BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig11451

Length=1003
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|ADE42972.1|  putative 60S ribosomal protein L18a                     357   9e-121   Gardenia jasminoides
ref|XP_009799848.1|  PREDICTED: 60S ribosomal protein L18a              357   2e-120   Nicotiana sylvestris
ref|XP_004241806.1|  PREDICTED: 60S ribosomal protein L18a              357   2e-120   Solanum lycopersicum
emb|CDP06299.1|  unnamed protein product                                356   3e-120   Coffea canephora [robusta coffee]
ref|NP_001275107.1|  60S ribosomal protein L18a-like                    355   4e-120   Solanum tuberosum [potatoes]
ref|XP_009609142.1|  PREDICTED: 60S ribosomal protein L18a              355   6e-120   Nicotiana tomentosiformis
ref|XP_010324737.1|  PREDICTED: 60S ribosomal protein L18a-like         355   1e-119   Solanum lycopersicum
ref|XP_009598886.1|  PREDICTED: 60S ribosomal protein L18a-like         354   1e-119   Nicotiana tomentosiformis
ref|XP_006363066.1|  PREDICTED: 60S ribosomal protein L18a-like         354   1e-119   Solanum tuberosum [potatoes]
ref|XP_006387417.1|  60S ribosomal protein L18a-1                       354   2e-119   
ref|NP_001275252.1|  uncharacterized protein LOC102577837               353   2e-119   Solanum tuberosum [potatoes]
ref|XP_009782492.1|  PREDICTED: 60S ribosomal protein L18a-like         353   3e-119   Nicotiana sylvestris
ref|NP_001275234.1|  60S ribosomal protein L18a-like                    353   4e-119   Solanum tuberosum [potatoes]
ref|XP_011071121.1|  PREDICTED: 60S ribosomal protein L18a              353   4e-119   Sesamum indicum [beniseed]
gb|ABB29925.1|  unknown                                                 352   1e-118   Solanum tuberosum [potatoes]
ref|XP_006477944.1|  PREDICTED: 60S ribosomal protein L18a-like i...    353   1e-118   Citrus sinensis [apfelsine]
ref|XP_002528496.1|  60S ribosomal protein L18a, putative               352   1e-118   Ricinus communis
ref|XP_011096544.1|  PREDICTED: 60S ribosomal protein L18a-like         352   2e-118   Sesamum indicum [beniseed]
ref|XP_011009655.1|  PREDICTED: 60S ribosomal protein L18a-2            351   2e-118   Populus euphratica
ref|XP_007215058.1|  hypothetical protein PRUPE_ppa012231mg             351   2e-118   
gb|ABK92715.1|  unknown                                                 351   2e-118   Populus trichocarpa [western balsam poplar]
ref|XP_009406265.1|  PREDICTED: 60S ribosomal protein L18a              351   2e-118   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002317384.1|  60S ribosomal protein L18a-1                       351   3e-118   Populus trichocarpa [western balsam poplar]
ref|XP_004134633.1|  PREDICTED: 60S ribosomal protein L18a              350   5e-118   Cucumis sativus [cucumbers]
ref|XP_011659876.1|  PREDICTED: 60S ribosomal protein L18a              350   6e-118   Cucumis sativus [cucumbers]
ref|XP_006449674.1|  hypothetical protein CICLE_v10016900mg             350   7e-118   Citrus clementina [clementine]
gb|KHN38335.1|  60S ribosomal protein L18a                              349   1e-117   Glycine soja [wild soybean]
gb|KHG02356.1|  60S ribosomal L18a                                      349   1e-117   Gossypium arboreum [tree cotton]
ref|XP_009389413.1|  PREDICTED: 60S ribosomal protein L18a-like         350   1e-117   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDO51884.1|  hypothetical protein CISIN_1g030276mg                   349   1e-117   Citrus sinensis [apfelsine]
ref|XP_008444078.1|  PREDICTED: 60S ribosomal protein L18a              349   1e-117   Cucumis melo [Oriental melon]
ref|XP_010924380.1|  PREDICTED: 60S ribosomal protein L18a              349   1e-117   Elaeis guineensis
ref|XP_011002051.1|  PREDICTED: 60S ribosomal protein L18a-like         349   1e-117   Populus euphratica
ref|XP_008439644.1|  PREDICTED: 60S ribosomal protein L18a              349   2e-117   Cucumis melo [Oriental melon]
ref|XP_011074018.1|  PREDICTED: 60S ribosomal protein L18a-2-like       349   2e-117   Sesamum indicum [beniseed]
ref|XP_008798296.1|  PREDICTED: 60S ribosomal protein L18a              349   2e-117   Phoenix dactylifera
ref|XP_008811096.1|  PREDICTED: 60S ribosomal protein L18a              348   2e-117   Phoenix dactylifera
ref|XP_006442292.1|  hypothetical protein CICLE_v10022114mg             350   2e-117   Citrus clementina [clementine]
ref|XP_002300869.1|  60S ribosomal protein L18a-1                       348   3e-117   Populus trichocarpa [western balsam poplar]
ref|XP_010655647.1|  PREDICTED: 60S ribosomal protein L18a isofor...    348   4e-117   Vitis vinifera
ref|XP_010542333.1|  PREDICTED: 60S ribosomal protein L18a isofor...    348   4e-117   Tarenaya hassleriana [spider flower]
gb|KCW89756.1|  hypothetical protein EUGRSUZ_A02018                     349   4e-117   Eucalyptus grandis [rose gum]
gb|KHG16522.1|  60S ribosomal L18a                                      348   4e-117   Gossypium arboreum [tree cotton]
ref|XP_010918885.1|  PREDICTED: 60S ribosomal protein L18a-like         348   4e-117   
ref|XP_009394206.1|  PREDICTED: 60S ribosomal protein L18a-like         348   5e-117   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010053843.1|  PREDICTED: 60S ribosomal protein L18a              348   5e-117   
ref|XP_006437137.1|  hypothetical protein CICLE_v10032878mg             348   6e-117   
gb|KCW75929.1|  hypothetical protein EUGRSUZ_D00304                     350   7e-117   Eucalyptus grandis [rose gum]
ref|XP_008789456.1|  PREDICTED: 60S ribosomal protein L18a-2            347   7e-117   Phoenix dactylifera
ref|XP_010052071.1|  PREDICTED: 60S ribosomal protein L18a-like i...    347   8e-117   Eucalyptus grandis [rose gum]
gb|EYU36633.1|  hypothetical protein MIMGU_mgv1a014793mg                347   1e-116   Erythranthe guttata [common monkey flower]
ref|XP_002276260.1|  PREDICTED: 60S ribosomal protein L18a              347   1e-116   Vitis vinifera
ref|XP_007025105.1|  Ribosomal protein L18ae/LX family protein          347   1e-116   
gb|EYU33348.1|  hypothetical protein MIMGU_mgv1a014797mg                347   1e-116   Erythranthe guttata [common monkey flower]
ref|XP_010538246.1|  PREDICTED: 60S ribosomal protein L18a-like         347   1e-116   Tarenaya hassleriana [spider flower]
gb|KHG16962.1|  60S ribosomal L18a                                      347   1e-116   Gossypium arboreum [tree cotton]
gb|KHG29727.1|  60S ribosomal L18a                                      347   2e-116   Gossypium arboreum [tree cotton]
ref|XP_012072093.1|  PREDICTED: 60S ribosomal protein L18a isofor...    346   2e-116   Jatropha curcas
gb|KJB10614.1|  hypothetical protein B456_001G211400                    346   2e-116   Gossypium raimondii
ref|XP_009399317.1|  PREDICTED: 60S ribosomal protein L18a-like         346   3e-116   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002268750.1|  PREDICTED: 60S ribosomal protein L18a              345   3e-116   Vitis vinifera
gb|ABK94361.1|  unknown                                                 345   4e-116   Populus trichocarpa [western balsam poplar]
ref|XP_008796386.1|  PREDICTED: 60S ribosomal protein L18a-like         345   4e-116   Phoenix dactylifera
gb|KJB42782.1|  hypothetical protein B456_007G174800                    345   4e-116   Gossypium raimondii
ref|XP_007048983.1|  Ribosomal protein L18ae/LX family protein          345   6e-116   Theobroma cacao [chocolate]
ref|NP_001237207.1|  uncharacterized protein LOC100527007               344   1e-115   
gb|EYU43268.1|  hypothetical protein MIMGU_mgv1a013972mg                345   1e-115   Erythranthe guttata [common monkey flower]
gb|KJB57268.1|  hypothetical protein B456_009G155900                    343   2e-115   Gossypium raimondii
gb|KHG26670.1|  60S ribosomal L18a                                      343   2e-115   Gossypium arboreum [tree cotton]
ref|NP_001237679.1|  uncharacterized protein LOC100306365               343   3e-115   Glycine max [soybeans]
gb|KJB69800.1|  hypothetical protein B456_011G042900                    343   3e-115   Gossypium raimondii
ref|XP_010540563.1|  PREDICTED: 60S ribosomal protein L18a              343   4e-115   Tarenaya hassleriana [spider flower]
ref|NP_001238728.1|  uncharacterized protein LOC100306174               342   6e-115   Glycine max [soybeans]
ref|XP_010552158.1|  PREDICTED: 60S ribosomal protein L18a              342   7e-115   Tarenaya hassleriana [spider flower]
ref|XP_010263115.1|  PREDICTED: 60S ribosomal protein L18a-2            342   7e-115   Nelumbo nucifera [Indian lotus]
sp|Q9ATF5.1|RL18A_CASSA  RecName: Full=60S ribosomal protein L18a       342   7e-115   Castanea sativa
ref|XP_006410594.1|  hypothetical protein EUTSA_v10017304mg             342   8e-115   Eutrema salsugineum [saltwater cress]
emb|CDX97587.1|  BnaA05g24920D                                          342   1e-114   
ref|XP_009407842.1|  PREDICTED: 60S ribosomal protein L18a-like         342   1e-114   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004486036.1|  PREDICTED: 60S ribosomal protein L18a-like         342   1e-114   Cicer arietinum [garbanzo]
ref|XP_008380196.1|  PREDICTED: 60S ribosomal protein L18a-2-like       342   1e-114   Malus domestica [apple tree]
ref|XP_007212144.1|  hypothetical protein PRUPE_ppa012251mg             342   1e-114   Prunus persica
ref|NP_001236918.1|  uncharacterized protein LOC100500108               341   2e-114   Glycine max [soybeans]
gb|AFK44558.1|  unknown                                                 341   2e-114   Lotus japonicus
gb|KHG27228.1|  60S ribosomal L18a                                      341   2e-114   Gossypium arboreum [tree cotton]
gb|AFK40398.1|  unknown                                                 340   3e-114   Medicago truncatula
ref|XP_007136179.1|  hypothetical protein PHAVU_009G024800g             340   4e-114   Phaseolus vulgaris [French bean]
gb|AFK33651.1|  unknown                                                 340   5e-114   Lotus japonicus
ref|XP_008371596.1|  PREDICTED: 60S ribosomal protein L18a-2 isof...    340   7e-114   Malus domestica [apple tree]
ref|XP_007159262.1|  hypothetical protein PHAVU_002G223200g             339   1e-113   Phaseolus vulgaris [French bean]
emb|CDX75778.1|  BnaC03g38610D                                          342   1e-113   
ref|XP_007147889.1|  hypothetical protein PHAVU_006G163400g             339   2e-113   Phaseolus vulgaris [French bean]
emb|CDX79564.1|  BnaC03g19000D                                          338   2e-113   
gb|AFK46978.1|  unknown                                                 338   3e-113   Lotus japonicus
ref|XP_009146339.1|  PREDICTED: 60S ribosomal protein L18a-2            338   4e-113   Brassica rapa
ref|XP_006841639.1|  PREDICTED: 60S ribosomal protein L18a              338   4e-113   Amborella trichopoda
ref|XP_006407062.1|  hypothetical protein EUTSA_v10021546mg             338   4e-113   Eutrema salsugineum [saltwater cress]
ref|XP_009135390.1|  PREDICTED: 60S ribosomal protein L18a-2-like       337   6e-113   Brassica rapa
ref|XP_004488610.1|  PREDICTED: 60S ribosomal protein L18a-like i...    337   7e-113   Cicer arietinum [garbanzo]
ref|XP_009132991.1|  PREDICTED: 60S ribosomal protein L18a-2-like       337   9e-113   Brassica rapa
ref|XP_006595492.1|  PREDICTED: uncharacterized protein LOC100305...    355   2e-112   
ref|XP_006298665.1|  hypothetical protein CARUB_v10014756mg             336   2e-112   Capsella rubella
gb|KFK36339.1|  hypothetical protein AALP_AA4G109800                    336   2e-112   Arabis alpina [alpine rockcress]
ref|XP_008229704.1|  PREDICTED: uncharacterized protein LOC103329046    356   2e-112   Prunus mume [ume]
gb|KEH33554.1|  60S ribosomal protein L18a-3                            335   4e-112   Medicago truncatula
ref|XP_011085620.1|  PREDICTED: 60S ribosomal protein L18a-like         335   4e-112   
ref|XP_011628903.1|  PREDICTED: 60S ribosomal protein L18a              335   5e-112   Amborella trichopoda
ref|XP_006601742.1|  PREDICTED: uncharacterized protein LOC100306...    335   8e-112   
ref|XP_009141387.1|  PREDICTED: 60S ribosomal protein L18a-2            334   9e-112   Brassica rapa
ref|XP_006295085.1|  hypothetical protein CARUB_v10024156mg             334   9e-112   Capsella rubella
ref|XP_010465351.1|  PREDICTED: 60S ribosomal protein L18a-3            334   1e-111   Camelina sativa [gold-of-pleasure]
ref|XP_006467486.1|  PREDICTED: 60S ribosomal protein L18a-2-like...    339   1e-111   Citrus sinensis [apfelsine]
ref|XP_003597433.1|  60S ribosomal protein L18a                         334   1e-111   
ref|XP_008465452.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    353   2e-111   Cucumis melo [Oriental melon]
ref|XP_004488609.1|  PREDICTED: 60S ribosomal protein L18a-like i...    334   2e-111   
ref|XP_010542335.1|  PREDICTED: 60S ribosomal protein L18a-2 isof...    338   2e-111   Tarenaya hassleriana [spider flower]
ref|XP_002276545.1|  PREDICTED: 60S ribosomal protein L18a isofor...    337   3e-111   Vitis vinifera
ref|XP_006574359.1|  PREDICTED: uncharacterized protein LOC100527...    353   3e-111   
ref|NP_180995.1|  60S ribosomal protein L18a-2                          333   4e-111   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004303886.1|  PREDICTED: 60S ribosomal protein L18a-2 isof...    333   4e-111   Fragaria vesca subsp. vesca
gb|KFK44821.1|  hypothetical protein AALP_AA1G307200                    332   7e-111   Arabis alpina [alpine rockcress]
ref|XP_010504908.1|  PREDICTED: 60S ribosomal protein L18a-2            332   7e-111   Camelina sativa [gold-of-pleasure]
ref|XP_002519698.1|  60S ribosomal protein L18a, putative               336   1e-110   Ricinus communis
ref|XP_012072094.1|  PREDICTED: 60S ribosomal protein L18a isofor...    336   1e-110   Jatropha curcas
ref|XP_006407063.1|  hypothetical protein EUTSA_v10021546mg             332   2e-110   
ref|XP_010052072.1|  PREDICTED: 60S ribosomal protein L18a-2-like...    336   2e-110   Eucalyptus grandis [rose gum]
ref|XP_006484924.1|  PREDICTED: uncharacterized protein LOC102625748    351   3e-110   
ref|XP_009360876.1|  PREDICTED: 60S ribosomal protein L18a-2 isof...    335   4e-110   Pyrus x bretschneideri [bai li]
ref|XP_008371597.1|  PREDICTED: 60S ribosomal protein L18a-2 isof...    335   4e-110   Malus domestica [apple tree]
ref|XP_008225468.1|  PREDICTED: 60S ribosomal protein L18a isofor...    335   5e-110   
ref|XP_010499515.1|  PREDICTED: 60S ribosomal protein L18a-1            330   5e-110   Camelina sativa [gold-of-pleasure]
ref|XP_010501986.1|  PREDICTED: 60S ribosomal protein L18a-3-like       329   1e-109   Camelina sativa [gold-of-pleasure]
ref|XP_002440257.1|  hypothetical protein SORBIDRAFT_09g028590          329   1e-109   Sorghum bicolor [broomcorn]
ref|NP_188078.1|  60S ribosomal protein L18a-3                          329   1e-109   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001056335.1|  Os05g0565000                                       329   1e-109   
gb|EMS54441.1|  60S ribosomal protein L18a                              328   2e-109   Triticum urartu
ref|XP_002449311.1|  hypothetical protein SORBIDRAFT_05g007540          328   2e-109   Sorghum bicolor [broomcorn]
gb|ABK26330.1|  unknown                                                 328   3e-109   Picea sitchensis
ref|XP_004303885.2|  PREDICTED: 60S ribosomal protein L18a-2 isof...    328   4e-109   Fragaria vesca subsp. vesca
ref|XP_002882886.1|  60S ribosomal protein L18A                         328   4e-109   
ref|NP_001149475.1|  LOC100283101                                       327   6e-109   Zea mays [maize]
ref|XP_006654794.1|  PREDICTED: 60S ribosomal protein L18a-like         327   7e-109   Oryza brachyantha
gb|AAM65890.1|  putative 60S ribosomal protein L18A                     327   7e-109   Arabidopsis thaliana [mouse-ear cress]
gb|EMT07340.1|  60S ribosomal protein L18a                              327   8e-109   
ref|XP_010460775.1|  PREDICTED: 60S ribosomal protein L18a-1-like       327   8e-109   Camelina sativa [gold-of-pleasure]
gb|ACG30921.1|  60S ribosomal protein L18a                              327   9e-109   Zea mays [maize]
ref|NP_001148024.1|  60S ribosomal protein L18a                         327   9e-109   Zea mays [maize]
ref|XP_010679799.1|  PREDICTED: 60S ribosomal protein L18a-2            327   1e-108   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006644488.1|  PREDICTED: 60S ribosomal protein L18a-like         326   1e-108   Oryza brachyantha
ref|XP_004969468.1|  PREDICTED: 60S ribosomal protein L18a-like         326   1e-108   Setaria italica
ref|XP_004491319.1|  PREDICTED: LOW QUALITY PROTEIN: probable asp...    345   2e-108   
gb|ACF78859.1|  unknown                                                 326   2e-108   Zea mays [maize]
ref|NP_001043805.2|  Os01g0666900                                       326   2e-108   
ref|XP_003567891.1|  PREDICTED: 60S ribosomal protein L18a-like         326   2e-108   Brachypodium distachyon [annual false brome]
dbj|BAJ85943.1|  predicted protein                                      325   2e-108   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003617399.1|  60S ribosomal protein L18a                         344   3e-108   
gb|ACN28455.1|  unknown                                                 325   3e-108   Zea mays [maize]
gb|EMT24993.1|  60S ribosomal protein L18a                              325   3e-108   
ref|XP_006415527.1|  hypothetical protein EUTSA_v10009933mg             330   4e-108   
ref|NP_001152227.1|  60S ribosomal protein L18a                         325   6e-108   Zea mays [maize]
ref|XP_004979031.1|  PREDICTED: 60S ribosomal protein L18a-like         325   7e-108   Setaria italica
ref|NP_001044264.1|  Os01g0752300                                       324   8e-108   
ref|XP_009109630.1|  PREDICTED: 60S ribosomal protein L18a-2            325   9e-108   Brassica rapa
ref|XP_003569521.1|  PREDICTED: 60S ribosomal protein L18a-like         324   1e-107   Brachypodium distachyon [annual false brome]
ref|XP_010940708.1|  PREDICTED: 60S ribosomal protein L18a-2-like       323   1e-107   Elaeis guineensis
emb|CDY35269.1|  BnaC03g59540D                                          323   3e-107   Brassica napus [oilseed rape]
ref|XP_010936051.1|  PREDICTED: 60S ribosomal protein L18a-2            323   4e-107   Elaeis guineensis
ref|XP_006306031.1|  hypothetical protein CARUB_v10011327mg             328   4e-107   
ref|NP_849729.1|  ribosomal protein L18ae/LX family protein             322   6e-107   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010666370.1|  PREDICTED: 60S ribosomal protein L18a-like         318   1e-105   Beta vulgaris subsp. vulgaris [field beet]
gb|ACG47612.1|  60S ribosomal protein L18a                              318   2e-105   Zea mays [maize]
ref|NP_001152434.1|  LOC100286074                                       317   4e-105   
ref|XP_003569823.1|  PREDICTED: 60S ribosomal protein L18a              315   3e-104   Brachypodium distachyon [annual false brome]
ref|XP_002893593.1|  60S ribosomal protein L18A-1                       319   8e-104   
ref|XP_004961208.1|  PREDICTED: 60S ribosomal protein L18a-like         320   8e-104   
ref|XP_010549484.1|  PREDICTED: 60S ribosomal protein L18a-2 isof...    319   1e-103   Tarenaya hassleriana [spider flower]
ref|NP_001077626.1|  60S ribosomal protein L18a-1                       317   6e-103   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001762693.1|  predicted protein                                  311   8e-103   
ref|XP_001765218.1|  predicted protein                                  310   2e-102   
gb|EEE55145.1|  hypothetical protein OsJ_02939                          311   2e-102   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009419339.1|  PREDICTED: 60S ribosomal protein L18a-like         310   3e-102   
dbj|BAB90499.1|  ribosomal protein L18a-like                            310   6e-102   Oryza sativa Japonica Group [Japonica rice]
ref|XP_001752605.1|  predicted protein                                  309   8e-102   
ref|XP_001760636.1|  predicted protein                                  306   9e-101   
pdb|3IZS|S  Chain S, Localization Of The Large Subunit Ribosomal ...    305   1e-100   Saccharomyces cerevisiae [brewer's yeast]
gb|AAG52055.1|AC022455_9  60S ribosomal protein L18A, putative; 2...    309   1e-99    Arabidopsis thaliana [mouse-ear cress]
gb|ADU56180.1|  hypothetical protein                                    300   1e-98    Jatropha curcas
ref|XP_011460183.1|  PREDICTED: 60S ribosomal protein L18a              301   2e-98    Fragaria vesca subsp. vesca
ref|XP_006387416.1|  hypothetical protein POPTR_1064s00200g             297   1e-97    
ref|XP_002961150.1|  hypothetical protein SELMODRAFT_227198             298   1e-97    Selaginella moellendorffii
gb|AAT08714.1|  ribosomal protein L18A                                  296   8e-97    Hyacinthus orientalis [common hyacinth]
gb|KJB34967.1|  hypothetical protein B456_006G092900                    294   2e-96    Gossypium raimondii
emb|CDX98480.1|  BnaC05g38950D                                          294   3e-96    
gb|KJB10615.1|  hypothetical protein B456_001G211400                    293   3e-96    Gossypium raimondii
ref|NP_001237792.1|  uncharacterized protein LOC100305604               293   7e-96    
gb|EYU33347.1|  hypothetical protein MIMGU_mgv1a014797mg                292   2e-95    Erythranthe guttata [common monkey flower]
emb|CDX82474.1|  BnaA03g33470D                                          292   2e-95    
emb|CDX84313.1|  BnaC04g10750D                                          290   6e-95    
emb|CDX84643.1|  BnaA03g15870D                                          290   7e-95    
emb|CDY43672.1|  BnaA04g20190D                                          289   2e-94    Brassica napus [oilseed rape]
ref|XP_007146225.1|  hypothetical protein PHAVU_006G022700g             288   4e-94    Phaseolus vulgaris [French bean]
ref|XP_005652280.1|  60S ribosomal protein L18a-2                       279   3e-90    Coccomyxa subellipsoidea C-169
dbj|BAH20340.1|  AT3G14600                                              278   4e-90    Arabidopsis thaliana [mouse-ear cress]
ref|XP_005848088.1|  hypothetical protein CHLNCDRAFT_30965              276   5e-89    Chlorella variabilis
gb|KCW89757.1|  hypothetical protein EUGRSUZ_A02018                     265   2e-84    Eucalyptus grandis [rose gum]
gb|KJB69797.1|  hypothetical protein B456_011G042800                    260   3e-83    Gossypium raimondii
gb|KIZ01204.1|  60S ribosomal protein L18a-2                            261   3e-83    Monoraphidium neglectum
gb|ERM96192.1|  hypothetical protein AMTR_s00001p00102800               255   3e-81    Amborella trichopoda
ref|XP_011401286.1|  60S ribosomal protein L18a-2                       255   1e-80    Auxenochlorella protothecoides
ref|XP_001689743.1|  ribosomal protein L18a, component of cytosol...    254   2e-80    Chlamydomonas reinhardtii
ref|XP_002948508.1|  ribosomal protein L18A component of cytosoli...    252   2e-79    Volvox carteri f. nagariensis
gb|KDD75676.1|  ribosomal protein L18ae/LX                              251   5e-79    Helicosporidium sp. ATCC 50920
ref|XP_003617398.1|  60S ribosomal protein L18a                         249   1e-78    
ref|XP_006387717.1|  hypothetical protein POPTR_0647s00210g             248   2e-78    
ref|XP_007508296.1|  unknown                                            228   9e-70    Bathycoccus prasinos
ref|XP_001418811.1|  Ribosomal protein L18a, component of cytosol...    226   2e-69    Ostreococcus lucimarinus CCE9901
ref|XP_006384076.1|  60S ribosomal protein L18a-1                       224   2e-69    
gb|KDO49364.1|  hypothetical protein CISIN_1g028910mg                   224   3e-69    Citrus sinensis [apfelsine]
ref|XP_011648501.1|  PREDICTED: 60S ribosomal protein L18a-2-like       221   4e-68    Cucumis sativus [cucumbers]
ref|XP_008880083.1|  hypothetical protein H310_14105                    221   2e-67    Aphanomyces invadans
emb|CEF98555.1|  Ribosomal protein L18ae                                221   2e-67    Ostreococcus tauri
gb|ADV03035.1|  ribosomal protein L18A                                  220   7e-67    Karlodinium veneficum
emb|CBI30857.3|  unnamed protein product                                216   4e-66    Vitis vinifera
ref|XP_009831602.1|  hypothetical protein H257_07690                    216   1e-65    Aphanomyces astaci
ref|XP_008604133.1|  50S ribosomal protein L18Ae                        215   4e-65    Saprolegnia diclina VS20
gb|AFW81143.1|  hypothetical protein ZEAMMB73_376835                    213   6e-65    
gb|ABQ42114.1|  60S ribosomal protein L18a                              212   7e-65    Sonneratia caseolaris
gb|ABQ42113.1|  60S ribosomal protein L18a                              211   2e-64    Sonneratia alba
ref|XP_009144150.1|  PREDICTED: 60S ribosomal protein L18a-2-like       211   3e-64    
ref|XP_003062312.1|  predicted protein                                  213   3e-64    Micromonas pusilla CCMP1545
gb|EMS66554.1|  60S ribosomal protein L18a                              209   3e-63    Triticum urartu
ref|XP_002501229.1|  predicted protein                                  207   5e-62    Micromonas commoda
emb|CBN79653.1|  ribosomal protein L18                                  207   2e-61    Ectocarpus siliculosus
gb|ACN30573.1|  unknown                                                 203   3e-61    Zea mays [maize]
ref|XP_005702735.1|  60S ribosomal protein L18Ae                        205   4e-61    Galdieria sulphuraria
gb|ADV03042.1|  ribosomal protein L18A                                  203   3e-60    Amphidinium carterae
gb|ACS68696.1|  60S RPL18aB                                             199   8e-60    Sonneratia alba
ref|XP_637982.2|  S60 ribosomal protein L18a                            199   3e-59    Dictyostelium discoideum AX4
gb|KHN49096.1|  60S ribosomal protein L18a-2                            197   3e-59    Glycine soja [wild soybean]
gb|KFH68950.1|  60S ribosomal protein L20                               198   2e-58    Mortierella verticillata NRRL 6337
gb|KFM72761.1|  60S ribosomal protein L18a                              196   4e-58    Stegodyphus mimosarum
gb|ELK19170.1|  60S ribosomal protein L18a                              197   1e-57    Pteropus alecto
gb|EPZ32213.1|  60S ribosomal protein L20-B                             195   2e-57    Rozella allomycis CSF55
dbj|GAM28311.1|  hypothetical protein SAMD00019534_114870               195   2e-57    Acytostelium subglobosum LB1
gb|ELK32292.1|  60S ribosomal protein L18a                              196   2e-57    Myotis davidii
ref|XP_006633700.1|  PREDICTED: 60S ribosomal protein L18a-like         195   3e-57    Lepisosteus oculatus
ref|XP_002108947.1|  expressed hypothetical protein                     195   3e-57    Trichoplax adhaerens
ref|XP_001362363.1|  PREDICTED: 60S ribosomal protein L18a              195   3e-57    Monodelphis domestica
gb|ACO51977.1|  60S ribosomal protein L18a                              194   4e-57    Rana catesbeiana [bullfrog]
gb|KFH68928.1|  large subunit ribosomal protein L18Ae                   197   4e-57    Mortierella verticillata NRRL 6337
ref|XP_009521845.1|  hypothetical protein PHYSODRAFT_354168             194   5e-57    Phytophthora sojae
ref|XP_011653978.1|  PREDICTED: 60S ribosomal protein L18a-like         191   5e-57    Cucumis sativus [cucumbers]
ref|XP_004616713.1|  PREDICTED: 60S ribosomal protein L18a              194   6e-57    Sorex araneus [Eurasian shrew]
ref|XP_003292885.1|  ribosomal protein L18a                             194   6e-57    Dictyostelium purpureum
gb|EHH59357.1|  hypothetical protein EGM_09444                          194   7e-57    Macaca fascicularis [crab eating macaque]
ref|NP_001090206.1|  ribosomal protein L18a                             193   1e-56    Xenopus laevis [clawed frog]
gb|AAH42256.1|  RPL18A protein                                          193   1e-56    Xenopus laevis [clawed frog]
gb|AGE89254.1|  60S ribosomal protein L18a                              193   1e-56    Cryptocaryon irritans
ref|NP_001016690.1|  ribosomal protein L18a                             193   2e-56    Xenopus tropicalis [western clawed frog]
ref|XP_320252.4|  AGAP012284-PA                                         192   2e-56    Anopheles gambiae str. PEST
gb|KFB49813.1|  AGAP012284-PA-like protein                              192   2e-56    Anopheles sinensis
emb|CDY71447.1|  BnaAnng37490D                                          190   2e-56    Brassica napus [oilseed rape]
ref|XP_008897642.1|  hypothetical protein PPTG_05682                    192   3e-56    Phytophthora parasitica INRA-310
ref|XP_001652207.1|  AAEL006785-PB                                      192   3e-56    Aedes aegypti
ref|XP_005682245.1|  PREDICTED: 60S ribosomal protein L18a              192   4e-56    
ref|XP_005830017.1|  large subunit ribosomal protein L18Ae, cytop...    192   4e-56    Guillardia theta CCMP2712
ref|XP_004761042.1|  PREDICTED: 60S ribosomal protein L18a isofor...    193   4e-56    
ref|XP_007433473.1|  PREDICTED: 60S ribosomal protein L18a-like         192   4e-56    Python bivittatus
gb|ACO51820.1|  60S ribosomal protein L18a                              192   5e-56    Rana catesbeiana [bullfrog]
sp|Q8WQI7.1|RL18A_SPOFR  RecName: Full=60S ribosomal protein L18a       191   5e-56    Spodoptera frugiperda
ref|XP_003413070.1|  PREDICTED: 60S ribosomal protein L18a              191   5e-56    Loxodonta africana [African bush elephant]
ref|XP_005370652.1|  PREDICTED: 60S ribosomal protein L18a              191   5e-56    Microtus ochrogaster [prairie voles]
ref|XP_005654963.1|  PREDICTED: 60S ribosomal protein L18a isofor...    192   5e-56    
ref|XP_005988719.1|  PREDICTED: 60S ribosomal protein L18a-like i...    191   6e-56    Latimeria chalumnae
ref|XP_002897608.1|  60S ribosomal protein L18a                         191   6e-56    Phytophthora infestans T30-4
ref|NP_957354.1|  60S ribosomal protein L18a                            191   7e-56    Danio rerio [leopard danio]
ref|XP_416064.3|  PREDICTED: 60S ribosomal protein L18a                 192   7e-56    
ref|XP_003465225.2|  PREDICTED: 60S ribosomal protein L18a              191   7e-56    Cavia porcellus [guinea pig]
ref|XP_006898371.1|  PREDICTED: 60S ribosomal protein L18a-like         192   7e-56    Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_002783609.1|  60S ribosomal protein L18A-2, putative             191   8e-56    
ref|XP_002808227.1|  PREDICTED: LOW QUALITY PROTEIN: 60S ribosoma...    191   8e-56    
ref|XP_006035334.1|  PREDICTED: 60S ribosomal protein L18a-like         191   8e-56    
gb|AAV90708.1|  60S ribosomal protein L18a                              191   8e-56    
ref|XP_006876351.1|  PREDICTED: 60S ribosomal protein L18a              191   9e-56    
ref|XP_005604175.1|  PREDICTED: 60S ribosomal protein L18a              193   9e-56    
ref|NP_001037219.1|  ribosomal protein L18A                             191   9e-56    
dbj|BAG34717.1|  unnamed protein product                                191   9e-56    
gb|AGH70166.1|  60S ribosomal protein L18a                              191   1e-55    
dbj|BAD96367.1|  ribosomal protein L18a variant                         191   1e-55    
ref|XP_533877.1|  PREDICTED: 60S ribosomal protein L18a isoform 1       191   1e-55    
ref|XP_005409607.1|  PREDICTED: 60S ribosomal protein L18a              191   1e-55    
ref|NP_000971.1|  60S ribosomal protein L18a                            191   1e-55    
ref|XP_005303239.1|  PREDICTED: 60S ribosomal protein L18a              191   1e-55    
gb|KFV71518.1|  60S ribosomal protein L18a                              190   1e-55    
gb|ELR54862.1|  60S ribosomal protein L18a                              190   1e-55    
ref|XP_005588457.1|  PREDICTED: 60S ribosomal protein L18a isofor...    191   1e-55    
ref|XP_006890332.1|  PREDICTED: 60S ribosomal protein L18a-like         190   1e-55    
ref|NP_997675.1|  60S ribosomal protein L18a                            190   1e-55    
gb|EDL28886.1|  mCG14783, isoform CRA_b                                 190   2e-55    
ref|NP_001291810.1|  ribosomal protein L18a                             190   2e-55    
ref|XP_006894400.1|  PREDICTED: 60S ribosomal protein L18a-like         190   2e-55    
ref|XP_008822798.1|  PREDICTED: 60S ribosomal protein L18a isofor...    191   2e-55    
ref|XP_005499868.1|  PREDICTED: 60S ribosomal protein L18a-like         190   2e-55    
gb|EFB19107.1|  hypothetical protein PANDA_000535                       190   2e-55    
gb|EDL28885.1|  mCG14783, isoform CRA_a                                 191   2e-55    
ref|XP_006887480.1|  PREDICTED: 60S ribosomal protein L18a-like         190   2e-55    
gb|AEL28892.1|  ribosomal protein L18A                                  190   2e-55    
ref|XP_004423023.1|  PREDICTED: 60S ribosomal protein L18a              190   2e-55    
ref|XP_011949759.1|  PREDICTED: 60S ribosomal protein L18a isofor...    190   2e-55    
gb|KFP08674.1|  60S ribosomal protein L18a                              189   2e-55    
gb|EMC81423.1|  60S ribosomal protein L18a                              189   2e-55    
gb|AAI61335.1|  LOC549444 protein                                       189   2e-55    
ref|XP_005444139.1|  PREDICTED: 60S ribosomal protein L18a-like         191   3e-55    
gb|KFV06361.1|  60S ribosomal protein L18a                              189   3e-55    
ref|XP_007116964.1|  PREDICTED: 60S ribosomal protein L18a              189   3e-55    
ref|XP_005972333.1|  PREDICTED: 60S ribosomal protein L18a              189   3e-55    
gb|KFP71409.1|  60S ribosomal protein L18a                              189   4e-55    
gb|ADT80712.1|  ribosomal protein L18A                                  189   4e-55    
gb|KFV79623.1|  60S ribosomal protein L18a                              189   4e-55    
ref|XP_004277609.1|  PREDICTED: 60S ribosomal protein L18a              189   4e-55    
gb|EHH29801.1|  hypothetical protein EGK_10314                          189   4e-55    
gb|AAR09828.1|  similar to Drosophila melanogaster RpL18A               189   5e-55    
ref|XP_003123559.3|  PREDICTED: 60S ribosomal protein L18a isoformX1    191   5e-55    
ref|XP_002187596.1|  PREDICTED: 60S ribosomal protein L18a-like i...    189   5e-55    
ref|XP_005148123.1|  PREDICTED: LOW QUALITY PROTEIN: 60S ribosoma...    189   5e-55    
ref|NP_523774.1|  ribosomal protein L18A                                189   5e-55    
gb|KFO58423.1|  60S ribosomal protein L18a                              189   5e-55    
gb|ADX97197.1|  60S ribosomal protein l18a                              189   5e-55    
ref|XP_001960744.1|  GF13512                                            189   5e-55    
ref|XP_008950341.1|  PREDICTED: 60S ribosomal protein L18a-like         189   5e-55    
gb|KFM08760.1|  60S ribosomal protein L18a                              189   6e-55    
ref|XP_005480619.1|  PREDICTED: 60S ribosomal protein L18a-like         189   6e-55    
ref|XP_011845447.1|  PREDICTED: 60S ribosomal protein L18a isofor...    191   7e-55    
ref|XP_006886772.1|  PREDICTED: 60S ribosomal protein L18a-like         189   7e-55    
ref|XP_007636083.1|  PREDICTED: 60S ribosomal protein L18a isofor...    188   7e-55    
ref|XP_006886145.1|  PREDICTED: 60S ribosomal protein L18a-like         188   8e-55    
dbj|BAE40206.1|  unnamed protein product                                188   9e-55    
ref|XP_003898411.1|  PREDICTED: 60S ribosomal protein L18a-like         188   9e-55    
ref|XP_002063423.1|  GK21403                                            188   9e-55    
ref|XP_004873387.1|  PREDICTED: 60S ribosomal protein L18a              188   9e-55    
ref|XP_007611098.1|  PREDICTED: 60S ribosomal protein L18a isofor...    188   9e-55    
gb|AFK10877.1|  60S ribosomal protein L18a-like protein                 188   9e-55    
gb|AFM89633.1|  60S ribosomal protein L18a-like protein                 188   9e-55    
gb|KFR06619.1|  60S ribosomal protein L18a                              188   1e-54    
gb|EFA83144.1|  S60 ribosomal protein L18a                              188   1e-54    
ref|XP_002006863.1|  GI21298                                            188   1e-54    
ref|XP_006889246.1|  PREDICTED: 60S ribosomal protein L18a-like         188   1e-54    
ref|XP_008109288.1|  PREDICTED: 60S ribosomal protein L18a              188   1e-54    
gb|EDL39919.1|  mCG14017                                                187   2e-54    
emb|CAF89492.1|  unnamed protein product                                187   2e-54    
gb|EAW97746.1|  hCG2015272                                              187   2e-54    
ref|XP_008508109.1|  PREDICTED: 60S ribosomal protein L18a isofor...    187   2e-54    
ref|XP_003976423.1|  PREDICTED: 60S ribosomal protein L18a              187   2e-54    
ref|NP_001279187.1|  ribosomal protein L18a                             187   2e-54    
emb|CAQ37750.1|  60S ribosomal protein L18a                             187   2e-54    
ref|XP_011203338.1|  PREDICTED: 60S ribosomal protein L18a              187   2e-54    
ref|XP_006882833.1|  PREDICTED: 60S ribosomal protein L18a-like         187   3e-54    
gb|ERE89015.1|  60S ribosomal protein L18a-like protein                 187   3e-54    
ref|XP_005174872.1|  PREDICTED: 60S ribosomal protein L18a              187   3e-54    
ref|XP_004087014.1|  PREDICTED: 60S ribosomal protein L18a              187   3e-54    
gb|AFM90776.1|  60S ribosomal protein L18a-like protein                 187   3e-54    
ref|XP_004384453.1|  PREDICTED: 60S ribosomal protein L18a              187   3e-54    
ref|XP_011177993.1|  PREDICTED: 60S ribosomal protein L18a              187   4e-54    
ref|XP_008313517.1|  PREDICTED: 60S ribosomal protein L18a              186   5e-54    
gb|AFM87509.1|  60S ribosomal protein L18a-like protein                 186   5e-54    
gb|AFK43985.1|  unknown                                                 186   6e-54    
ref|XP_004417384.1|  PREDICTED: 60S ribosomal protein L18a-like         186   6e-54    
gb|AFM87268.1|  60S ribosomal protein L18a-like protein                 186   6e-54    
ref|XP_004520736.1|  PREDICTED: 60S ribosomal protein L18a-like         186   6e-54    
emb|CBK25105.2|  unnamed protein product                                186   6e-54    
gb|AAP20183.1|  ribosomal protein L18a                                  186   6e-54    
dbj|BAC56406.1|  similar to ribosomal protein L18a                      185   6e-54    
ref|XP_005715079.1|  unnamed protein product                            186   7e-54    
dbj|BAN20250.1|  hypothetical protein                                   186   7e-54    
gb|EJY71843.1|  60S ribosomal protein L18a-1                            186   7e-54    
gb|ABR27953.1|  60S ribosomal protein L18a                              186   7e-54    
ref|XP_010896328.1|  PREDICTED: 60S ribosomal protein L18a              186   7e-54    
dbj|BAF98666.1|  ribosomal protein L18a                                 186   7e-54    
ref|XP_001360626.1|  GA19650                                            186   8e-54    
gb|ACY95363.1|  ribosomal protein L18A                                  186   8e-54    
ref|XP_007540776.1|  PREDICTED: 60S ribosomal protein L18a              186   8e-54    
emb|CDR97128.1|  60S ribosomal protein L18ae, putative                  186   9e-54    
ref|XP_003448789.1|  PREDICTED: 60S ribosomal protein L18a-like         186   9e-54    
ref|XP_002779521.1|  60S ribosomal protein L18A-2, putative             186   9e-54    
ref|NP_001187046.1|  60S ribosomal protein L18a                         186   9e-54    
gb|AFM87533.1|  60S ribosomal protein L18a-like protein                 186   9e-54    
ref|XP_005809747.1|  PREDICTED: 60S ribosomal protein L18a-like         186   1e-53    
ref|XP_006680278.1|  hypothetical protein BATDEDRAFT_17251              185   1e-53    
gb|AFM90945.1|  60S ribosomal protein L18a-like protein                 185   1e-53    
ref|XP_007235111.1|  PREDICTED: 60S ribosomal protein L18a-like         185   1e-53    
dbj|BAJ93879.1|  predicted protein                                      185   1e-53    
dbj|BAM17719.1|  ribosomal protein L18A                                 185   1e-53    
gb|AFM87145.1|  ribosomal protein L18a                                  185   1e-53    
ref|XP_004277364.1|  PREDICTED: 60S ribosomal protein L18a-like         185   2e-53    
gb|AFM87186.1|  60S ribosomal protein L18a-like protein                 185   2e-53    
ref|XP_005242188.1|  PREDICTED: uncharacterized protein LOC101921474    192   2e-53    
dbj|BAH28893.1|  ribosomal protein L18a                                 185   2e-53    
ref|NP_001284617.1|  60S ribosomal protein L18a                         184   3e-53    
gb|EHJ65723.1|  ribosomal protein L18A                                  184   3e-53    
ref|NP_001292407.1|  60S ribosomal protein L18a                         184   3e-53    
ref|XP_005097851.1|  PREDICTED: 60S ribosomal protein L18a-like         184   3e-53    
ref|XP_011349291.1|  PREDICTED: 60S ribosomal protein L18a-like         184   4e-53    
gb|AAX62413.1|  ribosomal protein L18a                                  184   4e-53    
gb|AAI67657.1|  Unknown (protein for IMAGE:7718161)                     184   4e-53    
ref|XP_003383990.1|  PREDICTED: 60S ribosomal protein L18a-like         184   4e-53    
gb|EZA47602.1|  60S ribosomal protein L18a                              184   4e-53    
ref|XP_011633071.1|  PREDICTED: 60S ribosomal protein L18a              184   4e-53    
ref|XP_003707868.1|  PREDICTED: 60S ribosomal protein L18a              184   5e-53    
ref|XP_003923253.1|  PREDICTED: 60S ribosomal protein L18a              184   6e-53    
gb|EGI58526.1|  60S ribosomal protein L18a                              183   7e-53    
ref|XP_011065620.1|  PREDICTED: 60S ribosomal protein L18a              183   7e-53    
gb|ETN61400.1|  hypothetical protein AND_006941                         189   7e-53    
ref|XP_001087364.1|  PREDICTED: 60S ribosomal protein L18a-like i...    183   8e-53    
ref|XP_009038926.1|  hypothetical protein AURANDRAFT_60205              183   8e-53    
ref|XP_628224.1|  60S ribosomal protein L18A                            184   8e-53    
ref|XP_011300735.1|  PREDICTED: 60S ribosomal protein L18a              183   8e-53    
gb|ABY28362.1|  ribosomal protein L18a                                  183   8e-53    
ref|XP_003393070.1|  PREDICTED: 60S ribosomal protein L18a-like         183   9e-53    
gb|ACI69714.1|  60S ribosomal protein L18a                              183   9e-53    
ref|XP_011336934.1|  PREDICTED: 60S ribosomal protein L18a-like         183   9e-53    
ref|XP_008213453.1|  PREDICTED: 60S ribosomal protein L18a-like i...    183   9e-53    
ref|XP_393322.1|  PREDICTED: 60S ribosomal protein L18a                 183   9e-53    
ref|XP_001985733.1|  GH20961                                            183   1e-52    
ref|XP_001614192.1|  60S ribosomal protein L18a                         183   1e-52    
ref|XP_004365311.1|  ribosomal protein L18ae                            182   1e-52    
gb|ABD98777.1|  putative ribosomal protein L18A                         183   1e-52    
emb|CCA22335.1|  60S ribosomal protein L18a putative                    196   1e-52    
gb|KIK92807.1|  hypothetical protein PAXRUDRAFT_13013                   182   1e-52    
ref|XP_001611594.1|  60S ribosomal  protein L18ae                       183   1e-52    
ref|XP_011265568.1|  PREDICTED: 60S ribosomal protein L18a-like         182   1e-52    
ref|XP_001607320.1|  PREDICTED: 60S ribosomal protein L18a-like         182   1e-52    
dbj|BAN65814.1|  60S ribosomal protein L18ae, putative                  183   1e-52    
emb|CCI45297.1|  unnamed protein product                                197   1e-52    
ref|XP_008815720.1|  50S ribosomal protein L18Ae                        183   1e-52    
gb|ACH70788.1|  ribosomal protein L18a                                  182   1e-52    
ref|XP_011770091.1|  PREDICTED: 60S ribosomal protein L18a-like         183   1e-52    
emb|CDQ92557.1|  unnamed protein product                                184   1e-52    
ref|XP_011156394.1|  PREDICTED: 60S ribosomal protein L18a              182   1e-52    
ref|XP_011142006.1|  PREDICTED: 60S ribosomal protein L18a-like         182   1e-52    
ref|XP_011876829.1|  PREDICTED: 60S ribosomal protein L18a              182   2e-52    
gb|EFZ20272.1|  hypothetical protein SINV_15860                         182   2e-52    
ref|XP_002599714.1|  hypothetical protein BRAFLDRAFT_116402             182   2e-52    
gb|KDR15731.1|  60S ribosomal protein L18a                              182   2e-52    
gb|KKA25011.1|  60S ribosomal protein L20                               182   2e-52    
ref|XP_011253777.1|  PREDICTED: 60S ribosomal protein L18a-like         182   2e-52    
gb|EAW72846.1|  hCG2040224                                              182   2e-52    
emb|CEG71682.1|  Putative 60S ribosomal protein L20                     182   2e-52    
ref|XP_007415007.1|  hypothetical protein MELLADRAFT_72927              182   2e-52    
gb|KIY70561.1|  60S ribosomal protein L18A                              182   2e-52    
ref|XP_004991000.1|  ribosomal protein L18a                             182   2e-52    
emb|CDI83837.1|  60S ribosomal protein L18a, putative                   182   2e-52    
gb|EUC60950.1|  60S ribosomal protein L20                               182   3e-52    
emb|CDH57447.1|  60s ribosomal protein l20                              182   3e-52    
ref|XP_004395636.1|  PREDICTED: 60S ribosomal protein L18a-like         182   3e-52    
gb|ABM55517.1|  putative ribosomal protein L18A                         182   3e-52    
ref|XP_008552298.1|  PREDICTED: 60S ribosomal protein L18a              182   3e-52    
emb|CDS14547.1|  Putative 60S ribosomal protein L20                     181   4e-52    
gb|AAN52374.1|  ribosomal protein L18a                                  181   4e-52    
emb|CDS03349.1|  Putative 60S ribosomal protein L20                     181   4e-52    
ref|XP_972907.1|  PREDICTED: 60S ribosomal protein L18a                 181   4e-52    
ref|XP_003697931.1|  PREDICTED: 60S ribosomal protein L18a-like         182   4e-52    
ref|XP_001245490.1|  60S ribosomal protein L20                          181   4e-52    
gb|KIJ91891.1|  hypothetical protein K443DRAFT_114419                   181   4e-52    
gb|ACN10349.1|  60S ribosomal protein L18a                              183   4e-52    
ref|XP_011494259.1|  PREDICTED: 60S ribosomal protein L18a              181   5e-52    
ref|XP_007874905.1|  hypothetical protein PNEG_02868                    181   6e-52    
ref|XP_004200777.1|  Piso0_003381                                       181   7e-52    
ref|XP_003145959.1|  60S ribosomal protein L18a                         181   8e-52    
gb|KJP86891.1|  hypothetical protein AK88_03505                         181   8e-52    
ref|XP_006899250.1|  PREDICTED: 60S ribosomal protein L18a-like         181   8e-52    
gb|KJA26912.1|  hypothetical protein HYPSUDRAFT_132230                  181   8e-52    
emb|CDO75758.1|  hypothetical protein BN946_scf184921.g34               181   8e-52    
ref|XP_001896063.1|  60S ribosomal protein L18a                         181   8e-52    
gb|EGU11460.1|  60S ribosomal protein L20A                              181   8e-52    
ref|XP_001882521.1|  60S ribosomal protein L20                          180   9e-52    
gb|ERS97659.1|  60S ribosomal protein L20                               181   9e-52    
gb|EJW80288.1|  ribosomal protein L18ae                                 181   9e-52    
gb|KIL64760.1|  hypothetical protein M378DRAFT_77817                    180   9e-52    
gb|ERG86859.1|  60s ribosomal protein l18a                              181   9e-52    
ref|XP_007313367.1|  hypothetical protein SERLADRAFT_456475             180   1e-51    
ref|XP_002365367.1|  60S ribosomal protein L18a, putative               181   1e-51    
gb|KHN84287.1|  60S ribosomal protein L18a                              180   1e-51    
ref|XP_005363729.1|  PREDICTED: 60S ribosomal protein L18a-like         182   1e-51    
gb|KDR72699.1|  hypothetical protein GALMADRAFT_142989                  180   1e-51    
emb|CAX71904.1|  putative ribosomal protein L18a                        180   2e-51    
gb|AAY66898.1|  ribosomal protein L18a                                  180   2e-51    
gb|KDQ60389.1|  hypothetical protein JAAARDRAFT_126134                  179   2e-51    
ref|XP_002142084.1|  60S ribosomal protein L18a                         180   2e-51    
sp|P0DJ18.1|RL18A_TETTH  RecName: Full=60S ribosomal protein L18a       180   2e-51    
ref|XP_006730525.1|  PREDICTED: 60S ribosomal protein L18a-like         179   2e-51    
ref|XP_003029116.1|  60S ribosomal protein L20                          179   2e-51    
gb|EAR97130.3|  60S ribosomal protein L18a                              180   2e-51    
emb|CDP99545.1|  Protein Bm13771, isoform b                             181   2e-51    
gb|EIF45355.1|  60s ribosomal protein l20                               181   2e-51    
ref|XP_001505898.2|  PREDICTED: 60S ribosomal protein L18a              179   2e-51    
ref|XP_001431742.1|  hypothetical protein                               180   2e-51    
gb|KIK23334.1|  hypothetical protein PISMIDRAFT_679451                  179   2e-51    
gb|ABZ04232.1|  ribosomal protein rpl18a                                179   3e-51    
gb|KIO01130.1|  hypothetical protein M404DRAFT_1003406                  179   3e-51    
ref|XP_001429686.1|  hypothetical protein                               180   3e-51    



>gb|ADE42972.1| putative 60S ribosomal protein L18a [Gardenia jasminoides]
Length=178

 Score =   357 bits (917),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 168/178 (94%), Positives = 175/178 (98%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            MV YRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVNYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR+
Sbjct  61   LAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRY  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
            HCIQIIKTAT+PAKLCKRESTKQFHNSKI+FPLVFKKVRPPSRKLKTTYKASRPN+F+
Sbjct  121  HCIQIIKTATVPAKLCKRESTKQFHNSKIRFPLVFKKVRPPSRKLKTTYKASRPNLFM  178



>ref|XP_009799848.1| PREDICTED: 60S ribosomal protein L18a [Nicotiana sylvestris]
Length=178

 Score =   357 bits (915),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 167/178 (94%), Positives = 176/178 (99%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            MV Y+FHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWY+LRKLKKVKKSNGQ+
Sbjct  1    MVNYKFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYYLRKLKKVKKSNGQM  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVRH
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRH  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
            HCIQIIKTATIPAKLCKRESTKQFH+SKIKFPLVFKKVRPPSRKLKTTYKA+RPN+F+
Sbjct  121  HCIQIIKTATIPAKLCKRESTKQFHDSKIKFPLVFKKVRPPSRKLKTTYKATRPNLFM  178



>ref|XP_004241806.1| PREDICTED: 60S ribosomal protein L18a [Solanum lycopersicum]
Length=178

 Score =   357 bits (915),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 167/178 (94%), Positives = 177/178 (99%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            MVT++FHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVTFKFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVRH
Sbjct  61   LAINEIFEKYPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRH  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
            HCIQIIKTATIPAKLCKRESTKQFH+SKIKFPLVFKKVRPPSRKLKTTYKA++PN+F+
Sbjct  121  HCIQIIKTATIPAKLCKRESTKQFHDSKIKFPLVFKKVRPPSRKLKTTYKATKPNLFM  178



>emb|CDP06299.1| unnamed protein product [Coffea canephora]
Length=178

 Score =   356 bits (913),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 167/178 (94%), Positives = 175/178 (98%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            MV YRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVNYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR+
Sbjct  61   LAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRY  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
            HCIQIIKTAT+PAKLCKRESTKQFHNSKI+FPLVFKKVRPPSRKLKTTYKAS+PN+F+
Sbjct  121  HCIQIIKTATVPAKLCKRESTKQFHNSKIRFPLVFKKVRPPSRKLKTTYKASKPNLFM  178



>ref|NP_001275107.1| 60S ribosomal protein L18a-like [Solanum tuberosum]
 gb|AFX66998.1| 60S ribosomal protein L18a [Solanum tuberosum]
Length=178

 Score =   355 bits (912),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 166/178 (93%), Positives = 177/178 (99%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            MVT++FHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVTFKFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVRH
Sbjct  61   LAINEIFEKYPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRH  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
            HCIQIIKTATIPAKLCKRESTKQFH+SKIKFPLVFKKVRPP+RKLKTTYKA++PN+F+
Sbjct  121  HCIQIIKTATIPAKLCKRESTKQFHDSKIKFPLVFKKVRPPTRKLKTTYKATKPNLFM  178



>ref|XP_009609142.1| PREDICTED: 60S ribosomal protein L18a [Nicotiana tomentosiformis]
 ref|XP_009627827.1| PREDICTED: 60S ribosomal protein L18a [Nicotiana tomentosiformis]
 ref|XP_009592293.1| PREDICTED: 60S ribosomal protein L18a [Nicotiana tomentosiformis]
 ref|XP_009757479.1| PREDICTED: 60S ribosomal protein L18a-like [Nicotiana sylvestris]
 ref|XP_009757480.1| PREDICTED: 60S ribosomal protein L18a-like [Nicotiana sylvestris]
Length=178

 Score =   355 bits (911),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 166/178 (93%), Positives = 176/178 (99%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            MVTY+FHQYQVVGRALP+E DEHPKIYRMKLWATNEVRAKSKFWY+LRKLKKVKKSNGQ+
Sbjct  1    MVTYKFHQYQVVGRALPTENDEHPKIYRMKLWATNEVRAKSKFWYYLRKLKKVKKSNGQM  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVRH
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRH  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
            HCIQIIKTATIPAKLCKRESTKQFH+SKIKFPLVFKKVRPPSRKLKTTYKA+RPN+F+
Sbjct  121  HCIQIIKTATIPAKLCKRESTKQFHDSKIKFPLVFKKVRPPSRKLKTTYKATRPNLFM  178



>ref|XP_010324737.1| PREDICTED: 60S ribosomal protein L18a-like [Solanum lycopersicum]
Length=178

 Score =   355 bits (910),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 166/178 (93%), Positives = 175/178 (98%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            MVTY+FHQYQVVGRALPSE DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVTYKFHQYQVVGRALPSENDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNG VEQMYTEMASRHRVRH
Sbjct  61   LAINEIFEKYPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGGVEQMYTEMASRHRVRH  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
            HCIQIIKTATIPAKLCKRESTKQFH+SKIKFPLVFKKVRPPSRKLKTTYKA++PN+F+
Sbjct  121  HCIQIIKTATIPAKLCKRESTKQFHDSKIKFPLVFKKVRPPSRKLKTTYKATKPNLFM  178



>ref|XP_009598886.1| PREDICTED: 60S ribosomal protein L18a-like [Nicotiana tomentosiformis]
Length=178

 Score =   354 bits (909),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 166/178 (93%), Positives = 175/178 (98%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            MV Y+FHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWY+LRKLKKVKKSNGQ+
Sbjct  1    MVNYKFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYYLRKLKKVKKSNGQM  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVRH
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRH  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
            HCIQIIK ATIPAKLCKRESTKQFH+SKIKFPLVFKKVRPPSRKLKTTYKA+RPN+F+
Sbjct  121  HCIQIIKIATIPAKLCKRESTKQFHDSKIKFPLVFKKVRPPSRKLKTTYKATRPNLFM  178



>ref|XP_006363066.1| PREDICTED: 60S ribosomal protein L18a-like [Solanum tuberosum]
Length=178

 Score =   354 bits (909),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 165/178 (93%), Positives = 176/178 (99%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            MV Y+FHQYQVVGRALPSE+DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVNYKFHQYQVVGRALPSESDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVRH
Sbjct  61   LAINEIFEKYPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRH  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
            HCIQIIKTATIPAKLCKRESTKQFH+SKIKFPLVFKK+RPPSRKLKTTYKA++PN+F+
Sbjct  121  HCIQIIKTATIPAKLCKRESTKQFHDSKIKFPLVFKKIRPPSRKLKTTYKATKPNLFM  178



>ref|XP_006387417.1| 60S ribosomal protein L18a-1 [Populus trichocarpa]
 ref|XP_011009656.1| PREDICTED: 60S ribosomal protein L18a [Populus euphratica]
 gb|ABK93213.1| unknown [Populus trichocarpa]
 gb|ABK94632.1| unknown [Populus trichocarpa]
 gb|ERP46331.1| 60S ribosomal protein L18a-1 [Populus trichocarpa]
Length=178

 Score =   354 bits (908),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 168/178 (94%), Positives = 175/178 (98%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            MVT+RFHQYQVVGRALP+E+DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVTFRFHQYQVVGRALPTESDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRF  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
             CIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPN+F+
Sbjct  121  PCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFM  178



>ref|NP_001275252.1| uncharacterized protein LOC102577837 [Solanum tuberosum]
 ref|XP_004233112.1| PREDICTED: 60S ribosomal protein L18a-2 [Solanum lycopersicum]
 ref|XP_010316931.1| PREDICTED: 60S ribosomal protein L18a-2 [Solanum lycopersicum]
 gb|ABA46783.1| unknown [Solanum tuberosum]
Length=178

 Score =   353 bits (907),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 165/178 (93%), Positives = 175/178 (98%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            MVTY+FHQYQVVGRALP+ETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVTYKFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNG VEQMYTEMASRHRVRH
Sbjct  61   LAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGGVEQMYTEMASRHRVRH  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
            HCIQIIKTATIPAKLCKRESTKQFH+SKIKFPLVFKKVRPPSRKLKTTYKA++PN+F+
Sbjct  121  HCIQIIKTATIPAKLCKRESTKQFHDSKIKFPLVFKKVRPPSRKLKTTYKATKPNLFM  178



>ref|XP_009782492.1| PREDICTED: 60S ribosomal protein L18a-like [Nicotiana sylvestris]
Length=178

 Score =   353 bits (907),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 165/178 (93%), Positives = 175/178 (98%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            MVTY+FHQYQVVGRALP+E DEHPKIYRMKLWATNEVRAKSKFWY+LRKLKKVKKSNGQ+
Sbjct  1    MVTYKFHQYQVVGRALPTENDEHPKIYRMKLWATNEVRAKSKFWYYLRKLKKVKKSNGQM  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNG VEQMYTEMASRHRVRH
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGGVEQMYTEMASRHRVRH  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
            HCIQIIKTATIPAKLCKRESTKQFH+SKIKFPLVFKKVRPPSRKLKTTYKA+RPN+F+
Sbjct  121  HCIQIIKTATIPAKLCKRESTKQFHDSKIKFPLVFKKVRPPSRKLKTTYKATRPNLFM  178



>ref|NP_001275234.1| 60S ribosomal protein L18a-like [Solanum tuberosum]
 gb|ABB29928.1| unknown [Solanum tuberosum]
Length=178

 Score =   353 bits (906),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 165/178 (93%), Positives = 175/178 (98%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            MVTY+FHQYQVVGRALPSE DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVTYKFHQYQVVGRALPSENDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNG VEQMYTEMASRHRVRH
Sbjct  61   LAINEIFEKYPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGGVEQMYTEMASRHRVRH  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
            HCIQIIKTATIPAKLCKRESTKQFH+SKIKFPLVFKKVRPP+RKLKTTYKA++PN+F+
Sbjct  121  HCIQIIKTATIPAKLCKRESTKQFHDSKIKFPLVFKKVRPPTRKLKTTYKATKPNLFM  178



>ref|XP_011071121.1| PREDICTED: 60S ribosomal protein L18a [Sesamum indicum]
Length=178

 Score =   353 bits (906),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 164/178 (92%), Positives = 175/178 (98%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            MVTY+FHQYQVVGR LP+ETDEHP+IYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVTYKFHQYQVVGRGLPTETDEHPRIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQI  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVRH
Sbjct  61   LAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRH  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
            HCIQIIKTATIPAKLCKRESTKQFH+SKIKFPLVF+KVRPP+RKLKTTYKASRPN+F+
Sbjct  121  HCIQIIKTATIPAKLCKRESTKQFHDSKIKFPLVFRKVRPPTRKLKTTYKASRPNLFM  178



>gb|ABB29925.1| unknown [Solanum tuberosum]
Length=178

 Score =   352 bits (903),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 165/178 (93%), Positives = 176/178 (99%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            MVT++FHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVTFKFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVRH
Sbjct  61   LAINEIFEKYPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRH  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
            HCIQIIKTATIPAKLCKRESTKQFH+SKIKFPLVFKKVRPP+RKLKTTY A++PN+F+
Sbjct  121  HCIQIIKTATIPAKLCKRESTKQFHDSKIKFPLVFKKVRPPTRKLKTTYWATKPNLFM  178



>ref|XP_006477944.1| PREDICTED: 60S ribosomal protein L18a-like isoform X1 [Citrus 
sinensis]
 gb|KDO49363.1| hypothetical protein CISIN_1g028910mg [Citrus sinensis]
Length=202

 Score =   353 bits (905),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 167/186 (90%), Positives = 177/186 (95%), Gaps = 0/186 (0%)
 Frame = +3

Query  192  EDGSVVAKMVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKK  371
            E   +  KMVT+RFHQYQVVGRALP+E DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKK
Sbjct  17   EPALLGGKMVTFRFHQYQVVGRALPTEKDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKK  76

Query  372  VKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEM  551
            VKKSNGQ+LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEM
Sbjct  77   VKKSNGQMLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEM  136

Query  552  ASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKAS  731
            ASRHRVR  CIQII+TATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPP+RKLKTTYKAS
Sbjct  137  ASRHRVRSPCIQIIRTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPTRKLKTTYKAS  196

Query  732  RPNIFV  749
            RPN+F+
Sbjct  197  RPNLFM  202



>ref|XP_002528496.1| 60S ribosomal protein L18a, putative [Ricinus communis]
 gb|EEF33913.1| 60S ribosomal protein L18a, putative [Ricinus communis]
Length=178

 Score =   352 bits (902),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 165/178 (93%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            MVT+RFHQYQVVGRALP+E D+HPKIYRMKLW+TNEVRAKSKFWYFLRKLKKVK+SNGQV
Sbjct  1    MVTFRFHQYQVVGRALPTENDDHPKIYRMKLWSTNEVRAKSKFWYFLRKLKKVKRSNGQV  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKSPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRF  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
             CIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPN+F+
Sbjct  121  SCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFM  178



>ref|XP_011096544.1| PREDICTED: 60S ribosomal protein L18a-like [Sesamum indicum]
Length=178

 Score =   352 bits (902),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 163/178 (92%), Positives = 176/178 (99%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            MVTY+FHQYQVVGRALP+ETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVTYKFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQI  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNG+VEQMYTEMASRHRVR+
Sbjct  61   LAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGSVEQMYTEMASRHRVRY  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
            HCIQIIKTATIPAKLCKRESTKQFH+SKIKFPLVF+KVRPP+RKLKTTYKA+RPN+F+
Sbjct  121  HCIQIIKTATIPAKLCKRESTKQFHDSKIKFPLVFRKVRPPTRKLKTTYKATRPNLFM  178



>ref|XP_011009655.1| PREDICTED: 60S ribosomal protein L18a-2 [Populus euphratica]
 ref|XP_011009657.1| PREDICTED: 60S ribosomal protein L18a-2 [Populus euphratica]
Length=178

 Score =   351 bits (901),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 167/178 (94%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            M T+RFHQYQVVGRALP+E+DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MGTFRFHQYQVVGRALPTESDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRF  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
             CIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPN+F+
Sbjct  121  PCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFM  178



>ref|XP_007215058.1| hypothetical protein PRUPE_ppa012231mg [Prunus persica]
 gb|EMJ16257.1| hypothetical protein PRUPE_ppa012231mg [Prunus persica]
Length=178

 Score =   351 bits (901),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 167/178 (94%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            MVT+RFHQYQVVGRALPSE DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVTFRFHQYQVVGRALPSEKDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVE MYTEMASRHRVR 
Sbjct  61   LAINEIFEKSPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEDMYTEMASRHRVRS  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
             CIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPP+RKLKTTYKA+RPNIFV
Sbjct  121  PCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPTRKLKTTYKATRPNIFV  178



>gb|ABK92715.1| unknown [Populus trichocarpa]
Length=178

 Score =   351 bits (901),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 167/178 (94%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            MVT+RFHQYQVVGRALP+ +DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVTFRFHQYQVVGRALPTGSDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRF  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
             CIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPN+F+
Sbjct  121  PCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFM  178



>ref|XP_009406265.1| PREDICTED: 60S ribosomal protein L18a [Musa acuminata subsp. 
malaccensis]
Length=178

 Score =   351 bits (901),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 165/178 (93%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            MV +RFHQYQVVGRALPS TDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVVFRFHQYQVVGRALPSATDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFE+ PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASRHRVR+
Sbjct  61   LAINEIFERKPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYNEMASRHRVRY  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
            HCIQIIKTATIP+KLCKRESTKQFH+SKIKFPLVFKKVRPPSRKLKTTYKASRPN+F+
Sbjct  121  HCIQIIKTATIPSKLCKRESTKQFHDSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFM  178



>ref|XP_002317384.1| 60S ribosomal protein L18a-1 [Populus trichocarpa]
 gb|ABK93710.1| unknown [Populus trichocarpa]
 gb|EEE97996.1| 60S ribosomal protein L18a-1 [Populus trichocarpa]
Length=178

 Score =   351 bits (900),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 166/178 (93%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            MVT+RFHQYQVVGRALP+++DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVTFRFHQYQVVGRALPTQSDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRF  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
             CIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPN+F+
Sbjct  121  PCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFM  178



>ref|XP_004134633.1| PREDICTED: 60S ribosomal protein L18a [Cucumis sativus]
 gb|KGN49388.1| hypothetical protein Csa_6G522810 [Cucumis sativus]
Length=178

 Score =   350 bits (898),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 165/178 (93%), Positives = 173/178 (97%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            MVT+RFHQYQVVGRALPSE DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVTFRFHQYQVVGRALPSEADEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVE MYTEMASRHRVRH
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEAMYTEMASRHRVRH  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
             CIQIIKTAT+PAKLCKRESTKQFH+SKIKFPLVFK VRPP+RKLKTTYKASRPN+F+
Sbjct  121  PCIQIIKTATVPAKLCKRESTKQFHDSKIKFPLVFKTVRPPTRKLKTTYKASRPNLFM  178



>ref|XP_011659876.1| PREDICTED: 60S ribosomal protein L18a [Cucumis sativus]
Length=178

 Score =   350 bits (898),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 165/178 (93%), Positives = 175/178 (98%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            MV++RFHQYQVVGRALPSE+DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVSFRFHQYQVVGRALPSESDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFEK PTKVKNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTKVKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRS  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
             CIQIIKTAT+PAKLCKRESTKQFH+SKIKFPLVFKKVRPP+RKLKTTYKAS+PN+F+
Sbjct  121  PCIQIIKTATVPAKLCKRESTKQFHDSKIKFPLVFKKVRPPTRKLKTTYKASKPNLFM  178



>ref|XP_006449674.1| hypothetical protein CICLE_v10016900mg [Citrus clementina]
 ref|XP_006467485.1| PREDICTED: 60S ribosomal protein L18a-2-like isoform X1 [Citrus 
sinensis]
 gb|ESR62914.1| hypothetical protein CICLE_v10016900mg [Citrus clementina]
 gb|KDO78150.1| hypothetical protein CISIN_1g035537mg [Citrus sinensis]
Length=178

 Score =   350 bits (897),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 164/178 (92%), Positives = 175/178 (98%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            MVT+RFHQYQVVGRALP+E+DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVTFRFHQYQVVGRALPTESDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRS  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
             CIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVF+KVRPPSRKL+TTYKA+RPN+F+
Sbjct  121  PCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFRKVRPPSRKLRTTYKATRPNLFM  178



>gb|KHN38335.1| 60S ribosomal protein L18a [Glycine soja]
Length=178

 Score =   349 bits (896),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 165/178 (93%), Positives = 173/178 (97%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            MV  RFHQYQVVGRALP+E+DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVAMRFHQYQVVGRALPTESDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFE+ PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVE MYTEMASRHRVRH
Sbjct  61   LAINEIFERNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEHMYTEMASRHRVRH  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
             CIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPP+RKLKTTYKASRPN+F+
Sbjct  121  PCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPTRKLKTTYKASRPNLFM  178



>gb|KHG02356.1| 60S ribosomal L18a [Gossypium arboreum]
 gb|KJB34966.1| hypothetical protein B456_006G092900 [Gossypium raimondii]
Length=178

 Score =   349 bits (896),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 165/178 (93%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            MVT+RFHQYQVVGRALP+E DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVTFRFHQYQVVGRALPTENDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRF  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
             CIQIIKTATIPAKLCKR+STKQFHNSKIKFPLVFKKVRPP+RKLKTTYKAS+PN+F+
Sbjct  121  PCIQIIKTATIPAKLCKRDSTKQFHNSKIKFPLVFKKVRPPTRKLKTTYKASKPNLFM  178



>ref|XP_009389413.1| PREDICTED: 60S ribosomal protein L18a-like [Musa acuminata subsp. 
malaccensis]
Length=188

 Score =   350 bits (897),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 163/178 (92%), Positives = 173/178 (97%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            MV +RFHQYQVVGRALP+  DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  11   MVAFRFHQYQVVGRALPTAADEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  70

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFE+ PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASRHRVRH
Sbjct  71   LAINEIFERKPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYNEMASRHRVRH  130

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
            HCIQIIKTATIP+KLCKRESTKQFH+SKIKFPLVFKKVRPP+RKLKTTYKASRPN+F+
Sbjct  131  HCIQIIKTATIPSKLCKRESTKQFHDSKIKFPLVFKKVRPPTRKLKTTYKASRPNLFM  188



>gb|KDO51884.1| hypothetical protein CISIN_1g030276mg [Citrus sinensis]
Length=180

 Score =   349 bits (896),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 164/179 (92%), Positives = 175/179 (98%), Gaps = 0/179 (0%)
 Frame = +3

Query  213  KMVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ  392
            +MVT+RFHQYQVVGRALP+ETDEHPKIYRMKLWATNEVRAKSKFWY+LRKLKKVKKSNGQ
Sbjct  2    RMVTFRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYYLRKLKKVKKSNGQ  61

Query  393  VLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVR  572
            VLAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASRHRVR
Sbjct  62   VLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYNEMASRHRVR  121

Query  573  HHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
              CIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVF+KVRPP+RKL+TTYKASRPN+F+
Sbjct  122  SPCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFRKVRPPTRKLRTTYKASRPNLFM  180



>ref|XP_008444078.1| PREDICTED: 60S ribosomal protein L18a [Cucumis melo]
Length=178

 Score =   349 bits (896),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 164/178 (92%), Positives = 175/178 (98%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            MV++RFHQYQVVGRALPSE+DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVSFRFHQYQVVGRALPSESDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFEK PTKVKNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTKVKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRS  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
             CIQIIKTAT+PAKLCKRESTKQFH+SKIKFPLVFKKVRPP+RKL+TTYKAS+PN+F+
Sbjct  121  PCIQIIKTATVPAKLCKRESTKQFHDSKIKFPLVFKKVRPPTRKLRTTYKASKPNLFM  178



>ref|XP_010924380.1| PREDICTED: 60S ribosomal protein L18a [Elaeis guineensis]
Length=178

 Score =   349 bits (896),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 165/178 (93%), Positives = 173/178 (97%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            MV +RFHQYQVVGRALPS TDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVAFRFHQYQVVGRALPSPTDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFE+ PTK+KNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVE MY EMASRHRVR+
Sbjct  61   LAINEIFERKPTKIKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEHMYNEMASRHRVRY  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
            HCIQIIKTATIPAKLCKRE+TKQFH+SKIKFPLVFKKVRPPSRKLKTTYKASRPN+F+
Sbjct  121  HCIQIIKTATIPAKLCKRENTKQFHDSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFM  178



>ref|XP_011002051.1| PREDICTED: 60S ribosomal protein L18a-like [Populus euphratica]
Length=178

 Score =   349 bits (895),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 165/178 (93%), Positives = 173/178 (97%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            MVT+RFHQYQVVGRALP+++DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVTFRFHQYQVVGRALPTQSDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRF  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
             CIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTY ASRPN+F+
Sbjct  121  PCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYNASRPNLFM  178



>ref|XP_008439644.1| PREDICTED: 60S ribosomal protein L18a [Cucumis melo]
Length=178

 Score =   349 bits (895),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 164/178 (92%), Positives = 173/178 (97%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            MVT+RFHQYQVVGRALPSE DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVTFRFHQYQVVGRALPSEADEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVE MYTEMASRHRVRH
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEAMYTEMASRHRVRH  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
             CIQIIKTAT+PAKLCKRESTKQFH+SKIKFPLVFK VRPP+RKLKTTYKAS+PN+F+
Sbjct  121  PCIQIIKTATVPAKLCKRESTKQFHDSKIKFPLVFKTVRPPTRKLKTTYKASKPNLFM  178



>ref|XP_011074018.1| PREDICTED: 60S ribosomal protein L18a-2-like [Sesamum indicum]
Length=178

 Score =   349 bits (895),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 163/178 (92%), Positives = 173/178 (97%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            M  YRF QYQVVGRALP+ET+EHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MAIYRFRQYQVVGRALPTETEEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQI  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVRH
Sbjct  61   LAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRH  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
            HCIQIIKTATIPAKLCKRESTKQFH+SKIKFPLVF+KVRPP+RKLKTTYKASRPN+F+
Sbjct  121  HCIQIIKTATIPAKLCKRESTKQFHDSKIKFPLVFRKVRPPTRKLKTTYKASRPNLFM  178



>ref|XP_008798296.1| PREDICTED: 60S ribosomal protein L18a [Phoenix dactylifera]
Length=178

 Score =   349 bits (895),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 165/178 (93%), Positives = 173/178 (97%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            MV +RFHQYQVVGRALPS T+EHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVAFRFHQYQVVGRALPSPTNEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFE+ PTK+KNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMY EMASRHRVR 
Sbjct  61   LAINEIFERKPTKIKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYNEMASRHRVRS  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
            HCIQIIKTATIPAKLCKRE+TKQFH+SKIKFPLVFKKVRPPSRKLKTTYKASRPN+F+
Sbjct  121  HCIQIIKTATIPAKLCKRENTKQFHDSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFM  178



>ref|XP_008811096.1| PREDICTED: 60S ribosomal protein L18a [Phoenix dactylifera]
Length=178

 Score =   348 bits (894),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 166/178 (93%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            MV +RFHQYQVVGRALPS TDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVVFRFHQYQVVGRALPSPTDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFE+ PTK+KNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMY EMASRHRVR 
Sbjct  61   LAINEIFERKPTKIKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYNEMASRHRVRC  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
            HCIQIIKTATIPAKLCKRESTKQFH+SKIKFPLVFK VRPPSRKLKTTYKASRPN+F+
Sbjct  121  HCIQIIKTATIPAKLCKRESTKQFHDSKIKFPLVFKMVRPPSRKLKTTYKASRPNLFM  178



>ref|XP_006442292.1| hypothetical protein CICLE_v10022114mg [Citrus clementina]
 gb|ESR55532.1| hypothetical protein CICLE_v10022114mg [Citrus clementina]
Length=224

 Score =   350 bits (898),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 182/204 (89%), Gaps = 0/204 (0%)
 Frame = +3

Query  138  PSLAAQrerergrergSQEDGSVVAKMVTYRFHQYQVVGRALPSETDEHPKIYRMKLWAT  317
            PS+ +   + R       E   +  KMVT+RFHQYQVVGRALP+E DEHPKIYRMKLWAT
Sbjct  21   PSMQSAAYKPRFPSFTCSEPALLGGKMVTFRFHQYQVVGRALPTEKDEHPKIYRMKLWAT  80

Query  318  NEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYK  497
            NEVRAKSKFWYFLRKLKKVKKSNGQ+LAI+EIFEK PTK+KNYGIWLRYQSRTGYHNMYK
Sbjct  81   NEVRAKSKFWYFLRKLKKVKKSNGQMLAIDEIFEKNPTKIKNYGIWLRYQSRTGYHNMYK  140

Query  498  EFRDTTLNGAVEQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLV  677
            E+RD TLNGAVEQMYTEMASRHRVR  CIQII+TATIPAKLCKRESTKQFHNSKIKFPLV
Sbjct  141  EYRDITLNGAVEQMYTEMASRHRVRSPCIQIIRTATIPAKLCKRESTKQFHNSKIKFPLV  200

Query  678  FKKVRPPSRKLKTTYKASRPNIFV  749
            FKKVRPP+RKLKTTYKASRPN+F+
Sbjct  201  FKKVRPPTRKLKTTYKASRPNLFM  224



>ref|XP_002300869.1| 60S ribosomal protein L18a-1 [Populus trichocarpa]
 ref|XP_011026230.1| PREDICTED: 60S ribosomal protein L18a-like [Populus euphratica]
 gb|ABK92614.1| unknown [Populus trichocarpa]
 gb|EEE80142.1| 60S ribosomal protein L18a-1 [Populus trichocarpa]
Length=178

 Score =   348 bits (894),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 163/178 (92%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            MV++RFHQYQVVGRALP+E+DEHPKIYRMKLWATNEVR+KSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVSFRFHQYQVVGRALPTESDEHPKIYRMKLWATNEVRSKSKFWYFLRKLKKVKKSNGQI  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASRHRVR 
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYNEMASRHRVRS  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
             CIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPP+RKLKTTYKASRPN+F+
Sbjct  121  PCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPTRKLKTTYKASRPNLFM  178



>ref|XP_010655647.1| PREDICTED: 60S ribosomal protein L18a isoform X1 [Vitis vinifera]
 emb|CAN82658.1| hypothetical protein VITISV_011977 [Vitis vinifera]
Length=178

 Score =   348 bits (893),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 164/178 (92%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            MVT+RFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVTFRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASRHRVR 
Sbjct  61   LAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYAEMASRHRVRS  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
             CIQIIKTATIPAKLCKRES+KQFHNSKIKFPL F+KVRPP+RKLKTTYKASRPN+F+
Sbjct  121  PCIQIIKTATIPAKLCKRESSKQFHNSKIKFPLTFRKVRPPTRKLKTTYKASRPNLFM  178



>ref|XP_010542333.1| PREDICTED: 60S ribosomal protein L18a isoform X1 [Tarenaya hassleriana]
Length=178

 Score =   348 bits (893),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 163/178 (92%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            MV +RFHQYQVVGRALP+ETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVAFRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRF  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
             CIQIIKTAT+PAKLCKRESTKQFHNSKIKFPLVF+KVRPP+RKLKTTYKAS+PN+F+
Sbjct  121  PCIQIIKTATVPAKLCKRESTKQFHNSKIKFPLVFRKVRPPTRKLKTTYKASKPNLFM  178



>gb|KCW89756.1| hypothetical protein EUGRSUZ_A02018 [Eucalyptus grandis]
Length=213

 Score =   349 bits (896),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 164/182 (90%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = +3

Query  204  VVAKMVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKS  383
              + MVT+RFHQYQVVGRALP+ +DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKS
Sbjct  32   ATSTMVTFRFHQYQVVGRALPTGSDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKS  91

Query  384  NGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRH  563
            NGQVLAINEIFEK PTK+ NYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRH
Sbjct  92   NGQVLAINEIFEKNPTKINNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRH  151

Query  564  RVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNI  743
            RVR  CIQIIKTAT+PAKLCKRESTKQFHNSKIKFPLVFKKVRPP+RKLKTTYKASRPN+
Sbjct  152  RVRFPCIQIIKTATVPAKLCKRESTKQFHNSKIKFPLVFKKVRPPTRKLKTTYKASRPNL  211

Query  744  FV  749
            F+
Sbjct  212  FM  213



>gb|KHG16522.1| 60S ribosomal L18a [Gossypium arboreum]
Length=178

 Score =   348 bits (892),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 165/178 (93%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            MVT+RFHQYQVVGRA P+E+DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVTFRFHQYQVVGRAHPTESDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRF  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
             CIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPP+RKLKTTYKAS+PN+F+
Sbjct  121  PCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPTRKLKTTYKASKPNLFM  178



>ref|XP_010918885.1| PREDICTED: 60S ribosomal protein L18a-like [Elaeis guineensis]
Length=178

 Score =   348 bits (892),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 164/178 (92%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            MV +RFHQYQVVGRALPS TDEHP+IYRMKLW TNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVAFRFHQYQVVGRALPSPTDEHPRIYRMKLWTTNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFE+ PTK+KNYGIWLRYQSRTGYHNMYKEFRDT LNGAVE MY EMASRHRVR+
Sbjct  61   LAINEIFERKPTKIKNYGIWLRYQSRTGYHNMYKEFRDTALNGAVEHMYNEMASRHRVRY  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
            HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPN+F+
Sbjct  121  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFM  178



>ref|XP_009394206.1| PREDICTED: 60S ribosomal protein L18a-like [Musa acuminata subsp. 
malaccensis]
Length=178

 Score =   348 bits (892),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 164/178 (92%), Positives = 173/178 (97%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            MV +RFHQYQVVGRALPS TDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVAFRFHQYQVVGRALPSSTDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFE+ PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASRHRVR 
Sbjct  61   LAINEIFERKPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYNEMASRHRVRC  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
            HCIQIIKTATIP+KLCKRESTKQFH+SKIKFPLVFKKVRPP+RKLKTTYKASRPN+F+
Sbjct  121  HCIQIIKTATIPSKLCKRESTKQFHDSKIKFPLVFKKVRPPTRKLKTTYKASRPNLFM  178



>ref|XP_010053843.1| PREDICTED: 60S ribosomal protein L18a [Eucalyptus grandis]
Length=178

 Score =   348 bits (892),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 164/178 (92%), Positives = 173/178 (97%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            MVT+RFHQYQVVGRALP+ +DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVTFRFHQYQVVGRALPTGSDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFEK PTK+ NYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTKINNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRF  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
             CIQIIKTAT+PAKLCKRESTKQFHNSKIKFPLVFKKVRPP+RKLKTTYKASRPN+F+
Sbjct  121  PCIQIIKTATVPAKLCKRESTKQFHNSKIKFPLVFKKVRPPTRKLKTTYKASRPNLFM  178



>ref|XP_006437137.1| hypothetical protein CICLE_v10032878mg [Citrus clementina]
 gb|ESR50377.1| hypothetical protein CICLE_v10032878mg [Citrus clementina]
Length=180

 Score =   348 bits (892),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 163/179 (91%), Positives = 174/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  213  KMVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ  392
            +MVT+RFHQYQVVGRALP+ETDEHPKIYRMKLWATNEVRAKSKFWY+LRKLKKVKKSNGQ
Sbjct  2    RMVTFRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYYLRKLKKVKKSNGQ  61

Query  393  VLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVR  572
            VLAINEIFEK P K+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASRHRVR
Sbjct  62   VLAINEIFEKNPAKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYNEMASRHRVR  121

Query  573  HHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
              CIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVF+KVRPP+RKL+TTYKASRPN+F+
Sbjct  122  SPCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFRKVRPPTRKLRTTYKASRPNLFM  180



>gb|KCW75929.1| hypothetical protein EUGRSUZ_D00304 [Eucalyptus grandis]
Length=255

 Score =   350 bits (898),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 164/182 (90%), Positives = 175/182 (96%), Gaps = 0/182 (0%)
 Frame = +3

Query  204  VVAKMVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKS  383
            + ++MVT+RFHQYQVVGRALP+  DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKS
Sbjct  74   LASEMVTFRFHQYQVVGRALPTGADEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKS  133

Query  384  NGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRH  563
            NGQVLAINEIFEK PTK+ NYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRH
Sbjct  134  NGQVLAINEIFEKNPTKINNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRH  193

Query  564  RVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNI  743
            RVR  CIQIIKTAT+PAKLCKRESTKQFHNSKIKFPLVFKKVRPP+RKLKTTYKASRPN+
Sbjct  194  RVRFPCIQIIKTATVPAKLCKRESTKQFHNSKIKFPLVFKKVRPPTRKLKTTYKASRPNL  253

Query  744  FV  749
            F+
Sbjct  254  FM  255



>ref|XP_008789456.1| PREDICTED: 60S ribosomal protein L18a-2 [Phoenix dactylifera]
Length=178

 Score =   347 bits (891),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 163/178 (92%), Positives = 173/178 (97%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            M  +RFHQYQVVGRALP+ +DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MGNFRFHQYQVVGRALPTPSDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFE+ PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASRHRVRH
Sbjct  61   LAINEIFERKPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYNEMASRHRVRH  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
            HCIQIIKTATIPAKLCKRESTKQFH+SKIKFPLVFKKVRPP+RKLKTTYKASRPN+F+
Sbjct  121  HCIQIIKTATIPAKLCKRESTKQFHDSKIKFPLVFKKVRPPTRKLKTTYKASRPNLFM  178



>ref|XP_010052071.1| PREDICTED: 60S ribosomal protein L18a-like isoform X1 [Eucalyptus 
grandis]
Length=178

 Score =   347 bits (891),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 164/178 (92%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            MVT+RFHQYQVVGRALP+  DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVTFRFHQYQVVGRALPTGADEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFEK PTK+ NYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTKINNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRF  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
             CIQIIKTAT+PAKLCKRESTKQFHNSKIKFPLVFKKVRPP+RKLKTTYKASRPN+F+
Sbjct  121  PCIQIIKTATVPAKLCKRESTKQFHNSKIKFPLVFKKVRPPTRKLKTTYKASRPNLFM  178



>gb|EYU36633.1| hypothetical protein MIMGU_mgv1a014793mg [Erythranthe guttata]
Length=178

 Score =   347 bits (890),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 163/178 (92%), Positives = 173/178 (97%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            MVTYRFHQYQVVGRALP+ET+EHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVTYRFHQYQVVGRALPTETEEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVE MYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEHMYTEMASRHRVRS  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
            HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLV +KVRPP+RKLKTTYKA++PN+F+
Sbjct  121  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVTRKVRPPTRKLKTTYKATKPNLFM  178



>ref|XP_002276260.1| PREDICTED: 60S ribosomal protein L18a [Vitis vinifera]
 emb|CAN71860.1| hypothetical protein VITISV_019859 [Vitis vinifera]
 emb|CBI30856.3| unnamed protein product [Vitis vinifera]
Length=178

 Score =   347 bits (890),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 163/178 (92%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            MVT+RFHQYQVVGRALPSE+DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVTFRFHQYQVVGRALPSESDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASRHRVR 
Sbjct  61   LAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYAEMASRHRVRS  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
             CIQIIKTATIPAKLCKRES+KQFHNSKIKFPL F+KVRPP+RKLKTTYKASRPN+F+
Sbjct  121  PCIQIIKTATIPAKLCKRESSKQFHNSKIKFPLTFRKVRPPTRKLKTTYKASRPNLFM  178



>ref|XP_007025105.1| Ribosomal protein L18ae/LX family protein [Theobroma cacao]
 gb|EOY27727.1| Ribosomal protein L18ae/LX family protein [Theobroma cacao]
Length=178

 Score =   347 bits (890),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 163/178 (92%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            MVT+R+HQYQVVGRALP+E+DEHPKIYRM+LWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVTFRYHQYQVVGRALPTESDEHPKIYRMRLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASRHRVR 
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYNEMASRHRVRF  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
             CIQIIKTATIPAKLCKR+STKQFHNSKIKFPLVFKKVRPP+RKLKTTYKASRPN+F+
Sbjct  121  PCIQIIKTATIPAKLCKRDSTKQFHNSKIKFPLVFKKVRPPTRKLKTTYKASRPNLFM  178



>gb|EYU33348.1| hypothetical protein MIMGU_mgv1a014797mg [Erythranthe guttata]
Length=178

 Score =   347 bits (889),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 162/178 (91%), Positives = 173/178 (97%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            MVTYR HQYQVVGRALP+ET+EHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVTYRIHQYQVVGRALPTETEEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQI  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVE MYTEMASRHRVR+
Sbjct  61   LAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEHMYTEMASRHRVRY  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
            HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVF KVRPP+RKLKTTYKA++PN+F+
Sbjct  121  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFHKVRPPTRKLKTTYKATKPNLFM  178



>ref|XP_010538246.1| PREDICTED: 60S ribosomal protein L18a-like [Tarenaya hassleriana]
Length=178

 Score =   347 bits (889),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 162/178 (91%), Positives = 173/178 (97%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            MVT+RFHQYQVVGRALP+E DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVTFRFHQYQVVGRALPTEADEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQI  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RD TLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDITLNGAVEQMYTEMASRHRVRF  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
             CIQIIKTAT+PAKLCKRESTKQFHNSKIKFPLVF+KVRPP+RKLKTTYKAS+PN+F+
Sbjct  121  PCIQIIKTATVPAKLCKRESTKQFHNSKIKFPLVFRKVRPPTRKLKTTYKASKPNLFM  178



>gb|KHG16962.1| 60S ribosomal L18a [Gossypium arboreum]
 gb|KJB69799.1| hypothetical protein B456_011G042800 [Gossypium raimondii]
Length=178

 Score =   347 bits (889),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 164/178 (92%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            MVT+RFHQYQVVGRA P+E+DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVTFRFHQYQVVGRAHPTESDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRF  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
             CIQIIKTATIPAKLCKR+STKQFHNSKIKFPLVFKKVRPP+RKLKTTYKAS+PN+F+
Sbjct  121  PCIQIIKTATIPAKLCKRDSTKQFHNSKIKFPLVFKKVRPPTRKLKTTYKASKPNLFM  178



>gb|KHG29727.1| 60S ribosomal L18a [Gossypium arboreum]
Length=178

 Score =   347 bits (889),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 163/178 (92%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            MVT+RFHQYQVVGRALP+E+DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVTFRFHQYQVVGRALPTESDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRF  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
             CIQIIKTATIPAKLCKR++TKQFHNSKIKFPL+ KKVRPP+RKLKTTYKASRPN+F+
Sbjct  121  PCIQIIKTATIPAKLCKRDNTKQFHNSKIKFPLMVKKVRPPTRKLKTTYKASRPNLFM  178



>ref|XP_012072093.1| PREDICTED: 60S ribosomal protein L18a isoform X1 [Jatropha curcas]
 gb|ACS96446.1| 60S ribosomal protein L18a [Jatropha curcas]
 gb|KDP37961.1| hypothetical protein JCGZ_04604 [Jatropha curcas]
Length=178

 Score =   346 bits (888),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 163/178 (92%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            MVTY+FHQYQVVGR LP+E DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVTYKFHQYQVVGRGLPTENDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRF  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
             CIQIIKT TIPAKLCKRES+KQFHNSKIKFPLVFKKVRPP+RKL+TTYKASRPN+F+
Sbjct  121  PCIQIIKTGTIPAKLCKRESSKQFHNSKIKFPLVFKKVRPPTRKLRTTYKASRPNLFM  178



>gb|KJB10614.1| hypothetical protein B456_001G211400 [Gossypium raimondii]
Length=178

 Score =   346 bits (887),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 162/178 (91%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            MV +RFHQYQVVGR LP+E DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVAFRFHQYQVVGRGLPTEADEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKSPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRF  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
             CIQIIKTATIPAKLCKR+STKQFHNSKIKFPLVFKKVRPP+RKLKTTYKA++PN+F+
Sbjct  121  PCIQIIKTATIPAKLCKRDSTKQFHNSKIKFPLVFKKVRPPTRKLKTTYKATKPNLFM  178



>ref|XP_009399317.1| PREDICTED: 60S ribosomal protein L18a-like [Musa acuminata subsp. 
malaccensis]
Length=178

 Score =   346 bits (887),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 162/177 (92%), Positives = 172/177 (97%), Gaps = 0/177 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            M  +RFHQYQVVGRALP+ET+EHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MGNFRFHQYQVVGRALPTETEEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFE+ PTK+KNYG+WLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASRHRVR 
Sbjct  61   LAINEIFERKPTKIKNYGVWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYNEMASRHRVRQ  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIF  746
            HCIQIIKTATIP+KLCKRESTKQFH+SKIKFPLVFKKVRPPSRKLKTTYKASRPN+F
Sbjct  121  HCIQIIKTATIPSKLCKRESTKQFHDSKIKFPLVFKKVRPPSRKLKTTYKASRPNLF  177



>ref|XP_002268750.1| PREDICTED: 60S ribosomal protein L18a [Vitis vinifera]
 emb|CBI22128.3| unnamed protein product [Vitis vinifera]
Length=178

 Score =   345 bits (886),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 162/178 (91%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            MVT++FHQYQVVGRALPSE+DEHP+IYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVTFKFHQYQVVGRALPSESDEHPRIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNG+VEQMYTEMASRHRVR+
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGSVEQMYTEMASRHRVRY  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
             CIQIIKTATIPAKLCKRESTKQ HNSKIKFPLV +KVRPP+RKLKTTYKASRPN+F+
Sbjct  121  PCIQIIKTATIPAKLCKRESTKQMHNSKIKFPLVVRKVRPPTRKLKTTYKASRPNLFM  178



>gb|ABK94361.1| unknown [Populus trichocarpa]
Length=178

 Score =   345 bits (886),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 162/178 (91%), Positives = 173/178 (97%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            MV++RFHQYQVVGRALP+E+DEHPKIYRMKLWATNEVR+KSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVSFRFHQYQVVGRALPTESDEHPKIYRMKLWATNEVRSKSKFWYFLRKLKKVKKSNGQI  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASRHRVR 
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYNEMASRHRVRS  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
             CIQIIKTATIPAKLCKR STKQFHNSKIKFPLVFKKVRPP+RKLKTTYKASRPN+F+
Sbjct  121  PCIQIIKTATIPAKLCKRGSTKQFHNSKIKFPLVFKKVRPPTRKLKTTYKASRPNLFM  178



>ref|XP_008796386.1| PREDICTED: 60S ribosomal protein L18a-like [Phoenix dactylifera]
Length=178

 Score =   345 bits (886),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 162/178 (91%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            M  +RFHQYQVVGRALP+ +DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MGNFRFHQYQVVGRALPTPSDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFE+ PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASRHRVRH
Sbjct  61   LAINEIFERKPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYNEMASRHRVRH  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
            HCIQIIKTATIPAKLCKRESTKQFH+SKIKFPLV KKVRPP+RKLKTTYKASRPN+F+
Sbjct  121  HCIQIIKTATIPAKLCKRESTKQFHDSKIKFPLVLKKVRPPTRKLKTTYKASRPNLFM  178



>gb|KJB42782.1| hypothetical protein B456_007G174800 [Gossypium raimondii]
Length=178

 Score =   345 bits (886),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 162/178 (91%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            MV +RFHQYQVVGR LP+E D+HPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVAFRFHQYQVVGRGLPTEADQHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRF  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
             CIQIIKTATIPAKLCKR+STKQFHNSKIKFPLVFKKVRPP+RKLKTTYKAS+PN+F+
Sbjct  121  PCIQIIKTATIPAKLCKRDSTKQFHNSKIKFPLVFKKVRPPTRKLKTTYKASKPNLFM  178



>ref|XP_007048983.1| Ribosomal protein L18ae/LX family protein [Theobroma cacao]
 gb|EOX93140.1| Ribosomal protein L18ae/LX family protein [Theobroma cacao]
Length=178

 Score =   345 bits (885),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 162/178 (91%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            MV++R+HQYQVVGR LP+E DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVSFRYHQYQVVGRGLPTEADEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASRHRVR 
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYNEMASRHRVRF  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
             CIQIIKTATIPAKLCKR+STKQFHNSKIKFPLVFKKVRPP+RKLKTTYKASRPN+F+
Sbjct  121  PCIQIIKTATIPAKLCKRDSTKQFHNSKIKFPLVFKKVRPPTRKLKTTYKASRPNLFM  178



>ref|NP_001237207.1| uncharacterized protein LOC100527007 [Glycine max]
 gb|ACU16044.1| unknown [Glycine max]
Length=178

 Score =   344 bits (883),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 163/178 (92%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            MV  RFHQYQVVGRALP+E+DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVAMRFHQYQVVGRALPTESDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFE+ PTK+KN GIWLRYQSRTGYHNMYKE+RDTTLNGAVE MYTEMASRHRVRH
Sbjct  61   LAINEIFERNPTKIKNCGIWLRYQSRTGYHNMYKEYRDTTLNGAVEHMYTEMASRHRVRH  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
             CIQIIKTATIPAKLCKRESTKQFHNSKI+FPLVFKKVRPP+RKLKTTYKASRPN+F+
Sbjct  121  PCIQIIKTATIPAKLCKRESTKQFHNSKIEFPLVFKKVRPPTRKLKTTYKASRPNLFM  178



>gb|EYU43268.1| hypothetical protein MIMGU_mgv1a013972mg [Erythranthe guttata]
Length=204

 Score =   345 bits (885),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 162/188 (86%), Positives = 178/188 (95%), Gaps = 0/188 (0%)
 Frame = +3

Query  186  SQEDGSVVAKMVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKL  365
            ++E  S  +KMVTY+FHQYQVVGRALP+E DEHPKIYRMKLWATNEVRAKSKFWYFLRKL
Sbjct  17   TEERESEQSKMVTYKFHQYQVVGRALPTEKDEHPKIYRMKLWATNEVRAKSKFWYFLRKL  76

Query  366  KKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYT  545
            KKVKKSNGQ+LAINEIFEK PT +KN+G+WLRYQSRTGYHNMYKE+RDTTLNG VEQMYT
Sbjct  77   KKVKKSNGQMLAINEIFEKNPTTIKNFGVWLRYQSRTGYHNMYKEYRDTTLNGGVEQMYT  136

Query  546  EMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYK  725
            EMASRHRVR HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLV++KVRP SRKLKTTYK
Sbjct  137  EMASRHRVRPHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVYRKVRPHSRKLKTTYK  196

Query  726  ASRPNIFV  749
            A++PN+F+
Sbjct  197  ATKPNLFM  204



>gb|KJB57268.1| hypothetical protein B456_009G155900 [Gossypium raimondii]
Length=178

 Score =   343 bits (881),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 161/178 (90%), Positives = 173/178 (97%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            MVT+RFHQYQVVGRALP+++DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVTFRFHQYQVVGRALPTDSDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRF  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
             CIQIIKTATIP KLCKR++TKQFHNSKIKFPL+ KKVRPP+RKLKTTYKASRPN+F+
Sbjct  121  PCIQIIKTATIPTKLCKRDNTKQFHNSKIKFPLMVKKVRPPTRKLKTTYKASRPNLFM  178



>gb|KHG26670.1| 60S ribosomal L18a [Gossypium arboreum]
Length=178

 Score =   343 bits (881),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 161/178 (90%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            MV +RFHQYQVVGR LP+E D+HPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVAFRFHQYQVVGRGLPTEADQHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASRHRVR 
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYAEMASRHRVRF  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
             CIQIIKTATIPAKLCKR+STKQFHNSKIKFPLVFKKVRPP+RKLKTTYKAS+PN+F+
Sbjct  121  PCIQIIKTATIPAKLCKRDSTKQFHNSKIKFPLVFKKVRPPTRKLKTTYKASKPNLFM  178



>ref|NP_001237679.1| uncharacterized protein LOC100306365 [Glycine max]
 gb|ACU14501.1| unknown [Glycine max]
 gb|KHN35898.1| 60S ribosomal protein L18a-2 [Glycine soja]
Length=178

 Score =   343 bits (880),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 162/178 (91%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            MVT+RFHQYQVVGRALP+ETD HPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVTFRFHQYQVVGRALPTETDVHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVE MY EMASRHRVR 
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEHMYNEMASRHRVRS  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
             CIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPP+RKLKTTYKA++PN+F+
Sbjct  121  PCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPTRKLKTTYKATKPNLFM  178



>gb|KJB69800.1| hypothetical protein B456_011G042900 [Gossypium raimondii]
Length=178

 Score =   343 bits (880),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 163/178 (92%), Positives = 173/178 (97%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            MVT+RFHQYQVVGRA P+E+DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKS GQV
Sbjct  1    MVTFRFHQYQVVGRAHPAESDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSIGQV  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRF  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
             CIQIIKTATIPAKLCKR+STKQFHNSKIKFPLVFKKVRPP+RKLKTTYKAS+PN+F+
Sbjct  121  PCIQIIKTATIPAKLCKRDSTKQFHNSKIKFPLVFKKVRPPTRKLKTTYKASKPNLFM  178



>ref|XP_010540563.1| PREDICTED: 60S ribosomal protein L18a [Tarenaya hassleriana]
Length=178

 Score =   343 bits (879),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 161/178 (90%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            MVT+RFHQYQVV RALP+ETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVTFRFHQYQVVERALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKEFRD TLNGAVEQMY EMASRHRVR 
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEFRDITLNGAVEQMYNEMASRHRVRF  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
             CIQIIKTAT+PAKLCKRES+KQFHNSKIKFPLVF+KVRPP+RKLKTTYKAS+PN+F+
Sbjct  121  PCIQIIKTATVPAKLCKRESSKQFHNSKIKFPLVFRKVRPPTRKLKTTYKASKPNLFM  178



>ref|NP_001238728.1| uncharacterized protein LOC100306174 [Glycine max]
 gb|ACU14228.1| unknown [Glycine max]
 gb|KHN33136.1| 60S ribosomal protein L18a [Glycine soja]
Length=178

 Score =   342 bits (878),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 161/178 (90%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            MVT+RFHQYQVVGRALP+E D+HPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVTFRFHQYQVVGRALPTEADQHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVE MY EMASRHRVR 
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEAMYNEMASRHRVRS  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
             CIQIIKTATIPAKLCKRESTKQFHNSKIKFPLV+KKVRPP+RKLKTTYKA +PN+F+
Sbjct  121  PCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVYKKVRPPTRKLKTTYKAKKPNLFM  178



>ref|XP_010552158.1| PREDICTED: 60S ribosomal protein L18a [Tarenaya hassleriana]
Length=178

 Score =   342 bits (878),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 158/178 (89%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            MV +RFHQYQVVGRALP+ETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVAFRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFEK PTK++NYGIWLRYQSRTGYHNMYKE+RDTTLNG+VEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTKIRNYGIWLRYQSRTGYHNMYKEYRDTTLNGSVEQMYTEMASRHRVRF  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
             C+QIIKTAT+PAKLCKRESTKQFHNSKIKFPLV++KVRPP+RKLKTT+KAS+PN+F+
Sbjct  121  PCVQIIKTATVPAKLCKRESTKQFHNSKIKFPLVYRKVRPPTRKLKTTFKASKPNLFM  178



>ref|XP_010263115.1| PREDICTED: 60S ribosomal protein L18a-2 [Nelumbo nucifera]
Length=178

 Score =   342 bits (878),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 162/178 (91%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            M  +RFHQYQVVGRALPSE D HPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MGIFRFHQYQVVGRALPSEADPHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASRHRVR+
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYNEMASRHRVRY  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
             CIQIIKTATIPA LCKRESTKQFHN+KIKFPLVFKKVRPP+RKLKTTYKASRPN+F+
Sbjct  121  PCIQIIKTATIPASLCKRESTKQFHNAKIKFPLVFKKVRPPTRKLKTTYKASRPNLFM  178



>sp|Q9ATF5.1|RL18A_CASSA RecName: Full=60S ribosomal protein L18a [Castanea sativa]
 gb|AAK25759.1|AF334839_1 ribosomal protein L18a [Castanea sativa]
Length=178

 Score =   342 bits (878),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 162/178 (91%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            MVT+RFHQYQVVGR LPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVTFRFHQYQVVGRGLPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASRHRVR 
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYIEMASRHRVRF  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
             CIQIIKTATIPAKLCKRES+KQFHNSKIKFPLV +K+RPPSRKLKT YKASRPN+F+
Sbjct  121  PCIQIIKTATIPAKLCKRESSKQFHNSKIKFPLVTRKIRPPSRKLKTHYKASRPNLFM  178



>ref|XP_006410594.1| hypothetical protein EUTSA_v10017304mg [Eutrema salsugineum]
 gb|ESQ52047.1| hypothetical protein EUTSA_v10017304mg [Eutrema salsugineum]
Length=178

 Score =   342 bits (877),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 160/178 (90%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            MVT++FHQYQVVGRALP+E DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVTFKFHQYQVVGRALPTEKDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFEK PT +KN+GIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTTIKNFGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRF  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
             CIQIIKTAT+PA LCKRESTKQFHNSKIKFPLVF+KVRPPSRKLKTTYKAS+PN+F+
Sbjct  121  PCIQIIKTATVPAALCKRESTKQFHNSKIKFPLVFRKVRPPSRKLKTTYKASKPNLFM  178



>emb|CDX97587.1| BnaA05g24920D [Brassica napus]
Length=178

 Score =   342 bits (877),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 161/178 (90%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            MV +RFHQYQVVGRALP+E D  PKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVAFRFHQYQVVGRALPTEKDVQPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRF  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
             CIQIIKTAT+PAKLCKRESTKQFHNSKIKFPLVF+KVRPP+RKLKTTYKAS+PN+F+
Sbjct  121  PCIQIIKTATVPAKLCKRESTKQFHNSKIKFPLVFRKVRPPTRKLKTTYKASKPNLFM  178



>ref|XP_009407842.1| PREDICTED: 60S ribosomal protein L18a-like [Musa acuminata subsp. 
malaccensis]
Length=178

 Score =   342 bits (877),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 161/177 (91%), Positives = 171/177 (97%), Gaps = 0/177 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            M  +RFHQYQVVGRALP+ TDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MGNFRFHQYQVVGRALPTATDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFE+ PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNG+VEQMY EMASRHRVR 
Sbjct  61   LAINEIFERKPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGSVEQMYNEMASRHRVRC  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIF  746
            HCIQIIKTATIP+KLCKRESTKQFH+SKIKFPLVFKKVRPP+RKLKTTYKASRPN+F
Sbjct  121  HCIQIIKTATIPSKLCKRESTKQFHDSKIKFPLVFKKVRPPTRKLKTTYKASRPNLF  177



>ref|XP_004486036.1| PREDICTED: 60S ribosomal protein L18a-like [Cicer arietinum]
Length=178

 Score =   342 bits (876),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 160/178 (90%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            MV++++HQYQVVGRALP+E+DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVSFKYHQYQVVGRALPTESDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV+ MY EMASRHRVR 
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVDLMYNEMASRHRVRF  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
             CIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKK+RPPSRKLKTTYKA +PN+F+
Sbjct  121  PCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKIRPPSRKLKTTYKAKKPNLFM  178



>ref|XP_008380196.1| PREDICTED: 60S ribosomal protein L18a-2-like [Malus domestica]
 ref|XP_008342343.1| PREDICTED: 60S ribosomal protein L18a-2-like [Malus domestica]
 ref|XP_009377204.1| PREDICTED: 60S ribosomal protein L18a-2-like [Pyrus x bretschneideri]
 ref|XP_009356606.1| PREDICTED: 60S ribosomal protein L18a-2-like [Pyrus x bretschneideri]
Length=178

 Score =   342 bits (876),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 162/178 (91%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            M  +RFHQYQVVGRALP+E DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MGVFRFHQYQVVGRALPTEKDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVE MYTE+ASRHRVR 
Sbjct  61   LAINEIFEKYPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEAMYTELASRHRVRF  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
             CIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVF+KVRPPSRKLKTTYKASRPN+F+
Sbjct  121  PCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFRKVRPPSRKLKTTYKASRPNLFM  178



>ref|XP_007212144.1| hypothetical protein PRUPE_ppa012251mg [Prunus persica]
 ref|XP_008225467.1| PREDICTED: 60S ribosomal protein L18a-2 isoform X1 [Prunus mume]
 gb|EMJ13343.1| hypothetical protein PRUPE_ppa012251mg [Prunus persica]
Length=178

 Score =   342 bits (876),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 162/178 (91%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            M T++FHQYQVVGR LP+ +DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MGTFKFHQYQVVGRKLPTASDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASRHRVR 
Sbjct  61   LAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYIEMASRHRVRF  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
             CIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVF+KVRPPSRKLKTTYKASRPN+FV
Sbjct  121  PCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFRKVRPPSRKLKTTYKASRPNLFV  178



>ref|NP_001236918.1| uncharacterized protein LOC100500108 [Glycine max]
 gb|ACU14971.1| unknown [Glycine max]
 gb|KHN47310.1| 60S ribosomal protein L18a [Glycine soja]
Length=178

 Score =   341 bits (875),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 160/178 (90%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            MVT+RFHQYQVVGRALP+E D+HPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVTFRFHQYQVVGRALPTEADQHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNG+VE MY EMASRHRVR 
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGSVEAMYNEMASRHRVRS  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
             CIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVF+KVRPP+RKLKTTYKA +PN+F+
Sbjct  121  PCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFQKVRPPTRKLKTTYKAKKPNLFM  178



>gb|AFK44558.1| unknown [Lotus japonicus]
Length=178

 Score =   341 bits (874),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 158/178 (89%), Positives = 173/178 (97%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            MVT+RFHQYQVVGRALP+++D+HPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVTFRFHQYQVVGRALPTDSDQHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFEK PTK+KN+GIWLRYQSRTGYHNMYKE+RDTTLNGAV+ MYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTKIKNFGIWLRYQSRTGYHNMYKEYRDTTLNGAVDAMYTEMASRHRVRS  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
             CIQIIKTAT+PAKLCKRESTKQFHNSKIKFPLV++KVRPPSRKLKTTYKA +PN+F+
Sbjct  121  PCIQIIKTATVPAKLCKRESTKQFHNSKIKFPLVYRKVRPPSRKLKTTYKAKKPNLFM  178



>gb|KHG27228.1| 60S ribosomal L18a [Gossypium arboreum]
Length=178

 Score =   341 bits (874),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 160/178 (90%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            MV +RFHQYQVVGR LP++ DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVAFRFHQYQVVGRGLPTDADEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRF  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
             CIQIIKTATIPAKLCKR+STKQFHNSKIKFPLV KKVRPP+RKLKTTYKA++PN+F+
Sbjct  121  PCIQIIKTATIPAKLCKRDSTKQFHNSKIKFPLVSKKVRPPTRKLKTTYKATKPNLFM  178



>gb|AFK40398.1| unknown [Medicago truncatula]
 gb|KEH33553.1| 60S ribosomal protein L18a-3 [Medicago truncatula]
Length=178

 Score =   340 bits (873),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 159/178 (89%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            M T+++HQYQVVGRALP+E DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MATFKYHQYQVVGRALPTEKDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVE MY EMASRHRVRH
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEYMYNEMASRHRVRH  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
             CIQIIKTATIPA LCKRESTKQFHNSKIKFPLVFKK+RPP+RKLKTTYKA++PN+F+
Sbjct  121  PCIQIIKTATIPANLCKRESTKQFHNSKIKFPLVFKKIRPPTRKLKTTYKATKPNMFM  178



>ref|XP_007136179.1| hypothetical protein PHAVU_009G024800g [Phaseolus vulgaris]
 gb|ESW08173.1| hypothetical protein PHAVU_009G024800g [Phaseolus vulgaris]
Length=178

 Score =   340 bits (872),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 159/178 (89%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            MV++RFHQYQVVGRALP+E D+HPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVSFRFHQYQVVGRALPTEADQHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFEK PTK++NYGIWLRYQSRTGYHNMYKEFRDTTLNGAVE MY EMASRHRVR 
Sbjct  61   LAINEIFEKNPTKIQNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEHMYNEMASRHRVRF  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
             CIQIIKTATIPAKLCKRESTKQFH+SKIKFPLVFKK+RPPSRKLKTTYKA +PN+F+
Sbjct  121  PCIQIIKTATIPAKLCKRESTKQFHDSKIKFPLVFKKIRPPSRKLKTTYKAKKPNLFM  178



>gb|AFK33651.1| unknown [Lotus japonicus]
Length=178

 Score =   340 bits (872),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 158/178 (89%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            MV ++FHQYQVVGRALP+E+D+HPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVAFKFHQYQVVGRALPTESDDHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVE MY EMASRHRVR 
Sbjct  61   LAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEHMYNEMASRHRVRS  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
             CIQIIKTAT+PAKLCKRESTKQFHNSKIKFPLV+KK+RPP+RKLKTTYKASRPN+F+
Sbjct  121  PCIQIIKTATVPAKLCKRESTKQFHNSKIKFPLVYKKIRPPTRKLKTTYKASRPNLFM  178



>ref|XP_008371596.1| PREDICTED: 60S ribosomal protein L18a-2 isoform X1 [Malus domestica]
 ref|XP_008383489.1| PREDICTED: 60S ribosomal protein L18a-2 [Malus domestica]
 ref|XP_009360875.1| PREDICTED: 60S ribosomal protein L18a-2 isoform X1 [Pyrus x bretschneideri]
Length=178

 Score =   340 bits (871),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 161/178 (90%), Positives = 169/178 (95%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            M  ++FHQYQVVGR LP+ETDE PKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MGVFKFHQYQVVGRKLPTETDEQPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASRHRVR 
Sbjct  61   LAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYIEMASRHRVRF  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
             CIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVF+KVRPPSRKLKTTYKASRPN+F+
Sbjct  121  PCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFRKVRPPSRKLKTTYKASRPNLFM  178



>ref|XP_007159262.1| hypothetical protein PHAVU_002G223200g [Phaseolus vulgaris]
 gb|ESW31256.1| hypothetical protein PHAVU_002G223200g [Phaseolus vulgaris]
Length=178

 Score =   339 bits (870),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 160/178 (90%), Positives = 169/178 (95%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            MVT+RFHQYQVVGRALP+E D+HPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVTFRFHQYQVVGRALPTEADQHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFEK PTK+ NYGIWLRYQSRTGYHNMYKEFRDTTLNGAVE MY EMASRHRVR 
Sbjct  61   LAINEIFEKNPTKINNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEHMYNEMASRHRVRS  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
             CIQIIKTATIPAKLCKRESTKQF NSKIKFPLVFKK+RPPSRKLKTTYKA +PN+F+
Sbjct  121  PCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKIRPPSRKLKTTYKAKKPNLFM  178



>emb|CDX75778.1| BnaC03g38610D [Brassica napus]
Length=258

 Score =   342 bits (877),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 160/179 (89%), Positives = 171/179 (96%), Gaps = 0/179 (0%)
 Frame = +3

Query  213  KMVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ  392
            +MV +RFHQYQVVGRALP+E D  PKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ
Sbjct  80   EMVAFRFHQYQVVGRALPTEKDVQPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ  139

Query  393  VLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVR  572
            +LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVR
Sbjct  140  MLAINEIFEKSPTKIKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVR  199

Query  573  HHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
              CIQIIKTAT+PA LCKRESTKQFHNSKIKFPLVF+KVRPP+RKLKTTYKAS+PN+F+
Sbjct  200  FPCIQIIKTATVPAGLCKRESTKQFHNSKIKFPLVFRKVRPPTRKLKTTYKASKPNLFM  258



>ref|XP_007147889.1| hypothetical protein PHAVU_006G163400g [Phaseolus vulgaris]
 gb|ESW19883.1| hypothetical protein PHAVU_006G163400g [Phaseolus vulgaris]
Length=178

 Score =   339 bits (869),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 160/178 (90%), Positives = 169/178 (95%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            MVT+RFHQYQVVGRALP+E D+HPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVTFRFHQYQVVGRALPTEADQHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFEK PTK+ NYGIWLRYQSRTGYHNMYKEFRDTTLNGAVE MY EMASRHRVR 
Sbjct  61   LAINEIFEKNPTKINNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEHMYNEMASRHRVRF  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
             CIQIIKTATIPAKLCKRESTKQF NSKIKFPLVFKK+RPPSRKLKTTYKA +PN+F+
Sbjct  121  PCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKIRPPSRKLKTTYKAKKPNLFM  178



>emb|CDX79564.1| BnaC03g19000D [Brassica napus]
Length=178

 Score =   338 bits (868),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 159/178 (89%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            MV +RFHQYQVVGRALP+E D  PKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVAFRFHQYQVVGRALPTEKDVQPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFEK PT +KN+GIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTNIKNFGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRF  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
             CIQIIKTAT+PAKLCKRESTKQFHNSKIKFPLVF+KVRPPSRKLKTTYKAS+PN+F+
Sbjct  121  PCIQIIKTATVPAKLCKRESTKQFHNSKIKFPLVFRKVRPPSRKLKTTYKASKPNLFM  178



>gb|AFK46978.1| unknown [Lotus japonicus]
Length=178

 Score =   338 bits (867),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 159/178 (89%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            MV ++FHQYQVVGRALP+ETD HPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVAFKFHQYQVVGRALPTETDVHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVE MY EMASRHRVR 
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEHMYNEMASRHRVRS  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
             CIQIIKTAT+ AKLCKRESTKQFHNSKIKFPLV+KK+RPP+RKLKTTYKASRPN+F+
Sbjct  121  PCIQIIKTATVEAKLCKRESTKQFHNSKIKFPLVYKKIRPPTRKLKTTYKASRPNLFM  178



>ref|XP_009146339.1| PREDICTED: 60S ribosomal protein L18a-2 [Brassica rapa]
Length=178

 Score =   338 bits (866),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 159/178 (89%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            MV + FHQYQVVGRALP+E D  PKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVAFGFHQYQVVGRALPTEKDVQPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKEFRDTTLNG+VEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEFRDTTLNGSVEQMYTEMASRHRVRF  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
             CIQIIKTAT+PAKLCKRESTKQFHNSKIKFPLVF+KVRPP+RKLKTTYKAS+PN+F+
Sbjct  121  PCIQIIKTATVPAKLCKRESTKQFHNSKIKFPLVFRKVRPPTRKLKTTYKASKPNLFM  178



>ref|XP_006841639.1| PREDICTED: 60S ribosomal protein L18a [Amborella trichopoda]
 gb|ERN03314.1| hypothetical protein AMTR_s00003p00234980 [Amborella trichopoda]
Length=178

 Score =   338 bits (866),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 158/178 (89%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            MV +RFHQYQVVGRALP+ T+EHPK+YRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVAFRFHQYQVVGRALPTPTEEHPKLYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASRHRVR+
Sbjct  61   LAINEIFEKKPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYNEMASRHRVRY  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
             CIQIIKTATIPAKLCKRE+TKQFH+SKIKFPLVF+K RPP+RKLKTT+KASRPN+F+
Sbjct  121  PCIQIIKTATIPAKLCKRENTKQFHDSKIKFPLVFRKFRPPTRKLKTTFKASRPNLFM  178



>ref|XP_006407062.1| hypothetical protein EUTSA_v10021546mg [Eutrema salsugineum]
 gb|ESQ48515.1| hypothetical protein EUTSA_v10021546mg [Eutrema salsugineum]
Length=178

 Score =   338 bits (866),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 159/178 (89%), Positives = 169/178 (95%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            MV +RFHQYQVVGRALP+E D  PKIYRMKLWATNEVRA SKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVAFRFHQYQVVGRALPTEKDVQPKIYRMKLWATNEVRAMSKFWYFLRKLKKVKKSNGQM  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRF  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
             CIQIIKTAT+PAKLCKRESTKQFHNSKIKFPLVF+KVRPP+RKLKTTYKAS+PN+F+
Sbjct  121  PCIQIIKTATVPAKLCKRESTKQFHNSKIKFPLVFRKVRPPTRKLKTTYKASKPNLFM  178



>ref|XP_009135390.1| PREDICTED: 60S ribosomal protein L18a-2-like [Brassica rapa]
Length=178

 Score =   337 bits (865),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 158/178 (89%), Positives = 169/178 (95%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            M  +RFHQYQVVGRALP+E D  PKIYRMKLWA+NEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MGAFRFHQYQVVGRALPTEKDVQPKIYRMKLWASNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKSPTKIKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRF  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
             CIQIIKTAT+PA LCKRESTKQFHNSKIKFPLVF+KVRPP+RKLKTTYKAS+PN+F+
Sbjct  121  PCIQIIKTATVPASLCKRESTKQFHNSKIKFPLVFRKVRPPTRKLKTTYKASKPNLFM  178



>ref|XP_004488610.1| PREDICTED: 60S ribosomal protein L18a-like isoform X2 [Cicer 
arietinum]
Length=178

 Score =   337 bits (865),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 158/178 (89%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            MV  +FHQYQVVGRALP+ET+EHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVNMKFHQYQVVGRALPTETEEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVE MY EMASRHRVR 
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVETMYNEMASRHRVRF  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
             CIQIIKTATIPA LCKRESTKQFHNSKIKFPLV+KK+RPP+RKLKTTYKA++PN+F+
Sbjct  121  PCIQIIKTATIPANLCKRESTKQFHNSKIKFPLVYKKIRPPTRKLKTTYKATKPNLFM  178



>ref|XP_009132991.1| PREDICTED: 60S ribosomal protein L18a-2-like [Brassica rapa]
Length=178

 Score =   337 bits (864),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 159/178 (89%), Positives = 169/178 (95%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            MV +RFHQYQVVGRALP+E D  PKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVAFRFHQYQVVGRALPTEKDVQPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFEK PT +KN+GIWLRYQSRTGYHNMYKE RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTTIKNFGIWLRYQSRTGYHNMYKESRDTTLNGAVEQMYTEMASRHRVRF  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
             CIQIIKTAT+PAKLCKRESTKQFHNSKIKFPLVF+KVRPPSRKLKTTYKAS+PN+F+
Sbjct  121  PCIQIIKTATVPAKLCKRESTKQFHNSKIKFPLVFRKVRPPSRKLKTTYKASKPNLFM  178



>ref|XP_006595492.1| PREDICTED: uncharacterized protein LOC100305604 isoform X1 [Glycine 
max]
Length=753

 Score =   355 bits (912),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 166/180 (92%), Positives = 175/180 (97%), Gaps = 0/180 (0%)
 Frame = +3

Query  210  AKMVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNG  389
            A+MV  RFHQYQVVGRALP+E+DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNG
Sbjct  574  AEMVAMRFHQYQVVGRALPTESDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNG  633

Query  390  QVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRV  569
            QVLAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVE MYTEMASRHRV
Sbjct  634  QVLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEHMYTEMASRHRV  693

Query  570  RHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
            RH CIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKK+RPP+RKLKTTYKASRPN+F+
Sbjct  694  RHPCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKIRPPTRKLKTTYKASRPNLFM  753



>ref|XP_006298665.1| hypothetical protein CARUB_v10014756mg [Capsella rubella]
 gb|EOA31563.1| hypothetical protein CARUB_v10014756mg [Capsella rubella]
Length=178

 Score =   336 bits (861),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 158/178 (89%), Positives = 169/178 (95%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            M  +RFHQYQVVGRALP+E DEHPKIYRMKLW TNEV AKSKFWYF+RKLKKVKKSNGQ+
Sbjct  1    MGAFRFHQYQVVGRALPTEKDEHPKIYRMKLWGTNEVCAKSKFWYFMRKLKKVKKSNGQM  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRF  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
             CIQIIKTAT+PAKLCKRESTKQFHNSKIKFPLVF+KVRPPSRKLKTTYKAS+PN+F+
Sbjct  121  PCIQIIKTATVPAKLCKRESTKQFHNSKIKFPLVFRKVRPPSRKLKTTYKASKPNLFM  178



>gb|KFK36339.1| hypothetical protein AALP_AA4G109800 [Arabis alpina]
Length=178

 Score =   336 bits (861),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 158/178 (89%), Positives = 169/178 (95%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            M T+RFHQYQVVGRALP+E D  PKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MGTFRFHQYQVVGRALPTEKDVQPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFEK PT +KN+GIWLRYQSRTGYHNMYKE+RDTTLNG VEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTTIKNFGIWLRYQSRTGYHNMYKEYRDTTLNGGVEQMYTEMASRHRVRF  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
             CIQIIKTAT+PAKLCKRESTKQFHNSKIKFPLVF+KVRPPSRKLKTTYKAS+PN+F+
Sbjct  121  PCIQIIKTATVPAKLCKRESTKQFHNSKIKFPLVFRKVRPPSRKLKTTYKASKPNLFM  178



>ref|XP_008229704.1| PREDICTED: uncharacterized protein LOC103329046 [Prunus mume]
Length=776

 Score =   356 bits (913),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 168/183 (92%), Positives = 175/183 (96%), Gaps = 0/183 (0%)
 Frame = +3

Query  201  SVVAKMVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK  380
            S  ++MVT+RFHQYQVVGRALPSE DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK
Sbjct  594  SPTSQMVTFRFHQYQVVGRALPSEKDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK  653

Query  381  SNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  560
            SNGQVLAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVE MYTEMASR
Sbjct  654  SNGQVLAINEIFEKSPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEDMYTEMASR  713

Query  561  HRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPN  740
            HRVR  CIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPP+RKLKTTYKA+RPN
Sbjct  714  HRVRSPCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPTRKLKTTYKATRPN  773

Query  741  IFV  749
            IFV
Sbjct  774  IFV  776



>gb|KEH33554.1| 60S ribosomal protein L18a-3 [Medicago truncatula]
Length=176

 Score =   335 bits (860),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 157/174 (90%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = +3

Query  228  RFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAIN  407
            ++HQYQVVGRALP+E DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAIN
Sbjct  3    QYHQYQVVGRALPTEKDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAIN  62

Query  408  EIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQ  587
            EIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVE MY EMASRHRVRH CIQ
Sbjct  63   EIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEYMYNEMASRHRVRHPCIQ  122

Query  588  IIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
            IIKTATIPA LCKRESTKQFHNSKIKFPLVFKK+RPP+RKLKTTYKA++PN+F+
Sbjct  123  IIKTATIPANLCKRESTKQFHNSKIKFPLVFKKIRPPTRKLKTTYKATKPNMFM  176



>ref|XP_011085620.1| PREDICTED: 60S ribosomal protein L18a-like [Sesamum indicum]
Length=175

 Score =   335 bits (859),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 160/178 (90%), Positives = 171/178 (96%), Gaps = 3/178 (2%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            MVTYR   YQVVGR+LP+ET+EHPKIYRMKLWA NEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVTYR---YQVVGRSLPTETEEHPKIYRMKLWAPNEVRAKSKFWYFLRKLKKVKKSNGQI  57

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  58   LAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRP  117

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
            HCIQIIKTATIPAKLCKRESTKQFH+SKIKFPLVF+KVRPP+RKLKTTYKASRPN+F+
Sbjct  118  HCIQIIKTATIPAKLCKRESTKQFHDSKIKFPLVFRKVRPPTRKLKTTYKASRPNLFM  175



>ref|XP_011628903.1| PREDICTED: 60S ribosomal protein L18a [Amborella trichopoda]
Length=178

 Score =   335 bits (859),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 156/178 (88%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            MV +RFHQYQVVGRALP+  +EHPK+YRMKLWATN+VRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVAFRFHQYQVVGRALPTACEEHPKLYRMKLWATNDVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASRHRVR 
Sbjct  61   LAINEIFEKKPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYNEMASRHRVRS  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
             CIQIIKTATIPAKLCKRE+TKQFH+S+IKFPLVF+KVRPP+RKLKTT+KASRPN+F+
Sbjct  121  PCIQIIKTATIPAKLCKRENTKQFHDSRIKFPLVFRKVRPPTRKLKTTFKASRPNLFM  178



>ref|XP_006601742.1| PREDICTED: uncharacterized protein LOC100306365 isoform X1 [Glycine 
max]
Length=184

 Score =   335 bits (858),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 158/174 (91%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = +3

Query  228  RFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAIN  407
            +FHQYQVVGRALP+ETD HPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+LAIN
Sbjct  11   QFHQYQVVGRALPTETDVHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQMLAIN  70

Query  408  EIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQ  587
            EIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVE MY EMASRHRVR  CIQ
Sbjct  71   EIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEHMYNEMASRHRVRSPCIQ  130

Query  588  IIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
            IIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPP+RKLKTTYKA++PN+F+
Sbjct  131  IIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPTRKLKTTYKATKPNLFM  184



>ref|XP_009141387.1| PREDICTED: 60S ribosomal protein L18a-2 [Brassica rapa]
 ref|XP_009143771.1| PREDICTED: 60S ribosomal protein L18a-2 [Brassica rapa]
Length=178

 Score =   334 bits (857),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 157/178 (88%), Positives = 169/178 (95%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            M  +RFHQYQVVGRALP+E D  PKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MGAFRFHQYQVVGRALPTEKDVQPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFEK PT +KN+GIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTTIKNFGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRF  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
             CIQIIKTAT+PAKLCKRESTKQFHNSKIKFPLVF+KVRPP+RKLKTTYKAS+PN+F+
Sbjct  121  PCIQIIKTATVPAKLCKRESTKQFHNSKIKFPLVFRKVRPPTRKLKTTYKASKPNLFM  178



>ref|XP_006295085.1| hypothetical protein CARUB_v10024156mg [Capsella rubella]
 gb|EOA27983.1| hypothetical protein CARUB_v10024156mg [Capsella rubella]
Length=178

 Score =   334 bits (857),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 157/178 (88%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            M T+RFHQYQVVGRALP+E D  PKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MGTFRFHQYQVVGRALPTEKDVQPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEI+EK PT +KN+GIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIYEKNPTTIKNFGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRF  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
             CIQIIKTAT+PAKLCKRESTKQFHNSKIKFPLVF+KVRPPSRKLKTTYKA++PN+F+
Sbjct  121  PCIQIIKTATVPAKLCKRESTKQFHNSKIKFPLVFRKVRPPSRKLKTTYKANKPNLFM  178



>ref|XP_010465351.1| PREDICTED: 60S ribosomal protein L18a-3 [Camelina sativa]
Length=178

 Score =   334 bits (856),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 158/178 (89%), Positives = 168/178 (94%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            M  +RFHQYQVVGRALP+E DEHPKIYRMKLW  NEV AKSKFWYF+RKLKKVKKSNGQ+
Sbjct  1    MGVFRFHQYQVVGRALPTEKDEHPKIYRMKLWGKNEVCAKSKFWYFMRKLKKVKKSNGQM  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRF  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
             CIQIIKTAT+PAKLCKRESTKQFHNSKIKFPLVF+KVRPPSRKLKTTYKASRPN+F+
Sbjct  121  PCIQIIKTATVPAKLCKRESTKQFHNSKIKFPLVFRKVRPPSRKLKTTYKASRPNLFM  178



>ref|XP_006467486.1| PREDICTED: 60S ribosomal protein L18a-2-like isoform X2 [Citrus 
sinensis]
Length=307

 Score =   339 bits (869),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 170/173 (98%), Gaps = 0/173 (0%)
 Frame = +3

Query  231  FHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINE  410
            FHQYQVVGRALP+E+DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+LAINE
Sbjct  135  FHQYQVVGRALPTESDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQMLAINE  194

Query  411  IFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQI  590
            IFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR  CIQI
Sbjct  195  IFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRSPCIQI  254

Query  591  IKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
            IKTATIPAKLCKRESTKQFHNSKIKFPLVF+KVRPPSRKL+TTYKA+RPN+F+
Sbjct  255  IKTATIPAKLCKRESTKQFHNSKIKFPLVFRKVRPPSRKLRTTYKATRPNLFM  307



>ref|XP_003597433.1| 60S ribosomal protein L18a [Medicago truncatula]
 ref|XP_003617397.1| 60S ribosomal protein L18a [Medicago truncatula]
 gb|ACJ84852.1| unknown [Medicago truncatula]
 gb|AES67684.1| 60S ribosomal protein L18a-3 [Medicago truncatula]
 gb|AET00356.1| 60S ribosomal protein L18a-3 [Medicago truncatula]
 gb|AFK39885.1| unknown [Medicago truncatula]
 gb|AFK41441.1| unknown [Medicago truncatula]
 gb|AFK43765.1| unknown [Medicago truncatula]
 gb|AFK46613.1| unknown [Medicago truncatula]
 gb|KEH28400.1| 60S ribosomal protein L18a-3 [Medicago truncatula]
Length=178

 Score =   334 bits (856),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 157/178 (88%), Positives = 167/178 (94%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            MV  +FHQYQVVGRALP+E DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVNAKFHQYQVVGRALPTEKDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVE MY EMASRHRVR 
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVETMYNEMASRHRVRF  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
             CIQIIKTATIPA LCKRESTKQFHNSKIKFPLV+KK+RPP+R LKTTYKA +PN+F+
Sbjct  121  PCIQIIKTATIPANLCKRESTKQFHNSKIKFPLVYKKIRPPTRSLKTTYKAKKPNLFM  178



>ref|XP_008465452.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Cucumis 
melo]
Length=751

 Score =   353 bits (905),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 165/179 (92%), Positives = 176/179 (98%), Gaps = 0/179 (0%)
 Frame = +3

Query  213  KMVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ  392
            KMVT+RFHQYQVVGRALPSE+DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ
Sbjct  573  KMVTFRFHQYQVVGRALPSESDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ  632

Query  393  VLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVR  572
            +LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR
Sbjct  633  ILAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVR  692

Query  573  HHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
              CIQIIKTAT+PAKLCKRESTKQFHNSKIKFPLV+KKVRPP+RKLKTTYKAS+PN+F+
Sbjct  693  CPCIQIIKTATVPAKLCKRESTKQFHNSKIKFPLVYKKVRPPTRKLKTTYKASKPNLFM  751



>ref|XP_004488609.1| PREDICTED: 60S ribosomal protein L18a-like isoform X1 [Cicer 
arietinum]
Length=182

 Score =   334 bits (856),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 156/179 (87%), Positives = 171/179 (96%), Gaps = 0/179 (0%)
 Frame = +3

Query  213  KMVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ  392
            +++  +FHQYQVVGRALP+ET+EHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ
Sbjct  4    RLLLKQFHQYQVVGRALPTETEEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ  63

Query  393  VLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVR  572
            VLAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVE MY EMASRHRVR
Sbjct  64   VLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVETMYNEMASRHRVR  123

Query  573  HHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
              CIQIIKTATIPA LCKRESTKQFHNSKIKFPLV+KK+RPP+RKLKTTYKA++PN+F+
Sbjct  124  FPCIQIIKTATIPANLCKRESTKQFHNSKIKFPLVYKKIRPPTRKLKTTYKATKPNLFM  182



>ref|XP_010542335.1| PREDICTED: 60S ribosomal protein L18a-2 isoform X3 [Tarenaya 
hassleriana]
Length=316

 Score =   338 bits (868),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 170/173 (98%), Gaps = 0/173 (0%)
 Frame = +3

Query  231  FHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINE  410
            FHQYQVVGRALP+ETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+LAINE
Sbjct  144  FHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQMLAINE  203

Query  411  IFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQI  590
            IFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR  CIQI
Sbjct  204  IFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRFPCIQI  263

Query  591  IKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
            IKTAT+PAKLCKRESTKQFHNSKIKFPLVF+KVRPP+RKLKTTYKAS+PN+F+
Sbjct  264  IKTATVPAKLCKRESTKQFHNSKIKFPLVFRKVRPPTRKLKTTYKASKPNLFM  316



>ref|XP_002276545.1| PREDICTED: 60S ribosomal protein L18a isoform X2 [Vitis vinifera]
Length=299

 Score =   337 bits (865),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 161/176 (91%), Positives = 168/176 (95%), Gaps = 0/176 (0%)
 Frame = +3

Query  222  TYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLA  401
            T  FHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLA
Sbjct  124  TIAFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLA  183

Query  402  INEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHC  581
            INEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASRHRVR  C
Sbjct  184  INEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYAEMASRHRVRSPC  243

Query  582  IQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
            IQIIKTATIPAKLCKRES+KQFHNSKIKFPL F+KVRPP+RKLKTTYKASRPN+F+
Sbjct  244  IQIIKTATIPAKLCKRESSKQFHNSKIKFPLTFRKVRPPTRKLKTTYKASRPNLFM  299



>ref|XP_006574359.1| PREDICTED: uncharacterized protein LOC100527007 isoform X1 [Glycine 
max]
Length=784

 Score =   353 bits (905),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 166/179 (93%), Positives = 174/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  213  KMVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ  392
            KMV  RFHQYQVVGRALP+E+DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ
Sbjct  606  KMVAMRFHQYQVVGRALPTESDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ  665

Query  393  VLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVR  572
            VLAINEIFE+ PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVE MYTEMASRHRVR
Sbjct  666  VLAINEIFERNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEHMYTEMASRHRVR  725

Query  573  HHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
            H CIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPP+RKLKTTYKASRPN+F+
Sbjct  726  HPCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPTRKLKTTYKASRPNLFM  784



>ref|NP_180995.1| 60S ribosomal protein L18a-2 [Arabidopsis thaliana]
 ref|XP_002881337.1| 60S ribosomal protein L18A [Arabidopsis lyrata subsp. lyrata]
 sp|P51418.2|R18A2_ARATH RecName: Full=60S ribosomal protein L18a-2 [Arabidopsis thaliana]
 gb|AAC26708.1| 60S ribosomal protein L18A [Arabidopsis thaliana]
 gb|AAK68743.1| Unknown protein [Arabidopsis thaliana]
 gb|AAM14956.1| 60S ribosomal protein L18A [Arabidopsis thaliana]
 gb|AAM53336.1| 60S ribosomal protein L18A [Arabidopsis thaliana]
 gb|AAN15395.1| 60S ribosomal protein L18A [Arabidopsis thaliana]
 gb|AAP21367.1| At2g34480 [Arabidopsis thaliana]
 gb|EFH57596.1| 60S ribosomal protein L18A [Arabidopsis lyrata subsp. lyrata]
 gb|AEC08980.1| 60S ribosomal protein L18a-2 [Arabidopsis thaliana]
Length=178

 Score =   333 bits (853),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 156/178 (88%), Positives = 169/178 (95%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            M  +RFHQYQVVGRALP+E D  PKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MGAFRFHQYQVVGRALPTEKDVQPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEI+EK PT +KN+GIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIYEKNPTTIKNFGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRF  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
             CIQIIKTAT+PAKLCKRESTKQFHNSKIKFPLVF+KVRPPSRKLKTTYKA++PN+F+
Sbjct  121  PCIQIIKTATVPAKLCKRESTKQFHNSKIKFPLVFRKVRPPSRKLKTTYKANKPNLFM  178



>ref|XP_004303886.1| PREDICTED: 60S ribosomal protein L18a-2 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=178

 Score =   333 bits (853),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 156/178 (88%), Positives = 167/178 (94%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            M  +R+HQYQVVGRALP+E DEHPKI+RMKLW TNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MAPFRYHQYQVVGRALPTEKDEHPKIFRMKLWHTNEVRAKSKFWYFLRKLKKVKKSNGQI  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFEK PT + NYGIWLRYQSRTGYHNMYKE+R+TTLNGAVE MYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTTINNYGIWLRYQSRTGYHNMYKEYRNTTLNGAVEDMYTEMASRHRVRS  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
             CIQIIKTATIPAKLCKRESTKQFHNSKIKFPLV +K+RPPSRKLKTTYKASRPNIF+
Sbjct  121  PCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVLRKIRPPSRKLKTTYKASRPNIFM  178



>gb|KFK44821.1| hypothetical protein AALP_AA1G307200 [Arabis alpina]
Length=178

 Score =   332 bits (851),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 156/178 (88%), Positives = 168/178 (94%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            M  +RFHQYQVVGRALPSE +  PKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MGAFRFHQYQVVGRALPSEKELQPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFEK PT +KN+GIWLRYQSRTGYHNMYKE+RDTTLNG VEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTTIKNFGIWLRYQSRTGYHNMYKEYRDTTLNGGVEQMYTEMASRHRVRF  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
             CIQIIKTAT+PAKLCKRESTKQFHNSKIKFPLVF+KVRPP+RKLKTTYKAS+PN+F+
Sbjct  121  PCIQIIKTATVPAKLCKRESTKQFHNSKIKFPLVFRKVRPPTRKLKTTYKASKPNLFM  178



>ref|XP_010504908.1| PREDICTED: 60S ribosomal protein L18a-2 [Camelina sativa]
 ref|XP_010509745.1| PREDICTED: 60S ribosomal protein L18a-2 [Camelina sativa]
 ref|XP_010516589.1| PREDICTED: 60S ribosomal protein L18a-2 isoform X1 [Camelina 
sativa]
 ref|XP_010516590.1| PREDICTED: 60S ribosomal protein L18a-2 isoform X2 [Camelina 
sativa]
Length=178

 Score =   332 bits (851),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 156/178 (88%), Positives = 169/178 (95%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            M  +RFHQYQVVGRALP+E D  PKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MGLFRFHQYQVVGRALPTEKDVQPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEI+EK PT +KN+GIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIYEKNPTTIKNFGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRF  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
             CIQIIKTAT+PAKLCKRESTKQFHNSKIKFPLVF+KVRPPSRKLKTTYKA++PN+F+
Sbjct  121  PCIQIIKTATVPAKLCKRESTKQFHNSKIKFPLVFRKVRPPSRKLKTTYKANKPNLFM  178



>ref|XP_002519698.1| 60S ribosomal protein L18a, putative [Ricinus communis]
 gb|EEF42671.1| 60S ribosomal protein L18a, putative [Ricinus communis]
Length=303

 Score =   336 bits (862),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 167/173 (97%), Gaps = 0/173 (0%)
 Frame = +3

Query  231  FHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINE  410
            FHQYQVVGR LP+E D+HPKIYRMKLWATNE RAKSKFWYFLRKLKKVKKSNGQVLAINE
Sbjct  131  FHQYQVVGRGLPTEADDHPKIYRMKLWATNEFRAKSKFWYFLRKLKKVKKSNGQVLAINE  190

Query  411  IFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQI  590
            IFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR  CIQI
Sbjct  191  IFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRFPCIQI  250

Query  591  IKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
            IKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPP+RKLKTTYKASRPN+F+
Sbjct  251  IKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPTRKLKTTYKASRPNLFM  303



>ref|XP_012072094.1| PREDICTED: 60S ribosomal protein L18a isoform X2 [Jatropha curcas]
Length=311

 Score =   336 bits (862),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 159/173 (92%), Positives = 167/173 (97%), Gaps = 0/173 (0%)
 Frame = +3

Query  231  FHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINE  410
            FHQYQVVGR LP+E DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINE
Sbjct  139  FHQYQVVGRGLPTENDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINE  198

Query  411  IFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQI  590
            IFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR  CIQI
Sbjct  199  IFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRFPCIQI  258

Query  591  IKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
            IKT TIPAKLCKRES+KQFHNSKIKFPLVFKKVRPP+RKL+TTYKASRPN+F+
Sbjct  259  IKTGTIPAKLCKRESSKQFHNSKIKFPLVFKKVRPPTRKLRTTYKASRPNLFM  311



>ref|XP_006407063.1| hypothetical protein EUTSA_v10021546mg [Eutrema salsugineum]
 gb|ESQ48516.1| hypothetical protein EUTSA_v10021546mg [Eutrema salsugineum]
Length=203

 Score =   332 bits (852),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 156/173 (90%), Positives = 165/173 (95%), Gaps = 0/173 (0%)
 Frame = +3

Query  231  FHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINE  410
            FHQYQVVGRALP+E D  PKIYRMKLWATNEVRA SKFWYFLRKLKKVKKSNGQ+LAINE
Sbjct  31   FHQYQVVGRALPTEKDVQPKIYRMKLWATNEVRAMSKFWYFLRKLKKVKKSNGQMLAINE  90

Query  411  IFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQI  590
            IFEK PT +KNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVR  CIQI
Sbjct  91   IFEKNPTTIKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRFPCIQI  150

Query  591  IKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
            IKTAT+PAKLCKRESTKQFHNSKIKFPLVF+KVRPP+RKLKTTYKAS+PN+F+
Sbjct  151  IKTATVPAKLCKRESTKQFHNSKIKFPLVFRKVRPPTRKLKTTYKASKPNLFM  203



>ref|XP_010052072.1| PREDICTED: 60S ribosomal protein L18a-2-like isoform X2 [Eucalyptus 
grandis]
Length=317

 Score =   336 bits (861),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 167/173 (97%), Gaps = 0/173 (0%)
 Frame = +3

Query  231  FHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINE  410
            FHQYQVVGRALP+  DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINE
Sbjct  145  FHQYQVVGRALPTGADEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINE  204

Query  411  IFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQI  590
            IFEK PTK+ NYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR  CIQI
Sbjct  205  IFEKNPTKINNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRFPCIQI  264

Query  591  IKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
            IKTAT+PAKLCKRESTKQFHNSKIKFPLVFKKVRPP+RKLKTTYKASRPN+F+
Sbjct  265  IKTATVPAKLCKRESTKQFHNSKIKFPLVFKKVRPPTRKLKTTYKASRPNLFM  317



>ref|XP_006484924.1| PREDICTED: uncharacterized protein LOC102625748 [Citrus sinensis]
Length=820

 Score =   351 bits (901),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 164/181 (91%), Positives = 176/181 (97%), Gaps = 0/181 (0%)
 Frame = +3

Query  207  VAKMVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSN  386
            ++ MVT+RFHQYQVVGRALP+ETDEHPKIYRMKLWATNEVRAKSKFWY+LRKLKKVKKSN
Sbjct  640  LSLMVTFRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYYLRKLKKVKKSN  699

Query  387  GQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHR  566
            GQVLAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASRHR
Sbjct  700  GQVLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYNEMASRHR  759

Query  567  VRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIF  746
            VR  CIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVF+KVRPP+RKL+TTYKASRPN+F
Sbjct  760  VRSPCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFRKVRPPTRKLRTTYKASRPNLF  819

Query  747  V  749
            +
Sbjct  820  M  820



>ref|XP_009360876.1| PREDICTED: 60S ribosomal protein L18a-2 isoform X2 [Pyrus x bretschneideri]
Length=321

 Score =   335 bits (860),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 161/176 (91%), Positives = 167/176 (95%), Gaps = 0/176 (0%)
 Frame = +3

Query  222  TYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLA  401
            T  FHQYQVVGR LP+ETDE PKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLA
Sbjct  146  TIAFHQYQVVGRKLPTETDEQPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLA  205

Query  402  INEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHC  581
            INEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASRHRVR  C
Sbjct  206  INEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYIEMASRHRVRFPC  265

Query  582  IQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
            IQIIKTATIPAKLCKRESTKQFHNSKIKFPLVF+KVRPPSRKLKTTYKASRPN+F+
Sbjct  266  IQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFRKVRPPSRKLKTTYKASRPNLFM  321



>ref|XP_008371597.1| PREDICTED: 60S ribosomal protein L18a-2 isoform X2 [Malus domestica]
Length=315

 Score =   335 bits (860),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 161/176 (91%), Positives = 167/176 (95%), Gaps = 0/176 (0%)
 Frame = +3

Query  222  TYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLA  401
            T  FHQYQVVGR LP+ETDE PKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLA
Sbjct  140  TIAFHQYQVVGRKLPTETDEQPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLA  199

Query  402  INEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHC  581
            INEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASRHRVR  C
Sbjct  200  INEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYIEMASRHRVRFPC  259

Query  582  IQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
            IQIIKTATIPAKLCKRESTKQFHNSKIKFPLVF+KVRPPSRKLKTTYKASRPN+F+
Sbjct  260  IQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFRKVRPPSRKLKTTYKASRPNLFM  315



>ref|XP_008225468.1| PREDICTED: 60S ribosomal protein L18a isoform X2 [Prunus mume]
Length=320

 Score =   335 bits (860),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 161/176 (91%), Positives = 167/176 (95%), Gaps = 0/176 (0%)
 Frame = +3

Query  222  TYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLA  401
            T  FHQYQVVGR LP+ +DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLA
Sbjct  145  TIAFHQYQVVGRKLPTASDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLA  204

Query  402  INEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHC  581
            INEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASRHRVR  C
Sbjct  205  INEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYIEMASRHRVRFPC  264

Query  582  IQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
            IQIIKTATIPAKLCKRESTKQFHNSKIKFPLVF+KVRPPSRKLKTTYKASRPN+FV
Sbjct  265  IQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFRKVRPPSRKLKTTYKASRPNLFV  320



>ref|XP_010499515.1| PREDICTED: 60S ribosomal protein L18a-1 [Camelina sativa]
 ref|XP_010478371.1| PREDICTED: 60S ribosomal protein L18a-1 [Camelina sativa]
Length=178

 Score =   330 bits (846),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 155/178 (87%), Positives = 166/178 (93%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            M  +R HQYQVVGRALP+E DE PKIYRMKLWATNEV AKSKFWYFLR+ KKVKKSNGQ+
Sbjct  1    MGVFRLHQYQVVGRALPTEKDEQPKIYRMKLWATNEVLAKSKFWYFLRRQKKVKKSNGQM  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFEK PT +KN+GIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTTIKNFGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRF  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
             CIQIIKTAT+PA LCKRESTKQFHNSKIKFPLVF+KVRPP+RKLKTTYKASRPN+F+
Sbjct  121  PCIQIIKTATVPANLCKRESTKQFHNSKIKFPLVFRKVRPPTRKLKTTYKASRPNLFM  178



>ref|XP_010501986.1| PREDICTED: 60S ribosomal protein L18a-3-like [Camelina sativa]
Length=178

 Score =   329 bits (844),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 155/178 (87%), Positives = 166/178 (93%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            M  +RFHQYQVVGRALP+E DEHPKIYRMKLW  NEV A SKFWYF+RKLKKVKKSNGQ+
Sbjct  1    MGAFRFHQYQVVGRALPTEKDEHPKIYRMKLWGKNEVCAMSKFWYFMRKLKKVKKSNGQM  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRF  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
             CIQIIKTAT+PAKLCKRESTKQFHNS+IKFPLVF+KVRPPSR LKTTYKASRPN+F+
Sbjct  121  PCIQIIKTATVPAKLCKRESTKQFHNSEIKFPLVFRKVRPPSRMLKTTYKASRPNLFM  178



>ref|XP_002440257.1| hypothetical protein SORBIDRAFT_09g028590 [Sorghum bicolor]
 gb|EES18687.1| hypothetical protein SORBIDRAFT_09g028590 [Sorghum bicolor]
Length=178

 Score =   329 bits (844),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 154/178 (87%), Positives = 169/178 (95%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            MV +RFHQYQVVGRALP+ TDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVAHRFHQYQVVGRALPTPTDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFE+ PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASRHRVR 
Sbjct  61   LAINEIFERNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYNEMASRHRVRS  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
             CIQIIKTAT+  KLCKR++TKQFHNSKIKFPLV++KVRPP+RKLKTT+KASRPN+F+
Sbjct  121  PCIQIIKTATVHFKLCKRDNTKQFHNSKIKFPLVYRKVRPPTRKLKTTFKASRPNLFM  178



>ref|NP_188078.1| 60S ribosomal protein L18a-3 [Arabidopsis thaliana]
 sp|Q9LUD4.1|R18A3_ARATH RecName: Full=60S ribosomal protein L18a-3 [Arabidopsis thaliana]
 dbj|BAB02392.1| 60S ribosomal protein L18A-like [Arabidopsis thaliana]
 gb|AAL60048.1| AT3g14600/MIE1_10 [Arabidopsis thaliana]
 gb|AAM19893.1| AT3g14600/MIE1_10 [Arabidopsis thaliana]
 gb|AEE75546.1| 60S ribosomal protein L18a-3 [Arabidopsis thaliana]
Length=178

 Score =   329 bits (843),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 155/178 (87%), Positives = 166/178 (93%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            M  +RFHQYQVVGRALP+E DEHPKIYRMKLW  NEV AKSKFWYF+RKLKKVKKSNGQ+
Sbjct  1    MGGFRFHQYQVVGRALPTENDEHPKIYRMKLWGRNEVCAKSKFWYFMRKLKKVKKSNGQM  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNG VEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGGVEQMYTEMASRHRVRF  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
             CIQIIKTAT+PAKLCKRE TKQFHNSKIKFPLVF+KVRPPSRKLKTTYKAS+PN+F+
Sbjct  121  PCIQIIKTATVPAKLCKREITKQFHNSKIKFPLVFRKVRPPSRKLKTTYKASKPNLFM  178



>ref|NP_001056335.1| Os05g0565000 [Oryza sativa Japonica Group]
 gb|AAT77404.1| putative 60S ribosomal protein L18a [Oryza sativa Japonica Group]
 dbj|BAF18249.1| Os05g0565000 [Oryza sativa Japonica Group]
 gb|EAY99039.1| hypothetical protein OsI_20997 [Oryza sativa Indica Group]
 dbj|BAG95664.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE64706.1| hypothetical protein OsJ_19561 [Oryza sativa Japonica Group]
Length=178

 Score =   329 bits (843),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 154/178 (87%), Positives = 168/178 (94%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            MV YRFHQYQVVGRALP+  DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVAYRFHQYQVVGRALPTPGDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFE+ PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFERNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRF  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
             CIQIIKTAT+  KLCKR++TKQFHNS IKFPLV++KVRPP+RKLKTT+KASRPN+F+
Sbjct  121  PCIQIIKTATVHFKLCKRDNTKQFHNSNIKFPLVYRKVRPPTRKLKTTFKASRPNLFM  178



>gb|EMS54441.1| 60S ribosomal protein L18a [Triticum urartu]
Length=178

 Score =   328 bits (842),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 154/178 (87%), Positives = 168/178 (94%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            MV +RFHQYQVVGRALP+  DE PKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVAFRFHQYQVVGRALPTPGDEQPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRS  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
             CIQIIKTAT+  KLCKR++TKQFHNSKIKFPLV++KVRPP+RKLKTTYKA+RPN+F+
Sbjct  121  PCIQIIKTATVNFKLCKRDNTKQFHNSKIKFPLVYQKVRPPTRKLKTTYKATRPNLFM  178



>ref|XP_002449311.1| hypothetical protein SORBIDRAFT_05g007540 [Sorghum bicolor]
 gb|EES08299.1| hypothetical protein SORBIDRAFT_05g007540 [Sorghum bicolor]
Length=178

 Score =   328 bits (842),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 153/178 (86%), Positives = 168/178 (94%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            MV +RFHQYQVVGRALP+  DEHPKIYRMKLWATNEVR+KSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVAHRFHQYQVVGRALPTPADEHPKIYRMKLWATNEVRSKSKFWYFLRKLKKVKKSNGQV  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFE+ PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASRHRVR 
Sbjct  61   LAINEIFERNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYNEMASRHRVRS  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
             CIQIIKTAT+  KLCKR++TKQFHNSKIKFPLV++KVRPP+RKLKTT+KASRPN+F+
Sbjct  121  PCIQIIKTATVDFKLCKRDNTKQFHNSKIKFPLVYRKVRPPTRKLKTTFKASRPNLFM  178



>gb|ABK26330.1| unknown [Picea sitchensis]
 gb|ABR16921.1| unknown [Picea sitchensis]
 gb|ABR17139.1| unknown [Picea sitchensis]
Length=178

 Score =   328 bits (841),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 151/178 (85%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            MV +RFHQYQVVGR+LP+ TDEHPKI+RMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVNFRFHQYQVVGRSLPTPTDEHPKIFRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQI  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFEK PT +KN+GIWLRYQSRTGYHNMYKE+RDTTLNGAV+QMY EMASRHRVR+
Sbjct  61   LAINEIFEKNPTTIKNFGIWLRYQSRTGYHNMYKEYRDTTLNGAVQQMYDEMASRHRVRY  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
             CIQIIKTATIP +LCKRE+TKQF +SKIKFPLV++KVRPP+RKLKTT+KASRPN+F+
Sbjct  121  PCIQIIKTATIPNELCKRENTKQFQDSKIKFPLVYRKVRPPTRKLKTTFKASRPNLFM  178



>ref|XP_004303885.2| PREDICTED: 60S ribosomal protein L18a-2 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=181

 Score =   328 bits (840),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 154/174 (89%), Positives = 165/174 (95%), Gaps = 0/174 (0%)
 Frame = +3

Query  228  RFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAIN  407
            ++HQYQVVGRALP+E DEHPKI+RMKLW TNEVRAKSKFWYFLRKLKKVKKSNGQ+LAIN
Sbjct  8    QYHQYQVVGRALPTEKDEHPKIFRMKLWHTNEVRAKSKFWYFLRKLKKVKKSNGQILAIN  67

Query  408  EIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQ  587
            EIFEK PT + NYGIWLRYQSRTGYHNMYKE+R+TTLNGAVE MYTEMASRHRVR  CIQ
Sbjct  68   EIFEKNPTTINNYGIWLRYQSRTGYHNMYKEYRNTTLNGAVEDMYTEMASRHRVRSPCIQ  127

Query  588  IIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
            IIKTATIPAKLCKRESTKQFHNSKIKFPLV +K+RPPSRKLKTTYKASRPNIF+
Sbjct  128  IIKTATIPAKLCKRESTKQFHNSKIKFPLVLRKIRPPSRKLKTTYKASRPNIFM  181



>ref|XP_002882886.1| 60S ribosomal protein L18A [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59145.1| 60S ribosomal protein L18A [Arabidopsis lyrata subsp. lyrata]
Length=178

 Score =   328 bits (840),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 154/178 (87%), Positives = 166/178 (93%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            M  +RFHQYQVVGRALP+E DEHPKIYRMKLW  NEV AKSKFWYF+RKLKKVKKSNGQ+
Sbjct  1    MGAFRFHQYQVVGRALPTEKDEHPKIYRMKLWGRNEVCAKSKFWYFMRKLKKVKKSNGQM  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNG VEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGGVEQMYTEMASRHRVRF  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
             CIQIIKTAT+PAKLCKRE TKQFHNSKIKFPLVF+KVRPP+RKLKTTYKAS+PN+F+
Sbjct  121  PCIQIIKTATVPAKLCKREITKQFHNSKIKFPLVFRKVRPPTRKLKTTYKASKPNLFM  178



>ref|NP_001149475.1| LOC100283101 [Zea mays]
 ref|XP_002458279.1| hypothetical protein SORBIDRAFT_03g030600 [Sorghum bicolor]
 gb|ACF85683.1| unknown [Zea mays]
 gb|ACF85980.1| unknown [Zea mays]
 gb|ACG29474.1| 60S ribosomal protein L18a [Zea mays]
 gb|ACG35503.1| 60S ribosomal protein L18a [Zea mays]
 gb|ACG35547.1| 60S ribosomal protein L18a [Zea mays]
 gb|EES03399.1| hypothetical protein SORBIDRAFT_03g030600 [Sorghum bicolor]
 tpg|DAA58211.1| TPA: hypothetical protein ZEAMMB73_000159 [Zea mays]
Length=178

 Score =   327 bits (839),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 153/178 (86%), Positives = 168/178 (94%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            MV +RFHQYQVVGRALP+  DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVAFRFHQYQVVGRALPTPGDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFE+ PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASRHRVR 
Sbjct  61   LAINEIFERNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYNEMASRHRVRS  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
             CIQIIKTAT+  KLCKR++TKQFHNS+IKFPLV++KVRPP+RKLKTT+KASRPN+F+
Sbjct  121  PCIQIIKTATVHFKLCKRDNTKQFHNSEIKFPLVYRKVRPPTRKLKTTFKASRPNLFM  178



>ref|XP_006654794.1| PREDICTED: 60S ribosomal protein L18a-like [Oryza brachyantha]
Length=178

 Score =   327 bits (838),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 153/178 (86%), Positives = 167/178 (94%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            MV YRFHQYQVVGRALP+  DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVAYRFHQYQVVGRALPTPGDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFE+ PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFERNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRF  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
             CIQIIKTAT+  KLCKR++TKQFHN  IKFPLV++KVRPP+RKLKTT+KASRPN+F+
Sbjct  121  PCIQIIKTATVHFKLCKRDNTKQFHNGSIKFPLVYRKVRPPTRKLKTTFKASRPNLFM  178



>gb|AAM65890.1| putative 60S ribosomal protein L18A [Arabidopsis thaliana]
Length=178

 Score =   327 bits (838),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 154/178 (87%), Positives = 166/178 (93%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            M  +RFHQYQVVGRALP+E DEHPKIYRMKLW  NEV AKSKFWYF+RKLKKVKKSNGQ+
Sbjct  1    MGGFRFHQYQVVGRALPTENDEHPKIYRMKLWGRNEVCAKSKFWYFMRKLKKVKKSNGQM  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNG VEQMYTE+ASRHRVR 
Sbjct  61   LAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGGVEQMYTEIASRHRVRF  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
             CIQIIKTAT+PAKLCKRE TKQFHNSKIKFPLVF+KVRPPSRKLKTTYKAS+PN+F+
Sbjct  121  PCIQIIKTATVPAKLCKREITKQFHNSKIKFPLVFRKVRPPSRKLKTTYKASKPNLFM  178



>gb|EMT07340.1| 60S ribosomal protein L18a [Aegilops tauschii]
Length=178

 Score =   327 bits (838),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 153/178 (86%), Positives = 167/178 (94%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            MV +RFHQYQVVGRALP+  DE PKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVAFRFHQYQVVGRALPTPGDEQPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRS  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
             CIQIIKTAT+  KLCKR++TKQFHNSKIKFPLV++KVRPP+RKLKTTYK +RPN+F+
Sbjct  121  PCIQIIKTATVNFKLCKRDNTKQFHNSKIKFPLVYQKVRPPTRKLKTTYKVTRPNLFM  178



>ref|XP_010460775.1| PREDICTED: 60S ribosomal protein L18a-1-like [Camelina sativa]
Length=178

 Score =   327 bits (838),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 154/178 (87%), Positives = 165/178 (93%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            M  +R HQYQVVGRALP+E DE PKIYRMKLWATNEV AKSKFWYFLR+ KKVKKSNGQ+
Sbjct  1    MGVFRLHQYQVVGRALPTEKDEQPKIYRMKLWATNEVLAKSKFWYFLRRQKKVKKSNGQM  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFEK PT +KN+GIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTTIKNFGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRF  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
             CIQIIKTAT+ A LCKRESTKQFHNSKIKFPLVF+KVRPP+RKLKTTYKASRPN+F+
Sbjct  121  PCIQIIKTATVQANLCKRESTKQFHNSKIKFPLVFRKVRPPTRKLKTTYKASRPNLFM  178



>gb|ACG30921.1| 60S ribosomal protein L18a [Zea mays]
 gb|AFW81142.1| 60S ribosomal protein L18a [Zea mays]
Length=178

 Score =   327 bits (837),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 152/178 (85%), Positives = 169/178 (95%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            MV +RFHQYQVVGRALP+ TDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVAHRFHQYQVVGRALPTPTDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFE+ PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASRHRVR 
Sbjct  61   LAINEIFERNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYNEMASRHRVRS  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
             CIQIIKTAT+  KLCKR++TKQFHNS+IKFPLV++KVRPP+RKL+TT+KASRPN+F+
Sbjct  121  PCIQIIKTATVHFKLCKRDNTKQFHNSEIKFPLVYRKVRPPTRKLRTTFKASRPNLFM  178



>ref|NP_001148024.1| 60S ribosomal protein L18a [Zea mays]
 gb|ACG29459.1| 60S ribosomal protein L18a [Zea mays]
Length=178

 Score =   327 bits (837),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 152/178 (85%), Positives = 168/178 (94%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            MV +RFHQYQVVGRALP+ TDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVAHRFHQYQVVGRALPTPTDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFE+ PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASRHRVR 
Sbjct  61   LAINEIFERNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYNEMASRHRVRS  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
             CIQIIKTAT+  KLCKR++TKQFHNS IKFPLV++KVRPP+RKL+TT+KASRPN+F+
Sbjct  121  PCIQIIKTATVHFKLCKRDNTKQFHNSAIKFPLVYRKVRPPTRKLRTTFKASRPNLFM  178



>ref|XP_010679799.1| PREDICTED: 60S ribosomal protein L18a-2 [Beta vulgaris subsp. 
vulgaris]
Length=178

 Score =   327 bits (837),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 154/178 (87%), Positives = 166/178 (93%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            M  +RFHQYQVVGRALP+E+D HPKIYRMKLWATN+VRAKSKFWYFLRKLKKVKKS GQV
Sbjct  1    MGQFRFHQYQVVGRALPTESDAHPKIYRMKLWATNDVRAKSKFWYFLRKLKKVKKSVGQV  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEI+EK PT +KNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIYEKNPTLIKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRA  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
             CIQIIKTAT+P +LCKRE+TKQFH   IKFPLVFKKVRPPSRKLKTTYKAS+PN+F+
Sbjct  121  PCIQIIKTATVPDELCKRENTKQFHAKDIKFPLVFKKVRPPSRKLKTTYKASKPNLFM  178



>ref|XP_006644488.1| PREDICTED: 60S ribosomal protein L18a-like [Oryza brachyantha]
Length=178

 Score =   326 bits (836),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 152/178 (85%), Positives = 168/178 (94%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            MV +RFHQYQVVGRALP+  DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVAFRFHQYQVVGRALPTPGDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFE+ PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFERNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRF  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
             CIQIIKTAT+  KLCKR++TKQFHN+ IKFPLV++KVRPP+RKLKTT+KASRPN+F+
Sbjct  121  PCIQIIKTATVHFKLCKRDNTKQFHNASIKFPLVYRKVRPPTRKLKTTFKASRPNLFM  178



>ref|XP_004969468.1| PREDICTED: 60S ribosomal protein L18a-like [Setaria italica]
Length=178

 Score =   326 bits (836),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 153/178 (86%), Positives = 167/178 (94%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            MV +RFHQYQVVGRALP+  DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVAFRFHQYQVVGRALPTPGDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFE+ PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASRHRVR 
Sbjct  61   LAINEIFERNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYNEMASRHRVRA  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
             CIQIIKTAT+  KLCKR++TKQFHNSKIKFPLV +K+RPP+RKLKTT+KASRPN+F+
Sbjct  121  PCIQIIKTATVHFKLCKRDNTKQFHNSKIKFPLVSRKIRPPTRKLKTTFKASRPNLFM  178



>ref|XP_004491319.1| PREDICTED: LOW QUALITY PROTEIN: probable aspartic protease At2g35615-like 
[Cicer arietinum]
Length=748

 Score =   345 bits (884),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 162/188 (86%), Positives = 174/188 (93%), Gaps = 0/188 (0%)
 Frame = +3

Query  186  SQEDGSVVAKMVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKL  365
            SQ +     KMV  +FHQYQVVGRALP+ET+EHPKIYRMKLWATNEVRAKSKFWYFLRKL
Sbjct  561  SQSESVFFVKMVNMKFHQYQVVGRALPTETEEHPKIYRMKLWATNEVRAKSKFWYFLRKL  620

Query  366  KKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYT  545
            KKVKKSNGQVLAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVE MY 
Sbjct  621  KKVKKSNGQVLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVETMYN  680

Query  546  EMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYK  725
            EMASRHRVR  CIQIIKTATIPA LCKRESTKQFHNSKIKFPLV+KK+RPPSRKLKTTYK
Sbjct  681  EMASRHRVRFPCIQIIKTATIPASLCKRESTKQFHNSKIKFPLVYKKIRPPSRKLKTTYK  740

Query  726  ASRPNIFV  749
            A++PN+F+
Sbjct  741  ANKPNLFM  748



>gb|ACF78859.1| unknown [Zea mays]
Length=178

 Score =   326 bits (835),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 152/178 (85%), Positives = 167/178 (94%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            MV +RFHQYQVVGRALP+  DEHPKIYRMKLWATNEVRAKSKFWYFLR LKKVKKSNGQV
Sbjct  1    MVAFRFHQYQVVGRALPTPGDEHPKIYRMKLWATNEVRAKSKFWYFLRNLKKVKKSNGQV  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFE+ PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASRHRVR 
Sbjct  61   LAINEIFERNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYNEMASRHRVRS  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
             CIQIIKTAT+  KLCKR++TKQFHNS+IKFPLV++KVRPP+RKLKTT+KASRPN+F+
Sbjct  121  PCIQIIKTATVHFKLCKRDNTKQFHNSEIKFPLVYRKVRPPTRKLKTTFKASRPNLFM  178



>ref|NP_001043805.2| Os01g0666900 [Oryza sativa Japonica Group]
 gb|EEC71234.1| hypothetical protein OsI_03189 [Oryza sativa Indica Group]
 dbj|BAF05719.2| Os01g0666900 [Oryza sativa Japonica Group]
Length=178

 Score =   326 bits (835),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 152/178 (85%), Positives = 167/178 (94%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            MV +RFHQYQVVGRALP+  DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVAFRFHQYQVVGRALPTPGDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFE+ PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFERNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRF  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
             CIQIIKTAT+  KLCKR++TKQFHN  IKFPLV++KVRPP+RKLKTT+KASRPN+F+
Sbjct  121  PCIQIIKTATVHFKLCKRDNTKQFHNGSIKFPLVYRKVRPPTRKLKTTFKASRPNLFM  178



>ref|XP_003567891.1| PREDICTED: 60S ribosomal protein L18a-like [Brachypodium distachyon]
Length=178

 Score =   326 bits (835),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 153/178 (86%), Positives = 167/178 (94%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            MV +RFHQYQVVGRALP+  DE PKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVAHRFHQYQVVGRALPTPGDEQPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRS  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
             CIQIIKTAT+   LCKR++TKQFHNSKIKFPLV++KVRPP+RKLKTTYKA+RPN+F+
Sbjct  121  PCIQIIKTATVHFSLCKRDNTKQFHNSKIKFPLVYQKVRPPTRKLKTTYKATRPNLFM  178



>dbj|BAJ85943.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=178

 Score =   325 bits (834),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 152/178 (85%), Positives = 167/178 (94%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            MV +RFHQYQVVGRALP+  DE PKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQ+
Sbjct  1    MVAHRFHQYQVVGRALPTPGDEQPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQM  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNG VEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGGVEQMYTEMASRHRVRS  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
             CIQIIKTAT+  KLCKR++TKQFHNSKIKFPLV++KVRPP+RKLKTTYKA+RPN+F+
Sbjct  121  PCIQIIKTATVDFKLCKRDNTKQFHNSKIKFPLVYQKVRPPTRKLKTTYKATRPNLFM  178



>ref|XP_003617399.1| 60S ribosomal protein L18a [Medicago truncatula]
Length=749

 Score =   344 bits (883),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 162/188 (86%), Positives = 173/188 (92%), Gaps = 0/188 (0%)
 Frame = +3

Query  186  SQEDGSVVAKMVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKL  365
            SQ +   VAKMV  +FHQYQVVGRALP+E DEHPKIYRMKLWATNEVRAKSKFWYFLRKL
Sbjct  562  SQSESVFVAKMVNAKFHQYQVVGRALPTEKDEHPKIYRMKLWATNEVRAKSKFWYFLRKL  621

Query  366  KKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYT  545
            KKVKKSNGQVLAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVE MY 
Sbjct  622  KKVKKSNGQVLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVETMYN  681

Query  546  EMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYK  725
            EMASRHRVR  CIQIIKTATIPA LCKRESTKQFHNSKIKFPLV+KK+RPP+R LKTTYK
Sbjct  682  EMASRHRVRFPCIQIIKTATIPANLCKRESTKQFHNSKIKFPLVYKKIRPPTRSLKTTYK  741

Query  726  ASRPNIFV  749
            A +PN+F+
Sbjct  742  AKKPNLFM  749



>gb|ACN28455.1| unknown [Zea mays]
 gb|AFW79177.1| 60S ribosomal protein L18a [Zea mays]
Length=178

 Score =   325 bits (834),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 151/178 (85%), Positives = 168/178 (94%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            MV +RFHQYQVVGRALP+ TDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVAHRFHQYQVVGRALPTPTDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFE+ PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASRHRVR 
Sbjct  61   LAINEIFERNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYNEMASRHRVRS  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
             CIQIIKTAT+  KLCKR++TKQFHNS IKFPLV++KVRPP+RKL+TT+K+SRPN+F+
Sbjct  121  PCIQIIKTATVHFKLCKRDNTKQFHNSAIKFPLVYRKVRPPTRKLRTTFKSSRPNLFM  178



>gb|EMT24993.1| 60S ribosomal protein L18a [Aegilops tauschii]
Length=178

 Score =   325 bits (834),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 152/178 (85%), Positives = 167/178 (94%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            MV +RFHQYQVVGRALP+  DE PKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQ+
Sbjct  1    MVAHRFHQYQVVGRALPTPGDEQPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQM  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNG VEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGGVEQMYTEMASRHRVRA  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
             CIQIIKTAT+  KLCKR++TKQFHNSKIKFPLV++KVRPP+RKLKTTYKA+RPN+F+
Sbjct  121  PCIQIIKTATVDFKLCKRDNTKQFHNSKIKFPLVYQKVRPPTRKLKTTYKATRPNLFM  178



>ref|XP_006415527.1| hypothetical protein EUTSA_v10009933mg [Eutrema salsugineum]
 gb|ESQ33880.1| hypothetical protein EUTSA_v10009933mg [Eutrema salsugineum]
Length=317

 Score =   330 bits (847),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 156/173 (90%), Positives = 167/173 (97%), Gaps = 0/173 (0%)
 Frame = +3

Query  231  FHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINE  410
            FHQYQVVGRALP+E + HPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+LAINE
Sbjct  145  FHQYQVVGRALPTEKELHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQMLAINE  204

Query  411  IFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQI  590
            IFEK PTK+KN+GIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVR  CIQI
Sbjct  205  IFEKNPTKIKNFGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRFPCIQI  264

Query  591  IKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
            IKTAT+PA LCKRESTKQFHNSKIKFPLVF+KVRPP+RKLKTTYKAS+PN+F+
Sbjct  265  IKTATVPAALCKRESTKQFHNSKIKFPLVFRKVRPPTRKLKTTYKASKPNLFM  317



>ref|NP_001152227.1| 60S ribosomal protein L18a [Zea mays]
 gb|ACG46491.1| 60S ribosomal protein L18a [Zea mays]
 gb|AFW83498.1| 60S ribosomal protein L18a [Zea mays]
Length=178

 Score =   325 bits (832),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 152/178 (85%), Positives = 167/178 (94%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            MV +RFHQYQVVGRALP+  DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVAFRFHQYQVVGRALPTPGDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFE+ PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASRHRVR 
Sbjct  61   LAINEIFERNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYNEMASRHRVRS  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
             CIQIIKTAT+  KLCKR++TKQFHNS+IKFPLV +KVRPP+RKL+TT+KASRPN+F+
Sbjct  121  PCIQIIKTATVHFKLCKRDNTKQFHNSEIKFPLVHRKVRPPTRKLRTTFKASRPNLFM  178



>ref|XP_004979031.1| PREDICTED: 60S ribosomal protein L18a-like [Setaria italica]
Length=178

 Score =   325 bits (832),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 152/178 (85%), Positives = 167/178 (94%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            MV +RFHQYQVVGRALP+  DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVAHRFHQYQVVGRALPTPGDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFE+ PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASRHRVR 
Sbjct  61   LAINEIFERNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYNEMASRHRVRA  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
             CIQIIKTAT+  KLCKR++TKQFHN+KIKFPLV +K+RPP+RKLKTT+KASRPN+F+
Sbjct  121  PCIQIIKTATVHFKLCKRDNTKQFHNAKIKFPLVSRKIRPPTRKLKTTFKASRPNLFM  178



>ref|NP_001044264.1| Os01g0752300 [Oryza sativa Japonica Group]
 ref|XP_006644713.1| PREDICTED: 60S ribosomal protein L18a-like [Oryza brachyantha]
 sp|Q943F3.1|RL18A_ORYSJ RecName: Full=60S ribosomal protein L18a [Oryza sativa Japonica 
Group]
 pdb|3J61|S Chain S, Localization Of The Large Subunit Ribosomal Proteins 
Into A 5.5 A Cryo-em Map Of Triticum Aestivum Translating 80s 
Ribosome
 dbj|BAB67920.1| putative ribosomal protein L18a [Oryza sativa Japonica Group]
 dbj|BAB89536.1| putative ribosomal protein L18a [Oryza sativa Japonica Group]
 dbj|BAF06178.1| Os01g0752300 [Oryza sativa Japonica Group]
 gb|EAY75840.1| hypothetical protein OsI_03756 [Oryza sativa Indica Group]
 gb|EAZ13560.1| hypothetical protein OsJ_03475 [Oryza sativa Japonica Group]
Length=178

 Score =   324 bits (831),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 152/178 (85%), Positives = 166/178 (93%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            M  +RFHQYQVVGR LP+ TDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MGAFRFHQYQVVGRGLPTPTDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQI  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRF  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
             CIQIIKTAT+  KLCKR++TKQFH S IKFPLV++KVRPP+RKLKTT+KASRPN+F+
Sbjct  121  PCIQIIKTATVHFKLCKRDNTKQFHKSDIKFPLVYRKVRPPTRKLKTTFKASRPNLFM  178



>ref|XP_009109630.1| PREDICTED: 60S ribosomal protein L18a-2 [Brassica rapa]
Length=194

 Score =   325 bits (832),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 151/182 (83%), Positives = 166/182 (91%), Gaps = 0/182 (0%)
 Frame = +3

Query  204  VVAKMVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKS  383
            +  KM  +RFHQYQVVGRALP+E +  PKIYRMKLWATNEVRA SKFWYFLRK  K+KKS
Sbjct  13   LTTKMGVFRFHQYQVVGRALPTENEVQPKIYRMKLWATNEVRAMSKFWYFLRKQVKIKKS  72

Query  384  NGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRH  563
            NGQ+LAINEIFEK PT + N+GIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRH
Sbjct  73   NGQMLAINEIFEKNPTTINNFGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRH  132

Query  564  RVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNI  743
            RVR  CIQIIKTAT+PA LCKRESTKQFHNSKIKFPLV++KVRPP+RKLKTTYKAS+PN+
Sbjct  133  RVRFPCIQIIKTATVPAALCKRESTKQFHNSKIKFPLVYRKVRPPTRKLKTTYKASKPNL  192

Query  744  FV  749
            F+
Sbjct  193  FM  194



>ref|XP_003569521.1| PREDICTED: 60S ribosomal protein L18a-like [Brachypodium distachyon]
Length=178

 Score =   324 bits (830),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 151/178 (85%), Positives = 167/178 (94%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            MV +RFHQYQVVGRALP+  DE PKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVAFRFHQYQVVGRALPTPGDEQPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFEK PT +KN+GIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTTIKNFGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRS  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
             CIQIIKTAT+   LCKR++TKQFHNSKIKFPLV++KVRPP+RKLKTT+KA+RPN+F+
Sbjct  121  PCIQIIKTATVHFSLCKRDNTKQFHNSKIKFPLVYQKVRPPTRKLKTTFKATRPNLFM  178



>ref|XP_010940708.1| PREDICTED: 60S ribosomal protein L18a-2-like [Elaeis guineensis]
Length=178

 Score =   323 bits (829),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 160/178 (90%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            M  +RFHQYQVVGRALP+ +DEHPKIYRMKLWATNEVRAKSKFWYFL KLKKVKKSNGQV
Sbjct  1    MGNFRFHQYQVVGRALPTPSDEHPKIYRMKLWATNEVRAKSKFWYFLSKLKKVKKSNGQV  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFE+ PTK+KNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVE MY EMASRHRVR+
Sbjct  61   LAINEIFERKPTKIKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEHMYNEMASRHRVRY  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
            HCIQIIKTATIPAKLCKRESTKQFH+SKIKFPLVFKK+RPP+RKLKTTYKASRPN+F+
Sbjct  121  HCIQIIKTATIPAKLCKRESTKQFHDSKIKFPLVFKKIRPPTRKLKTTYKASRPNLFM  178



>emb|CDY35269.1| BnaC03g59540D [Brassica napus]
Length=178

 Score =   323 bits (827),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 151/178 (85%), Positives = 165/178 (93%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            M  +RFHQYQVVGRALP+E +  PKIYRMKLWATNEVRA SKFWYFLRK  K+KKSNGQ+
Sbjct  1    MGVFRFHQYQVVGRALPTEKEVQPKIYRMKLWATNEVRAMSKFWYFLRKQVKIKKSNGQM  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFEK PT +KN+GIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTTIKNFGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRF  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
             CIQIIKTAT+PA LCKRESTKQFHNSKIKFPLV++KVRPP+RKLKTTYKAS+PN+F+
Sbjct  121  PCIQIIKTATVPAALCKRESTKQFHNSKIKFPLVYRKVRPPTRKLKTTYKASKPNLFM  178



>ref|XP_010936051.1| PREDICTED: 60S ribosomal protein L18a-2 [Elaeis guineensis]
Length=178

 Score =   323 bits (827),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 160/178 (90%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            M  +RFHQYQVVGRALP+ +DEHPKIYRMKLWATNEVRAKSKFWYFL KLKKVKKSNGQV
Sbjct  1    MGNFRFHQYQVVGRALPTPSDEHPKIYRMKLWATNEVRAKSKFWYFLSKLKKVKKSNGQV  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFE+ PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVE MY EMASRHRVR+
Sbjct  61   LAINEIFERKPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEHMYNEMASRHRVRY  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
            HCIQIIKTATIPAKLCKRESTKQFH+SKIKFPLVFKKVRPP+RKLKTTYKASRPN+F+
Sbjct  121  HCIQIIKTATIPAKLCKRESTKQFHDSKIKFPLVFKKVRPPTRKLKTTYKASRPNLFM  178



>ref|XP_006306031.1| hypothetical protein CARUB_v10011327mg [Capsella rubella]
 gb|EOA38929.1| hypothetical protein CARUB_v10011327mg [Capsella rubella]
Length=319

 Score =   328 bits (840),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 154/173 (89%), Positives = 165/173 (95%), Gaps = 0/173 (0%)
 Frame = +3

Query  231  FHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINE  410
             HQYQVVGRALP+E DEHPKIYRMKLWATNEV AKSKFWYFLR+ KKVKKSNGQ+LAINE
Sbjct  147  LHQYQVVGRALPTEKDEHPKIYRMKLWATNEVLAKSKFWYFLRRQKKVKKSNGQMLAINE  206

Query  411  IFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQI  590
            IFEK PTK+KNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVR  CIQI
Sbjct  207  IFEKSPTKIKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRFPCIQI  266

Query  591  IKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
            IKTAT+PA LCKRESTKQFHNSKIKFPLVF+KVRPP+RKLKTTYKA++PN+F+
Sbjct  267  IKTATVPANLCKRESTKQFHNSKIKFPLVFRKVRPPTRKLKTTYKANKPNLFM  319



>ref|NP_849729.1| ribosomal protein L18ae/LX family protein [Arabidopsis thaliana]
 sp|Q8L7K0.1|R18A1_ARATH RecName: Full=60S ribosomal protein L18a-1 [Arabidopsis thaliana]
 gb|AAM91614.1| 60S ribosomal protein L18A, putative [Arabidopsis thaliana]
 gb|AAN15378.1| 60S ribosomal protein L18A, putative [Arabidopsis thaliana]
 gb|AEE31159.1| ribosomal protein L18ae/LX family protein [Arabidopsis thaliana]
Length=178

 Score =   322 bits (825),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 150/178 (84%), Positives = 165/178 (93%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            M   R HQYQVVGRALP+E DE PKIYRMKLWATNEV AKSKFWY+LR+ KKVKKSNGQ+
Sbjct  1    MSVIRLHQYQVVGRALPTEKDEQPKIYRMKLWATNEVLAKSKFWYYLRRQKKVKKSNGQM  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFEK PT +KN+GIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTTIKNFGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRF  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
             CIQIIKTAT+PA LCKRESTKQFHNSKIKFPLVF+KVRPP+RKLKTT+KA++PN+F+
Sbjct  121  PCIQIIKTATVPASLCKRESTKQFHNSKIKFPLVFRKVRPPTRKLKTTFKANKPNLFM  178



>ref|XP_010666370.1| PREDICTED: 60S ribosomal protein L18a-like [Beta vulgaris subsp. 
vulgaris]
Length=177

 Score =   318 bits (816),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 149/175 (85%), Positives = 165/175 (94%), Gaps = 0/175 (0%)
 Frame = +3

Query  225  YRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAI  404
            +RFHQYQVVGRALP+E+ EHPKIYRMKLWATN+VRAKSKFWYFLRKLKKVKKS GQVLAI
Sbjct  3    FRFHQYQVVGRALPTESVEHPKIYRMKLWATNDVRAKSKFWYFLRKLKKVKKSVGQVLAI  62

Query  405  NEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCI  584
            NEI+EK PT +KNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMY EMASRHRVR  CI
Sbjct  63   NEIYEKNPTIIKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYCEMASRHRVRAPCI  122

Query  585  QIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
            QIIKTAT+P +LCKRE+TKQFH+  IKFP+VF+KVRPP+RKLKTTYKAS+PN+F+
Sbjct  123  QIIKTATVPDELCKRENTKQFHSKDIKFPMVFRKVRPPTRKLKTTYKASKPNLFM  177



>gb|ACG47612.1| 60S ribosomal protein L18a [Zea mays]
Length=178

 Score =   318 bits (815),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 148/178 (83%), Positives = 165/178 (93%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            MV +RFHQYQVVGRALP+ TDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVAHRFHQYQVVGRALPTPTDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFE+ PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNG V QMY EM SRHRVR 
Sbjct  61   LAINEIFERNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGXVXQMYNEMXSRHRVRS  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
             CIQIIKTAT+  KLCKR++TKQFHNS+IKFPLV++KV PP+RKL+TT+KASRPN+F+
Sbjct  121  PCIQIIKTATVHFKLCKRDNTKQFHNSEIKFPLVYRKVXPPTRKLRTTFKASRPNLFM  178



>ref|NP_001152434.1| LOC100286074 [Zea mays]
 gb|ACG47606.1| 60S ribosomal protein L18a [Zea mays]
Length=178

 Score =   317 bits (813),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 149/178 (84%), Positives = 166/178 (93%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            MV +RFHQYQVVGRAL + TDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKS GQ+
Sbjct  1    MVAHRFHQYQVVGRALXTPTDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSXGQM  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFE+ PT +KNYGIWLRYQSRTGYHNMYKE+R TTLNGAVEQMY EMASRHRVR 
Sbjct  61   LAINEIFERXPTTIKNYGIWLRYQSRTGYHNMYKEYRXTTLNGAVEQMYNEMASRHRVRS  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
             CIQIIKTAT+  KLCKR++TKQFHNS+IKFPLV++KVRPP+RKL+TT+KASRPN+F+
Sbjct  121  PCIQIIKTATVHFKLCKRDNTKQFHNSEIKFPLVYRKVRPPTRKLRTTFKASRPNLFM  178



>ref|XP_003569823.1| PREDICTED: 60S ribosomal protein L18a [Brachypodium distachyon]
Length=178

 Score =   315 bits (808),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 146/178 (82%), Positives = 164/178 (92%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            MV +RFHQYQVVGR LP+ T+E PKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVAFRFHQYQVVGRGLPTPTEEKPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQI  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LA NEIFEK PT +KN+GIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAFNEIFEKNPTTIKNFGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRS  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
             CIQIIKTAT+   +CKR++TKQFH S IKFPLV++KVRPP+RKLKTT+KA+RPN+F+
Sbjct  121  PCIQIIKTATVHFSICKRDNTKQFHKSDIKFPLVYQKVRPPTRKLKTTFKATRPNLFM  178



>ref|XP_002893593.1| 60S ribosomal protein L18A-1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69852.1| 60S ribosomal protein L18A-1 [Arabidopsis lyrata subsp. lyrata]
Length=314

 Score =   319 bits (818),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 150/173 (87%), Positives = 162/173 (94%), Gaps = 0/173 (0%)
 Frame = +3

Query  231  FHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINE  410
             HQYQVVGRALP E DE PKIYRMKLWATNEV AKSKFWYFLR+ KKVKKSNGQ+LAINE
Sbjct  142  LHQYQVVGRALPMEKDEQPKIYRMKLWATNEVLAKSKFWYFLRRQKKVKKSNGQMLAINE  201

Query  411  IFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQI  590
            IFEK PT +KN+GIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR  CIQI
Sbjct  202  IFEKNPTTIKNFGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRFPCIQI  261

Query  591  IKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
            IKTAT+PA LCKRESTKQFHNSKIKFPLVF+KVRPP+RKLKTT+KAS+PN+F+
Sbjct  262  IKTATVPANLCKRESTKQFHNSKIKFPLVFRKVRPPTRKLKTTFKASKPNLFM  314



>ref|XP_004961208.1| PREDICTED: 60S ribosomal protein L18a-like [Setaria italica]
Length=339

 Score =   320 bits (820),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 151/177 (85%), Positives = 165/177 (93%), Gaps = 0/177 (0%)
 Frame = +3

Query  219  VTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVL  398
             T  FHQYQVVGRALP+  DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+L
Sbjct  163  CTIAFHQYQVVGRALPTPGDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQML  222

Query  399  AINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHH  578
            AINEIFE+ PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASRHRVR  
Sbjct  223  AINEIFERNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYNEMASRHRVRAP  282

Query  579  CIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
            CIQIIKTAT+  KLCKR++TKQFHNSKIKFPLV++KVRPP+RKLKTT+KASRPN+F+
Sbjct  283  CIQIIKTATVHFKLCKRDNTKQFHNSKIKFPLVYRKVRPPTRKLKTTFKASRPNLFM  339



>ref|XP_010549484.1| PREDICTED: 60S ribosomal protein L18a-2 isoform X2 [Tarenaya 
hassleriana]
Length=312

 Score =   319 bits (817),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 152/187 (81%), Positives = 168/187 (90%), Gaps = 3/187 (2%)
 Frame = +3

Query  189  QEDGSVVAKMVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLK  368
            ++ G +   +    +H +     ALP+ETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLK
Sbjct  129  EKPGYIACAIAVSSYHCFV---PALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLK  185

Query  369  KVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTE  548
            KVKKSNGQ+LAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RD TLNGAVEQMYTE
Sbjct  186  KVKKSNGQILAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDITLNGAVEQMYTE  245

Query  549  MASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKA  728
            MASRHRVR  CIQIIKTAT+PAKLCKRESTKQFHNSKIKFPLVF+KVRPP+RKLKTTYKA
Sbjct  246  MASRHRVRFPCIQIIKTATVPAKLCKRESTKQFHNSKIKFPLVFRKVRPPTRKLKTTYKA  305

Query  729  SRPNIFV  749
            S+PN+F+
Sbjct  306  SKPNLFM  312



>ref|NP_001077626.1| 60S ribosomal protein L18a-1 [Arabidopsis thaliana]
 gb|AEE31161.1| 60S ribosomal protein L18a-1 [Arabidopsis thaliana]
Length=312

 Score =   317 bits (812),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 148/173 (86%), Positives = 163/173 (94%), Gaps = 0/173 (0%)
 Frame = +3

Query  231  FHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINE  410
             HQYQVVGRALP+E DE PKIYRMKLWATNEV AKSKFWY+LR+ KKVKKSNGQ+LAINE
Sbjct  140  LHQYQVVGRALPTEKDEQPKIYRMKLWATNEVLAKSKFWYYLRRQKKVKKSNGQMLAINE  199

Query  411  IFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQI  590
            IFEK PT +KN+GIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR  CIQI
Sbjct  200  IFEKNPTTIKNFGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRFPCIQI  259

Query  591  IKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
            IKTAT+PA LCKRESTKQFHNSKIKFPLVF+KVRPP+RKLKTT+KA++PN+F+
Sbjct  260  IKTATVPASLCKRESTKQFHNSKIKFPLVFRKVRPPTRKLKTTFKANKPNLFM  312



>ref|XP_001762693.1| predicted protein [Physcomitrella patens]
 ref|XP_001768277.1| predicted protein [Physcomitrella patens]
 gb|EDQ66891.1| predicted protein [Physcomitrella patens]
 gb|EDQ72492.1| predicted protein [Physcomitrella patens]
Length=177

 Score =   311 bits (798),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 146/177 (82%), Positives = 161/177 (91%), Gaps = 0/177 (0%)
 Frame = +3

Query  219  VTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVL  398
            +++RFHQYQVVGRALP+ T+E PK YRMKLWATNEVRAKSKFWYFLRKL+KVKK++GQ+L
Sbjct  1    MSFRFHQYQVVGRALPTATNETPKAYRMKLWATNEVRAKSKFWYFLRKLQKVKKAHGQLL  60

Query  399  AINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHH  578
            AINEIFEK PT +KNYGIW+RYQSRTGYHNMYKE+RD TLNGAVEQMY EMASRHRVR  
Sbjct  61   AINEIFEKYPTTIKNYGIWVRYQSRTGYHNMYKEYRDLTLNGAVEQMYDEMASRHRVRFP  120

Query  579  CIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
            CIQIIKTATIP  LCKR +TKQFHNSKIKFPL  +K+RPPSR LKTTYKASRPN FV
Sbjct  121  CIQIIKTATIPVSLCKRVNTKQFHNSKIKFPLTTRKIRPPSRSLKTTYKASRPNTFV  177



>ref|XP_001765218.1| predicted protein [Physcomitrella patens]
 ref|XP_001774990.1| predicted protein [Physcomitrella patens]
 gb|EDQ60256.1| predicted protein [Physcomitrella patens]
 gb|EDQ69946.1| predicted protein [Physcomitrella patens]
Length=177

 Score =   310 bits (795),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 145/177 (82%), Positives = 161/177 (91%), Gaps = 0/177 (0%)
 Frame = +3

Query  219  VTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVL  398
            +++RFHQYQVVGRALP+ T+E PK YRMKLWATNEVRAKSKFWYFLRKL+KVKK++GQ+L
Sbjct  1    MSFRFHQYQVVGRALPTATNETPKAYRMKLWATNEVRAKSKFWYFLRKLQKVKKAHGQLL  60

Query  399  AINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHH  578
            AINEIFEK PT +KNYGIW+RYQSRTGYHNMYKE+RD TLNGAVEQMY EMASRHRVR  
Sbjct  61   AINEIFEKYPTTIKNYGIWVRYQSRTGYHNMYKEYRDLTLNGAVEQMYDEMASRHRVRFP  120

Query  579  CIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
            CIQIIKTATIP  LCKR +TKQFHNSKIKFPL  +K+RPP+R LKTTYKASRPN FV
Sbjct  121  CIQIIKTATIPVSLCKRVNTKQFHNSKIKFPLTTRKIRPPTRSLKTTYKASRPNTFV  177



>gb|EEE55145.1| hypothetical protein OsJ_02939 [Oryza sativa Japonica Group]
Length=198

 Score =   311 bits (797),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 151/198 (76%), Positives = 166/198 (84%), Gaps = 20/198 (10%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            MV +RFHQYQVVGRALP+  DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVAFRFHQYQVVGRALPTPGDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  396  LAINE--------------------IFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTT  515
            LAIN                     IFE+ PT +KNYGIWLRYQSRTGYHNMYKE+RDTT
Sbjct  61   LAINGGGPSAFANEFFIFLHHGFVGIFERNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTT  120

Query  516  LNGAVEQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRP  695
            LNGAVEQMYTEMASRHRVR  CIQIIKTAT+  KLCKR++TKQFHN  IKFPLV++KVRP
Sbjct  121  LNGAVEQMYTEMASRHRVRFPCIQIIKTATVHFKLCKRDNTKQFHNGSIKFPLVYRKVRP  180

Query  696  PSRKLKTTYKASRPNIFV  749
            P+RKLKTT+KASRPN+F+
Sbjct  181  PTRKLKTTFKASRPNLFM  198



>ref|XP_009419339.1| PREDICTED: 60S ribosomal protein L18a-like [Musa acuminata subsp. 
malaccensis]
Length=173

 Score =   310 bits (794),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 148/177 (84%), Positives = 161/177 (91%), Gaps = 5/177 (3%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            M  +RFHQYQVVGRALP+   EHPKIYRMKLWATNE RAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MTIFRFHQYQVVGRALPTAAVEHPKIYRMKLWATNEARAKSKFWYFLRKLKKVKKSNGQV  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAIN IFE+ PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASRHRVR 
Sbjct  61   LAINVIFERKPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYNEMASRHRVRC  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIF  746
             CIQII+TATIP+KLC     KQFH+SKIKFP+VFKKVRPP+RKLKTT+KASRP++F
Sbjct  121  LCIQIIRTATIPSKLC-----KQFHDSKIKFPVVFKKVRPPTRKLKTTFKASRPSLF  172



>dbj|BAB90499.1| ribosomal protein L18a-like [Oryza sativa Japonica Group]
Length=195

 Score =   310 bits (794),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 152/195 (78%), Positives = 167/195 (86%), Gaps = 17/195 (9%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKF----------W------  347
            MV +RFHQYQVVGRALP+  DEHPKIYRMKLWATNEVRAKSKF          W      
Sbjct  1    MVAFRFHQYQVVGRALPTPGDEHPKIYRMKLWATNEVRAKSKFCSSYLVRFADWGACPVC  60

Query  348  -YFLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNG  524
             YFLRKLKKVKKSNGQ+LAINEIFE+ PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNG
Sbjct  61   RYFLRKLKKVKKSNGQMLAINEIFERNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNG  120

Query  525  AVEQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSR  704
            AVEQMYTEMASRHRVR  CIQIIKTAT+  KLCKR++TKQFHN  IKFPLV++KVRPP+R
Sbjct  121  AVEQMYTEMASRHRVRFPCIQIIKTATVHFKLCKRDNTKQFHNGSIKFPLVYRKVRPPTR  180

Query  705  KLKTTYKASRPNIFV  749
            KLKTT+KASRPN+F+
Sbjct  181  KLKTTFKASRPNLFM  195



>ref|XP_001752605.1| predicted protein [Physcomitrella patens]
 gb|EDQ82476.1| predicted protein [Physcomitrella patens]
Length=177

 Score =   309 bits (791),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 144/177 (81%), Positives = 160/177 (90%), Gaps = 0/177 (0%)
 Frame = +3

Query  219  VTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVL  398
            +++RFHQYQVVGRALP+ T+E PK YRMKLWATNEVRAKSKFWYFLRKL+KVKK++GQ+L
Sbjct  1    MSFRFHQYQVVGRALPTATNEAPKAYRMKLWATNEVRAKSKFWYFLRKLQKVKKAHGQLL  60

Query  399  AINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHH  578
            AINEIFEK PT +KNYGIW+RYQSRTGYHNMYKE+RD TLNGAVEQMY EMASRHRVR  
Sbjct  61   AINEIFEKYPTTIKNYGIWVRYQSRTGYHNMYKEYRDLTLNGAVEQMYDEMASRHRVRFP  120

Query  579  CIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
            CIQIIKT TIP  LCKR +TKQFHNSKIKFPL  +K+RPP+R LKTTYKASRPN FV
Sbjct  121  CIQIIKTGTIPVSLCKRVNTKQFHNSKIKFPLTTRKIRPPTRSLKTTYKASRPNTFV  177



>ref|XP_001760636.1| predicted protein [Physcomitrella patens]
 gb|EDQ74375.1| predicted protein [Physcomitrella patens]
Length=177

 Score =   306 bits (784),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 144/177 (81%), Positives = 159/177 (90%), Gaps = 0/177 (0%)
 Frame = +3

Query  219  VTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVL  398
            + +RFHQYQVVGRALP+  +E PK YRMKLWAT+EVRAKSKFWYFLRKL+KVKK++GQ+L
Sbjct  1    MIFRFHQYQVVGRALPTPGNETPKAYRMKLWATDEVRAKSKFWYFLRKLQKVKKAHGQLL  60

Query  399  AINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHH  578
            AINEIFEK PT +KNYGIW+RYQSRTGYHNMYKE+RD TLNGAVEQMY EMASRHRVR  
Sbjct  61   AINEIFEKYPTTIKNYGIWVRYQSRTGYHNMYKEYRDLTLNGAVEQMYDEMASRHRVRSP  120

Query  579  CIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
            CIQIIKTATIP  LCKR +TKQFHNSKIKFPL  +K+RPPSR LKTTYKASRPN FV
Sbjct  121  CIQIIKTATIPVALCKRVNTKQFHNSKIKFPLTSRKIRPPSRSLKTTYKASRPNTFV  177



>pdb|3IZS|S Chain S, Localization Of The Large Subunit Ribosomal Proteins 
Into A 6.1 A Cryo-Em Map Of Saccharomyces Cerevisiae Translating 
80s Ribosome
Length=167

 Score =   305 bits (782),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 144/167 (86%), Positives = 155/167 (93%), Gaps = 0/167 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            M  +RFHQYQVVGR LP+ TDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MGAFRFHQYQVVGRGLPTPTDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQI  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRF  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKT  716
             CIQIIKTAT+  KLCKR++TKQFH S IKFPLV++KVRPP+RKLKT
Sbjct  121  PCIQIIKTATVHFKLCKRDNTKQFHKSDIKFPLVYRKVRPPTRKLKT  167



>gb|AAG52055.1|AC022455_9 60S ribosomal protein L18A, putative; 23187-20334 [Arabidopsis 
thaliana]
Length=321

 Score =   309 bits (791),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 148/185 (80%), Positives = 163/185 (88%), Gaps = 12/185 (6%)
 Frame = +3

Query  231  FHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINE  410
             HQYQVVGRALP+E DE PKIYRMKLWATNEV AKSKFWY+LR+ KKVKKSNGQ+LAINE
Sbjct  137  LHQYQVVGRALPTEKDEQPKIYRMKLWATNEVLAKSKFWYYLRRQKKVKKSNGQMLAINE  196

Query  411  ------------IFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMA  554
                        IFEK PT +KN+GIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMA
Sbjct  197  VLAVGSEFDLFSIFEKNPTTIKNFGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMA  256

Query  555  SRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASR  734
            SRHRVR  CIQIIKTAT+PA LCKRESTKQFHNSKIKFPLVF+KVRPP+RKLKTT+KA++
Sbjct  257  SRHRVRFPCIQIIKTATVPASLCKRESTKQFHNSKIKFPLVFRKVRPPTRKLKTTFKANK  316

Query  735  PNIFV  749
            PN+F+
Sbjct  317  PNLFM  321



>gb|ADU56180.1| hypothetical protein [Jatropha curcas]
Length=154

 Score =   300 bits (768),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 143/154 (93%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = +3

Query  288  KIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQ  467
            KIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEK PTK+KNYGIWLRYQ
Sbjct  1    KIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKNPTKIKNYGIWLRYQ  60

Query  468  SRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQF  647
            SRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR  CIQIIKT TIPAKLCKRES+KQF
Sbjct  61   SRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRFPCIQIIKTGTIPAKLCKRESSKQF  120

Query  648  HNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
            HNSKIKFPLVFKKVRPP+RKL+TTYKASRPN+F+
Sbjct  121  HNSKIKFPLVFKKVRPPTRKLRTTYKASRPNLFM  154



>ref|XP_011460183.1| PREDICTED: 60S ribosomal protein L18a [Fragaria vesca subsp. 
vesca]
Length=178

 Score =   301 bits (770),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 150/178 (84%), Positives = 164/178 (92%), Gaps = 0/178 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            MV  ++HQYQVVGRALP + ++ PKIYRMKLW TNEVRAKSKFWYFL+KLKKVKKSNGQ+
Sbjct  1    MVALKYHQYQVVGRALPKDAEDTPKIYRMKLWHTNEVRAKSKFWYFLKKLKKVKKSNGQM  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINEIFEK PT V+NYGIWLRYQSRTGYHNMYKE+RDTTLNGAV+QMY EMASRHRVR 
Sbjct  61   LAINEIFEKKPTVVENYGIWLRYQSRTGYHNMYKEYRDTTLNGAVDQMYNEMASRHRVRF  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
             CIQIIK ATIPAKLCKRE TKQFHNSKIKFPL+ +KVRPP+RKLKTTYKASRPN+FV
Sbjct  121  PCIQIIKIATIPAKLCKRECTKQFHNSKIKFPLITRKVRPPTRKLKTTYKASRPNLFV  178



>ref|XP_006387416.1| hypothetical protein POPTR_1064s00200g [Populus trichocarpa]
 gb|ERP46330.1| hypothetical protein POPTR_1064s00200g [Populus trichocarpa]
Length=150

 Score =   297 bits (761),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 143/150 (95%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = +3

Query  300  MKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTG  479
            MKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEK PTK+KNYGIWLRYQSRTG
Sbjct  1    MKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKNPTKIKNYGIWLRYQSRTG  60

Query  480  YHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSK  659
            YHNMYKE+RDTTLNGAVEQMYTEMASRHRVR  CIQIIKTATIPAKLCKRESTKQFHNSK
Sbjct  61   YHNMYKEYRDTTLNGAVEQMYTEMASRHRVRFPCIQIIKTATIPAKLCKRESTKQFHNSK  120

Query  660  IKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
            IKFPLVFKKVRPPSRKLKTTYKASRPN+F+
Sbjct  121  IKFPLVFKKVRPPSRKLKTTYKASRPNLFM  150



>ref|XP_002961150.1| hypothetical protein SELMODRAFT_227198 [Selaginella moellendorffii]
 ref|XP_002966859.1| hypothetical protein SELMODRAFT_270606 [Selaginella moellendorffii]
 gb|EFJ31458.1| hypothetical protein SELMODRAFT_270606 [Selaginella moellendorffii]
 gb|EFJ38689.1| hypothetical protein SELMODRAFT_227198 [Selaginella moellendorffii]
Length=177

 Score =   298 bits (764),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 138/175 (79%), Positives = 157/175 (90%), Gaps = 0/175 (0%)
 Frame = +3

Query  225  YRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAI  404
            +RFHQYQVVGRA P+  +EHPK+YRMKLWA +EVRAKSKFWYFLRKLKKVKKS+GQ+LAI
Sbjct  3    FRFHQYQVVGRATPTPDNEHPKMYRMKLWAGDEVRAKSKFWYFLRKLKKVKKSHGQILAI  62

Query  405  NEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCI  584
            NEIFEK PT +KNYGIW+RYQSRTGYHNMYKE+RD TLNGAVEQMY EMASRHRVR  CI
Sbjct  63   NEIFEKNPTTIKNYGIWVRYQSRTGYHNMYKEYRDITLNGAVEQMYDEMASRHRVRFPCI  122

Query  585  QIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
            QIIKTA++P   CKRE+TKQFH+S+IKFPL+ +K+R PSRKLKTT+KA RPN F 
Sbjct  123  QIIKTASVPDSACKRENTKQFHSSEIKFPLMNRKIRAPSRKLKTTFKAKRPNTFA  177



>gb|AAT08714.1| ribosomal protein L18A [Hyacinthus orientalis]
Length=178

 Score =   296 bits (758),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 147/182 (81%), Positives = 160/182 (88%), Gaps = 8/182 (4%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            M  +RFHQYQVVGRALP+ +DEHPKI+RMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MGGFRFHQYQVVGRALPTPSDEHPKIFRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHN----MYKEFRDTTLNGAVEQMYTEMASRH  563
            LAINEIFEK PTK+    I LR+ +     N    MYKE+RDTTLNG VEQMYTEMASRH
Sbjct  61   LAINEIFEKNPTKI----IELRHMAEVPEQNRLSYMYKEYRDTTLNGGVEQMYTEMASRH  116

Query  564  RVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNI  743
            RVR  CIQIIKTATIPAKLCKRESTKQFH+SKIKFPLVFKKVRPP+RKLKTT+KASRPN+
Sbjct  117  RVRFPCIQIIKTATIPAKLCKRESTKQFHDSKIKFPLVFKKVRPPTRKLKTTFKASRPNL  176

Query  744  FV  749
            F+
Sbjct  177  FM  178



>gb|KJB34967.1| hypothetical protein B456_006G092900 [Gossypium raimondii]
 gb|KJB42783.1| hypothetical protein B456_007G174800 [Gossypium raimondii]
 gb|KJB69798.1| hypothetical protein B456_011G042800 [Gossypium raimondii]
Length=150

 Score =   294 bits (753),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 140/150 (93%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = +3

Query  300  MKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTG  479
            MKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEK PTK+KNYGIWLRYQSRTG
Sbjct  1    MKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKNPTKIKNYGIWLRYQSRTG  60

Query  480  YHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSK  659
            YHNMYKE+RDTTLNGAVEQMYTEMASRHRVR  CIQIIKTATIPAKLCKR+STKQFHNSK
Sbjct  61   YHNMYKEYRDTTLNGAVEQMYTEMASRHRVRFPCIQIIKTATIPAKLCKRDSTKQFHNSK  120

Query  660  IKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
            IKFPLVFKKVRPP+RKLKTTYKAS+PN+F+
Sbjct  121  IKFPLVFKKVRPPTRKLKTTYKASKPNLFM  150



>emb|CDX98480.1| BnaC05g38950D [Brassica napus]
Length=150

 Score =   294 bits (752),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 139/150 (93%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = +3

Query  300  MKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTG  479
            MKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+LAINEIFEK PTK+KNYGIWLRYQSRTG
Sbjct  1    MKLWATNEVRAKSKFWYFLRKLKKVKKSNGQMLAINEIFEKNPTKIKNYGIWLRYQSRTG  60

Query  480  YHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSK  659
            YHNMYKEFRDTTLNGAVEQMYTEMASRHRVR  CIQIIKTAT+PAKLCKRESTKQFHNSK
Sbjct  61   YHNMYKEFRDTTLNGAVEQMYTEMASRHRVRFPCIQIIKTATVPAKLCKRESTKQFHNSK  120

Query  660  IKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
            IKFPLVF+KVRPP+RKLKTTYKAS+PN+F+
Sbjct  121  IKFPLVFRKVRPPTRKLKTTYKASKPNLFM  150



>gb|KJB10615.1| hypothetical protein B456_001G211400 [Gossypium raimondii]
Length=150

 Score =   293 bits (751),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 139/150 (93%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = +3

Query  300  MKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTG  479
            MKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEK PTK+KNYGIWLRYQSRTG
Sbjct  1    MKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKSPTKIKNYGIWLRYQSRTG  60

Query  480  YHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSK  659
            YHNMYKE+RDTTLNGAVEQMYTEMASRHRVR  CIQIIKTATIPAKLCKR+STKQFHNSK
Sbjct  61   YHNMYKEYRDTTLNGAVEQMYTEMASRHRVRFPCIQIIKTATIPAKLCKRDSTKQFHNSK  120

Query  660  IKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
            IKFPLVFKKVRPP+RKLKTTYKA++PN+F+
Sbjct  121  IKFPLVFKKVRPPTRKLKTTYKATKPNLFM  150



>ref|NP_001237792.1| uncharacterized protein LOC100305604 [Glycine max]
 gb|ACU13370.1| unknown [Glycine max]
Length=150

 Score =   293 bits (749),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 139/150 (93%), Positives = 145/150 (97%), Gaps = 0/150 (0%)
 Frame = +3

Query  300  MKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTG  479
            MKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEK PTK+KNYGIWLRYQSRTG
Sbjct  1    MKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKNPTKIKNYGIWLRYQSRTG  60

Query  480  YHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSK  659
            YHNMYKE+RDTTLNGAVE MYTEMASRHRVRH CIQIIKTAT PAKLCKRESTKQFHNSK
Sbjct  61   YHNMYKEYRDTTLNGAVEHMYTEMASRHRVRHPCIQIIKTATTPAKLCKRESTKQFHNSK  120

Query  660  IKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
            IKFPLVFKK+RPP+RKLKTTYK SRPN+F+
Sbjct  121  IKFPLVFKKIRPPTRKLKTTYKTSRPNLFM  150



>gb|EYU33347.1| hypothetical protein MIMGU_mgv1a014797mg [Erythranthe guttata]
Length=150

 Score =   292 bits (747),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 137/150 (91%), Positives = 146/150 (97%), Gaps = 0/150 (0%)
 Frame = +3

Query  300  MKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTG  479
            MKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+LAINEIFEK PT +KNYGIWLRYQSRTG
Sbjct  1    MKLWATNEVRAKSKFWYFLRKLKKVKKSNGQILAINEIFEKNPTTIKNYGIWLRYQSRTG  60

Query  480  YHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSK  659
            YHNMYKE+RDTTLNGAVE MYTEMASRHRVR+HCIQIIKTATIPAKLCKRESTKQFHNSK
Sbjct  61   YHNMYKEYRDTTLNGAVEHMYTEMASRHRVRYHCIQIIKTATIPAKLCKRESTKQFHNSK  120

Query  660  IKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
            IKFPLVF KVRPP+RKLKTTYKA++PN+F+
Sbjct  121  IKFPLVFHKVRPPTRKLKTTYKATKPNLFM  150



>emb|CDX82474.1| BnaA03g33470D [Brassica napus]
Length=150

 Score =   292 bits (747),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 137/150 (91%), Positives = 146/150 (97%), Gaps = 0/150 (0%)
 Frame = +3

Query  300  MKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTG  479
            MKLWA+NEVRAKSKFWYFLRKLKKVKKSNGQ+LAINEIFEK PTK+KNYGIWLRYQSRTG
Sbjct  1    MKLWASNEVRAKSKFWYFLRKLKKVKKSNGQMLAINEIFEKSPTKIKNYGIWLRYQSRTG  60

Query  480  YHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSK  659
            YHNMYKEFRDTTLNGAVEQMYTEMASRHRVR  CIQIIKTAT+PA LCKRESTKQFHNSK
Sbjct  61   YHNMYKEFRDTTLNGAVEQMYTEMASRHRVRFPCIQIIKTATVPASLCKRESTKQFHNSK  120

Query  660  IKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
            IKFPLVF+KVRPP+RKLKTTYKAS+PN+F+
Sbjct  121  IKFPLVFRKVRPPTRKLKTTYKASKPNLFM  150



>emb|CDX84313.1| BnaC04g10750D [Brassica napus]
Length=150

 Score =   290 bits (743),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 137/150 (91%), Positives = 146/150 (97%), Gaps = 0/150 (0%)
 Frame = +3

Query  300  MKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTG  479
            MKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+LAINEIFEK PT +KN+GIWLRYQSRTG
Sbjct  1    MKLWATNEVRAKSKFWYFLRKLKKVKKSNGQMLAINEIFEKNPTTIKNFGIWLRYQSRTG  60

Query  480  YHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSK  659
            YHNMYKEFRDTTLNGAVEQMYTEMASRHRVR  CIQIIKTAT+PAKLCKRESTKQFHNSK
Sbjct  61   YHNMYKEFRDTTLNGAVEQMYTEMASRHRVRFPCIQIIKTATVPAKLCKRESTKQFHNSK  120

Query  660  IKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
            IKFPLVF+KVRPP+RKLKTTYKAS+PN+F+
Sbjct  121  IKFPLVFRKVRPPTRKLKTTYKASKPNLFM  150



>emb|CDX84643.1| BnaA03g15870D [Brassica napus]
Length=150

 Score =   290 bits (743),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 137/150 (91%), Positives = 146/150 (97%), Gaps = 0/150 (0%)
 Frame = +3

Query  300  MKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTG  479
            MKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+LAINEIFEK PT +KN+GIWLRYQSRTG
Sbjct  1    MKLWATNEVRAKSKFWYFLRKLKKVKKSNGQMLAINEIFEKNPTTIKNFGIWLRYQSRTG  60

Query  480  YHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSK  659
            YHNMYKE+RDTTLNGAVEQMYTEMASRHRVR  CIQIIKTAT+PAKLCKRESTKQFHNSK
Sbjct  61   YHNMYKEYRDTTLNGAVEQMYTEMASRHRVRFPCIQIIKTATVPAKLCKRESTKQFHNSK  120

Query  660  IKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
            IKFPLVF+KVRPPSRKLKTTYKAS+PN+F+
Sbjct  121  IKFPLVFRKVRPPSRKLKTTYKASKPNLFM  150



>emb|CDY43672.1| BnaA04g20190D [Brassica napus]
 emb|CDY17253.1| BnaA05g09350D [Brassica napus]
Length=150

 Score =   289 bits (739),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 136/150 (91%), Positives = 146/150 (97%), Gaps = 0/150 (0%)
 Frame = +3

Query  300  MKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTG  479
            MKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+LAINEIFEK PT +KN+GIWLRYQSRTG
Sbjct  1    MKLWATNEVRAKSKFWYFLRKLKKVKKSNGQMLAINEIFEKNPTTIKNFGIWLRYQSRTG  60

Query  480  YHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSK  659
            YHNMYKE+RDTTLNGAVEQMYTEMASRHRVR  CIQIIKTAT+PAKLCKRESTKQFHNSK
Sbjct  61   YHNMYKEYRDTTLNGAVEQMYTEMASRHRVRFPCIQIIKTATVPAKLCKRESTKQFHNSK  120

Query  660  IKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
            IKFPLVF+KVRPP+RKLKTTYKAS+PN+F+
Sbjct  121  IKFPLVFRKVRPPTRKLKTTYKASKPNLFM  150



>ref|XP_007146225.1| hypothetical protein PHAVU_006G022700g [Phaseolus vulgaris]
 gb|ESW18219.1| hypothetical protein PHAVU_006G022700g [Phaseolus vulgaris]
Length=159

 Score =   288 bits (738),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 142/178 (80%), Positives = 153/178 (86%), Gaps = 19/178 (11%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            MVT+RFHQYQVVGRALP+ETD HPKIYRMKLWATNEVRAKSKFWYFLRK+KKVKKSNGQ+
Sbjct  1    MVTFRFHQYQVVGRALPTETDVHPKIYRMKLWATNEVRAKSKFWYFLRKVKKVKKSNGQM  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LAINE                   SRTGYHNMYKE+RDTTLNGAVEQMY EMASRHRVR 
Sbjct  61   LAINE-------------------SRTGYHNMYKEYRDTTLNGAVEQMYNEMASRHRVRC  101

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
             CIQIIKTATIPAKLCKRE TKQF +SKIKFPLVFKK+RPP+RKLKTTYKAS+PN+F+
Sbjct  102  PCIQIIKTATIPAKLCKRECTKQFLDSKIKFPLVFKKIRPPTRKLKTTYKASKPNLFM  159



>ref|XP_005652280.1| 60S ribosomal protein L18a-2 [Coccomyxa subellipsoidea C-169]
 gb|EIE27736.1| 60S ribosomal protein L18a-2 [Coccomyxa subellipsoidea C-169]
Length=179

 Score =   279 bits (714),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 130/176 (74%), Positives = 150/176 (85%), Gaps = 0/176 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            M  Y++HQYQVVGR LP+E +  P IYRMKLWAT+ VRAKSKFWYFLRKL+KVKK+NGQ+
Sbjct  1    MGGYKYHQYQVVGRHLPTEKEPEPTIYRMKLWATDPVRAKSKFWYFLRKLRKVKKANGQI  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            LA NEIFEK PT VKN+G+W+RYQSRTGYHNMYKE+RDTTLNGAVEQ+Y EMASRHRVR 
Sbjct  61   LAANEIFEKKPTTVKNFGVWVRYQSRTGYHNMYKEYRDTTLNGAVEQLYQEMASRHRVRA  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNI  743
             C+QIIKTAT+PA L KR + KQFH+SKIKFPL  +  RP SR  KTT+KA RPN+
Sbjct  121  PCMQIIKTATVPAALTKRVNIKQFHDSKIKFPLTRRMARPSSRTFKTTFKAVRPNV  176



>dbj|BAH20340.1| AT3G14600 [Arabidopsis thaliana]
Length=150

 Score =   278 bits (711),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 132/150 (88%), Positives = 141/150 (94%), Gaps = 0/150 (0%)
 Frame = +3

Query  300  MKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTG  479
            MKLW  NEV AKSKFWYF+RKLKKVKKSNGQ+LAINEIFEK PT +KNYGIWLRYQSRTG
Sbjct  1    MKLWGRNEVCAKSKFWYFMRKLKKVKKSNGQMLAINEIFEKNPTTIKNYGIWLRYQSRTG  60

Query  480  YHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSK  659
            YHNMYKE+RDTTLNG VEQMYTEMASRHRVR  CIQIIKTAT+PAKLCKRE TKQFHNSK
Sbjct  61   YHNMYKEYRDTTLNGGVEQMYTEMASRHRVRFPCIQIIKTATVPAKLCKREITKQFHNSK  120

Query  660  IKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
            IKFPLVF+KVRPPSRKLKTTYKAS+PN+F+
Sbjct  121  IKFPLVFRKVRPPSRKLKTTYKASKPNLFM  150



>ref|XP_005848088.1| hypothetical protein CHLNCDRAFT_30965 [Chlorella variabilis]
 gb|EFN55986.1| hypothetical protein CHLNCDRAFT_30965 [Chlorella variabilis]
Length=181

 Score =   276 bits (707),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 129/173 (75%), Positives = 146/173 (84%), Gaps = 0/173 (0%)
 Frame = +3

Query  225  YRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAI  404
            Y++HQYQVVGR LPSE D  P IYRMKLWA + VRAKSKFWYFLRKL+KVKK+NGQ+LA 
Sbjct  6    YKYHQYQVVGRHLPSEKDAEPTIYRMKLWAQDPVRAKSKFWYFLRKLRKVKKANGQILAC  65

Query  405  NEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCI  584
            NEIFE+ PT VKNYGIW+RYQSRTG+HN YKE+RDTTLNGAVEQMY EM SRHRVR  CI
Sbjct  66   NEIFERNPTTVKNYGIWVRYQSRTGFHNAYKEYRDTTLNGAVEQMYQEMGSRHRVRSPCI  125

Query  585  QIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNI  743
            QIIKTATI A  CKR +T+Q H+SKI FPL  K +RP SRK +TT+KA RPN+
Sbjct  126  QIIKTATITAAQCKRAATQQLHDSKISFPLTRKVLRPSSRKYRTTFKAVRPNV  178



>gb|KCW89757.1| hypothetical protein EUGRSUZ_A02018 [Eucalyptus grandis]
Length=178

 Score =   265 bits (676),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 122/137 (89%), Positives = 129/137 (94%), Gaps = 0/137 (0%)
 Frame = +3

Query  204  VVAKMVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKS  383
              + MVT+RFHQYQVVGRALP+ +DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKS
Sbjct  32   ATSTMVTFRFHQYQVVGRALPTGSDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKS  91

Query  384  NGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRH  563
            NGQVLAINEIFEK PTK+ NYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRH
Sbjct  92   NGQVLAINEIFEKNPTKINNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRH  151

Query  564  RVRHHCIQIIKTATIPA  614
            RVR  CIQIIKTAT+PA
Sbjct  152  RVRFPCIQIIKTATVPA  168



>gb|KJB69797.1| hypothetical protein B456_011G042800 [Gossypium raimondii]
Length=145

 Score =   260 bits (665),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 124/134 (93%), Positives = 131/134 (98%), Gaps = 0/134 (0%)
 Frame = +3

Query  348  YFLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGA  527
            YFLRKLKKVKKSNGQVLAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGA
Sbjct  12   YFLRKLKKVKKSNGQVLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGA  71

Query  528  VEQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRK  707
            VEQMYTEMASRHRVR  CIQIIKTATIPAKLCKR+STKQFHNSKIKFPLVFKKVRPP+RK
Sbjct  72   VEQMYTEMASRHRVRFPCIQIIKTATIPAKLCKRDSTKQFHNSKIKFPLVFKKVRPPTRK  131

Query  708  LKTTYKASRPNIFV  749
            LKTTYKAS+PN+F+
Sbjct  132  LKTTYKASKPNLFM  145



>gb|KIZ01204.1| 60S ribosomal protein L18a-2 [Monoraphidium neglectum]
Length=182

 Score =   261 bits (668),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 118/173 (68%), Positives = 145/173 (84%), Gaps = 0/173 (0%)
 Frame = +3

Query  225  YRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAI  404
            +++HQYQVVGR  P+  + +P +YRMK+WA + V AKSKFWYFLRKL++VKK+NGQVLA+
Sbjct  7    FKYHQYQVVGRHNPTTAEPNPTVYRMKVWAPDAVCAKSKFWYFLRKLRRVKKANGQVLAV  66

Query  405  NEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCI  584
            NEIFE+  T VKN+G+W+RYQSRTGYHNMYKE+RDTTLNGA+ QMY EMASRHRVR+ CI
Sbjct  67   NEIFERKTTTVKNFGVWVRYQSRTGYHNMYKEYRDTTLNGAIGQMYGEMASRHRVRYPCI  126

Query  585  QIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNI  743
            Q+IKTAT+PA  CKR +T QFH+SKIKFPL    +RP S+  KT YKA RPN+
Sbjct  127  QVIKTATVPASACKRANTLQFHDSKIKFPLTHNALRPSSKVFKTLYKAKRPNV  179



>gb|ERM96192.1| hypothetical protein AMTR_s00001p00102800 [Amborella trichopoda]
Length=138

 Score =   255 bits (651),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 120/134 (90%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = +3

Query  348  YFLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGA  527
            YFLRKLKKVKKSNGQVLAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGA
Sbjct  5    YFLRKLKKVKKSNGQVLAINEIFEKKPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGA  64

Query  528  VEQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRK  707
            VEQMY EMASRHRVR  CIQIIKTATIPAKLCKRE+TKQFH+S+IKFPLVF+KVRPP+RK
Sbjct  65   VEQMYNEMASRHRVRSPCIQIIKTATIPAKLCKRENTKQFHDSRIKFPLVFRKVRPPTRK  124

Query  708  LKTTYKASRPNIFV  749
            LKTT+KASRPN+F+
Sbjct  125  LKTTFKASRPNLFM  138



>ref|XP_011401286.1| 60S ribosomal protein L18a-2 [Auxenochlorella protothecoides]
 gb|KFM28272.1| 60S ribosomal protein L18a-2 [Auxenochlorella protothecoides]
Length=182

 Score =   255 bits (652),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 116/175 (66%), Positives = 141/175 (81%), Gaps = 0/175 (0%)
 Frame = +3

Query  225  YRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAI  404
            Y++HQYQVVGR LP+E D  P I+RMKLWA + VRAKSKFWYFL KL+KVKK+NGQ++A+
Sbjct  7    YKYHQYQVVGRHLPTEKDAEPPIFRMKLWAQDTVRAKSKFWYFLAKLRKVKKANGQIVAV  66

Query  405  NEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCI  584
            NEIFE+ PT +KN+GIW+RY SRTG HNM+KE+RD TLNGAVEQMY EM SRHRVR   +
Sbjct  67   NEIFERRPTTIKNFGIWVRYTSRTGVHNMFKEYRDVTLNGAVEQMYQEMGSRHRVRSSAL  126

Query  585  QIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
            QIIKTATI A   KR + KQFH+SKI FPL  +  RP   + KTT+KA+RPN+ +
Sbjct  127  QIIKTATIKAADTKRANIKQFHDSKISFPLTRRMARPSDPRFKTTFKANRPNVAI  181



>ref|XP_001689743.1| ribosomal protein L18a, component of cytosolic 80S ribosome and 
60S large subunit [Chlamydomonas reinhardtii]
 gb|EDP09481.1| ribosomal protein L18a [Chlamydomonas reinhardtii]
Length=182

 Score =   254 bits (650),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 115/173 (66%), Positives = 140/173 (81%), Gaps = 0/173 (0%)
 Frame = +3

Query  225  YRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAI  404
            ++FHQYQVVGR LP+  D +P +YRMK+WA ++V+AKSKFWYFLRKL++VKK+NGQ++A 
Sbjct  7    FKFHQYQVVGRHLPTAADANPTVYRMKVWAEDDVKAKSKFWYFLRKLRRVKKANGQIIAC  66

Query  405  NEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCI  584
            NEIFE+ PT  KNYGIW+RYQSRTG HNMYKE+RD TLNG+V QMY EMASRHRVR   I
Sbjct  67   NEIFERKPTLAKNYGIWVRYQSRTGVHNMYKEYRDVTLNGSVSQMYQEMASRHRVRPSSI  126

Query  585  QIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNI  743
            QIIKTAT+    CKR +TKQFHN KI FP+  K  RP S   +T +KA+RPN+
Sbjct  127  QIIKTATVDYHSCKRANTKQFHNEKISFPVTQKLARPSSATFRTLFKANRPNV  179



>ref|XP_002948508.1| ribosomal protein L18A component of cytosolic 80S ribosome and 
60S large subunit [Volvox carteri f. nagariensis]
 gb|EFJ50383.1| ribosomal protein L18A component of cytosolic 80S ribosome and 
60S large subunit [Volvox carteri f. nagariensis]
Length=182

 Score =   252 bits (643),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 114/173 (66%), Positives = 140/173 (81%), Gaps = 0/173 (0%)
 Frame = +3

Query  225  YRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAI  404
            ++FHQYQVVGR LP+  D  P +YRMK+WA ++V+AKSKFWYFLRKL++VKK+NGQ++A 
Sbjct  7    FKFHQYQVVGRHLPTAADATPTVYRMKVWAEDDVKAKSKFWYFLRKLRRVKKANGQIIAC  66

Query  405  NEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCI  584
            NEIFE+ PT  KNYG+W+RYQSRTG HNMYKE+RD TLNG+V QMY EMASRHRVR   I
Sbjct  67   NEIFERKPTLAKNYGVWVRYQSRTGVHNMYKEYRDVTLNGSVAQMYQEMASRHRVRPSSI  126

Query  585  QIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNI  743
            QIIKTAT+    CKR +TKQFHN  IKFP+  K  RP + + +T +KASRPN+
Sbjct  127  QIIKTATVDYHSCKRANTKQFHNENIKFPVTHKLSRPSNPEFRTLFKASRPNV  179



>gb|KDD75676.1| ribosomal protein L18ae/LX [Helicosporidium sp. ATCC 50920]
Length=182

 Score =   251 bits (641),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 116/172 (67%), Positives = 140/172 (81%), Gaps = 0/172 (0%)
 Frame = +3

Query  225  YRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAI  404
            +++ QYQVVGR LP+E D  P ++RMKLWA + VRAKSKFWYF+RKL+KVKK+NGQV+A+
Sbjct  7    FKYKQYQVVGRHLPTEKDAEPALFRMKLWAEDSVRAKSKFWYFMRKLRKVKKANGQVVAV  66

Query  405  NEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCI  584
            NEI EK PT VKNYGIW+RY SRTG HNMYKEFRDTTLNGAV QMY+EMA RHRVRH  +
Sbjct  67   NEIVEKRPTVVKNYGIWVRYTSRTGVHNMYKEFRDTTLNGAVSQMYSEMAGRHRVRHSAL  126

Query  585  QIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPN  740
            QIIKTA IPA+L KR   KQF ++KI+FP+  + VRP SR  K+ ++  RPN
Sbjct  127  QIIKTAEIPAELVKRPGVKQFLSAKIRFPITRRLVRPSSRVHKSLFQDRRPN  178



>ref|XP_003617398.1| 60S ribosomal protein L18a [Medicago truncatula]
Length=147

 Score =   249 bits (635),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 118/134 (88%), Positives = 126/134 (94%), Gaps = 0/134 (0%)
 Frame = +3

Query  348  YFLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGA  527
            YFLRKLKKVKKSNGQVLAINEIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGA
Sbjct  14   YFLRKLKKVKKSNGQVLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGA  73

Query  528  VEQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRK  707
            VE MY EMASRHRVR  CIQIIKTATIPA LCKRESTKQFHNSKIKFPLV+KK+RPP+R 
Sbjct  74   VETMYNEMASRHRVRFPCIQIIKTATIPANLCKRESTKQFHNSKIKFPLVYKKIRPPTRS  133

Query  708  LKTTYKASRPNIFV  749
            LKTTYKA +PN+F+
Sbjct  134  LKTTYKAKKPNLFM  147



>ref|XP_006387717.1| hypothetical protein POPTR_0647s00210g [Populus trichocarpa]
 gb|ERP46631.1| hypothetical protein POPTR_0647s00210g [Populus trichocarpa]
Length=152

 Score =   248 bits (634),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 118/129 (91%), Positives = 125/129 (97%), Gaps = 0/129 (0%)
 Frame = +3

Query  363  LKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMY  542
            LKKVKKSNGQ+LAINEIFEK PT +KN+GIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMY
Sbjct  24   LKKVKKSNGQILAINEIFEKNPTTIKNFGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMY  83

Query  543  TEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTY  722
            TEMASRHRVR  CIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPP+RKLKTTY
Sbjct  84   TEMASRHRVRFPCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPTRKLKTTY  143

Query  723  KASRPNIFV  749
            KASRPN+F+
Sbjct  144  KASRPNLFM  152



>ref|XP_007508296.1| unknown [Bathycoccus prasinos]
 emb|CCO20400.1| unknown [Bathycoccus prasinos]
Length=211

 Score =   228 bits (582),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 100/173 (58%), Positives = 134/173 (77%), Gaps = 0/173 (0%)
 Frame = +3

Query  231  FHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINE  410
            +HQYQ+VGR +P+E +  P++YRMKLWA +  RA+SKFWYFL +L+KVKK+NGQ++A NE
Sbjct  38   YHQYQIVGRRVPTEQEPTPQVYRMKLWALDATRARSKFWYFLSRLRKVKKANGQIIACNE  97

Query  411  IFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQI  590
            IFEK  T VKNYG+W+RYQSR G+HN YKE+R+TT+N AV+ +YTEMASRHRVR H +QI
Sbjct  98   IFEKDDTTVKNYGVWIRYQSRVGFHNAYKEYRETTMNAAVDALYTEMASRHRVRSHALQI  157

Query  591  IKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
            IK A +  +  +RE+T+QF    + FP+V K +R  S+  KTT+K  RPN  +
Sbjct  158  IKIAEVANEDVRRENTRQFLADDVSFPVVRKTLRHDSKSQKTTFKYQRPNFAI  210



>ref|XP_001418811.1| Ribosomal protein L18a, component of cytosolic 80S ribosome and 
60S large subunit [Ostreococcus lucimarinus CCE9901]
 gb|ABO97104.1| Ribosomal protein L18a, component of cytosolic 80S ribosome and 
60S large subunit [Ostreococcus lucimarinus CCE9901]
Length=179

 Score =   226 bits (577),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 102/175 (58%), Positives = 133/175 (76%), Gaps = 0/175 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            M   R+HQYQVVGR +P++    P+++RMKLWA ++V+A+SKFWYF+ +LKKVKK+NGQ+
Sbjct  1    MAKIRYHQYQVVGRHVPTDAHPEPEVFRMKLWALDDVKARSKFWYFMSRLKKVKKANGQI  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            +A NEIFE   T VKN+GIW+RYQSRTGYHN YKE+R+TT+N AV+ +Y EMASRHRVR 
Sbjct  61   IACNEIFEADTTTVKNFGIWIRYQSRTGYHNSYKEYRETTMNAAVDALYEEMASRHRVRA  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPN  740
             C+QIIK A +  K  +RE+T+QF    + FP+V K  R PS+  KT  K  RPN
Sbjct  121  SCLQIIKIAEVADKDVRRENTRQFIQDDLSFPVVTKVTRHPSKASKTIIKYKRPN  175



>ref|XP_006384076.1| 60S ribosomal protein L18a-1 [Populus trichocarpa]
 gb|ERP61873.1| 60S ribosomal protein L18a-1 [Populus trichocarpa]
Length=121

 Score =   224 bits (570),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 106/113 (94%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = +3

Query  411  IFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQI  590
            IFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR  CIQI
Sbjct  9    IFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRFPCIQI  68

Query  591  IKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
            IKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPN+F+
Sbjct  69   IKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFM  121



>gb|KDO49364.1| hypothetical protein CISIN_1g028910mg [Citrus sinensis]
Length=124

 Score =   224 bits (570),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 105/114 (92%), Positives = 111/114 (97%), Gaps = 0/114 (0%)
 Frame = +3

Query  408  EIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQ  587
            EIFEK PTK+KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR  CIQ
Sbjct  11   EIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRSPCIQ  70

Query  588  IIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
            II+TATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPP+RKLKTTYKASRPN+F+
Sbjct  71   IIRTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPTRKLKTTYKASRPNLFM  124



>ref|XP_011648501.1| PREDICTED: 60S ribosomal protein L18a-2-like, partial [Cucumis 
sativus]
Length=121

 Score =   221 bits (563),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 103/114 (90%), Positives = 111/114 (97%), Gaps = 0/114 (0%)
 Frame = +3

Query  408  EIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQ  587
            +IFEK PTKVKNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR  CIQ
Sbjct  8    QIFEKNPTKVKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRSPCIQ  67

Query  588  IIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
            IIKTAT+PAKLCKRESTKQFH+SKIKFPLVFKKVRPP+RKLKTTYKAS+PN+F+
Sbjct  68   IIKTATVPAKLCKRESTKQFHDSKIKFPLVFKKVRPPTRKLKTTYKASKPNLFM  121



>ref|XP_008880083.1| hypothetical protein H310_14105 [Aphanomyces invadans]
 gb|ETV91246.1| hypothetical protein H310_14105 [Aphanomyces invadans]
Length=177

 Score =   221 bits (563),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 101/172 (59%), Positives = 133/172 (77%), Gaps = 0/172 (0%)
 Frame = +3

Query  231  FHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINE  410
             H YQVVGR  P+ETD +P  +RMKL+A NEV AKS+FWYFL ++KK+KK+ G++L+INE
Sbjct  4    IHHYQVVGRKAPTETDPNPPAFRMKLFAPNEVLAKSRFWYFLHQMKKMKKTTGEILSINE  63

Query  411  IFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQI  590
            + EK    VKNYG+W+RY SR+G HNMYKE+RD TLNGA+EQ+Y E+A RHR R   IQI
Sbjct  64   LREKNKRIVKNYGVWIRYNSRSGTHNMYKEYRDVTLNGAIEQLYAELAGRHRARPRSIQI  123

Query  591  IKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIF  746
            ++TA + AK CK+ +T Q+H+SKIKFPL  +  RP  +K +T YKA+RP+ F
Sbjct  124  MRTAILAAKDCKKPNTLQYHDSKIKFPLSHRVPRPSLKKFRTVYKANRPSTF  175



>emb|CEF98555.1| Ribosomal protein L18ae [Ostreococcus tauri]
Length=179

 Score =   221 bits (563),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 100/175 (57%), Positives = 135/175 (77%), Gaps = 0/175 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            M  YR+ Q+QVVGR LP+E    P+++RMKLWA ++V+A+SKFWYF+ +LKKVKK+NGQ+
Sbjct  1    MAPYRYRQFQVVGRHLPTEATPEPEVFRMKLWALDDVKARSKFWYFMSRLKKVKKANGQI  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            +A NEIFE+  T VKN+GIW+RYQSRTG+HN YKE+R+TT+N AV+ +Y EMASRHRVR 
Sbjct  61   IACNEIFEEDTTTVKNFGIWIRYQSRTGFHNSYKEYRETTMNKAVDALYEEMASRHRVRS  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPN  740
              +QIIK A +  +  +RE+T+QF    + FP+V K +R PS+  KT +K  RPN
Sbjct  121  SQLQIIKIAEVSDENVRRENTRQFLAEDLSFPVVNKVMRHPSKATKTIFKYKRPN  175



>gb|ADV03035.1| ribosomal protein L18A [Karlodinium veneficum]
Length=187

 Score =   220 bits (560),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 103/187 (55%), Positives = 136/187 (73%), Gaps = 6/187 (3%)
 Frame = +3

Query  189  QEDGSVVAKMVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLK  368
            + D S+ A+M     HQYQ+VGRA P+  +  PKIYRM+L+A N V AKS+FWYF++K+ 
Sbjct  6    KADASLQARM-----HQYQIVGRAAPTPKNPTPKIYRMRLFAKNAVLAKSRFWYFMKKIN  60

Query  369  KVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTE  548
            K K+S G++L +NE+F++ PTKVKNYGIWLRY+SRT  HNMYKEFRD T+NGAV Q+Y+E
Sbjct  61   KAKRSGGELLGVNELFDRAPTKVKNYGIWLRYESRTNTHNMYKEFRDVTINGAVSQLYSE  120

Query  549  MASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKA  728
            MA RHR +   IQII T  + A  CKR+   + H S +KFP V +K+   ++KLKTT+ A
Sbjct  121  MAGRHRAQPGSIQIIDTKVLKASECKRDHVTEMHKSDLKFP-VIRKMPMSAKKLKTTFTA  179

Query  729  SRPNIFV  749
             RP  FV
Sbjct  180  KRPMTFV  186



>emb|CBI30857.3| unnamed protein product [Vitis vinifera]
Length=124

 Score =   216 bits (549),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 99/105 (94%), Positives = 103/105 (98%), Gaps = 0/105 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            MVT+RFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVTFRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  530
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGA+
Sbjct  61   LAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAL  105



>ref|XP_009831602.1| hypothetical protein H257_07690 [Aphanomyces astaci]
 gb|ETV78883.1| hypothetical protein H257_07690 [Aphanomyces astaci]
Length=177

 Score =   216 bits (550),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 98/172 (57%), Positives = 131/172 (76%), Gaps = 0/172 (0%)
 Frame = +3

Query  231  FHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINE  410
             H YQVVGR  P+ETD +P  +RMKL+A NEV AKS+FWYFL ++KK+KK+ G++L++NE
Sbjct  4    IHHYQVVGRKAPTETDPNPPAFRMKLFAPNEVLAKSRFWYFLHQMKKMKKTTGEILSVNE  63

Query  411  IFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQI  590
            + EK    VKNYG+W+RY SR+G HNMYKE+RD TLN A+EQ+Y E+A RHR R   IQI
Sbjct  64   LREKNKRIVKNYGVWIRYNSRSGTHNMYKEYRDVTLNSAIEQLYAELAGRHRARPRSIQI  123

Query  591  IKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIF  746
            ++TA + AK CK+ +T Q+HNS IKFPL  +  RP  +K +T +KA+RP+ F
Sbjct  124  MRTAILAAKDCKKPNTLQYHNSAIKFPLSHRVPRPSLKKFRTIFKANRPSTF  175



>ref|XP_008604133.1| 50S ribosomal protein L18Ae [Saprolegnia diclina VS20]
 gb|EQC42710.1| 50S ribosomal protein L18Ae [Saprolegnia diclina VS20]
Length=177

 Score =   215 bits (547),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 99/172 (58%), Positives = 130/172 (76%), Gaps = 0/172 (0%)
 Frame = +3

Query  231  FHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINE  410
             HQYQVVGR  P+E+D +P  +RMKL+A NEV AKS+FWYFL ++KK+KK+ G++L +NE
Sbjct  4    IHQYQVVGRKAPTESDPNPPAFRMKLFAPNEVLAKSRFWYFLHQMKKMKKTTGEILCLNE  63

Query  411  IFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQI  590
            + EK    VKNYG+W+RY SR+G HNMYKE+RD TL GAVEQMY E+A RHR R   IQI
Sbjct  64   LREKNKRIVKNYGVWIRYNSRSGTHNMYKEYRDVTLCGAVEQMYAELAGRHRARPRSIQI  123

Query  591  IKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIF  746
            ++TA + AK CK+ +T Q+H+S IKFPL  +  RP ++  +T +KASRP  F
Sbjct  124  MRTAILAAKDCKKPNTLQYHDSAIKFPLSHRVPRPANKNQRTVFKASRPTTF  175



>gb|AFW81143.1| hypothetical protein ZEAMMB73_376835 [Zea mays]
Length=119

 Score =   213 bits (541),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 97/119 (82%), Positives = 112/119 (94%), Gaps = 0/119 (0%)
 Frame = +3

Query  393  VLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVR  572
            +LAINEIFE+ PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASRHRVR
Sbjct  1    MLAINEIFERNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYNEMASRHRVR  60

Query  573  HHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
              CIQIIKTAT+  KLCKR++TKQFHNS+IKFPLV++KVRPP+RKL+TT+KASRPN+F+
Sbjct  61   SPCIQIIKTATVHFKLCKRDNTKQFHNSEIKFPLVYRKVRPPTRKLRTTFKASRPNLFM  119



>gb|ABQ42114.1| 60S ribosomal protein L18a [Sonneratia caseolaris]
Length=107

 Score =   212 bits (539),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 100/107 (93%), Positives = 102/107 (95%), Gaps = 0/107 (0%)
 Frame = +3

Query  276  DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIW  455
            DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEK PTK+ NYGIW
Sbjct  1    DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKNPTKIDNYGIW  60

Query  456  LRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQIIK  596
            LRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASRHRVR  CIQIIK
Sbjct  61   LRYQSRTGYHNMYKEYRDTTLNGAVEQMYNEMASRHRVRFPCIQIIK  107



>gb|ABQ42113.1| 60S ribosomal protein L18a [Sonneratia alba]
 gb|ABQ42115.1| 60S ribosomal protein L18a [Sonneratia ovata]
 gb|ABQ42116.1| 60S ribosomal protein L18a [Sonneratia apetala]
Length=107

 Score =   211 bits (537),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 99/107 (93%), Positives = 102/107 (95%), Gaps = 0/107 (0%)
 Frame = +3

Query  276  DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIW  455
            DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEK PT++ NYGIW
Sbjct  1    DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKNPTRIDNYGIW  60

Query  456  LRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQIIK  596
            LRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASRHRVR  CIQIIK
Sbjct  61   LRYQSRTGYHNMYKEYRDTTLNGAVEQMYNEMASRHRVRFPCIQIIK  107



>ref|XP_009144150.1| PREDICTED: 60S ribosomal protein L18a-2-like [Brassica rapa]
Length=117

 Score =   211 bits (536),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 98/113 (87%), Positives = 107/113 (95%), Gaps = 0/113 (0%)
 Frame = +3

Query  411  IFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQI  590
            IFEK PT +KN+GIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR  CIQI
Sbjct  5    IFEKNPTTIKNFGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRFPCIQI  64

Query  591  IKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
            IKTAT+PAKLCKRESTK FHNSKIKFP VF+KVRPP+RKLKTTYKAS+PN+F+
Sbjct  65   IKTATVPAKLCKRESTKLFHNSKIKFPSVFRKVRPPTRKLKTTYKASKPNLFM  117



>ref|XP_003062312.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH53131.1| predicted protein [Micromonas pusilla CCMP1545]
Length=185

 Score =   213 bits (542),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 98/181 (54%), Positives = 136/181 (75%), Gaps = 2/181 (1%)
 Frame = +3

Query  204  VVAKMVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKS  383
            +V  +  +R+HQY +VGR +P++ D +P++YRMKLW+ ++ RAKSKFWYFL +LKKVKK+
Sbjct  1    MVKGLKPHRYHQYHIVGRHVPTDADPNPQVYRMKLWSLDDTRAKSKFWYFLSRLKKVKKA  60

Query  384  NGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRH  563
            NGQ++A NEIFE+  T +KN+GIW+RYQSRTG+HN YKE+R+ ++N AV+ +Y EMASRH
Sbjct  61   NGQIIACNEIFEEDVTTIKNFGIWIRYQSRTGFHNAYKEYREISMNKAVDALYEEMASRH  120

Query  564  RVRHHCIQIIKTATIPAKLCKRESTKQFHNSK--IKFPLVFKKVRPPSRKLKTTYKASRP  737
            RVR  C+QIIK   +     KR++T QF   K  + FP+V K +R  S+  KTT+K  RP
Sbjct  121  RVRAPCLQIIKICQVADADVKRDNTIQFLGVKEPVSFPVVNKVLRHDSKSQKTTFKYKRP  180

Query  738  N  740
            N
Sbjct  181  N  181



>gb|EMS66554.1| 60S ribosomal protein L18a [Triticum urartu]
Length=146

 Score =   209 bits (532),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 106/179 (59%), Positives = 124/179 (69%), Gaps = 34/179 (19%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            MV +RFHQYQVVGR LP+ T++HP+IYRMKLWATNE                        
Sbjct  1    MVAFRFHQYQVVGRGLPTPTEDHPRIYRMKLWATNE------------------------  36

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRH-RVR  572
                 IFEK PT ++N+GIWLRYQSRTGYHNMY E+ DTTLNGAVEQMYTEMASRH    
Sbjct  37   -----IFEKNPTTIENFGIWLRYQSRTGYHNMYNEYSDTTLNGAVEQMYTEMASRHCAAS  91

Query  573  HHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
                Q + T  I    CKR++TKQFH S I+F LV++KVRPPSRKL+TT+KASRPN+FV
Sbjct  92   RSSRQPLSTPNI----CKRDNTKQFHKSDIRFLLVYQKVRPPSRKLQTTFKASRPNLFV  146



>ref|XP_002501229.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO62487.1| predicted protein [Micromonas sp. RCC299]
Length=188

 Score =   207 bits (528),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 96/172 (56%), Positives = 130/172 (76%), Gaps = 2/172 (1%)
 Frame = +3

Query  231  FHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINE  410
            + Q+ +VGR +P++    P++YRMKLW+T++ RAKSKFWYFL +LKKVKK+NGQ+LA NE
Sbjct  13   YRQFHIVGRHVPTDAMPDPQVYRMKLWSTDDTRAKSKFWYFLSRLKKVKKANGQILACNE  72

Query  411  IFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQI  590
            IFE+  T +KN+GIW+RYQSRTG+HN YKE+R+ ++N AV+ +Y EMASRHRVR  C+QI
Sbjct  73   IFEEDVTTIKNFGIWIRYQSRTGFHNAYKEYREVSMNKAVDALYEEMASRHRVRAPCLQI  132

Query  591  IKTATIPAKLCKRESTKQFHNSK--IKFPLVFKKVRPPSRKLKTTYKASRPN  740
            IK A +     KR++T QF   K  + FP+V K +R  S+  KTT+K  RPN
Sbjct  133  IKIAQVADADVKRDNTIQFLGVKEPVSFPVVNKVLRHDSKSQKTTFKYKRPN  184



>emb|CBN79653.1| ribosomal protein L18 [Ectocarpus siliculosus]
Length=238

 Score =   207 bits (528),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 108/222 (49%), Positives = 142/222 (64%), Gaps = 11/222 (5%)
 Frame = +3

Query  96   PPSCC--LNRPTPFVGPSLA--AQrerergrergSQEDGSVVAKMVTYRFHQYQVVGRAL  263
            PP  C  + RP     PSLA   +           Q  G  + KMV  R  QYQVVGR  
Sbjct  23   PPYSCRLILRP-----PSLALRCRGAARPVLLILRQPHGIRLFKMVAMR--QYQVVGRKA  75

Query  264  PSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKCPTKVKN  443
             +E + +P +YRMK++A NEV   S+FWY + +++K+KK+ G++L I E+ EK    +KN
Sbjct  76   VTEKEPNPPVYRMKVFAPNEVTGASQFWYLMHQMRKMKKTTGEILDIVELTEKNARIIKN  135

Query  444  YGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQIIKTATIPAKLC  623
            YGIWLRY SR+G HNMY+E+RD TL GAV+QMY+EMA RHR R   IQII+T  + AK  
Sbjct  136  YGIWLRYDSRSGTHNMYREYRDLTLTGAVDQMYSEMAGRHRCRPRSIQIIRTGIVAAKDT  195

Query  624  KRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
            KR   +QFHN+ IKFPL  +  R P +K +TT+KASRP  F+
Sbjct  196  KRPDVQQFHNANIKFPLTHRLPRAPKKKFRTTFKASRPTTFL  237



>gb|ACN30573.1| unknown [Zea mays]
Length=117

 Score =   203 bits (516),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 93/114 (82%), Positives = 107/114 (94%), Gaps = 0/114 (0%)
 Frame = +3

Query  408  EIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQ  587
            +IFE+ PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASRHRVR  CIQ
Sbjct  4    QIFERNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYNEMASRHRVRSPCIQ  63

Query  588  IIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
            IIKTAT+  KLCKR++TKQFHNS+IKFPLV++KVRPP+RKLKTT+KASRPN+F+
Sbjct  64   IIKTATVHFKLCKRDNTKQFHNSEIKFPLVYRKVRPPTRKLKTTFKASRPNLFM  117



>ref|XP_005702735.1| 60S ribosomal protein L18Ae [Galdieria sulphuraria]
 gb|EME26215.1| 60S ribosomal protein L18Ae [Galdieria sulphuraria]
Length=178

 Score =   205 bits (521),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 96/173 (55%), Positives = 126/173 (73%), Gaps = 0/173 (0%)
 Frame = +3

Query  231  FHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINE  410
             HQY VVGR +P++ +  P IYR+K++A N V AKS+FWYFLRKLK+VKKS+G++L I+E
Sbjct  5    LHQYSVVGRKIPTQEEPEPPIYRLKIFAPNVVNAKSRFWYFLRKLKRVKKSSGEILNISE  64

Query  411  IFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQI  590
            IFEK  T+VKNYGIW+RY+SR+   NMY+E+RD T+NGAVEQMY +M+ RHR R   I +
Sbjct  65   IFEKKSTQVKNYGIWIRYKSRSDTINMYREYRDVTVNGAVEQMYKDMSGRHRARWSSIWV  124

Query  591  IKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
            +K   + AK C+R    QFH+SKIKF L   + R P +K  T +KA RP   V
Sbjct  125  LKAMPVAAKDCRRSKVTQFHDSKIKFALPHMRPRAPLKKYNTPFKAKRPTTIV  177



>gb|ADV03042.1| ribosomal protein L18A [Amphidinium carterae]
Length=187

 Score =   203 bits (516),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 98/187 (52%), Positives = 132/187 (71%), Gaps = 6/187 (3%)
 Frame = +3

Query  189  QEDGSVVAKMVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLK  368
            +ED S+  KM     HQ+Q+VGRA P+     PKIYRM+L+A N V AKS+FWYF++K+ 
Sbjct  6    KEDPSLKPKM-----HQFQIVGRAAPTTKRPTPKIYRMRLFAKNTVMAKSRFWYFMKKMC  60

Query  369  KVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTE  548
            K KKS G++LA+NEI ++ P  VKNYGIWLRY+SRT  HNMYKE+RD  +N AV +MY E
Sbjct  61   KAKKSGGELLAVNEIKDRRPLVVKNYGIWLRYESRTNTHNMYKEYRDVDINNAVGKMYQE  120

Query  549  MASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKA  728
            M+ RHR     IQII TA +P   C+R+   + H   ++FP+V +K+  P +K ++T+KA
Sbjct  121  MSGRHRANPGSIQIINTAVLPDDKCRRDHVTEMHQKMLRFPVV-RKLPLPLKKYRSTFKA  179

Query  729  SRPNIFV  749
            SRPN FV
Sbjct  180  SRPNTFV  186



>gb|ACS68696.1| 60S RPL18aB [Sonneratia alba]
 gb|ACS68767.1| 60S RPL18aB, partial [Sonneratia alba]
Length=101

 Score =   199 bits (505),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 93/101 (92%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = +3

Query  285  PKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRY  464
            PKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEK PT++ NYGIWLRY
Sbjct  1    PKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKNPTRIDNYGIWLRY  60

Query  465  QSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQ  587
            QSRTGYHNMYKE+RDTTLNGAVEQMY EMASRHRVR  CIQ
Sbjct  61   QSRTGYHNMYKEYRDTTLNGAVEQMYNEMASRHRVRFPCIQ  101



>ref|XP_637982.2| S60 ribosomal protein L18a [Dictyostelium discoideum AX4]
 sp|Q54MK8.2|RL18A_DICDI RecName: Full=60S ribosomal protein L18a [Dictyostelium discoideum]
 gb|EAL64475.2| S60 ribosomal protein L18a [Dictyostelium discoideum AX4]
Length=171

 Score =   199 bits (507),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 95/171 (56%), Positives = 123/171 (72%), Gaps = 5/171 (3%)
 Frame = +3

Query  234  HQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINEI  413
            H++QVVGR +P+E D +PKIYRM+L+A   + AKS+FWYFL K+ K+KKS G++L + EI
Sbjct  4    HEFQVVGRHVPTERDANPKIYRMRLFAQTSIHAKSRFWYFLSKIVKMKKSTGEILNVTEI  63

Query  414  FEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQII  593
            FE  P KVKN+G+++RY SR+G HN+YKE+RD T  GAV QMY EMASRH  R   I II
Sbjct  64   FEDKPQKVKNFGVFIRYNSRSGTHNIYKEYRDLTRCGAVSQMYDEMASRHSARESSIHII  123

Query  594  KTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIF  746
                I A L +R +TKQFH+SKIKFPL  +       K K+T+ A+RPN F
Sbjct  124  DIKEIAASLTRRANTKQFHDSKIKFPLTHRIA-----KSKSTFVANRPNTF  169



>gb|KHN49096.1| 60S ribosomal protein L18a-2, partial [Glycine soja]
Length=116

 Score =   197 bits (502),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 92/116 (79%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = +3

Query  402  INEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHC  581
            I + FEK PTK+KNYGIWLRYQSRTGY +MYKE+RDTTLNGA+  MY EMASRHRVR  C
Sbjct  1    IFQTFEKNPTKIKNYGIWLRYQSRTGYDSMYKEYRDTTLNGAIRVMYNEMASRHRVRSPC  60

Query  582  IQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIFV  749
            IQIIK  TIPAKLCKRESTKQFHNSKI FPLV+KKVRPP+RKLK TYKA +PN+F+
Sbjct  61   IQIIKIVTIPAKLCKRESTKQFHNSKINFPLVYKKVRPPTRKLKATYKAKKPNLFM  116



>gb|KFH68950.1| 60S ribosomal protein L20 [Mortierella verticillata NRRL 6337]
Length=176

 Score =   198 bits (503),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 92/173 (53%), Positives = 122/173 (71%), Gaps = 0/173 (0%)
 Frame = +3

Query  228  RFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAIN  407
            R H+YQ+VGR LP+E D  PK++RM+L+A NEV AKS+FWYF+RKLKKVKK NG+++ IN
Sbjct  3    RLHEYQLVGRHLPTEKDATPKLFRMRLFAPNEVIAKSRFWYFMRKLKKVKKVNGEIVGIN  62

Query  408  EIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQ  587
            EI EK P ++KN+GIW+RY SR+G HNMYKE+R+ T N AVE  Y++MASRHR R   IQ
Sbjct  63   EIHEKKPLQIKNFGIWIRYDSRSGTHNMYKEYRELTRNAAVEACYSDMASRHRARSRSIQ  122

Query  588  IIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIF  746
            II+ A +     +R   KQ     IKFPL  + +R   +  +  +  SRP+ F
Sbjct  123  IIRVAEVANADVRRPYIKQILVPGIKFPLPHRVIRAADKSHRALFMGSRPSTF  175



>gb|KFM72761.1| 60S ribosomal protein L18a, partial [Stegodyphus mimosarum]
Length=165

 Score =   196 bits (499),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 86/152 (57%), Positives = 118/152 (78%), Gaps = 0/152 (0%)
 Frame = +3

Query  219  VTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVL  398
            V  +  +++++GR LP+E + +P +YRM+++A ++V AKS+FWYF RKLKK+KKSNG+++
Sbjct  3    VKGQLKEFKIIGRPLPTEKERNPPLYRMRIFAPDKVTAKSRFWYFTRKLKKLKKSNGEIV  62

Query  399  AINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHH  578
             I+EI++K PTKVKN+GIWLRY SRTG HNMY+E+RD T+  AV Q Y +M +RHR R  
Sbjct  63   CISEIYDKTPTKVKNFGIWLRYNSRTGTHNMYREYRDMTVASAVTQCYRDMGARHRARAD  122

Query  579  CIQIIKTATIPAKLCKRESTKQFHNSKIKFPL  674
             IQI+K   IPA  C+R   KQFH+SKIKFPL
Sbjct  123  SIQIMKVEEIPASKCRRPHVKQFHDSKIKFPL  154



>gb|ELK19170.1| 60S ribosomal protein L18a [Pteropus alecto]
Length=212

 Score =   197 bits (501),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 96/212 (45%), Positives = 137/212 (65%), Gaps = 5/212 (2%)
 Frame = +3

Query  117  RPTPFVGPSLAA--QrerergrergSQEDGSVVAKMVTYRFHQYQVVGRALPSETDEHPK  290
            +P   + PSL+   Q +        S  D  +   ++ ++  +Y+VVGR LP+     P 
Sbjct  3    KPWDGIHPSLSTGHQWKGSGASPVASAVDAGLTPPLILFQLREYKVVGRCLPTPKCRTPP  62

Query  291  IYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQS  470
            +YRM+++A N V AKS+FWYF+ +LKK+KKS+G+++   ++FEK P +VKN+GIWLRY S
Sbjct  63   LYRMRIFAPNHVVAKSRFWYFVSQLKKMKKSSGEIVYCGQVFEKSPLRVKNFGIWLRYDS  122

Query  471  RTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFH  650
            R+G HNMY+E+RD T  GAV Q Y +M +RHR R H IQI+K   I A  C+R + KQFH
Sbjct  123  RSGTHNMYREYRDLTTAGAVTQCYRDMGARHRARAHSIQIMKVEEIAASKCRRPAVKQFH  182

Query  651  NSKIKFPLVFKKVRPPSRKLKTTYKASRPNIF  746
            +SKIKFPL  + +R   R+ K  +   RPN F
Sbjct  183  DSKIKFPLPHRVLR---RQHKPRFTTKRPNTF  211



>gb|EPZ32213.1| 60S ribosomal protein L20-B [Rozella allomycis CSF55]
Length=178

 Score =   195 bits (496),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 92/177 (52%), Positives = 123/177 (69%), Gaps = 0/177 (0%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            M   ++H+YQ++GR LP+  +  P++Y+M+++A NEV  KS+FWYFL+KLKKVKK+NG++
Sbjct  1    MTESKYHEYQIIGRKLPTAAEPVPRLYKMRVFAKNEVVGKSRFWYFLQKLKKVKKANGEI  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            +A+NEIFEK P +VKNYGIWLRY SRTG HNMYKE+R+ +   AV   Y +MASRHR R 
Sbjct  61   VAVNEIFEKRPNQVKNYGIWLRYDSRTGTHNMYKEYREMSRVDAVHSCYQDMASRHRARF  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIF  746
              IQIIK   I     +R   KQ     +KFPL  +  R PSR+ K  + A RP+ F
Sbjct  121  RSIQIIKVEEIANSDVRRPYIKQLLEPGLKFPLPHRVYRAPSRRYKKLFVAHRPSTF  177



>dbj|GAM28311.1| hypothetical protein SAMD00019534_114870, partial [Acytostelium 
subglobosum LB1]
 dbj|GAM22826.1| hypothetical protein SAMD00019534_060010, partial [Acytostelium 
subglobosum LB1]
Length=173

 Score =   195 bits (496),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/173 (53%), Positives = 126/173 (73%), Gaps = 5/173 (3%)
 Frame = +3

Query  234  HQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINEI  413
            H++QVVGR +P+E + HPK++RM+L+A   V AKS+FWYFL K++K+KK+ G++L + EI
Sbjct  4    HEFQVVGRHVPTEREAHPKLFRMRLFAKTSVHAKSRFWYFLSKIQKMKKATGEILNVTEI  63

Query  414  FEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQII  593
            FE+ P ++KN+GI++RY SR+G HN+YKE+RD T  GAV QMY EMASRH  R   I II
Sbjct  64   FEEKPQQIKNFGIFIRYNSRSGTHNIYKEYRDVTRVGAVAQMYDEMASRHSAREKTIHII  123

Query  594  KTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSR--KLKTTYKASRPNIF  746
            +   + A   +R +TKQFH+SKI+FPL     R P R  + K T+KA+RP  F
Sbjct  124  EIKEVAAAQTRRTNTKQFHDSKIRFPLTH---RVPKRLPQFKATFKATRPKTF  173



>gb|ELK32292.1| 60S ribosomal protein L18a [Myotis davidii]
Length=193

 Score =   196 bits (497),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/186 (49%), Positives = 128/186 (69%), Gaps = 3/186 (2%)
 Frame = +3

Query  189  QEDGSVVAKMVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLK  368
             E+G ++   +  +  +Y+VVGR LP+     P +YRM+++A N V AKS+FWYF+ +LK
Sbjct  10   DEEGCLMGLSLRLQLREYKVVGRCLPTPKCHTPPLYRMRIFAPNHVVAKSRFWYFVSQLK  69

Query  369  KVKKSNGQVLAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTE  548
            K+KKS+G+++   ++FEK P +VKN+GIWLRY SR+G HNMY+E+RD T  GAV Q Y +
Sbjct  70   KMKKSSGEIVYCGQVFEKSPLRVKNFGIWLRYDSRSGTHNMYREYRDLTTAGAVTQCYRD  129

Query  549  MASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKA  728
            M +RHR R H IQI+K   I A  C+R + KQFH+SKIKFPL  + +R   R+ K  +  
Sbjct  130  MGARHRARAHSIQIMKVEEIAASKCRRPAVKQFHDSKIKFPLPHRVLR---RQHKPRFTT  186

Query  729  SRPNIF  746
             RPN F
Sbjct  187  KRPNTF  192



>ref|XP_006633700.1| PREDICTED: 60S ribosomal protein L18a-like [Lepisosteus oculatus]
Length=176

 Score =   195 bits (495),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 89/170 (52%), Positives = 123/170 (72%), Gaps = 3/170 (2%)
 Frame = +3

Query  237  QYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIF  416
            +Y+V+GR LPS  +  P +YRM+++A N V AKS+FWYF+ +L+K+KK++G+++   ++F
Sbjct  9    EYKVIGRLLPSAKNPTPPLYRMRIFAPNHVVAKSRFWYFVSQLRKMKKASGEIVYCGQVF  68

Query  417  EKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQIIK  596
            EK P KVKN+GIWLRY SR+G HNMY+E+RD T  GAV Q Y +M +RHR R H IQI+K
Sbjct  69   EKSPLKVKNFGIWLRYDSRSGTHNMYREYRDLTTAGAVTQCYRDMGARHRARAHSIQIMK  128

Query  597  TATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIF  746
               IPA  C+R + KQFH+SKIKFPL  + +R   R+ K  +   RPN F
Sbjct  129  VEEIPASKCRRPAIKQFHDSKIKFPLPHRVLR---RQHKPRFTTKRPNTF  175



>ref|XP_002108947.1| expressed hypothetical protein [Trichoplax adhaerens]
 gb|EDV29745.1| expressed hypothetical protein [Trichoplax adhaerens]
Length=175

 Score =   195 bits (495),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 91/177 (51%), Positives = 124/177 (70%), Gaps = 3/177 (2%)
 Frame = +3

Query  216  MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  395
            M    + +Y+V GR  P++ + +P +YRM+++A+NEV AKS+FWYF+RKLKKVKK  G++
Sbjct  1    MAGTPYSEYRVTGRHAPTDKEPNPALYRMRIFASNEVTAKSRFWYFVRKLKKVKKGTGEI  60

Query  396  LAINEIFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  575
            L    I EK PTK+KN+GIWLRY SR+G HNMYKEFRD T+ GAV  +Y EM +RHR R 
Sbjct  61   LECRLITEKTPTKIKNFGIWLRYDSRSGTHNMYKEFRDLTIGGAVTALYREMGARHRARA  120

Query  576  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIF  746
              IQ++K   I A   +R+  KQFH+SKI+FPL  + +R    + K+ + A RPN F
Sbjct  121  RSIQVMKVEPIVASKTRRQPIKQFHDSKIRFPLPHRIIRS---QFKSKFVAKRPNTF  174



>ref|XP_001362363.1| PREDICTED: 60S ribosomal protein L18a [Monodelphis domestica]
Length=176

 Score =   195 bits (495),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 90/170 (53%), Positives = 122/170 (72%), Gaps = 3/170 (2%)
 Frame = +3

Query  237  QYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIF  416
            +Y+VVGR LP+     P +YRM+++A N V AKS+FWYF+ +LKK+KKS+G+++   ++F
Sbjct  9    EYKVVGRCLPTPKSPVPPLYRMRIFAPNHVVAKSRFWYFVSQLKKMKKSSGEIVYCGQVF  68

Query  417  EKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQIIK  596
            EK P +VKN+GIWLRY SR+G HNMY+E+RD T  GAV Q Y +M +RHR R H IQI+K
Sbjct  69   EKSPLRVKNFGIWLRYDSRSGTHNMYREYRDLTTAGAVTQCYRDMGARHRARAHSIQIMK  128

Query  597  TATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIF  746
               IPA  C+R + KQFH+SKIKFPL  + +R   R+ K  +   RPN F
Sbjct  129  VEEIPASKCRRPAVKQFHDSKIKFPLPHRVLR---RQHKPRFTTKRPNTF  175



>gb|ACO51977.1| 60S ribosomal protein L18a [Rana catesbeiana]
Length=176

 Score =   194 bits (494),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 90/170 (53%), Positives = 123/170 (72%), Gaps = 3/170 (2%)
 Frame = +3

Query  237  QYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIF  416
            +Y+V+GR+LP+     P  YRM+++A N V AKS+FWYF+ +LKK+KK++G+++   ++F
Sbjct  9    EYKVIGRSLPTVKAPAPPHYRMRIFAPNHVVAKSRFWYFVSQLKKMKKASGEIVYCGQVF  68

Query  417  EKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQIIK  596
            EK P KVKN+GIWLRY SR+G HNMY+E+RD T  GAV Q Y +M +RHR R H IQI+K
Sbjct  69   EKSPLKVKNFGIWLRYDSRSGTHNMYREYRDLTTAGAVTQCYRDMGARHRARAHAIQIMK  128

Query  597  TATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIF  746
               IPA  C+R + KQFH+SKIKFPL  + +R   R+ K  +   RPNIF
Sbjct  129  VEVIPANKCRRPAIKQFHDSKIKFPLPHRVLR---RQHKPRFTTKRPNIF  175



>gb|KFH68928.1| large subunit ribosomal protein L18Ae [Mortierella verticillata 
NRRL 6337]
Length=244

 Score =   197 bits (500),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 91/172 (53%), Positives = 121/172 (70%), Gaps = 0/172 (0%)
 Frame = +3

Query  231  FHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINE  410
             H+YQ+VGR LP+E D  PK++RM+L+A NEV AKS+FWYF+RKLKKVKK NG+++ INE
Sbjct  72   LHEYQLVGRHLPTEKDATPKLFRMRLFAPNEVIAKSRFWYFMRKLKKVKKVNGEIVGINE  131

Query  411  IFEKCPTKVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQI  590
            I EK P ++KN+GIW+RY SR+G HNMYKE+R+ T N AVE  Y++MASRHR R   IQI
Sbjct  132  IHEKKPLQIKNFGIWIRYDSRSGTHNMYKEYRELTRNAAVEACYSDMASRHRARSRSIQI  191

Query  591  IKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNIF  746
            I+ A +     +R   KQ     IKFPL  + +R   +  +  +  SRP+ F
Sbjct  192  IRVAEVANADVRRPYIKQILVPGIKFPLPHRVIRAADKSHRALFMGSRPSTF  243



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2502572571944