001238136.1| uncharacterized protein LOC100527576 [Glycine max]
 gb|ACU16686.1| unknown [Glycine max]
Length=100

 Score =   101 bits (251),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 56/76 (74%), Positives = 66/76 (87%), Gaps = 0/76 (0%)
 Frame = +1

Query  346  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisrasr  525
            R PL+ VV DCV+RWF+DTLKEAKAGD++MQVLVGQMY+ GYGV RDAQKG+ W+++ASR
Sbjct  13   RAPLSGVVADCVKRWFKDTLKEAKAGDVNMQVLVGQMYYHGYGVPRDAQKGRIWLTKASR  72

Query  526  trssawrVSDKRPGYN  573
             RSS WRV  KRPGYN
Sbjct  73   VRSSVWRVGGKRPGYN  88



>ref|XP_004984894.1| PREDICTED: myc-associated zinc finger protein-like [Setaria italica]
Length=173

 Score =   103 bits (257),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 53/77 (69%), Positives = 66/77 (86%), Gaps = 0/77 (0%)
 Frame = +1

Query  346  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisrasr  525
            R+PLAEVV+DC RRWFQD LKEA+AGDI+MQVLVGQMY SGYGV+++  K + W+ +ASR
Sbjct  82   RVPLAEVVSDCTRRWFQDALKEARAGDITMQVLVGQMYRSGYGVNKNEHKARVWMEKASR  141

Query  526  trssawrVSDKRPGYNV  576
             RS+ W+VS+KRPGYN 
Sbjct  142  YRSTVWKVSNKRPGYNA  158



>ref|NP_974733.1| uncharacterized protein [Arabidopsis thaliana]
 gb|ABK32156.1| At5g05360 [Arabidopsis thaliana]
 gb|AED90863.1| uncharacterized protein AT5G05360 [Arabidopsis thaliana]
Length=153

 Score =   102 bits (254),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 58/79 (73%), Positives = 70/79 (89%), Gaps = 0/79 (0%)
 Frame = +1

Query  340  LRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisra  519
            + R+PLA+VV DCVRRWFQDTLKEAK+GD+ MQVLVGQMY SGYG+ +D  KG+AWI++A
Sbjct  75   INRVPLAQVVEDCVRRWFQDTLKEAKSGDVGMQVLVGQMYCSGYGIPKDENKGRAWINKA  134

Query  520  srtrssawrVSDKRPGYNV  576
            SRTRSSAW+VSDK PG N+
Sbjct  135  SRTRSSAWQVSDKPPGNNI  153



>ref|NP_001055251.1| Os05g0342900 [Oryza sativa Japonica Group]
 gb|AAV43869.1| unknown protein [Oryza sativa Japonica Group]
 gb|AAV44160.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF17165.1| Os05g0342900 [Oryza sativa Japonica Group]
 gb|EAY97601.1| hypothetical protein OsI_19526 [Oryza sativa Indica Group]
 dbj|BAG89024.1| unnamed protein product [Oryza sativa Japonica Group]
Length=103

 Score =   100 bits (248),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 56/90 (62%), Positives = 68/90 (76%), Gaps = 0/90 (0%)
 Frame = +1

Query  346  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisrasr  525
            R PL+EVV DCV+RWFQD LKEA+ GD +MQVLV QMY SGYG+ ++  KG+AW  +ASR
Sbjct  13   RKPLSEVVGDCVQRWFQDALKEARRGDSAMQVLVAQMYHSGYGIPKNEHKGRAWAEKASR  72

Query  526  trssawrVSDKRPGYNVSDSDSDDTAGEAK  615
             R S W+V  KRPGYN SDSDSD+   + K
Sbjct  73   YRPSVWKVGTKRPGYNASDSDSDEMNDDEK  102



>ref|XP_002465405.1| hypothetical protein SORBIDRAFT_01g038090 [Sorghum bicolor]
 gb|EER92403.1| hypothetical protein SORBIDRAFT_01g038090 [Sorghum bicolor]
Length=215

 Score =   102 bits (254),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 53/77 (69%), Positives = 66/77 (86%), Gaps = 0/77 (0%)
 Frame = +1

Query  346  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisrasr  525
            R+PLAEVV+DC RRWFQD LKEA+AGDI+MQVLVGQMY SGYGV+++  K + W+ +ASR
Sbjct  124  RVPLAEVVSDCTRRWFQDALKEARAGDITMQVLVGQMYRSGYGVNKNEHKARVWMEKASR  183

Query  526  trssawrVSDKRPGYNV  576
             RS+ W+VS+KRPGYN 
Sbjct  184  YRSTVWKVSNKRPGYNA  200



>ref|XP_004962417.1| PREDICTED: uncharacterized protein LOC101777264 isoform X1 [Setaria 
italica]
 ref|XP_004962418.1| PREDICTED: uncharacterized protein LOC101777264 isoform X2 [Setaria 
italica]
Length=104

 Score = 99.0 bits (245),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 69/91 (76%), Gaps = 0/91 (0%)
 Frame = +1

Query  340  LRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisra  519
              R PL+EVV DCV+RWFQD  KEA+ GD++ QVLV QM+FSGYGV ++  KG+ W+ RA
Sbjct  12   CERKPLSEVVGDCVQRWFQDAFKEARKGDVANQVLVAQMFFSGYGVPKNEYKGRQWMDRA  71

Query  520  srtrssawrVSDKRPGYNVSDSDSDDTAGEA  612
            S+ RSSA +V  KRPGYN SDSDSD+   +A
Sbjct  72   SKYRSSALKVGMKRPGYNASDSDSDEANDDA  102



>ref|NP_001049844.1| Os03g0298600 [Oryza sativa Japonica Group]
 gb|ABF95462.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF11758.1| Os03g0298600 [Oryza sativa Japonica Group]
 dbj|BAG90150.1| unnamed protein product [Oryza sativa Japonica Group]
Length=170

 Score =   100 bits (248),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 52/77 (68%), Positives = 64/77 (83%), Gaps = 0/77 (0%)
 Frame = +1

Query  346  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisrasr  525
            R+PL+EVV DC RRWFQDTLKEA+AGD +MQVLVGQMY SGYGV+++  K + W  +ASR
Sbjct  74   RVPLSEVVLDCTRRWFQDTLKEARAGDAAMQVLVGQMYRSGYGVNKNEHKAQIWTEKASR  133

Query  526  trssawrVSDKRPGYNV  576
             RS+ W+VS+KRPGYN 
Sbjct  134  YRSTVWKVSNKRPGYNA  150



>gb|EEE58888.1| hypothetical protein OsJ_10507 [Oryza sativa Japonica Group]
Length=180

 Score = 99.8 bits (247),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 52/77 (68%), Positives = 64/77 (83%), Gaps = 0/77 (0%)
 Frame = +1

Query  346  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisrasr  525
            R+PL+EVV DC RRWFQDTLKEA+AGD +MQVLVGQMY SGYGV+++  K + W  +ASR
Sbjct  74   RVPLSEVVLDCTRRWFQDTLKEARAGDAAMQVLVGQMYRSGYGVNKNEHKAQIWTEKASR  133

Query  526  trssawrVSDKRPGYNV  576
             RS+ W+VS+KRPGYN 
Sbjct  134  YRSTVWKVSNKRPGYNA  150



>ref|XP_006411058.1| hypothetical protein EUTSA_v10017381mg [Eutrema salsugineum]
 gb|ESQ52511.1| hypothetical protein EUTSA_v10017381mg [Eutrema salsugineum]
Length=146

 Score = 97.8 bits (242),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 51/78 (65%), Positives = 68/78 (87%), Gaps = 0/78 (0%)
 Frame = +1

Query  343  RRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisras  522
            R +PL+ VV+DC +RWF+DTL+EAKAG+I+MQVL+GQMY+SGYG+ +D +KG+ WI++AS
Sbjct  57   RCVPLSSVVSDCAKRWFKDTLEEAKAGNITMQVLLGQMYYSGYGIPKDPRKGRLWITKAS  116

Query  523  rtrssawrVSDKRPGYNV  576
            R RSS W+V DKRPGYN 
Sbjct  117  RVRSSVWKVKDKRPGYNA  134



>ref|XP_003601009.1| hypothetical protein MTR_3g072010 [Medicago truncatula]
 gb|AES71260.1| Sel1 repeat protein [Medicago truncatula]
 gb|AFK43254.1| unknown [Medicago truncatula]
 gb|AFK48125.1| unknown [Medicago truncatula]
Length=156

 Score = 97.8 bits (242),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 67/84 (80%), Gaps = 0/84 (0%)
 Frame = +1

Query  346  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisrasr  525
            RI L+ VV DC  RWF DTLKEAK GD+S QVLVGQMY SGYGV R+ QKG AWISRASR
Sbjct  66   RIALSRVVADCTHRWFHDTLKEAKRGDLSSQVLVGQMYCSGYGVPRNPQKGHAWISRASR  125

Query  526  trssawrVSDKRPGYNVSDSDSDD  597
            +R+S W++S+K PGY  SDSDS +
Sbjct  126  SRNSVWQLSEKPPGYRASDSDSSE  149



>ref|XP_006282317.1| hypothetical protein CARUB_v10028606mg, partial [Capsella rubella]
 gb|EOA15215.1| hypothetical protein CARUB_v10028606mg, partial [Capsella rubella]
Length=117

 Score = 95.9 bits (237),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +1

Query  340  LRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQK  495
            + RIPLA+VV DCVRRWFQDTLKEAK+GD+ MQVLVGQMY SGYG+S+D QK
Sbjct  66   INRIPLAQVVEDCVRRWFQDTLKEAKSGDVGMQVLVGQMYCSGYGISKDEQK  117



>ref|XP_006289773.1| hypothetical protein CARUB_v10003374mg, partial [Capsella rubella]
 gb|EOA22671.1| hypothetical protein CARUB_v10003374mg, partial [Capsella rubella]
Length=130

 Score = 95.9 bits (237),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +1

Query  340  LRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQK  495
            + RIPLA+VV DCVRRWFQDTLKEAK+GD+ MQVLVGQMY SGYG+S+D QK
Sbjct  79   INRIPLAQVVEDCVRRWFQDTLKEAKSGDVGMQVLVGQMYCSGYGISKDEQK  130



>gb|KDO44850.1| hypothetical protein CISIN_1g032635mg [Citrus sinensis]
 gb|KDO44851.1| hypothetical protein CISIN_1g032635mg [Citrus sinensis]
 gb|KDO44852.1| hypothetical protein CISIN_1g032635mg [Citrus sinensis]
 gb|KDO44853.1| hypothetical protein CISIN_1g032635mg [Citrus sinensis]
 gb|KDO44854.1| hypothetical protein CISIN_1g032635mg [Citrus sinensis]
Length=137

 Score = 94.0 bits (232),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 59/141 (42%), Positives = 83/141 (59%), Gaps = 25/141 (18%)
 Frame = +1

Query  91   MGKSVPSP-TKLQDFARIIGSNTPRR----RPTQVKPPVSRTRSVSPAEGPKLKGLVGGl  255
            MGKS+ S  T L+D ARI+ S++P R    RP   KPP   T  VS     K + +V   
Sbjct  1    MGKSIASTVTTLRDLARIVSSSSPERLQRVRPRHSKPPP--TSVVSARSETKARPIV---  55

Query  256  espsserrlrrNKMeeessngnsseeQRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISM  435
                           ++     + + Q+ +R+PL++VV+DCV+RWFQDTL+EAK GD +M
Sbjct  56   ---------------KKPKMNINWDTQQQQRVPLSQVVSDCVQRWFQDTLREAKNGDKAM  100

Query  436  QVLVGQMYFSGYGVSRDAQKG  498
            +VLVGQMY SGYGV+   ++G
Sbjct  101  EVLVGQMYLSGYGVAEMKKRG  121



>gb|KJB67484.1| hypothetical protein B456_010G193200 [Gossypium raimondii]
Length=183

 Score = 95.1 bits (235),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 85/202 (42%), Positives = 106/202 (52%), Gaps = 46/202 (23%)
 Frame = +1

Query  91   MGKSVPSPTKLQDFARIIGSNTPRRRPTQVKPPVSRTRSVSPAEGPKLKGL-VGGlesps  267
            MGKS+   TK Q+FA+ + S+    R   VKP  SR R VS  E     G+ V       
Sbjct  1    MGKSIVCTTKGQEFAKAVPSD-KLHRAKHVKP-ASRNR-VSCREKAGPSGVRVNSERVKQ  57

Query  268  serrlrrNKMeeessngnsseeQRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLV  447
                   N                  RIPLA+VV++ V+ WFQ+ LKEAKAGD +MQVLV
Sbjct  58   KAMDTWGND----------------DRIPLAQVVSELVKGWFQEALKEAKAGDTNMQVLV  101

Query  448  GQMYFSGYGVSRDAQKGKawisrasrtrssawrVSDKRP---------------------  564
            GQMY +GYGV +D QKG+AWIS+ASR+RSS W+VSDK P                     
Sbjct  102  GQMYCNGYGVPKDVQKGRAWISKASRSRSSVWKVSDKHPGTLCVCACVKVGLLLLSKTIF  161

Query  565  -----GYNVSDSDSDDTAGEAK  615
                 GYN SDSDSD+   +A+
Sbjct  162  LRFPSGYNASDSDSDELRDDAE  183



>ref|XP_010497949.1| PREDICTED: uncharacterized protein LOC104775718, partial [Camelina 
sativa]
Length=68

 Score = 90.1 bits (222),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +1

Query  340  LRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQK  495
            + R+PLA+VV DCVRRWFQDTLK+AK+GD+ MQVLVGQMY SGYG+ +D QK
Sbjct  17   INRVPLAQVVEDCVRRWFQDTLKDAKSGDVGMQVLVGQMYCSGYGIPKDEQK  68



>ref|XP_002871153.1| hypothetical protein ARALYDRAFT_325170 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47412.1| hypothetical protein ARALYDRAFT_325170 [Arabidopsis lyrata subsp. 
lyrata]
Length=177

 Score = 93.2 bits (230),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +1

Query  340  LRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGK  501
            + R+PLA+VV DCVRRWFQDTLKEAK+GD+ MQVLVGQMY SGYG+ +D  KG+
Sbjct  73   INRVPLAQVVEDCVRRWFQDTLKEAKSGDVGMQVLVGQMYCSGYGIPKDENKGR  126



>dbj|BAB09979.1| unnamed protein product [Arabidopsis thaliana]
Length=179

 Score = 93.2 bits (230),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +1

Query  340  LRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGK  501
            + R+PLA+VV DCVRRWFQDTLKEAK+GD+ MQVLVGQMY SGYG+ +D  KG+
Sbjct  75   INRVPLAQVVEDCVRRWFQDTLKEAKSGDVGMQVLVGQMYCSGYGIPKDENKGR  128



>gb|KHN29550.1| hypothetical protein glysoja_005274 [Glycine soja]
Length=185

 Score = 90.1 bits (222),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +1

Query  346  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQK  495
            R PL+ VV DCV+RWF+DTLKEAKAGD++MQVLVGQMY+ GYGV RDAQK
Sbjct  13   RAPLSGVVADCVKRWFKDTLKEAKAGDVNMQVLVGQMYYHGYGVPRDAQK  62



>gb|EMT09012.1| hypothetical protein F775_27191 [Aegilops tauschii]
Length=152

 Score = 88.6 bits (218),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 45/51 (88%), Gaps = 0/51 (0%)
 Frame = +1

Query  346  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKG  498
            R+PLAEVV DC +RWFQDTLKEA+AGD +MQVLVGQMY SGYGV+++  KG
Sbjct  70   RVPLAEVVLDCTKRWFQDTLKEARAGDAAMQVLVGQMYRSGYGVNKNEHKG  120



>gb|EMS50296.1| hypothetical protein TRIUR3_29514 [Triticum urartu]
Length=328

 Score = 90.1 bits (222),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +1

Query  334  QRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKG  498
            Q   R+PLAEVV DC +RWFQDTLKEA+AGD +MQVLVGQMY SGYGV+++  KG
Sbjct  225  QEDDRVPLAEVVLDCTKRWFQDTLKEARAGDAAMQVLVGQMYRSGYGVNKNEHKG  279



>dbj|BAK02754.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=139

 Score = 86.3 bits (212),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 37/50 (74%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +1

Query  346  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQK  495
            R+PLAEVV DC +RWFQDTLKEA+AGD +MQVLVGQMY SGYGV+++  K
Sbjct  68   RVPLAEVVLDCTKRWFQDTLKEARAGDAAMQVLVGQMYRSGYGVNKNEHK  117



>ref|XP_010517140.1| PREDICTED: uncharacterized protein LOC104792648 isoform X2 [Camelina 
sativa]
Length=127

 Score = 84.7 bits (208),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 34/51 (67%), Positives = 47/51 (92%), Gaps = 0/51 (0%)
 Frame = +1

Query  343  RRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQK  495
            R +PL+ VV+DC +RWF+DTL+EAKAG+I+MQV++GQMY+SGYGV +DA+K
Sbjct  59   RFVPLSTVVSDCAKRWFKDTLEEAKAGNITMQVVLGQMYYSGYGVPKDAKK  109



>ref|NP_001143861.1| uncharacterized protein LOC100276657 [Zea mays]
 gb|ACG36065.1| hypothetical protein [Zea mays]
Length=134

 Score = 85.1 bits (209),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 49/76 (64%), Positives = 58/76 (76%), Gaps = 0/76 (0%)
 Frame = +1

Query  346  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisrasr  525
            R PLAEVV DCV+RWFQD  KEA+ GD++ QVLV QM+FSGYG  ++  KGK W+ R SR
Sbjct  14   RKPLAEVVGDCVQRWFQDAYKEARKGDVANQVLVAQMFFSGYGTPKNEYKGKQWMDRVSR  73

Query  526  trssawrVSDKRPGYN  573
             RSSA +V  KRPGYN
Sbjct  74   FRSSALKVGMKRPGYN  89



>ref|XP_010529921.1| PREDICTED: uncharacterized protein LOC104806634 [Tarenaya hassleriana]
Length=175

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 49/69 (71%), Positives = 58/69 (84%), Gaps = 0/69 (0%)
 Frame = +1

Query  388  WFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisrasrtrssawrVSDKRPG  567
            WF++TL+EAKAGD  MQVLVGQMY+SGYGV RD +KG+ WIS+AS+ RSS W V DK PG
Sbjct  107  WFKETLQEAKAGDTGMQVLVGQMYYSGYGVPRDDRKGRLWISKASKIRSSVWSVRDKHPG  166

Query  568  YNVSDSDSD  594
            YN SDSDS+
Sbjct  167  YNASDSDSE  175



>ref|NP_001142513.1| hypothetical protein [Zea mays]
 gb|ACG24563.1| hypothetical protein [Zea mays]
Length=105

 Score = 83.2 bits (204),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 50/76 (66%), Positives = 59/76 (78%), Gaps = 0/76 (0%)
 Frame = +1

Query  346  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisrasr  525
            R PL+EVV DCV+RWFQD  KEA+ GDI+ QVLV QM+FSGYG  ++  KGK W+ RASR
Sbjct  14   RKPLSEVVGDCVQRWFQDAYKEARKGDIANQVLVAQMFFSGYGTPKNEYKGKQWMDRASR  73

Query  526  trssawrVSDKRPGYN  573
             RSSA +V  KRPGYN
Sbjct  74   FRSSALKVGMKRPGYN  89



>ref|XP_008647657.1| PREDICTED: uncharacterized protein LOC100276657 isoform X1 [Zea 
mays]
 ref|XP_008647658.1| PREDICTED: uncharacterized protein LOC100276657 isoform X1 [Zea 
mays]
 gb|AFW77783.1| hypothetical protein ZEAMMB73_141974 [Zea mays]
 gb|AFW77784.1| hypothetical protein ZEAMMB73_141974 [Zea mays]
Length=104

 Score = 82.8 bits (203),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 50/76 (66%), Positives = 59/76 (78%), Gaps = 0/76 (0%)
 Frame = +1

Query  346  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisrasr  525
            R PLAEVV DCV+RWFQD  KEA+ GD++ QVLV QM+FSGYG  ++  KGK W+ RASR
Sbjct  14   RKPLAEVVGDCVQRWFQDAYKEARKGDVANQVLVAQMFFSGYGTPKNEYKGKQWMDRASR  73

Query  526  trssawrVSDKRPGYN  573
             RSSA +V  KRPGYN
Sbjct  74   FRSSALKVGMKRPGYN  89



>ref|XP_008654668.1| PREDICTED: uncharacterized protein LOC100274749 isoform X1 [Zea 
mays]
 ref|XP_008654669.1| PREDICTED: uncharacterized protein LOC100274749 isoform X1 [Zea 
mays]
 ref|XP_008654670.1| PREDICTED: uncharacterized protein LOC100274749 isoform X1 [Zea 
mays]
 gb|AFW82044.1| hypothetical protein ZEAMMB73_653152 [Zea mays]
 gb|AFW82045.1| hypothetical protein ZEAMMB73_653152 [Zea mays]
Length=105

 Score = 82.8 bits (203),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 50/76 (66%), Positives = 59/76 (78%), Gaps = 0/76 (0%)
 Frame = +1

Query  346  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisrasr  525
            R PL+EVV DCV+RWFQD  KEA+ GDI+ QVLV QM+FSGYG  ++  KGK W+ RASR
Sbjct  14   RKPLSEVVGDCVQRWFQDAYKEARKGDIANQVLVAQMFFSGYGTPKNEYKGKQWMDRASR  73

Query  526  trssawrVSDKRPGYN  573
             RSSA +V  KRPGYN
Sbjct  74   FRSSALKVGMKRPGYN  89



>ref|XP_002439596.1| hypothetical protein SORBIDRAFT_09g015880 [Sorghum bicolor]
 gb|EES18026.1| hypothetical protein SORBIDRAFT_09g015880 [Sorghum bicolor]
Length=104

 Score = 82.4 bits (202),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 51/76 (67%), Positives = 59/76 (78%), Gaps = 0/76 (0%)
 Frame = +1

Query  346  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisrasr  525
            R PL+EVV DCV+RWFQD  KEA+ GDI+ QVLV QM+FSGYG  ++  KGK W+ RASR
Sbjct  14   RRPLSEVVGDCVQRWFQDAYKEARKGDIANQVLVAQMFFSGYGTPKNEYKGKQWMDRASR  73

Query  526  trssawrVSDKRPGYN  573
             RSSA RV  KRPGYN
Sbjct  74   FRSSALRVGMKRPGYN  89



>gb|ACG31011.1| hypothetical protein [Zea mays]
Length=105

 Score = 81.3 bits (199),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 48/75 (64%), Positives = 57/75 (76%), Gaps = 0/75 (0%)
 Frame = +1

Query  346  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisrasr  525
            R PL+EVV DCV+RWFQD  KEA+ GDI+ QVLV QM+FSGYG  ++  KG  W+ RASR
Sbjct  14   RKPLSEVVGDCVQRWFQDAYKEARKGDIANQVLVAQMFFSGYGTPKNEYKGXQWMDRASR  73

Query  526  trssawrVSDKRPGY  570
             RSSA +V  KRPGY
Sbjct  74   FRSSALKVGMKRPGY  88



>ref|XP_009133258.1| PREDICTED: uncharacterized protein LOC103857784 isoform X2 [Brassica 
rapa]
Length=130

 Score = 81.6 bits (200),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +1

Query  349  IPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQK  495
            +PL+ VV+DC +RWF+DTL+EAKAG+I+MQV++GQMY SGYGV +DA+K
Sbjct  58   VPLSAVVSDCAKRWFEDTLEEAKAGNITMQVVLGQMYNSGYGVPKDARK  106



>emb|CBI25405.3| unnamed protein product [Vitis vinifera]
Length=61

 Score = 72.8 bits (177),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 48/61 (79%), Positives = 53/61 (87%), Gaps = 0/61 (0%)
 Frame = +1

Query  433  MQVLVGQMYFSGYGVSRDAQKGKawisrasrtrssawrVSDKRPGYNVSDSDSDDTAGEA  612
            MQVLVGQMYFSGYGVSRDAQKG+AWISRAS++RSSA +V DK PGYN SDSDSDD   + 
Sbjct  1    MQVLVGQMYFSGYGVSRDAQKGRAWISRASKSRSSALKVGDKHPGYNASDSDSDDLKNDE  60

Query  613  K  615
            K
Sbjct  61   K  61



>emb|CBI18085.3| unnamed protein product [Vitis vinifera]
Length=60

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +1

Query  433  MQVLVGQMYFSGYGVSRDAQKGKawisrasrtrssawrVSDKRPGYNVSDSDSDDTAGEA  612
            MQVLVGQMY+SGYGV RDAQKG+ W++RASRTRSS W+VSDK PGYN SDSDSD+  G++
Sbjct  1    MQVLVGQMYYSGYGVPRDAQKGRVWMTRASRTRSSVWKVSDKHPGYNASDSDSDELKGDS  60



>ref|XP_001778215.1| predicted protein [Physcomitrella patens]
 gb|EDQ56997.1| predicted protein [Physcomitrella patens]
Length=156

 Score = 69.7 bits (169),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = +1

Query  343  RRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQK  495
            + IPL EVV +C  RWF+ TLK AK+GDIS Q LVGQM+ SGYGV  + +K
Sbjct  22   KAIPLREVVANCEHRWFEQTLKAAKSGDISSQCLVGQMFCSGYGVPVNVKK  72



>ref|XP_002526705.1| hypothetical protein RCOM_0850070 [Ricinus communis]
 gb|EEF35727.1| hypothetical protein RCOM_0850070 [Ricinus communis]
Length=109

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +1

Query  439  VLVGQMYFSGYGVSRDAQKGKawisrasrtrssawrVSDKRPGYNVSDSDSDD  597
            VLVGQMY+SGYG+ RDAQKGK W++RAS+TRSS WRVSDK PGYN SDSDSD+
Sbjct  52   VLVGQMYYSGYGIPRDAQKGKIWMTRASKTRSSVWRVSDKHPGYNASDSDSDE  104



>ref|XP_005650064.1| hypothetical protein COCSUDRAFT_32673 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE25520.1| hypothetical protein COCSUDRAFT_32673 [Coccomyxa subellipsoidea 
C-169]
Length=116

 Score = 65.5 bits (158),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +1

Query  352  PLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGK  501
            PL  VV D VRRWFQ+T KEA  GD+  Q L+GQM   GYG  RD+  GK
Sbjct  47   PLTAVVHDAVRRWFQETHKEALRGDVKQQALLGQMLLEGYGCERDSAAGK  96



>ref|XP_001692982.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDP03551.1| predicted protein [Chlamydomonas reinhardtii]
Length=136

 Score = 65.9 bits (159),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = +1

Query  349  IPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGK  501
            IPL  VV + V+RWF+DTL EA+ GD+  Q LVG+MY  GYG  +DA+  K
Sbjct  66   IPLKYVVQEAVKRWFEDTLLEAQRGDVKQQALVGEMYKEGYGCQKDARAAK  116



>gb|EEE63318.1| hypothetical protein OsJ_18129 [Oryza sativa Japonica Group]
Length=84

 Score = 63.5 bits (153),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 45/90 (50%), Positives = 54/90 (60%), Gaps = 19/90 (21%)
 Frame = +1

Query  346  RIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGKawisrasr  525
            R PL+EVV DCV+RWFQD LKEA+ GD +MQ                   G+AW  +ASR
Sbjct  13   RKPLSEVVGDCVQRWFQDALKEARRGDSAMQ-------------------GRAWAEKASR  53

Query  526  trssawrVSDKRPGYNVSDSDSDDTAGEAK  615
             R S W+V  KRPGYN SDSDSD+   + K
Sbjct  54   YRPSVWKVGTKRPGYNASDSDSDEMNDDEK  83



>ref|XP_002950802.1| hypothetical protein VOLCADRAFT_120924 [Volvox carteri f. nagariensis]
 gb|EFJ48117.1| hypothetical protein VOLCADRAFT_120924 [Volvox carteri f. nagariensis]
Length=135

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = +1

Query  349  IPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGK  501
            IPL  VV + V+RWF+DTL EA+ GD+  Q L+G+MY  GYG  +D + GK
Sbjct  65   IPLKYVVQEAVKRWFEDTLLEAQRGDVKQQALLGEMYKEGYGCQKDVRAGK  115



>gb|KIY93418.1| hypothetical protein MNEG_14545 [Monoraphidium neglectum]
Length=90

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 33/57 (58%), Gaps = 9/57 (16%)
 Frame = +1

Query  349  IPLAEVV---------TDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQ  492
            +PL  VV         T  VRRWF+DTL EA+ GD+  Q LV QM+  GYG  RD Q
Sbjct  11   VPLKAVVQAAQRNRNATAQVRRWFEDTLVEAQRGDVKQQALVAQMFAEGYGCQRDLQ  67



>ref|XP_009590059.1| PREDICTED: uncharacterized protein LOC104087340, partial [Nicotiana 
tomentosiformis]
Length=57

 Score = 53.5 bits (127),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 27/39 (69%), Positives = 30/39 (77%), Gaps = 2/39 (5%)
 Frame = +1

Query  343  RRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMY  459
            RR  LAEVV +   RW +DTLKE KAGD +MQVLVGQMY
Sbjct  17   RRHSLAEVVGEW--RWCRDTLKETKAGDTTMQVLVGQMY  53



>gb|KIY94194.1| hypothetical protein MNEG_13768, partial [Monoraphidium neglectum]
Length=56

 Score = 50.8 bits (120),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = +1

Query  379  VRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRD  486
            VRRWF+DT  EA+ GD+  Q L+ QMY  GYG  RD
Sbjct  1    VRRWFEDTQIEAQRGDVKQQALLAQMYNEGYGTERD  36



>ref|XP_002505403.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO66661.1| predicted protein [Micromonas sp. RCC299]
Length=155

 Score = 52.4 bits (124),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 20/49 (41%), Positives = 33/49 (67%), Gaps = 0/49 (0%)
 Frame = +1

Query  355  LAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGK  501
            L +V+ D + RWF DTL+ AK GD +   L+ +M  +GYG ++DA++ +
Sbjct  85   LKDVMADAIERWFVDTLRNAKNGDANQAALLAEMLSTGYGCTKDAEEAR  133



>ref|XP_003059675.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH55627.1| predicted protein [Micromonas pusilla CCMP1545]
Length=158

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/49 (39%), Positives = 34/49 (69%), Gaps = 0/49 (0%)
 Frame = +1

Query  355  LAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGK  501
            L +V+ + + RWF DTL+ AK GD++   L+ +M  +GYG ++DA++ +
Sbjct  88   LKDVMANAIERWFIDTLRNAKNGDVNQAALLAEMLATGYGCNKDAEEAR  136



>ref|XP_005850343.1| hypothetical protein CHLNCDRAFT_142152 [Chlorella variabilis]
 gb|EFN58241.1| hypothetical protein CHLNCDRAFT_142152 [Chlorella variabilis]
Length=486

 Score = 53.9 bits (128),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/49 (49%), Positives = 30/49 (61%), Gaps = 0/49 (0%)
 Frame = +1

Query  355  LAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKGK  501
            L  VV D +RRW+ +T KEA  GD+  Q L+GQM   GYG   D  KG+
Sbjct  36   LGAVVADALRRWYLETEKEALRGDVKAQALLGQMLIEGYGCQADPVKGR  84



>ref|XP_002962942.1| hypothetical protein SELMODRAFT_404377 [Selaginella moellendorffii]
 gb|EFJ36405.1| hypothetical protein SELMODRAFT_404377 [Selaginella moellendorffii]
Length=833

 Score = 51.6 bits (122),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = +1

Query  334  QRLRRIPLAEVVTDCVRRWFQDTLKEAKAGDISMQVLVGQMYFSGYGVSRDAQKG  498
            + L + PL E+V    R+WF + L+ A AGD  MQ L+G+M+ +GYG   +  +G
Sbjct  3    ETLEKGPLREIVAQLTRQWFLEALELAMAGDRQMQQLIGKMFCTGYGCHANLSQG  57



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2227596869306