BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig11398

Length=799
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009792971.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     257   9e-80   Nicotiana sylvestris
ref|XP_009629822.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     254   1e-78   Nicotiana tomentosiformis
ref|XP_006367776.1|  PREDICTED: GDSL esterase/lipase At1g28590-like     254   2e-78   Solanum tuberosum [potatoes]
ref|XP_004234096.1|  PREDICTED: GDSL esterase/lipase At1g28590-like     242   5e-74   Solanum lycopersicum
ref|XP_002267261.1|  PREDICTED: GDSL esterase/lipase At1g28580          239   5e-73   Vitis vinifera
emb|CDP21061.1|  unnamed protein product                                236   1e-71   Coffea canephora [robusta coffee]
emb|CBI30663.3|  unnamed protein product                                241   3e-69   Vitis vinifera
emb|CDO96754.1|  unnamed protein product                                229   7e-69   Coffea canephora [robusta coffee]
ref|XP_010277742.1|  PREDICTED: GDSL esterase/lipase At1g28610-like     228   2e-68   Nelumbo nucifera [Indian lotus]
ref|XP_008358656.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     220   1e-67   
ref|XP_007020867.1|  GDSL-like Lipase/Acylhydrolase superfamily p...    217   2e-66   
gb|KFK44741.1|  hypothetical protein AALP_AA1G296900                    220   2e-65   Arabis alpina [alpine rockcress]
ref|XP_006361073.1|  PREDICTED: GDSL esterase/lipase At2g27360-like     218   3e-65   
ref|NP_973932.1|  GDSL esterase/lipase                                  219   4e-65   Arabidopsis thaliana [mouse-ear cress]
emb|CDP21060.1|  unnamed protein product                                210   2e-63   Coffea canephora [robusta coffee]
emb|CDO96753.1|  unnamed protein product                                214   6e-63   Coffea canephora [robusta coffee]
ref|XP_008225208.1|  PREDICTED: GDSL esterase/lipase At1g28590-like     211   8e-62   Prunus mume [ume]
ref|XP_008777731.1|  PREDICTED: GDSL esterase/lipase At1g31550-like     211   8e-62   Phoenix dactylifera
ref|XP_007020866.1|  GDSL-like Lipase/Acylhydrolase superfamily p...    218   1e-61   
ref|XP_010540491.1|  PREDICTED: GDSL esterase/lipase At1g28570-li...    207   2e-61   Tarenaya hassleriana [spider flower]
gb|KHN08455.1|  GDSL esterase/lipase                                    203   2e-61   Glycine soja [wild soybean]
ref|XP_009401628.1|  PREDICTED: GDSL esterase/lipase At1g28570-like     209   3e-61   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010911731.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     204   3e-61   Elaeis guineensis
ref|XP_009113643.1|  PREDICTED: GDSL esterase/lipase At2g27360-li...    209   4e-61   
gb|AAL86351.1|  putative lipase                                         204   5e-61   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007212730.1|  hypothetical protein PRUPE_ppa019092mg             208   5e-61   
ref|XP_009113642.1|  PREDICTED: GDSL esterase/lipase At2g27360-li...    209   5e-61   Brassica rapa
ref|XP_003542989.1|  PREDICTED: GDSL esterase/lipase At1g28600          209   7e-61   Glycine max [soybeans]
emb|CDY15655.1|  BnaA07g08260D                                          208   8e-61   Brassica napus [oilseed rape]
ref|XP_010540489.1|  PREDICTED: GDSL esterase/lipase At1g28580-li...    207   9e-61   Tarenaya hassleriana [spider flower]
ref|XP_010540488.1|  PREDICTED: GDSL esterase/lipase At1g28610-li...    208   1e-60   Tarenaya hassleriana [spider flower]
ref|XP_010057068.1|  PREDICTED: GDSL esterase/lipase At1g28570-like     208   1e-60   Eucalyptus grandis [rose gum]
ref|XP_003593737.1|  GDSL esterase/lipase                               207   1e-60   Medicago truncatula
ref|XP_004291631.1|  PREDICTED: GDSL esterase/lipase At1g28580-like     207   1e-60   Fragaria vesca subsp. vesca
emb|CDX94634.1|  BnaC07g10240D                                          207   2e-60   
ref|XP_006362447.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     207   2e-60   Solanum tuberosum [potatoes]
ref|XP_009102892.1|  PREDICTED: GDSL esterase/lipase At1g28570-like     207   2e-60   Brassica rapa
ref|NP_174182.1|  GDSL esterase/lipase                                  207   2e-60   Arabidopsis thaliana [mouse-ear cress]
gb|AAM65183.1|  lipase, putative                                        207   2e-60   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008225217.1|  PREDICTED: uncharacterized protein LOC103324878    215   3e-60   
ref|XP_007212863.1|  hypothetical protein PRUPE_ppa021567mg             206   4e-60   
ref|XP_009347996.1|  PREDICTED: GDSL esterase/lipase At1g28580-like     206   5e-60   Pyrus x bretschneideri [bai li]
ref|XP_010478238.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     207   6e-60   Camelina sativa [gold-of-pleasure]
ref|NP_180304.1|  GDSL esterase/lipase                                  206   6e-60   Arabidopsis thaliana [mouse-ear cress]
dbj|BAD44668.1|  putative lipase                                        206   7e-60   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002879083.1|  predicted protein                                  206   1e-59   
ref|NP_001241470.1|  uncharacterized protein LOC100816865               205   1e-59   Glycine max [soybeans]
ref|XP_009774388.1|  PREDICTED: GDSL esterase/lipase At1g28580-like     205   1e-59   Nicotiana sylvestris
gb|KCW45467.1|  hypothetical protein EUGRSUZ_L00816                     206   1e-59   Eucalyptus grandis [rose gum]
ref|XP_010912648.1|  PREDICTED: sinapine esterase-like isoform X3       204   2e-59   
gb|AFK42362.1|  unknown                                                 204   2e-59   Medicago truncatula
ref|XP_002893538.1|  predicted protein                                  212   2e-59   
ref|NP_174181.1|  GDSL esterase/lipase                                  205   2e-59   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010912640.1|  PREDICTED: GDSL esterase/lipase At1g28650-li...    204   2e-59   Elaeis guineensis
ref|XP_010912632.1|  PREDICTED: GDSL esterase/lipase At1g28650-li...    205   3e-59   Elaeis guineensis
ref|XP_008785390.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     203   3e-59   Phoenix dactylifera
ref|XP_008371712.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     205   3e-59   
ref|XP_009765841.1|  PREDICTED: GDSL esterase/lipase At1g28610-like     204   3e-59   Nicotiana sylvestris
ref|XP_008777733.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     204   4e-59   Phoenix dactylifera
ref|XP_007020868.1|  GDSL-like Lipase/Acylhydrolase superfamily p...    197   4e-59   
ref|XP_004233850.1|  PREDICTED: GDSL esterase/lipase At1g28580-li...    204   4e-59   Solanum lycopersicum
ref|XP_009352954.1|  PREDICTED: uncharacterized protein LOC103944252    212   5e-59   
ref|XP_010422035.1|  PREDICTED: GDSL esterase/lipase At1g31550-li...    203   5e-59   Camelina sativa [gold-of-pleasure]
ref|XP_010422034.1|  PREDICTED: GDSL esterase/lipase At1g31550-li...    203   8e-59   Camelina sativa [gold-of-pleasure]
gb|AAG60153.1|AC074360_18  lipase, putative                             203   1e-58   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008777734.1|  PREDICTED: GDSL esterase/lipase At1g28570-like     202   1e-58   Phoenix dactylifera
gb|EEE55084.1|  hypothetical protein OsJ_02825                          199   1e-58   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001031122.1|  GDSL esterase/lipase                               202   1e-58   Arabidopsis thaliana [mouse-ear cress]
dbj|BAD95190.1|  hypothetical protein                                   202   1e-58   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003542992.1|  PREDICTED: GDSL esterase/lipase At1g28580-like     202   2e-58   
gb|KHN08454.1|  GDSL esterase/lipase                                    209   2e-58   Glycine soja [wild soybean]
ref|XP_009607101.1|  PREDICTED: GDSL esterase/lipase At1g28580-like     202   2e-58   Nicotiana tomentosiformis
ref|XP_009352806.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     202   2e-58   
ref|XP_008812188.1|  PREDICTED: GDSL esterase/lipase At1g28570-like     202   2e-58   
ref|XP_004248464.1|  PREDICTED: GDSL esterase/lipase At1g28610-li...    202   2e-58   Solanum lycopersicum
ref|XP_010460655.1|  PREDICTED: GDSL esterase/lipase At1g28610-like     202   2e-58   Camelina sativa [gold-of-pleasure]
ref|XP_010462954.1|  PREDICTED: uncharacterized protein LOC104743592    208   4e-58   
ref|XP_010499707.1|  PREDICTED: GDSL esterase/lipase At1g31550-li...    201   4e-58   Camelina sativa [gold-of-pleasure]
gb|EYU28060.1|  hypothetical protein MIMGU_mgv1a008085mg                201   6e-58   Erythranthe guttata [common monkey flower]
ref|NP_001172483.1|  Os01g0649400                                       198   6e-58   
ref|XP_010912659.1|  PREDICTED: GDSL esterase/lipase At1g28650-like     201   6e-58   Elaeis guineensis
ref|XP_010912598.1|  PREDICTED: GDSL esterase/lipase At1g28650-li...    201   9e-58   
emb|CDY30819.1|  BnaC05g21950D                                          201   9e-58   Brassica napus [oilseed rape]
ref|XP_009113646.1|  PREDICTED: GDSL esterase/lipase At1g28580-like     201   1e-57   Brassica rapa
gb|AAF24548.2|AC007508_11  F1K23.17                                     207   1e-57   Arabidopsis thaliana [mouse-ear cress]
emb|CDM83549.1|  unnamed protein product                                200   1e-57   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010478618.1|  PREDICTED: GDSL esterase/lipase At1g31550-like     200   1e-57   Camelina sativa [gold-of-pleasure]
ref|XP_010460979.1|  PREDICTED: GDSL esterase/lipase At1g31550-like     200   1e-57   Camelina sativa [gold-of-pleasure]
ref|XP_009393075.1|  PREDICTED: GDSL esterase/lipase At1g28580-like     200   1e-57   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010499708.1|  PREDICTED: GDSL esterase/lipase At1g31550-li...    199   2e-57   
ref|XP_010501635.1|  PREDICTED: uncharacterized protein LOC104778925    206   2e-57   
ref|XP_009416172.1|  PREDICTED: GDSL esterase/lipase At1g28570-like     199   2e-57   
ref|XP_010478903.1|  PREDICTED: GDSL esterase/lipase At1g31550          199   2e-57   Camelina sativa [gold-of-pleasure]
ref|XP_010460977.1|  PREDICTED: GDSL esterase/lipase At1g31550-like     192   3e-57   Camelina sativa [gold-of-pleasure]
ref|XP_007025435.1|  GDSL-like Lipase/Acylhydrolase superfamily p...    198   3e-57   
gb|KCW45468.1|  hypothetical protein EUGRSUZ_L00817                     199   3e-57   Eucalyptus grandis [rose gum]
gb|EAY75182.1|  hypothetical protein OsI_03072                          197   3e-57   Oryza sativa Indica Group [Indian rice]
ref|XP_010057069.1|  PREDICTED: GDSL esterase/lipase At1g28580-like     199   4e-57   Eucalyptus grandis [rose gum]
ref|XP_010499588.1|  PREDICTED: GDSL esterase/lipase At1g28580-like     199   4e-57   Camelina sativa [gold-of-pleasure]
ref|XP_002891138.1|  carboxylic ester hydrolase/ lipase                 199   5e-57   Arabidopsis lyrata subsp. lyrata
ref|XP_002893537.1|  hypothetical protein ARALYDRAFT_473078             198   5e-57   
ref|XP_009601721.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     198   5e-57   Nicotiana tomentosiformis
ref|XP_010040115.1|  PREDICTED: uncharacterized protein LOC104428890    205   6e-57   
ref|XP_009407319.1|  PREDICTED: GDSL esterase/lipase At1g28650-like     198   6e-57   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010912585.1|  PREDICTED: GDSL esterase/lipase At1g31550-like     198   6e-57   Elaeis guineensis
emb|CDO96750.1|  unnamed protein product                                198   8e-57   Coffea canephora [robusta coffee]
gb|KDO77812.1|  hypothetical protein CISIN_1g018031mg                   195   9e-57   Citrus sinensis [apfelsine]
ref|XP_009109699.1|  PREDICTED: GDSL esterase/lipase At1g28670-like     197   1e-56   Brassica rapa
ref|XP_006415636.1|  hypothetical protein EUTSA_v10006895mg             204   1e-56   
emb|CDY64716.1|  BnaCnng44670D                                          197   2e-56   Brassica napus [oilseed rape]
ref|XP_006467672.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     196   2e-56   Citrus sinensis [apfelsine]
ref|XP_003593740.1|  GDSL esterase/lipase                               197   2e-56   Medicago truncatula
ref|NP_973931.1|  GDSL esterase/lipase                                  194   2e-56   Arabidopsis thaliana [mouse-ear cress]
gb|KFK44742.1|  hypothetical protein AALP_AA1G297000                    206   2e-56   Arabis alpina [alpine rockcress]
ref|XP_010460658.1|  PREDICTED: GDSL esterase/lipase At1g28580-li...    196   3e-56   Camelina sativa [gold-of-pleasure]
gb|EMT27195.1|  GDSL esterase/lipase                                    197   3e-56   
ref|XP_010460657.1|  PREDICTED: GDSL esterase/lipase At1g28580-li...    196   4e-56   Camelina sativa [gold-of-pleasure]
ref|XP_010501634.1|  PREDICTED: uncharacterized protein LOC104778924    203   4e-56   
gb|KDO77809.1|  hypothetical protein CISIN_1g018031mg                   195   5e-56   Citrus sinensis [apfelsine]
ref|NP_973930.1|  GDSL esterase/lipase                                  194   6e-56   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006449476.1|  hypothetical protein CICLE_v10015707mg             195   7e-56   Citrus clementina [clementine]
ref|XP_009352808.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     195   8e-56   Pyrus x bretschneideri [bai li]
sp|Q3ZFI4.1|SCE3_BRANA  RecName: Full=Sinapine esterase; Short=Bn...    195   8e-56   Brassica napus [oilseed rape]
emb|CDY63998.1|  BnaA07g36520D                                          195   9e-56   Brassica napus [oilseed rape]
emb|CDO99485.1|  unnamed protein product                                195   9e-56   Coffea canephora [robusta coffee]
ref|XP_004485879.1|  PREDICTED: GDSL esterase/lipase At2g27360-like     195   1e-55   Cicer arietinum [garbanzo]
ref|NP_174180.1|  GDSL esterase/lipase                                  195   1e-55   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009102890.1|  PREDICTED: GDSL esterase/lipase At1g28670-like     194   1e-55   Brassica rapa
emb|CDY43309.1|  BnaC03g58810D                                          194   2e-55   Brassica napus [oilseed rape]
ref|XP_010912577.1|  PREDICTED: GDSL esterase/lipase At1g28580-like     194   2e-55   
emb|CDX90163.1|  BnaA08g18210D                                          194   2e-55   
ref|XP_010435654.1|  PREDICTED: GDSL esterase/lipase At1g31550-like     194   2e-55   Camelina sativa [gold-of-pleasure]
emb|CDM83548.1|  unnamed protein product                                195   2e-55   Triticum aestivum [Canadian hard winter wheat]
gb|AAX62802.1|  lipase 2                                                194   2e-55   Brassica napus [oilseed rape]
ref|XP_008777735.1|  PREDICTED: GDSL esterase/lipase At1g28580-like     194   2e-55   
gb|EMT22154.1|  GDSL esterase/lipase                                    194   2e-55   
ref|XP_004485878.1|  PREDICTED: GDSL esterase/lipase At1g28590-like     194   3e-55   Cicer arietinum [garbanzo]
ref|XP_009784633.1|  PREDICTED: GDSL esterase/lipase At5g45910          193   3e-55   Nicotiana sylvestris
ref|NP_174179.3|  GDSL esterase/lipase                                  194   3e-55   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010478237.1|  PREDICTED: GDSL esterase/lipase At1g28580-like     194   4e-55   
ref|XP_006415637.1|  hypothetical protein EUTSA_v10009438mg             193   4e-55   
gb|KJB62810.1|  hypothetical protein B456_009G437600                    193   5e-55   Gossypium raimondii
ref|XP_003546023.2|  PREDICTED: GDSL esterase/lipase At1g31550-like     193   5e-55   Glycine max [soybeans]
gb|EMT22799.1|  GDSL esterase/lipase                                    194   6e-55   
ref|XP_010912671.1|  PREDICTED: GDSL esterase/lipase At1g31550-like     194   6e-55   
ref|XP_010925696.1|  PREDICTED: GDSL esterase/lipase At5g45910-li...    192   8e-55   Elaeis guineensis
ref|XP_007148064.1|  hypothetical protein PHAVU_006G177500g             192   8e-55   Phaseolus vulgaris [French bean]
ref|XP_003542991.1|  PREDICTED: GDSL esterase/lipase At1g28600-li...    192   8e-55   
gb|KHG23842.1|  hypothetical protein F383_29871                         192   8e-55   Gossypium arboreum [tree cotton]
ref|XP_010499396.1|  PREDICTED: GDSL esterase/lipase At1g28580-like     193   8e-55   Camelina sativa [gold-of-pleasure]
ref|XP_010462953.1|  PREDICTED: GDSL esterase/lipase At1g28580-like     192   9e-55   
ref|XP_004248142.1|  PREDICTED: GDSL esterase/lipase At1g28610          192   1e-54   Solanum lycopersicum
ref|XP_010455496.1|  PREDICTED: GDSL esterase/lipase At1g31550-li...    192   1e-54   Camelina sativa [gold-of-pleasure]
ref|XP_010912608.1|  PREDICTED: GDSL esterase/lipase At1g28570-li...    193   1e-54   
dbj|BAK06933.1|  predicted protein                                      192   1e-54   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010478243.1|  PREDICTED: GDSL esterase/lipase At1g28650          192   1e-54   
ref|XP_008812183.1|  PREDICTED: GDSL esterase/lipase At1g31550-like     192   1e-54   Phoenix dactylifera
ref|NP_001043721.1|  Os01g0649900                                       192   1e-54   
gb|KJB62807.1|  hypothetical protein B456_009G437300                    192   1e-54   Gossypium raimondii
ref|XP_009608032.1|  PREDICTED: GDSL esterase/lipase At5g45910 is...    191   1e-54   
emb|CDM80951.1|  unnamed protein product                                187   2e-54   Triticum aestivum [Canadian hard winter wheat]
ref|XP_002456052.1|  hypothetical protein SORBIDRAFT_03g029580          192   2e-54   
dbj|BAJ98364.1|  predicted protein                                      192   2e-54   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010480702.1|  PREDICTED: uncharacterized protein LOC104759479    198   2e-54   
dbj|BAJ93079.1|  predicted protein                                      192   2e-54   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010461021.1|  PREDICTED: GDSL esterase/lipase At1g31550-like     191   3e-54   Camelina sativa [gold-of-pleasure]
ref|XP_003569458.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     191   3e-54   Brachypodium distachyon [annual false brome]
gb|KJB63193.1|  hypothetical protein B456_009G437100                    191   4e-54   Gossypium raimondii
ref|XP_011096449.1|  PREDICTED: uncharacterized protein LOC105175645    199   4e-54   
tpg|DAA58330.1|  TPA: hypothetical protein ZEAMMB73_195608              186   4e-54   
ref|XP_006367777.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     190   5e-54   
emb|CDY30822.1|  BnaC05g21980D                                          191   7e-54   Brassica napus [oilseed rape]
emb|CDO96752.1|  unnamed protein product                                190   7e-54   Coffea canephora [robusta coffee]
ref|XP_009608031.1|  PREDICTED: GDSL esterase/lipase At5g45910 is...    189   7e-54   Nicotiana tomentosiformis
ref|NP_001149094.1|  LOC100282715 precursor                             190   8e-54   Zea mays [maize]
gb|KHG11244.1|  hypothetical protein F383_11796                         189   8e-54   Gossypium arboreum [tree cotton]
ref|XP_010478236.1|  PREDICTED: GDSL esterase/lipase At1g28610-like     190   9e-54   Camelina sativa [gold-of-pleasure]
ref|XP_011626558.1|  PREDICTED: GDSL esterase/lipase At1g28590-like     189   1e-53   Amborella trichopoda
emb|CDO96755.1|  unnamed protein product                                189   2e-53   Coffea canephora [robusta coffee]
ref|XP_011096420.1|  PREDICTED: LOW QUALITY PROTEIN: GDSL esteras...    189   2e-53   Sesamum indicum [beniseed]
ref|XP_006644439.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     189   2e-53   Oryza brachyantha
ref|NP_174440.2|  GDSL esterase/lipase                                  189   2e-53   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002317430.2|  hypothetical protein POPTR_0011s07610g             183   3e-53   
ref|XP_010478242.1|  PREDICTED: GDSL esterase/lipase At1g28670-like     189   3e-53   Camelina sativa [gold-of-pleasure]
ref|XP_008225209.1|  PREDICTED: GDSL esterase/lipase At5g45910          187   5e-53   Prunus mume [ume]
ref|XP_004234095.1|  PREDICTED: GDSL esterase/lipase At5g45910          187   6e-53   Solanum lycopersicum
ref|XP_007020872.1|  SGNH hydrolase-type esterase superfamily pro...    186   8e-53   
ref|XP_009411654.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     187   8e-53   Musa acuminata subsp. malaccensis [pisang utan]
gb|KGN49290.1|  hypothetical protein Csa_6G519430                       186   8e-53   Cucumis sativus [cucumbers]
ref|XP_011027710.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     187   1e-52   Populus euphratica
ref|XP_010499397.1|  PREDICTED: GDSL esterase/lipase At1g28670          187   1e-52   Camelina sativa [gold-of-pleasure]
ref|XP_010460659.1|  PREDICTED: GDSL esterase/lipase At1g28670-like     187   1e-52   Camelina sativa [gold-of-pleasure]
ref|XP_012091740.1|  PREDICTED: GDSL esterase/lipase At5g45910          186   1e-52   Jatropha curcas
ref|XP_008812189.1|  PREDICTED: GDSL esterase/lipase At1g28570-like     187   2e-52   Phoenix dactylifera
ref|XP_003593736.1|  GDSL esterase/lipase                               187   2e-52   Medicago truncatula
ref|XP_006415633.1|  hypothetical protein EUTSA_v10007853mg             186   2e-52   Eutrema salsugineum [saltwater cress]
dbj|BAF02148.1|  putative lipase                                        185   2e-52   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009414900.1|  PREDICTED: GDSL esterase/lipase At1g28570-like     186   2e-52   
ref|XP_010232088.1|  PREDICTED: GDSL esterase/lipase At1g28600-li...    186   3e-52   
ref|NP_174186.1|  GDSL esterase/lipase                                  186   3e-52   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003569457.2|  PREDICTED: GDSL esterase/lipase At1g28600-li...    187   3e-52   
ref|NP_001130974.1|  uncharacterized protein LOC100192079               186   3e-52   Zea mays [maize]
ref|XP_004969326.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     186   4e-52   Setaria italica
ref|NP_001149136.1|  alpha-L-fucosidase 2 precursor                     186   5e-52   
ref|XP_009411653.1|  PREDICTED: GDSL esterase/lipase At1g28570-like     185   5e-52   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDO96749.1|  unnamed protein product                                185   8e-52   Coffea canephora [robusta coffee]
gb|ACL53525.1|  unknown                                                 186   8e-52   Zea mays [maize]
ref|XP_008654982.1|  PREDICTED: alpha-L-fucosidase 2 isoform X1         186   8e-52   
gb|ERN06190.1|  hypothetical protein AMTR_s00016p00147040               180   9e-52   Amborella trichopoda
ref|XP_006828268.1|  PREDICTED: GDSL esterase/lipase At5g45910          184   9e-52   Amborella trichopoda
gb|KCW76151.1|  hypothetical protein EUGRSUZ_D00528                     181   9e-52   Eucalyptus grandis [rose gum]
ref|XP_010041182.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     184   9e-52   Eucalyptus grandis [rose gum]
gb|EEE55085.1|  hypothetical protein OsJ_02827                          185   1e-51   Oryza sativa Japonica Group [Japonica rice]
gb|ACN28025.1|  unknown                                                 185   1e-51   Zea mays [maize]
ref|XP_011027711.1|  PREDICTED: GDSL esterase/lipase At1g28580-like     184   1e-51   Populus euphratica
gb|KHN08453.1|  GDSL esterase/lipase                                    182   1e-51   Glycine soja [wild soybean]
ref|XP_003546024.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     184   1e-51   Glycine max [soybeans]
ref|NP_001140937.1|  hypothetical protein                               185   1e-51   Zea mays [maize]
ref|XP_004134933.1|  PREDICTED: GDSL esterase/lipase At1g28570          184   2e-51   Cucumis sativus [cucumbers]
gb|EEC71081.1|  hypothetical protein OsI_02841                          184   2e-51   Oryza sativa Indica Group [Indian rice]
ref|XP_009415143.1|  PREDICTED: GDSL esterase/lipase At1g28590-li...    184   2e-51   Musa acuminata subsp. malaccensis [pisang utan]
gb|EAZ12674.1|  hypothetical protein OsJ_02589                          184   3e-51   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010540487.1|  PREDICTED: GDSL esterase/lipase At1g28570-like     184   3e-51   Tarenaya hassleriana [spider flower]
ref|XP_002305753.2|  hypothetical protein POPTR_0004s05350g             184   3e-51   
ref|XP_010052212.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     183   3e-51   Eucalyptus grandis [rose gum]
ref|XP_010068248.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     182   5e-51   
ref|XP_002455947.1|  hypothetical protein SORBIDRAFT_03g027770          184   5e-51   Sorghum bicolor [broomcorn]
gb|EAY75193.1|  hypothetical protein OsI_03085                          182   6e-51   Oryza sativa Indica Group [Indian rice]
ref|XP_006644441.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     179   6e-51   
ref|XP_002438721.1|  hypothetical protein SORBIDRAFT_10g025020          179   7e-51   
ref|XP_004971993.1|  PREDICTED: GDSL esterase/lipase At1g28590-like     181   7e-51   Setaria italica
ref|NP_001242505.1|  uncharacterized protein LOC100815771 precursor     182   7e-51   Glycine max [soybeans]
gb|KJB62806.1|  hypothetical protein B456_009G437200                    182   8e-51   Gossypium raimondii
ref|XP_006646093.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     182   9e-51   
ref|XP_010052216.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     182   9e-51   Eucalyptus grandis [rose gum]
ref|XP_009411652.1|  PREDICTED: GDSL esterase/lipase At1g28570-like     182   9e-51   
ref|NP_174188.1|  lipase ARAB-1                                         181   1e-50   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003569463.1|  PREDICTED: GDSL esterase/lipase At1g28600-li...    181   1e-50   Brachypodium distachyon [annual false brome]
ref|XP_010232089.1|  PREDICTED: GDSL esterase/lipase At1g28600-li...    181   2e-50   Brachypodium distachyon [annual false brome]
gb|KCW63215.1|  hypothetical protein EUGRSUZ_G00835                     180   2e-50   Eucalyptus grandis [rose gum]
ref|XP_006646155.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     181   2e-50   Oryza brachyantha
ref|XP_010052214.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     181   2e-50   Eucalyptus grandis [rose gum]
ref|XP_002461110.1|  hypothetical protein SORBIDRAFT_02g040940          181   2e-50   
ref|XP_004485880.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     181   2e-50   Cicer arietinum [garbanzo]
ref|XP_009415142.1|  PREDICTED: uncharacterized protein LOC103996...    182   2e-50   
ref|XP_010277743.1|  PREDICTED: GDSL esterase/lipase At1g28570-like     181   2e-50   Nelumbo nucifera [Indian lotus]
ref|XP_010052211.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     180   2e-50   Eucalyptus grandis [rose gum]
ref|XP_006415634.1|  hypothetical protein EUTSA_v10009717mg             181   3e-50   
ref|NP_001042396.1|  Os01g0215700                                       180   4e-50   
ref|NP_564314.1|  GDSL esterase/lipase                                  180   4e-50   Arabidopsis thaliana [mouse-ear cress]
dbj|BAA94228.1|  putative esterase                                      180   4e-50   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002893540.1|  predicted protein                                  188   5e-50   
ref|XP_010915609.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     179   5e-50   
gb|EEE54111.1|  hypothetical protein OsJ_00875                          180   5e-50   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011623529.1|  PREDICTED: GDSL esterase/lipase At5g45910          180   6e-50   Amborella trichopoda
emb|CDX90162.1|  BnaA08g18220D                                          180   6e-50   
ref|NP_849723.1|  GDSL esterase/lipase                                  179   7e-50   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008783908.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     180   9e-50   Phoenix dactylifera
gb|KJB57433.1|  hypothetical protein B456_009G164000                    179   9e-50   Gossypium raimondii
gb|KCW44565.1|  hypothetical protein EUGRSUZ_L01922                     178   9e-50   Eucalyptus grandis [rose gum]
emb|CDY43308.1|  BnaC03g58800D                                          179   1e-49   Brassica napus [oilseed rape]
ref|XP_002305752.2|  GDSL-motif lipase/hydrolase family protein         179   1e-49   
gb|KCW63207.1|  hypothetical protein EUGRSUZ_G00824                     178   1e-49   Eucalyptus grandis [rose gum]
ref|XP_010068245.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     179   1e-49   
ref|XP_006644440.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     179   1e-49   Oryza brachyantha
ref|XP_011623527.1|  PREDICTED: GDSL esterase/lipase At1g28590          180   1e-49   Amborella trichopoda
ref|XP_002267222.2|  PREDICTED: GDSL esterase/lipase At5g45910          178   1e-49   Vitis vinifera
ref|XP_009109702.1|  PREDICTED: GDSL esterase/lipase At1g28670-li...    179   2e-49   
gb|EMT19408.1|  GDSL esterase/lipase                                    177   2e-49   
ref|XP_009109700.1|  PREDICTED: GDSL esterase/lipase At1g28670-li...    179   2e-49   Brassica rapa
dbj|BAD61220.1|  lanatoside 15'-O-acetylesterase-like                   178   2e-49   Oryza sativa Japonica Group [Japonica rice]
gb|ERN06188.1|  hypothetical protein AMTR_s00016p00145970               178   2e-49   Amborella trichopoda
ref|XP_003569350.1|  PREDICTED: GDSL esterase/lipase At2g27360-like     179   2e-49   Brachypodium distachyon [annual false brome]
ref|XP_003565548.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     178   3e-49   Brachypodium distachyon [annual false brome]
gb|KEH34273.1|  GDSL-like lipase/acylhydrolase                          178   3e-49   Medicago truncatula
gb|KEH34272.1|  GDSL-like lipase/acylhydrolase                          178   3e-49   Medicago truncatula
ref|XP_009109701.1|  PREDICTED: GDSL esterase/lipase At1g28670-li...    178   3e-49   
gb|ERM95689.1|  hypothetical protein AMTR_s00023p00217880               177   4e-49   Amborella trichopoda
ref|XP_006828273.2|  PREDICTED: GDSL esterase/lipase At5g45910          177   4e-49   
gb|KCW76148.1|  hypothetical protein EUGRSUZ_D00525                     177   4e-49   
ref|XP_011086014.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     177   5e-49   
ref|XP_002457137.1|  hypothetical protein SORBIDRAFT_03g001850          177   5e-49   
ref|NP_001057786.1|  Os06g0531900                                       177   6e-49   
ref|XP_007025434.1|  GDSL-like Lipase/Acylhydrolase superfamily p...    177   6e-49   
ref|XP_008439763.1|  PREDICTED: GDSL esterase/lipase At1g28570-like     177   6e-49   
gb|EAZ37226.1|  hypothetical protein OsJ_21564                          177   6e-49   
ref|XP_007148066.1|  hypothetical protein PHAVU_006G177700g             176   7e-49   
ref|XP_003593742.1|  GDSL esterase/lipase                               177   8e-49   
sp|P0C8Z7.1|GDL91_ARATH  RecName: Full=GDSL esterase/lipase At1g2...    177   8e-49   
ref|NP_174185.2|  GDSL esterase/lipase                                  177   8e-49   
ref|XP_007148063.1|  hypothetical protein PHAVU_006G177400g             176   8e-49   
gb|EEE55083.1|  hypothetical protein OsJ_02823                          178   1e-48   
gb|AFW80395.1|  esterase                                                176   1e-48   
ref|NP_001149156.1|  esterase precursor                                 176   1e-48   
gb|KCW76155.1|  hypothetical protein EUGRSUZ_D00534                     176   1e-48   
ref|XP_006656143.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     177   1e-48   
gb|KGN49292.1|  hypothetical protein Csa_6G519450                       176   1e-48   
dbj|BAJ86481.1|  predicted protein                                      176   2e-48   
gb|EAY75181.1|  hypothetical protein OsI_03071                          176   2e-48   
ref|XP_002438501.1|  hypothetical protein SORBIDRAFT_10g020950          176   2e-48   
dbj|BAJ86410.1|  predicted protein                                      176   2e-48   
ref|XP_004968625.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     175   3e-48   
gb|EAZ01210.1|  hypothetical protein OsI_23235                          175   3e-48   
ref|XP_010054333.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     176   3e-48   
ref|XP_010915611.1|  PREDICTED: GDSL esterase/lipase At1g28600-li...    174   3e-48   
ref|XP_008439761.1|  PREDICTED: GDSL esterase/lipase At1g28570-like     175   3e-48   
ref|XP_008675274.1|  PREDICTED: GDSL esterase/lipase At1g28600-li...    176   3e-48   
gb|EEE59101.1|  hypothetical protein OsJ_10956                          175   3e-48   
ref|NP_001050175.1|  Os03g0365800                                       175   3e-48   
ref|XP_004965533.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     175   4e-48   
ref|XP_004134931.1|  PREDICTED: GDSL esterase/lipase At1g28570-like     175   4e-48   
ref|XP_002456053.1|  hypothetical protein SORBIDRAFT_03g029590          175   4e-48   
dbj|BAJ97312.1|  predicted protein                                      175   5e-48   
gb|KCW44566.1|  hypothetical protein EUGRSUZ_L01923                     174   5e-48   
tpg|DAA58335.1|  TPA: hypothetical protein ZEAMMB73_102185              176   5e-48   
ref|XP_010041184.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     174   5e-48   
ref|XP_008675273.1|  PREDICTED: GDSL esterase/lipase At1g28600-li...    176   6e-48   
ref|XP_011626557.1|  PREDICTED: GDSL esterase/lipase At5g45910          175   7e-48   
ref|XP_010915610.1|  PREDICTED: GDSL esterase/lipase At5g45910-li...    175   8e-48   
ref|XP_010455497.1|  PREDICTED: GDSL esterase/lipase At1g31550-li...    174   9e-48   
ref|XP_004969330.1|  PREDICTED: GDSL esterase/lipase At1g28600-li...    174   1e-47   
ref|XP_006651411.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     173   1e-47   
tpg|DAA58326.1|  TPA: hypothetical protein ZEAMMB73_004372              170   1e-47   
ref|XP_008383648.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     173   1e-47   
gb|AAF24544.2|AC007508_7  F1K23.13                                      181   2e-47   
ref|XP_010231604.1|  PREDICTED: GDSL esterase/lipase At1g28580-like     173   2e-47   
ref|NP_001150078.1|  esterase                                           173   2e-47   
dbj|BAJ92568.1|  predicted protein                                      172   3e-47   
ref|XP_008673015.1|  PREDICTED: alpha-L-fucosidase 2 isoform X2         171   3e-47   
ref|XP_010915608.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     172   5e-47   
ref|XP_002439451.1|  hypothetical protein SORBIDRAFT_09g006600          172   5e-47   
ref|XP_006643908.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     172   6e-47   
ref|XP_004296391.1|  PREDICTED: GDSL esterase/lipase At5g45910          171   7e-47   
ref|XP_004969325.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     172   7e-47   
gb|EMT32479.1|  GDSL esterase/lipase                                    169   9e-47   
emb|CDM83418.1|  unnamed protein product                                172   1e-46   
gb|ACF85857.1|  unknown                                                 171   1e-46   
ref|NP_001151904.1|  alpha-L-fucosidase 2 precursor                     171   1e-46   
gb|ERN14605.1|  hypothetical protein AMTR_s00038p00165200               175   2e-46   
gb|EAY90131.1|  hypothetical protein OsI_11697                          171   2e-46   
gb|KFK31510.1|  hypothetical protein AALP_AA6G122100                    170   2e-46   
ref|XP_004960620.1|  PREDICTED: GDSL esterase/lipase At1g28580-like     169   3e-46   
ref|NP_001054913.1|  Os05g0210100                                       169   4e-46   
ref|XP_008785157.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     169   4e-46   
ref|NP_001050176.1|  Os03g0365900                                       164   5e-46   
ref|XP_004969329.1|  PREDICTED: GDSL esterase/lipase At1g28600-li...    169   5e-46   
dbj|BAK05475.1|  predicted protein                                      169   7e-46   
ref|XP_003593744.1|  GDSL esterase/lipase                               168   7e-46   
gb|KJB66737.1|  hypothetical protein B456_010G156100                    168   7e-46   
gb|KJB66736.1|  hypothetical protein B456_010G156100                    168   7e-46   
ref|XP_006651409.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     169   7e-46   
ref|XP_009382515.1|  PREDICTED: GDSL esterase/lipase At1g28580-like     169   7e-46   
ref|XP_006603997.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     168   8e-46   
gb|KHG30334.1|  hypothetical protein F383_10781                         168   9e-46   
gb|KJB66738.1|  hypothetical protein B456_010G156100                    169   9e-46   
gb|KJB66739.1|  hypothetical protein B456_010G156100                    168   9e-46   
ref|XP_002456059.1|  hypothetical protein SORBIDRAFT_03g029650          169   9e-46   
ref|XP_002863442.1|  GDSL-motif lipase/hydrolase family protein         168   1e-45   
gb|EPS71267.1|  hypothetical protein M569_03493                         169   1e-45   
ref|XP_004491864.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     168   1e-45   
ref|NP_001168439.1|  uncharacterized protein LOC100382211               166   1e-45   
ref|XP_004984286.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     168   2e-45   
dbj|BAK01308.1|  predicted protein                                      168   2e-45   
ref|XP_004963464.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     168   2e-45   
gb|KHN18921.1|  GDSL esterase/lipase                                    164   2e-45   
gb|ACF87885.1|  unknown                                                 168   2e-45   
ref|NP_001149411.1|  esterase precursor                                 167   2e-45   
ref|XP_006387672.1|  hypothetical protein POPTR_0686s00200g             161   2e-45   
gb|AAM62801.1|  GDSL-motif lipase/hydrolase-like protein                167   3e-45   
ref|XP_006655093.1|  PREDICTED: GDSL esterase/lipase At1g28580-like     167   3e-45   
ref|NP_199403.1|  GDSL esterase/lipase                                  167   4e-45   
emb|CDX94632.1|  BnaC07g10260D                                          167   4e-45   
ref|XP_010925692.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     166   5e-45   
ref|XP_009140758.1|  PREDICTED: GDSL esterase/lipase At5g45910          167   5e-45   
ref|XP_011096421.1|  PREDICTED: GDSL esterase/lipase At5g45910          167   5e-45   
emb|CDY48195.1|  BnaA04g15590D                                          167   6e-45   
emb|CDX77066.1|  BnaC04g38610D                                          167   6e-45   
dbj|BAJ90990.1|  predicted protein                                      167   6e-45   
ref|XP_002439450.1|  hypothetical protein SORBIDRAFT_09g006590          166   7e-45   
ref|XP_008655208.1|  PREDICTED: uncharacterized protein LOC100382...    166   1e-44   
ref|XP_008675275.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     165   1e-44   
ref|XP_009102895.1|  PREDICTED: GDSL esterase/lipase At1g28570-like     165   2e-44   
ref|XP_008783909.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     165   2e-44   
gb|EAZ27028.1|  hypothetical protein OsJ_10957                          165   2e-44   
gb|ERN06193.1|  hypothetical protein AMTR_s00016p00149780               159   2e-44   
gb|AAX59709.1|  lipase 1                                                165   2e-44   
ref|XP_008655207.1|  PREDICTED: uncharacterized protein LOC100382...    165   2e-44   
ref|NP_001043728.2|  Os01g0651000                                       159   3e-44   
ref|XP_006844517.1|  PREDICTED: GDSL esterase/lipase At5g45910          164   3e-44   
emb|CDY15658.1|  BnaA07g08290D                                          165   3e-44   
ref|XP_006281867.1|  hypothetical protein CARUB_v10028062mg             161   3e-44   
ref|XP_007213171.1|  hypothetical protein PRUPE_ppa026981mg             162   5e-44   
dbj|BAK05815.1|  predicted protein                                      164   5e-44   
ref|XP_010915606.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     163   6e-44   
dbj|BAD68794.1|  lipase-like                                            164   6e-44   
ref|XP_010327054.1|  PREDICTED: GDSL esterase/lipase At2g27360-li...    162   1e-43   
gb|EAZ12911.1|  hypothetical protein OsJ_02834                          163   2e-43   
dbj|BAB89203.1|  lipase-like                                            162   2e-43   
gb|KJB62808.1|  hypothetical protein B456_009G437400                    162   2e-43   
ref|XP_010915607.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     162   2e-43   
ref|XP_004967474.1|  PREDICTED: GDSL esterase/lipase At1g31550-li...    162   2e-43   
gb|KHN34100.1|  GDSL esterase/lipase                                    162   2e-43   
ref|XP_003566944.2|  PREDICTED: GDSL esterase/lipase At1g28600-like     161   3e-43   
gb|EMT01150.1|  GDSL esterase/lipase                                    161   3e-43   
ref|XP_008783975.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     162   4e-43   
ref|XP_004980345.1|  PREDICTED: GDSL esterase/lipase At1g28570-like     161   4e-43   
ref|XP_003566943.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     161   5e-43   
ref|XP_002456054.1|  hypothetical protein SORBIDRAFT_03g029600          160   8e-43   
gb|EEE62726.1|  hypothetical protein OsJ_17529                          160   1e-42   
gb|KHN34101.1|  GDSL esterase/lipase                                    160   1e-42   
ref|NP_001054914.2|  Os05g0210400                                       160   1e-42   
gb|ACG38031.1|  alpha-L-fucosidase 2 precursor                          160   2e-42   
ref|XP_003559896.2|  PREDICTED: GDSL esterase/lipase At1g28600-like     160   2e-42   
gb|EMT30303.1|  GDSL esterase/lipase                                    159   2e-42   
ref|XP_010495736.1|  PREDICTED: GDSL esterase/lipase At5g45910          159   2e-42   
ref|XP_002453668.1|  hypothetical protein SORBIDRAFT_04g010100          159   2e-42   
ref|XP_004964803.1|  PREDICTED: GDSL esterase/lipase At5g45910-li...    159   3e-42   
ref|XP_009409411.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     159   3e-42   
tpg|DAA58339.1|  TPA: hypothetical protein ZEAMMB73_636863              155   4e-42   
ref|NP_001141565.1|  uncharacterized protein LOC100273681               159   4e-42   
emb|CDO96751.1|  unnamed protein product                                158   4e-42   
gb|EAY90132.1|  hypothetical protein OsI_11698                          159   4e-42   
ref|XP_004964802.1|  PREDICTED: GDSL esterase/lipase At5g45910-li...    159   5e-42   
ref|XP_010243821.1|  PREDICTED: GDSL esterase/lipase At5g03980-like     153   5e-42   
ref|XP_008785278.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     159   6e-42   
ref|XP_006646152.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     158   6e-42   
ref|XP_003635688.1|  GDSL esterase/lipase                               157   8e-42   
gb|KEH33412.1|  GDSL-like lipase/acylhydrolase                          158   9e-42   
gb|AES71072.2|  GDSL-like lipase/acylhydrolase                          158   1e-41   
ref|XP_003537084.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     161   1e-41   
gb|KEH33577.1|  GDSL-like lipase/acylhydrolase                          157   1e-41   
gb|EAY96955.1|  hypothetical protein OsI_18874                          158   1e-41   
ref|XP_009102894.1|  PREDICTED: GDSL esterase/lipase At1g28580-like     158   1e-41   
emb|CDY15657.1|  BnaA07g08280D                                          158   1e-41   
ref|XP_004510075.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     157   1e-41   
ref|XP_004516452.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     157   1e-41   
gb|ABL11233.1|  UCW116, putative lipase                                 157   1e-41   
gb|EMT23758.1|  GDSL esterase/lipase                                    157   1e-41   
dbj|BAJ90380.1|  predicted protein                                      157   2e-41   
ref|XP_002437861.1|  hypothetical protein SORBIDRAFT_10g003930          157   2e-41   
ref|XP_008656709.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     157   2e-41   
ref|XP_004509605.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     157   2e-41   
ref|XP_004952371.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     157   2e-41   
gb|KEH17248.1|  GDSL-like lipase/acylhydrolase                          156   2e-41   
ref|XP_004968628.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     157   3e-41   
ref|XP_003565496.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     157   3e-41   
ref|XP_008658948.1|  PREDICTED: uncharacterized protein LOC100501...    156   3e-41   
ref|XP_004516453.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     157   3e-41   
ref|XP_003600821.1|  GDSL esterase/lipase                               156   3e-41   
ref|NP_001043727.1|  Os01g0650900                                       156   4e-41   
ref|XP_004515399.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     156   4e-41   
gb|AFW85778.1|  hypothetical protein ZEAMMB73_678347                    156   4e-41   
ref|XP_003564307.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     156   4e-41   
dbj|BAJ93038.1|  predicted protein                                      150   5e-41   
ref|XP_004966744.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     156   5e-41   
ref|XP_009421256.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     155   6e-41   
emb|CDX94633.1|  BnaC07g10250D                                          156   7e-41   
ref|NP_001042399.1|  Os01g0216400                                       155   7e-41   
gb|EMT16237.1|  GDSL esterase/lipase                                    155   8e-41   
ref|XP_010445802.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     155   8e-41   
ref|XP_006655809.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     154   8e-41   
ref|XP_006646151.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     155   9e-41   
ref|XP_008675276.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     155   1e-40   
ref|XP_003560500.1|  PREDICTED: acetylajmalan esterase-like             155   1e-40   
ref|XP_002450232.1|  hypothetical protein SORBIDRAFT_05g002280          154   1e-40   
ref|NP_001132224.1|  alpha-L-fucosidase 2 precursor                     155   1e-40   
ref|XP_010925693.1|  PREDICTED: GDSL esterase/lipase At5g45910-li...    155   1e-40   
ref|XP_006344835.1|  PREDICTED: acetylajmalan esterase-like             155   1e-40   
ref|XP_004971499.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     155   1e-40   
ref|XP_004968627.1|  PREDICTED: GDSL esterase/lipase At5g45910-li...    155   1e-40   
gb|ACG28261.1|  alpha-L-fucosidase 2 precursor                          155   2e-40   
gb|KEH38722.1|  GDSL-like lipase/acylhydrolase                          154   2e-40   
ref|XP_006651410.1|  PREDICTED: GDSL esterase/lipase At1g31550-like     154   2e-40   
dbj|BAJ90120.1|  predicted protein                                      154   2e-40   
ref|XP_004963669.1|  PREDICTED: GDSL esterase/lipase At2g27360-like     154   2e-40   
ref|XP_006654152.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     154   2e-40   
ref|XP_009413940.1|  PREDICTED: uncharacterized protein LOC103995136    158   2e-40   
ref|XP_002450231.1|  hypothetical protein SORBIDRAFT_05g002270          153   2e-40   
ref|XP_004230195.1|  PREDICTED: GDSL esterase/lipase At5g03980-li...    154   2e-40   
ref|XP_003635692.1|  GDSL esterase/lipase                               154   2e-40   
gb|EMT02900.1|  GDSL esterase/lipase                                    157   3e-40   
ref|NP_001056858.1|  Os06g0157000                                       153   3e-40   
ref|NP_001242867.1|  uncharacterized protein LOC100794616 precursor     154   3e-40   
dbj|BAD69424.1|  putative lipase                                        153   3e-40   
ref|XP_004971835.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     154   3e-40   
ref|XP_004230194.1|  PREDICTED: acetylajmalan esterase-like isofo...    154   3e-40   
ref|XP_010480704.1|  PREDICTED: GDSL esterase/lipase At1g28590-like     153   3e-40   
ref|NP_001054912.2|  Os05g0209600                                       153   4e-40   
gb|EAY96951.1|  hypothetical protein OsI_18870                          153   4e-40   
gb|AAS91011.1|  putative lipase                                         153   4e-40   
gb|ACR34288.1|  unknown                                                 150   4e-40   
ref|XP_003564303.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     153   4e-40   
ref|NP_001168581.1|  hypothetical protein precursor                     153   4e-40   
dbj|BAK06902.1|  predicted protein                                      154   5e-40   
ref|XP_009383158.1|  PREDICTED: GDSL esterase/lipase At1g28570-like     153   5e-40   
dbj|BAJ97605.1|  predicted protein                                      153   5e-40   
ref|XP_009414901.1|  PREDICTED: GDSL esterase/lipase At1g28590-like     153   5e-40   
gb|EEE65121.1|  hypothetical protein OsJ_20187                          153   7e-40   
gb|EMT15617.1|  GDSL esterase/lipase                                    153   7e-40   
ref|XP_010312722.1|  PREDICTED: GDSL esterase/lipase At5g03980 is...    152   7e-40   



>ref|XP_009792971.1| PREDICTED: GDSL esterase/lipase At1g28600-like [Nicotiana sylvestris]
Length=384

 Score =   257 bits (657),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 116/179 (65%), Positives = 140/179 (78%), Gaps = 0/179 (0%)
 Frame = -2

Query  783  FSVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRL  604
             +++ELIE GAQ +IVPGN PIGCSASYL  F  +N  EYD +TGC+NWLN+F+EYHN+L
Sbjct  205  LAIHELIELGAQTLIVPGNLPIGCSASYLNTFENSNKDEYDAETGCINWLNNFAEYHNQL  264

Query  603  LQNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGLVDC  424
            LQ E+ R+RE +P   IIYADYYNAAM++Y SP K+GF +T+VACCGGGGPYNYD L  C
Sbjct  265  LQEEIHRIRELHPQANIIYADYYNAAMQIYQSPKKFGFTSTIVACCGGGGPYNYDSLASC  324

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGECIFRSPKTKLSD  247
            GS  S VC+NPSS++SWDG HLTEAAY+WIA GLL+GPYT P+IN  C F       SD
Sbjct  325  GSPLSNVCNNPSSHVSWDGVHLTEAAYRWIAKGLLQGPYTIPKINELCSFDGLSKGKSD  383



>ref|XP_009629822.1| PREDICTED: GDSL esterase/lipase At1g28600-like [Nicotiana tomentosiformis]
Length=385

 Score =   254 bits (649),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 114/179 (64%), Positives = 141/179 (79%), Gaps = 0/179 (0%)
 Frame = -2

Query  783  FSVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRL  604
             +++ELIE GAQ +IVPGN PIGCSASYLT+F  +N +EYD +TGC+NWLN+F+EYHN+L
Sbjct  206  LAIHELIELGAQTLIVPGNLPIGCSASYLTNFKNSNKNEYDSETGCINWLNNFAEYHNQL  265

Query  603  LQNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGLVDC  424
            LQ E+ R+RE +P   +IYADYYNAAM++Y SP K+GF +T+VACCGGGGPYNYD L  C
Sbjct  266  LQEEIHRIRELHPQANVIYADYYNAAMQIYKSPKKFGFTSTIVACCGGGGPYNYDSLAIC  325

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGECIFRSPKTKLSD  247
            GS  S VC+NPSSY+SWDG HLTEAAY+ IA GLL+GPY  P++N  C F       SD
Sbjct  326  GSPLSNVCNNPSSYVSWDGVHLTEAAYRLIAKGLLQGPYAIPRMNELCSFDGLSKGKSD  384



>ref|XP_006367776.1| PREDICTED: GDSL esterase/lipase At1g28590-like [Solanum tuberosum]
Length=383

 Score =   254 bits (648),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 115/165 (70%), Positives = 134/165 (81%), Gaps = 0/165 (0%)
 Frame = -2

Query  783  FSVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRL  604
             ++NELIE GAQ +IVPGN PIGCSASYLT F  +N  EYD  TGC+NWLNDF+EYHN+L
Sbjct  208  LAINELIELGAQTLIVPGNLPIGCSASYLTIFKNSNKKEYDDSTGCINWLNDFAEYHNQL  267

Query  603  LQNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGLVDC  424
            LQ E+ +LRE +P   IIYADYYNAAM++Y SP K+GF +T+VACCGGGGPYNYD    C
Sbjct  268  LQQEIHKLREIHPHANIIYADYYNAAMQIYKSPKKFGFTSTIVACCGGGGPYNYDSKRPC  327

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQIN  289
            GS SS  CD PSSY+SWDG HLTEAAYK IA+GLL+GPYT PQ+N
Sbjct  328  GSPSSNYCDTPSSYVSWDGVHLTEAAYKLIAEGLLQGPYTIPQMN  372



>ref|XP_004234096.1| PREDICTED: GDSL esterase/lipase At1g28590-like [Solanum lycopersicum]
Length=380

 Score =   242 bits (618),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 111/164 (68%), Positives = 131/164 (80%), Gaps = 0/164 (0%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++NELIE GAQ +IVPGN PIGCSASYLT F  +N  +YD  TGC+ WLN+F+EYHN+LL
Sbjct  206  AINELIELGAQTLIVPGNLPIGCSASYLTIFKNSNKKDYDNSTGCIIWLNEFAEYHNQLL  265

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGLVDCG  421
            Q E+ +LRE +P   IIYADYYNAAM++Y SP K+GF +T+VACCGGGG YNYD    CG
Sbjct  266  QQEIHKLREIHPHANIIYADYYNAAMQIYRSPKKFGFTSTIVACCGGGGVYNYDSNRPCG  325

Query  420  SASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQIN  289
            S SS  CD PSSY+SWDG HLTEAAYK IA GLL+GPYT PQ+N
Sbjct  326  SPSSNYCDTPSSYVSWDGVHLTEAAYKLIAKGLLQGPYTIPQMN  369



>ref|XP_002267261.1| PREDICTED: GDSL esterase/lipase At1g28580 [Vitis vinifera]
Length=375

 Score =   239 bits (611),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 110/169 (65%), Positives = 133/169 (79%), Gaps = 1/169 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++ ELIE GA  ++VPG  P GCSASYLT F T N  +YDP TGCLNWLN+F+EYHN  L
Sbjct  194  AITELIELGAVTLMVPGKLPTGCSASYLTLFKTPNIEDYDPVTGCLNWLNEFAEYHNEQL  253

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKN-TVVACCGGGGPYNYDGLVDC  424
            + EL+R+RE YP T IIYADYYNAAMR+Y SP+K+GFK   + ACCGGGGPYNY+  V+C
Sbjct  254  KTELNRIRELYPHTNIIYADYYNAAMRIYRSPNKFGFKRGALTACCGGGGPYNYNSSVEC  313

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGECI  277
            G+  +T CD+PS Y+SWDG HLTEAAYKWIA+GLL+ PYT P +N  CI
Sbjct  314  GNLPATSCDDPSLYVSWDGLHLTEAAYKWIANGLLEEPYTFPPLNASCI  362



>emb|CDP21061.1| unnamed protein product [Coffea canephora]
Length=394

 Score =   236 bits (603),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 109/177 (62%), Positives = 137/177 (77%), Gaps = 1/177 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++ E+I+ GA  +IVPGNFPIGCSA YLT+F  +N  +YD  TGC+NWLNDFS+YHNRLL
Sbjct  214  AIEEVIKLGAVTLIVPGNFPIGCSAVYLTYFQGSNQQDYDKATGCINWLNDFSKYHNRLL  273

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNTVV-ACCGGGGPYNYDGLVDC  424
            Q EL+R+R+ +P  TIIYADYYNAAMRLY SP+KYGF+   + ACCGGGGPYNY+  V+C
Sbjct  274  QKELNRIRKLHPHATIIYADYYNAAMRLYRSPNKYGFRGGALKACCGGGGPYNYNSSVEC  333

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGECIFRSPKTKL  253
            G   +T CD+PS Y+ WDG HLTEAAY+ IA GLL+GP++TP +N  C   S  + L
Sbjct  334  GYPPATSCDDPSLYVCWDGLHLTEAAYQLIAGGLLQGPFSTPPMNTICALASTSSGL  390



>emb|CBI30663.3| unnamed protein product [Vitis vinifera]
Length=1124

 Score =   241 bits (616),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 110/169 (65%), Positives = 133/169 (79%), Gaps = 1/169 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++ ELIE GA  ++VPG  P GCSASYLT F T N  +YDP TGCLNWLN+F+EYHN  L
Sbjct  194  AITELIELGAVTLMVPGKLPTGCSASYLTLFKTPNIEDYDPVTGCLNWLNEFAEYHNEQL  253

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKN-TVVACCGGGGPYNYDGLVDC  424
            + EL+R+RE YP T IIYADYYNAAMR+Y SP+K+GFK   + ACCGGGGPYNY+  V+C
Sbjct  254  KTELNRIRELYPHTNIIYADYYNAAMRIYRSPNKFGFKRGALTACCGGGGPYNYNSSVEC  313

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGECI  277
            G+  +T CD+PS Y+SWDG HLTEAAYKWIA+GLL+ PYT P +N  CI
Sbjct  314  GNLPATSCDDPSLYVSWDGLHLTEAAYKWIANGLLEEPYTFPPLNASCI  362


 Score =   174 bits (442),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 84/155 (54%), Positives = 106/155 (68%), Gaps = 1/155 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            + + LIE GA  ++VPGNFPIGCSA YLT F + N ++YD   GCL   N F++YHN  L
Sbjct  548  AASMLIEEGAVTLMVPGNFPIGCSAVYLTIFRSPNKADYDENNGCLKAFNAFAQYHNTHL  607

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNTVV-ACCGGGGPYNYDGLVDC  424
            +  LD+L  +YP   IIYADYYNAAM L+ +P  +GF N  + ACCGGGGPYN++    C
Sbjct  608  KLALDKLGLKYPHAKIIYADYYNAAMPLFQAPRSFGFYNGALRACCGGGGPYNFNNSARC  667

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLL  319
            G   S  C++PSSY +WDG HLTE AYK IA  L+
Sbjct  668  GHIGSKACNDPSSYANWDGIHLTEGAYKIIATCLI  702



>emb|CDO96754.1| unnamed protein product [Coffea canephora]
Length=398

 Score =   229 bits (585),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 103/168 (61%), Positives = 132/168 (79%), Gaps = 1/168 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++ ELIE GA  ++VPGNFPIGCSASYLT++ ++   +YD  TGC+ WLN+F++YHN++L
Sbjct  217  AIQELIELGAVTLVVPGNFPIGCSASYLTYYQSSKKQDYDTDTGCIKWLNNFAKYHNQVL  276

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNTVV-ACCGGGGPYNYDGLVDC  424
            Q+E++R+RE  P  TIIYADYYNAAMRLY  P+KYGFK  V+ ACCG GGPYNY+  V C
Sbjct  277  QSEINRIRELNPHATIIYADYYNAAMRLYRFPNKYGFKGEVLKACCGAGGPYNYNSTVPC  336

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGEC  280
            G   +  CD+P  Y+SWDG HLTEAAY+WIA GLL+GP++TP IN  C
Sbjct  337  GYQPAASCDDPPLYVSWDGLHLTEAAYRWIARGLLEGPFSTPPINTVC  384



>ref|XP_010277742.1| PREDICTED: GDSL esterase/lipase At1g28610-like [Nelumbo nucifera]
Length=391

 Score =   228 bits (581),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 106/180 (59%), Positives = 130/180 (72%), Gaps = 2/180 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            +V  LIE GA  ++VPGN PIGCSA+YLT F + N  +YDP+TGCL WLN+F++  N  L
Sbjct  209  TVQMLIEQGAVTLLVPGNLPIGCSAAYLTQFQSPNKDDYDPETGCLKWLNEFAQKFNDHL  268

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKN-TVVACCGGGGPYNYDGLVDC  424
              ELD +RE YP  TIIYADYYNAAMR+Y SPS+YGF N  + ACCGGGGPYNYD    C
Sbjct  269  VKELDGMRELYPHATIIYADYYNAAMRIYRSPSQYGFTNGALTACCGGGGPYNYDRTAMC  328

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGECIFRSPKTKLSDS  244
            G A S  C++PSSY+SWDG HLTEAAY+ IA+GL++GPY  P I   C    P+   +D+
Sbjct  329  GDAGSRTCEDPSSYVSWDGIHLTEAAYRLIAEGLIRGPYAVPSIKHSCA-SLPQIPFADT  387



>ref|XP_008358656.1| PREDICTED: GDSL esterase/lipase At1g28600-like [Malus domestica]
Length=208

 Score =   220 bits (561),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 104/170 (61%), Positives = 126/170 (74%), Gaps = 2/170 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            S+NELI  GA X++VPGNFPIGC  +YLT + T++ SEYDP TGCLNWLN FSEYHN LL
Sbjct  36   SINELIAFGASXLVVPGNFPIGCIPAYLTTYETSDESEYDPSTGCLNWLNKFSEYHNELL  95

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFK-NTVVACCGGGGPYNYDGLVDC  424
            Q EL R+R  +P   I YADYYNA ++LY SP ++GF   T  ACCGGGGPYNY+    C
Sbjct  96   QRELSRIRSLHPHVNIXYADYYNAMLQLYQSPDQFGFTGETTKACCGGGGPYNYNSSALC  155

Query  423  GSASSTV-CDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGECI  277
            G+  + V C+NP+ +ISWDG H TEAAY+WIA GLL G YT PQI+  C+
Sbjct  156  GTPEANVLCENPAQFISWDGVHSTEAAYRWIAKGLLNGNYTVPQISTLCV  205



>ref|XP_007020867.1| GDSL-like Lipase/Acylhydrolase superfamily protein, putative 
isoform 1 [Theobroma cacao]
 gb|EOY12392.1| GDSL-like Lipase/Acylhydrolase superfamily protein, putative 
isoform 1 [Theobroma cacao]
Length=215

 Score =   217 bits (553),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 101/180 (56%), Positives = 124/180 (69%), Gaps = 1/180 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++NELIE GA   +VPGN PIGCS +YLT+F  ++  EYDP TGCL WLN FSEYHN LL
Sbjct  36   AINELIELGAVTFLVPGNLPIGCSPAYLTYFQGSDKGEYDPLTGCLTWLNQFSEYHNELL  95

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGLVDCG  421
            Q ELD++RE +P   IIYADYYN AMR Y+ P ++GF  T+VACCG G PYNY   + CG
Sbjct  96   QQELDQIRELHPHVNIIYADYYNIAMRFYHFPDQFGFTKTIVACCGRGVPYNYSSSMACG  155

Query  420  SAS-STVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGECIFRSPKTKLSDS  244
                 T CD+PSSY+SWDG H TEA Y+WI+  +LK  +T P IN  C+  +   K   S
Sbjct  156  DPPLRTSCDDPSSYVSWDGVHFTEATYRWISKAVLKELFTIPYINSLCLPLTVNNKFISS  215



>gb|KFK44741.1| hypothetical protein AALP_AA1G296900 [Arabis alpina]
Length=390

 Score =   220 bits (561),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 99/180 (55%), Positives = 131/180 (73%), Gaps = 3/180 (2%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++ EL+E G +  +VPG+FP+GCS +YLT + T+N  EYDP TGCL WLN+FSEYHN  L
Sbjct  206  AITELVEMGGRTFLVPGDFPLGCSVAYLTLYQTSNRVEYDPLTGCLTWLNEFSEYHNEHL  265

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNT-VVACCGGGGPYNYDGLVDC  424
            Q ELD+LR  YP  TIIY DYYNA +R++  P+K+G  N  + ACCG GGPYN++  + C
Sbjct  266  QAELDKLRNLYPHVTIIYGDYYNALLRIFEDPAKFGLMNRPLPACCGLGGPYNFNFSIKC  325

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGECIFRSPKTKLSDS  244
            G+  S  C +PS Y++WDG HLTEAAY+WI++GLLKGPY  P ++  CI  S K K ++S
Sbjct  326  GTRGSEYCSDPSKYVNWDGVHLTEAAYRWISEGLLKGPYAIPHLDMSCI--SSKVKNNES  383



>ref|XP_006361073.1| PREDICTED: GDSL esterase/lipase At2g27360-like [Solanum tuberosum]
Length=310

 Score =   218 bits (554),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 93/179 (52%), Positives = 130/179 (73%), Gaps = 1/179 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++ E+IE GA  ++VPG+ P+GCS + LT FM +N  +YDP TGCL W N+F+ YHN LL
Sbjct  131  AIQEVIEFGASRVVVPGSMPLGCSTALLTIFMDSNKEDYDPITGCLIWPNEFASYHNELL  190

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGF-KNTVVACCGGGGPYNYDGLVDC  424
            Q EL RLRE +P   IIYADYYNA+M+LY +P KYGF K  ++ACCGGGGPYN++    C
Sbjct  191  QKELHRLRELHPHVNIIYADYYNASMKLYRAPRKYGFLKGVLIACCGGGGPYNFNISAQC  250

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGECIFRSPKTKLSD  247
            G++ +T C++P+ Y++WDG H TEAAY+W+   LL+GP+T P +   C+F   + ++S 
Sbjct  251  GTSQATSCEDPNQYVNWDGYHFTEAAYRWMTKSLLEGPFTYPPMKNLCLFDVIEAQISQ  309



>ref|NP_973932.1| GDSL esterase/lipase [Arabidopsis thaliana]
 sp|Q9SHP6.2|GDL10_ARATH RecName: Full=GDSL esterase/lipase At1g28610; AltName: Full=Extracellular 
lipase At1g28610; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAG22835.1|AC007508_11 F1K23.16 [Arabidopsis thaliana]
 gb|AEE31002.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=383

 Score =   219 bits (559),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 101/178 (57%), Positives = 127/178 (71%), Gaps = 1/178 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++ EL++ G +  +VPGNFP+GCSA+YLT + T+N  EYDP TGCL WLNDFSEY+N  L
Sbjct  203  AIVELVDMGGRTFLVPGNFPLGCSATYLTLYQTSNKEEYDPLTGCLTWLNDFSEYYNEKL  262

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNT-VVACCGGGGPYNYDGLVDC  424
            Q EL+RL + YP   IIY DY+NA +RLY  PSK+GF +  + ACCG GGPYN+     C
Sbjct  263  QAELNRLSKLYPHVNIIYGDYFNALLRLYQEPSKFGFMDRPLPACCGLGGPYNFTLSKKC  322

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGECIFRSPKTKLS  250
            GS     C +PS Y++WDG H+TEAAYKWIADGLLKGPYT P  +  C+    K+K S
Sbjct  323  GSVGVKYCSDPSKYVNWDGVHMTEAAYKWIADGLLKGPYTIPSFHWLCLGSKIKSKES  380



>emb|CDP21060.1| unnamed protein product [Coffea canephora]
Length=238

 Score =   210 bits (535),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 94/175 (54%), Positives = 122/175 (70%), Gaps = 0/175 (0%)
 Frame = -2

Query  783  FSVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRL  604
             +VNEL+E G   ++VPG  P GC A  LT+F + NT  YD  TGC+NWLN+F+EYH+ L
Sbjct  58   LAVNELVELGVGTVMVPGLVPDGCLAVSLTYFGSPNTGNYDLSTGCINWLNEFAEYHDEL  117

Query  603  LQNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGLVDC  424
            LQ +L+  R+++P   IIYADYYNA ++LY +P +YGF+ T  ACCG GGPYNY+  V C
Sbjct  118  LQTKLNMARKRHPTAAIIYADYYNAILQLYRNPEEYGFRRTTAACCGDGGPYNYNKEVQC  177

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGECIFRSPKT  259
            G   +TVC +PS YI+WDG H TEAA +WI   LLKGPYT P ++  CI  +  T
Sbjct  178  GDPPTTVCPDPSVYINWDGPHFTEAANRWITSALLKGPYTLPHLDASCISEAAST  232



>emb|CDO96753.1| unnamed protein product [Coffea canephora]
Length=404

 Score =   214 bits (545),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 96/168 (57%), Positives = 128/168 (76%), Gaps = 1/168 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++ ELI+ GA+ ++VPGN PIGCS+SYLT+F ++N  +YD +TGC+ WLN+F++YHN+LL
Sbjct  226  AIQELIDLGAETLVVPGNLPIGCSSSYLTYFQSSNKHDYDMETGCIKWLNEFAKYHNKLL  285

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFK-NTVVACCGGGGPYNYDGLVDC  424
              E++R+RE  P   I+YADYYNAAM LY SP KYGFK   + ACCG GGPYNY+    C
Sbjct  286  LTEINRIRELNPHALIVYADYYNAAMTLYRSPQKYGFKAGALKACCGAGGPYNYNASAPC  345

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGEC  280
            G   +T CD+PS Y++WDG HLTEAAY++IA  LL+GPY+  +IN  C
Sbjct  346  GYPPATSCDDPSLYVAWDGLHLTEAAYRFIARRLLQGPYSGLRINRFC  393



>ref|XP_008225208.1| PREDICTED: GDSL esterase/lipase At1g28590-like [Prunus mume]
Length=380

 Score =   211 bits (536),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 94/169 (56%), Positives = 125/169 (74%), Gaps = 1/169 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++NELIE GA  I+VPGN PIGC  SYL+ F +++ S+YD  TGCL WLN+F++YHN  L
Sbjct  209  TINELIELGAATILVPGNNPIGCLPSYLSKFESSDKSQYDASTGCLKWLNEFAQYHNEQL  268

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFK-NTVVACCGGGGPYNYDGLVDC  424
            Q EL R+R  +P  TI+YADYYNA ++LY SP ++GF   T  ACCGGGGPYN++  V C
Sbjct  269  QIELSRIRRLHPQVTIVYADYYNALLQLYQSPRQFGFTGETSKACCGGGGPYNFNSSVQC  328

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGECI  277
            G+A +TVC+NPS +I+WDG H TEAAY+ +   LL+G YT P++   C+
Sbjct  329  GNAGATVCENPSQFINWDGMHCTEAAYRLMTKALLQGNYTFPRLASLCV  377



>ref|XP_008777731.1| PREDICTED: GDSL esterase/lipase At1g31550-like [Phoenix dactylifera]
Length=396

 Score =   211 bits (537),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 93/173 (54%), Positives = 123/173 (71%), Gaps = 0/173 (0%)
 Frame = -2

Query  783  FSVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRL  604
            +++N LIE GA+ ++VPG FP+GC ++YLT   +    +YDP+TGC+ WLN+FSEYHN L
Sbjct  215  WAINSLIELGAKTLVVPGIFPLGCVSAYLTVHQSGRREDYDPQTGCIKWLNEFSEYHNSL  274

Query  603  LQNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGLVDC  424
            LQ ELDRLR  +P  TIIYA+YY+AAM +Y  P KYGF   + ACCGGGGPYN++    C
Sbjct  275  LQTELDRLRRLHPRITIIYANYYDAAMDIYRHPLKYGFDAPLAACCGGGGPYNFNLTAMC  334

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGECIFRSP  265
            G+   TVC +PS ++ WDG HLT+AAY+ IA GLL+G Y +  I   C+   P
Sbjct  335  GAREDTVCSDPSKHVCWDGMHLTDAAYEIIARGLLQGSYASAPITQACLLLEP  387



>ref|XP_007020866.1| GDSL-like Lipase/Acylhydrolase superfamily protein, putative 
[Theobroma cacao]
 gb|EOY12391.1| GDSL-like Lipase/Acylhydrolase superfamily protein, putative 
[Theobroma cacao]
Length=789

 Score =   218 bits (556),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 99/169 (59%), Positives = 121/169 (72%), Gaps = 1/169 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++NELIE GA   +VPGN PIGCS +YLT+F  ++  EYDP TGCL WLN FSEYHN LL
Sbjct  243  AINELIELGAVTFLVPGNLPIGCSPAYLTYFQGSDKGEYDPLTGCLTWLNQFSEYHNELL  302

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGLVDCG  421
            Q ELD++RE +P   IIYADYYN AMR Y+ P ++GF  T+VACCG G PYNY   + CG
Sbjct  303  QQELDQIRELHPHVNIIYADYYNIAMRFYHFPDQFGFTKTIVACCGKGVPYNYSSSMACG  362

Query  420  SAS-STVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGECI  277
                 T CD+PSSY+SWDG H TEA Y+WI+  +LK  +T P IN  C+
Sbjct  363  DPPLRTSCDDPSSYVSWDGVHFTEATYRWISKAVLKELFTIPYINSLCL  411


 Score =   184 bits (468),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 87/162 (54%), Positives = 115/162 (71%), Gaps = 3/162 (2%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            +++ELIE GA   +VPGN PIGC  SYLT++  ++  EYDP TGCL WLN FSEYHN+LL
Sbjct  607  AIHELIELGAVTFLVPGNLPIGCLPSYLTNYQGSDEEEYDPLTGCLTWLNQFSEYHNQLL  666

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNTV--VACCGGGGPYNYDGLVD  427
            Q EL R++E +P   I YADYY+AA+R Y SP ++GF+      ACCGGGGPYN++    
Sbjct  667  QEELARIQEIHPHVNIFYADYYSAAIRFYLSPKQFGFRKETQRKACCGGGGPYNFNLSAV  726

Query  426  CG-SASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYT  304
            CG    ++ CD+PSSY+SWDG H TEAA + ++  +L G +T
Sbjct  727  CGYPLVTSCCDDPSSYVSWDGIHYTEAANRLLSRAILDGLHT  768



>ref|XP_010540491.1| PREDICTED: GDSL esterase/lipase At1g28570-like isoform X3 [Tarenaya 
hassleriana]
Length=321

 Score =   207 bits (528),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 94/169 (56%), Positives = 118/169 (70%), Gaps = 2/169 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++ EL++ G +  +VPGNFPIGCSA+YLT + T N  +YDP TGCL WLN+F+E+HN  L
Sbjct  137  AIRELVDMGGRTFLVPGNFPIGCSAAYLTMYQTENMEKYDPLTGCLKWLNEFAEHHNERL  196

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNTVVA-CCGGGGPYNYDGLVDC  424
            Q EL+RLR+ YP   I+YADYYN  +RL+  P ++GF N  ++ CCG GGPYNY     C
Sbjct  197  QIELNRLRKLYPHVNIVYADYYNVVLRLFQDPIEFGFMNRPLSVCCGAGGPYNYSPSRLC  256

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGECI  277
            G      CDNPS Y++WDG HLTE AY+WIA GLLKGPY  P  N  C 
Sbjct  257  GDGVP-YCDNPSKYVNWDGFHLTEHAYRWIAKGLLKGPYADPAFNSYCF  304



>gb|KHN08455.1| GDSL esterase/lipase [Glycine soja]
Length=182

 Score =   203 bits (517),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 98/170 (58%), Positives = 122/170 (72%), Gaps = 5/170 (3%)
 Frame = -2

Query  783  FSVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRL  604
            FS+ ELI  GA+ +IVPGNFPIGCSASYLT + T + ++Y    GCL WL  F+EY++  
Sbjct  9    FSLQELIGLGARTLIVPGNFPIGCSASYLTIYETVDKNQY----GCLKWLTKFAEYYHHE  64

Query  603  LQNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGLVDC  424
            LQ+ELD+LR  YP   IIYADYYNAA  LY  P+K+GF +  V CCG GGPYNY+   DC
Sbjct  65   LQSELDKLRGLYPRANIIYADYYNAAFTLYRDPTKFGFTDLKV-CCGMGGPYNYNTTADC  123

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGECIF  274
            G+   + CD+PS +I WD  HLTEAAY+ IA+GL+KGPY  PQIN  C+ 
Sbjct  124  GNPGVSACDDPSKHIGWDNVHLTEAAYRIIAEGLMKGPYCLPQINTSCLM  173



>ref|XP_009401628.1| PREDICTED: GDSL esterase/lipase At1g28570-like [Musa acuminata 
subsp. malaccensis]
Length=377

 Score =   209 bits (532),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 94/171 (55%), Positives = 122/171 (71%), Gaps = 0/171 (0%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++N+LIE G + ++VPGNFPIGC  +YL  F + N  +YD +TGC+ WLN+FSEYHNRLL
Sbjct  202  AINDLIELGVKTLLVPGNFPIGCIPAYLDVFQSKNVEDYDSQTGCIKWLNEFSEYHNRLL  261

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGLVDCG  421
            Q+ELDRLR+ +P  TIIYA+YY+A +  + +P  +GFK  + ACCG  GPY  +  V CG
Sbjct  262  QDELDRLRKLHPHVTIIYANYYDATISFFRAPQLFGFKAPLHACCGSDGPYGVNRFVQCG  321

Query  420  SASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGECIFRS  268
               +TVC +PSS ISWDG HLTEAAY+ IA  LL+GP+  P I   C  RS
Sbjct  322  HKDATVCSDPSSSISWDGIHLTEAAYETIARSLLEGPHAKPPITRACPQRS  372



>ref|XP_010911731.1| PREDICTED: GDSL esterase/lipase At1g28600-like [Elaeis guineensis]
Length=226

 Score =   204 bits (520),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 96/167 (57%), Positives = 119/167 (71%), Gaps = 2/167 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++  LIE GA+ ++VPGNF IGC   YL  F +  +  YDP+TGC+ WLN+FSEYHNRLL
Sbjct  36   TLKVLIELGAKTLVVPGNFAIGCVPLYLMLFQSPASEYYDPQTGCIKWLNEFSEYHNRLL  95

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGLVDCG  421
             +ELD+LR  YP+ TIIYADYY A + +Y SP ++GF+    ACCGGGGP N    V CG
Sbjct  96   LDELDKLRHLYPNATIIYADYYKALLSIYRSPREFGFEKPFDACCGGGGPNN--SAVPCG  153

Query  420  SASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGEC  280
                TVC +PS Y+SWDG HLTEAAY+ IA GLL+G YTTP +N  C
Sbjct  154  DPGFTVCSDPSKYVSWDGLHLTEAAYREIALGLLQGSYTTPSMNQVC  200



>ref|XP_009113643.1| PREDICTED: GDSL esterase/lipase At2g27360-like isoform X2 [Brassica 
rapa]
Length=386

 Score =   209 bits (532),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 96/178 (54%), Positives = 122/178 (69%), Gaps = 1/178 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++ EL++ G +  +VPG+FP+GCS  YLT + T+N   YDP+TGCL WLN+FSEYHN  L
Sbjct  206  TITELVDMGGKTFLVPGDFPLGCSVIYLTLYQTSNKEAYDPQTGCLTWLNEFSEYHNEQL  265

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNT-VVACCGGGGPYNYDGLVDC  424
            Q EL+RLR+ YP   IIY DYYNA +RL   P+K+G  N  +  CCG GG YNY   V C
Sbjct  266  QAELNRLRKLYPYVNIIYGDYYNALLRLIQEPAKFGLMNNPLPVCCGLGGRYNYTFGVKC  325

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGECIFRSPKTKLS  250
            G      C++PS Y++WDG H+TEAAYKWIA+GLLKGPY TP  +  C+    K K S
Sbjct  326  GLKGVECCNDPSKYVNWDGIHMTEAAYKWIAEGLLKGPYATPPFDWSCLSSEIKDKES  383



>gb|AAL86351.1| putative lipase [Arabidopsis thaliana]
Length=243

 Score =   204 bits (520),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 96/178 (54%), Positives = 124/178 (70%), Gaps = 1/178 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++ EL+  G +  +VPGNFPIG SASYLT + T+N  EYDP TGCL WLNDFSEY+N+ L
Sbjct  49   AITELVCMGGRTFLVPGNFPIGYSASYLTLYKTSNKEEYDPLTGCLKWLNDFSEYYNKQL  108

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNT-VVACCGGGGPYNYDGLVDC  424
            Q EL+ LR+ YP   IIYADYYNA +RL+  P+K+GF N  + ACCG GG YN++    C
Sbjct  109  QEELNGLRKLYPHVNIIYADYYNALLRLFQEPAKFGFMNRPLPACCGVGGSYNFNFSRRC  168

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGECIFRSPKTKLS  250
            GS     CD+PS Y+++DG H+TEAAY+ I++GLLKGPY  P     C+      K+S
Sbjct  169  GSVGVEYCDDPSQYVNYDGIHMTEAAYRLISEGLLKGPYAIPPFKWSCLSSEIMNKMS  226



>ref|XP_007212730.1| hypothetical protein PRUPE_ppa019092mg [Prunus persica]
 gb|EMJ13929.1| hypothetical protein PRUPE_ppa019092mg [Prunus persica]
Length=377

 Score =   208 bits (530),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 93/168 (55%), Positives = 123/168 (73%), Gaps = 1/168 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++NELIE GA  ++VPGNFPIGC  +YLT + +++ ++YDP TGCLNWLN FS YHN  L
Sbjct  206  TINELIELGAATLLVPGNFPIGCLPAYLTKYESSDKNQYDPSTGCLNWLNKFSGYHNDQL  265

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGF-KNTVVACCGGGGPYNYDGLVDC  424
            Q  L R+R  +P  TIIYADYYNA ++LY SP ++GF   T  ACCGGGGPYNY+    C
Sbjct  266  QIALSRIRRLHPQVTIIYADYYNAMLQLYQSPDQFGFIGETSKACCGGGGPYNYNASALC  325

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGEC  280
            G A ++ C+NP+ +ISWDG H TEAA++WI   +L+G YT P+++  C
Sbjct  326  GDAGASACENPAQFISWDGLHSTEAAHRWITKAILQGNYTVPRVSTLC  373



>ref|XP_009113642.1| PREDICTED: GDSL esterase/lipase At2g27360-like isoform X1 [Brassica 
rapa]
 emb|CDY34089.1| BnaA09g27150D [Brassica napus]
Length=389

 Score =   209 bits (531),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 96/178 (54%), Positives = 122/178 (69%), Gaps = 1/178 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++ EL++ G +  +VPG+FP+GCS  YLT + T+N   YDP+TGCL WLN+FSEYHN  L
Sbjct  209  TITELVDMGGKTFLVPGDFPLGCSVIYLTLYQTSNKEAYDPQTGCLTWLNEFSEYHNEQL  268

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNT-VVACCGGGGPYNYDGLVDC  424
            Q EL+RLR+ YP   IIY DYYNA +RL   P+K+G  N  +  CCG GG YNY   V C
Sbjct  269  QAELNRLRKLYPYVNIIYGDYYNALLRLIQEPAKFGLMNNPLPVCCGLGGRYNYTFGVKC  328

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGECIFRSPKTKLS  250
            G      C++PS Y++WDG H+TEAAYKWIA+GLLKGPY TP  +  C+    K K S
Sbjct  329  GLKGVECCNDPSKYVNWDGIHMTEAAYKWIAEGLLKGPYATPPFDWSCLSSEIKDKES  386



>ref|XP_003542989.1| PREDICTED: GDSL esterase/lipase At1g28600 [Glycine max]
Length=400

 Score =   209 bits (531),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 96/169 (57%), Positives = 119/169 (70%), Gaps = 2/169 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++ ELI+ GA   +VPG+ P+GC+ +YLT F T +  EYD + GCL WLN F EYHN LL
Sbjct  215  AIRELIDLGAVTFMVPGSLPLGCNPAYLTIFATIDKEEYD-QAGCLKWLNTFYEYHNELL  273

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFK-NTVVACCGGGGPYNYDGLVDC  424
            Q E++RLR  YP T IIYADY+NAA+  YNSP ++GF  N +  CCGGGGPYNY+    C
Sbjct  274  QIEINRLRVLYPLTNIIYADYFNAALEFYNSPEQFGFGGNVLKVCCGGGGPYNYNETAMC  333

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGECI  277
            G A    CD+PS Y+SWDG HLTEAAY+W+  GLL GPYT P+ N  C 
Sbjct  334  GDAGVVACDDPSQYVSWDGYHLTEAAYRWMTKGLLDGPYTIPKFNVSCF  382



>emb|CDY15655.1| BnaA07g08260D [Brassica napus]
Length=393

 Score =   208 bits (530),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 95/169 (56%), Positives = 117/169 (69%), Gaps = 1/169 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++ ELI  G +  +VPGNFP+GCS +YLT + T+N  EYDP TGCL WLN F+EY N  L
Sbjct  205  AITELIGMGGRTFLVPGNFPLGCSVAYLTLYQTSNVEEYDPVTGCLKWLNKFAEYFNEQL  264

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNT-VVACCGGGGPYNYDGLVDC  424
            Q ELDRLR+ YP   IIYADYYNA  R++  P+K+GF N  + ACCG GG YNY     C
Sbjct  265  QAELDRLRKMYPHVNIIYADYYNALSRIFQEPAKFGFMNRPLPACCGLGGQYNYTPGKKC  324

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGECI  277
            G      CD+PS Y++WDG H+TEAAY+ IA+GLLKGPY  P  N  C+
Sbjct  325  GFEGVEYCDDPSKYVNWDGVHMTEAAYRLIAEGLLKGPYVIPPFNWSCL  373



>ref|XP_010540489.1| PREDICTED: GDSL esterase/lipase At1g28580-like isoform X2 [Tarenaya 
hassleriana]
Length=366

 Score =   207 bits (528),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 94/168 (56%), Positives = 118/168 (70%), Gaps = 2/168 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++ EL++ G +  +VPGNFPIGCSA+YLT + T N  +YDP TGCL WLN+F+E+HN  L
Sbjct  182  AIRELVDMGGRTFLVPGNFPIGCSAAYLTMYQTENMEKYDPLTGCLKWLNEFAEHHNERL  241

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNTVVA-CCGGGGPYNYDGLVDC  424
            Q EL+RLR+ YP   I+YADYYN  +RL+  P ++GF N  ++ CCG GGPYNY     C
Sbjct  242  QIELNRLRKLYPHVNIVYADYYNVVLRLFQDPIEFGFMNRPLSVCCGAGGPYNYSPSRLC  301

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGEC  280
            G      CDNPS Y++WDG HLTE AY+WIA GLLKGPY  P  N  C
Sbjct  302  GDGVP-YCDNPSKYVNWDGFHLTEHAYRWIAKGLLKGPYADPAFNSYC  348



>ref|XP_010540488.1| PREDICTED: GDSL esterase/lipase At1g28610-like isoform X1 [Tarenaya 
hassleriana]
Length=393

 Score =   208 bits (529),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 94/169 (56%), Positives = 118/169 (70%), Gaps = 2/169 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++ EL++ G +  +VPGNFPIGCSA+YLT + T N  +YDP TGCL WLN+F+E+HN  L
Sbjct  209  AIRELVDMGGRTFLVPGNFPIGCSAAYLTMYQTENMEKYDPLTGCLKWLNEFAEHHNERL  268

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNTVVA-CCGGGGPYNYDGLVDC  424
            Q EL+RLR+ YP   I+YADYYN  +RL+  P ++GF N  ++ CCG GGPYNY     C
Sbjct  269  QIELNRLRKLYPHVNIVYADYYNVVLRLFQDPIEFGFMNRPLSVCCGAGGPYNYSPSRLC  328

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGECI  277
            G      CDNPS Y++WDG HLTE AY+WIA GLLKGPY  P  N  C 
Sbjct  329  GDG-VPYCDNPSKYVNWDGFHLTEHAYRWIAKGLLKGPYADPAFNSYCF  376



>ref|XP_010057068.1| PREDICTED: GDSL esterase/lipase At1g28570-like [Eucalyptus grandis]
 gb|KCW74054.1| hypothetical protein EUGRSUZ_E02674 [Eucalyptus grandis]
Length=402

 Score =   208 bits (530),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 98/179 (55%), Positives = 128/179 (72%), Gaps = 6/179 (3%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            +++ELI  GA  I+VPGNFPIGC  +YLT F +++   YDP TGCLNWLN+FS+YHN  L
Sbjct  211  AISELIHLGAVTILVPGNFPIGCLPAYLTKFQSSDKEAYDPSTGCLNWLNEFSQYHNEQL  270

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNTVV-ACCGGGGPYNYDGLVDC  424
            Q +LD LRE +P T IIY DYYNAA+R + SP+K+GF+  V  ACCGGGG +NY+    C
Sbjct  271  QLKLDHLRELHPRTKIIYVDYYNAAIRFFQSPNKFGFEGQVFRACCGGGGTHNYNSSALC  330

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGECIFRSPKTKLSD  247
             S+++ VCD+PSSY SWDG H TEAAY+WI   +  GP+T P+++  C    P   LS+
Sbjct  331  -SSNTKVCDDPSSYASWDGLHFTEAAYRWIFKSIADGPFTVPKLDISC----PSLALSE  384



>ref|XP_003593737.1| GDSL esterase/lipase [Medicago truncatula]
 gb|AES63988.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=375

 Score =   207 bits (527),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 95/169 (56%), Positives = 121/169 (72%), Gaps = 2/169 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            S+ ELI  GA  I+VPG+ P+GC+ +YLT F T +  EYD + GCL WLN F EYHN LL
Sbjct  205  SIRELINLGAVTILVPGSLPLGCNPAYLTMFATKDEEEYD-QAGCLKWLNKFFEYHNELL  263

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFK-NTVVACCGGGGPYNYDGLVDC  424
            Q EL +LR  YP T IIYADY+NAA++LY SP +YGF  N    CCGGGGPYNY+    C
Sbjct  264  QTELHKLRVLYPFTNIIYADYFNAALQLYKSPEQYGFDGNAFKVCCGGGGPYNYNDSALC  323

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGECI  277
            G++    CD+PS Y+SWDG HLTEAA++W+ + LL+GPYT P+ +  C+
Sbjct  324  GNSEVIACDDPSKYVSWDGYHLTEAAHRWMTEALLEGPYTIPKFSFSCL  372



>ref|XP_004291631.1| PREDICTED: GDSL esterase/lipase At1g28580-like [Fragaria vesca 
subsp. vesca]
Length=389

 Score =   207 bits (528),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 95/173 (55%), Positives = 121/173 (70%), Gaps = 3/173 (2%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++NELIE GA  ++VPGNFPIGC   YLT F T++  +Y+  TGCLNWLN F+EYHN  L
Sbjct  212  AINELIELGAVTLVVPGNFPIGCLPIYLTKFQTSDKGQYNSSTGCLNWLNKFAEYHNDQL  271

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGF-KNTVVACCGGGGPYNYDGLVDC  424
            Q EL R++  +P+  IIYADYYNA M  Y+SP ++GF   TV ACCGGGGPYNY+    C
Sbjct  272  QIELSRIQRLHPNINIIYADYYNAVMHFYHSPDQFGFIGGTVKACCGGGGPYNYNSSAQC  331

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQING--ECIFR  271
            GS  ++ C+NP+ +I+WDG H TEAAY+WI   L KG Y  P I+    C+F 
Sbjct  332  GSIEASACENPAEFINWDGIHFTEAAYRWIVKVLFKGKYNVPGISRLVPCVFH  384



>emb|CDX94634.1| BnaC07g10240D [Brassica napus]
Length=398

 Score =   207 bits (528),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 96/169 (57%), Positives = 116/169 (69%), Gaps = 1/169 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++ ELI  G +  +VPGNFP+GCS +YLT + T+N  EYDP TGCL WLN F+EY N  L
Sbjct  211  AITELIGMGGRTFLVPGNFPLGCSVAYLTLYQTSNMEEYDPVTGCLKWLNKFAEYFNEQL  270

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNT-VVACCGGGGPYNYDGLVDC  424
            Q ELDRLR+ YP   IIYADYYNA  RL+  P+KYGF N  + ACCG GG YNY     C
Sbjct  271  QAELDRLRKLYPHVNIIYADYYNALARLFQEPAKYGFMNRPLPACCGFGGQYNYTPGKKC  330

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGECI  277
            G      C +PS Y++WDG H+TEAAY+ IA+GLLKGPY  P  N  C+
Sbjct  331  GFEGVDYCKDPSKYVNWDGVHMTEAAYRLIAEGLLKGPYVIPPFNWSCL  379



>ref|XP_006362447.1| PREDICTED: GDSL esterase/lipase At1g28600-like [Solanum tuberosum]
Length=400

 Score =   207 bits (528),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 99/172 (58%), Positives = 122/172 (71%), Gaps = 2/172 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++ ELIE GA  ++VPG+ PIGCS +YLT +M ++  +YDPKTGCLNWLN+FS+ +N LL
Sbjct  209  AIQELIELGASTLLVPGDLPIGCSTAYLTKYMHSDKGQYDPKTGCLNWLNNFSQQYNELL  268

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGF-KNTVVACCGGGGPYNYDGLVDC  424
            Q EL  LR+ YP  TIIYADYYNAAM+ Y SP  +GF K  +VACCG GGPYN+     C
Sbjct  269  QKELHLLRDLYPAATIIYADYYNAAMQFYASPKSHGFRKGALVACCGAGGPYNFMFSTIC  328

Query  423  GS-ASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGECIFR  271
            G  A+  +C + S Y SWDG H TEAAYKWIA GLLKG +T P +   C  R
Sbjct  329  GDPAARNICSDTSVYASWDGMHFTEAAYKWIATGLLKGTFTFPPLPKICTDR  380



>ref|XP_009102892.1| PREDICTED: GDSL esterase/lipase At1g28570-like [Brassica rapa]
Length=395

 Score =   207 bits (528),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 95/169 (56%), Positives = 117/169 (69%), Gaps = 1/169 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++ ELI  G +  +VPGNFP+GCS +YLT + T+N  EYDP TGCL WLN F+EY N  L
Sbjct  205  AITELIGMGGRTFLVPGNFPLGCSVAYLTLYQTSNMEEYDPVTGCLKWLNKFAEYFNEQL  264

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNT-VVACCGGGGPYNYDGLVDC  424
            Q ELDRLR+ YP   IIYADYYNA  R++  P+K+GF N  + ACCG GG YNY     C
Sbjct  265  QAELDRLRKLYPHVNIIYADYYNALSRIFQEPAKFGFMNRPLPACCGLGGQYNYTPGKKC  324

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGECI  277
            G      CD+PS Y++WDG H+TEAAY+ IA+GLLKGPY  P  N  C+
Sbjct  325  GFEGVEYCDDPSKYVNWDGVHMTEAAYRLIAEGLLKGPYVIPPFNWSCL  373



>ref|NP_174182.1| GDSL esterase/lipase [Arabidopsis thaliana]
 sp|Q94F40.1|GDL9_ARATH RecName: Full=GDSL esterase/lipase At1g28600; AltName: Full=Extracellular 
lipase At1g28600; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAK60329.1|AF385739_1 At1g28600/F1K23_6 [Arabidopsis thaliana]
 gb|AAM91505.1| At1g28600/F1K23_6 [Arabidopsis thaliana]
 gb|AEE30999.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=393

 Score =   207 bits (527),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 91/169 (54%), Positives = 116/169 (69%), Gaps = 1/169 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++ ELI  G +  +VPG FPIGCS  YLT + T+N  EYDP TGCL WLN F EYH+  L
Sbjct  203  TITELIGMGGKTFLVPGEFPIGCSVVYLTLYKTSNKDEYDPSTGCLKWLNKFGEYHSEKL  262

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGF-KNTVVACCGGGGPYNYDGLVDC  424
            + EL+RLR+ YP   IIYADYYN+ +R++  P+K+GF +    ACCG GGPYN++    C
Sbjct  263  KVELNRLRKLYPHVNIIYADYYNSLLRIFKEPAKFGFMERPFPACCGIGGPYNFNFTRKC  322

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGECI  277
            GS     C +PS Y+ WDG H+TEAAYKWIADG+L GPY  P  +  C+
Sbjct  323  GSVGVKSCKDPSKYVGWDGVHMTEAAYKWIADGILNGPYANPPFDRSCL  371



>gb|AAM65183.1| lipase, putative [Arabidopsis thaliana]
Length=393

 Score =   207 bits (527),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 91/169 (54%), Positives = 116/169 (69%), Gaps = 1/169 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++ ELI  G +  +VPG FPIGCS  YLT + T+N  EYDP TGCL WLN F EYH+  L
Sbjct  203  TITELIGMGGKTFLVPGEFPIGCSVVYLTLYKTSNKDEYDPTTGCLKWLNKFGEYHSEKL  262

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNT-VVACCGGGGPYNYDGLVDC  424
            + EL+RLR+ YP   IIYADYYN+ +R++  P+K+GF +    ACCG GGPYN++    C
Sbjct  263  KAELNRLRKLYPHVNIIYADYYNSLLRIFKEPAKFGFMDRPFPACCGIGGPYNFNFTRKC  322

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGECI  277
            GS     C +PS Y+ WDG H+TEAAYKWIADG+L GPY  P  +  C+
Sbjct  323  GSVGVKSCKDPSKYVGWDGVHMTEAAYKWIADGILNGPYANPPFDRSCL  371



>ref|XP_008225217.1| PREDICTED: uncharacterized protein LOC103324878 [Prunus mume]
Length=885

 Score =   215 bits (547),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 96/168 (57%), Positives = 125/168 (74%), Gaps = 1/168 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++NELIE GA  ++VPGNFPIGC  +YLT + +++ ++YDP TGCLNWLN FS YHN  L
Sbjct  714  TINELIELGAATLLVPGNFPIGCLPAYLTKYESSDKNQYDPSTGCLNWLNKFSGYHNDQL  773

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGF-KNTVVACCGGGGPYNYDGLVDC  424
            Q EL R+R  +P  TIIYADYYNA ++LY SP ++GF   T  ACCGGGGPYNY+    C
Sbjct  774  QIELSRIRRLHPQVTIIYADYYNAMLQLYQSPDQFGFIGETSKACCGGGGPYNYNASALC  833

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGEC  280
            G A ++VC+NP+ +ISWDG H TEAAY+WI   +L+G YT P+++  C
Sbjct  834  GDAGASVCENPAQFISWDGLHSTEAAYRWITKAILQGNYTVPRVSTLC  881


 Score =   199 bits (506),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 100/182 (55%), Positives = 127/182 (70%), Gaps = 7/182 (4%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++NELIE GA  ++VPGNFPIGC  +YLT + +++ ++YDP TGCLNWLN FS YHN  L
Sbjct  212  TINELIELGAATLLVPGNFPIGCLPAYLTKYESSDKNQYDPSTGCLNWLNKFSGYHNDQL  271

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGF-KNTVVACCGGGGPYNYDGLVDC  424
            Q EL R+R  +P  TIIYADYYNA ++LY SP ++GF   T  ACCGGGGPYNY+    C
Sbjct  272  QIELSRIRRLHPQVTIIYADYYNAMLQLYQSPDQFGFIGETSKACCGGGGPYNYNTSALC  331

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKW----IADGLLKGPYTTPQINGECIF-RSPKT  259
            G A ++VC+NP+ +ISWDG H TEAAY +     AD  LKG    P +  EC F +S  T
Sbjct  332  GDAGASVCENPAQFISWDGLHSTEAAYSYAGAIFADACLKGLNGVPDVV-ECSFVQSSVT  390

Query  258  KL  253
            +L
Sbjct  391  EL  392



>ref|XP_007212863.1| hypothetical protein PRUPE_ppa021567mg [Prunus persica]
 gb|EMJ14062.1| hypothetical protein PRUPE_ppa021567mg [Prunus persica]
Length=393

 Score =   206 bits (525),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 92/168 (55%), Positives = 124/168 (74%), Gaps = 1/168 (1%)
 Frame = -2

Query  777  VNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLLQ  598
            + ELIE GA  I+VPGN PIGC  +YL+ F T++ ++YDP TGCL WLN+F++YHN  LQ
Sbjct  223  LQELIELGAATILVPGNNPIGCLPAYLSKFETSDKNQYDPSTGCLKWLNEFAQYHNEQLQ  282

Query  597  NELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFK-NTVVACCGGGGPYNYDGLVDCG  421
             EL R+R  +P  TI+YADYYNA ++LY SP ++GF   T  ACCGGGGPYN++  + CG
Sbjct  283  IELSRIRRLHPQVTIVYADYYNALLQLYQSPHQFGFTGETSKACCGGGGPYNFNPSLQCG  342

Query  420  SASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGECI  277
            +A +TVC+NPS +I+WDG H TEAAY+ +   LL+G YT P++   C+
Sbjct  343  NAGATVCENPSQFINWDGMHSTEAAYRLMTKALLQGNYTFPRLASLCV  390



>ref|XP_009347996.1| PREDICTED: GDSL esterase/lipase At1g28580-like [Pyrus x bretschneideri]
Length=376

 Score =   206 bits (524),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 97/170 (57%), Positives = 119/170 (70%), Gaps = 1/170 (1%)
 Frame = -2

Query  783  FSVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRL  604
             S+NELIE GA  ++VPGN PIGC   YLT++  ++ S+YDP TGCLNWLN F EY+N  
Sbjct  204  LSINELIELGAATLLVPGNVPIGCLPIYLTNYEGSDKSDYDPSTGCLNWLNKFVEYYNEQ  263

Query  603  LQNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGF-KNTVVACCGGGGPYNYDGLVD  427
            LQ EL+R+R  +P   IIYADYYNA M LY+SP ++GF   T  ACCGGGG YNY+    
Sbjct  264  LQTELNRIRSLHPHVNIIYADYYNAMMYLYHSPEQFGFIGGTPKACCGGGGTYNYNSSAQ  323

Query  426  CGSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGECI  277
            CG   ++ C NP  +ISWDG H TEAAYKWI + LLKG YT P I+  C+
Sbjct  324  CGMRQASACQNPEEFISWDGIHFTEAAYKWITNALLKGNYTDPCISSLCV  373



>ref|XP_010478238.1| PREDICTED: GDSL esterase/lipase At1g28600-like [Camelina sativa]
Length=415

 Score =   207 bits (526),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 95/169 (56%), Positives = 116/169 (69%), Gaps = 1/169 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            +V ELI  G +  +VPGNFPIGCS  YLT + T+N  EYDP TGCL WLN+F EYH   L
Sbjct  218  AVTELIAMGGRTFLVPGNFPIGCSVIYLTLYQTSNKEEYDPLTGCLKWLNNFGEYHEEQL  277

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNT-VVACCGGGGPYNYDGLVDC  424
              EL+RLR+  P   IIYADYYNA +RL+  P+K+GF N    ACCG GGPYN+    +C
Sbjct  278  HAELNRLRKLNPHVNIIYADYYNALLRLFQEPAKFGFGNRPFPACCGIGGPYNFSLNRNC  337

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGECI  277
            GS     C++PS Y+ WDG H+TEAAYK IADG+L+GPY  P  N  C+
Sbjct  338  GSVGVKSCNDPSKYVGWDGIHMTEAAYKLIADGILQGPYAIPPFNWSCL  386



>ref|NP_180304.1| GDSL esterase/lipase [Arabidopsis thaliana]
 sp|Q9ZQI3.1|GDL40_ARATH RecName: Full=GDSL esterase/lipase At2g27360; AltName: Full=Extracellular 
lipase At2g27360; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAD41994.1| putative lipase [Arabidopsis thaliana]
 gb|AAM15186.1| putative lipase [Arabidopsis thaliana]
 gb|AEC07985.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=394

 Score =   206 bits (524),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 92/169 (54%), Positives = 117/169 (69%), Gaps = 1/169 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            +++EL++ GA+  +VPGNFP+GCS +YLT + T N  EY+P TGCL WLNDFS YHN  L
Sbjct  207  AISELVDMGARTFLVPGNFPLGCSVAYLTLYETPNKEEYNPLTGCLTWLNDFSVYHNEQL  266

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNT-VVACCGGGGPYNYDGLVDC  424
            Q EL RLR  YP   IIY DYYN  +RL   PSK+G  +  + ACCG GGPYN+   + C
Sbjct  267  QAELKRLRNLYPHVNIIYGDYYNTLLRLMQEPSKFGLMDRPLPACCGLGGPYNFTFSIKC  326

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGECI  277
            GS     C +PS Y++WDG H+TEAAYKWI++G+L GPY  P  N  C+
Sbjct  327  GSKGVEYCSDPSKYVNWDGIHMTEAAYKWISEGVLTGPYAIPPFNWSCL  375



>dbj|BAD44668.1| putative lipase [Arabidopsis thaliana]
Length=390

 Score =   206 bits (524),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 92/169 (54%), Positives = 117/169 (69%), Gaps = 1/169 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            +++EL++ GA+  +VPGNFP+GCS +YLT + T N  EY+P TGCL WLNDFS YHN  L
Sbjct  203  AISELVDMGARTFLVPGNFPLGCSVAYLTLYETPNKEEYNPLTGCLTWLNDFSVYHNEQL  262

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNT-VVACCGGGGPYNYDGLVDC  424
            Q EL RLR  YP   IIY DYYN  +RL   PSK+G  +  + ACCG GGPYN+   + C
Sbjct  263  QAELKRLRNLYPHVNIIYGDYYNTLLRLMQEPSKFGLMDRPLPACCGLGGPYNFTFSIKC  322

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGECI  277
            GS     C +PS Y++WDG H+TEAAYKWI++G+L GPY  P  N  C+
Sbjct  323  GSKGVEYCSDPSKYVNWDGIHMTEAAYKWISEGVLTGPYAIPPFNWSCL  371



>ref|XP_002879083.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH55342.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=392

 Score =   206 bits (523),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 94/177 (53%), Positives = 122/177 (69%), Gaps = 1/177 (1%)
 Frame = -2

Query  777  VNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLLQ  598
            ++EL++ GA+  +VPGNFP+GCS +YLT + T+N  EY+P TGCL WLNDFS YHN  LQ
Sbjct  208  ISELVDMGARTFLVPGNFPLGCSVAYLTLYETSNEEEYNPLTGCLTWLNDFSVYHNEQLQ  267

Query  597  NELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNT-VVACCGGGGPYNYDGLVDCG  421
             EL+RLR+ YP   IIY DYYN  +RL   PSK+G  +  + ACCG GGPYN+   + CG
Sbjct  268  AELNRLRKLYPHVNIIYGDYYNTLLRLVQEPSKFGLMDRPLPACCGVGGPYNFTFSIQCG  327

Query  420  SASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGECIFRSPKTKLS  250
            S     C +PS Y++WDG H+TEAAYK I++G+LKGPY  P  +  C+    K K S
Sbjct  328  SKGVEYCSDPSKYVNWDGIHMTEAAYKCISEGILKGPYAIPPFDWSCLSSEIKNKES  384



>ref|NP_001241470.1| uncharacterized protein LOC100816865 [Glycine max]
 gb|ACU18909.1| unknown [Glycine max]
 gb|KHN18922.1| GDSL esterase/lipase [Glycine soja]
Length=386

 Score =   205 bits (522),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 97/169 (57%), Positives = 123/169 (73%), Gaps = 2/169 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++NELI  GA+ +IVPGNFPIGCSASYLT + T   ++YD + GCL WLN F+EY+N  L
Sbjct  211  AINELIGLGARTLIVPGNFPIGCSASYLTIYETEYKNQYD-QFGCLKWLNKFAEYYNNEL  269

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGLVDCG  421
            Q+ELD+LR  YP   IIYADY+NAA+  Y  P+K+GF    V CCG GGPYNY+   DCG
Sbjct  270  QSELDKLRRLYPRANIIYADYFNAALLFYRDPTKFGFTGLKV-CCGMGGPYNYNTSADCG  328

Query  420  SASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGECIF  274
            +   + CD+PS +I WD  HLTEAAY+ +A+GL+KGPY  PQIN  C+ 
Sbjct  329  NPGVSACDDPSKHIGWDSVHLTEAAYRIVAEGLIKGPYCLPQINTLCLM  377



>ref|XP_009774388.1| PREDICTED: GDSL esterase/lipase At1g28580-like [Nicotiana sylvestris]
Length=385

 Score =   205 bits (522),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 96/178 (54%), Positives = 128/178 (72%), Gaps = 2/178 (1%)
 Frame = -2

Query  777  VNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLLQ  598
             +EL+E GA+ I+VP   P+GC++SYLT++ + N  +YD + GCL W N F+ +HN+LLQ
Sbjct  208  AHELVELGAKTIMVPSVLPLGCASSYLTYYQSWNEEDYD-ELGCLIWPNHFASHHNQLLQ  266

Query  597  NELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGF-KNTVVACCGGGGPYNYDGLVDCG  421
             EL RLRE +P   IIYADYYNAAM+LY SPSKYGF K  +V CCGGGGPYN++    CG
Sbjct  267  RELHRLREIHPHVNIIYADYYNAAMQLYRSPSKYGFLKGGLVTCCGGGGPYNFNPFAPCG  326

Query  420  SASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGECIFRSPKTKLSD  247
               +T C++P+ YI+WDG HLTEAAY+W+   LL+GP+T P IN  C F   + ++S 
Sbjct  327  DYPATSCEDPNQYINWDGYHLTEAAYRWMTKSLLEGPFTNPPINSVCPFDINEAQVSQ  384



>gb|KCW45467.1| hypothetical protein EUGRSUZ_L00816 [Eucalyptus grandis]
Length=402

 Score =   206 bits (523),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 95/168 (57%), Positives = 123/168 (73%), Gaps = 2/168 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            +++ELI  GA  I+VPGNFPIGC  +YLT F +++   YDP TGCLNWLN+FS+YHN  L
Sbjct  211  AISELIHLGAVTILVPGNFPIGCLPAYLTKFQSSDKEAYDPSTGCLNWLNEFSQYHNEQL  270

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNTVV-ACCGGGGPYNYDGLVDC  424
            Q +LD LRE +P T IIY DYYNAA+R Y SP+K+GF+  V  ACCGGGG +NY+    C
Sbjct  271  QLKLDHLRELHPRTKIIYVDYYNAAVRFYQSPNKFGFEGQVFRACCGGGGTHNYNSSALC  330

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGEC  280
             S+++ VCD+PSSY SWDG H TEAAY+WI   +  G +T P+++  C
Sbjct  331  -SSNTKVCDDPSSYASWDGLHFTEAAYRWIFKSIADGSFTVPKLDISC  377



>ref|XP_010912648.1| PREDICTED: sinapine esterase-like isoform X3 [Elaeis guineensis]
Length=370

 Score =   204 bits (520),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 92/166 (55%), Positives = 123/166 (74%), Gaps = 3/166 (2%)
 Frame = -2

Query  774  NELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLLQN  595
            N LI+ GA+ ++VPGNFPIGC + YL  F +    +YD +TGC+ WLN+F+EYHNRLL +
Sbjct  193  NALIQLGAKTLVVPGNFPIGCVSWYLQAFQSRRKEDYDSQTGCIKWLNEFAEYHNRLLVD  252

Query  594  ELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNT-VVACCGGGGPYNYDGLVDCGS  418
            ELD L++ +P  TIIYADYY A + ++ SP+++GFK   + ACCGGGGPYN    V CG 
Sbjct  253  ELDHLQQLHPHVTIIYADYYKALLNIFRSPTQFGFKKAPLAACCGGGGPYNIS--VPCGG  310

Query  417  ASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGEC  280
             ++TVC++PS+Y+ WDG HLTEAAY+ IA GLL+GP+T P I   C
Sbjct  311  RAATVCNDPSTYVCWDGMHLTEAAYRTIAQGLLEGPHTAPPITQAC  356



>gb|AFK42362.1| unknown [Medicago truncatula]
Length=375

 Score =   204 bits (520),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 94/169 (56%), Positives = 120/169 (71%), Gaps = 2/169 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            S+ ELI  GA  I+VPG+ P+GC+ +YLT F T +  EYD + GCL WLN F EY N LL
Sbjct  205  SIRELINLGAVTILVPGSLPLGCNPAYLTMFATKDEEEYD-QAGCLKWLNKFFEYRNELL  263

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFK-NTVVACCGGGGPYNYDGLVDC  424
            Q EL +LR  YP T IIYADY+NAA++LY SP +YGF  N    CCGGGGPYNY+    C
Sbjct  264  QTELHKLRVLYPFTNIIYADYFNAALQLYKSPEQYGFDGNAFKVCCGGGGPYNYNDSALC  323

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGECI  277
            G++    CD+PS Y+SWDG HLTEAA++W+ + LL+GPYT P+ +  C+
Sbjct  324  GNSEVIACDDPSKYVSWDGYHLTEAAHRWMTEALLEGPYTIPKFSFSCL  372



>ref|XP_002893538.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69797.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=808

 Score =   212 bits (540),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 95/170 (56%), Positives = 123/170 (72%), Gaps = 1/170 (1%)
 Frame = -2

Query  783  FSVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRL  604
             ++ EL+  G +  +VPGNFP+GCSA+YLT + T+N  EYDP TGCL WLN FSEY+N  
Sbjct  627  LAIKELVCMGGRTFLVPGNFPLGCSAAYLTLYQTSNKEEYDPLTGCLTWLNVFSEYYNEQ  686

Query  603  LQNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNT-VVACCGGGGPYNYDGLVD  427
            LQ EL+RL+E YP   IIYADYYNA +RL+  P+K+GF N  + ACCG GG YN++    
Sbjct  687  LQKELNRLKELYPHVNIIYADYYNALLRLFPEPAKFGFMNRPLPACCGLGGSYNFNFSRR  746

Query  426  CGSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGECI  277
            CGS     C++PS Y++WDG H+TEAAY+WI++GLLKGPY  P  N  C+
Sbjct  747  CGSVGVEYCNDPSKYVNWDGIHMTEAAYRWISEGLLKGPYAIPTFNWSCL  796


 Score =   207 bits (527),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 95/178 (53%), Positives = 119/178 (67%), Gaps = 1/178 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++ ELI  GA+  +VPG FPIGCS  YLT + T+N  EYDP TGCL WLN F EYH++ L
Sbjct  203  AITELIGMGAKTFLVPGEFPIGCSVVYLTLYQTSNKEEYDPLTGCLKWLNKFGEYHSQQL  262

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNTVV-ACCGGGGPYNYDGLVDC  424
            + EL+RLR+  P   IIYADYYNA +RL+  P+K+GF +  + ACCG GG YN++    C
Sbjct  263  KTELNRLRKLNPHVNIIYADYYNALLRLFKEPAKFGFMDRPLHACCGIGGQYNFNFTRKC  322

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGECIFRSPKTKLS  250
            GS     C +PS Y+ WDG H+TE AYKWIADG+LKGPY  P     C+    K K S
Sbjct  323  GSVGVESCKDPSKYVGWDGVHMTEGAYKWIADGILKGPYAIPPFGRSCLRSEIKNKES  380



>ref|NP_174181.1| GDSL esterase/lipase [Arabidopsis thaliana]
 sp|Q8RXT9.2|GDL8_ARATH RecName: Full=GDSL esterase/lipase At1g28590; AltName: Full=Extracellular 
lipase At1g28590; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AEE30998.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=403

 Score =   205 bits (522),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 96/178 (54%), Positives = 124/178 (70%), Gaps = 1/178 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++ EL+  G +  +VPGNFPIG SASYLT + T+N  EYDP TGCL WLNDFSEY+N+ L
Sbjct  209  AITELVCMGGRTFLVPGNFPIGYSASYLTLYKTSNKEEYDPLTGCLKWLNDFSEYYNKQL  268

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNT-VVACCGGGGPYNYDGLVDC  424
            Q EL+ LR+ YP   IIYADYYNA +RL+  P+K+GF N  + ACCG GG YN++    C
Sbjct  269  QEELNGLRKLYPHVNIIYADYYNALLRLFQEPAKFGFMNRPLPACCGVGGSYNFNFSRRC  328

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGECIFRSPKTKLS  250
            GS     CD+PS Y+++DG H+TEAAY+ I++GLLKGPY  P     C+      K+S
Sbjct  329  GSVGVEYCDDPSQYVNYDGIHMTEAAYRLISEGLLKGPYAIPPFKWSCLSSEIMNKMS  386



>ref|XP_010912640.1| PREDICTED: GDSL esterase/lipase At1g28650-like isoform X2 [Elaeis 
guineensis]
Length=386

 Score =   204 bits (520),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 92/166 (55%), Positives = 123/166 (74%), Gaps = 3/166 (2%)
 Frame = -2

Query  774  NELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLLQN  595
            N LI+ GA+ ++VPGNFPIGC + YL  F +    +YD +TGC+ WLN+F+EYHNRLL +
Sbjct  209  NALIQLGAKTLVVPGNFPIGCVSWYLQAFQSRRKEDYDSQTGCIKWLNEFAEYHNRLLVD  268

Query  594  ELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNT-VVACCGGGGPYNYDGLVDCGS  418
            ELD L++ +P  TIIYADYY A + ++ SP+++GFK   + ACCGGGGPYN    V CG 
Sbjct  269  ELDHLQQLHPHVTIIYADYYKALLNIFRSPTQFGFKKAPLAACCGGGGPYNIS--VPCGG  326

Query  417  ASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGEC  280
             ++TVC++PS+Y+ WDG HLTEAAY+ IA GLL+GP+T P I   C
Sbjct  327  RAATVCNDPSTYVCWDGMHLTEAAYRTIAQGLLEGPHTAPPITQAC  372



>ref|XP_010912632.1| PREDICTED: GDSL esterase/lipase At1g28650-like isoform X1 [Elaeis 
guineensis]
Length=398

 Score =   205 bits (521),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 92/166 (55%), Positives = 123/166 (74%), Gaps = 3/166 (2%)
 Frame = -2

Query  774  NELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLLQN  595
            N LI+ GA+ ++VPGNFPIGC + YL  F +    +YD +TGC+ WLN+F+EYHNRLL +
Sbjct  221  NALIQLGAKTLVVPGNFPIGCVSWYLQAFQSRRKEDYDSQTGCIKWLNEFAEYHNRLLVD  280

Query  594  ELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNT-VVACCGGGGPYNYDGLVDCGS  418
            ELD L++ +P  TIIYADYY A + ++ SP+++GFK   + ACCGGGGPYN    V CG 
Sbjct  281  ELDHLQQLHPHVTIIYADYYKALLNIFRSPTQFGFKKAPLAACCGGGGPYNIS--VPCGG  338

Query  417  ASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGEC  280
             ++TVC++PS+Y+ WDG HLTEAAY+ IA GLL+GP+T P I   C
Sbjct  339  RAATVCNDPSTYVCWDGMHLTEAAYRTIAQGLLEGPHTAPPITQAC  384



>ref|XP_008785390.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Phoenix dactylifera]
Length=364

 Score =   203 bits (517),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 93/164 (57%), Positives = 120/164 (73%), Gaps = 1/164 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++  LI++GA  ++VPG  P GCS++YLT F + N  +YDP+TGCL WLN F++YHN LL
Sbjct  201  AIESLIKNGAVNLLVPGILPFGCSSAYLTVFNSPNREDYDPRTGCLRWLNGFAKYHNALL  260

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGF-KNTVVACCGGGGPYNYDGLVDC  424
            +  LD LR +YP   I+YADYY A+  +  SP  +GF +N  VACCGG GPYN+  L  C
Sbjct  261  RRALDELRRKYPRARIMYADYYGASNPISRSPQHFGFGRNIFVACCGGDGPYNFSPLALC  320

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQI  292
            G  SSTVC +PSSY++WDG HLTEAAY +IA GLL+GPYTTP +
Sbjct  321  GQPSSTVCSHPSSYVNWDGFHLTEAAYHFIATGLLEGPYTTPPL  364



>ref|XP_008371712.1| PREDICTED: GDSL esterase/lipase At1g28600-like, partial [Malus 
domestica]
Length=434

 Score =   205 bits (522),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 95/170 (56%), Positives = 120/170 (71%), Gaps = 1/170 (1%)
 Frame = -2

Query  783  FSVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRL  604
             S+NELIE GA  ++VPGN PIGC   YLT++  ++ S+YDP TGCLNWLN F EY+N  
Sbjct  262  LSINELIELGAATLLVPGNLPIGCLPIYLTNYEGSDESDYDPSTGCLNWLNKFVEYYNEQ  321

Query  603  LQNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGF-KNTVVACCGGGGPYNYDGLVD  427
            LQ EL R+R  +P   IIYADYYNA M L +SP ++GF   +  ACCGGGG YNY+    
Sbjct  322  LQTELSRIRSLHPHVNIIYADYYNAMMYLXHSPEQFGFIGGSPKACCGGGGTYNYNSSAQ  381

Query  426  CGSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGECI  277
            CG   ++ C+NP+ +ISWDG H TEAAYKWI + LLKG YT P+I+  C+
Sbjct  382  CGMRQASACENPAEFISWDGIHFTEAAYKWITNALLKGNYTDPRISSLCV  431



>ref|XP_009765841.1| PREDICTED: GDSL esterase/lipase At1g28610-like [Nicotiana sylvestris]
Length=388

 Score =   204 bits (519),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 99/181 (55%), Positives = 122/181 (67%), Gaps = 3/181 (2%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++ ELIE GA  ++VPG  PIGCS +YLT F  +N   YDPKTGC+NWLN FS+++N LL
Sbjct  209  AIQELIELGASTLVVPGELPIGCSTAYLTKFTHSNKEHYDPKTGCINWLNHFSQHYNELL  268

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGF-KNTVVACCGGGGPYNYDGLVDC  424
            Q EL  LRE +P  TIIYADYYNAAM+ Y SP+ +GF K  + ACCG GGPYN+     C
Sbjct  269  QKELHLLRELHPSVTIIYADYYNAAMQFYVSPTSHGFRKGALDACCGAGGPYNFKFSAVC  328

Query  423  GS-ASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGECIFRSPKTKLSD  247
            G   +  +C + S Y SWDG H TEAAYKWIA GLL+G +T P +   C F +P     D
Sbjct  329  GDPPARNICSDTSQYASWDGMHFTEAAYKWIARGLLEGTFTFPPLAKICTF-NPNVNQFD  387

Query  246  S  244
            S
Sbjct  388  S  388



>ref|XP_008777733.1| PREDICTED: GDSL esterase/lipase At1g28600-like [Phoenix dactylifera]
Length=375

 Score =   204 bits (518),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 94/163 (58%), Positives = 117/163 (72%), Gaps = 0/163 (0%)
 Frame = -2

Query  768  LIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLLQNEL  589
            LI+ GA+ ++VPGNFPIGC   YL  F  ++  +YDP+TGC+NWLN FSEYHNRLL +EL
Sbjct  211  LIDLGAKTLVVPGNFPIGCVPLYLALFQNSSKGDYDPQTGCINWLNKFSEYHNRLLMDEL  270

Query  588  DRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGLVDCGSASS  409
            ++LR+ +PD TIIYA+YY A + +  SP +YG + T  ACCG  GP N    V CG  ++
Sbjct  271  NKLRQLHPDATIIYANYYEALLSIVRSPGQYGIEVTEAACCGPSGPVNVTSPVLCGDPAA  330

Query  408  TVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGEC  280
            TVC +PS YISWDG HLTEAAY  IA GLL+GPY TP I   C
Sbjct  331  TVCSDPSKYISWDGVHLTEAAYGNIARGLLEGPYATPPIARAC  373



>ref|XP_007020868.1| GDSL-like Lipase/Acylhydrolase superfamily protein, putative 
isoform 2, partial [Theobroma cacao]
 gb|EOY12393.1| GDSL-like Lipase/Acylhydrolase superfamily protein, putative 
isoform 2, partial [Theobroma cacao]
Length=172

 Score =   197 bits (501),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 92/161 (57%), Positives = 112/161 (70%), Gaps = 5/161 (3%)
 Frame = -2

Query  744  IIVPGNFPIGCSASYLTHFMTANTS----EYDPKTGCLNWLNDFSEYHNRLLQNELDRLR  577
             +VPGN PIGCS +YLT+F  ++      EYDP TGCL WLN FSEYHN LLQ ELD++R
Sbjct  1    FLVPGNLPIGCSPAYLTYFQGSDKGSDKGEYDPLTGCLTWLNQFSEYHNELLQQELDQIR  60

Query  576  EQYPDTTIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGLVDCGSAS-STVC  400
            E +P   IIYADYYN AMR Y+ P ++GF  T+VACCG G PYNY   + CG     T C
Sbjct  61   ELHPHVNIIYADYYNIAMRFYHFPDQFGFTKTIVACCGRGVPYNYSSSMACGDPPLRTSC  120

Query  399  DNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGECI  277
            D+PSSY+SWDG H TEA Y+WI+  +LK  +T P IN  C+
Sbjct  121  DDPSSYVSWDGVHFTEATYRWISKAVLKELFTIPYINSLCL  161



>ref|XP_004233850.1| PREDICTED: GDSL esterase/lipase At1g28580-like isoform X1 [Solanum 
lycopersicum]
Length=385

 Score =   204 bits (518),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 97/172 (56%), Positives = 120/172 (70%), Gaps = 2/172 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++ ELIE GA  ++VPG+ PIGCS +YLT FM ++  +YDPKTGC+NWLN FS+ +N LL
Sbjct  208  AIQELIELGASTLLVPGDLPIGCSTAYLTKFMHSDKGQYDPKTGCINWLNKFSQQYNELL  267

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGF-KNTVVACCGGGGPYNYDGLVDC  424
            Q EL  LR+  P  TIIYADYYNAAM+ Y SP  +GF K  +VACCG GGPYN+     C
Sbjct  268  QKELHLLRDLNPAATIIYADYYNAAMQFYASPKSHGFRKGALVACCGAGGPYNFKFSALC  327

Query  423  GSASST-VCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGECIFR  271
            G  S+  +C + S Y SWDG H TEAAYKWIA GLL+G +T P +   C  R
Sbjct  328  GDPSARDICSDTSVYASWDGMHFTEAAYKWIATGLLQGTFTFPPVPKICTNR  379



>ref|XP_009352954.1| PREDICTED: uncharacterized protein LOC103944252 [Pyrus x bretschneideri]
Length=1005

 Score =   212 bits (540),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 103/165 (62%), Positives = 120/165 (73%), Gaps = 7/165 (4%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++NELI  GA  ++VPGNFPIGC  +YLT     N SEYDP TGCLNWLN FSEYHN LL
Sbjct  199  TINELIAFGASTLVVPGNFPIGCIPAYLT-----NESEYDPLTGCLNWLNKFSEYHNELL  253

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFK-NTVVACCGGGGPYNYDGLVDC  424
            Q EL R+R  +P   IIYADYYNA ++LY SP ++GF   T  ACCGGGGPYNY+    C
Sbjct  254  QRELSRIRILHPYVNIIYADYYNAMLQLYQSPDQFGFTGETTKACCGGGGPYNYNSSALC  313

Query  423  GSASSTV-CDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQI  292
            GS  + V C+NP+ +ISWDG H TEAAY+WIA GLL G YT PQI
Sbjct  314  GSPEANVLCENPAQFISWDGVHSTEAAYRWIAKGLLNGNYTVPQI  358


 Score =   207 bits (527),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 95/170 (56%), Positives = 121/170 (71%), Gaps = 2/170 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++NELI  GA  ++VPG FP GC  ++LT + T++  EYDP TGCLNWLN F+EYHN LL
Sbjct  659  AINELIALGASTLLVPGVFPFGCVPAFLTRYQTSDEDEYDPSTGCLNWLNKFTEYHNELL  718

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFK-NTVVACCGGGGPYNYDGLVDC  424
            Q EL R++  +P   IIYADYYNA + L+ SP ++GF   T  ACCGGGGPYNY+    C
Sbjct  719  QIELRRIQSLHPHVNIIYADYYNAMLELHQSPDQFGFTGETTKACCGGGGPYNYNSSALC  778

Query  423  GSASSTV-CDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGECI  277
            G+  + V C+NP+ +ISWDG H TEAAY+WIA GLL   YT PQI+  C+
Sbjct  779  GTPEANVLCENPAQFISWDGLHSTEAAYRWIAKGLLNRNYTVPQISALCV  828


 Score = 78.2 bits (191),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = -2

Query  474  ACCGGGGPYNYDGLVDCGSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKG  313
            ACCGGG PYN++    CG   ST C +PSSY++WDG HLTEAAY++IA GL+ G
Sbjct  367  ACCGGGEPYNFNNSARCGHIGSTACKDPSSYVNWDGIHLTEAAYRYIAKGLIHG  420



>ref|XP_010422035.1| PREDICTED: GDSL esterase/lipase At1g31550-like isoform X2 [Camelina 
sativa]
Length=382

 Score =   203 bits (517),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 98/176 (56%), Positives = 120/176 (68%), Gaps = 2/176 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++ ELI  G +  +VPG FPIGCS +YLT + T+N  EYDP  GCL WLN F EYH+  L
Sbjct  196  AITELISMGGKTFLVPGEFPIGCSVAYLTLYQTSNIEEYDP-FGCLKWLNKFGEYHDEQL  254

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNT-VVACCGGGGPYNYDGLVDC  424
            Q EL RLR+  P   IIYADYYNA +RL   P+KYGF N  + ACCG G PYN++    C
Sbjct  255  QAELKRLRKLNPHVNIIYADYYNALLRLNQEPTKYGFINKPLSACCGVGEPYNFNFSTCC  314

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGECIFRSPKTK  256
            GS     C++PS Y++WDG H+TEAAYK+IADGLLKGPYT+P  N  C+    K K
Sbjct  315  GSFGVDSCNDPSMYVAWDGIHMTEAAYKFIADGLLKGPYTSPPFNWTCLTSKIKNK  370



>ref|XP_010422034.1| PREDICTED: GDSL esterase/lipase At1g31550-like isoform X1 [Camelina 
sativa]
Length=396

 Score =   203 bits (517),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 98/176 (56%), Positives = 120/176 (68%), Gaps = 2/176 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++ ELI  G +  +VPG FPIGCS +YLT + T+N  EYDP  GCL WLN F EYH+  L
Sbjct  210  AITELISMGGKTFLVPGEFPIGCSVAYLTLYQTSNIEEYDP-FGCLKWLNKFGEYHDEQL  268

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNT-VVACCGGGGPYNYDGLVDC  424
            Q EL RLR+  P   IIYADYYNA +RL   P+KYGF N  + ACCG G PYN++    C
Sbjct  269  QAELKRLRKLNPHVNIIYADYYNALLRLNQEPTKYGFINKPLSACCGVGEPYNFNFSTCC  328

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGECIFRSPKTK  256
            GS     C++PS Y++WDG H+TEAAYK+IADGLLKGPYT+P  N  C+    K K
Sbjct  329  GSFGVDSCNDPSMYVAWDGIHMTEAAYKFIADGLLKGPYTSPPFNWTCLTSKIKNK  384



>gb|AAG60153.1|AC074360_18 lipase, putative [Arabidopsis thaliana]
Length=391

 Score =   203 bits (516),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 94/176 (53%), Positives = 119/176 (68%), Gaps = 1/176 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++ ELI  G +  +VPG FP+GCS ++LT   T+N  EYDP TGCL WLN F EYH+  L
Sbjct  205  AITELIGMGGRTFLVPGGFPLGCSVAFLTLHQTSNMEEYDPLTGCLKWLNKFGEYHSEQL  264

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNT-VVACCGGGGPYNYDGLVDC  424
            Q EL+RLR+  P   IIYADYYNA++RL   PSKYGF N  + ACCG GGPYN++    C
Sbjct  265  QEELNRLRKLNPHVNIIYADYYNASLRLGREPSKYGFINRHLSACCGVGGPYNFNLSRSC  324

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGECIFRSPKTK  256
            GS     C +PS Y++WDG H+TEAA+K +ADGL+KGPY  P  +  C+    K K
Sbjct  325  GSVGVEACSDPSKYVAWDGLHMTEAAHKSMADGLVKGPYAIPPFDWSCLSSMIKKK  380



>ref|XP_008777734.1| PREDICTED: GDSL esterase/lipase At1g28570-like [Phoenix dactylifera]
Length=387

 Score =   202 bits (515),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 90/167 (54%), Positives = 122/167 (73%), Gaps = 1/167 (1%)
 Frame = -2

Query  777  VNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLLQ  598
            +++LI+ GA+  +VPG FP GC ++YLT F + +  +YDP TGC+ W+N+FS YHN LLQ
Sbjct  221  IDDLIKLGAKTFVVPGIFPSGCVSTYLTAFQSEDAEDYDPDTGCIRWVNEFSAYHNHLLQ  280

Query  597  NELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNTVV-ACCGGGGPYNYDGLVDCG  421
            NELDRLR  +P  TIIYADYY A M +++SP K+GFK   + ACCGGGGPYN +  + CG
Sbjct  281  NELDRLRRLHPHVTIIYADYYEALMSIFHSPQKFGFKKAPLDACCGGGGPYNVNFSLLCG  340

Query  420  SASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGEC  280
            +  +TVC +PS ++ WDG+HLT+AA + +A GLL+GPY  P I   C
Sbjct  341  APMTTVCRDPSMFVFWDGTHLTDAASEIVARGLLEGPYADPPIIQTC  387



>gb|EEE55084.1| hypothetical protein OsJ_02825 [Oryza sativa Japonica Group]
Length=254

 Score =   199 bits (505),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 87/163 (53%), Positives = 115/163 (71%), Gaps = 0/163 (0%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++ ELI  GA+ ++VPGN PIGC  +YL  F +    +Y+P+ GCL W+N+FS+YHN+LL
Sbjct  67   TITELIGLGAKTLVVPGNLPIGCIPTYLMQFESDKKEDYEPEIGCLRWMNEFSQYHNKLL  126

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGLVDCG  421
             +EL+ LR+ +PD  IIY DYY AAM ++ SP ++G ++ +VACCGGGGPY       CG
Sbjct  127  IDELENLRKLHPDVAIIYTDYYGAAMEIFLSPEQFGIEDPLVACCGGGGPYGVSASAGCG  186

Query  420  SASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQI  292
                 VCD+PS Y SWDG H +EAAYK IA GLL+GPYT P I
Sbjct  187  YGEYKVCDDPSKYASWDGFHPSEAAYKGIAIGLLQGPYTQPPI  229



>ref|NP_001031122.1| GDSL esterase/lipase [Arabidopsis thaliana]
 sp|Q9C857.1|GDL16_ARATH RecName: Full=GDSL esterase/lipase At1g31550; AltName: Full=Extracellular 
lipase At1g31550; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAG51269.1|AC027135_10 unknown protein [Arabidopsis thaliana]
 gb|AEE31372.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=394

 Score =   202 bits (515),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 94/176 (53%), Positives = 119/176 (68%), Gaps = 1/176 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++ ELI  G +  +VPG FP+GCS ++LT   T+N  EYDP TGCL WLN F EYH+  L
Sbjct  208  AITELIGMGGRTFLVPGGFPLGCSVAFLTLHQTSNMEEYDPLTGCLKWLNKFGEYHSEQL  267

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNT-VVACCGGGGPYNYDGLVDC  424
            Q EL+RLR+  P   IIYADYYNA++RL   PSKYGF N  + ACCG GGPYN++    C
Sbjct  268  QEELNRLRKLNPHVNIIYADYYNASLRLGREPSKYGFINRHLSACCGVGGPYNFNLSRSC  327

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGECIFRSPKTK  256
            GS     C +PS Y++WDG H+TEAA+K +ADGL+KGPY  P  +  C+    K K
Sbjct  328  GSVGVEACSDPSKYVAWDGLHMTEAAHKSMADGLVKGPYAIPPFDWSCLSSMIKKK  383



>dbj|BAD95190.1| hypothetical protein [Arabidopsis thaliana]
Length=394

 Score =   202 bits (515),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 94/176 (53%), Positives = 119/176 (68%), Gaps = 1/176 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++ ELI  G +  +VPG FP+GCS ++LT   T+N  EYDP TGCL WLN F EYH+  L
Sbjct  208  AITELIGMGGRTFLVPGGFPLGCSVAFLTLHQTSNMEEYDPLTGCLKWLNKFGEYHSEQL  267

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNT-VVACCGGGGPYNYDGLVDC  424
            Q EL+RLR+  P   IIYADYYNA++RL   PSKYGF N  + ACCG GGPYN++    C
Sbjct  268  QEELNRLRKLNPHVNIIYADYYNASLRLGREPSKYGFINRHLSACCGVGGPYNFNLSRSC  327

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGECIFRSPKTK  256
            GS     C +PS Y++WDG H+TEAA+K +ADGL+KGPY  P  +  C+    K K
Sbjct  328  GSVGVEACSDPSKYVAWDGLHMTEAAHKSMADGLVKGPYAIPPFDWSCLSSMIKKK  383



>ref|XP_003542992.1| PREDICTED: GDSL esterase/lipase At1g28580-like [Glycine max]
Length=376

 Score =   202 bits (513),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 95/170 (56%), Positives = 126/170 (74%), Gaps = 3/170 (2%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++NELI  GA+ ++VPGN PIGCS  YLT + T + ++YD + GCL WLN+F EY+N  L
Sbjct  201  AINELIGLGARTLMVPGNLPIGCSVIYLTIYETIDKTQYD-QFGCLKWLNEFGEYYNHKL  259

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGLVDCG  421
            Q+ELD+LR  +P   IIYADYYNAA+ LY  P+K+GF +  + CCG GGPYN++ L +CG
Sbjct  260  QSELDKLRVFHPRANIIYADYYNAALPLYRDPTKFGFTDLKI-CCGMGGPYNFNKLTNCG  318

Query  420  SASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGECIFR  271
            + S   CD+PS +I WDG HLTEAAY++IA GL+KGPY+ PQ +  C FR
Sbjct  319  NPSVIACDDPSKHIGWDGVHLTEAAYRFIAKGLIKGPYSLPQFSTLC-FR  367



>gb|KHN08454.1| GDSL esterase/lipase [Glycine soja]
Length=709

 Score =   209 bits (531),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 96/169 (57%), Positives = 119/169 (70%), Gaps = 2/169 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++ ELI+ GA   +VPG+ P+GC+ +YLT F T +  EYD + GCL WLN F EYHN LL
Sbjct  524  AIRELIDLGAVTFMVPGSLPLGCNPAYLTIFATIDKEEYD-QAGCLKWLNTFYEYHNELL  582

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFK-NTVVACCGGGGPYNYDGLVDC  424
            Q E++RLR  YP T IIYADY+NAA+  YNSP ++GF  N +  CCGGGGPYNY+    C
Sbjct  583  QIEINRLRVLYPLTNIIYADYFNAALEFYNSPEQFGFGGNVLKVCCGGGGPYNYNETAMC  642

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGECI  277
            G A    CD+PS Y+SWDG HLTEAAY+W+  GLL GPYT P+ N  C 
Sbjct  643  GDAGVVACDDPSQYVSWDGYHLTEAAYRWMTKGLLDGPYTIPKFNVSCF  691


 Score =   172 bits (436),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 89/190 (47%), Positives = 120/190 (63%), Gaps = 14/190 (7%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            +VNELI  GA+ +IVPGN P+GCS +YLT + T + ++YD + GCL WLN F+EY+N+ L
Sbjct  203  AVNELIGLGARTLIVPGNIPLGCSITYLTIYETMDKNQYD-QYGCLKWLNKFAEYYNQKL  261

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGLVDCG  421
            Q+EL RL+  +    IIYADYYNA + LY  P+ +GF N +  CCG GGPYNY+   DCG
Sbjct  262  QSELHRLQGLHSHANIIYADYYNAILSLYRDPTMFGFTN-LKTCCGMGGPYNYNASADCG  320

Query  420  SASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGP----YTTPQINGECI--------  277
                  CD+PS +I WDG HLTEAAY+ IA   L       + +P+ + +C+        
Sbjct  321  DPGVNACDDPSKHIGWDGVHLTEAAYRIIAQDSLTDTGNLYFISPRQSPDCLLPPYGQTH  380

Query  276  FRSPKTKLSD  247
            F  P  + SD
Sbjct  381  FHRPNGRCSD  390



>ref|XP_009607101.1| PREDICTED: GDSL esterase/lipase At1g28580-like [Nicotiana tomentosiformis]
Length=398

 Score =   202 bits (514),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 95/179 (53%), Positives = 128/179 (72%), Gaps = 2/179 (1%)
 Frame = -2

Query  777  VNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLLQ  598
             +EL+E GA+ I+VP   P+GC++SYLT++ + N  +YD + GCL W N F+ +HN+LLQ
Sbjct  211  AHELVELGAKTIMVPSVLPLGCTSSYLTYYQSWNEEDYD-ELGCLIWPNHFATHHNQLLQ  269

Query  597  NELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGF-KNTVVACCGGGGPYNYDGLVDCG  421
             EL RLRE  P   IIYADYYNAAM+LY +PSKYGF K  +V CCG GGPYN++    CG
Sbjct  270  RELHRLREINPHVNIIYADYYNAAMQLYRAPSKYGFLKGGLVTCCGAGGPYNFNPFAQCG  329

Query  420  SASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGECIFRSPKTKLSDS  244
            +  +T C++P+ YI+WDG HLTEAAYKW+   LL+GP+T P IN  C F   + ++S +
Sbjct  330  NYPATSCEDPNQYINWDGYHLTEAAYKWMTKSLLEGPFTNPPINSFCPFDISEAQVSKN  388



>ref|XP_009352806.1| PREDICTED: GDSL esterase/lipase At1g28600-like [Pyrus x bretschneideri]
Length=373

 Score =   202 bits (513),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 91/169 (54%), Positives = 120/169 (71%), Gaps = 1/169 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++NELI+HGA  ++VPGNFPIGC+++YLT +  ++ SEYDP TGCL WLN FSEYHN LL
Sbjct  202  AINELIQHGASTLLVPGNFPIGCTSAYLTLYEGSDESEYDPSTGCLTWLNKFSEYHNELL  261

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGF-KNTVVACCGGGGPYNYDGLVDC  424
            + +L ++R  +P   IIY D YNA ++LY SP ++GF +NT  ACCGGGG YNY+    C
Sbjct  262  KTKLSQIRSLHPHVNIIYGDVYNAELQLYQSPEQFGFTENTSRACCGGGGTYNYNLSAPC  321

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGECI  277
            G   ++ C NP+  I+WDG H TEAA +WI   LL G YT P I+  C+
Sbjct  322  GLRGASACANPAKSINWDGRHTTEAANQWITKALLNGIYTIPHISTSCV  370



>ref|XP_008812188.1| PREDICTED: GDSL esterase/lipase At1g28570-like [Phoenix dactylifera]
Length=377

 Score =   202 bits (513),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 93/163 (57%), Positives = 116/163 (71%), Gaps = 0/163 (0%)
 Frame = -2

Query  768  LIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLLQNEL  589
            LI+ GA+ ++VPGNFPIGC   YL  F  ++   YDP+TGC+NWLN FSEYHNRLL +EL
Sbjct  189  LIDLGAKTLVVPGNFPIGCVPLYLALFQNSSKGNYDPQTGCINWLNKFSEYHNRLLMDEL  248

Query  588  DRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGLVDCGSASS  409
            ++LR+ +PD TIIYA+YY A + +  SP +YG + T  ACCG  GP N    V CG  ++
Sbjct  249  NKLRQLHPDATIIYANYYEALLSIVRSPGQYGIEVTEAACCGPSGPVNVTSPVLCGDPAA  308

Query  408  TVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGEC  280
            TVC +PS YISWDG HLTEAAY  IA GLL+GPYT P +   C
Sbjct  309  TVCSDPSKYISWDGVHLTEAAYGNIARGLLEGPYTAPPMIRAC  351



>ref|XP_004248464.1| PREDICTED: GDSL esterase/lipase At1g28610-like isoform X1 [Solanum 
lycopersicum]
Length=378

 Score =   202 bits (513),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 91/177 (51%), Positives = 127/177 (72%), Gaps = 2/177 (1%)
 Frame = -2

Query  774  NELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLLQN  595
            +EL+E GA+ IIVP   P+GCS+SYLT+F + N  +YD + GCL W N+ + YHN LLQ 
Sbjct  202  HELVELGARTIIVPSVLPLGCSSSYLTNFESLNEEDYD-ELGCLIWPNELASYHNELLQK  260

Query  594  ELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGF-KNTVVACCGGGGPYNYDGLVDCGS  418
            EL RLRE +P   IIYADYYNA+M++Y +P KYGF K+ +VACCGGGGPYN++    CG+
Sbjct  261  ELHRLRELHPHVNIIYADYYNASMKIYRAPRKYGFLKSVLVACCGGGGPYNFNVSAQCGT  320

Query  417  ASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGECIFRSPKTKLSD  247
            + +T C++P  Y++WDG H +EAAYKWI   LL+G ++ P +   C+F   + ++S 
Sbjct  321  SQATSCEDPKQYVNWDGYHFSEAAYKWITKSLLEGLFSYPPMKNLCLFDVVEAQVSQ  377



>ref|XP_010460655.1| PREDICTED: GDSL esterase/lipase At1g28610-like [Camelina sativa]
Length=414

 Score =   202 bits (515),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 88/170 (52%), Positives = 120/170 (71%), Gaps = 2/170 (1%)
 Frame = -2

Query  783  FSVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRL  604
            F + EL++ G + I+VP +FPIGC  ++LT +  +N  EYDP TGCL WLN+F EYHN+ 
Sbjct  210  FMITELVKMGGKTIMVPADFPIGCWTAFLTEYRISNNEEYDPLTGCLKWLNEFIEYHNKE  269

Query  603  LQNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKN--TVVACCGGGGPYNYDGLV  430
            LQ EL+R+++ YP  TIIYADYYNA +R++  P+K+GF +   + A CG GGPYN++ + 
Sbjct  270  LQEELNRVQKIYPHVTIIYADYYNALLRIFQEPAKFGFTSGRPLSAFCGTGGPYNFNSMS  329

Query  429  DCGSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGEC  280
             CG+     C +PS Y+ WDG HLTE+AY+WIA G LKGPYT P  +  C
Sbjct  330  WCGTKKVDSCSDPSKYVHWDGFHLTESAYRWIAMGFLKGPYTIPAYDWSC  379



>ref|XP_010462954.1| PREDICTED: uncharacterized protein LOC104743592 [Camelina sativa]
Length=799

 Score =   208 bits (530),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 95/178 (53%), Positives = 123/178 (69%), Gaps = 1/178 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            +  EL+  G +  +VPGNFP+GCSA+YLT + T+N  EYDP TGCL WLNDF +YH+  L
Sbjct  209  ATTELVRMGGRTFLVPGNFPLGCSAAYLTLYQTSNKEEYDPLTGCLTWLNDFGKYHSEQL  268

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGF-KNTVVACCGGGGPYNYDGLVDC  424
            Q EL+RL+  YP+  IIYADYYNA + LY  P+K+GF K  + ACCG GG YN++    C
Sbjct  269  QTELNRLKNLYPNVNIIYADYYNALLCLYQEPTKFGFIKRPLPACCGLGGLYNFNFTRKC  328

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGECIFRSPKTKLS  250
            GS     C++PS Y++WDG H+TEAAY+WI++GLL GPY  P  N  C+    K K S
Sbjct  329  GSLGVESCNDPSKYVNWDGIHMTEAAYRWISEGLLNGPYAIPPFNWSCLNSKIKKKKS  386


 Score =   188 bits (477),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 84/165 (51%), Positives = 110/165 (67%), Gaps = 1/165 (1%)
 Frame = -2

Query  768  LIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLLQNEL  589
            LI  G +  +VPG FP GCS  YLT +  +N  EYDP TGCL WLN + E H   L+ EL
Sbjct  620  LISMGGRTFLVPGGFPTGCSVVYLTLYQKSNVDEYDPLTGCLTWLNKYGENHGEQLRVEL  679

Query  588  DRLREQYPDTTIIYADYYNAAMRLYNSPSKYGF-KNTVVACCGGGGPYNYDGLVDCGSAS  412
            +RL++ YP   IIYADYYNA +R+Y  P+K+GF K  + ACCG GGPYN+     CG+  
Sbjct  680  NRLQKLYPHVNIIYADYYNALLRIYQDPAKFGFMKRPLSACCGVGGPYNFTAGKKCGTDV  739

Query  411  STVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGECI  277
               C++PS Y++WDG HLTEAAY+ +A+G+L GPY  P  +  C+
Sbjct  740  VDSCNDPSKYVAWDGVHLTEAAYRLMAEGILNGPYAVPPFDWSCL  784



>ref|XP_010499707.1| PREDICTED: GDSL esterase/lipase At1g31550-like isoform X1 [Camelina 
sativa]
Length=396

 Score =   201 bits (512),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 96/176 (55%), Positives = 117/176 (66%), Gaps = 1/176 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++ ELI  G +  +VPG FPIGCS +YLT + T+N  EYDP TGCL W N F EYH+  L
Sbjct  210  AITELIGMGGRTFLVPGGFPIGCSVAYLTLYQTSNMEEYDPLTGCLKWPNKFGEYHSEQL  269

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKN-TVVACCGGGGPYNYDGLVDC  424
            Q EL RLR+  P   IIYADYYNA++ L   P+KY F N T+ ACCG G PYN+     C
Sbjct  270  QVELKRLRKLNPHVNIIYADYYNASLSLGQEPAKYRFINGTLSACCGVGKPYNFSFSQSC  329

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGECIFRSPKTK  256
            GS     C+NPS Y++WDG H+TEAA+K +ADGLLKGPY TP  N  C+    K K
Sbjct  330  GSVGVESCNNPSKYVAWDGIHMTEAAHKLMADGLLKGPYATPPFNWSCLSSKIKNK  385



>gb|EYU28060.1| hypothetical protein MIMGU_mgv1a008085mg [Erythranthe guttata]
Length=385

 Score =   201 bits (510),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 96/169 (57%), Positives = 124/169 (73%), Gaps = 5/169 (3%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANT-SEYDPKTGCLNWLNDFSEYHNRL  604
            ++ ELI+ G + ++VP   PIGC   YLT F  ++T  +YDPKTGCLNWLN+F+ YHN+L
Sbjct  207  TIQELIKLGVKTMLVPAIPPIGCLPVYLTQFKKSSTIRDYDPKTGCLNWLNEFARYHNKL  266

Query  603  LQNELDRLREQY-PDTT-IIYADYYNAAMRLYNSPSKYGF--KNTVVACCGGGGPYNYDG  436
            L+ EL+R++E   PD   IIYADYYNAAMR Y SP++YG   K  + ACCG GGPYNY+ 
Sbjct  267  LKKELNRIQELINPDQIDIIYADYYNAAMRFYLSPNEYGLSKKGILRACCGAGGPYNYNA  326

Query  435  LVDCGSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQIN  289
              +CGS+ +T CD+PSS+ SWDG H TEAAY+ IA GL  GPYTTP++ 
Sbjct  327  SAECGSSPATCCDDPSSFASWDGLHFTEAAYRLIAQGLFDGPYTTPRVK  375



>ref|NP_001172483.1| Os01g0649400 [Oryza sativa Japonica Group]
 dbj|BAH91213.1| Os01g0649400 [Oryza sativa Japonica Group]
Length=306

 Score =   198 bits (504),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 87/163 (53%), Positives = 115/163 (71%), Gaps = 0/163 (0%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++ ELI  GA+ ++VPGN PIGC  +YL  F +    +Y+P+ GCL W+N+FS+YHN+LL
Sbjct  119  TITELIGLGAKTLVVPGNLPIGCIPTYLMQFESDKKEDYEPEIGCLRWMNEFSQYHNKLL  178

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGLVDCG  421
             +EL+ LR+ +PD  IIY DYY AAM ++ SP ++G ++ +VACCGGGGPY       CG
Sbjct  179  IDELENLRKLHPDVAIIYTDYYGAAMEIFLSPEQFGIEDPLVACCGGGGPYGVSASAGCG  238

Query  420  SASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQI  292
                 VCD+PS Y SWDG H +EAAYK IA GLL+GPYT P I
Sbjct  239  YGEYKVCDDPSKYASWDGFHPSEAAYKGIAIGLLQGPYTQPPI  281



>ref|XP_010912659.1| PREDICTED: GDSL esterase/lipase At1g28650-like [Elaeis guineensis]
Length=387

 Score =   201 bits (510),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 91/168 (54%), Positives = 120/168 (71%), Gaps = 3/168 (2%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++N LI+ GA+ ++VPGNFPIGC + YL  F +    +YD +TGC+ WLN+F+EYHNRLL
Sbjct  207  AINVLIQLGAKTMVVPGNFPIGCVSRYLQTFQSQRKEDYDSETGCIKWLNEFAEYHNRLL  266

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKN-TVVACCGGGGPYNYDGLVDC  424
             +ELD LR+ +P  TIIYADYY A + ++  P+++GFK   + ACCG GGPYN    V C
Sbjct  267  VDELDHLRQLHPHVTIIYADYYEALLHIFRFPTQFGFKEPPLAACCGAGGPYNV--FVAC  324

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGEC  280
            G  ++TVC++PS Y+ WDG HLTEAAY  IA GLL+G Y TP I   C
Sbjct  325  GDRAATVCNDPSKYVCWDGIHLTEAAYGTIAQGLLEGSYATPPITQAC  372



>ref|XP_010912598.1| PREDICTED: GDSL esterase/lipase At1g28650-like isoform X1 [Elaeis 
guineensis]
Length=410

 Score =   201 bits (511),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 92/166 (55%), Positives = 118/166 (71%), Gaps = 2/166 (1%)
 Frame = -2

Query  777  VNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLLQ  598
            +++LI+ GA+ ++VPG FP GC   YLT   +    +YDP TGC+ W+N+FS YHN+LLQ
Sbjct  221  IDDLIKLGAKTLVVPGIFPSGCVPVYLTWMQSEIVEDYDPDTGCIKWVNEFSAYHNQLLQ  280

Query  597  NELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGLVDCGS  418
            NELDR+R  +P  TIIYADYY A M ++ SP K+GF+    ACCGGGGP N    + CG 
Sbjct  281  NELDRIRRLHPHVTIIYADYYEALMSVFRSPEKFGFEKPFDACCGGGGPNN--CAIQCGD  338

Query  417  ASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGEC  280
               TVC +PS Y+SWDGSHLTEAAY+ IA GLL+G YTTP ++  C
Sbjct  339  PGFTVCSDPSKYVSWDGSHLTEAAYRAIALGLLQGSYTTPSMSRAC  384



>emb|CDY30819.1| BnaC05g21950D [Brassica napus]
Length=397

 Score =   201 bits (510),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 86/167 (51%), Positives = 119/167 (71%), Gaps = 1/167 (1%)
 Frame = -2

Query  777  VNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLLQ  598
            + EL+  G + I+VP + PIGC  S+LT + T+N  EY+P TGCLNWLN+F E+HN+ LQ
Sbjct  211  ITELVHMGGRTIMVPTDLPIGCWTSFLTQYQTSNQEEYNPLTGCLNWLNEFVEHHNKELQ  270

Query  597  NELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNT-VVACCGGGGPYNYDGLVDCG  421
             EL+RL++ YP  TI+YADYYNA + ++  P+++GF N  + ACCG GGPYN++    CG
Sbjct  271  EELNRLQKLYPHVTILYADYYNALLHIFQEPARFGFMNRPLSACCGTGGPYNFNNGSQCG  330

Query  420  SASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGEC  280
            +     C +PS Y+ WDG HLTE+AY+W+A GLL+GPYT P  +  C
Sbjct  331  TKGVDCCTDPSKYVHWDGFHLTESAYRWVAMGLLEGPYTLPAFDWSC  377



>ref|XP_009113646.1| PREDICTED: GDSL esterase/lipase At1g28580-like [Brassica rapa]
 emb|CDY34093.1| BnaA09g27190D [Brassica napus]
Length=397

 Score =   201 bits (510),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 86/167 (51%), Positives = 119/167 (71%), Gaps = 1/167 (1%)
 Frame = -2

Query  777  VNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLLQ  598
            + EL+  G + I+VP + PIGC  S+LT + T+N  EY+P TGCLNWLN+F E+HN+ LQ
Sbjct  211  ITELVHMGGRTIMVPTDLPIGCWTSFLTQYQTSNQEEYNPLTGCLNWLNEFVEHHNKELQ  270

Query  597  NELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNT-VVACCGGGGPYNYDGLVDCG  421
             EL+RL++ YP  TI+YADYYNA + ++  P+++GF N  + ACCG GGPYN++    CG
Sbjct  271  EELNRLQKLYPHVTILYADYYNALLHIFQEPARFGFVNRPLSACCGTGGPYNFNNGSQCG  330

Query  420  SASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGEC  280
            +     C +PS Y+ WDG HLTE+AY+W+A GLL+GPYT P  +  C
Sbjct  331  TKGVDCCTDPSKYVHWDGFHLTESAYRWVAMGLLEGPYTLPAFDWSC  377



>gb|AAF24548.2|AC007508_11 F1K23.17 [Arabidopsis thaliana]
Length=823

 Score =   207 bits (527),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 91/169 (54%), Positives = 116/169 (69%), Gaps = 1/169 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++ ELI  G +  +VPG FPIGCS  YLT + T+N  EYDP TGCL WLN F EYH+  L
Sbjct  203  TITELIGMGGKTFLVPGEFPIGCSVVYLTLYKTSNKDEYDPSTGCLKWLNKFGEYHSEKL  262

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGF-KNTVVACCGGGGPYNYDGLVDC  424
            + EL+RLR+ YP   IIYADYYN+ +R++  P+K+GF +    ACCG GGPYN++    C
Sbjct  263  KVELNRLRKLYPHVNIIYADYYNSLLRIFKEPAKFGFMERPFPACCGIGGPYNFNFTRKC  322

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGECI  277
            GS     C +PS Y+ WDG H+TEAAYKWIADG+L GPY  P  +  C+
Sbjct  323  GSVGVKSCKDPSKYVGWDGVHMTEAAYKWIADGILNGPYANPPFDRSCL  371


 Score =   204 bits (519),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 96/178 (54%), Positives = 124/178 (70%), Gaps = 1/178 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++ EL+  G +  +VPGNFPIG SASYLT + T+N  EYDP TGCL WLNDFSEY+N+ L
Sbjct  629  AITELVCMGGRTFLVPGNFPIGYSASYLTLYKTSNKEEYDPLTGCLKWLNDFSEYYNKQL  688

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNT-VVACCGGGGPYNYDGLVDC  424
            Q EL+ LR+ YP   IIYADYYNA +RL+  P+K+GF N  + ACCG GG YN++    C
Sbjct  689  QEELNGLRKLYPHVNIIYADYYNALLRLFQEPAKFGFMNRPLPACCGVGGSYNFNFSRRC  748

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGECIFRSPKTKLS  250
            GS     CD+PS Y+++DG H+TEAAY+ I++GLLKGPY  P     C+      K+S
Sbjct  749  GSVGVEYCDDPSQYVNYDGIHMTEAAYRLISEGLLKGPYAIPPFKWSCLSSEIMNKMS  806



>emb|CDM83549.1| unnamed protein product [Triticum aestivum]
Length=389

 Score =   200 bits (509),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 85/164 (52%), Positives = 119/164 (73%), Gaps = 0/164 (0%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++ EL+E GA+ ++VPGN PIGC  +YLT +M+    +Y+P+TGC+ W+N+FS+YHN+LL
Sbjct  203  TIAELVELGAKTLLVPGNLPIGCIPAYLTTYMSDKMEDYEPETGCIRWMNEFSQYHNKLL  262

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGLVDCG  421
             +EL+ LR+ +P   IIYADYY AAM +++SP ++G ++ ++ACCGGGGPY       CG
Sbjct  263  VDELENLRKLHPGVVIIYADYYGAAMEIFSSPEQFGIEDPLMACCGGGGPYGVSATAGCG  322

Query  420  SASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQIN  289
                 VCD+P  Y SWDG H TEA YK IA+GLL+G YT P I+
Sbjct  323  HGDYKVCDDPQEYASWDGFHPTEATYKGIANGLLRGSYTQPPIS  366



>ref|XP_010478618.1| PREDICTED: GDSL esterase/lipase At1g31550-like [Camelina sativa]
Length=396

 Score =   200 bits (509),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 96/176 (55%), Positives = 118/176 (67%), Gaps = 2/176 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++ ELI  G +  +VPG FP GCS +YLT + T+N +EYD   GCL WLN FSEYH+  L
Sbjct  210  AITELIGMGGRTFLVPGEFPKGCSVAYLTLYQTSNLAEYD-SLGCLKWLNKFSEYHDEQL  268

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGF-KNTVVACCGGGGPYNYDGLVDC  424
            Q EL RLR+  P   II+ADYYN  +RL   PSKYGF K  + ACCG GGPYN++    C
Sbjct  269  QAELKRLRKLNPHVNIIFADYYNTLLRLNQEPSKYGFTKEPLYACCGVGGPYNFNFNTKC  328

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGECIFRSPKTK  256
            GS     C++PS Y++WDG H+TEAAYK +ADGLLKGPY TP  N  C+    K K
Sbjct  329  GSVEVESCNDPSKYVAWDGIHMTEAAYKSMADGLLKGPYATPPFNWSCLSSKIKNK  384



>ref|XP_010460979.1| PREDICTED: GDSL esterase/lipase At1g31550-like [Camelina sativa]
Length=387

 Score =   200 bits (508),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 95/176 (54%), Positives = 117/176 (66%), Gaps = 1/176 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++ ELI  G +  +VPG FPIGCS +YLT + T+N  EYDP TGCL W N F EYH+  L
Sbjct  201  AITELIGMGGRTFLVPGGFPIGCSVAYLTLYQTSNMEEYDPLTGCLKWPNKFGEYHSEQL  260

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKN-TVVACCGGGGPYNYDGLVDC  424
            Q E+ RLR+  P   IIYADYYNA++ L   P+KY F N T+ ACCG G PYN+     C
Sbjct  261  QVEIKRLRKLNPHVNIIYADYYNASLSLGQEPAKYRFINGTLSACCGVGRPYNFSFSQSC  320

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGECIFRSPKTK  256
            GS     C++PS Y++WDG H+TEAAYK +ADGLLKGPY TP  N  C+    K K
Sbjct  321  GSVGVESCNDPSKYVAWDGIHMTEAAYKLMADGLLKGPYATPPFNWSCLSSKIKNK  376



>ref|XP_009393075.1| PREDICTED: GDSL esterase/lipase At1g28580-like [Musa acuminata 
subsp. malaccensis]
Length=410

 Score =   200 bits (509),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 93/178 (52%), Positives = 126/178 (71%), Gaps = 5/178 (3%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            +++ELIE GA+ ++VPG  P+GC+++YLT++ T    +YD  TGCL WLN+FS YHN  L
Sbjct  227  AIDELIELGARTLLVPGITPLGCNSAYLTYYRTHQAEDYDSTTGCLKWLNEFSMYHNGRL  286

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGF-KNTVVACCGGGGPYNYDGLVDC  424
            Q EL RL++ +P  TIIYADYY A+M ++++P+ +GF +  +VACCGGGGPYNY+    C
Sbjct  287  QAELRRLQQLHPHATIIYADYYGASMSIFSNPNAFGFGEEPLVACCGGGGPYNYNFSRQC  346

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGECIFRSPKTKLS  250
            GS  STVC +PS Y+ WDG H+TEA Y+ IA GLL GP+  P I   C    P  +LS
Sbjct  347  GSEGSTVCGDPSRYVHWDGLHMTEATYRSIASGLLHGPFAAPAIGSTC----PNIQLS  400



>ref|XP_010499708.1| PREDICTED: GDSL esterase/lipase At1g31550-like isoform X2 [Camelina 
sativa]
Length=379

 Score =   199 bits (507),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 96/173 (55%), Positives = 115/173 (66%), Gaps = 1/173 (1%)
 Frame = -2

Query  771  ELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLLQNE  592
            ELI  G +  +VPG FPIGCS +YLT + T+N  EYDP TGCL W N F EYH+  LQ E
Sbjct  196  ELIGMGGRTFLVPGGFPIGCSVAYLTLYQTSNMEEYDPLTGCLKWPNKFGEYHSEQLQVE  255

Query  591  LDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKN-TVVACCGGGGPYNYDGLVDCGSA  415
            L RLR+  P   IIYADYYNA++ L   P+KY F N T+ ACCG G PYN+     CGS 
Sbjct  256  LKRLRKLNPHVNIIYADYYNASLSLGQEPAKYRFINGTLSACCGVGKPYNFSFSQSCGSV  315

Query  414  SSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGECIFRSPKTK  256
                C+NPS Y++WDG H+TEAA+K +ADGLLKGPY TP  N  C+    K K
Sbjct  316  GVESCNNPSKYVAWDGIHMTEAAHKLMADGLLKGPYATPPFNWSCLSSKIKNK  368



>ref|XP_010501635.1| PREDICTED: uncharacterized protein LOC104778925 [Camelina sativa]
Length=815

 Score =   206 bits (525),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 93/178 (52%), Positives = 123/178 (69%), Gaps = 1/178 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++ EL+  G +  +VPGNFP+GCSA+YLT + T+N  +YDP TGCL WLNDF +YH+  L
Sbjct  209  AITELVRMGGRTFLVPGNFPLGCSAAYLTLYQTSNKEKYDPLTGCLTWLNDFGKYHSEQL  268

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGF-KNTVVACCGGGGPYNYDGLVDC  424
            Q EL+RL+   P+  IIYADYYNA +RLY  P+K+GF K  + ACCG GG YN++    C
Sbjct  269  QTELNRLKNLNPNVNIIYADYYNALLRLYQEPTKFGFIKRPLPACCGLGGLYNFNFTRKC  328

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGECIFRSPKTKLS  250
            GS     C +PS +++WDG H+TEAAY+WI++GLL GPY  P  N  C+    K K S
Sbjct  329  GSLGVESCIDPSEFVNWDGIHMTEAAYRWISEGLLNGPYAIPPFNWSCLNSKIKNKKS  386


 Score =   194 bits (492),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 86/169 (51%), Positives = 114/169 (67%), Gaps = 1/169 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++ ELI  G +  +VPG FP GCS  YLT +  +N  EYDP TGCL WLN F + H   L
Sbjct  619  AITELISMGGRTFLVPGGFPTGCSVVYLTLYQKSNVEEYDPLTGCLTWLNKFGKNHGEQL  678

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNT-VVACCGGGGPYNYDGLVDC  424
            + EL+RL++ YP   IIYADYYNA +R+Y  P+K+GF +  + ACCG GGP+N+     C
Sbjct  679  RVELNRLQKLYPHVNIIYADYYNALLRIYQDPAKFGFMDRPLSACCGVGGPHNFTAGNKC  738

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGECI  277
            G+     CD+PS Y++WDG HLTEAAY+ IA+G+LKGPY  P  +  C+
Sbjct  739  GTVVVESCDDPSKYVAWDGVHLTEAAYRLIAEGILKGPYAVPPFDWFCL  787



>ref|XP_009416172.1| PREDICTED: GDSL esterase/lipase At1g28570-like [Musa acuminata 
subsp. malaccensis]
Length=390

 Score =   199 bits (507),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 89/167 (53%), Positives = 117/167 (70%), Gaps = 11/167 (7%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++ +LI+ GA+ ++VPGN PIGC   YLT F T    +YD KTGC+ WLN+FS+YHNRLL
Sbjct  200  AITDLIKLGAKNLVVPGNLPIGCVPVYLTQFQTQKLDDYDAKTGCIRWLNEFSQYHNRLL  259

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGLVDCG  421
            Q+E++R+R  +P+ TI YADYY +AMRL+ SP ++GFK  + ACC           V CG
Sbjct  260  QDEIERVRGLHPNATIAYADYYESAMRLFESPKQFGFKEPLSACC-----------VGCG  308

Query  420  SASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGEC  280
              S+ +C +PSSY SWDG HLTEAAY+ IA+GLLKGP   P +N  C
Sbjct  309  GPSAKLCSDPSSYASWDGLHLTEAAYRTIANGLLKGPLAVPSLNQTC  355



>ref|XP_010478903.1| PREDICTED: GDSL esterase/lipase At1g31550 [Camelina sativa]
Length=395

 Score =   199 bits (507),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 93/169 (55%), Positives = 117/169 (69%), Gaps = 1/169 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++ ELI  G +  +VPG FPIGCS ++LT + T+N  EYDP TGCL W N F EYH+  L
Sbjct  209  AITELIGMGGRTFLVPGGFPIGCSVAFLTLYQTSNMEEYDPLTGCLKWPNKFGEYHSEQL  268

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKN-TVVACCGGGGPYNYDGLVDC  424
            Q EL+RLR+  P   IIYADYYNA++ L   P+KY F N T+ ACCG G PYN+     C
Sbjct  269  QVELNRLRKLNPHVNIIYADYYNASLSLGQEPAKYRFINGTLSACCGVGRPYNFSFSQSC  328

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGECI  277
            GSA    C++PS Y++WDG H+TEAA+K +ADGLLKGPY TP  N  C+
Sbjct  329  GSAGVKSCNDPSKYVAWDGIHMTEAAHKLMADGLLKGPYATPPFNWSCL  377



>ref|XP_010460977.1| PREDICTED: GDSL esterase/lipase At1g31550-like [Camelina sativa]
Length=180

 Score =   192 bits (489),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 92/168 (55%), Positives = 112/168 (67%), Gaps = 1/168 (1%)
 Frame = -2

Query  756  GAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLLQNELDRLR  577
            G +  +VPG FPIGCS +YLT + T+N  EYDP TGCL W N F EYH+  LQ E+ RLR
Sbjct  2    GGRTFLVPGGFPIGCSVAYLTLYQTSNMEEYDPLTGCLKWPNKFGEYHSEQLQVEIKRLR  61

Query  576  EQYPDTTIIYADYYNAAMRLYNSPSKYGFKN-TVVACCGGGGPYNYDGLVDCGSASSTVC  400
            +  P   IIYADYYNA++ L   P+KY F N T+ ACCG G PYN+     CGS     C
Sbjct  62   KLNPHVNIIYADYYNASLSLGQEPAKYRFINGTLSACCGVGRPYNFSFSQSCGSVGVESC  121

Query  399  DNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGECIFRSPKTK  256
            ++PS Y++WDG H+TEAAYK +ADGLLKGPY TP  N  C+    K K
Sbjct  122  NDPSKYVAWDGIHMTEAAYKLMADGLLKGPYATPPFNWSCLSSKIKNK  169



>ref|XP_007025435.1| GDSL-like Lipase/Acylhydrolase superfamily protein, putative 
[Theobroma cacao]
 gb|EOY28057.1| GDSL-like Lipase/Acylhydrolase superfamily protein, putative 
[Theobroma cacao]
Length=343

 Score =   198 bits (503),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 88/167 (53%), Positives = 119/167 (71%), Gaps = 0/167 (0%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++ EL++ GA  I+VPGN PIGC   YLT F T+N  +Y   TGCL WLNDFS+Y+N +L
Sbjct  169  AIQELMKLGAVTILVPGNLPIGCLPIYLTRFQTSNKQDYGRSTGCLTWLNDFSQYYNGML  228

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGLVDCG  421
            +NEL+++R+ +P   I+YADYY AA+  Y SP ++GF +T+ ACCGGGGPYN++  + CG
Sbjct  229  KNELNKIRKLHPFANIVYADYYQAAIPFYRSPRQFGFNSTLTACCGGGGPYNFNLSLGCG  288

Query  420  SASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGEC  280
            S  +T C +PSSY+SWDG HLTEA Y  I+  LL G  T P++   C
Sbjct  289  SPGTTSCGDPSSYVSWDGIHLTEATYGLISKALLDGSSTIPRLKILC  335



>gb|KCW45468.1| hypothetical protein EUGRSUZ_L00817 [Eucalyptus grandis]
Length=398

 Score =   199 bits (506),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 94/168 (56%), Positives = 119/168 (71%), Gaps = 2/168 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            +++ELI+ GA  I+VPGNFPIGC   YLT F  ++   YD  TGCLNWLN+FS+YHN  L
Sbjct  218  AISELIDLGAVMILVPGNFPIGCLPIYLTEFQGSDKEAYDSSTGCLNWLNEFSQYHNEQL  277

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNTVV-ACCGGGGPYNYDGLVDC  424
            Q +L+ LRE +P   IIY DYYNAA+R Y SP K+GF   V+ ACCGG G YNY+ L  C
Sbjct  278  QRKLNHLRELHPRANIIYVDYYNAALRFYQSPDKFGFDGRVLRACCGGEGTYNYNILEPC  337

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGEC  280
             S ++ VCD+PSSY SWDG H TEAAY+WI  G+  G +T P+++  C
Sbjct  338  NS-NARVCDDPSSYASWDGIHFTEAAYRWIFKGVADGSFTVPKLDISC  384



>gb|EAY75182.1| hypothetical protein OsI_03072 [Oryza sativa Indica Group]
Length=310

 Score =   197 bits (500),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 87/164 (53%), Positives = 113/164 (69%), Gaps = 0/164 (0%)
 Frame = -2

Query  783  FSVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRL  604
             S  ELI  GA+ ++VPGN PIGC  +YL  F +    +Y+P+ GCL W+N+FS+YHN+L
Sbjct  122  LSSQELIGLGAKTLVVPGNLPIGCIPTYLMQFESDKKEDYEPEIGCLRWMNEFSQYHNKL  181

Query  603  LQNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGLVDC  424
              +EL+ LR+ +PD  IIY DYY AAM ++ SP ++G ++ +VACCGGGGPY       C
Sbjct  182  FIDELENLRKLHPDVAIIYTDYYGAAMEIFLSPEQFGIEDPLVACCGGGGPYGVSASAGC  241

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQI  292
            G     VCD+PS Y SWDG H +EAAYK IA GLL+GPYT P I
Sbjct  242  GYGEYKVCDDPSKYASWDGFHPSEAAYKGIAIGLLQGPYTQPPI  285



>ref|XP_010057069.1| PREDICTED: GDSL esterase/lipase At1g28580-like [Eucalyptus grandis]
 gb|KCW74053.1| hypothetical protein EUGRSUZ_E02673 [Eucalyptus grandis]
Length=400

 Score =   199 bits (506),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 94/168 (56%), Positives = 119/168 (71%), Gaps = 2/168 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            +++ELI+ GA  I+VPGNFPIGC   YLT F  ++   YD  TGCLNWLN+FS+YHN  L
Sbjct  220  AISELIDLGAVTILVPGNFPIGCLPIYLTEFQGSDMEAYDSSTGCLNWLNEFSQYHNEQL  279

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNTVV-ACCGGGGPYNYDGLVDC  424
            Q +L+ LRE +P   IIY DYYNAA+R Y SP K+GF   V+ ACCGG G YNY+ L  C
Sbjct  280  QRKLNHLRELHPRANIIYVDYYNAALRFYQSPDKFGFDGRVLRACCGGEGTYNYNILEPC  339

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGEC  280
             S ++ VCD+PSSY SWDG H TEAAY+WI  G+  G +T P+++  C
Sbjct  340  NS-NARVCDDPSSYASWDGIHFTEAAYRWIFKGVADGSFTVPKLDISC  386



>ref|XP_010499588.1| PREDICTED: GDSL esterase/lipase At1g28580-like [Camelina sativa]
Length=395

 Score =   199 bits (505),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 89/169 (53%), Positives = 116/169 (69%), Gaps = 1/169 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            S+ ELI  G +  +VPG+FP+GCSA YLT + T+N   YDP TGCL WLN F E H+  L
Sbjct  212  SITELIGMGGRTFLVPGDFPLGCSAIYLTSYQTSNMEAYDPLTGCLTWLNKFGENHDAQL  271

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNT-VVACCGGGGPYNYDGLVDC  424
            Q EL+RL++ YP   IIYADYYNA +R+Y  P+K+GF N  + ACCG GGPYN+     C
Sbjct  272  QAELNRLQKLYPHVNIIYADYYNALLRIYQEPTKFGFMNRPLSACCGVGGPYNFTSFWQC  331

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGECI  277
            G+     C +PS Y++WDG H+TEAAY  I++G+LKGPY  P  +  C+
Sbjct  332  GADVVEGCSDPSKYVTWDGVHMTEAAYSLISEGILKGPYAAPPFDWSCL  380



>ref|XP_002891138.1| carboxylic ester hydrolase/ lipase [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67397.1| carboxylic ester hydrolase/ lipase [Arabidopsis lyrata subsp. 
lyrata]
Length=394

 Score =   199 bits (505),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 92/176 (52%), Positives = 118/176 (67%), Gaps = 1/176 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++ ELI  G +  +VPG FP+GCS ++LT + T+N  EYDP TGCL WLN F EYH+  L
Sbjct  208  AITELIGMGGRTFLVPGGFPLGCSVAFLTLYQTSNVEEYDPLTGCLIWLNKFGEYHSEQL  267

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNT-VVACCGGGGPYNYDGLVDC  424
            + EL RLR+  P   IIYADYYNA++RL   P+KYGF N  + ACCG G PYN++    C
Sbjct  268  KEELKRLRQLNPHVNIIYADYYNASLRLGQEPTKYGFINRHLSACCGVGRPYNFNFSRSC  327

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGECIFRSPKTK  256
            GS     C++PS Y++WDG H+TEAA+K +ADGLL GPY  P  N  C+    K K
Sbjct  328  GSVGVESCNDPSKYVAWDGLHMTEAAHKSMADGLLNGPYAIPPFNWSCLSSKIKKK  383



>ref|XP_002893537.1| hypothetical protein ARALYDRAFT_473078 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69796.1| hypothetical protein ARALYDRAFT_473078 [Arabidopsis lyrata subsp. 
lyrata]
Length=390

 Score =   198 bits (504),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 89/169 (53%), Positives = 115/169 (68%), Gaps = 1/169 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++ ELI  G +  +VPG FP+GCS  YLT   T+N  EYDP TGCL WLN+F E H   L
Sbjct  210  AITELISMGGRTFLVPGEFPVGCSVFYLTSHQTSNMEEYDPLTGCLKWLNNFGENHGEQL  269

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNT-VVACCGGGGPYNYDGLVDC  424
            + EL RL++ YP   +IYADYYNA +RLY  P+K+GF N  + ACCG GGPYNY     C
Sbjct  270  RAELKRLQKLYPHVNVIYADYYNALLRLYQEPAKFGFMNRPLSACCGSGGPYNYTVGRKC  329

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGECI  277
            G+     C++PS Y++WDG HLTEAAY+ +A+G+LKGPY  P  +  C+
Sbjct  330  GTDIVESCNDPSKYVAWDGVHLTEAAYRLMAEGILKGPYAIPPFDWSCL  378



>ref|XP_009601721.1| PREDICTED: GDSL esterase/lipase At1g28600-like [Nicotiana tomentosiformis]
Length=389

 Score =   198 bits (504),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 93/169 (55%), Positives = 118/169 (70%), Gaps = 2/169 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++ ELIE GA  ++VPG+ PIGCS +YLT FM ++   YDPKTGC+NWLN F++++N LL
Sbjct  209  AIQELIELGASTLVVPGDLPIGCSTAYLTKFMHSDKENYDPKTGCINWLNHFAQHYNELL  268

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGF-KNTVVACCGGGGPYNYDGLVDC  424
            Q EL  LR+ +P  TIIYADYYNAAM+ Y SP  +GF K  + ACCG GGPYN+     C
Sbjct  269  QKELHLLRKLHPSATIIYADYYNAAMQFYVSPMSHGFTKGALDACCGAGGPYNFKFSAVC  328

Query  423  GS-ASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGEC  280
            G   +  +C + S Y SWDG H TEAAYKWIA GLL+G +T P +   C
Sbjct  329  GDPPARNICSDTSLYASWDGMHFTEAAYKWIARGLLEGTFTFPPLAKIC  377



>ref|XP_010040115.1| PREDICTED: uncharacterized protein LOC104428890 [Eucalyptus grandis]
Length=814

 Score =   205 bits (522),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 95/168 (57%), Positives = 123/168 (73%), Gaps = 2/168 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            +++ELI  GA  I+VPGNFPIGC  +YLT F +++   YDP TGCLNWLN+FS+YHN  L
Sbjct  623  AISELIHLGAVTILVPGNFPIGCLPAYLTKFQSSDKEAYDPSTGCLNWLNEFSQYHNEQL  682

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNTVV-ACCGGGGPYNYDGLVDC  424
            Q +LD LRE +P T IIY DYYNAA+R Y SP+K+GF+  V  ACCGGGG +NY+    C
Sbjct  683  QLKLDHLRELHPRTKIIYVDYYNAAVRFYQSPNKFGFEGQVFRACCGGGGTHNYNSSALC  742

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGEC  280
             S+++ VCD+PSSY SWDG H TEAAY+WI   +  G +T P+++  C
Sbjct  743  -SSNTKVCDDPSSYASWDGLHFTEAAYRWIFKSIADGSFTVPKLDISC  789


 Score =   199 bits (507),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 94/168 (56%), Positives = 119/168 (71%), Gaps = 2/168 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            +++ELI+ GA  I+VPGNFPIGC   YLT F  ++   YD  TGCLNWLN+FS+YHN  L
Sbjct  218  AISELIDLGAVMILVPGNFPIGCLPIYLTEFQGSDKEAYDSSTGCLNWLNEFSQYHNEQL  277

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNTVV-ACCGGGGPYNYDGLVDC  424
            Q +L+ LRE +P   IIY DYYNAA+R Y SP K+GF   V+ ACCGG G YNY+ L  C
Sbjct  278  QRKLNHLRELHPRANIIYVDYYNAALRFYQSPDKFGFDGRVLRACCGGEGTYNYNILEPC  337

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGEC  280
             S ++ VCD+PSSY SWDG H TEAAY+WI  G+  G +T P+++  C
Sbjct  338  NS-NARVCDDPSSYASWDGIHFTEAAYRWIFKGVADGSFTVPKLDISC  384



>ref|XP_009407319.1| PREDICTED: GDSL esterase/lipase At1g28650-like [Musa acuminata 
subsp. malaccensis]
Length=398

 Score =   198 bits (504),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 97/168 (58%), Positives = 120/168 (71%), Gaps = 3/168 (2%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++ ELI+ GA+ +IVPGNFPIGC A YLT F +    +Y+  TGC+ WLN FS YHNR L
Sbjct  215  AIEELIKLGARTMIVPGNFPIGCVAVYLTMFQSDRREDYESGTGCIEWLNQFSMYHNRHL  274

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGF-KNTVVACCGGGGPYNYDGLVDC  424
             +EL +LR +YP  TIIYA+YY AAM ++ SP +YGF K  + ACCGGGGPYNY+    C
Sbjct  275  LDELTQLRRRYPQATIIYANYYEAAMAIFRSPQEYGFGKFPLAACCGGGGPYNYNHSTKC  334

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGEC  280
            G   + VC +PSS ISWDG HLTEAAY+ IA GLL GPYT P ++  C
Sbjct  335  GK-DAGVCSSPSSQISWDGIHLTEAAYRVIARGLL-GPYTIPSLSRSC  380



>ref|XP_010912585.1| PREDICTED: GDSL esterase/lipase At1g31550-like [Elaeis guineensis]
Length=396

 Score =   198 bits (504),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 91/169 (54%), Positives = 119/169 (70%), Gaps = 0/169 (0%)
 Frame = -2

Query  783  FSVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRL  604
            +++N LIE GA+ ++VPG FP+GC ++YLT   +    +YDP+TGC+  LN+FSEYHN L
Sbjct  215  WAINSLIELGAKTLVVPGIFPLGCVSAYLTIHQSQRKEDYDPQTGCIKRLNEFSEYHNNL  274

Query  603  LQNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGLVDC  424
            L+ E+DRLR  +P TTIIYADYY AAM +Y  P KYG    + ACCGGGG YN++  V C
Sbjct  275  LKAEVDRLRGLHPYTTIIYADYYEAAMDIYRHPLKYGIDAPLAACCGGGGRYNFNLAVMC  334

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGECI  277
            G+   TVC +PS ++ WDG HLT+A YK IA GLL+G Y T  I   C+
Sbjct  335  GAPGGTVCSDPSKHVCWDGMHLTDAVYKIIARGLLEGSYATAPIAQACL  383



>emb|CDO96750.1| unnamed protein product [Coffea canephora]
Length=386

 Score =   198 bits (503),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 90/153 (59%), Positives = 118/153 (77%), Gaps = 1/153 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++ ELI+ GA  ++VPGNFPIGC ASYLT+F +++  +YD  TGC+NWLND ++YHNRLL
Sbjct  214  AIEELIKLGAVTLVVPGNFPIGCLASYLTYFQSSSQHDYDTDTGCINWLNDLAKYHNRLL  273

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNTVV-ACCGGGGPYNYDGLVDC  424
            Q EL+R+R+  P  TIIYADYYNAAMRLY SP+KYGF+   + ACCG GGPYN +  + C
Sbjct  274  QKELNRIRKLLPHATIIYADYYNAAMRLYRSPNKYGFRGEALRACCGTGGPYNCNTSIPC  333

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADG  325
            G   +T C +PS Y++WDG HLTEAAY++ + G
Sbjct  334  GYLPATPCKDPSLYVTWDGLHLTEAAYQFGSSG  366



>gb|KDO77812.1| hypothetical protein CISIN_1g018031mg [Citrus sinensis]
Length=286

 Score =   195 bits (495),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 89/160 (56%), Positives = 115/160 (72%), Gaps = 2/160 (1%)
 Frame = -2

Query  768  LIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLLQNEL  589
            LIE GA  ++VPGNFPIGCSA YLT F + N  +YD + GCL   N F+ YHN +L+ EL
Sbjct  127  LIEEGAVELVVPGNFPIGCSAVYLTLFQSLNEMDYD-RNGCLKAPNAFARYHNTMLKAEL  185

Query  588  DRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNTVV-ACCGGGGPYNYDGLVDCGSAS  412
             +LR++YP   IIYADYY AAMR Y++P  YGF N  V ACCGGGGPYN++    CG   
Sbjct  186  HKLRQKYPHANIIYADYYGAAMRFYHAPGHYGFSNGAVKACCGGGGPYNFNNSARCGHTG  245

Query  411  STVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQI  292
            S  C+NPS++ +WDG HLTE+AY+ +A+GL+ GP+ TP +
Sbjct  246  SRACENPSTHANWDGIHLTESAYRHVANGLIHGPFATPSL  285



>ref|XP_009109699.1| PREDICTED: GDSL esterase/lipase At1g28670-like [Brassica rapa]
Length=390

 Score =   197 bits (502),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 92/168 (55%), Positives = 116/168 (69%), Gaps = 1/168 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++ +L++ G++  +VPGNFPIGCSASYLT F  A   E+DP TGC+ WLN+F EYHN  L
Sbjct  209  AIVDLVDLGSKTFLVPGNFPIGCSASYLTLFQNAKEEEHDPFTGCIPWLNEFGEYHNDQL  268

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNT-VVACCGGGGPYNYDGLVDC  424
            +NEL RL++ YP   IIYADYYN+    +  P+KYGFKN  + ACCG GG YN+    +C
Sbjct  269  KNELKRLQKLYPHVNIIYADYYNSIHTFFQEPAKYGFKNRPLAACCGVGGKYNFTVNEEC  328

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGEC  280
            G      C NPS Y++WDG HLTEAAY+ IA GLL GPY TP  +  C
Sbjct  329  GYRGVNYCQNPSEYVNWDGYHLTEAAYRKIAHGLLNGPYATPAFDWSC  376



>ref|XP_006415636.1| hypothetical protein EUTSA_v10006895mg [Eutrema salsugineum]
 gb|ESQ33989.1| hypothetical protein EUTSA_v10006895mg [Eutrema salsugineum]
Length=753

 Score =   204 bits (518),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 92/180 (51%), Positives = 122/180 (68%), Gaps = 1/180 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++ EL++ G +  +VPGNFP+GCS  YLT + T N  +YDP TGCL WLN+FSEYHN  L
Sbjct  212  AITELVDMGGKTFLVPGNFPLGCSVIYLTLYQTPNKEDYDPLTGCLTWLNEFSEYHNEKL  271

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNT-VVACCGGGGPYNYDGLVDC  424
            Q EL+RLR+ YP   IIY DYYNA +RL   P+K+G  +  +  CCG GG YN+   V C
Sbjct  272  QTELNRLRKLYPHVNIIYGDYYNALLRLIQEPAKFGLMSRPLPVCCGSGGTYNFTFGVKC  331

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGECIFRSPKTKLSDS  244
            GS     CD+PS Y++WDG H+TE AY+ IA+GLLKGPY+ P  +  C+    + K S++
Sbjct  332  GSKGVGYCDDPSKYVNWDGVHMTETAYRLIAEGLLKGPYSIPPFDWSCLSSEIENKDSET  391


 Score =   200 bits (508),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 89/169 (53%), Positives = 119/169 (70%), Gaps = 1/169 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++ ELI  G +  +VPG+FP+GCS +YLT + T+N  EYDPKTGCL WLN F EY+N+ L
Sbjct  571  AIKELINMGGRTFLVPGDFPLGCSVAYLTIYQTSNMEEYDPKTGCLKWLNKFGEYYNKQL  630

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNT-VVACCGGGGPYNYDGLVDC  424
            Q EL++L++ YP   IIYADYYNA  RL+  P+K+GF N  + ACCG GG YN+     C
Sbjct  631  QAELNKLQKLYPHVNIIYADYYNAVSRLFQEPAKFGFMNRPLPACCGLGGSYNFTFGRKC  690

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGECI  277
            G      C++P+ Y++WDG HLTE+AY+ IA+GLLKGPY  P  +  C+
Sbjct  691  GFQGVECCNDPTKYVNWDGVHLTESAYRLIAEGLLKGPYAIPPFDWSCL  739



>emb|CDY64716.1| BnaCnng44670D [Brassica napus]
Length=389

 Score =   197 bits (501),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 91/169 (54%), Positives = 118/169 (70%), Gaps = 1/169 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++ +LI+ G +  +VPG+FP+GCSA+YLT F TA   +YDP TGCL WLNDF ++H+  L
Sbjct  208  AIVDLIDLGGKTFLVPGSFPVGCSAAYLTLFQTAKEKDYDPLTGCLPWLNDFGKHHDEQL  267

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNT-VVACCGGGGPYNYDGLVDC  424
            + E+ RLR+ YP   IIYADYYN+  RLY  P+KYGFKN  + ACCG GG YN+    +C
Sbjct  268  KTEIRRLRKLYPHVNIIYADYYNSLYRLYQKPTKYGFKNRPLAACCGVGGQYNFTIGEEC  327

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGECI  277
            G      C NPS YI+WDG HLTEAA++ +A G+L GPY TP  N  C+
Sbjct  328  GYEGVGYCQNPSEYINWDGYHLTEAAHQKMAHGILNGPYATPAFNWSCL  376



>ref|XP_006467672.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Citrus sinensis]
Length=362

 Score =   196 bits (499),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/160 (56%), Positives = 115/160 (72%), Gaps = 2/160 (1%)
 Frame = -2

Query  768  LIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLLQNEL  589
            LIE GA  ++VPGNFPIGCSA YLT F + N  +YD + GCL   N F+ YHN +L+ EL
Sbjct  203  LIEEGAVELVVPGNFPIGCSAVYLTLFQSLNEMDYD-RNGCLKAPNAFARYHNTMLKAEL  261

Query  588  DRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNTVV-ACCGGGGPYNYDGLVDCGSAS  412
             +LR++YP   IIYADYY AAMR Y++P  YGF N  V ACCGGGGPYN++    CG   
Sbjct  262  HKLRQKYPHANIIYADYYGAAMRFYHAPGHYGFSNGAVKACCGGGGPYNFNNSARCGHTG  321

Query  411  STVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQI  292
            S  C+NPS++ +WDG HLTEAAY+ +A+GL+ GP+ TP +
Sbjct  322  SRACENPSTHANWDGIHLTEAAYRHVANGLIHGPFATPSL  361



>ref|XP_003593740.1| GDSL esterase/lipase [Medicago truncatula]
 gb|AES63991.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=387

 Score =   197 bits (500),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 92/170 (54%), Positives = 121/170 (71%), Gaps = 2/170 (1%)
 Frame = -2

Query  783  FSVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRL  604
             ++NELI+ GA+ ++VPGNFP+GCSA +LT + T + ++YD   GCL WLN+FSE++N+ 
Sbjct  207  LAINELIDLGARTLMVPGNFPLGCSAVHLTTYETTDKNQYD-SFGCLKWLNEFSEFYNQK  265

Query  603  LQNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGLVDC  424
            LQ+E+ RLR  +P   IIYADYYNAA+ LY  P KYGF    V CCG G PYNY+    C
Sbjct  266  LQHEIHRLRVIHPHANIIYADYYNAALPLYRYPKKYGFTGLKV-CCGIGSPYNYNASNMC  324

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGECIF  274
            G      CD+PS YI+WDG H TEAAY+ IA+GL+KGPY+ PQ++  C  
Sbjct  325  GKPGVPACDDPSQYITWDGVHFTEAAYRLIANGLIKGPYSVPQLSNLCFM  374



>ref|NP_973931.1| GDSL esterase/lipase [Arabidopsis thaliana]
 gb|AEE30997.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=309

 Score =   194 bits (494),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 93/180 (52%), Positives = 116/180 (64%), Gaps = 3/180 (2%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++ ELI  G +  +VPG FP+GCS  YLT   T+N  EYDP TGCL WLN F E H   L
Sbjct  129  AITELIGMGGRTFLVPGEFPVGCSVLYLTSHQTSNMEEYDPLTGCLKWLNKFGENHGEQL  188

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNT-VVACCGGGGPYNYDGLVDC  424
            + EL+RL++ YP   IIYADYYNA   LY  P+K+GF N  + ACCG GGPYNY     C
Sbjct  189  RAELNRLQKLYPHVNIIYADYYNALFHLYQEPAKFGFMNRPLSACCGAGGPYNYTVGRKC  248

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGECIFRSPKTKLSDS  244
            G+     CD+PS Y++WDG H+TEAAY+ +A+G+L GPY  P  +  C  RS   K S S
Sbjct  249  GTDIVESCDDPSKYVAWDGVHMTEAAYRLMAEGILNGPYAIPPFDWSC--RSSGVKNSGS  306



>gb|KFK44742.1| hypothetical protein AALP_AA1G297000 [Arabis alpina]
Length=1372

 Score =   206 bits (525),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 93/176 (53%), Positives = 120/176 (68%), Gaps = 1/176 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++ ELI  G +  +VPGNFPIGCS +YLT + T+N  EYDP TGCL WLN+F EYH   L
Sbjct  206  AITELIGMGGRTFLVPGNFPIGCSVAYLTLYQTSNKKEYDPLTGCLAWLNEFGEYHGEQL  265

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGF-KNTVVACCGGGGPYNYDGLVDC  424
            Q EL+RL++ YP   IIYADYYN  +R++  P+K+GF    + ACCG GG YNY   + C
Sbjct  266  QVELNRLQKLYPHVNIIYADYYNPMLRIFQEPAKFGFISRPLPACCGVGGLYNYTVGMQC  325

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGECIFRSPKTK  256
            G+     C++PS Y++WDG HLTEAAY+W+ADGLL GPY  P  +  C+    K K
Sbjct  326  GTEVVECCNDPSKYVNWDGVHLTEAAYRWLADGLLNGPYAIPPFDWSCLSSEIKNK  381


 Score = 80.1 bits (196),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 50/88 (57%), Gaps = 7/88 (8%)
 Frame = -2

Query  540   YYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGLVDCGSASSTVCDNPSSYISWDGSH  361
             Y +     Y+   K  FK       G GG YNY+ +  CG+     C +PS Y+ WDGSH
Sbjct  1274  YESKQFLTYDLEDKVDFK-------GAGGMYNYNSVRQCGTKGVDCCLDPSKYVHWDGSH  1326

Query  360   LTEAAYKWIADGLLKGPYTTPQINGECI  277
             LTE+ Y+WIA GLL+GPYT P  +  C+
Sbjct  1327  LTESTYRWIAMGLLEGPYTIPAFDWSCL  1354



>ref|XP_010460658.1| PREDICTED: GDSL esterase/lipase At1g28580-like isoform X2 [Camelina 
sativa]
Length=394

 Score =   196 bits (499),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 86/176 (49%), Positives = 118/176 (67%), Gaps = 1/176 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++ ELI  G +  +VPG FP+GC  +YLT + T+N  EYDP TGCL WLN F E H+  L
Sbjct  207  AITELIGMGGKTFLVPGQFPMGCLVAYLTLYQTSNIEEYDPLTGCLTWLNKFGENHDSQL  266

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNT-VVACCGGGGPYNYDGLVDC  424
            + EL+R+++ YP   IIYADYYNA +R Y  P+K+GF +  + ACCG GGPYNY  +  C
Sbjct  267  RAELNRIQKLYPHVNIIYADYYNALLRFYQEPAKFGFMDRPLCACCGVGGPYNYTSVSQC  326

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGECIFRSPKTK  256
            G+     C +PS Y++WDG H+TEAAY+ +++G+LKGPY  P  +  C+    K K
Sbjct  327  GTDVVEGCSDPSKYVAWDGVHMTEAAYRLMSEGILKGPYAVPPFDWSCLSSEIKDK  382



>gb|EMT27195.1| GDSL esterase/lipase [Aegilops tauschii]
Length=403

 Score =   197 bits (500),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 88/164 (54%), Positives = 115/164 (70%), Gaps = 0/164 (0%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            +V ELI  GA+ ++VPGN PIGC  +YL  F +    +Y+P+TGCL W+N+FS+YHNRLL
Sbjct  216  TVTELIGLGAKTLVVPGNLPIGCVPNYLMIFKSDKKEDYEPETGCLRWMNEFSKYHNRLL  275

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGLVDCG  421
             +EL++LR+ +P  +IIYADYY AAM +Y SP ++G  + + ACCGGGGPY       CG
Sbjct  276  IDELEKLRKLHPGVSIIYADYYGAAMEIYRSPEQFGIDHPLAACCGGGGPYGVSMTARCG  335

Query  420  SASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQIN  289
                 VCD+P  Y SWDG H +EAAYK IA GLL+G YT P I+
Sbjct  336  YGEYKVCDDPQKYGSWDGFHPSEAAYKGIAIGLLRGTYTQPSIS  379



>ref|XP_010460657.1| PREDICTED: GDSL esterase/lipase At1g28580-like isoform X1 [Camelina 
sativa]
Length=397

 Score =   196 bits (499),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 86/176 (49%), Positives = 118/176 (67%), Gaps = 1/176 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++ ELI  G +  +VPG FP+GC  +YLT + T+N  EYDP TGCL WLN F E H+  L
Sbjct  210  AITELIGMGGKTFLVPGQFPMGCLVAYLTLYQTSNIEEYDPLTGCLTWLNKFGENHDSQL  269

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNT-VVACCGGGGPYNYDGLVDC  424
            + EL+R+++ YP   IIYADYYNA +R Y  P+K+GF +  + ACCG GGPYNY  +  C
Sbjct  270  RAELNRIQKLYPHVNIIYADYYNALLRFYQEPAKFGFMDRPLCACCGVGGPYNYTSVSQC  329

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGECIFRSPKTK  256
            G+     C +PS Y++WDG H+TEAAY+ +++G+LKGPY  P  +  C+    K K
Sbjct  330  GTDVVEGCSDPSKYVAWDGVHMTEAAYRLMSEGILKGPYAVPPFDWSCLSSEIKDK  385



>ref|XP_010501634.1| PREDICTED: uncharacterized protein LOC104778924 [Camelina sativa]
Length=818

 Score =   203 bits (516),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 90/169 (53%), Positives = 117/169 (69%), Gaps = 1/169 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++ ELI+ G +  +VPG+FP+GCSA YLT + T+N   YDP TGCL WLN F E HN+ L
Sbjct  207  AITELIDMGGRTFLVPGDFPLGCSAIYLTSYQTSNMEAYDPLTGCLTWLNKFGENHNKQL  266

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNT-VVACCGGGGPYNYDGLVDC  424
            Q EL+RL + YP   IIYADYYNA +R+Y  PSK+GF N  + ACCG GGPYN+     C
Sbjct  267  QAELNRLLKLYPHVNIIYADYYNALLRIYQEPSKFGFMNRPLSACCGVGGPYNFTSFWQC  326

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGECI  277
            G+     C +PS Y++WDG H+TEAAY  I++G+LKGPY  P  +  C+
Sbjct  327  GADVVEGCSDPSKYVTWDGVHMTEAAYSLISEGILKGPYAVPPFDWSCL  375


 Score =   195 bits (496),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 85/176 (48%), Positives = 117/176 (66%), Gaps = 1/176 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++ ELI  G +  +VPG FP+GC  +YLT + T+N  EYDP TGCL WLN F E H+  L
Sbjct  631  AITELISMGGKTFLVPGQFPMGCLVAYLTLYQTSNIEEYDPLTGCLTWLNKFGENHDAQL  690

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNT-VVACCGGGGPYNYDGLVDC  424
            + EL+R+++ YP   IIY DYYNA +R Y  P+K+GF +  + ACCG GGPYNY  +  C
Sbjct  691  RAELNRIQKLYPHVNIIYVDYYNALLRFYQEPAKFGFMDRPLPACCGVGGPYNYTSVTQC  750

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGECIFRSPKTK  256
            G+     C +PS Y++WDG H+TEAAY+ +++G+LKGPY  P  +  C+    K K
Sbjct  751  GTDVVEGCSDPSKYVAWDGVHMTEAAYRLMSEGILKGPYAVPLFDWSCLSSEIKDK  806



>gb|KDO77809.1| hypothetical protein CISIN_1g018031mg [Citrus sinensis]
Length=362

 Score =   195 bits (496),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 89/160 (56%), Positives = 115/160 (72%), Gaps = 2/160 (1%)
 Frame = -2

Query  768  LIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLLQNEL  589
            LIE GA  ++VPGNFPIGCSA YLT F + N  +YD + GCL   N F+ YHN +L+ EL
Sbjct  203  LIEEGAVELVVPGNFPIGCSAVYLTLFQSLNEMDYD-RNGCLKAPNAFARYHNTMLKAEL  261

Query  588  DRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNTVV-ACCGGGGPYNYDGLVDCGSAS  412
             +LR++YP   IIYADYY AAMR Y++P  YGF N  V ACCGGGGPYN++    CG   
Sbjct  262  HKLRQKYPHANIIYADYYGAAMRFYHAPGHYGFSNGAVKACCGGGGPYNFNNSARCGHTG  321

Query  411  STVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQI  292
            S  C+NPS++ +WDG HLTE+AY+ +A+GL+ GP+ TP +
Sbjct  322  SRACENPSTHANWDGIHLTESAYRHVANGLIHGPFATPSL  361



>ref|NP_973930.1| GDSL esterase/lipase [Arabidopsis thaliana]
 gb|AEE30995.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=317

 Score =   194 bits (492),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 86/169 (51%), Positives = 115/169 (68%), Gaps = 1/169 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++ ELI  G +  +VPG FP+GCS +YL+ + T+N  EYDP TGCL WLN FSEYH+  L
Sbjct  135  AITELIGMGGKTFLVPGEFPLGCSVAYLSLYQTSNIEEYDPLTGCLKWLNKFSEYHDEQL  194

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGF-KNTVVACCGGGGPYNYDGLVDC  424
            Q EL+RL++ YP   IIYADYYN  +RL   P+K+GF    + ACC  GGP+N+      
Sbjct  195  QAELNRLQKLYPHVNIIYADYYNTLLRLAQEPAKFGFISRPLPACCALGGPFNFTLGRKR  254

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGECI  277
            G+     CD+PS Y+SWDG H+TEAAY+ +A+G+LKGPY  P  +  C+
Sbjct  255  GTQVPECCDDPSKYVSWDGVHMTEAAYRLMAEGILKGPYAIPPFDWSCL  303



>ref|XP_006449476.1| hypothetical protein CICLE_v10015707mg [Citrus clementina]
 gb|ESR62716.1| hypothetical protein CICLE_v10015707mg [Citrus clementina]
Length=362

 Score =   195 bits (495),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 89/160 (56%), Positives = 115/160 (72%), Gaps = 2/160 (1%)
 Frame = -2

Query  768  LIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLLQNEL  589
            LIE GA  ++VPGNFPIGCSA YLT F + N  +YD + GCL   N F+ YHN +L+ +L
Sbjct  203  LIEEGAVELVVPGNFPIGCSAVYLTLFQSLNEMDYD-QNGCLKAPNAFARYHNTMLKAQL  261

Query  588  DRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNTVV-ACCGGGGPYNYDGLVDCGSAS  412
             +LR++YP   IIYADYY AAMR Y++P  YGF N  V ACCGGGGPYN++    CG   
Sbjct  262  HKLRQKYPHANIIYADYYGAAMRFYHAPGHYGFSNGAVKACCGGGGPYNFNNSARCGHTG  321

Query  411  STVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQI  292
            S  C+NPS++ +WDG HLTEAAY+ +A+GL+ GP+ TP +
Sbjct  322  SRACENPSTHANWDGIHLTEAAYRHVANGLIHGPFATPSL  361



>ref|XP_009352808.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Pyrus x bretschneideri]
Length=367

 Score =   195 bits (495),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 91/162 (56%), Positives = 114/162 (70%), Gaps = 1/162 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            + + LIE GA  ++VPGN PIGCSA YLT F T N S YD + GCL   N FS+YHN  L
Sbjct  205  ATSALIEEGAVELLVPGNLPIGCSAVYLTLFQTPNRSYYDKRNGCLKAFNTFSKYHNSEL  264

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKN-TVVACCGGGGPYNYDGLVDC  424
            +  L  LR++YP   IIYADYY AAM  +++P  YGFK+ T+ ACCGGGGPYN++    C
Sbjct  265  KRALATLRQKYPHVNIIYADYYGAAMPFFHAPQHYGFKSGTLRACCGGGGPYNFNNSARC  324

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTP  298
            G   ST C +PSSY++WDG HLTEAAY++IA GL+ G +T P
Sbjct  325  GHIGSTACKDPSSYVNWDGIHLTEAAYRYIAKGLIHGQFTKP  366



>sp|Q3ZFI4.1|SCE3_BRANA RecName: Full=Sinapine esterase; Short=BnSCE3; AltName: Full=Lipase 
2; Short=BnLIP2; Flags: Precursor [Brassica napus]
 gb|AAX58135.1| lipase 2 [Brassica napus]
Length=389

 Score =   195 bits (496),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 89/169 (53%), Positives = 118/169 (70%), Gaps = 1/169 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++ +LI+ G +  +VPG+FP+GCSA+YLT F TA   +YDP TGCL WLNDF ++H+  L
Sbjct  208  AIVDLIDLGGKTFLVPGSFPVGCSAAYLTLFQTAKEKDYDPLTGCLPWLNDFGKHHDEQL  267

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNT-VVACCGGGGPYNYDGLVDC  424
            + E+ RLR+ YP   I+YADYYN+  RLY  P+KYGFKN  + ACCG GG YN+    +C
Sbjct  268  KTEIRRLRKLYPHVNIMYADYYNSLYRLYQKPTKYGFKNRPLAACCGVGGQYNFTIGEEC  327

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGECI  277
            G      C NPS YI+WDG H+TEAA++ +A G+L GPY TP  N  C+
Sbjct  328  GYEGVGYCQNPSEYINWDGYHITEAAHQKMAHGILNGPYATPAFNWSCL  376



>emb|CDY63998.1| BnaA07g36520D [Brassica napus]
Length=389

 Score =   195 bits (496),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 90/169 (53%), Positives = 117/169 (69%), Gaps = 1/169 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++ +LI+ G +  +VPG+FP GCSA+YLT F TA   +YDP TGCL WLNDF ++H+  L
Sbjct  208  AIVDLIDLGGKTFLVPGSFPAGCSAAYLTLFQTAKEEDYDPLTGCLPWLNDFGKHHDEQL  267

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNT-VVACCGGGGPYNYDGLVDC  424
            + E+ RLR++YP   IIYADYYN+  RLY  P+KYGFKN  + ACCG GG YN+    +C
Sbjct  268  KTEIKRLRKRYPHVNIIYADYYNSLYRLYQEPTKYGFKNRPLAACCGVGGQYNFTIGEEC  327

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGECI  277
            G      C NPS YI+WDG HLTEAA++ +A G+L GPY  P  N  C+
Sbjct  328  GYEGVGYCQNPSEYINWDGYHLTEAAHQKMAHGILNGPYAAPAFNWSCL  376



>emb|CDO99485.1| unnamed protein product [Coffea canephora]
Length=399

 Score =   195 bits (496),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 94/169 (56%), Positives = 122/169 (72%), Gaps = 2/169 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++NELI+ G   I+V G  P GCS + LT+F ++N  +YD  TGCL+WLNDFS YHN LL
Sbjct  214  AINELIDLGVVNIMVNGLLPDGCSPAMLTYFKSSNKEDYDTATGCLSWLNDFSNYHNELL  273

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGF-KNTVVACCGGGG-PYNYDGLVD  427
            Q EL+ +R  +PD  I+YADY+N  M+L+ SP + GF   +++ACCG GG PYNY+    
Sbjct  274  QEELNGVRANHPDALILYADYFNPLMQLFRSPEQNGFGGRSLMACCGDGGPPYNYNFSAQ  333

Query  426  CGSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGEC  280
            CG  +ST C  PS YISWDG HLTEAAY+++A GLL+GPYTTP+IN  C
Sbjct  334  CGEPASTACAWPSLYISWDGIHLTEAAYRFMAKGLLEGPYTTPRINPLC  382



>ref|XP_004485879.1| PREDICTED: GDSL esterase/lipase At2g27360-like [Cicer arietinum]
Length=383

 Score =   195 bits (495),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 90/169 (53%), Positives = 118/169 (70%), Gaps = 2/169 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++ +LI+ GA  I+VPG+ P+GC+ + LT F T N  EYD + GCL  LN F EYHN LL
Sbjct  202  AIKDLIDLGAVTILVPGSLPLGCNPALLTKFATINEEEYD-QAGCLKLLNMFFEYHNELL  260

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGF-KNTVVACCGGGGPYNYDGLVDC  424
            Q EL+RLR  YP T IIYADY+NAA++ Y SP ++GF +N +  CCGGGGPYN++    C
Sbjct  261  QFELNRLRVLYPFTNIIYADYFNAALQFYKSPEQFGFERNALQVCCGGGGPYNFNDTALC  320

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGECI  277
            G+     CD+ S Y+SWDG HLTEAAY+W+A  LL G YT P+ +  C+
Sbjct  321  GNLEVIACDDTSKYVSWDGYHLTEAAYRWMAMSLLDGQYTIPKFSLSCL  369



>ref|NP_174180.1| GDSL esterase/lipase [Arabidopsis thaliana]
 sp|Q9FXJ2.1|GDL7_ARATH RecName: Full=GDSL esterase/lipase At1g28580; AltName: Full=Extracellular 
lipase At1g28580; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAG22836.1|AC007508_13 F1K23.18 [Arabidopsis thaliana]
 gb|AAK32776.1|AF361608_1 At1g28580/F1K23_7 [Arabidopsis thaliana]
 gb|AAK76488.1| putative lipase [Arabidopsis thaliana]
 gb|AAL69539.1| At1g28580/F1K23_7 [Arabidopsis thaliana]
 gb|AAL85126.1| putative lipase [Arabidopsis thaliana]
 gb|AEE30996.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=390

 Score =   195 bits (495),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 93/180 (52%), Positives = 116/180 (64%), Gaps = 3/180 (2%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++ ELI  G +  +VPG FP+GCS  YLT   T+N  EYDP TGCL WLN F E H   L
Sbjct  210  AITELIGMGGRTFLVPGEFPVGCSVLYLTSHQTSNMEEYDPLTGCLKWLNKFGENHGEQL  269

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNT-VVACCGGGGPYNYDGLVDC  424
            + EL+RL++ YP   IIYADYYNA   LY  P+K+GF N  + ACCG GGPYNY     C
Sbjct  270  RAELNRLQKLYPHVNIIYADYYNALFHLYQEPAKFGFMNRPLSACCGAGGPYNYTVGRKC  329

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGECIFRSPKTKLSDS  244
            G+     CD+PS Y++WDG H+TEAAY+ +A+G+L GPY  P  +  C  RS   K S S
Sbjct  330  GTDIVESCDDPSKYVAWDGVHMTEAAYRLMAEGILNGPYAIPPFDWSC--RSSGVKNSGS  387



>ref|XP_009102890.1| PREDICTED: GDSL esterase/lipase At1g28670-like [Brassica rapa]
Length=389

 Score =   194 bits (494),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 89/169 (53%), Positives = 117/169 (69%), Gaps = 1/169 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++ +LI+ G +  +VPG+FP GCSA+YLT F TA   +YDP TGCL WLNDF ++H+  L
Sbjct  208  AIVDLIDLGGKTFLVPGSFPAGCSAAYLTLFQTAKEEDYDPLTGCLPWLNDFGKHHDEQL  267

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNT-VVACCGGGGPYNYDGLVDC  424
            + E+ RLR++YP   +IYADYYN+  RLY  P+KYGFKN  + ACCG GG YN+    +C
Sbjct  268  KTEIKRLRKRYPHVNVIYADYYNSLYRLYQEPTKYGFKNRPLAACCGVGGQYNFTIGEEC  327

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGECI  277
            G      C NPS YI+WDG HLTEAA++ +A G+L GPY  P  N  C+
Sbjct  328  GYEGVGYCQNPSEYINWDGYHLTEAAHQKMAHGILNGPYAAPAFNWSCL  376



>emb|CDY43309.1| BnaC03g58810D [Brassica napus]
Length=390

 Score =   194 bits (494),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 91/168 (54%), Positives = 114/168 (68%), Gaps = 1/168 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++ +L++ G +  +VPGNFPIGCSASYLT F  A   E+DP TGC+ WLN+F EYHN  L
Sbjct  209  AIVDLVDLGGKTFLVPGNFPIGCSASYLTLFHNAKEEEHDPFTGCIPWLNEFGEYHNDQL  268

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNT-VVACCGGGGPYNYDGLVDC  424
            + EL RL++ YP   IIYADYYN+    +  P+KYGFKN  + ACCG GG YN+    +C
Sbjct  269  KTELKRLQKLYPHVNIIYADYYNSIYTFFQEPAKYGFKNRPLAACCGVGGKYNFTVNEEC  328

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGEC  280
            G      C NPS Y++WDG HLTEAAY+ IA GLL GPY TP  +  C
Sbjct  329  GYRGVNYCQNPSEYVNWDGYHLTEAAYRKIAHGLLNGPYATPAFDWSC  376



>ref|XP_010912577.1| PREDICTED: GDSL esterase/lipase At1g28580-like [Elaeis guineensis]
Length=393

 Score =   194 bits (494),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 85/168 (51%), Positives = 120/168 (71%), Gaps = 1/168 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++ +LI+ GA+ ++VPG  P GC + YLT F +    +YDP+TGC+ W N+FSE HNRL+
Sbjct  222  AITDLIQLGAKTLVVPGIVPSGCVSLYLTVFQSQKGEDYDPRTGCIKWANEFSEEHNRLI  281

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNTVV-ACCGGGGPYNYDGLVDC  424
              ELDRLR  +P  TII+A+YY+A M ++ SP ++GFK + + ACCGG GPYN +  + C
Sbjct  282  SEELDRLRRLHPHATIIHANYYDALMSIFRSPQQFGFKKSPLDACCGGDGPYNMNISLRC  341

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGEC  280
            G   +TVC +P+ ++ WDG+HLTEAAY+ I+ GLL+GPY TP I   C
Sbjct  342  GDPKTTVCRDPAKFVFWDGTHLTEAAYEVISRGLLEGPYATPSIIQTC  389



>emb|CDX90163.1| BnaA08g18210D [Brassica napus]
Length=390

 Score =   194 bits (494),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 91/168 (54%), Positives = 113/168 (67%), Gaps = 1/168 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++ +L++ G +  +VPGNFPIGCSASYLT F  A   E+DP TGC+ WLN+F EYHN  L
Sbjct  209  AIVDLVDLGGKTFLVPGNFPIGCSASYLTLFHNAKEEEHDPFTGCIPWLNEFGEYHNEQL  268

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNT-VVACCGGGGPYNYDGLVDC  424
            + EL RL++ YP   IIYADYYN+    +  P+KYGFKN  + ACCG GG YN+    +C
Sbjct  269  KTELKRLQKLYPHVNIIYADYYNSIHTFFQEPAKYGFKNRPLAACCGVGGKYNFTVNEEC  328

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGEC  280
            G      C NPS Y++WDG HLTEAAY  IA GLL GPY TP  +  C
Sbjct  329  GYGGVNYCQNPSEYVNWDGYHLTEAAYHKIAHGLLNGPYATPAFDWSC  376



>ref|XP_010435654.1| PREDICTED: GDSL esterase/lipase At1g31550-like [Camelina sativa]
Length=396

 Score =   194 bits (494),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 94/176 (53%), Positives = 116/176 (66%), Gaps = 2/176 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++ ELI  G +  +VPG FPIGCS +YLT + T+N  EYD   GCL WLN F EYH+  L
Sbjct  210  AITELISMGGRTFLVPGEFPIGCSVAYLTLYQTSNMEEYD-SFGCLKWLNKFGEYHDEQL  268

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNT-VVACCGGGGPYNYDGLVDC  424
            Q EL RLR   P   IIYADYYNA +RL   P+KYGF +  + ACCG G PYN++    C
Sbjct  269  QAELKRLRNLNPHVNIIYADYYNALLRLNQEPTKYGFIDKPLSACCGVGEPYNFNFSTCC  328

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGECIFRSPKTK  256
            GS     C++PS Y++WDG H+TEAAYK +ADGLLKGPY +P  N  C+    K K
Sbjct  329  GSFGVDSCNDPSKYVAWDGIHMTEAAYKLMADGLLKGPYASPPFNWTCLSSKIKNK  384



>emb|CDM83548.1| unnamed protein product [Triticum aestivum]
Length=426

 Score =   195 bits (496),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 88/164 (54%), Positives = 114/164 (70%), Gaps = 0/164 (0%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            +V ELI  GA+ ++VPGN PIGC  +YL  F +    +Y+P+TGCL W+N+FS+YHNRLL
Sbjct  219  TVTELIGLGAKTLVVPGNLPIGCVPNYLMIFKSDKKEDYEPETGCLRWMNEFSKYHNRLL  278

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGLVDCG  421
             +EL++LR+ +P  +IIYADYY AAM +Y SP ++G  +   ACCGGGGPY       CG
Sbjct  279  IDELEKLRKLHPGMSIIYADYYGAAMEIYRSPEQFGIDHPSAACCGGGGPYGVSMTARCG  338

Query  420  SASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQIN  289
                 VCD+P  Y SWDG H +EAAYK IA GLL+G YT P I+
Sbjct  339  YGEYKVCDDPQKYGSWDGFHPSEAAYKGIAIGLLRGTYTQPSIS  382



>gb|AAX62802.1| lipase 2 [Brassica napus]
Length=389

 Score =   194 bits (493),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/169 (53%), Positives = 117/169 (69%), Gaps = 1/169 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++ +LI+ G +  +VPG+FP GCSA+YLT F TA   +YDP TGCL WLNDF ++H+  L
Sbjct  208  AIVDLIDLGGKTFLVPGSFPGGCSAAYLTLFQTAKEEDYDPLTGCLPWLNDFGKHHDEQL  267

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNT-VVACCGGGGPYNYDGLVDC  424
            + E+ RLR++YP   IIYADYYN+  RLY  P+KYGFKN  + ACCG GG YN+    +C
Sbjct  268  KTEIKRLRKRYPHVNIIYADYYNSLYRLYQEPTKYGFKNRPLAACCGVGGQYNFTIGEEC  327

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGECI  277
            G      C NPS YI+WDG HLTEAA++ +A G+L GPY  P  N  C+
Sbjct  328  GYEGVGYCQNPSEYINWDGYHLTEAAHQKMAHGILNGPYAAPAFNWSCL  376



>ref|XP_008777735.1| PREDICTED: GDSL esterase/lipase At1g28580-like, partial [Phoenix 
dactylifera]
Length=396

 Score =   194 bits (493),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 87/168 (52%), Positives = 119/168 (71%), Gaps = 1/168 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++ +LIE GA+ ++VPG  P GC + YLT F +    +YDP+TGC+ W N+FSE+H RLL
Sbjct  225  AITDLIELGAKTVVVPGIVPSGCVSLYLTVFQSQKREDYDPQTGCIKWANEFSEHHGRLL  284

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNTVV-ACCGGGGPYNYDGLVDC  424
              ELDRLR  +P   II+A+YY+A M ++ SP ++GFK + + ACCGG GPYN +  + C
Sbjct  285  SEELDRLRRLHPHAIIIHANYYDALMSIFRSPQQFGFKKSPLDACCGGDGPYNLNISLRC  344

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGEC  280
            G   +TVC +PS Y+ WDG+HLTEAAY+ I+ GLL+GPY TP I   C
Sbjct  345  GDPMTTVCHDPSKYVFWDGTHLTEAAYEVISRGLLEGPYATPSIIQTC  392



>gb|EMT22154.1| GDSL esterase/lipase [Aegilops tauschii]
Length=387

 Score =   194 bits (493),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 83/164 (51%), Positives = 118/164 (72%), Gaps = 0/164 (0%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++ EL+E GA+ ++VPGN PIGC  +YLT + +    +Y+P+TGC+ W+N+FS+YHN+LL
Sbjct  201  TIAELVELGAKTLLVPGNLPIGCIPAYLTTYKSDMMEDYEPETGCIRWMNEFSQYHNKLL  260

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGLVDCG  421
             +EL+ LR+ +P   IIYADYY AAM +++SP ++G ++ ++ACCGGGGPY       CG
Sbjct  261  VDELENLRKLHPGVVIIYADYYGAAMEIFSSPEQFGIEDPLMACCGGGGPYGVSASAGCG  320

Query  420  SASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQIN  289
                 VC++P  Y SWDG H TEA YK IA+GLL+G YT P I+
Sbjct  321  HGDYKVCNDPQKYASWDGFHPTEATYKGIANGLLRGSYTQPPIS  364



>ref|XP_004485878.1| PREDICTED: GDSL esterase/lipase At1g28590-like [Cicer arietinum]
Length=390

 Score =   194 bits (493),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 93/169 (55%), Positives = 118/169 (70%), Gaps = 2/169 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++NELI  GA+ +IVPGNFP+GC+A YLT +   + ++YD   GCL WLN F+E++N+ L
Sbjct  213  AINELIYLGARTLIVPGNFPLGCNAIYLTKYEAKDKNQYD-SAGCLKWLNAFAEFYNQKL  271

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGLVDCG  421
            Q E+ RLR  +PD  IIYADYYNA + LY+ P+KYGF   + ACCG GGPYNY+    CG
Sbjct  272  QYEIHRLRGIHPDANIIYADYYNAVLPLYHYPTKYGFTG-LKACCGIGGPYNYNTSKACG  330

Query  420  SASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGECIF  274
                  C++PS YI WDG HLTEAAYK IADGL+ GPY  PQ +  C  
Sbjct  331  DPDVIACEDPSQYIGWDGIHLTEAAYKLIADGLINGPYCVPQFSNLCFM  379



>ref|XP_009784633.1| PREDICTED: GDSL esterase/lipase At5g45910 [Nicotiana sylvestris]
Length=366

 Score =   193 bits (491),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 92/159 (58%), Positives = 111/159 (70%), Gaps = 1/159 (1%)
 Frame = -2

Query  768  LIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLLQNEL  589
            LIE GA  +IVPGN PIGCSA YLT F T N + YD K GCL   N FS+YHN  L+  L
Sbjct  201  LIEEGAVELIVPGNLPIGCSAVYLTLFGTQNKAAYD-KNGCLKAYNAFSKYHNSQLKLSL  259

Query  588  DRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGLVDCGSASS  409
            ++LRE+YP   IIYADYY AA R +++P  YGF NT+VACCGGGGPYN++    CG   S
Sbjct  260  EKLREEYPHAKIIYADYYGAAKRFFHAPKHYGFSNTLVACCGGGGPYNFNNSARCGHIGS  319

Query  408  TVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQI  292
              C + S + +WDG HLTEAAY  IA GLL GP+T+P +
Sbjct  320  KACLDSSKFANWDGIHLTEAAYHHIAKGLLNGPFTSPPL  358



>ref|NP_174179.3| GDSL esterase/lipase [Arabidopsis thaliana]
 sp|Q9FXJ1.1|GDL6_ARATH RecName: Full=GDSL esterase/lipase At1g28570; AltName: Full=Extracellular 
lipase At1g28570; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAG22837.1|AC007508_14 F1K23.19 [Arabidopsis thaliana]
 gb|AEE30994.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=389

 Score =   194 bits (493),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 86/169 (51%), Positives = 115/169 (68%), Gaps = 1/169 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++ ELI  G +  +VPG FP+GCS +YL+ + T+N  EYDP TGCL WLN FSEYH+  L
Sbjct  207  AITELIGMGGKTFLVPGEFPLGCSVAYLSLYQTSNIEEYDPLTGCLKWLNKFSEYHDEQL  266

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGF-KNTVVACCGGGGPYNYDGLVDC  424
            Q EL+RL++ YP   IIYADYYN  +RL   P+K+GF    + ACC  GGP+N+      
Sbjct  267  QAELNRLQKLYPHVNIIYADYYNTLLRLAQEPAKFGFISRPLPACCALGGPFNFTLGRKR  326

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGECI  277
            G+     CD+PS Y+SWDG H+TEAAY+ +A+G+LKGPY  P  +  C+
Sbjct  327  GTQVPECCDDPSKYVSWDGVHMTEAAYRLMAEGILKGPYAIPPFDWSCL  375



>ref|XP_010478237.1| PREDICTED: GDSL esterase/lipase At1g28580-like [Camelina sativa]
Length=415

 Score =   194 bits (493),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 87/169 (51%), Positives = 114/169 (67%), Gaps = 1/169 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++ ELI  G + I+VPG+FP+GCSA+YLT +  +    YDP TGCL WLN F E H+  L
Sbjct  228  AITELIGMGGRTILVPGDFPLGCSATYLTLYQKSKKEAYDPSTGCLTWLNKFGENHDVQL  287

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNT-VVACCGGGGPYNYDGLVDC  424
            + EL+RL++ YP   IIYADYYNA +R+Y  P  +GF N  + ACCG GGPYN+     C
Sbjct  288  RAELNRLQKLYPHVNIIYADYYNALLRIYQEPENFGFMNRPLSACCGVGGPYNFTSFWQC  347

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGECI  277
            G+     C+ PS Y++WDG H+TEAAY  IA+G+LKGPY  P  N  C+
Sbjct  348  GTDVVEGCNYPSKYVAWDGVHMTEAAYSLIAEGILKGPYAVPPFNWSCL  396



>ref|XP_006415637.1| hypothetical protein EUTSA_v10009438mg, partial [Eutrema salsugineum]
 gb|ESQ33990.1| hypothetical protein EUTSA_v10009438mg, partial [Eutrema salsugineum]
Length=387

 Score =   193 bits (491),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 86/168 (51%), Positives = 114/168 (68%), Gaps = 1/168 (1%)
 Frame = -2

Query  777  VNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLLQ  598
            V ELI  G + I+VP +FPIGC  S+LT + T+N  EYDP TGCL WLN+F E HN  LQ
Sbjct  211  VTELISMGGRTILVPSDFPIGCWPSFLTQYQTSNQEEYDPLTGCLKWLNEFIERHNEELQ  270

Query  597  NELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNT-VVACCGGGGPYNYDGLVDCG  421
             EL+RL+   P  TI+YADY+NA +  +  P+++GF N  + ACCG GGPY ++ +  CG
Sbjct  271  AELNRLQRLNPRVTILYADYHNALLHTFQEPTRFGFMNRPLSACCGSGGPYKFNSVRQCG  330

Query  420  SASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGECI  277
            +     C +PS Y+ WDG HLTE+AY+WIA GLL+G YT P  +  C+
Sbjct  331  TKGVDCCVDPSKYVHWDGFHLTESAYRWIALGLLEGNYTVPAFDWSCL  378



>gb|KJB62810.1| hypothetical protein B456_009G437600 [Gossypium raimondii]
Length=391

 Score =   193 bits (491),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 88/169 (52%), Positives = 120/169 (71%), Gaps = 1/169 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++ ELI  GA  I+VPGN PIGCS +YLT+F  ++ ++YDP TGC+ WLN FSE+HN  L
Sbjct  214  AIAELIGLGAVTILVPGNLPIGCSPAYLTYFQGSDMADYDPLTGCITWLNQFSEFHNEQL  273

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGLVDCG  421
            Q +LD++R+ + +  IIYADYYN AMR Y+S +++GF  T+ ACCGGGG YNY   + CG
Sbjct  274  QEKLDQVRKLHRNVNIIYADYYNTAMRFYHSLNQFGFTETLRACCGGGGRYNYSSSMACG  333

Query  420  SAS-STVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGECI  277
                +T C++PSS++SWDG H TEA Y+WI+ G+L+  Y  P  N  C 
Sbjct  334  DLPLTTSCNDPSSHVSWDGLHYTEATYRWISKGVLEELYAIPYTNSLCF  382



>ref|XP_003546023.2| PREDICTED: GDSL esterase/lipase At1g31550-like [Glycine max]
Length=391

 Score =   193 bits (491),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 91/168 (54%), Positives = 121/168 (72%), Gaps = 2/168 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            +VNELI  GA+ +IVPGN P+GCS +YLT + T + ++YD + GCL WLN+F+EY+N+ L
Sbjct  216  AVNELIGLGARTLIVPGNLPLGCSINYLTIYETMDKNQYD-QYGCLKWLNEFAEYYNQKL  274

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGLVDCG  421
            Q+ELDRLR  +    IIYADYYNA + LY++ + +GF N +  CCG GGPYNY+   DCG
Sbjct  275  QSELDRLRGLHSHANIIYADYYNATLPLYHNTTMFGFTN-LKTCCGMGGPYNYNAAADCG  333

Query  420  SASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGECI  277
               +  CD+PS +I WD  H TEAAY+ IA+GL+KGPY  PQ N  C+
Sbjct  334  DPGAIACDDPSKHIGWDSVHFTEAAYRIIAEGLIKGPYCLPQFNTFCL  381



>gb|EMT22799.1| GDSL esterase/lipase [Aegilops tauschii]
Length=445

 Score =   194 bits (494),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 87/161 (54%), Positives = 113/161 (70%), Gaps = 0/161 (0%)
 Frame = -2

Query  774  NELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLLQN  595
             +LI  GA+ ++VPGN PIGC   YLT + + +T +Y+  TGC+ W+N+FS YHN+LL +
Sbjct  260  TDLIGLGAKTLLVPGNLPIGCLPVYLTMYQSDDTGDYESDTGCIRWMNEFSRYHNKLLVD  319

Query  594  ELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGLVDCGSA  415
            EL++LR+ +P  +IIYADYY AAM ++ SPS++G KN +VACCG  GPY       CG  
Sbjct  320  ELEKLRKLHPSVSIIYADYYGAAMEIFVSPSQFGIKNPLVACCGVEGPYGVSITTKCGHG  379

Query  414  SSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQI  292
               VCDNP  Y SWDG H TE +YK IADGLL+GPYT P I
Sbjct  380  EYKVCDNPQKYASWDGLHPTETSYKAIADGLLRGPYTQPPI  420



>ref|XP_010912671.1| PREDICTED: GDSL esterase/lipase At1g31550-like [Elaeis guineensis]
Length=436

 Score =   194 bits (493),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 93/185 (50%), Positives = 129/185 (70%), Gaps = 8/185 (4%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++  LIE GA+ ++VPGNFPIGC+++YLT F +  + +YD   GC+ WLN FS YHN  L
Sbjct  248  AITALIELGARTLVVPGNFPIGCNSAYLTVFHSNRSEDYD-AFGCIKWLNKFSRYHNNQL  306

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNTVV-ACCGGGGPYNYDGLVDC  424
            +  L R+R++ P  T+IYADYY+AAM ++ SP   GF+++ + ACCGGGGPYN++  + C
Sbjct  307  RVVLKRIRQRNPHATVIYADYYSAAMSMFRSPQLSGFRSSPLPACCGGGGPYNFNSFLQC  366

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGECIFRSPKTKLSDS  244
            G+  S VC +PSSY++WDG H+TEAAY+ IA GLL+GP   P I   C    P+TK   S
Sbjct  367  GNPGSNVCADPSSYVTWDGMHMTEAAYRKIATGLLEGPNAVPPILNTC----PRTKQKTS  422

Query  243  *LRPN  229
              RP+
Sbjct  423  --RPH  425



>ref|XP_010925696.1| PREDICTED: GDSL esterase/lipase At5g45910-like isoform X1 [Elaeis 
guineensis]
Length=377

 Score =   192 bits (489),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 86/161 (53%), Positives = 113/161 (70%), Gaps = 0/161 (0%)
 Frame = -2

Query  771  ELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLLQNE  592
             LI++GA  ++VPGN P GCS+ YLT F + N  EYDP TGCL WLN F++YH+ LL+  
Sbjct  213  RLIKNGAVNLLVPGNLPFGCSSVYLTVFNSPNKEEYDPTTGCLKWLNAFAKYHDALLRRA  272

Query  591  LDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGLVDCGSAS  412
            LD LR +YP   I+YADYY A++++  SP ++GF + ++ACCGG GPYN+  L  CG   
Sbjct  273  LDELRRKYPRARIMYADYYGASIQIGRSPQRFGFDDVLIACCGGDGPYNFSPLAFCGQPG  332

Query  411  STVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQIN  289
            S+VC   SS  +WDG HLTEAAY +IA  LL GPYT+P + 
Sbjct  333  SSVCSCLSSRANWDGLHLTEAAYHFIATSLLDGPYTSPPLR  373



>ref|XP_007148064.1| hypothetical protein PHAVU_006G177500g [Phaseolus vulgaris]
 gb|ESW20058.1| hypothetical protein PHAVU_006G177500g [Phaseolus vulgaris]
Length=380

 Score =   192 bits (489),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 91/164 (55%), Positives = 113/164 (69%), Gaps = 2/164 (1%)
 Frame = -2

Query  777  VNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLLQ  598
            + ELI+ GA   +VPG  P+GC+++YLT F T +  EYD + GCL WLN F EYHN LLQ
Sbjct  206  IRELIDLGAVTFMVPGMLPLGCNSAYLTRFETTDKEEYD-QVGCLKWLNTFYEYHNELLQ  264

Query  597  NELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFK-NTVVACCGGGGPYNYDGLVDCG  421
             EL++LR  Y  T IIYADY+NAA++LY SP ++GF  N +  CCG  G YNY+    CG
Sbjct  265  IELNQLRGLYSHTNIIYADYFNAALQLYKSPEQFGFGGNVLKVCCGVDGSYNYNDTYKCG  324

Query  420  SASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQIN  289
             A    CD+PS YISWDG H+TEAAY+WIA  LL G YT P+ N
Sbjct  325  EAGVVACDDPSQYISWDGYHMTEAAYRWIAIALLDGSYTIPKFN  368



>ref|XP_003542991.1| PREDICTED: GDSL esterase/lipase At1g28600-like isoform X1 [Glycine 
max]
 ref|XP_006594559.1| PREDICTED: GDSL esterase/lipase At1g28600-like isoform X2 [Glycine 
max]
 ref|XP_006594560.1| PREDICTED: GDSL esterase/lipase At1g28600-like isoform X3 [Glycine 
max]
Length=378

 Score =   192 bits (489),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 91/171 (53%), Positives = 119/171 (70%), Gaps = 2/171 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            +VNELI  GA+ +IVPGN P+GCS +YLT + T + ++YD + GCL WLN F+EY+N+ L
Sbjct  203  AVNELIGLGARTLIVPGNIPLGCSITYLTIYETMDKNQYD-QYGCLKWLNKFAEYYNQKL  261

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGLVDCG  421
            Q+EL RL+  +    IIYADYYNA + LY  P+ +GF N +  CCG GGPYNY+   DCG
Sbjct  262  QSELHRLQGLHSHANIIYADYYNAILSLYRDPTMFGFTN-LKTCCGMGGPYNYNASADCG  320

Query  420  SASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGECIFRS  268
                  CD+PS +I WDG HLTEAAY+ IA GL+KGPY  P+ N  C+  +
Sbjct  321  DPGVNACDDPSKHIGWDGVHLTEAAYRIIAQGLIKGPYCLPRFNTLCLINT  371



>gb|KHG23842.1| hypothetical protein F383_29871 [Gossypium arboreum]
Length=379

 Score =   192 bits (489),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 87/156 (56%), Positives = 115/156 (74%), Gaps = 1/156 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            +++ELIE GA   +VPGNFPIGCS   LT++  +N  +YDP TGCL WLN FS++HN LL
Sbjct  213  AIHELIELGAMTFLVPGNFPIGCSPELLTNYQGSNKDKYDPLTGCLTWLNQFSQHHNELL  272

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGLVDCG  421
            + EL++LR ++PD  I+YADYYN AMR Y+SP ++GFK T+ ACCG GG YNY+    CG
Sbjct  273  RTELEKLRNRHPDINIVYADYYNIAMRFYHSPKQFGFKETLKACCGIGGLYNYNSSRSCG  332

Query  420  -SASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLK  316
                 + C++PSSYISWDG H TEAA KW+A+ + +
Sbjct  333  YPPLKSSCNDPSSYISWDGIHYTEAANKWLANVVFE  368



>ref|XP_010499396.1| PREDICTED: GDSL esterase/lipase At1g28580-like [Camelina sativa]
Length=397

 Score =   193 bits (490),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 87/169 (51%), Positives = 113/169 (67%), Gaps = 1/169 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++ ELI  G +  +VPG+FP+GCSA+YLT + T+N   YDP TGCL WLN F E H+  L
Sbjct  210  AITELIGMGGRTFLVPGDFPLGCSATYLTLYQTSNVEAYDPWTGCLTWLNKFGENHDEQL  269

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNT-VVACCGGGGPYNYDGLVDC  424
            Q EL +L++ YP   IIYADYY A +R+Y  P K+GF N  + ACCG GGPYN+     C
Sbjct  270  QAELKKLQKLYPHVNIIYADYYKALLRIYQEPEKFGFMNRPLSACCGVGGPYNFTSFWQC  329

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGECI  277
            G+     C+ PS Y++WDG H+TEAAY  IA+G+LKG Y  P  N  C+
Sbjct  330  GTDVVEGCNYPSKYVAWDGVHMTEAAYSLIAEGILKGAYAVPPFNWSCL  378



>ref|XP_010462953.1| PREDICTED: GDSL esterase/lipase At1g28580-like [Camelina sativa]
Length=370

 Score =   192 bits (488),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 89/169 (53%), Positives = 111/169 (66%), Gaps = 1/169 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++ ELI  G +  +VPG FP+GCS  Y T + T N  EYDP TGCL WLN F EYHN  L
Sbjct  184  AITELIGMGGKAFLVPGEFPMGCSVVYWTIYQTTNMEEYDPLTGCLKWLNKFGEYHNEQL  243

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNT-VVACCGGGGPYNYDGLVDC  424
            Q EL+RL++ YP   IIYADYYN    ++  P+K+GF N  + ACCG GGPYNY     C
Sbjct  244  QVELNRLQKLYPHVNIIYADYYNVLSSIFQEPAKFGFINRPLSACCGFGGPYNYTVGKKC  303

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGECI  277
            G+     C +PS Y++WDG HLTEAAY  IA+G+L GPYT P  +  C+
Sbjct  304  GTDVVEGCSDPSKYVAWDGVHLTEAAYSLIAEGILSGPYTIPPFDWSCL  352



>ref|XP_004248142.1| PREDICTED: GDSL esterase/lipase At1g28610 [Solanum lycopersicum]
Length=388

 Score =   192 bits (489),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/168 (54%), Positives = 118/168 (70%), Gaps = 2/168 (1%)
 Frame = -2

Query  777  VNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLLQ  598
            + E+I+ GA  ++VPG+ P+GCS + LT FM +N  +YDP TGC+NWLN FS+ +N+LLQ
Sbjct  208  IKEVIKFGASRVVVPGSMPLGCSTALLTIFMDSNKEDYDPITGCINWLNQFSKNYNKLLQ  267

Query  597  NELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGF-KNTVVACCGGGGPYNYDGLVDCG  421
             EL  +R+ +P  TIIYAD+YNAAM+ Y SP+ YGF K  +VACCG GGPYNY     CG
Sbjct  268  MELHLVRQLHPSVTIIYADHYNAAMQFYLSPNTYGFTKGALVACCGAGGPYNYKLFELCG  327

Query  420  SASS-TVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGEC  280
              ++  +C +PS Y SWDG H TEAAYK IA  LL+G +T P +   C
Sbjct  328  DPTARNICSDPSIYASWDGMHFTEAAYKLIATSLLEGNFTFPSLPKIC  375



>ref|XP_010455496.1| PREDICTED: GDSL esterase/lipase At1g31550-like isoform X1 [Camelina 
sativa]
Length=396

 Score =   192 bits (489),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 93/176 (53%), Positives = 118/176 (67%), Gaps = 2/176 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++ ELI  G +  +VPG FPIGCS +YLT + T+N  EYDP  GCL WLN F EYH+  L
Sbjct  210  AITELISMGGRTFLVPGEFPIGCSVAYLTLYQTSNMEEYDP-FGCLKWLNKFGEYHDEQL  268

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNT-VVACCGGGGPYNYDGLVDC  424
            + EL RLR+      IIYADYYNA + L   P+KYGF N  + ACCG G PYN++    C
Sbjct  269  EAELKRLRKLNHHVNIIYADYYNALLGLNQEPTKYGFINKPLSACCGVGEPYNFNFSTCC  328

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGECIFRSPKTK  256
            GS     C++PS Y++WDG H+TEAAYK++ADG+LKGPYT+P  N  C+    K K
Sbjct  329  GSFGVDSCNDPSKYVAWDGIHMTEAAYKFMADGILKGPYTSPPFNWTCLSSKIKNK  384



>ref|XP_010912608.1| PREDICTED: GDSL esterase/lipase At1g28570-like isoform X2 [Elaeis 
guineensis]
Length=405

 Score =   193 bits (490),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 87/167 (52%), Positives = 116/167 (69%), Gaps = 1/167 (1%)
 Frame = -2

Query  777  VNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLLQ  598
            +++LI+ GA+ ++VPG FP GC   YLT   +    +YDP TGC+ W+N+FS YHN+LLQ
Sbjct  221  IDDLIKLGAKTLVVPGIFPSGCVPVYLTWMQSEIVEDYDPDTGCIKWVNEFSAYHNQLLQ  280

Query  597  NELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNTVV-ACCGGGGPYNYDGLVDCG  421
            NELDR+R  +P  TIIYADYY A M ++ SP K+GFK   + ACCGGGGPYN +  + CG
Sbjct  281  NELDRIRRLHPHVTIIYADYYEALMSVFRSPEKFGFKKAPLDACCGGGGPYNVNFSLPCG  340

Query  420  SASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGEC  280
               +TVC +PS ++ WD +H TEAA + +A GLL+GPY  P I   C
Sbjct  341  GPMATVCKDPSKFVFWDDAHPTEAATEIVARGLLEGPYAYPPILQAC  387



>dbj|BAK06933.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=401

 Score =   192 bits (489),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 88/164 (54%), Positives = 113/164 (69%), Gaps = 0/164 (0%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            +V ELI  GA+ ++VPGN PIGC  +YL  F +    +YDP+TGCL W+N+FS+YHNRLL
Sbjct  214  TVTELIGLGAKTLVVPGNLPIGCVPNYLMIFKSDKKEDYDPETGCLRWMNEFSKYHNRLL  273

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGLVDCG  421
             +EL++LR  +   +IIYADYY AAM +Y SP ++G  + + ACCGGGGPY       CG
Sbjct  274  IDELEKLRNFHHGVSIIYADYYGAAMEIYRSPEQFGIDHPLAACCGGGGPYGVSMTARCG  333

Query  420  SASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQIN  289
                 VCD+P  Y SWDG H +EAAYK IA GLL+G YT P I+
Sbjct  334  YGEYKVCDDPQKYGSWDGFHPSEAAYKGIAIGLLRGTYTQPSIS  377



>ref|XP_010478243.1| PREDICTED: GDSL esterase/lipase At1g28650 [Camelina sativa]
Length=367

 Score =   192 bits (487),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 88/169 (52%), Positives = 116/169 (69%), Gaps = 2/169 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++ +LI+ G +  +VPGNFPIGCS +YLT F TA   E+DP TGC+ WLN F+E+HN  L
Sbjct  197  AIVDLIDLGGKTFLVPGNFPIGCSTAYLTLFQTAKV-EHDPFTGCIPWLNKFAEHHNEQL  255

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNT-VVACCGGGGPYNYDGLVDC  424
            + EL RL+  YP   IIYADYYN+  R +  P+KYGF+N  + ACCG GG YN+    +C
Sbjct  256  KTELKRLQNLYPHVNIIYADYYNSLYRFFQEPAKYGFRNRPLAACCGVGGQYNFTIGKEC  315

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGECI  277
            G    + C NPS Y++WDG HLTEA Y+ +A GLL GPYT+P  +  C+
Sbjct  316  GDKRVSYCQNPSVYVNWDGYHLTEATYRKMAQGLLNGPYTSPAFDWSCL  364



>ref|XP_008812183.1| PREDICTED: GDSL esterase/lipase At1g31550-like [Phoenix dactylifera]
Length=395

 Score =   192 bits (488),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 93/184 (51%), Positives = 127/184 (69%), Gaps = 7/184 (4%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++  LIE GA+ ++VPGNFPIGC+++YLT F +  + +YD   GC+ WLN FS +HN  L
Sbjct  208  AITALIELGARTLVVPGNFPIGCNSAYLTVFRSNRSEDYD-AIGCIKWLNKFSRFHNNRL  266

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFK-NTVVACCGGGGPYNYDGLVDC  424
            +  L+R+R + P  T+IYADYY+AAM L++SP   GF+ + + ACCGGGGPYNY+  + C
Sbjct  267  RVVLNRVRLRNPHATVIYADYYSAAMSLFSSPEPSGFRISPLPACCGGGGPYNYNSSLQC  326

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGECI-----FRSPKT  259
            G++ S +C +PS YI+WDG H+TEAAY+ IA GLLKGP   P I   C      F  P+ 
Sbjct  327  GNSGSNICADPSIYITWDGMHMTEAAYRKIAIGLLKGPNAVPAILNTCPQTNQEFSRPQY  386

Query  258  KLSD  247
             LSD
Sbjct  387  VLSD  390



>ref|NP_001043721.1| Os01g0649900 [Oryza sativa Japonica Group]
 dbj|BAB89190.1| lipase-like [Oryza sativa Japonica Group]
 dbj|BAF05635.1| Os01g0649900 [Oryza sativa Japonica Group]
 gb|EAY75183.1| hypothetical protein OsI_03073 [Oryza sativa Indica Group]
 gb|EAZ12905.1| hypothetical protein OsJ_02826 [Oryza sativa Japonica Group]
Length=400

 Score =   192 bits (489),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 87/162 (54%), Positives = 113/162 (70%), Gaps = 0/162 (0%)
 Frame = -2

Query  777  VNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLLQ  598
            + ELI  GA+ ++VPGN PIGC   YL  F +    +Y+PK GCL W+N+FS+YHN+LL 
Sbjct  214  ITELIGLGAKTLVVPGNIPIGCIPMYLMQFESDKKEDYEPKIGCLRWMNEFSQYHNKLLV  273

Query  597  NELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGLVDCGS  418
            +EL+ LR+ + D TIIYADYY AAM ++ SP ++G ++ +VACCGG GPY     V CG 
Sbjct  274  DELENLRKLHLDVTIIYADYYGAAMEVFLSPERFGIEDPLVACCGGRGPYGVSASVRCGY  333

Query  417  ASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQI  292
                VCD+P+ Y SWDG H +EAAYK IA GLL+G YT P I
Sbjct  334  GEYKVCDDPAKYASWDGFHPSEAAYKGIAIGLLQGSYTQPPI  375



>gb|KJB62807.1| hypothetical protein B456_009G437300 [Gossypium raimondii]
Length=401

 Score =   192 bits (489),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 88/157 (56%), Positives = 114/157 (73%), Gaps = 1/157 (1%)
 Frame = -2

Query  783  FSVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRL  604
            F + ELIE GA   +VPGNFPIGCS   LT++  +N  +YDP TGCL WLN FS++HN L
Sbjct  234  FPMQELIELGAVTFLVPGNFPIGCSPDLLTNYQGSNKDKYDPLTGCLTWLNQFSQHHNEL  293

Query  603  LQNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGLVDC  424
            L+ EL++LR ++PD  I+YADYYN AMR Y+SP ++GFK T+ ACCG GG YNY+    C
Sbjct  294  LRTELEKLRNRHPDINIVYADYYNIAMRFYHSPKQFGFKETLKACCGIGGLYNYNSSRSC  353

Query  423  G-SASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLK  316
            G     + C++PSSYISWDG H TEAA KW+A+ + +
Sbjct  354  GYPPLKSSCNDPSSYISWDGIHYTEAANKWLANVVFE  390



>ref|XP_009608032.1| PREDICTED: GDSL esterase/lipase At5g45910 isoform X2 [Nicotiana 
tomentosiformis]
Length=340

 Score =   191 bits (484),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 92/159 (58%), Positives = 111/159 (70%), Gaps = 1/159 (1%)
 Frame = -2

Query  768  LIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLLQNEL  589
            LIE GA  +IVPGN PIGCSA YLT F T N + YD K GCL   N FS+YHN  L+  L
Sbjct  175  LIEEGAVELIVPGNLPIGCSALYLTLFGTTNKAAYD-KNGCLKAYNAFSKYHNSQLKLSL  233

Query  588  DRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGLVDCGSASS  409
            ++LRE+YP   IIYADYY AA RL+++P  YGF NT+VACCGGGGPYN++    CG   S
Sbjct  234  EKLREEYPHAKIIYADYYGAAKRLFHAPKHYGFFNTLVACCGGGGPYNFNNSARCGHIGS  293

Query  408  TVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQI  292
              C + S + +WDG HLTEAAY  IA GLL G +T+P +
Sbjct  294  KACLDSSKFANWDGIHLTEAAYHHIAKGLLNGLFTSPPL  332



>emb|CDM80951.1| unnamed protein product [Triticum aestivum]
Length=231

 Score =   187 bits (475),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 83/161 (52%), Positives = 111/161 (69%), Gaps = 0/161 (0%)
 Frame = -2

Query  774  NELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLLQN  595
             +LI  GA+ ++VPGN PIGC   YLT + + +T +Y+  TGC+ W+N+FS YHN+LL +
Sbjct  46   TDLIGLGAKTLLVPGNLPIGCLPVYLTMYQSDDTGDYESDTGCIRWMNEFSRYHNKLLVD  105

Query  594  ELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGLVDCGSA  415
            EL++LR+ +P  +IIYADYY AAM ++ SP  +G ++ +VACCG  GPY       CG  
Sbjct  106  ELEKLRKLHPSVSIIYADYYGAAMEIFVSPYLFGIEDPLVACCGVEGPYGVSVTTKCGHG  165

Query  414  SSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQI  292
               VCDNP  Y SWDG H TE +Y+ IADGLL+GPYT P I
Sbjct  166  EYKVCDNPQKYASWDGLHPTETSYRAIADGLLRGPYTQPPI  206



>ref|XP_002456052.1| hypothetical protein SORBIDRAFT_03g029580 [Sorghum bicolor]
 gb|EES01172.1| hypothetical protein SORBIDRAFT_03g029580 [Sorghum bicolor]
Length=399

 Score =   192 bits (488),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 85/163 (52%), Positives = 114/163 (70%), Gaps = 0/163 (0%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            +++ELI+ GA+ ++VPGN PIGC   YL  F +    +Y+P+TGCL W+N+FS+YHN+LL
Sbjct  212  TISELIQLGAKTLMVPGNLPIGCVPDYLMIFKSDKEEDYEPQTGCLRWMNEFSQYHNKLL  271

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGLVDCG  421
              EL +LR+ +P  TIIYADYY AAM ++ SP +YG ++ +VACCGG GPY     + CG
Sbjct  272  VEELKKLRKLHPGVTIIYADYYGAAMEIFLSPEQYGIEHPLVACCGGEGPYGVSPTITCG  331

Query  420  SASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQI  292
                 +CDNP  Y SWDG H +E+AY+ IA GLL G YT P I
Sbjct  332  FGEYKLCDNPEKYGSWDGFHPSESAYRAIATGLLLGSYTRPSI  374



>dbj|BAJ98364.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ87933.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=391

 Score =   192 bits (487),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 84/163 (52%), Positives = 115/163 (71%), Gaps = 0/163 (0%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++ +LI  GA+ ++VPGN PIGC   YLT + T N  +Y+ +TGC+ W+N+FS YHN+LL
Sbjct  204  TITDLIGLGAKTLVVPGNLPIGCLPVYLTMYQTDNMGDYESETGCIRWMNEFSRYHNKLL  263

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGLVDCG  421
             +EL++LR+ +P  +IIYADYY AAM ++ SP K+G ++ ++ACCG  GPY       CG
Sbjct  264  VDELEKLRKLHPSASIIYADYYGAAMEIFVSPYKFGIEDPLMACCGVEGPYGVSITTKCG  323

Query  420  SASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQI  292
                 VCDNP +Y SWDG H TE +Y+ IADGLL+GPYT P I
Sbjct  324  HGEYKVCDNPQNYASWDGLHPTETSYRVIADGLLRGPYTQPPI  366



>ref|XP_010480702.1| PREDICTED: uncharacterized protein LOC104759479 [Camelina sativa]
Length=826

 Score =   198 bits (503),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 87/169 (51%), Positives = 116/169 (69%), Gaps = 1/169 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++ ELI  G +  +VPG FP+GC  +YLT + T+N  EYDP TGCL WLN F E H+  L
Sbjct  209  AITELIGMGGKTFLVPGEFPMGCLVAYLTLYQTSNKEEYDPLTGCLTWLNKFGENHDGQL  268

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNT-VVACCGGGGPYNYDGLVDC  424
            + EL+RL++ YP   IIYADYYNA +R Y  P+K+GF +  + ACCG GGPYNY  +  C
Sbjct  269  RAELNRLQKLYPHVNIIYADYYNALLRFYQEPAKFGFMDRPLSACCGVGGPYNYTSVTQC  328

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGECI  277
            G+     C +PS Y++WDG H+TEAAY+ I+DG+LKGPY  P  +  C+
Sbjct  329  GTDVVEGCSDPSKYVAWDGVHMTEAAYRLISDGILKGPYAVPPFDWSCL  377


 Score =   189 bits (480),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 89/169 (53%), Positives = 111/169 (66%), Gaps = 1/169 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++ ELI  G +  +VPG FP+GCS  YLT + TAN  EYDP TGCL  LN F EYHN  L
Sbjct  637  AITELIGMGGKTFLVPGEFPMGCSVVYLTIYHTANMEEYDPLTGCLKLLNKFGEYHNEQL  696

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNT-VVACCGGGGPYNYDGLVDC  424
            Q EL+RL++ YP   IIYADYYN    ++  P+K+GF N  + ACCG GGPYN      C
Sbjct  697  QVELNRLQKLYPRVNIIYADYYNVLSSIFQEPAKFGFINRPLSACCGFGGPYNDTVGKKC  756

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGECI  277
            G+     C +PS Y++WDG HLTEAAY  IA+G+L GPYT P  +  C+
Sbjct  757  GTDVVEGCSDPSKYVAWDGVHLTEAAYSLIAEGILSGPYTIPPFDWSCL  805



>dbj|BAJ93079.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=432

 Score =   192 bits (489),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 88/164 (54%), Positives = 113/164 (69%), Gaps = 0/164 (0%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            +V ELI  GA+ ++VPGN PIGC  +YL  F +    +YDP+TGCL W+N+FS+YHNRLL
Sbjct  214  TVTELIGLGAKTLVVPGNLPIGCVPNYLMIFKSDKKEDYDPETGCLRWMNEFSKYHNRLL  273

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGLVDCG  421
             +EL++LR  +   +IIYADYY AAM +Y SP ++G  + + ACCGGGGPY       CG
Sbjct  274  IDELEKLRNFHHGVSIIYADYYGAAMEIYRSPEQFGIDHPLAACCGGGGPYGVSMTARCG  333

Query  420  SASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQIN  289
                 VCD+P  Y SWDG H +EAAYK IA GLL+G YT P I+
Sbjct  334  YGEYKVCDDPQKYGSWDGFHPSEAAYKGIAIGLLRGTYTQPSIS  377



>ref|XP_010461021.1| PREDICTED: GDSL esterase/lipase At1g31550-like [Camelina sativa]
Length=396

 Score =   191 bits (486),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 92/176 (52%), Positives = 116/176 (66%), Gaps = 2/176 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++ ELI  G +  +VPG FP GCS +YLT + T+N  EYD   GCL WLN F+EYH+  L
Sbjct  210  AITELIGMGGRTFLVPGEFPKGCSVAYLTLYQTSNLEEYD-SFGCLKWLNKFAEYHDEQL  268

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGF-KNTVVACCGGGGPYNYDGLVDC  424
            Q EL RLR+  P   II+ADYYN  +RL   PSKYGF K  + ACCG GG YN++    C
Sbjct  269  QAELKRLRKLNPHVNIIFADYYNTLLRLNQEPSKYGFIKEPLSACCGVGGTYNFNLSTGC  328

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGECIFRSPKTK  256
            G+     C++PS Y++WDG H+TEAAYK +ADGLLKGPY TP  +  C+    K K
Sbjct  329  GNVGVESCNDPSKYVAWDGIHMTEAAYKSMADGLLKGPYATPPFSWSCLSSKIKNK  384



>ref|XP_003569458.1| PREDICTED: GDSL esterase/lipase At1g28600-like [Brachypodium 
distachyon]
Length=395

 Score =   191 bits (485),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 87/164 (53%), Positives = 111/164 (68%), Gaps = 1/164 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++ ELIE GAQ ++VPGN PIGC   YL  + +    +Y+P+TGC+ W+N FS YHN+LL
Sbjct  206  TIAELIELGAQTLVVPGNLPIGCIPMYLMMYKSNKPEDYEPETGCIRWMNKFSRYHNKLL  265

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGG-GPYNYDGLVDC  424
              EL++LR+ +P   IIYADYY AAM +Y+SP ++  +N +VACCGGG  PY       C
Sbjct  266  VGELEKLRKLHPGVAIIYADYYGAAMEIYSSPEQFEIENPLVACCGGGEEPYGVSRAAGC  325

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQI  292
            G     VC +P  Y SWDG H TEA YK IADGLL+GPYT P I
Sbjct  326  GHGEYKVCSDPQKYGSWDGFHPTEAVYKAIADGLLRGPYTQPAI  369



>gb|KJB63193.1| hypothetical protein B456_009G437100 [Gossypium raimondii]
Length=399

 Score =   191 bits (486),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 91/169 (54%), Positives = 114/169 (67%), Gaps = 2/169 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            S+NELIE GA   +VPGNFPIGCS S LT F  +   +YDP TGCL WLN FS++HN LL
Sbjct  214  SINELIELGAMTFLVPGNFPIGCSPSLLTKFHGSERDQYDPLTGCLTWLNRFSQHHNELL  273

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGLVDCG  421
            + EL+ +R  +P   IIY DYY AA+R Y+SP ++GFK T+ ACCG GG YNYD L+ CG
Sbjct  274  RKELENIRSLHPQINIIYVDYYKAAVRFYHSPKQFGFKETLKACCGIGGLYNYDPLIFCG  333

Query  420  SAS-STVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTT-PQINGEC  280
                   C++PSSYISWDG H TEA  KW+A  + +   +T P +   C
Sbjct  334  YPQLKQCCNDPSSYISWDGIHYTEAVNKWLAHTVFEELMSTIPSLGSLC  382



>ref|XP_011096449.1| PREDICTED: uncharacterized protein LOC105175645 [Sesamum indicum]
Length=1007

 Score =   199 bits (505),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 101/168 (60%), Positives = 127/168 (76%), Gaps = 1/168 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++ ELI  GA  ++VPGNFPIGCS++YLT+F++ N  +Y+P TGC+ WLN F++YHN LL
Sbjct  605  AITELINLGAVTLMVPGNFPIGCSSAYLTYFLSENQDDYEPATGCIKWLNRFAQYHNDLL  664

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGF-KNTVVACCGGGGPYNYDGLVDC  424
            + EL R+RE +P TTIIYADYYNA M LY SP ++GF    + ACCGGGGPYN +  V C
Sbjct  665  KKELARIRELHPHTTIIYADYYNAVMDLYRSPIEHGFAGGALGACCGGGGPYNCNLTVHC  724

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGEC  280
            G   S  CD+PS Y++WDG H TEAAYKWIA GLLKGPYTTP ++  C
Sbjct  725  GYPPSNTCDDPSLYVNWDGMHFTEAAYKWIALGLLKGPYTTPPLSTVC  772


 Score =   192 bits (488),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 93/171 (54%), Positives = 117/171 (68%), Gaps = 5/171 (3%)
 Frame = -2

Query  777  VNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTS-EYDPKTGCLNWLNDFSEYHNRLL  601
            + ELI+ GA+ ++VPGN  +GC   YLT + T++T  +YDPKTGCLNWLN+ S YHN LL
Sbjct  203  IEELIKLGAETMLVPGNLALGCLPLYLTQYKTSSTENDYDPKTGCLNWLNELSIYHNELL  262

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNTVV--ACCGGGGPYNYDGLVD  427
            Q EL R+R  +P  +IIYADYYNA +R Y SP ++GF    V  ACCGGGGPYNYD L  
Sbjct  263  QKELFRIRHLHPRISIIYADYYNATIRFYLSPDQFGFTKESVLRACCGGGGPYNYDPLTA  322

Query  426  CG--SASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGEC  280
            CG    ++  C+NPS + SWDG H TEAA +WIA G ++  YT P I   C
Sbjct  323  CGIDRPAANCCENPSLFASWDGIHFTEAANRWIAQGFIRQHYTHPPIKTLC  373



>tpg|DAA58330.1| TPA: hypothetical protein ZEAMMB73_195608 [Zea mays]
Length=231

 Score =   186 bits (472),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 83/164 (51%), Positives = 111/164 (68%), Gaps = 0/164 (0%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            +++ELI  GA+ ++VPGN PIGC   YL  F +    +Y+P+TGCL W+N+FS+YHN++L
Sbjct  44   TISELIRLGAKTLVVPGNLPIGCIPDYLMIFKSNKEEDYEPQTGCLRWMNEFSQYHNKVL  103

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGLVDCG  421
              +L +LR+ +P  TIIYADYY AAM ++ SP +YG +  +VACCGG GPY       CG
Sbjct  104  VEQLKKLRKLHPGATIIYADYYGAAMEIFLSPEQYGIEYPLVACCGGEGPYGVSPSTGCG  163

Query  420  SASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQIN  289
                 +CDNP  Y SWDG H +E+AY+ IA GLL G YT P I 
Sbjct  164  FGEYKLCDNPEKYGSWDGFHPSESAYRAIAMGLLLGSYTRPSIT  207



>ref|XP_006367777.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Solanum tuberosum]
Length=368

 Score =   190 bits (482),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 92/159 (58%), Positives = 110/159 (69%), Gaps = 1/159 (1%)
 Frame = -2

Query  768  LIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLLQNEL  589
            LIE GA  +IVPGNFPIGCSA +LT F T N   YD K GCL   N FS+YHN  L+  +
Sbjct  203  LIEEGAVELIVPGNFPIGCSAVFLTIFGTTNKEAYD-KHGCLKAYNAFSKYHNAKLKLGI  261

Query  588  DRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGLVDCGSASS  409
            + LR++YP   IIYADYY AA RL +SP  YGF NT+VACCGGGGPYN++    CG   S
Sbjct  262  ENLRKEYPHAKIIYADYYGAAKRLIHSPKHYGFSNTLVACCGGGGPYNFNNSARCGHIGS  321

Query  408  TVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQI  292
              C + SS+ +WDG HLTEAAY  IA GLL GP+ +P +
Sbjct  322  KACLDASSFANWDGIHLTEAAYHHIAKGLLNGPFISPSL  360



>emb|CDY30822.1| BnaC05g21980D [Brassica napus]
Length=401

 Score =   191 bits (484),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 87/169 (51%), Positives = 114/169 (67%), Gaps = 2/169 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++ ELI  G +  +VPG FPIGCS +YLT + T+N  EYDP +GCL WLN F++YH+  L
Sbjct  215  AITELIGMGGRTFLVPGEFPIGCSVTYLTLYQTSNKEEYDP-SGCLKWLNKFAKYHSDQL  273

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNTVV-ACCGGGGPYNYDGLVDC  424
            Q EL++LRE YP   IIYADYYNA +RL+  P  +GF +  + ACCG GGPYN+     C
Sbjct  274  QAELNKLRELYPHVNIIYADYYNALLRLFQEPGNFGFIDRPLHACCGFGGPYNFTFGRKC  333

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGECI  277
            G      C +PS YI WDG H+TEA Y+ +A+G+LKGPY  P  +  C+
Sbjct  334  GFKGVESCSDPSKYICWDGVHMTEATYRLMAEGILKGPYAIPPFDWSCL  382



>emb|CDO96752.1| unnamed protein product [Coffea canephora]
Length=385

 Score =   190 bits (483),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 88/171 (51%), Positives = 118/171 (69%), Gaps = 4/171 (2%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTS---EYDPKTGCLNWLNDFSEYHN  610
            ++ ++I  GA   IVPGN P+GC A+YLT+F  +N     +YD   GC+NWLNDF+++HN
Sbjct  202  AITDMIRLGAANFIVPGNLPLGCLAAYLTYFQNSNRDYDYDYDEAPGCINWLNDFAKHHN  261

Query  609  RLLQNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFK-NTVVACCGGGGPYNYDGL  433
             +LQ EL+R+RE +P  TIIYADYYN+A+R Y  P ++GF   T+ ACCG GGPYN+D  
Sbjct  262  EVLQIELNRIRELHPHVTIIYADYYNSAIRFYRWPKEFGFTGGTLSACCGAGGPYNFDSS  321

Query  432  VDCGSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGEC  280
            V CG   +T C +PS+Y+ WDG HLTEAA + I  GL +G Y+ P I   C
Sbjct  322  VGCGDPPTTGCADPSAYVCWDGLHLTEAANRLIVKGLFEGSYSAPPIKLIC  372



>ref|XP_009608031.1| PREDICTED: GDSL esterase/lipase At5g45910 isoform X1 [Nicotiana 
tomentosiformis]
Length=366

 Score =   189 bits (481),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 92/159 (58%), Positives = 111/159 (70%), Gaps = 1/159 (1%)
 Frame = -2

Query  768  LIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLLQNEL  589
            LIE GA  +IVPGN PIGCSA YLT F T N + YD K GCL   N FS+YHN  L+  L
Sbjct  201  LIEEGAVELIVPGNLPIGCSALYLTLFGTTNKAAYD-KNGCLKAYNAFSKYHNSQLKLSL  259

Query  588  DRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGLVDCGSASS  409
            ++LRE+YP   IIYADYY AA RL+++P  YGF NT+VACCGGGGPYN++    CG   S
Sbjct  260  EKLREEYPHAKIIYADYYGAAKRLFHAPKHYGFFNTLVACCGGGGPYNFNNSARCGHIGS  319

Query  408  TVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQI  292
              C + S + +WDG HLTEAAY  IA GLL G +T+P +
Sbjct  320  KACLDSSKFANWDGIHLTEAAYHHIAKGLLNGLFTSPPL  358



>ref|NP_001149094.1| LOC100282715 precursor [Zea mays]
 gb|ACG34180.1| esterase precursor [Zea mays]
 gb|ACN34799.1| unknown [Zea mays]
 tpg|DAA58332.1| TPA: esterase [Zea mays]
Length=399

 Score =   190 bits (483),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 86/163 (53%), Positives = 110/163 (67%), Gaps = 0/163 (0%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            +++ELI+ GA+ ++VPGN PIGC   YL  F +    +YDP+TGCL W+N+FS+YHN+LL
Sbjct  212  TISELIQLGAKTLVVPGNLPIGCVPKYLMIFKSNKKEDYDPQTGCLRWMNEFSQYHNKLL  271

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGLVDCG  421
              +L +LR  +P  TIIYADYY AAM ++ SP +YG +  +VACCG  GPY       CG
Sbjct  272  VEQLKKLRRLHPGVTIIYADYYGAAMEIFLSPERYGIEYPLVACCGAEGPYGVSPTTSCG  331

Query  420  SASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQI  292
                 +CDNP  Y SWDG H TE+AYK IA GLL G YT P I
Sbjct  332  LGEYKLCDNPERYGSWDGLHPTESAYKVIAMGLLLGSYTRPPI  374



>gb|KHG11244.1| hypothetical protein F383_11796 [Gossypium arboreum]
Length=336

 Score =   189 bits (479),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 87/156 (56%), Positives = 115/156 (74%), Gaps = 1/156 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            S+NELIE GA   +VPGNFPIGC ASYLT F  ++  +YDP TGCL WLN FS++HN+LL
Sbjct  164  SINELIELGAVTFLVPGNFPIGCFASYLTLFQGSDKDQYDPLTGCLTWLNQFSQHHNQLL  223

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGLVDCG  421
            + EL+++R  +PDT I+YADYY+  +R+YNSP+K+GFK T+ ACCG GG YNY+    CG
Sbjct  224  RKELEKIRNLHPDTNIVYADYYSTTLRIYNSPNKFGFKETLKACCGTGGLYNYNLSRTCG  283

Query  420  -SASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLK  316
                   C++PSSY+SWDG H TEA  + IA+ + +
Sbjct  284  YPPLRRCCNDPSSYMSWDGIHYTEAVNRLIANVVFE  319



>ref|XP_010478236.1| PREDICTED: GDSL esterase/lipase At1g28610-like [Camelina sativa]
Length=400

 Score =   190 bits (483),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 83/168 (49%), Positives = 119/168 (71%), Gaps = 2/168 (1%)
 Frame = -2

Query  777  VNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLLQ  598
            + +L+  G + I+VP +FPIGC +++LT +  +N  EYDP TGCL  LN+F EYHN+ LQ
Sbjct  212  ITDLVNMGGKTIMVPADFPIGCWSAFLTEYWISNKEEYDPLTGCLKSLNEFIEYHNKELQ  271

Query  597  NELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKN--TVVACCGGGGPYNYDGLVDC  424
             E++R+++ YP  TI+YADYYNA +R++  P+K+GF +   + ACCG G PYN++ +  C
Sbjct  272  EEINRVQKLYPHVTILYADYYNALLRIFLEPAKFGFTSGRPLSACCGTGEPYNFNSMSWC  331

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGEC  280
            G+ +   C +PS Y+ WDG HLTE+AY+WIA G LKGPYT P  +  C
Sbjct  332  GTKNVDSCIDPSKYVHWDGFHLTESAYRWIAMGFLKGPYTIPAYDWSC  379



>ref|XP_011626558.1| PREDICTED: GDSL esterase/lipase At1g28590-like [Amborella trichopoda]
Length=370

 Score =   189 bits (480),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 88/163 (54%), Positives = 116/163 (71%), Gaps = 2/163 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            +V ELI  GA+ ++VPGN PIGCS SYLT F T++  +YDP+TGCL  LNDF+ +HN  L
Sbjct  205  AVTELILKGAETLVVPGNLPIGCSTSYLTAFQTSDKQQYDPQTGCLTHLNDFACHHNSKL  264

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGF-KNT-VVACCGGGGPYNYDGLVD  427
            Q+ +  +RE++P   I+YADYYN+AMR + +P  +GF K T + ACCG GG YNY+ +  
Sbjct  265  QDAIKVMRERFPHARIMYADYYNSAMRFFKNPELFGFPKETYLSACCGVGGQYNYNFVKT  324

Query  426  CGSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTP  298
            CG++  TVC +PS Y++WDG HLTE AYK IA  LL G Y  P
Sbjct  325  CGTSGVTVCKDPSMYVNWDGIHLTETAYKSIATALLSGSYMDP  367



>emb|CDO96755.1| unnamed protein product [Coffea canephora]
Length=376

 Score =   189 bits (480),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 87/165 (53%), Positives = 120/165 (73%), Gaps = 2/165 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            +++ LI+ GA  ++VPGNFPIGCSA YLT F T N + YD + GCL   N F++YHN  L
Sbjct  206  TISALIDEGAVELVVPGNFPIGCSAVYLTLFETPNKAAYD-EHGCLKVYNAFAKYHNAQL  264

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGF-KNTVVACCGGGGPYNYDGLVDC  424
            +  L++LR++YP   IIYADYY AA R  +SP  YGF K+ +VACCGGGGPYN++    C
Sbjct  265  RLGLEKLRQKYPQAKIIYADYYGAAKRFVHSPKHYGFSKDRLVACCGGGGPYNFNNSARC  324

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQIN  289
            G   ST C +PS++ +WDG HLTEAAY+++A GL+ GP+++P ++
Sbjct  325  GHTGSTTCTSPSAHANWDGIHLTEAAYRYVAMGLINGPFSSPSLS  369



>ref|XP_011096420.1| PREDICTED: LOW QUALITY PROTEIN: GDSL esterase/lipase At2g27360-like 
[Sesamum indicum]
Length=408

 Score =   189 bits (481),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 92/171 (54%), Positives = 118/171 (69%), Gaps = 4/171 (2%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANT-SEYDPKTGCLNWLNDFSEYHNRL  604
            ++ ELI+ GA  ++VPG  P+GC  + LTH+ T++T  +Y P TGCLNWLN+ S YHN L
Sbjct  223  TIEELIKLGATTMLVPGVIPMGCLPALLTHYKTSSTEKDYHPTTGCLNWLNELSIYHNEL  282

Query  603  LQNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGF--KNTVVACCGGGGPYNYDGLV  430
            LQ EL RLR  +P   IIYAD YNA MR Y SP ++GF  ++ + ACCGGGGPYN++G  
Sbjct  283  LQKELSRLRHLHPHIAIIYADNYNAMMRFYLSPHQFGFAKESILRACCGGGGPYNFNGSA  342

Query  429  DCGS-ASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGEC  280
             CG+   +  C+NPS Y++WDG H TEAA KWIA GL +G YT P I   C
Sbjct  343  LCGNLPRANCCENPSLYVNWDGLHCTEAANKWIAQGLWEGSYTHPHIKTIC  393



>ref|XP_006644439.1| PREDICTED: GDSL esterase/lipase At1g28600-like [Oryza brachyantha]
Length=405

 Score =   189 bits (481),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 84/163 (52%), Positives = 112/163 (69%), Gaps = 0/163 (0%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++ ELI  GA+ ++VPGN PIGC  +YL  F +    +Y+ +TGCL WLN+FS+YHN+ L
Sbjct  218  TITELIGLGAKTMVVPGNLPIGCIPNYLVKFESDEKEDYELETGCLRWLNEFSQYHNKHL  277

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGLVDCG  421
             +EL++LR+ +PD  IIYADYY A+M ++ SP ++G ++ +VACCGGGGPY     V CG
Sbjct  278  TDELEKLRKLHPDVAIIYADYYGASMEIFLSPEQFGIEDPLVACCGGGGPYGVSASVRCG  337

Query  420  SASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQI  292
                 VCD P  Y SWDG H +EAAYK I  GLL+G YT P  
Sbjct  338  HGEYKVCDGPEKYASWDGFHPSEAAYKAITIGLLRGSYTQPSF  380



>ref|NP_174440.2| GDSL esterase/lipase [Arabidopsis thaliana]
 gb|AAT99799.1| At1g31550 [Arabidopsis thaliana]
 gb|AAU45217.1| At1g31550 [Arabidopsis thaliana]
 gb|AEE31371.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=391

 Score =   189 bits (480),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 90/176 (51%), Positives = 115/176 (65%), Gaps = 4/176 (2%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++ ELI  G +  +VPG FP+GCS ++LT   T+N  EYDP TGCL WLN F EYH+  L
Sbjct  208  AITELIGMGGRTFLVPGGFPLGCSVAFLTLHQTSNMEEYDPLTGCLKWLNKFGEYHSEQL  267

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNT-VVACCGGGGPYNYDGLVDC  424
            Q EL+RLR+  P   IIYADYYNA++RL   P    F N  + ACCG GGPYN++    C
Sbjct  268  QEELNRLRKLNPHVNIIYADYYNASLRLGREPR---FINRHLSACCGVGGPYNFNLSRSC  324

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGECIFRSPKTK  256
            GS     C +PS Y++WDG H+TEAA+K +ADGL+KGPY  P  +  C+    K K
Sbjct  325  GSVGVEACSDPSKYVAWDGLHMTEAAHKSMADGLVKGPYAIPPFDWSCLSSMIKKK  380



>ref|XP_002317430.2| hypothetical protein POPTR_0011s07610g, partial [Populus trichocarpa]
 gb|EEE98042.2| hypothetical protein POPTR_0011s07610g, partial [Populus trichocarpa]
Length=210

 Score =   183 bits (465),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 88/168 (52%), Positives = 115/168 (68%), Gaps = 1/168 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++ ELIE GA  I+VPGN PIGC  SYLT F + +  +YD  TGCL WLN FSE HN  L
Sbjct  33   AIKELIELGAITILVPGNLPIGCLPSYLTLFESLDKKDYDHSTGCLEWLNRFSEDHNEQL  92

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNTVV-ACCGGGGPYNYDGLVDC  424
              EL +++  YP   IIYADYYNA M LY+SP+++GF   V+ ACCG GG YNY+   +C
Sbjct  93   LAELKQIQNLYPHAKIIYADYYNAVMPLYHSPNQFGFTGGVLRACCGWGGTYNYNSSAEC  152

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGEC  280
            G+  ++VCD+PS Y++WDG H TEAAYK I + +++G Y+ P     C
Sbjct  153  GNPLASVCDDPSFYVNWDGIHYTEAAYKLIFESVIEGSYSFPSFKALC  200



>ref|XP_010478242.1| PREDICTED: GDSL esterase/lipase At1g28670-like [Camelina sativa]
Length=389

 Score =   189 bits (479),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 84/168 (50%), Positives = 112/168 (67%), Gaps = 0/168 (0%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++ +LI+ G +  +VPG FP GCSA+YLT F T    E+DP TGC+ WLN+F E+HN  L
Sbjct  209  AIVDLIDLGGKTFLVPGGFPAGCSAAYLTLFQTVAEQEHDPLTGCIPWLNEFGEHHNEQL  268

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGLVDCG  421
            + EL RL++ YP   IIYADY+N+  R +  P+KYGFKN + ACCG GG YN+    +CG
Sbjct  269  KTELKRLQKLYPHVNIIYADYHNSLYRFFQEPAKYGFKNPLAACCGVGGQYNFTIDKECG  328

Query  420  SASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGECI  277
                  C NPS +++WDG HLTEA Y+ +A  LL GPY TP  +  C+
Sbjct  329  YEGVGYCQNPSEHVNWDGYHLTEATYQKMAHSLLNGPYATPAFDWSCL  376



>ref|XP_008225209.1| PREDICTED: GDSL esterase/lipase At5g45910 [Prunus mume]
Length=362

 Score =   187 bits (475),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 90/162 (56%), Positives = 110/162 (68%), Gaps = 1/162 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            + + LIE GA  ++VPGN PIGCSA YLT F + N + YD + GCL   N FS+YHN  L
Sbjct  200  ATSALIEEGAVELVVPGNLPIGCSAVYLTLFRSPNEAVYDKRNGCLKAFNGFSKYHNSEL  259

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKN-TVVACCGGGGPYNYDGLVDC  424
            +  L  LR +YP   IIYADYY AAM  Y++P  YGFK+ T+ ACCGGGGPYN++    C
Sbjct  260  KRALGALRLKYPHARIIYADYYGAAMPFYHAPQHYGFKSGTLRACCGGGGPYNFNNSARC  319

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTP  298
            G   ST C +PSSY +WDG HLTEAAY  IA GL+ G + TP
Sbjct  320  GHIGSTACKDPSSYANWDGIHLTEAAYGHIAKGLIHGRFATP  361



>ref|XP_004234095.1| PREDICTED: GDSL esterase/lipase At5g45910 [Solanum lycopersicum]
Length=368

 Score =   187 bits (475),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 91/163 (56%), Positives = 111/163 (68%), Gaps = 1/163 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            + + LIE GA  +IVPGN PIGCSA +LT F T N   YD K GCL   N FS+YHN  L
Sbjct  199  ATSALIEEGAVELIVPGNLPIGCSAVFLTIFGTTNKDAYD-KYGCLKAYNAFSKYHNAKL  257

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGLVDCG  421
            +  ++ LR++YP   IIYADYY  A RL +SP  YGF NT+VACCGGGGPYN++    CG
Sbjct  258  KLGIENLRKEYPHAKIIYADYYGVAKRLIHSPKHYGFSNTLVACCGGGGPYNFNNSARCG  317

Query  420  SASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQI  292
               S  C + SS+ +WDG HLTEAAY  IA GLL GP+T+P +
Sbjct  318  HIGSKSCLDASSFTNWDGIHLTEAAYHHIAKGLLNGPFTSPSL  360



>ref|XP_007020872.1| SGNH hydrolase-type esterase superfamily protein, putative [Theobroma 
cacao]
 gb|EOY12397.1| SGNH hydrolase-type esterase superfamily protein, putative [Theobroma 
cacao]
Length=344

 Score =   186 bits (473),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 93/183 (51%), Positives = 124/183 (68%), Gaps = 4/183 (2%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            +++ELIE GA   +VPGN P GC  S LT+F  ++  EYDP TGCL WLN FSEYHN+LL
Sbjct  162  AIHELIELGAVTFLVPGNLPFGCFPSCLTNFEGSDEEEYDPLTGCLTWLNQFSEYHNQLL  221

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNTVV--ACCGGGGPYNYDGLVD  427
            Q EL R++E +P   I+YADYY+AA+R Y SP ++GF+   +  ACCGGGGPYN++    
Sbjct  222  QEELARIQEIHPHVNIVYADYYSAAIRFYLSPKQFGFRKETLTKACCGGGGPYNFNLSAI  281

Query  426  CG-SASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTT-PQINGECIFRSPKTKL  253
            CG    ++ CD+PSSY+SWDG H TEAA + ++  +L G +T  P  N  C   +   KL
Sbjct  282  CGYPLVTSCCDDPSSYVSWDGIHYTEAANRLLSRAILDGLHTNFPISNSLCQSFTVNNKL  341

Query  252  SDS  244
            S+S
Sbjct  342  SNS  344



>ref|XP_009411654.1| PREDICTED: GDSL esterase/lipase At1g28600-like [Musa acuminata 
subsp. malaccensis]
Length=381

 Score =   187 bits (475),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 84/166 (51%), Positives = 114/166 (69%), Gaps = 0/166 (0%)
 Frame = -2

Query  777  VNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLLQ  598
            +N+LIE GA+ ++VPGNFPIGC   YL  + + N  EY+  TGC+ WLN+ S+YHNRLL 
Sbjct  205  INDLIELGAKTLLVPGNFPIGCVPVYLDIYKSYNVEEYESDTGCIKWLNELSKYHNRLLL  264

Query  597  NELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGLVDCGS  418
             ELDRLR+ +P+  IIYA+YY+A +  + +P  +GFK  + ACCG  GPY+ +    CG 
Sbjct  265  AELDRLRKLHPNVMIIYANYYDAMISFFRAPEVFGFKAPLHACCGSDGPYSVNRNAPCGH  324

Query  417  ASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGEC  280
             ++ VC +PSS +SWDG HLTEAAY  IA  LL+GP+  P +   C
Sbjct  325  RNAKVCSDPSSSVSWDGIHLTEAAYGTIASSLLEGPHANPPLTRAC  370



>gb|KGN49290.1| hypothetical protein Csa_6G519430 [Cucumis sativus]
Length=326

 Score =   186 bits (471),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 91/174 (52%), Positives = 115/174 (66%), Gaps = 8/174 (5%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++ ELI  GAQ ++VPGN PIGCS+ YL  +   +TS  D K GCL+WLN FSEYHN+ L
Sbjct  144  TITELIHLGAQSLLVPGNLPIGCSSKYLQIY---STSIQDSKNGCLDWLNQFSEYHNKYL  200

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNTVVAC-CGGGGPYNYDGLVDC  424
            Q EL+R+R ++P+  IIYADY+N+AM+ YN P  +G KNT+ AC          DG    
Sbjct  201  QEELNRIRSRHPNVQIIYADYHNSAMQFYNHPENFGLKNTLEACLVDRNETLKKDGKYGL  260

Query  423  GSASSTV----CDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGECIF  274
            G  + T     CD+PS Y+SWDG HLTEAAY+ IA GLL+GPYT PQ    CI 
Sbjct  261  GGKTKTKTKIECDDPSKYVSWDGVHLTEAAYRLIAMGLLQGPYTHPQFTTSCII  314



>ref|XP_011027710.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Populus euphratica]
Length=373

 Score =   187 bits (474),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 89/161 (55%), Positives = 112/161 (70%), Gaps = 2/161 (1%)
 Frame = -2

Query  768  LIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLLQNEL  589
            LIE GA  ++VPGN PIGCSA YLT F + N +EYD + GCL   N FS+YHN  L+  L
Sbjct  210  LIEEGAVELLVPGNLPIGCSAVYLTLFGSPNRTEYD-RNGCLKACNAFSKYHNNQLKTAL  268

Query  588  DRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKN-TVVACCGGGGPYNYDGLVDCGSAS  412
              LR++YP   IIYADYY AA R Y++P ++GF   T+ ACCGGGGPYN++    CG   
Sbjct  269  QMLRQKYPHARIIYADYYGAAKRFYHAPQRHGFTGGTLTACCGGGGPYNFNNSARCGHMG  328

Query  411  STVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQIN  289
            S  C NPSS+ +WDG HLTEAAY++IA GL+ G +TTP + 
Sbjct  329  SRTCSNPSSHANWDGIHLTEAAYRYIAMGLVSGSFTTPPLR  369



>ref|XP_010499397.1| PREDICTED: GDSL esterase/lipase At1g28670 [Camelina sativa]
Length=389

 Score =   187 bits (475),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 82/168 (49%), Positives = 112/168 (67%), Gaps = 0/168 (0%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++ +L++ G +  +VPG FP GCSA+YLT F T    ++DP TGC+ WLN+F E+HN  L
Sbjct  209  AIVDLVDLGGKTFLVPGGFPAGCSAAYLTLFQTVAEQDHDPLTGCIPWLNEFGEHHNEQL  268

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGLVDCG  421
            + EL RL++ YP   IIYADY+N+  R +  P+KYGFKN + ACCG GG YN+    +CG
Sbjct  269  KTELKRLQKLYPHVNIIYADYHNSLYRFFQEPAKYGFKNPLAACCGVGGQYNFTIDKECG  328

Query  420  SASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGECI  277
                  C NPS +++WDG HLTEA Y+ +A  LL GPY TP  +  C+
Sbjct  329  YEGVGYCQNPSEHVNWDGYHLTEATYQKMAQSLLNGPYATPAFDWSCL  376



>ref|XP_010460659.1| PREDICTED: GDSL esterase/lipase At1g28670-like [Camelina sativa]
Length=389

 Score =   187 bits (474),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 82/168 (49%), Positives = 112/168 (67%), Gaps = 0/168 (0%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++ +L++ G +  +VPG FP GCSA+YLT F T    ++DP TGC+ WLN+F E+HN  L
Sbjct  209  AIVDLVDLGGKTFLVPGGFPAGCSAAYLTLFQTVAEQDHDPLTGCIPWLNEFGEHHNEQL  268

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGLVDCG  421
            + EL RL++ YP   IIYADY+N+  R +  P+KYGFKN + ACCG GG YN+    +CG
Sbjct  269  KTELKRLQKLYPHVNIIYADYHNSLYRFFQEPAKYGFKNPLAACCGVGGQYNFTIDKECG  328

Query  420  SASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGECI  277
                  C NPS +++WDG HLTEA Y+ +A  LL GPY TP  +  C+
Sbjct  329  YEGVGYCQNPSEHVNWDGYHLTEATYQKMAQSLLNGPYATPAFDWSCL  376



>ref|XP_012091740.1| PREDICTED: GDSL esterase/lipase At5g45910 [Jatropha curcas]
 gb|KDP21068.1| hypothetical protein JCGZ_21539 [Jatropha curcas]
Length=367

 Score =   186 bits (473),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 90/164 (55%), Positives = 113/164 (69%), Gaps = 2/164 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++  LIE GA  ++VPGN PIGCSA YLT F + N ++YD K GCL   N FS+YHN  L
Sbjct  200  AITVLIEEGAVELMVPGNLPIGCSAVYLTLFQSPNKADYD-KNGCLKAYNSFSKYHNNQL  258

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNTVV-ACCGGGGPYNYDGLVDC  424
            +  L+ LR +YP+  IIYADYY AA R Y+SP  YGF N V+ ACCGGGG YN++    C
Sbjct  259  KGALETLRNKYPNARIIYADYYGAAKRFYHSPKHYGFYNGVLTACCGGGGSYNFNNFARC  318

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQI  292
            G   S  C NPS+Y +WDG HLTEAAY+ IA GL+ G ++TP +
Sbjct  319  GHVGSKACVNPSTYANWDGIHLTEAAYRIIAMGLINGSFSTPPL  362



>ref|XP_008812189.1| PREDICTED: GDSL esterase/lipase At1g28570-like [Phoenix dactylifera]
Length=386

 Score =   187 bits (474),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 96/168 (57%), Positives = 125/168 (74%), Gaps = 3/168 (2%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++N LI+ GA+ ++VPGNFPIGC + YL  F +    +YD +TGC+ WLN+FS +HNRLL
Sbjct  207  AINVLIQLGAKTLVVPGNFPIGCVSWYLQIFQSQRKEDYDSQTGCIKWLNEFSAHHNRLL  266

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNT-VVACCGGGGPYNYDGLVDC  424
             +ELDRLR+ +P  TIIYADYY A + ++ SP+++GFK   + ACCGGGGPYN    V C
Sbjct  267  LDELDRLRQLHPHATIIYADYYKALLHIFRSPTQFGFKKAPLAACCGGGGPYNAS--VAC  324

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGEC  280
            G  ++TVC++PS Y+SWDG HLTEAAYK IA GLL+GP TTP I   C
Sbjct  325  GDRAATVCNDPSRYVSWDGMHLTEAAYKTIAQGLLEGPDTTPPITQAC  372



>ref|XP_003593736.1| GDSL esterase/lipase [Medicago truncatula]
 gb|AES63987.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=399

 Score =   187 bits (474),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 88/167 (53%), Positives = 118/167 (71%), Gaps = 3/167 (2%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++NELI+ GA+ +++PGNFP+GC+  YLT + T + S+YD   GCL WLN+F+E++N+ L
Sbjct  223  AINELIDLGARTLMIPGNFPLGCNVIYLTKYETTDKSQYD-SAGCLKWLNEFAEFYNQEL  281

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGLVDCG  421
            Q EL RLR  +P  TIIYADYYNA + LY +P+K+GF   +  CCG GG YN+ G   CG
Sbjct  282  QYELHRLRRIHPHATIIYADYYNALLPLYQNPTKFGFTG-LKNCCGMGGSYNF-GSGSCG  339

Query  420  SASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGEC  280
                  CD+PS YI WDG HLTEAAY+ IADG++ GP + PQ +  C
Sbjct  340  KPGVFACDDPSQYIGWDGVHLTEAAYRLIADGIINGPCSVPQFSNLC  386



>ref|XP_006415633.1| hypothetical protein EUTSA_v10007853mg [Eutrema salsugineum]
 gb|ESQ33986.1| hypothetical protein EUTSA_v10007853mg [Eutrema salsugineum]
Length=392

 Score =   186 bits (473),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 85/169 (50%), Positives = 114/169 (67%), Gaps = 1/169 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++ +LI+ G +  +VPGNFP+GCS +YLT F T    E+DP TGC+ WLN+F ++HN  L
Sbjct  211  AIVDLIDLGGKTFLVPGNFPLGCSPAYLTLFKTVEEEEHDPFTGCITWLNEFGQHHNEQL  270

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNTVV-ACCGGGGPYNYDGLVDC  424
            + EL RL++ YP   IIYADYYN+    +  P++YGFKN  + ACCG GG YN+    +C
Sbjct  271  KTELKRLQKLYPHVNIIYADYYNSMYPFFQEPARYGFKNRPLGACCGVGGNYNFTINEEC  330

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGECI  277
            G    + C NPS Y++WDG HLTEA ++ IA GLL GPY TP  +  CI
Sbjct  331  GYEGVSYCQNPSEYVNWDGYHLTEATHQKIAHGLLNGPYATPAFDWSCI  379



>dbj|BAF02148.1| putative lipase [Arabidopsis thaliana]
Length=353

 Score =   185 bits (470),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 89/169 (53%), Positives = 116/169 (69%), Gaps = 2/169 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++ +LI+ G +  +VPGNFPIGCS +YLT F TA T E+DP TGC+ WLN F E+HN  L
Sbjct  179  AIVDLIDLGGKTFLVPGNFPIGCSTAYLTLFQTA-TVEHDPFTGCIPWLNKFGEHHNEQL  237

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNT-VVACCGGGGPYNYDGLVDC  424
            + EL +L++ YP   IIYADYYN+   L+  P+KYGFKN  + ACCG GG YN+    +C
Sbjct  238  KIELKQLQKLYPHVNIIYADYYNSLYGLFQEPAKYGFKNRPLAACCGVGGQYNFTIGKEC  297

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGECI  277
            G    + C NPS Y++WDG HLTEA Y+ +A GLL G YTTP  +  C+
Sbjct  298  GENGVSYCQNPSEYVNWDGYHLTEATYQKMAQGLLNGRYTTPAFDWSCL  346



>ref|XP_009414900.1| PREDICTED: GDSL esterase/lipase At1g28570-like [Musa acuminata 
subsp. malaccensis]
Length=383

 Score =   186 bits (472),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 84/169 (50%), Positives = 113/169 (67%), Gaps = 0/169 (0%)
 Frame = -2

Query  786  RFSVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNR  607
            R +V+ LI+ GA  ++VPGNFPIGC  +YL+ + +    EYDP+TGC++WLN+ SEYHN 
Sbjct  204  RQAVDVLIQLGATTLVVPGNFPIGCVPAYLSDYQSTVAEEYDPQTGCISWLNELSEYHNS  263

Query  606  LLQNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGLVD  427
            +L +EL++LR+ YP  TIIYADYY A + +  SP ++GFK  + ACCG  G YN++    
Sbjct  264  MLLDELNQLRKVYPHATIIYADYYEAVLNILRSPQQFGFKTPLAACCGSDGLYNFNWSKM  323

Query  426  CGSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGEC  280
            CG+  S VC +PS  +SWDG H T+AAY  IA  LL G Y  P     C
Sbjct  324  CGTQMSKVCSDPSDSLSWDGIHFTDAAYSTIALSLLDGTYAYPSFTEAC  372



>ref|XP_010232088.1| PREDICTED: GDSL esterase/lipase At1g28600-like isoform X2 [Brachypodium 
distachyon]
Length=404

 Score =   186 bits (473),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 83/163 (51%), Positives = 113/163 (69%), Gaps = 0/163 (0%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++ ELI  GA+ ++VPGN PIGC  +YL  F +    +Y+P+TGCL W+N+FS+YHN+LL
Sbjct  217  TITELIGLGAKTLVVPGNLPIGCIPNYLMIFKSDKKEDYEPETGCLRWMNEFSQYHNKLL  276

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGLVDCG  421
             +EL++LR+ +   ++IYADYY AAM +Y SP ++G ++ + ACCGGGGPY       CG
Sbjct  277  VDELEKLRKLHHGVSLIYADYYGAAMEIYRSPEQFGIEHPLAACCGGGGPYGVSITSRCG  336

Query  420  SASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQI  292
                 VC +P  Y SWDG H +EAAYK IA GLL+G YT P I
Sbjct  337  YGEYKVCHDPQKYGSWDGFHPSEAAYKGIAIGLLRGTYTQPSI  379



>ref|NP_174186.1| GDSL esterase/lipase [Arabidopsis thaliana]
 sp|Q3E7I6.1|GDL11_ARATH RecName: Full=GDSL esterase/lipase At1g28650; AltName: Full=Extracellular 
lipase At1g28650; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AEE31009.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=385

 Score =   186 bits (471),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 89/169 (53%), Positives = 116/169 (69%), Gaps = 2/169 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++ +LI+ G +  +VPGNFPIGCS +YLT F TA T E+DP TGC+ WLN F E+HN  L
Sbjct  211  AIVDLIDLGGKTFLVPGNFPIGCSTAYLTLFQTA-TVEHDPFTGCIPWLNKFGEHHNEQL  269

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNT-VVACCGGGGPYNYDGLVDC  424
            + EL +L++ YP   IIYADYYN+   L+  P+KYGFKN  + ACCG GG YN+    +C
Sbjct  270  KIELKQLQKLYPHVNIIYADYYNSLYGLFQEPAKYGFKNRPLAACCGVGGQYNFTIGKEC  329

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGECI  277
            G    + C NPS Y++WDG HLTEA Y+ +A GLL G YTTP  +  C+
Sbjct  330  GENGVSYCQNPSEYVNWDGYHLTEATYQKMAQGLLNGRYTTPAFDWSCL  378



>ref|XP_003569457.2| PREDICTED: GDSL esterase/lipase At1g28600-like isoform X1 [Brachypodium 
distachyon]
Length=424

 Score =   187 bits (474),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 83/163 (51%), Positives = 113/163 (69%), Gaps = 0/163 (0%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++ ELI  GA+ ++VPGN PIGC  +YL  F +    +Y+P+TGCL W+N+FS+YHN+LL
Sbjct  217  TITELIGLGAKTLVVPGNLPIGCIPNYLMIFKSDKKEDYEPETGCLRWMNEFSQYHNKLL  276

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGLVDCG  421
             +EL++LR+ +   ++IYADYY AAM +Y SP ++G ++ + ACCGGGGPY       CG
Sbjct  277  VDELEKLRKLHHGVSLIYADYYGAAMEIYRSPEQFGIEHPLAACCGGGGPYGVSITSRCG  336

Query  420  SASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQI  292
                 VC +P  Y SWDG H +EAAYK IA GLL+G YT P I
Sbjct  337  YGEYKVCHDPQKYGSWDGFHPSEAAYKGIAIGLLRGTYTQPSI  379



>ref|NP_001130974.1| uncharacterized protein LOC100192079 [Zea mays]
 gb|ACF79385.1| unknown [Zea mays]
 gb|ACN29020.1| unknown [Zea mays]
 tpg|DAA58329.1| TPA: hypothetical protein ZEAMMB73_195608 [Zea mays]
Length=403

 Score =   186 bits (472),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 83/164 (51%), Positives = 111/164 (68%), Gaps = 0/164 (0%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            +++ELI  GA+ ++VPGN PIGC   YL  F +    +Y+P+TGCL W+N+FS+YHN++L
Sbjct  216  TISELIRLGAKTLVVPGNLPIGCIPDYLMIFKSNKEEDYEPQTGCLRWMNEFSQYHNKVL  275

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGLVDCG  421
              +L +LR+ +P  TIIYADYY AAM ++ SP +YG +  +VACCGG GPY       CG
Sbjct  276  VEQLKKLRKLHPGATIIYADYYGAAMEIFLSPEQYGIEYPLVACCGGEGPYGVSPSTGCG  335

Query  420  SASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQIN  289
                 +CDNP  Y SWDG H +E+AY+ IA GLL G YT P I 
Sbjct  336  FGEYKLCDNPEKYGSWDGFHPSESAYRAIAMGLLLGSYTRPSIT  379



>ref|XP_004969326.1| PREDICTED: GDSL esterase/lipase At1g28600-like [Setaria italica]
Length=422

 Score =   186 bits (473),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 83/163 (51%), Positives = 112/163 (69%), Gaps = 0/163 (0%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++ ELI  GA+ ++VPGN PIGC   YL+ F + N  +Y+P++GCL W+N+FS+YHN+LL
Sbjct  215  TITELIGLGAKTLVVPGNLPIGCVPRYLSIFRSDNKEDYEPESGCLRWMNEFSKYHNKLL  274

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGLVDCG  421
              EL++LR+ +P  +IIYADYY AAM ++  P ++G +  +VACCGG G +       CG
Sbjct  275  VEELEKLRKLHPGVSIIYADYYGAAMEIFLFPERFGIEEPLVACCGGEGTHGVSPAAACG  334

Query  420  SASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQI  292
                 VCDNP  Y SWDG H +EAAYK IA GLL+G YT P I
Sbjct  335  YGEYKVCDNPDKYGSWDGFHPSEAAYKAIAMGLLRGTYTQPSI  377



>ref|NP_001149136.1| alpha-L-fucosidase 2 precursor [Zea mays]
 gb|ACG34335.1| alpha-L-fucosidase 2 precursor [Zea mays]
Length=402

 Score =   186 bits (471),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 84/166 (51%), Positives = 112/166 (67%), Gaps = 1/166 (1%)
 Frame = -2

Query  777  VNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLLQ  598
            + +LI  GA+ ++VPGNFPIGC   YL  F +     Y+ +TGC+ WLN+F+EYHNR+LQ
Sbjct  208  ITDLINLGAKKLVVPGNFPIGCVPLYLAIFQSQKEGYYEEQTGCIKWLNEFAEYHNRMLQ  267

Query  597  NELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGLVDCGS  418
             EL++LR  +PD TIIYADYY AA+ ++ +P K+GF   + ACCG   PYN    + CG 
Sbjct  268  EELEKLRNLHPDVTIIYADYYGAALNIFRAPLKFGFTVPLNACCGSDAPYNCSPSILCGR  327

Query  417  ASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGEC  280
              STVC +PS YISWDG H TEA+YK +  G+L G Y  P ++  C
Sbjct  328  PGSTVCPDPSKYISWDGLHFTEASYKVVIQGVLGG-YAKPPLSEAC  372



>ref|XP_009411653.1| PREDICTED: GDSL esterase/lipase At1g28570-like [Musa acuminata 
subsp. malaccensis]
Length=367

 Score =   185 bits (469),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 83/173 (48%), Positives = 114/173 (66%), Gaps = 6/173 (3%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            +VN LI  G + +IV G  P+GCSA YLT F T +  EYDP+TGCL W N+ S YHN  L
Sbjct  198  TVNSLIRKGVETVIVAGVIPLGCSAVYLTFFQTQSAEEYDPRTGCLKWANELSHYHNLRL  257

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGLVDCG  421
              EL+R+R+Q+P + I Y DYY A M +Y SP ++G K  + ACCGG GPYN++  V CG
Sbjct  258  HKELNRIRKQHPHSKIFYVDYYTALMPVYQSPEQFGIKEPLAACCGGEGPYNFNVSVGCG  317

Query  420  SASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGECIFRSPK  262
               S +C +PSSY+SWDG HLT+AA+  +A  +LK      ++  +C+ R+ +
Sbjct  318  HPMSNLCSDPSSYVSWDGLHLTDAAHGIVARHILK------ELQFQCMERTVR  364



>emb|CDO96749.1| unnamed protein product [Coffea canephora]
Length=397

 Score =   185 bits (470),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 90/170 (53%), Positives = 111/170 (65%), Gaps = 2/170 (1%)
 Frame = -2

Query  783  FSVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRL  604
             S+ ELI  G + I+VPG  P GC    LT F      +YD  TGCL WLNDFS+YHN L
Sbjct  210  ISIQELINLGVKNIMVPGMLPDGCLPISLTMFKGYKKEDYDRITGCLIWLNDFSKYHNEL  269

Query  603  LQNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGF-KNTVVACCGGGG-PYNYDGLV  430
            LQ EL R+R+++ +  ++YA+YY+A M+LY SP +YGF    + ACCG GG PYNYD   
Sbjct  270  LQAELTRIRQRHRNAVVMYANYYDALMQLYLSPEQYGFGGEPLTACCGAGGIPYNYDSDA  329

Query  429  DCGSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGEC  280
             CG   S  C  PS YISWDG+H TEAAY++I   LL+GPYT P IN  C
Sbjct  330  VCGDPPSRACAQPSLYISWDGAHCTEAAYRFITKSLLEGPYTAPHINSSC  379



>gb|ACL53525.1| unknown [Zea mays]
 gb|AFW83241.1| alpha-L-fucosidase 2 [Zea mays]
Length=432

 Score =   186 bits (472),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 84/166 (51%), Positives = 112/166 (67%), Gaps = 1/166 (1%)
 Frame = -2

Query  777  VNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLLQ  598
            + +LI  GA+ ++VPGNFPIGC   YL  F +     Y+ +TGC+ WLN+F+EYHNR+LQ
Sbjct  238  ITDLINLGAKKLVVPGNFPIGCVPLYLAIFQSQKEGYYEEQTGCIKWLNEFAEYHNRMLQ  297

Query  597  NELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGLVDCGS  418
             EL++LR  +PD TIIYADYY AA+ ++ +P K+GF   + ACCG   PYN    + CG 
Sbjct  298  EELEKLRNLHPDVTIIYADYYGAALNIFRAPLKFGFTVPLNACCGSDAPYNCSPSILCGR  357

Query  417  ASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGEC  280
              STVC +PS YISWDG H TEA+YK +  G+L G Y  P ++  C
Sbjct  358  PGSTVCPDPSKYISWDGLHFTEASYKVVIQGVLGG-YAKPPLSEAC  402



>ref|XP_008654982.1| PREDICTED: alpha-L-fucosidase 2 isoform X1 [Zea mays]
Length=431

 Score =   186 bits (471),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 84/166 (51%), Positives = 112/166 (67%), Gaps = 1/166 (1%)
 Frame = -2

Query  777  VNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLLQ  598
            + +LI  GA+ ++VPGNFPIGC   YL  F +     Y+ +TGC+ WLN+F+EYHNR+LQ
Sbjct  237  ITDLINLGAKKLVVPGNFPIGCVPLYLAIFQSQKEGYYEEQTGCIKWLNEFAEYHNRMLQ  296

Query  597  NELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGLVDCGS  418
             EL++LR  +PD TIIYADYY AA+ ++ +P K+GF   + ACCG   PYN    + CG 
Sbjct  297  EELEKLRNLHPDVTIIYADYYGAALNIFRAPLKFGFTVPLNACCGSDAPYNCSPSILCGR  356

Query  417  ASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGEC  280
              STVC +PS YISWDG H TEA+YK +  G+L G Y  P ++  C
Sbjct  357  PGSTVCPDPSKYISWDGLHFTEASYKVVIQGVLGG-YAKPPLSEAC  401



>gb|ERN06190.1| hypothetical protein AMTR_s00016p00147040 [Amborella trichopoda]
Length=218

 Score =   180 bits (456),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 88/162 (54%), Positives = 108/162 (67%), Gaps = 2/162 (1%)
 Frame = -2

Query  768  LIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLLQNEL  589
            LI  GA+ +I+PGN PIGCS  YLT   T +  +YDP TGCL   NDF+ Y+N  LQ+ +
Sbjct  43   LISEGAETLIIPGNLPIGCSTMYLTQHHTLDKGQYDPNTGCLTRFNDFACYYNSKLQDAI  102

Query  588  DRLREQYPDTTIIYADYYNAAMRLYNSPSKYGF-KNTVV-ACCGGGGPYNYDGLVDCGSA  415
              +R ++P  TIIYADYYNAAM  + SP   GF K TV+ ACCG GG YN+D    CG  
Sbjct  103  KDMRVRFPQATIIYADYYNAAMLFFESPGLIGFPKETVLSACCGVGGQYNFDPRRTCGKP  162

Query  414  SSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQIN  289
             +TVCD+PS Y +WDG HLTEAAYK IA  LL G +T P + 
Sbjct  163  GATVCDDPSLYTNWDGIHLTEAAYKVIATALLSGEFTHPPLK  204



>ref|XP_006828268.1| PREDICTED: GDSL esterase/lipase At5g45910 [Amborella trichopoda]
 gb|ERM95684.1| hypothetical protein AMTR_s00023p00212280 [Amborella trichopoda]
Length=377

 Score =   184 bits (468),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 81/162 (50%), Positives = 110/162 (68%), Gaps = 2/162 (1%)
 Frame = -2

Query  768  LIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLLQNEL  589
            LI  GA+ ++VPGN P+GCSAS LT F+T + +EYDP+ GCL   N+F++YHN  L   +
Sbjct  214  LIRIGAKTLVVPGNLPVGCSASILTGFLTTDKNEYDPRNGCLIRFNEFAQYHNSKLHKAI  273

Query  588  DRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNTVV--ACCGGGGPYNYDGLVDCGSA  415
              +RE++P   IIYADYYNAA+R   +P  +GF+   V  ACCGGGGPYN++    CG  
Sbjct  274  QAMRERFPHINIIYADYYNAAIRFVQTPEMFGFRKETVLRACCGGGGPYNFNITDRCGHP  333

Query  414  SSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQIN  289
             +  C NP+ Y++WDG HLTEAAY++IA  +L G +  P I 
Sbjct  334  GAHACANPARYVNWDGIHLTEAAYEFIAKAMLNGEFMHPPIK  375



>gb|KCW76151.1| hypothetical protein EUGRSUZ_D00528 [Eucalyptus grandis]
Length=263

 Score =   181 bits (459),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 83/164 (51%), Positives = 111/164 (68%), Gaps = 1/164 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            +V+ LIE GA  ++VPG  P GC + YLT F +AN S YDPKTGCL   N   +YHN  L
Sbjct  98   AVSILIEEGAVNLVVPGQLPTGCISLYLTLFQSANESAYDPKTGCLKAYNALFKYHNNYL  157

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGF-KNTVVACCGGGGPYNYDGLVDC  424
            + EL +LREQYP   ++YADYY A++ +Y +P  YGF    + ACCGGGGPYN++    C
Sbjct  158  KQELQKLREQYPHARVMYADYYGASISIYRTPKFYGFYGGALTACCGGGGPYNFNTSAYC  217

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQI  292
            G   STVC +PS+++ WDG H TE+AY +IA GL+ G + +P +
Sbjct  218  GQPGSTVCKDPSAFVDWDGIHSTESAYHYIARGLIDGGFISPPL  261



>ref|XP_010041182.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Eucalyptus grandis]
Length=366

 Score =   184 bits (467),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 85/164 (52%), Positives = 112/164 (68%), Gaps = 1/164 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            +V+ LIE GA  ++VPG  P GC + YLT F +AN S YDPKTGCL   N   +YHN  L
Sbjct  201  AVSTLIEEGAVNLVVPGQLPTGCISMYLTLFQSANESAYDPKTGCLEAYNALFKYHNNYL  260

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGF-KNTVVACCGGGGPYNYDGLVDC  424
            + EL +LREQYP   I+YADYY A++ +Y +P  YGF    + ACCGGGGPYN++    C
Sbjct  261  KQELQKLREQYPHARIMYADYYGASISIYRTPKFYGFYGGALTACCGGGGPYNFNTSAYC  320

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQI  292
            G + STVC +PS+++ WDG H TEAAY +IA GL+ G + +P +
Sbjct  321  GQSGSTVCKDPSAFVDWDGIHSTEAAYHYIARGLIDGGFISPPL  364



>gb|EEE55085.1| hypothetical protein OsJ_02827 [Oryza sativa Japonica Group]
Length=398

 Score =   185 bits (469),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 85/169 (50%), Positives = 111/169 (66%), Gaps = 5/169 (3%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++ ELI  GA+ ++VPGN PIGC   YL  F +    +Y+P+TGCL W+N FS+YHN+LL
Sbjct  216  TITELIRLGAKTLVVPGNLPIGCIPYYLMIFKSGKKEDYEPETGCLRWMNGFSQYHNKLL  275

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGLVDCG  421
             +EL+ LR+ +PD  IIYADYY AAM ++ SP ++G +N + ACCGGGGPY       CG
Sbjct  276  MDELENLRKLHPDVAIIYADYYGAAMGIFFSPEQFGIENPLAACCGGGGPYGVSETARCG  335

Query  420  SASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTT-----PQIN  289
                 VCD+P  Y SWD  H +EA +K IA GLL+G YT      PQI 
Sbjct  336  HGEYKVCDDPQLYGSWDDYHPSEAVFKAIAIGLLRGSYTQAPLACPQIT  384



>gb|ACN28025.1| unknown [Zea mays]
 tpg|DAA58333.1| TPA: hypothetical protein ZEAMMB73_278814 [Zea mays]
Length=395

 Score =   185 bits (469),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 84/163 (52%), Positives = 106/163 (65%), Gaps = 0/163 (0%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
             ++  I  GA+ ++VPGN PIGC   YL  F +    +YDP+TGCL W+N+FS+YHN+LL
Sbjct  208  KISSTISLGAKTLVVPGNLPIGCVPKYLMIFKSNKKEDYDPQTGCLRWMNEFSQYHNKLL  267

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGLVDCG  421
              +L +LR  +P  TIIYADYY AAM ++ SP +YG +  +VACCG  GPY       CG
Sbjct  268  VEQLKKLRRLHPGVTIIYADYYGAAMEIFLSPERYGIEYPLVACCGAEGPYGVSPTTSCG  327

Query  420  SASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQI  292
                 +CDNP  Y SWDG H TE+AYK IA GLL G YT P I
Sbjct  328  LGEYKLCDNPERYGSWDGLHPTESAYKVIAMGLLLGSYTRPPI  370



>ref|XP_011027711.1| PREDICTED: GDSL esterase/lipase At1g28580-like [Populus euphratica]
Length=380

 Score =   184 bits (467),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 84/169 (50%), Positives = 117/169 (69%), Gaps = 1/169 (1%)
 Frame = -2

Query  783  FSVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRL  604
             ++ ELI+ GA  I+VPGN PIGCS SYLT F  ++  +YD  TGCL WLN F++ HN  
Sbjct  205  LAIKELIQLGAITILVPGNLPIGCSPSYLTLFEGSDKKDYDHFTGCLKWLNKFAQEHNEQ  264

Query  603  LQNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNTVV-ACCGGGGPYNYDGLVD  427
            L  EL R+++ +P   IIYADYYNAAM  Y+SP+++GF   V+ +CCG GG YNY+ LV+
Sbjct  265  LMKELKRIQKLHPHAKIIYADYYNAAMPFYHSPNRFGFTGGVLKSCCGWGGMYNYNSLVN  324

Query  426  CGSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGEC  280
            CG+   + CD+P+S+++WDG H TEA YK I + +++G Y+ P     C
Sbjct  325  CGNPLVSACDDPTSFVNWDGIHYTEATYKLIFESIIEGSYSYPSFKAFC  373



>gb|KHN08453.1| GDSL esterase/lipase [Glycine soja]
Length=296

 Score =   182 bits (461),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 84/166 (51%), Positives = 116/166 (70%), Gaps = 2/166 (1%)
 Frame = -2

Query  783  FSVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRL  604
             ++N LI  GA+ ++VPGNFPIGCSA YLT F + N  +YD ++GCL   N F+EYHNR 
Sbjct  125  MAINGLIAEGARELLVPGNFPIGCSALYLTLFRSENKEDYD-ESGCLKTFNGFAEYHNRE  183

Query  603  LQNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNTVV-ACCGGGGPYNYDGLVD  427
            L+  L+ LR++ P   I+YADYY AA R +++P  +GF N  + ACCGGGGP+N++    
Sbjct  184  LKLALETLRKKNPHARILYADYYGAAKRFFHAPGHHGFTNGALRACCGGGGPFNFNISAR  243

Query  426  CGSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQIN  289
            CG   S  C +PS+Y +WDG HLTEAAY++IA GL+ GP++ P + 
Sbjct  244  CGHTGSKACADPSTYANWDGIHLTEAAYRYIAKGLIYGPFSYPPLK  289



>ref|XP_003546024.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Glycine max]
 gb|KHN18920.1| GDSL esterase/lipase [Glycine soja]
Length=374

 Score =   184 bits (466),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 85/165 (52%), Positives = 116/165 (70%), Gaps = 2/165 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++NELI  GA+ ++VPGNFPIGCSA YLT F + N  +YD  +GCL   N F+EYHN+ L
Sbjct  204  AINELIAEGARELLVPGNFPIGCSALYLTLFRSENKEDYD-DSGCLKTFNGFAEYHNKEL  262

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNTVV-ACCGGGGPYNYDGLVDC  424
            +  L+ LR++ P   I+YADYY AA R +++P  +GF N  + ACCGGGGPYN++    C
Sbjct  263  KLALETLRKKNPHARILYADYYGAAKRFFHAPGHHGFTNGALRACCGGGGPYNFNISARC  322

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQIN  289
            G   S  C +PS+Y +WDG HLTEAAY++IA GL+ GP++ P + 
Sbjct  323  GHTGSKACADPSTYANWDGIHLTEAAYRYIAKGLIYGPFSYPPLK  367



>ref|NP_001140937.1| hypothetical protein [Zea mays]
 gb|ACF85001.1| unknown [Zea mays]
 tpg|DAA58957.1| TPA: hypothetical protein ZEAMMB73_908344 [Zea mays]
Length=433

 Score =   185 bits (470),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 83/167 (50%), Positives = 113/167 (68%), Gaps = 1/167 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++ +LI  GA+ ++VPGNFPIGC   YL  F +     Y+ +TGC+ WLNDF+EYHN++L
Sbjct  238  AITDLINLGAKKLVVPGNFPIGCVPLYLAIFQSQKEDYYEEQTGCIKWLNDFAEYHNKML  297

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGLVDCG  421
            Q EL++LR  +PD TIIYADYY AA+ ++ +P ++GF   + ACCG   PYN    + CG
Sbjct  298  QEELEKLRNLHPDVTIIYADYYGAALNIFRAPLQFGFTVPLNACCGSDAPYNCSPSILCG  357

Query  420  SASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGEC  280
               STVC +PS YISWDG H TEA+YK +  G+L G Y  P ++  C
Sbjct  358  RPGSTVCPDPSKYISWDGLHFTEASYKVVIQGVLGG-YAKPPLSETC  403



>ref|XP_004134933.1| PREDICTED: GDSL esterase/lipase At1g28570 [Cucumis sativus]
Length=397

 Score =   184 bits (467),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 91/173 (53%), Positives = 115/173 (66%), Gaps = 8/173 (5%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++ ELI  GAQ ++VPGN PIGCS+ YL  +   +TS  D K GCL+WLN FSEYHN+ L
Sbjct  215  TITELIHLGAQSLLVPGNLPIGCSSKYLQIY---STSIQDSKNGCLDWLNQFSEYHNKYL  271

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNTVVAC-CGGGGPYNYDGLVDC  424
            Q EL+R+R ++P+  IIYADY+N+AM+ YN P  +G KNT+ AC          DG    
Sbjct  272  QEELNRIRSRHPNVQIIYADYHNSAMQFYNHPENFGLKNTLEACLVDRNETLKKDGKYGL  331

Query  423  GSASSTV----CDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGECI  277
            G  + T     CD+PS Y+SWDG HLTEAAY+ IA GLL+GPYT PQ    CI
Sbjct  332  GGKTKTKTKIECDDPSKYVSWDGVHLTEAAYRLIAMGLLQGPYTHPQFTTSCI  384



>gb|EEC71081.1| hypothetical protein OsI_02841 [Oryza sativa Indica Group]
Length=388

 Score =   184 bits (466),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 85/167 (51%), Positives = 111/167 (66%), Gaps = 1/167 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++ ELI  GA+ ++VPGNFPIGC   YL+ F +     YD KTGC+ WLN+F+EYHNRLL
Sbjct  193  AITELINLGAKKLVVPGNFPIGCVPLYLSIFPSQKEDYYDEKTGCIKWLNEFTEYHNRLL  252

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGLVDCG  421
            Q EL++LR  YPD +IIYADYY AA+ ++ +P ++GF   + +CCG   PYN    + CG
Sbjct  253  QEELEKLRNLYPDVSIIYADYYGAALNIFLAPLQFGFTVPLNSCCGSDAPYNCSPSILCG  312

Query  420  SASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGEC  280
               S VC +PS Y SWDG H TEA YK I  G+L G Y  P ++  C
Sbjct  313  HPGSVVCSDPSKYTSWDGLHFTEATYKIIIQGVL-GSYANPPLSETC  358



>ref|XP_009415143.1| PREDICTED: GDSL esterase/lipase At1g28590-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=384

 Score =   184 bits (466),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 82/176 (47%), Positives = 118/176 (67%), Gaps = 5/176 (3%)
 Frame = -2

Query  777  VNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLLQ  598
            +N+LIE GA+ ++VPG  P+GC+  YLT + +    +YD   GC+ WLN+FS+YHN  L 
Sbjct  201  INKLIELGARALLVPGITPLGCNTVYLTTYRSDRAEDYD-AIGCIRWLNEFSQYHNGHLH  259

Query  597  NELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGLVDCGS  418
            +E+ RL+  +P+  IIYADYY A M +++ P ++G +   +ACCGGGGPYNY+    CGS
Sbjct  260  DEVRRLQALHPEAVIIYADYYGAMMNIFSDPERFGIEERFLACCGGGGPYNYNSSRPCGS  319

Query  417  ASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGECIFRSPKTKLS  250
               TVCD+ S+Y+ WDG H+TEA Y+ ++ GLL+GP+  P I   C    P T+ S
Sbjct  320  EGQTVCDDTSTYLHWDGLHMTEATYRIVSVGLLQGPFAVPAIATTC----PATRFS  371



>gb|EAZ12674.1| hypothetical protein OsJ_02589 [Oryza sativa Japonica Group]
 dbj|BAH01546.1| unnamed protein product [Oryza sativa Japonica Group]
Length=408

 Score =   184 bits (467),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 85/167 (51%), Positives = 111/167 (66%), Gaps = 1/167 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++ ELI  GA+ ++VPGNFPIGC   YL+ F +     YD KTGC+ WLN+F+EYHNRLL
Sbjct  213  AITELINLGAKKLVVPGNFPIGCVPLYLSIFPSQKEDYYDEKTGCIKWLNEFTEYHNRLL  272

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGLVDCG  421
            Q EL++LR  YPD +IIYADYY AA+ ++ +P ++GF   + +CCG   PYN    + CG
Sbjct  273  QEELEKLRNLYPDVSIIYADYYGAALNIFLAPLQFGFTVPLNSCCGSDAPYNCSPSILCG  332

Query  420  SASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGEC  280
               S VC +PS Y SWDG H TEA YK I  G+L G Y  P ++  C
Sbjct  333  HPGSVVCSDPSKYTSWDGLHFTEATYKIIIQGVL-GSYANPPLSETC  378



>ref|XP_010540487.1| PREDICTED: GDSL esterase/lipase At1g28570-like [Tarenaya hassleriana]
Length=402

 Score =   184 bits (466),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 88/169 (52%), Positives = 112/169 (66%), Gaps = 2/169 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++ ELI+ G +  +VPG+FPIGCS +YLT F T NT EYDP TGCL WLN+F+EYHN  L
Sbjct  218  AIVELIDMGGRTFLVPGDFPIGCSTAYLTVFQTGNTEEYDPLTGCLTWLNEFAEYHNEQL  277

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGF-KNTVVACCGGGGPYNYDGLVDC  424
            Q ELDRLR+ YP   I+Y DYY+   R +  PSKYGF K  + ACCG GGPYN+     C
Sbjct  278  QTELDRLRKLYPHVNIVYGDYYSVVSRFHAQPSKYGFGKMHLAACCGEGGPYNFTLGKQC  337

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGECI  277
            GS     C +PS Y+ +DG H+TEA+Y  IA+ LL G      ++  C+
Sbjct  338  GSGVP-CCSDPSEYVYFDGVHMTEASYGRIAEHLLDGIRANSALDQCCL  385



>ref|XP_002305753.2| hypothetical protein POPTR_0004s05350g [Populus trichocarpa]
 gb|EEE86264.2| hypothetical protein POPTR_0004s05350g [Populus trichocarpa]
Length=424

 Score =   184 bits (467),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 85/169 (50%), Positives = 117/169 (69%), Gaps = 1/169 (1%)
 Frame = -2

Query  783  FSVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRL  604
             ++ ELI+ GA  I+VPGN PIGCS SYLT F  ++  +YD  TGCLNWLN F++ HN  
Sbjct  249  LAIKELIQLGAITILVPGNLPIGCSPSYLTLFEGSDKKDYDHLTGCLNWLNKFAQEHNEQ  308

Query  603  LQNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNTVV-ACCGGGGPYNYDGLVD  427
            L  EL R+++ +P   IIYADYYNAAM  Y+SP+++GF   V+ +CCG GG YNY+ LV 
Sbjct  309  LIKELKRIQKLHPHAKIIYADYYNAAMPFYHSPNRFGFTGGVLKSCCGWGGMYNYNSLVK  368

Query  426  CGSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGEC  280
            CG+   +VCD+P+S+++WDG H TEA YK I + +++G  + P     C
Sbjct  369  CGNPLVSVCDDPTSFVNWDGIHYTEATYKLIFESIIEGSNSYPSFKAFC  417



>ref|XP_010052212.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Eucalyptus grandis]
Length=392

 Score =   183 bits (465),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 84/164 (51%), Positives = 112/164 (68%), Gaps = 1/164 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            +V+ LIE GA  ++VPG  P GC + YLT F +AN S YDPKTGCL   N   +YHN  L
Sbjct  201  AVSTLIEEGAVNLVVPGQLPTGCISMYLTLFQSANESAYDPKTGCLEAYNALFKYHNNYL  260

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGF-KNTVVACCGGGGPYNYDGLVDC  424
            + EL +LREQYP   I+YADYY A++ +Y +P  YGF    + ACCGGGGPYN++    C
Sbjct  261  KQELQKLREQYPHARIMYADYYGASISIYRTPKFYGFYGGALTACCGGGGPYNFNTSAYC  320

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQI  292
            G + STVC +PS+++ WDG H TE+AY +IA GL+ G + +P +
Sbjct  321  GQSGSTVCKDPSAFVDWDGIHSTESAYHYIARGLIDGGFISPPL  364



>ref|XP_010068248.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Eucalyptus grandis]
Length=367

 Score =   182 bits (462),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 88/160 (55%), Positives = 115/160 (72%), Gaps = 2/160 (1%)
 Frame = -2

Query  768  LIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLLQNEL  589
            LIEHGA  ++VPGN PIGC  SY+T       ++ +  TGCLN  N+F++YHN  LQ EL
Sbjct  207  LIEHGAVELVVPGNLPIGCLTSYITTAPPFLKNDANTATGCLNRYNEFAKYHNNYLQREL  266

Query  588  DRLREQYPDTTIIYADYYNAAMRLYNSPSKYGF-KNTVVACCGGGGPYNYDGLVDCGSAS  412
              LR++Y    IIYADYY   MRL+ SP++YGF K+T VACCG GGP+N++  + CGS S
Sbjct  267  QVLRQKYSHARIIYADYYGDIMRLFESPTQYGFSKSTHVACCGAGGPFNFNVRMMCGSTS  326

Query  411  STVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQI  292
            S VC +PS+ I WDG HLTEAAY+ +A GLL GP+T+P++
Sbjct  327  S-VCKDPSASILWDGVHLTEAAYRHMAKGLLDGPFTSPRL  365



>ref|XP_002455947.1| hypothetical protein SORBIDRAFT_03g027770 [Sorghum bicolor]
 gb|EES01067.1| hypothetical protein SORBIDRAFT_03g027770 [Sorghum bicolor]
Length=437

 Score =   184 bits (466),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 85/178 (48%), Positives = 118/178 (66%), Gaps = 3/178 (2%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++ +LI  GA+ ++VPGNFPIGC   YL  F +     Y+ +TGC+ WLN+F+EYHNR+L
Sbjct  242  AIVDLINLGAKKLVVPGNFPIGCVPLYLAIFQSQKEDYYEEQTGCIKWLNEFAEYHNRML  301

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGLVDCG  421
            Q EL++LR  +PD TIIYADYY AA+ ++ +P ++GF   + +CCG   PYN    + CG
Sbjct  302  QEELEKLRNLHPDVTIIYADYYGAALNIFRAPLQFGFTVPLNSCCGSDAPYNCSPSILCG  361

Query  420  SASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGECIFRSPKTKLSD  247
               STVC +PS YISWDG H TEA+YK +  G+L G Y  P ++  C  R  + K+S 
Sbjct  362  RPGSTVCPDPSKYISWDGLHFTEASYKVVIQGVLGG-YAKPPLSETC--RGAEFKVSQ  416



>gb|EAY75193.1| hypothetical protein OsI_03085 [Oryza sativa Indica Group]
Length=379

 Score =   182 bits (462),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 82/161 (51%), Positives = 107/161 (66%), Gaps = 7/161 (4%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            +V ELI  GA+  +VPGN P GC+  YL  F  A  SEYD +TGCL W N F+E+HNR+L
Sbjct  216  AVEELIGMGARAFVVPGNLPFGCAPLYLNRFRGAAASEYDARTGCLAWFNKFAEFHNRVL  275

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGLVDCG  421
               LD LR  +PD TI+YAD+Y A   ++ +P K GF N + +CCG       +  V CG
Sbjct  276  TARLDDLRRLHPDVTIVYADWYGAMTSIFQAPGKLGFTNALGSCCG-------NQSVPCG  328

Query  420  SASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTP  298
             A  TVC++PS+Y+SWDG+H TEA YK IADG+L GP+ +P
Sbjct  329  KAGCTVCEDPSTYVSWDGTHPTEAVYKLIADGVLHGPHASP  369



>ref|XP_006644441.1| PREDICTED: GDSL esterase/lipase At1g28600-like [Oryza brachyantha]
Length=265

 Score =   179 bits (454),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 85/162 (52%), Positives = 116/162 (72%), Gaps = 0/162 (0%)
 Frame = -2

Query  777  VNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLLQ  598
            + ELI  GA+ ++VPGN PIGC  +YL  FM+    +Y+P+TGCL W+N+FS+YHN+LL 
Sbjct  79   ITELIGLGAKTLVVPGNLPIGCIPNYLRIFMSDKQEDYEPQTGCLRWMNEFSQYHNKLLL  138

Query  597  NELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGLVDCGS  418
            +EL++LR+ +P+ TIIYADYY AAM ++ SP  +G ++ +VACCGG GPY       CG+
Sbjct  139  DELEKLRKLHPNVTIIYADYYGAAMEIFLSPEHFGIEDPLVACCGGEGPYGVSADARCGT  198

Query  417  ASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQI  292
                VCD+P  Y SWDG H TEAAYK +A GL++G +T P I
Sbjct  199  GEYKVCDDPEKYASWDGHHPTEAAYKAMAVGLVRGSHTQPPI  240



>ref|XP_002438721.1| hypothetical protein SORBIDRAFT_10g025020 [Sorghum bicolor]
 gb|EER90088.1| hypothetical protein SORBIDRAFT_10g025020 [Sorghum bicolor]
Length=254

 Score =   179 bits (453),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 80/163 (49%), Positives = 106/163 (65%), Gaps = 0/163 (0%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            S+ ELI  GA+ ++VPGN PIGC   YL  F +    +Y+P TGC+ WLN+F+ YHN+LL
Sbjct  70   SITELIRLGAKTLVVPGNLPIGCIPMYLLAFQSDENEDYEPGTGCIKWLNEFARYHNKLL  129

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGLVDCG  421
              EL++LR+ +P  TIIYADYY AA  ++ SP +YG +  ++ACCGGGG Y     V CG
Sbjct  130  IQELEKLRKLHPRVTIIYADYYGAATEVFASPQQYGIEYPLMACCGGGGRYGVSSGVRCG  189

Query  420  SASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQI  292
                 +C+NP  + SWDG H +E  YK IA  LL+G  T P I
Sbjct  190  RGEYKLCENPEMHGSWDGMHPSETVYKAIAMSLLRGSRTQPPI  232



>ref|XP_004971993.1| PREDICTED: GDSL esterase/lipase At1g28590-like, partial [Setaria 
italica]
Length=355

 Score =   181 bits (460),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 82/167 (49%), Positives = 111/167 (66%), Gaps = 1/167 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++ +L   GA  ++VPGNFPIGC   YL+ F +     YD +TGC+ WLN+F+EYHN +L
Sbjct  160  AITDLTSLGANKLVVPGNFPIGCVPLYLSIFPSQKEDYYDEQTGCIKWLNEFAEYHNSML  219

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGLVDCG  421
            Q EL+RLR  YPD TIIYADYY A++ ++ +P ++GF   + ACCG   PYN    + CG
Sbjct  220  QEELERLRNLYPDVTIIYADYYGASLNIFRAPLQFGFTVPLNACCGSDAPYNCSPSILCG  279

Query  420  SASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGEC  280
               STVC +PS YISWDG H TEA+Y+ +  G+L G Y  P ++  C
Sbjct  280  RPGSTVCSDPSKYISWDGLHFTEASYRVVIQGVLGG-YAIPPLSETC  325



>ref|NP_001242505.1| uncharacterized protein LOC100815771 precursor [Glycine max]
 gb|ACU18018.1| unknown [Glycine max]
Length=375

 Score =   182 bits (462),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 84/165 (51%), Positives = 116/165 (70%), Gaps = 2/165 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++N LI  GA+ ++VPGNFPIGCSA YLT F + N  +YD ++GCL   N F+EYHNR L
Sbjct  205  AINGLIAEGARELLVPGNFPIGCSALYLTLFRSENKEDYD-ESGCLKTFNGFAEYHNREL  263

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNTVV-ACCGGGGPYNYDGLVDC  424
            +  L+ LR++ P   I+YADYY AA R +++P  +GF N  + ACCGGGGP+N++    C
Sbjct  264  KLALETLRKKNPHARILYADYYGAAKRFFHAPGHHGFTNGALRACCGGGGPFNFNISARC  323

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQIN  289
            G   S  C +PS+Y +WDG HLTEAAY++IA GL+ GP++ P + 
Sbjct  324  GHTGSKACADPSTYANWDGIHLTEAAYRYIAKGLIYGPFSYPPLK  368



>gb|KJB62806.1| hypothetical protein B456_009G437200 [Gossypium raimondii]
Length=399

 Score =   182 bits (463),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 88/170 (52%), Positives = 108/170 (64%), Gaps = 2/170 (1%)
 Frame = -2

Query  783  FSVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRL  604
             S+ ELIE GA   +VPGNFPIGCS S LT F  +   +YDP TGCL WLN FS++HN L
Sbjct  213  LSIKELIELGAVTFLVPGNFPIGCSPSLLTSFHGSEKDQYDPLTGCLTWLNQFSQHHNEL  272

Query  603  LQNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGLVDC  424
            L+ EL+ +R  +P   IIY DYY A+   Y SP  YGFK T+ ACCG GG YNYD L+ C
Sbjct  273  LRKELENIRNLHPQINIIYVDYYKASTPFYQSPKNYGFKETLKACCGIGGLYNYDPLIYC  332

Query  423  G-SASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPY-TTPQINGEC  280
            G       C++PSSYISWDG H TE   KW+A  + +    T P++   C
Sbjct  333  GYPPLKQCCNDPSSYISWDGIHFTEVVNKWLAHTVFEELMNTIPRLGSLC  382



>ref|XP_006646093.1| PREDICTED: GDSL esterase/lipase At1g28600-like, partial [Oryza 
brachyantha]
Length=383

 Score =   182 bits (461),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 83/167 (50%), Positives = 111/167 (66%), Gaps = 1/167 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++ +LI  GA+ ++VPGNFPIGC   YL+ F +     YD KTGC+ WLN+F+EYHNRLL
Sbjct  188  AITDLINFGAKKLVVPGNFPIGCVPLYLSIFPSQKEDYYDEKTGCIKWLNEFTEYHNRLL  247

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGLVDCG  421
            Q EL++LR  +PD +IIYADYY AA+ ++ +P ++GF   + +CCG   PYN    + CG
Sbjct  248  QEELEKLRNLHPDVSIIYADYYGAALNIFRAPLQFGFTVPLNSCCGSDAPYNCSPSILCG  307

Query  420  SASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGEC  280
               S VC +PS Y SWDG H TEA YK I  G+L G Y  P ++  C
Sbjct  308  HPGSVVCSDPSKYTSWDGLHFTEATYKIIIQGVL-GSYAIPPLSETC  353



>ref|XP_010052216.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Eucalyptus grandis]
 gb|KCW76154.1| hypothetical protein EUGRSUZ_D00533 [Eucalyptus grandis]
Length=386

 Score =   182 bits (462),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 85/165 (52%), Positives = 112/165 (68%), Gaps = 1/165 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            +V  LIE GA  ++VPGN P+GCSA YLT F + + S YDP TGCL   N F++YHN  L
Sbjct  221  AVGMLIEEGAVNLVVPGNLPVGCSAVYLTLFHSPDKSAYDPGTGCLKAYNVFAKYHNNYL  280

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGF-KNTVVACCGGGGPYNYDGLVDC  424
            + EL  LREQYP   I+YADYY AA+ +Y++P  YGF   T+ ACCGGGGP+N++    C
Sbjct  281  KQELQNLREQYPHARIMYADYYGAALPIYHTPKHYGFYGGTLRACCGGGGPFNFNNSARC  340

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQIN  289
            G   ST C +PS++ +WDG HLTE+AY  IA  L+ G + +P + 
Sbjct  341  GHTGSTACRDPSAFANWDGIHLTESAYHHIAKRLIYGGFISPPLR  385



>ref|XP_009411652.1| PREDICTED: GDSL esterase/lipase At1g28570-like [Musa acuminata 
subsp. malaccensis]
Length=404

 Score =   182 bits (463),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 81/173 (47%), Positives = 115/173 (66%), Gaps = 6/173 (3%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            +VN LI  G + ++V G  P+GCSA YLT F T + +EYDP+TGCL W N+ S YH+  L
Sbjct  235  TVNSLIRKGVETVMVAGIIPLGCSAVYLTVFQTQSAAEYDPRTGCLKWANELSHYHSLRL  294

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGLVDCG  421
              EL+R+R+Q+P + I Y DYY A M +Y SP ++G K  + ACCGG GPYN++  V CG
Sbjct  295  LKELNRIRKQHPHSKIFYVDYYTALMPVYQSPEQFGMKEPLAACCGGEGPYNFNVSVGCG  354

Query  420  SASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGECIFRSPK  262
               S +C +PSSY+SWDG HLT+AA+  +A  +LK      ++  +C+ R+ +
Sbjct  355  HPMSNLCSDPSSYVSWDGLHLTDAAHGIVARHILK------ELQFQCMERTAR  401



>ref|NP_174188.1| lipase ARAB-1 [Arabidopsis thaliana]
 sp|Q38894.1|GDL13_ARATH RecName: Full=GDSL esterase/lipase At1g28670; AltName: Full=Extracellular 
lipase At1g28670; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAA93262.1| lipase [Arabidopsis thaliana]
 dbj|BAC43359.1| putative lipase [Arabidopsis thaliana]
 gb|AEE31012.1| lipase ARAB-1 [Arabidopsis thaliana]
Length=384

 Score =   181 bits (460),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 84/169 (50%), Positives = 111/169 (66%), Gaps = 1/169 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++ +LI+ G +  +VPG FP GCSA+YLT F T    + DP TGC   LN+F E+HN  L
Sbjct  209  AIVDLIDLGGKTFLVPGGFPTGCSAAYLTLFQTVAEKDQDPLTGCYPLLNEFGEHHNEQL  268

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNT-VVACCGGGGPYNYDGLVDC  424
            + EL RL++ YP   IIYADY+N+  R Y  P+KYGFKN  + ACCG GG YN+    +C
Sbjct  269  KTELKRLQKFYPHVNIIYADYHNSLYRFYQEPAKYGFKNKPLAACCGVGGKYNFTIGKEC  328

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGECI  277
            G      C NPS Y++WDG HLTEAAY+ + +G+L GPY TP  +  C+
Sbjct  329  GYEGVNYCQNPSEYVNWDGYHLTEAAYQKMTEGILNGPYATPAFDWSCL  377



>ref|XP_003569463.1| PREDICTED: GDSL esterase/lipase At1g28600-like isoform X2 [Brachypodium 
distachyon]
Length=369

 Score =   181 bits (459),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 83/162 (51%), Positives = 109/162 (67%), Gaps = 8/162 (5%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHF-MTANTSEYDPKTGCLNWLNDFSEYHNRL  604
            +V ELI  GA+  +VPGN P GC+  YL  F  +A+  +YDP+TGCL W N F+EYHNR+
Sbjct  205  AVEELIAMGARAFMVPGNLPFGCTPLYLRRFGRSASAGDYDPRTGCLAWFNAFAEYHNRV  264

Query  603  LQNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGLVDC  424
            L   LD LR ++PD  I+YAD+Y A M ++ SP K GF N +++CCG       +  V C
Sbjct  265  LNARLDELRLRHPDVAIVYADWYGAMMSIFQSPGKLGFTNALLSCCG-------NQTVPC  317

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTP  298
            G    TVCD+PS+Y SWDG+H TEA YK IADG+L GP+ +P
Sbjct  318  GQPGCTVCDDPSTYGSWDGTHPTEAVYKVIADGVLHGPHASP  359



>ref|XP_010232089.1| PREDICTED: GDSL esterase/lipase At1g28600-like isoform X1 [Brachypodium 
distachyon]
Length=370

 Score =   181 bits (459),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 83/162 (51%), Positives = 109/162 (67%), Gaps = 8/162 (5%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHF-MTANTSEYDPKTGCLNWLNDFSEYHNRL  604
            +V ELI  GA+  +VPGN P GC+  YL  F  +A+  +YDP+TGCL W N F+EYHNR+
Sbjct  206  AVEELIAMGARAFMVPGNLPFGCTPLYLRRFGRSASAGDYDPRTGCLAWFNAFAEYHNRV  265

Query  603  LQNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGLVDC  424
            L   LD LR ++PD  I+YAD+Y A M ++ SP K GF N +++CCG       +  V C
Sbjct  266  LNARLDELRLRHPDVAIVYADWYGAMMSIFQSPGKLGFTNALLSCCG-------NQTVPC  318

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTP  298
            G    TVCD+PS+Y SWDG+H TEA YK IADG+L GP+ +P
Sbjct  319  GQPGCTVCDDPSTYGSWDGTHPTEAVYKVIADGVLHGPHASP  360



>gb|KCW63215.1| hypothetical protein EUGRSUZ_G00835, partial [Eucalyptus grandis]
Length=345

 Score =   180 bits (457),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 88/158 (56%), Positives = 113/158 (72%), Gaps = 2/158 (1%)
 Frame = -2

Query  768  LIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLLQNEL  589
            LIEHGA  ++VPGN PIGC  SY+T       ++ +  TGCLN  N+F++YHN  LQ EL
Sbjct  189  LIEHGAVELVVPGNLPIGCLTSYITTAPPFLKNDANTATGCLNRYNEFAKYHNNYLQREL  248

Query  588  DRLREQYPDTTIIYADYYNAAMRLYNSPSKYGF-KNTVVACCGGGGPYNYDGLVDCGSAS  412
              LR++Y    IIYADYY   MRL+ SP++YGF K+T VACCG GGP+N++  + CGS S
Sbjct  249  QVLRQKYSHARIIYADYYGDIMRLFESPTQYGFSKSTHVACCGAGGPFNFNVRMMCGSTS  308

Query  411  STVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTP  298
            S VC +PS+ I WDG HLTEAAY+ +A GLL GP+T+P
Sbjct  309  S-VCKDPSASILWDGVHLTEAAYRHMAKGLLDGPFTSP  345



>ref|XP_006646155.1| PREDICTED: GDSL esterase/lipase At1g28600-like [Oryza brachyantha]
Length=375

 Score =   181 bits (459),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 82/161 (51%), Positives = 105/161 (65%), Gaps = 7/161 (4%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            +V E+I  GA+  +VPGN P GC+  YL  F  A  SEYD +TGCL W N F+EYHNRLL
Sbjct  212  AVEEMIGMGARAFVVPGNLPFGCAPLYLQRFRGAPASEYDARTGCLAWFNRFAEYHNRLL  271

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGLVDCG  421
               LD LR+ +PD TI+YAD+Y A   ++ +P K GF N + +CCG       +  V CG
Sbjct  272  TARLDELRQLHPDVTIVYADWYGAMTSIFQNPGKLGFTNALGSCCG-------NQSVPCG  324

Query  420  SASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTP  298
                 VCD+PS+Y+SWDG+H TEA YK IADG+L GP+  P
Sbjct  325  KKGCAVCDDPSTYVSWDGTHPTEAVYKVIADGVLHGPHAAP  365



>ref|XP_010052214.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Eucalyptus grandis]
Length=366

 Score =   181 bits (458),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 83/164 (51%), Positives = 111/164 (68%), Gaps = 1/164 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            +V+ LIE GA  ++VPG  P GC + YLT F +AN S YDPKTGCL   N   +YHN  L
Sbjct  201  AVSILIEEGAVNLVVPGQLPTGCISLYLTLFQSANESAYDPKTGCLKAYNALFKYHNNYL  260

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGF-KNTVVACCGGGGPYNYDGLVDC  424
            + EL +LREQYP   ++YADYY A++ +Y +P  YGF    + ACCGGGGPYN++    C
Sbjct  261  KQELQKLREQYPHARVMYADYYGASISIYRTPKFYGFYGGALTACCGGGGPYNFNTSAYC  320

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQI  292
            G   STVC +PS+++ WDG H TE+AY +IA GL+ G + +P +
Sbjct  321  GQPGSTVCKDPSAFVDWDGIHSTESAYHYIARGLIDGGFISPPL  364



>ref|XP_002461110.1| hypothetical protein SORBIDRAFT_02g040940 [Sorghum bicolor]
 gb|EER97631.1| hypothetical protein SORBIDRAFT_02g040940 [Sorghum bicolor]
Length=396

 Score =   181 bits (460),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 83/164 (51%), Positives = 110/164 (67%), Gaps = 2/164 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++ ELI  GA+ ++VPGNFP GC+  YL  F T +T++YD K GCL W ND S+ HNR L
Sbjct  225  ALTELIGLGARTVVVPGNFPTGCNPGYLAQFQTNDTAQYDAK-GCLRWPNDLSQLHNRAL  283

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNT-VVACCGGGGPYNYDGLVDC  424
              EL  LR ++P   ++YADYY AAM +   P K+GF    +V+CCGGGGPYN +    C
Sbjct  284  MAELAELRRRHPGVAVVYADYYAAAMDITADPRKHGFGGAPLVSCCGGGGPYNTNFTAHC  343

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQI  292
            G+ +ST C +P   +SWDG H T+ AYK IADG+L+GPY  P +
Sbjct  344  GATTSTTCRHPYEAVSWDGFHFTDHAYKVIADGVLRGPYAAPPV  387



>ref|XP_004485880.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Cicer arietinum]
Length=375

 Score =   181 bits (458),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 84/165 (51%), Positives = 114/165 (69%), Gaps = 2/165 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++ ELI  GA  ++VPGN PIGCSA YLT F + N  +YD K GCL   N F++YHN+ L
Sbjct  205  TITELIAEGAVELLVPGNLPIGCSAVYLTLFRSKNIEDYD-KNGCLKAFNGFAKYHNKQL  263

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNTVV-ACCGGGGPYNYDGLVDC  424
               L+ LR++ P   IIYA+Y+ AA R +++P  YGF N    ACCGGGGPYN++    C
Sbjct  264  NLALETLRQKNPHARIIYANYFGAANRFFHAPRHYGFTNGASRACCGGGGPYNFNNSARC  323

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQIN  289
            G ++S  C +P++Y +WDG HLTEAAY+ IA GL++GP+T P +N
Sbjct  324  GHSNSKACADPTTYANWDGIHLTEAAYRHIAKGLIEGPFTNPPLN  368



>ref|XP_009415142.1| PREDICTED: uncharacterized protein LOC103996059 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=448

 Score =   182 bits (463),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 82/178 (46%), Positives = 117/178 (66%), Gaps = 5/178 (3%)
 Frame = -2

Query  783  FSVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRL  604
            F   +LIE GA+ ++VPG  P+GC+  YLT + +    +YD   GC+ WLN+FS+YHN  
Sbjct  263  FVGQKLIELGARALLVPGITPLGCNTVYLTTYRSDRAEDYD-AIGCIRWLNEFSQYHNGH  321

Query  603  LQNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGLVDC  424
            L +E+ RL+  +P+  IIYADYY A M +++ P ++G +   +ACCGGGGPYNY+    C
Sbjct  322  LHDEVRRLQALHPEAVIIYADYYGAMMNIFSDPERFGIEERFLACCGGGGPYNYNSSRPC  381

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGECIFRSPKTKLS  250
            GS   TVCD+ S+Y+ WDG H+TEA Y+ ++ GLL+GP+  P I   C    P T+ S
Sbjct  382  GSEGQTVCDDTSTYLHWDGLHMTEATYRIVSVGLLQGPFAVPAIATTC----PATRFS  435



>ref|XP_010277743.1| PREDICTED: GDSL esterase/lipase At1g28570-like [Nelumbo nucifera]
Length=390

 Score =   181 bits (459),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 81/160 (51%), Positives = 108/160 (68%), Gaps = 2/160 (1%)
 Frame = -2

Query  762  EHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLLQNELDR  583
            E+GA  ++VPG+ P GC   +LT F + N  +Y+ +TGCL WLN  SE++N LLQ E+ R
Sbjct  215  ENGAVTLLVPGHLPYGCFPVFLTDFKSPNEEDYESETGCLRWLNQLSEFNNHLLQEEIHR  274

Query  582  LREQYPDTTIIYADYYNAAMRLYNSPSKYGFKN--TVVACCGGGGPYNYDGLVDCGSASS  409
            LR  +P  TIIYAD YNA   ++ SP K+GF+    ++ CCGG GPYNY+  V CG   +
Sbjct  275  LRHLHPHVTIIYADLYNAVKAIFRSPDKFGFRKGALLLTCCGGEGPYNYNKSVHCGVRGA  334

Query  408  TVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQIN  289
             VC +PS Y SWDG+H+TEA Y+ IA GL++GPY  P  N
Sbjct  335  KVCQDPSQYGSWDGTHMTEAVYRVIATGLMEGPYAIPPFN  374



>ref|XP_010052211.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Eucalyptus grandis]
 gb|KCW76147.1| hypothetical protein EUGRSUZ_D00523 [Eucalyptus grandis]
Length=367

 Score =   180 bits (457),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 82/164 (50%), Positives = 111/164 (68%), Gaps = 1/164 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            +V+ LIE GA  ++VPG  P+GC++ +LT F +AN S YD +TGCL   + F +YHN  L
Sbjct  202  AVSMLIEEGAVDLMVPGQLPVGCTSMFLTVFQSANESAYDNRTGCLKAYDAFFKYHNNYL  261

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGF-KNTVVACCGGGGPYNYDGLVDC  424
            + EL  LREQYP   I+YADYY AAM +Y SP  YGF   T  ACCGGGGP+N++    C
Sbjct  262  KQELQNLREQYPHARIMYADYYGAAMTIYRSPKHYGFYGGTPRACCGGGGPHNFNTTAVC  321

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQI  292
            G   +T C +PS+++ WDG H TE+AY  IA G++ G +T+P +
Sbjct  322  GQTGATACKDPSAFMDWDGIHFTESAYHHIAKGMINGGFTSPPL  365



>ref|XP_006415634.1| hypothetical protein EUTSA_v10009717mg [Eutrema salsugineum]
 gb|ESQ33987.1| hypothetical protein EUTSA_v10009717mg [Eutrema salsugineum]
Length=390

 Score =   181 bits (458),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 85/170 (50%), Positives = 112/170 (66%), Gaps = 2/170 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++  LI+ G +  +VPG+FP+GC  +YLT F TA   +YDP TGCL WLN+F E+HN  L
Sbjct  214  AIVNLIDLGGKTFVVPGSFPLGCIPAYLTLFQTAKEEDYDPFTGCLPWLNEFGEHHNEQL  273

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNTVV-ACCGGGGPYNYDGLVD-  427
            + EL RL++ YP  +IIYAD+YN+  R +  P+K+GFKN  + A CG GG YN+    D 
Sbjct  274  KTELKRLQQLYPHASIIYADHYNSMYRFFREPAKHGFKNRPLGASCGVGGKYNFTVSEDQ  333

Query  426  CGSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGECI  277
            CG    + C NPS Y+ WDG H TEA Y+ +A GLL GPY TP  N  C+
Sbjct  334  CGYRGVSYCPNPSEYVHWDGYHSTEATYRKMAQGLLNGPYATPAFNWSCL  383



>ref|NP_001042396.1| Os01g0215700 [Oryza sativa Japonica Group]
 dbj|BAF04310.1| Os01g0215700 [Oryza sativa Japonica Group]
 dbj|BAG87737.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG86888.1| unnamed protein product [Oryza sativa Japonica Group]
Length=378

 Score =   180 bits (457),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 82/164 (50%), Positives = 116/164 (71%), Gaps = 2/164 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            +   LI+ GA  ++VPGN PIGCS++YLT   ++N S+YD  TGCL   NDF+++HN +L
Sbjct  215  ATERLIKAGAVHLVVPGNLPIGCSSAYLTLHPSSNRSDYD-STGCLKTYNDFAQHHNAVL  273

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNTVV-ACCGGGGPYNYDGLVDC  424
            Q++L  LR  YP+  I+YADYY AAM    +P ++GF++  +  CCGGGGPYN++    C
Sbjct  274  QDKLRLLRRSYPEARIMYADYYGAAMSFAQNPKQFGFRHGALRTCCGGGGPYNFNPKASC  333

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQI  292
            G   S+VC +PS+Y +WDG HLTEA Y  IA+ +L GPYT+P++
Sbjct  334  GVRGSSVCTDPSAYANWDGVHLTEAGYHAIANSILNGPYTSPRL  377



>ref|NP_564314.1| GDSL esterase/lipase [Arabidopsis thaliana]
 sp|Q9FPE4.1|GDL12_ARATH RecName: Full=GDSL esterase/lipase At1g28660; AltName: Full=Extracellular 
lipase At1g28660; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAG42007.1|AF327417_1 unknown protein [Arabidopsis thaliana]
 gb|AAN71956.1| unknown protein [Arabidopsis thaliana]
 gb|AEE31011.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=383

 Score =   180 bits (457),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 83/169 (49%), Positives = 112/169 (66%), Gaps = 1/169 (1%)
 Frame = -2

Query  780  SVNELIEHGAQXIIVPGNFPIGCSASYLTHFMTANTSEYDPKTGCLNWLNDFSEYHNRLL  601
            ++ +LI  G +  +VPG FP GCSA+ LT +  A   +YDP TGC+  LN+  E+ N  L
Sbjct  208  AIVDLIALGGKTFLVPGGFPAGCSAACLTQYQNATEEDYDPLTGCIPRLNELGEHDNEQL  267

Query  600  QNELDRLREQYPDTTIIYADYYNAAMRLYNSPSKYGFKNT-VVACCGGGGPYNYDGLVDC  424
            + EL RL++ YPD  IIYADY+N+  R Y  P+KYGFKN  + ACCG GG YN+    +C
Sbjct  268  KTELKRLQKLYPDVNIIYADYHNSLYRFYQEPAKYGFKNKPLAACCGVGGKYNFTIGKEC  327

Query  423  GSASSTVCDNPSSYISWDGSHLTEAAYKWIADGLLKGPYTTPQINGECI  277
            G    + C NPS Y++WDG HLTEAAY+ +A+G+L GPY TP  +  C+
Sbjct  328  GYEGVSYCQNPSEYVNWDGYHLTEAAYQKMAEGILNGPYATPAFDWSCL  376



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1641823912876