BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig11397

Length=861
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009771934.1|  PREDICTED: RNA polymerase sigma factor sigA        315   2e-100   Nicotiana sylvestris
dbj|BAA88921.1|  sigma factor                                           315   2e-100   Nicotiana tabacum [American tobacco]
ref|XP_011075762.1|  PREDICTED: RNA polymerase sigma factor sigA        315   2e-100   Sesamum indicum [beniseed]
ref|XP_009601815.1|  PREDICTED: RNA polymerase sigma factor sigA-...    312   3e-99    Nicotiana tomentosiformis
ref|XP_009767654.1|  PREDICTED: RNA polymerase sigma factor sigA-...    309   5e-98    Nicotiana sylvestris
ref|XP_004235299.1|  PREDICTED: RNA polymerase sigma factor sigA        309   6e-98    Solanum lycopersicum
ref|XP_010275189.1|  PREDICTED: RNA polymerase sigma factor sigA-...    307   3e-97    Nelumbo nucifera [Indian lotus]
ref|XP_006419162.1|  hypothetical protein EUTSA_v10002486mg             307   5e-97    Eutrema salsugineum [saltwater cress]
ref|XP_002524027.1|  RNA polymerase sigma factor rpoD, putative         305   1e-96    
ref|XP_009629626.1|  PREDICTED: RNA polymerase sigma factor sigA-...    305   2e-96    Nicotiana tomentosiformis
dbj|BAA88922.1|  sigma factor                                           305   2e-96    Nicotiana tabacum [American tobacco]
ref|XP_009629625.1|  PREDICTED: RNA polymerase sigma factor sigA-...    305   2e-96    Nicotiana tomentosiformis
ref|XP_009128472.1|  PREDICTED: RNA polymerase sigma factor sigA        304   2e-96    Brassica rapa
gb|EYU44877.1|  hypothetical protein MIMGU_mgv1a004509mg                305   2e-96    Erythranthe guttata [common monkey flower]
ref|XP_006347341.1|  PREDICTED: RNA polymerase sigma factor sigA-...    305   2e-96    Solanum tuberosum [potatoes]
emb|CDY56127.1|  BnaA02g20170D                                          304   2e-96    Brassica napus [oilseed rape]
gb|EYU44876.1|  hypothetical protein MIMGU_mgv1a004509mg                305   3e-96    Erythranthe guttata [common monkey flower]
ref|XP_010662046.1|  PREDICTED: RNA polymerase sigma factor sigA ...    304   3e-96    Vitis vinifera
emb|CDY52962.1|  BnaCnng23900D                                          303   3e-96    Brassica napus [oilseed rape]
ref|XP_010662045.1|  PREDICTED: RNA polymerase sigma factor sigA ...    304   3e-96    
emb|CDP04910.1|  unnamed protein product                                304   4e-96    Coffea canephora [robusta coffee]
emb|CBI26421.3|  unnamed protein product                                305   6e-96    Vitis vinifera
ref|XP_012070278.1|  PREDICTED: RNA polymerase sigma factor sigA        303   6e-96    Jatropha curcas
ref|XP_010511140.1|  PREDICTED: RNA polymerase sigma factor sigA        305   6e-96    
ref|XP_010414870.1|  PREDICTED: RNA polymerase sigma factor sigA-...    303   1e-95    Camelina sativa [gold-of-pleasure]
ref|XP_007029766.1|  Sigma factor A isoform 1                           303   1e-95    
ref|XP_004241445.1|  PREDICTED: RNA polymerase sigma factor sigA        303   1e-95    Solanum lycopersicum
gb|KDO48034.1|  hypothetical protein CISIN_1g010521mg                   301   4e-95    Citrus sinensis [apfelsine]
ref|XP_006484698.1|  PREDICTED: RNA polymerase sigma factor sigA-...    301   5e-95    Citrus sinensis [apfelsine]
ref|XP_010470329.1|  PREDICTED: RNA polymerase sigma factor sigA-...    301   5e-95    Camelina sativa [gold-of-pleasure]
gb|KDO48032.1|  hypothetical protein CISIN_1g010521mg                   301   5e-95    Citrus sinensis [apfelsine]
ref|XP_002325882.1|  RNA POLYMERASE SIGMA SUBUNIT 1 family protein      301   8e-95    Populus trichocarpa [western balsam poplar]
gb|KJB44350.1|  hypothetical protein B456_007G247500                    300   1e-94    Gossypium raimondii
ref|XP_010266387.1|  PREDICTED: RNA polymerase sigma factor sigA-...    300   1e-94    Nelumbo nucifera [Indian lotus]
ref|XP_006302143.1|  hypothetical protein CARUB_v10020145mg             301   1e-94    
ref|XP_011012457.1|  PREDICTED: RNA polymerase sigma factor sigA        300   1e-94    Populus euphratica
emb|CAA75859.1|  Sig1                                                   299   1e-94    Sinapis alba [bai jie]
gb|KHG03684.1|  RNA polymerase sigma factor rpoD                        300   2e-94    Gossypium arboreum [tree cotton]
ref|XP_006437403.1|  hypothetical protein CICLE_v10031289mg             300   2e-94    Citrus clementina [clementine]
ref|XP_010087437.1|  RNA polymerase sigma factor rpoD                   300   2e-94    
ref|XP_002886771.1|  RNA polymerase sigma subunit 1                     297   1e-93    
ref|NP_176666.1|  RNA polymerase sigma subunit 1                        297   1e-93    Arabidopsis thaliana [mouse-ear cress]
gb|AAG40388.1|AF325036_1  At1g64860                                     297   1e-93    Arabidopsis thaliana [mouse-ear cress]
emb|CAA74896.1|  sigma factorB                                          297   2e-93    Arabidopsis thaliana [mouse-ear cress]
gb|AAB81958.1|  RNA polymerase sigma subunit 1                          297   2e-93    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010550940.1|  PREDICTED: RNA polymerase sigma factor sigA        297   2e-93    Tarenaya hassleriana [spider flower]
dbj|BAA22214.1|  plastid RNA polymerase sigma-subunit                   297   2e-93    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002319237.2|  hypothetical protein POPTR_0013s07290g             297   2e-93    
ref|XP_011011636.1|  PREDICTED: RNA polymerase sigma factor sigA-...    296   3e-93    Populus euphratica
ref|XP_010063584.1|  PREDICTED: RNA polymerase sigma factor sigA        296   8e-93    Eucalyptus grandis [rose gum]
ref|XP_007219023.1|  hypothetical protein PRUPE_ppa004393mg             295   2e-92    Prunus persica
ref|XP_008234513.1|  PREDICTED: RNA polymerase sigma factor sigA        294   4e-92    Prunus mume [ume]
ref|XP_010670766.1|  PREDICTED: RNA polymerase sigma factor sigA        293   6e-92    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009361126.1|  PREDICTED: RNA polymerase sigma factor sigA ...    292   2e-91    Pyrus x bretschneideri [bai li]
ref|XP_008376946.1|  PREDICTED: RNA polymerase sigma factor sigA-...    291   4e-91    Malus domestica [apple tree]
ref|XP_004307835.2|  PREDICTED: RNA polymerase sigma factor sigA        288   5e-90    Fragaria vesca subsp. vesca
ref|XP_006878659.1|  PREDICTED: RNA polymerase sigma factor sigA        286   2e-89    Amborella trichopoda
ref|XP_003539986.1|  PREDICTED: RNA polymerase sigma factor sigA-...    286   3e-89    Glycine max [soybeans]
ref|XP_008462812.1|  PREDICTED: RNA polymerase sigma factor sigA        286   3e-89    
gb|KJB44354.1|  hypothetical protein B456_007G247500                    287   4e-89    Gossypium raimondii
ref|XP_004151855.1|  PREDICTED: RNA polymerase sigma factor sigA        285   8e-89    Cucumis sativus [cucumbers]
gb|KJB26696.1|  hypothetical protein B456_004G255000                    284   2e-88    Gossypium raimondii
ref|XP_010910228.1|  PREDICTED: RNA polymerase sigma factor sigA ...    284   3e-88    Elaeis guineensis
ref|XP_008382369.1|  PREDICTED: RNA polymerase sigma factor sigA-...    283   1e-87    
ref|XP_007131471.1|  hypothetical protein PHAVU_011G016400g             281   2e-87    Phaseolus vulgaris [French bean]
ref|XP_010910226.1|  PREDICTED: RNA polymerase sigma factor sigA ...    283   3e-87    
gb|KHG22597.1|  RNA polymerase sigma factor rpoD                        280   4e-87    Gossypium arboreum [tree cotton]
ref|XP_003534364.1|  PREDICTED: RNA polymerase sigma factor sigA-...    280   5e-87    Glycine max [soybeans]
ref|XP_009397520.1|  PREDICTED: RNA polymerase sigma factor sigA-...    280   5e-87    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004499501.1|  PREDICTED: RNA polymerase sigma factor sigA-...    279   2e-86    
gb|KEH16477.1|  RNA polymerase sigma factor                             278   3e-86    Medicago truncatula
ref|XP_004499499.1|  PREDICTED: RNA polymerase sigma factor sigA-...    278   3e-86    Cicer arietinum [garbanzo]
ref|XP_008808794.1|  PREDICTED: RNA polymerase sigma factor sigA        278   5e-86    Phoenix dactylifera
gb|EPS67249.1|  sigma factor                                            276   2e-85    Genlisea aurea
ref|XP_009348922.1|  PREDICTED: RNA polymerase sigma factor sigA-...    276   4e-85    Pyrus x bretschneideri [bai li]
ref|XP_009382828.1|  PREDICTED: RNA polymerase sigma factor sigA-...    274   1e-84    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004499502.1|  PREDICTED: RNA polymerase sigma factor sigA-...    273   6e-84    Cicer arietinum [garbanzo]
ref|XP_010662047.1|  PREDICTED: RNA polymerase sigma factor sigA ...    251   2e-75    Vitis vinifera
gb|EAZ05701.1|  hypothetical protein OsI_27933                          246   3e-75    Oryza sativa Indica Group [Indian rice]
dbj|BAC99906.1|  putative plastid RNA polymerase sigma factor           245   3e-75    Oryza sativa Japonica Group [Japonica rice]
dbj|BAC99905.1|  putative plastid RNA polymerase sigma factor           246   4e-75    Oryza sativa Japonica Group [Japonica rice]
gb|EAZ41616.1|  hypothetical protein OsJ_26150                          246   1e-74    Oryza sativa Japonica Group [Japonica rice]
ref|XP_003573435.1|  PREDICTED: RNA polymerase sigma factor sigA        248   3e-74    Brachypodium distachyon [annual false brome]
gb|AAC78467.1|  RNA polymerase sigma factor 1                           243   5e-74    Zea mays [maize]
ref|XP_008678254.1|  PREDICTED: RNA polymerase sigma factor sigA ...    246   6e-74    Zea mays [maize]
ref|XP_002443917.1|  hypothetical protein SORBIDRAFT_07g004340          246   6e-74    Sorghum bicolor [broomcorn]
dbj|BAA24364.1|  plastid RNA polymerase sigma factor                    246   9e-74    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001061065.2|  Os08g0163400                                       246   1e-73    
dbj|BAJ99592.1|  predicted protein                                      245   2e-73    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008662828.1|  PREDICTED: RNA polymerase sigma factor sigA        244   4e-73    Zea mays [maize]
emb|CAA74653.1|  plastid RNA polymerase sigma factor                    244   4e-73    Sorghum bicolor [broomcorn]
dbj|BAJ92935.1|  predicted protein                                      244   5e-73    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KDO48031.1|  hypothetical protein CISIN_1g010521mg                   242   2e-72    Citrus sinensis [apfelsine]
gb|AAC78468.1|  RNA polymerase sigma factor 2                           238   2e-72    Zea mays [maize]
ref|XP_004972754.1|  PREDICTED: RNA polymerase sigma factor sigA-...    243   2e-72    
gb|EMT32448.1|  RNA polymerase sigma factor rpoD                        239   2e-72    
ref|XP_008678253.1|  PREDICTED: RNA polymerase sigma factor sigA ...    240   1e-71    Zea mays [maize]
ref|NP_001185314.1|  RNA polymerase sigma subunit 1                     239   3e-71    
gb|KCW90982.1|  hypothetical protein EUGRSUZ_A02994                     240   4e-71    Eucalyptus grandis [rose gum]
ref|XP_009361127.1|  PREDICTED: RNA polymerase sigma factor sigA ...    238   5e-71    Pyrus x bretschneideri [bai li]
gb|EMS46133.1|  RNA polymerase sigma factor rpoD                        238   1e-70    Triticum urartu
ref|XP_008376947.1|  PREDICTED: RNA polymerase sigma factor sigA-...    237   1e-70    Malus domestica [apple tree]
ref|XP_006659164.1|  PREDICTED: LOW QUALITY PROTEIN: RNA polymera...    236   6e-70    Oryza brachyantha
emb|CAA10725.1|  chloroplast sigma factor                               233   2e-69    Triticum aestivum [Canadian hard winter wheat]
ref|XP_010910227.1|  PREDICTED: RNA polymerase sigma factor sigA ...    225   3e-65    
gb|KHN11742.1|  Maltose excess protein 1, chloroplastic                 221   2e-63    Glycine soja [wild soybean]
ref|XP_010094612.1|  RNA polymerase sigma factor rpoD                   202   1e-60    
ref|XP_006371210.1|  hypothetical protein POPTR_0019s06020g             197   2e-55    
gb|KJB44352.1|  hypothetical protein B456_007G247500                    194   2e-54    Gossypium raimondii
ref|XP_007029767.1|  Sigma factor A isoform 2                           192   9e-54    
gb|KDO48035.1|  hypothetical protein CISIN_1g010521mg                   187   4e-52    Citrus sinensis [apfelsine]
gb|KCW90985.1|  hypothetical protein EUGRSUZ_A02994                     188   6e-52    Eucalyptus grandis [rose gum]
gb|KDO48036.1|  hypothetical protein CISIN_1g010521mg                   143   8e-36    Citrus sinensis [apfelsine]
gb|KDO48037.1|  hypothetical protein CISIN_1g010521mg                   140   9e-35    Citrus sinensis [apfelsine]
ref|XP_001770550.1|  plastid sigma factor SIG1                          139   2e-33    
gb|KCW90984.1|  hypothetical protein EUGRSUZ_A02994                     125   2e-29    Eucalyptus grandis [rose gum]
dbj|BAM45408.1|  sigma factor 1                                         122   8e-28    Marchantia polymorpha
gb|KHE92742.1|  RNA polymerase sigma factor RpoD                        102   5e-22    Candidatus Scalindua brodae
ref|WP_013565889.1|  RNA polymerase sigma70                             103   3e-21    Isosphaera pallida
ref|XP_006302141.1|  hypothetical protein CARUB_v10020145mg             102   4e-21    
ref|WP_015245113.1|  RNA polymerase sigma70                             101   1e-20    Singulisphaera acidiphila
dbj|GAN34376.1|  RNA polymerase primary sigma factor                    100   2e-20    Candidatus Brocadia sinica JPN1
ref|WP_007219995.1|  RNA polymerase sigma70                             100   3e-20    Candidatus Jettenia caeni
gb|KJB44351.1|  hypothetical protein B456_007G247500                  98.6    4e-20    Gossypium raimondii
emb|CAJ71462.1|  strongly similar to transcription initiation fac...    100   4e-20    Candidatus Kuenenia stuttgartiensis
ref|WP_010581773.1|  RNA polymerase sigma70                             100   5e-20    Schlesneria paludicola
ref|WP_024544660.1|  RNA polymerase sigma factor SigC                 97.8    6e-20    Synechococcus
ref|WP_044276944.1|  RNA polymerase sigma factor RpoD                 97.8    7e-20    
dbj|BAL98787.1|  putative RNA polymerase sigma factor                 97.8    9e-20    Caldilinea aerophila DSM 14535 = NBRC 104270
gb|EKD62776.1|  hypothetical protein ACD_52C00059G0002                96.7    1e-19    uncultured bacterium
ref|WP_004405548.1|  MULTISPECIES: RNA polymerase sigma factor RpoD   95.9    1e-19    Thermoanaerobacter
ref|WP_013108497.1|  RNA polymerase sigma70                           97.8    2e-19    Planctopirus limnophila
ref|WP_010049964.1|  RNA polymerase sigma70                           97.4    3e-19    Gemmata obscuriglobus
ref|WP_012842663.1|  RNA polymerase sigma factor rpoD                 94.4    4e-19    Rhodothermus marinus
ref|WP_027131434.1|  RNA polymerase sigma factor rpoD                 94.0    5e-19    
ref|WP_014065864.1|  RNA polymerase sigma factor rpoD                 93.6    8e-19    Rhodothermus
gb|EKE12962.1|  hypothetical protein ACD_13C00110G0010                93.6    1e-18    uncultured bacterium
gb|ADN14192.1|  RNA polymerase, sigma 70 subunit, RpoD subfamily      93.6    3e-18    Cyanothece sp. PCC 7822
ref|WP_041933648.1|  RNA polymerase sigma factor SigC                 93.6    3e-18    
ref|WP_030006065.1|  RNA polymerase sigma factor SigC                 93.2    3e-18    Synechococcus sp. NKBG042902
ref|WP_012305904.1|  RNA polymerase sigma factor SigC                 93.2    3e-18    Synechococcus
gb|EAQ77941.1|  transcription initiation factor sigma 70              94.4    3e-18    Blastopirellula marina DSM 3645
ref|WP_040352700.1|  RNA polymerase sigma70                           94.4    4e-18    Blastopirellula marina
ref|WP_015133087.1|  RNA polymerase, sigma subunit, RpsC/SigC         92.8    4e-18    Leptolyngbya sp. PCC 7376
ref|WP_026389920.1|  DNA-directed RNA polymerase subunit sigma        92.8    4e-18    Acholeplasma axanthum
ref|WP_015954827.1|  RNA polymerase sigma factor SigC                 91.3    2e-17    Cyanothece sp. PCC 7424
dbj|BAL57223.1|  RNA polymerase primary sigma factor                  91.3    2e-17    uncultured Chloroflexi bacterium
gb|ADY58255.1|  RNA polymerase, sigma 70 subunit, RpoD                92.4    2e-17    Rubinisphaera brasiliensis DSM 5305
ref|WP_041398861.1|  RNA polymerase sigma70                           92.4    2e-17    Rubinisphaera brasiliensis
ref|WP_022462739.1|  RNA polymerase sigma factor                      90.1    3e-17    Lachnospiraceae
ref|WP_021962254.1|  RNA polymerase sigma factor                      89.7    3e-17    
ref|WP_028529211.1|  RNA polymerase sigma70 factor                    89.7    4e-17    Ruminococcus gauvreauii
gb|EKD53587.1|  hypothetical protein ACD_61C00009G0004                89.7    4e-17    uncultured bacterium
ref|XP_001712214.1|  rpoD                                             90.9    4e-17    Hemiselmis andersenii
ref|WP_022319742.1|  RNA polymerase sigma factor                      89.4    4e-17    
ref|WP_026369250.1|  RNA polymerase sigma factor RpoD                 89.7    4e-17    
ref|WP_016218807.1|  RNA polymerase sigma factor rpoD                 89.4    4e-17    Dorea sp. 5-2
ref|WP_041904229.1|  RNA polymerase sigma factor rpoD                 88.6    5e-17    
gb|AFP65672.1|  RNA-polymerase sigma factor                           90.5    5e-17    Chroomonas mesostigmatica CCMP1168
ref|WP_022172950.1|  RNA polymerase sigma factor                      89.4    5e-17    Blautia
ref|WP_022338948.1|  RNA polymerase sigma factor                      89.0    5e-17    
dbj|BAB87262.1|  RNA polymerase sigma factor                          90.5    6e-17    Guillardia theta
ref|WP_022270001.1|  RNA polymerase sigma factor                      89.4    6e-17    
ref|WP_022398535.1|  RNA polymerase sigma factor                      89.0    6e-17    
ref|WP_035642681.1|  RNA polymerase sigma70 factor                    89.0    6e-17    Lachnospiraceae bacterium FE2018
ref|WP_003021111.1|  RNA polymerase sigma factor RpoD                 88.6    6e-17    
dbj|GAN34470.1|  RNA polymerase primary sigma factor                  90.1    6e-17    Candidatus Brocadia sinica JPN1
ref|XP_001713512.1|  RNA-polymerase sigma factor                      90.1    7e-17    Guillardia theta
ref|WP_035614203.1|  RNA polymerase sigma factor                      90.9    7e-17    
ref|WP_045646239.1|  RNA polymerase sigma factor RpoD                 89.0    7e-17    
ref|WP_027641114.1|  RNA polymerase sigma70 factor [                  89.4    7e-17    [Clostridium] clostridioforme
ref|WP_044902992.1|  RNA polymerase sigma70 factor                    89.0    7e-17    Lachnospiraceae bacterium P6B14
ref|WP_002645726.1|  RNA polymerase sigma70                           90.5    7e-17    Gimesia maris
ref|WP_004602370.1|  RNA polymerase sigma factor RpoD [               89.0    8e-17    [Eubacterium] cellulosolvens
gb|AEV88019.1|  RNA polymerase principal sigma factor hrdB            88.2    8e-17    Actinoplanes sp. SE50/110
ref|WP_044916468.1|  RNA polymerase sigma70 factor                    89.0    8e-17    Clostridiales
ref|WP_043516178.1|  RNA polymerase sigma factor SigB                 88.2    8e-17    Actinoplanes
ref|WP_009246158.1|  MULTISPECIES: RNA polymerase sigma factor RpoD   88.6    8e-17    Blautia hansenii
ref|WP_021620497.1|  RNA polymerase sigma factor RpoD                 88.6    9e-17    Aneurinibacillus aneurinilyticus
ref|WP_016214220.1|  RNA polymerase sigma factor rpoD                 88.6    9e-17    Eubacterium sp. 14-2
ref|WP_009250189.1|  RNA polymerase sigma factor RpoD                 89.0    9e-17    
ref|WP_031389425.1|  RNA polymerase sigma70 factor                    88.6    9e-17    Kineothrix alysoides
ref|WP_044971698.1|  MULTISPECIES: RNA polymerase sigma70 factor      88.6    9e-17    Eisenbergiella tayi
ref|WP_025491372.1|  RNA polymerase sigma70 factor                    89.0    9e-17    
ref|WP_008374891.1|  MULTISPECIES: RNA polymerase sigma factor RpoD   88.6    9e-17    Coprococcus comes
gb|ERI65918.1|  RNA polymerase sigma factor RpoD                      89.0    9e-17    Clostridium sp. KLE 1755
ref|WP_043065621.1|  RNA polymerase sigma factor RpoD                 88.6    1e-16    Aneurinibacillus migulanus
ref|WP_016294465.1|  RNA polymerase sigma factor rpoD                 88.6    1e-16    Lachnospiraceae bacterium M18-1
gb|AAB39998.1|  sigma factor                                          89.0    1e-16    Synechococcus sp. PCC 7002
ref|WP_027870836.1|  RNA polymerase sigma70 factor [                  88.6    1e-16    [Eubacterium] cellulosolvens
ref|WP_022068647.1|  RNA polymerase sigma factor                      88.6    1e-16    
ref|WP_025960939.1|  RNA polymerase sigma factor RpoD                 85.9    1e-16    
ref|WP_029244874.1|  RNA polymerase sigma factor rpoD                 87.0    1e-16    Streptococcus sobrinus
gb|AFN76004.1|  DNA-directed RNA polymerase sigma subunit RpoD        87.4    1e-16    Melioribacter roseus P3M-2
ref|WP_009645128.1|  RNA polymerase sigma factor RpoD                 88.2    1e-16    Selenomonas sp. CM52
ref|WP_045170522.1|  RNA polymerase sigma factor RpoD                 87.8    1e-16    Caldicellulosiruptor morganii
ref|WP_022034187.1|  RNA polymerase sigma factor                      88.2    1e-16    
ref|WP_013669912.1|  RNA polymerase sigma factor RpoD                 88.6    1e-16    Aerococcus urinae
ref|WP_041356134.1|  RNA polymerase sigma factor rpoD                 87.0    1e-16    Melioribacter roseus
ref|WP_006191682.1|  RNA polymerase sigma factor RpoD                 88.2    1e-16    Selenomonas sputigena
ref|WP_022201595.1|  RNA polymerase sigma factor                      88.6    1e-16    Clostridium sp. C105KSO14
ref|WP_002587616.1|  RNA polymerase sigma70 factor [                  88.6    1e-16    [Clostridium] clostridioforme
gb|EFQ56572.1|  RNA polymerase sigma factor RpoD                      87.4    1e-16    Streptococcus downei F0415
ref|WP_036709770.1|  RNA polymerase sigma factor RpoD                 87.4    1e-16    
ref|WP_022057754.1|  RNA polymerase sigma factor                      88.2    1e-16    
ref|WP_044945206.1|  RNA polymerase sigma70 factor                    88.2    1e-16    Blautia schinkii
ref|WP_002564777.1|  RNA polymerase sigma70 factor [                  88.2    2e-16    [Clostridium] bolteae
ref|WP_044123975.1|  RNA polymerase sigma factor RpoD                 87.8    2e-16    Streptococcus downei
ref|WP_016291595.1|  RNA polymerase sigma factor rpoD                 87.8    2e-16    Lachnospiraceae bacterium 28-4
ref|WP_002575068.1|  MULTISPECIES: RNA polymerase sigma factor RpoD   88.2    2e-16    Clostridiales
ref|WP_027890242.1|  RNA polymerase sigma factor RpoD                 87.8    2e-16    Megamonas hypermegale
ref|WP_045166428.1|  RNA polymerase sigma factor RpoD                 87.4    2e-16    
ref|WP_012911622.1|  RNA polymerase sigma70                           89.4    2e-16    Pirellula staleyi
ref|WP_020474117.1|  hypothetical protein                             89.4    2e-16    Zavarzinella formosa
ref|WP_027415838.1|  RNA polymerase sigma factor RpoD                 87.8    2e-16    Aneurinibacillus terranovensis
ref|WP_025920634.1|  RNA polymerase sigma factor RpoD                 86.3    2e-16    
ref|WP_022075107.1|  RNA polymerase sigma factor                      87.8    2e-16    
ref|WP_018345375.1|  RNA polymerase sigma factor RpoD                 87.8    2e-16    Enterococcus cecorum
ref|WP_016284218.1|  RNA polymerase sigma factor rpoD                 87.8    2e-16    Lachnospiraceae bacterium A4
ref|WP_022313271.1|  RNA polymerase sigma factor                      87.8    2e-16    Clostridium
ref|WP_033405388.1|  MULTISPECIES: RNA polymerase sigma factor RpoD   87.4    2e-16    
ref|WP_002960771.1|  RNA polymerase sigma factor RpoD                 87.8    2e-16    Streptococcus sobrinus
gb|ERK42316.1|  RNA polymerase sigma factor RpoD                      87.8    2e-16    Eubacterium ramulus ATCC 29099
ref|WP_025943963.1|  RNA polymerase sigma factor RpoD                 86.3    2e-16    
ref|WP_022035513.1|  MULTISPECIES: RNA polymerase sigma factor        87.8    2e-16    Eubacterium ramulus
ref|WP_025657366.1|  RNA polymerase sigma70 factor                    87.8    2e-16    Clostridiales
ref|WP_022005546.1|  RNA polymerase sigma factor                      87.8    2e-16    
gb|EOX17123.1|  RNA polymerase sigma factor rpoD                      87.8    2e-16    Enterococcus cecorum DSM 20682 = ATCC 43198
ref|WP_019787874.1|  RNA polymerase sigma factor RpoD                 87.8    2e-16    Streptococcus
ref|WP_018367429.1|  RNA polymerase sigma factor RpoD                 87.4    2e-16    Streptococcus entericus
ref|WP_016224725.1|  RNA polymerase sigma factor rpoD                 87.4    2e-16    Lachnospiraceae bacterium 3-2
ref|WP_019782236.1|  RNA polymerase sigma factor RpoD                 87.4    2e-16    Streptococcus sobrinus
ref|WP_025927421.1|  RNA polymerase sigma factor RpoD                 86.3    2e-16    
ref|WP_027424571.1|  RNA polymerase sigma70 factor                    87.8    2e-16    
ref|WP_004229816.1|  RNA polymerase sigma factor RpoD                 87.4    2e-16    Streptococcus criceti
ref|WP_022469409.1|  RNA polymerase sigma factor                      87.4    2e-16    
ref|WP_009004137.1|  RNA polymerase sigma factor RpoD                 87.4    2e-16    Clostridiales
ref|WP_015810559.1|  MULTISPECIES: RNA polymerase sigma factor rpoD   86.3    2e-16    Dyadobacter
ref|WP_027429543.1|  RNA polymerase sigma70 factor                    87.4    2e-16    Lachnospiraceae bacterium AD3010
ref|WP_004606297.1|  RNA polymerase sigma factor RpoD [               87.4    2e-16    [Clostridium] scindens
emb|CDZ79786.1|  Sigma-A                                              89.0    2e-16    Candidatus Rubidus massiliensis
ref|WP_034122048.1|  RNA polymerase sigma factor RpoD                 87.4    2e-16    
ref|WP_026399781.1|  DNA-directed RNA polymerase subunit sigma        87.8    2e-16    Acholeplasma equifetale
ref|WP_008538968.1|  RNA polymerase sigma factor RpoD                 87.4    2e-16    Megamonas
ref|WP_016183140.1|  RNA polymerase sigma factor rpoD                 87.4    2e-16    Enterococcus columbae
ref|WP_013560272.1|  RNA polymerase sigma factor RpoD                 87.8    3e-16    Anaerolinea thermophila
ref|WP_022433499.1|  RNA polymerase sigma factor                      87.8    3e-16    
ref|WP_011434275.1|  RNA polymerase sigma factor SigC                 87.0    3e-16    Synechococcus sp. JA-2-3B'a(2-13)
ref|WP_006443915.1|  RNA polymerase sigma factor RpoD [               87.0    3e-16    [Clostridium] hylemonae
ref|XP_001757475.1|  predicted protein                                88.6    3e-16    
ref|WP_012032078.1|  RNA polymerase sigma factor RpoD                 87.0    3e-16    
ref|WP_034868024.1|  hypothetical protein                             86.3    3e-16    
ref|WP_017770196.1|  RNA polymerase sigma factor RpoD                 87.0    3e-16    Streptococcus
ref|WP_016301004.1|  RNA polymerase sigma factor rpoD                 87.0    3e-16    Lachnospiraceae bacterium COE1
ref|WP_018379952.1|  RNA polymerase sigma factor RpoD                 87.0    3e-16    Streptococcus thoraltensis
ref|WP_019162076.1|  RNA polymerase sigma factor RpoD                 87.0    3e-16    
ref|WP_028086279.1|  RNA polymerase sigma70 factor                    87.0    3e-16    Dorea longicatena
ref|WP_011343392.1|  MULTISPECIES: RNA polymerase sigma factor RpoD   87.0    3e-16    Carboxydothermus
ref|WP_029691735.1|  RNA polymerase sigma factor RpoD                 87.0    3e-16    Streptococcus hyovaginalis
ref|WP_006426751.1|  MULTISPECIES: RNA polymerase sigma factor RpoD   87.0    4e-16    Dorea longicatena
ref|WP_009266328.1|  RNA polymerase sigma factor RpoD                 87.0    4e-16    Lachnospiraceae bacterium 1_4_56FAA
gb|KIJ81847.1|  RNA polymerase sigma factor SigC                      87.4    4e-16    Scytonema tolypothrichoides VB-61278
ref|WP_006522670.1|  RNA polymerase sigma factor RpoD                 87.0    4e-16    Desulfallas gibsoniae
ref|WP_005336805.1|  MULTISPECIES: RNA polymerase sigma factor RpoD   87.0    4e-16    Dorea
ref|WP_041741986.1|  RNA polymerase sigma factor RpoD                 86.7    4e-16    
emb|CCY34339.1|  rNA polymerase sigma factor                          86.3    4e-16    Ruminococcus sp. CAG:60
ref|WP_025195396.1|  RNA polymerase sigma factor RpoD                 86.7    4e-16    Streptococcus agalactiae
ref|WP_025958297.1|  RNA polymerase sigma factor RpoD                 85.9    4e-16    
ref|WP_022304129.1|  RNA polymerase sigma factor                      86.7    4e-16    unclassified Firmicutes sensu stricto (miscellaneous)
ref|WP_022123760.1|  RNA polymerase sigma factor                      86.7    4e-16    
ref|WP_039725405.1|  MULTISPECIES: RNA polymerase sigma factor SigC   87.4    4e-16    
emb|CBK81185.1|  RNA polymerase, sigma 70 subunit, RpoD               86.7    4e-16    Coprococcus catus GD/7
ref|WP_022127798.1|  RNA polymerase sigma factor                      86.7    4e-16    
ref|WP_003087872.1|  RNA polymerase sigma factor RpoD                 86.7    4e-16    Streptococcus
ref|WP_022407703.1|  RNA polymerase sigma factor                      86.7    4e-16    
gb|EFO80491.1|  RNA polymerase, sigma 70 subunit, RpoD subfamily      87.0    4e-16    Oscillochloris trichoides DG-6
ref|WP_009460881.1|  RNA polymerase sigma factor RpoD                 86.7    4e-16    Lachnospiraceae bacterium 2_1_46FAA
ref|WP_044200429.1|  RNA polymerase sigma factor RpoD                 86.7    4e-16    Oscillochloris trichoides
gb|ABD00177.1|  RNA polymerase sigma-70 factor family                 86.7    4e-16    Synechococcus sp. JA-3-3Ab
ref|WP_022421282.1|  RNA polymerase sigma factor                      87.0    4e-16    
ref|WP_027976273.1|  RNA polymerase sigma factor RpoD                 86.7    4e-16    
ref|WP_022517411.1|  RNA polymerase sigma factor                      86.7    4e-16    
ref|WP_037620212.1|  RNA polymerase sigma factor RpoD                 86.3    5e-16    
ref|WP_014561989.1|  RNA polymerase sigma factor rpoD                 85.5    5e-16    
gb|EDR47971.1|  RNA polymerase sigma factor RpoD                      86.7    5e-16    
ref|WP_008505496.1|  RNA polymerase sigma factor rpoD                 85.5    5e-16    
gb|KGO31538.1|  RNA polymerase sigma factor RpoD                      85.9    5e-16    
ref|WP_022010210.1|  RNA polymerase sigma factor                      86.7    5e-16    
ref|WP_036923371.1|  RNA polymerase sigma factor RpoD                 85.9    5e-16    
ref|WP_034937910.1|  RNA polymerase sigma factor SigC                 86.3    5e-16    
ref|WP_018597411.1|  RNA polymerase sigma factor RpoD                 86.7    5e-16    
gb|EPW31923.1|  RNA polymerase sigma factor RpoD                      86.7    5e-16    
ref|WP_008707631.1|  MULTISPECIES: RNA polymerase sigma factor RpoD   86.7    5e-16    
ref|WP_041439130.1|  RNA polymerase sigma70                           86.3    5e-16    
gb|EQC64107.1|  RNA polymerase sigma factor RpoD                      85.9    5e-16    
ref|WP_033143553.1|  RNA polymerase sigma70 factor                    86.3    5e-16    
ref|WP_025761602.1|  RNA polymerase sigma factor rpoD                 85.5    5e-16    
ref|WP_011678359.1|  RNA polymerase sigma factor RpoD                 86.3    5e-16    
ref|WP_042762425.1|  RNA polymerase sigma factor RpoD                 85.9    6e-16    
ref|WP_004232342.1|  RNA polymerase sigma factor RpoD                 86.3    6e-16    
ref|WP_022283552.1|  RNA polymerase sigma factor                      86.3    6e-16    
ref|WP_021866959.1|  RNA polymerase sigma factor                      87.0    6e-16    
gb|ELR96456.1|  RNA polymerase sigma factor, cyanobacterial RpoD-...  86.7    6e-16    
ref|WP_005610194.1|  RNA polymerase sigma factor RpoD                 86.3    6e-16    
ref|WP_025194105.1|  RNA polymerase sigma factor RpoD                 86.3    6e-16    
ref|WP_015758480.1|  RNA polymerase sigma factor RpoD                 86.3    6e-16    
ref|WP_026692870.1|  RNA polymerase sigma factor RpoD                 86.3    6e-16    
ref|WP_022515293.1|  RNA polymerase sigma factor                      87.0    6e-16    
ref|WP_000818341.1|  RNA polymerase sigma factor RpoD                 86.3    6e-16    
ref|WP_017644081.1|  RNA polymerase sigma factor RpoD                 86.3    6e-16    
ref|WP_036794658.1|  hypothetical protein                             87.4    6e-16    
ref|WP_015632126.1|  RNA polymerase major sigma factor RpoD           86.3    6e-16    
emb|CBL26440.1|  RNA polymerase, sigma 70 subunit, RpoD               86.3    7e-16    
ref|WP_039714940.1|  RNA polymerase sigma factor SigC                 86.7    7e-16    
ref|WP_015152358.1|  RNA polymerase, sigma subunit, RpsC/SigC         86.7    7e-16    
ref|WP_001871254.1|  RNA polymerase sigma factor RpoD                 86.3    7e-16    
emb|CDC14326.1|  rNA polymerase sigma factor                          86.3    7e-16    
ref|WP_027971240.1|  RNA polymerase sigma factor RpoD                 86.3    7e-16    
ref|WP_019475598.1|  RNA polymerase sigma factor RpoD                 86.3    7e-16    
ref|WP_021921323.1|  RNA polymerase sigma factor                      85.9    7e-16    
ref|WP_022359694.1|  RNA polymerase sigma factor                      86.3    7e-16    
ref|WP_041332290.1|  RNA polymerase sigma factor RpoD                 86.3    7e-16    
ref|WP_025970648.1|  RNA polymerase sigma factor RpoD                 86.3    7e-16    
ref|WP_007288873.1|  RNA polymerase sigma factor RpoD                 85.9    7e-16    
ref|WP_004840799.1|  MULTISPECIES: RNA polymerase sigma factor RpoD   85.9    7e-16    
ref|WP_026648542.1|  RNA polymerase sigma70 factor                    85.9    7e-16    
ref|WP_011132131.1|  RNA polymerase sigma factor RpoD                 86.3    7e-16    
gb|EKE00372.1|  hypothetical protein ACD_22C00037G0001                85.9    7e-16    
ref|WP_027974743.1|  RNA polymerase sigma factor RpoD                 85.9    7e-16    
ref|WP_041904322.1|  RNA polymerase sigma factor rpoD                 85.1    7e-16    
ref|WP_040228918.1|  RNA polymerase sigma factor RpoD                 84.0    7e-16    
ref|WP_008397910.1|  MULTISPECIES: RNA polymerase sigma factor RpoD   85.9    8e-16    
emb|CBL19893.1|  RNA polymerase, sigma 70 subunit, RpoD               85.9    8e-16    
gb|ABU60372.1|  RNA polymerase, sigma 70 subunit, RpoD family         86.3    8e-16    
ref|WP_003093176.1|  RNA polymerase sigma factor RpoD                 85.9    8e-16    
ref|WP_021651146.1|  MULTISPECIES: RNA polymerase sigma factor RpoD   85.9    8e-16    
gb|EQC69320.1|  RNA polymerase sigma factor RpoD                      85.5    8e-16    
ref|WP_032517801.1|  RNA polymerase sigma factor RpoD                 86.3    8e-16    
ref|WP_011226338.1|  MULTISPECIES: RNA polymerase sigma factor RpoD   85.9    8e-16    
ref|WP_002884252.1|  MULTISPECIES: RNA polymerase sigma factor RpoD   85.9    8e-16    
ref|WP_009242592.1|  RNA polymerase sigma factor RpoD [               85.9    8e-16    
ref|WP_025945754.1|  MULTISPECIES: RNA polymerase sigma factor RpoD   86.3    8e-16    
ref|WP_021977937.1|  RNA polymerase sigma factor                      85.9    8e-16    
ref|WP_025925092.1|  MULTISPECIES: RNA polymerase sigma factor RpoD   86.3    8e-16    
ref|WP_008178455.1|  RNA polymerase sigma factor RpoD                 85.9    8e-16    
ref|WP_042849952.1|  RNA polymerase sigma factor RpoD                 86.3    8e-16    
ref|WP_025980881.1|  RNA polymerase sigma factor RpoD                 86.3    8e-16    
ref|WP_025953539.1|  RNA polymerase sigma factor RpoD                 86.3    8e-16    
ref|WP_025887735.1|  MULTISPECIES: RNA polymerase sigma factor RpoD   86.3    8e-16    
ref|WP_002951487.1|  RNA polymerase sigma factor RpoD                 85.9    8e-16    
ref|WP_011993616.1|  RNA polymerase sigma factor rpoD                 85.9    8e-16    
ref|WP_025954001.1|  RNA polymerase sigma factor RpoD                 86.3    8e-16    
ref|WP_011862516.1|  RNA polymerase sigma factor RpoD                 86.3    8e-16    
ref|WP_011227440.1|  RNA polymerase sigma factor RpoD                 85.9    8e-16    
ref|WP_022215535.1|  RNA polymerase sigma factor                      85.9    8e-16    
ref|WP_025952492.1|  RNA polymerase sigma factor RpoD                 86.3    8e-16    
ref|WP_032524682.1|  RNA polymerase sigma factor RpoD                 86.3    8e-16    
ref|WP_036897481.1|  RNA polymerase sigma factor RpoD                 86.3    8e-16    
ref|WP_025914315.1|  RNA polymerase sigma factor RpoD                 86.3    8e-16    
ref|WP_012192194.1|  RNA polymerase sigma 70                          85.9    8e-16    
ref|WP_020367723.1|  RNA polymerase sigma factor RpoD                 83.2    8e-16    
ref|WP_032087619.1|  RNA polymerase sigma factor RpoD                 85.9    9e-16    
ref|WP_019475092.1|  RNA polymerase sigma factor RpoD                 86.3    9e-16    
ref|WP_025973773.1|  RNA polymerase sigma factor RpoD                 86.3    9e-16    
ref|WP_025955336.1|  RNA polymerase sigma factor RpoD                 86.3    9e-16    
ref|WP_025942216.1|  MULTISPECIES: RNA polymerase sigma factor RpoD   86.3    9e-16    
ref|WP_025926138.1|  RNA polymerase sigma factor RpoD                 86.3    9e-16    
ref|WP_011819876.1|  RNA polymerase sigma factor RpoD                 86.3    9e-16    
ref|WP_025931515.1|  MULTISPECIES: RNA polymerase sigma factor RpoD   86.3    9e-16    
ref|XP_002182327.1|  predicted protein                                85.1    9e-16    
ref|WP_032519424.1|  RNA polymerase sigma factor RpoD                 86.3    9e-16    
ref|WP_032514870.1|  RNA polymerase sigma factor RpoD                 86.3    9e-16    
gb|ADQ46761.1|  RNA polymerase, sigma 70 subunit, RpoD subfamily      86.3    9e-16    
gb|EWM57510.1|  RNA polymerase sigma factor RpoD                      85.9    9e-16    
ref|WP_019478440.1|  RNA polymerase sigma factor RpoD                 85.9    9e-16    
ref|WP_032526796.1|  RNA polymerase sigma factor RpoD                 85.9    9e-16    
ref|WP_025929226.1|  RNA polymerase sigma factor RpoD                 85.9    9e-16    
ref|WP_021850976.1|  RNA polymerase sigma factor                      87.0    9e-16    
gb|EQC72060.1|  RNA polymerase sigma factor RpoD                      85.1    9e-16    
ref|WP_018450963.1|  RNA polymerase sigma factor rpoD                 85.9    9e-16    
ref|WP_025981223.1|  RNA polymerase sigma factor RpoD                 85.9    9e-16    
ref|WP_025941422.1|  RNA polymerase sigma factor RpoD                 85.9    9e-16    
ref|WP_035998314.1|  RNA polymerase sigma factor SigC                 86.3    9e-16    
ref|WP_032522483.1|  RNA polymerase sigma factor RpoD                 85.9    9e-16    
ref|WP_025929923.1|  RNA polymerase sigma factor RpoD                 85.9    9e-16    
ref|WP_011818005.1|  RNA polymerase sigma factor RpoD                 85.9    9e-16    
ref|WP_025964657.1|  RNA polymerase sigma factor RpoD                 85.9    9e-16    
gb|EFV97681.1|  RNA polymerase sigma factor RpoD                      85.9    9e-16    
ref|WP_025960325.1|  RNA polymerase sigma factor RpoD                 85.9    9e-16    
ref|WP_025894144.1|  MULTISPECIES: RNA polymerase sigma factor RpoD   85.9    9e-16    
gb|EPU22976.1|  RNA polymerase sigma factor RpoD                      85.9    9e-16    
ref|WP_003078860.1|  RNA polymerase sigma factor RpoD                 85.9    9e-16    
ref|WP_012007320.1|  RNA polymerase sigma factor RpoD                 85.9    9e-16    
ref|WP_005425625.1|  RNA polymerase sigma factor RpoD [               85.1    9e-16    
ref|WP_037282964.1|  RNA polymerase sigma factor rpoD                 84.7    9e-16    
ref|WP_041040568.1|  RNA polymerase sigma factor SigC                 86.3    1e-15    
ref|WP_004080872.1|  RNA polymerase sigma factor rpoD                 85.9    1e-15    
ref|WP_039765430.1|  RNA polymerase sigma factor RpoD                 85.5    1e-15    
ref|WP_011376056.1|  RNA polymerase sigma factor RpoD                 85.9    1e-15    
ref|WP_018975314.1|  hypothetical protein                             84.7    1e-15    
ref|WP_008393675.1|  MULTISPECIES: RNA polymerase sigma factor RpoD   85.5    1e-15    
ref|WP_022204299.1|  RNA polymerase sigma factor                      86.3    1e-15    
ref|WP_042767100.1|  RNA polymerase sigma factor RpoD                 85.1    1e-15    
gb|EGV09381.1|  RNA polymerase sigma factor RpoD                      84.7    1e-15    
ref|WP_035168192.1|  MULTISPECIES: RNA polymerase sigma factor RpoD   85.5    1e-15    
ref|WP_022328925.1|  RNA polymerase sigma factor                      86.3    1e-15    
ref|WP_002805209.1|  RNA polymerase sigma factor RpoD                 85.9    1e-15    
gb|AEF24968.1|  RNA polymerase sigma factor RpoD                      84.3    1e-15    
ref|WP_032513929.1|  RNA polymerase sigma factor RpoD                 85.9    1e-15    
ref|WP_041725789.1|  RNA polymerase sigma factor RpoD                 85.5    1e-15    
ref|WP_033125388.1|  RNA polymerase sigma70 factor                    85.5    1e-15    
ref|WP_041727339.1|  RNA polymerase sigma factor RpoD                 85.5    1e-15    
ref|WP_041742691.1|  RNA polymerase sigma factor RpoD                 85.5    1e-15    
ref|WP_034842479.1|  MULTISPECIES: RNA polymerase sigma factor RpoD   85.1    1e-15    
ref|WP_015739695.1|  RNA polymerase sigma factor RpoD                 85.5    1e-15    
gb|EPW76135.1|  RNA polymerase sigma factor RpoD                      85.5    1e-15    
ref|WP_006859165.1|  MULTISPECIES: RNA polymerase sigma factor RpoD   85.9    1e-15    
ref|WP_001984001.1|  RNA polymerase sigma factor RpoD                 85.5    1e-15    
ref|WP_006740340.1|  RNA polymerase sigma factor RpoD                 85.5    1e-15    
ref|WP_018376600.1|  RNA polymerase sigma factor RpoD                 85.5    1e-15    
ref|WP_006532557.1|  RNA polymerase sigma factor RpoD                 85.5    1e-15    
ref|WP_041097285.1|  RNA polymerase sigma factor RpoD                 85.5    1e-15    
ref|WP_038433994.1|  RNA polymerase sigma factor RpoD                 85.5    1e-15    
ref|WP_018372062.1|  RNA polymerase sigma factor RpoD                 85.5    1e-15    
ref|WP_018365811.1|  RNA polymerase sigma factor RpoD                 85.5    1e-15    
emb|CBL14141.1|  RNA polymerase, sigma 70 subunit, RpoD               85.9    1e-15    
ref|WP_041596030.1|  RNA polymerase sigma factor RpoD                 85.1    1e-15    
ref|WP_022503734.1|  RNA polymerase sigma factor                      85.5    1e-15    
ref|WP_003065454.1|  MULTISPECIES: RNA polymerase sigma factor RpoD   85.5    1e-15    
gb|AIW11523.1|  RNA polymerase sigma factor RpoD                      85.5    1e-15    
ref|WP_021860698.1|  RNA polymerase sigma factor                      85.5    1e-15    
ref|WP_045176005.1|  RNA polymerase sigma factor RpoD                 85.1    1e-15    
ref|WP_009854480.1|  MULTISPECIES: RNA polymerase sigma factor RpoD   85.5    1e-15    
ref|WP_024406915.1|  RNA polymerase sigma factor RpoD                 85.5    1e-15    
gb|ADQ15082.1|  RNA polymerase, sigma 70 subunit, RpoD subfamily      85.5    1e-15    
ref|WP_018165712.1|  RNA polymerase sigma factor RpoD                 85.5    1e-15    
ref|WP_014334937.1|  RNA polymerase sigma factor RpoD                 85.5    1e-15    
ref|WP_028459317.1|  RNA polymerase sigma factor RpoD                 85.5    1e-15    
ref|WP_035405126.1|  RNA polymerase sigma factor RpoD                 85.5    1e-15    
ref|WP_040376649.1|  RNA polymerase sigma factor RpoD                 85.5    1e-15    
ref|WP_028880535.1|  RNA polymerase sigma factor RpoD                 87.0    1e-15    
ref|WP_024343868.1|  RNA polymerase sigma factor RpoD                 85.5    1e-15    
ref|WP_031459787.1|  RNA polymerase sigma factor RpoD                 85.5    1e-15    
ref|WP_004846231.1|  RNA polymerase sigma factor RpoD [               85.5    1e-15    
ref|WP_009910370.1|  RNA polymerase sigma factor RpoD                 85.5    1e-15    
emb|CBL24242.1|  RNA polymerase, sigma 70 subunit, RpoD               85.5    1e-15    
ref|WP_017714813.1|  RNA polymerase sigma factor SigC                 85.9    1e-15    
ref|WP_015173425.1|  RNA polymerase, sigma subunit, RpsC/SigC         85.9    1e-15    
ref|WP_023554764.1|  RNA polymerase sigma factor RpoD                 85.5    1e-15    
ref|WP_015517421.1|  MULTISPECIES: RNA polymerase, sigma 70 subun...  85.9    1e-15    
ref|WP_044894767.1|  RNA polymerase sigma factor RpoD                 85.5    1e-15    
gb|EKD51428.1|  hypothetical protein ACD_62C00257G0007                87.0    1e-15    
ref|WP_027365437.1|  RNA polymerase sigma factor RpoD                 85.5    1e-15    
ref|WP_041722761.1|  RNA polymerase sigma factor RpoD                 85.1    1e-15    
ref|WP_021857664.1|  RNA polymerase sigma factor                      85.9    1e-15    
ref|WP_003390594.1|  RNA polymerase sigma factor                      85.5    1e-15    
ref|WP_028391833.1|  RNA polymerase sigma factor RpoD                 85.5    1e-15    
ref|WP_013059219.1|  MULTISPECIES: RNA polymerase sigma factor RpoD   85.5    1e-15    
ref|WP_034235384.1|  RNA polymerase sigma70 factor                    85.5    1e-15    
ref|WP_002284380.1|  RNA polymerase sigma factor SigA                 85.5    1e-15    
ref|WP_035050050.1|  RNA polymerase sigma factor RpoD                 85.5    1e-15    
ref|WP_034308477.1|  RNA polymerase sigma factor RpoD                 85.5    1e-15    
ref|WP_032100082.1|  RNA polymerase sigma factor RpoD                 85.5    1e-15    
ref|WP_008722836.1|  MULTISPECIES: RNA polymerase sigma70 factor      85.9    1e-15    
ref|WP_006317861.1|  RNA polymerase sigma factor RpoD                 85.5    1e-15    
ref|WP_009374015.1|  RNA polymerase sigma factor RpoD                 85.5    1e-15    
ref|WP_007777605.1|  MULTISPECIES: RNA polymerase sigma factor RpoD   85.5    1e-15    
ref|WP_019242622.1|  RNA polymerase sigma factor RpoD                 85.5    1e-15    
ref|WP_019416902.1|  MULTISPECIES: RNA polymerase sigma factor RpoD   85.5    1e-15    
ref|WP_011543962.1|  RNA polymerase sigma factor RpoD                 85.1    1e-15    
ref|WP_008535195.1|  RNA polymerase sigma factor RpoD                 85.1    1e-15    
ref|WP_043965521.1|  RNA polymerase sigma factor RpoD                 85.1    1e-15    
ref|WP_029173272.1|  RNA polymerase sigma factor RpoD                 85.1    1e-15    
ref|WP_024532366.1|  RNA polymerase sigma factor RpoD                 85.1    1e-15    
ref|WP_021095173.1|  MULTISPECIES: RNA polymerase sigma factor RpoD   85.1    1e-15    
ref|WP_012685780.1|  RNA polymerase sigma factor RpoD                 85.5    1e-15    
ref|WP_002261972.1|  RNA polymerase sigma factor SigA                 85.1    1e-15    
ref|WP_034439558.1|  RNA polymerase sigma factor RpoD                 85.1    1e-15    
ref|WP_014458197.1|  RNA polymerase sigma factor RpoD                 85.1    1e-15    
ref|WP_024782781.1|  RNA polymerase sigma factor SigA                 85.1    1e-15    
ref|WP_024377441.1|  RNA polymerase sigma factor RpoD                 85.1    1e-15    
ref|WP_018674194.1|  RNA polymerase sigma factor RpoD                 85.1    1e-15    
ref|WP_041688496.1|  RNA polymerase sigma70 factor [                  85.1    1e-15    
gb|EUJ37708.1|  RNA polymerase sigma factor RpoD                      84.3    1e-15    
ref|WP_044758787.1|  RNA polymerase sigma factor RpoD                 85.1    1e-15    
ref|WP_029998484.1|  RNA polymerase sigma factor RpoD                 85.1    1e-15    
ref|WP_044744554.1|  RNA polymerase sigma factor RpoD                 85.1    1e-15    
ref|WP_007727582.1|  MULTISPECIES: RNA polymerase sigma factor RpoD   85.1    1e-15    
ref|WP_019321924.1|  RNA polymerase sigma factor RpoD                 85.1    1e-15    
ref|WP_002292411.1|  RNA polymerase sigma factor RpoD                 85.1    1e-15    
ref|WP_029172170.1|  RNA polymerase sigma factor RpoD                 85.1    1e-15    
ref|WP_024404349.1|  RNA polymerase sigma factor RpoD                 85.1    1e-15    
ref|WP_020917009.1|  RNA polymerase sigma factor RpoD                 85.1    1e-15    
ref|WP_004889483.1|  RNA polymerase sigma factor rpoD                 85.1    1e-15    
ref|WP_005833040.1|  RNA polymerase sigma factor                      85.1    1e-15    
ref|WP_012616263.1|  RNA polymerase sigma 70                          85.1    1e-15    
ref|WP_024378007.1|  RNA polymerase sigma factor RpoD                 85.1    1e-15    
ref|WP_016938926.1|  RNA polymerase sigma factor RpoD                 85.1    1e-15    
ref|WP_003393929.1|  RNA polymerase sigma factor RpoD                 85.1    2e-15    
ref|WP_027407833.1|  RNA polymerase sigma factor RpoD                 85.1    2e-15    



>ref|XP_009771934.1| PREDICTED: RNA polymerase sigma factor sigA [Nicotiana sylvestris]
Length=508

 Score =   315 bits (808),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 153/178 (86%), Positives = 166/178 (93%), Gaps = 1/178 (1%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAIS  680
            AL +NSR LRLPT++HERLSLIRNAK RLEEKGITPS+  IA SLNMSQKKVRNATEA S
Sbjct  332  ALVENSRTLRLPTYLHERLSLIRNAKARLEEKGITPSVNNIAASLNMSQKKVRNATEASS  391

Query  679  RVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLREREG  500
            ++YSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVD WALKDEV NLI +TLR+RE 
Sbjct  392  KMYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDVWALKDEVNNLISSTLRDRER  451

Query  499  EIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAMLIKQ  326
            EIIRLYYG+ DNECLTWEDIS+RIGLSRERVRQVGLVALEKLKHAAR+R+L+AMLIKQ
Sbjct  452  EIIRLYYGL-DNECLTWEDISKRIGLSRERVRQVGLVALEKLKHAARKRQLDAMLIKQ  508



>dbj|BAA88921.1| sigma factor [Nicotiana tabacum]
Length=508

 Score =   315 bits (808),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 153/178 (86%), Positives = 166/178 (93%), Gaps = 1/178 (1%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAIS  680
            AL +NSR LRLPT++HERLSLIRNAK RLEEKGITPS+  IA SLNMSQKKVRNATEA S
Sbjct  332  ALVENSRTLRLPTYLHERLSLIRNAKARLEEKGITPSVNNIAASLNMSQKKVRNATEASS  391

Query  679  RVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLREREG  500
            ++YSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVD WALKDEV NLI +TLR+RE 
Sbjct  392  KMYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDVWALKDEVNNLISSTLRDRER  451

Query  499  EIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAMLIKQ  326
            EIIRLYYG+ DNECLTWEDIS+RIGLSRERVRQVGLVALEKLKHAAR+R+L+AMLIKQ
Sbjct  452  EIIRLYYGL-DNECLTWEDISKRIGLSRERVRQVGLVALEKLKHAARKRQLDAMLIKQ  508



>ref|XP_011075762.1| PREDICTED: RNA polymerase sigma factor sigA [Sesamum indicum]
Length=505

 Score =   315 bits (806),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 152/177 (86%), Positives = 166/177 (94%), Gaps = 1/177 (1%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAIS  680
            AL +NSR LRLPTH+HERLSLIRNAK RLEEKGITPSI+RIAE LNMSQKKV+NATEAI+
Sbjct  329  ALVENSRTLRLPTHLHERLSLIRNAKARLEEKGITPSIDRIAECLNMSQKKVKNATEAIT  388

Query  679  RVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLREREG  500
            +V+SLDREAFPSLNGLPGETLHSYIADNH+ENNPWHGVDEWALKDEV  LI  TLRERE 
Sbjct  389  KVFSLDREAFPSLNGLPGETLHSYIADNHVENNPWHGVDEWALKDEVDKLINLTLRERER  448

Query  499  EIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAMLIK  329
            EIIRLYYG+ DNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAAR+R+L+ ML++
Sbjct  449  EIIRLYYGL-DNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARKRRLDTMLVQ  504



>ref|XP_009601815.1| PREDICTED: RNA polymerase sigma factor sigA-like [Nicotiana tomentosiformis]
Length=508

 Score =   312 bits (800),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 152/178 (85%), Positives = 165/178 (93%), Gaps = 1/178 (1%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAIS  680
            AL +NSR LRLPT++HERLSLIRNAK RLEEKGI PS+  IA SLNMSQKKVRNATEA S
Sbjct  332  ALVENSRTLRLPTYLHERLSLIRNAKTRLEEKGIIPSVNDIAASLNMSQKKVRNATEASS  391

Query  679  RVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLREREG  500
            ++YSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVD WALKDEV NLI +TLR+RE 
Sbjct  392  KMYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDIWALKDEVNNLISSTLRDRER  451

Query  499  EIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAMLIKQ  326
            EIIRLYYG+ DNECLTWEDIS+RIGLSRERVRQVGLVALEKLKHAAR+R+L+AMLIKQ
Sbjct  452  EIIRLYYGL-DNECLTWEDISKRIGLSRERVRQVGLVALEKLKHAARKRQLDAMLIKQ  508



>ref|XP_009767654.1| PREDICTED: RNA polymerase sigma factor sigA-like [Nicotiana sylvestris]
Length=504

 Score =   309 bits (791),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 151/177 (85%), Positives = 163/177 (92%), Gaps = 1/177 (1%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAIS  680
            AL +NSR LRLP H+HERLSLIRNAK +L+E GITPSIE+IAE LNMSQKKVRNATEA S
Sbjct  328  ALVENSRTLRLPIHLHERLSLIRNAKIKLKENGITPSIEKIAECLNMSQKKVRNATEASS  387

Query  679  RVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLREREG  500
            +V+SLDREAFPSLNGLPGETLHSYIADN LEN PWHGVDEW LKDEV NLI +TLRERE 
Sbjct  388  KVFSLDREAFPSLNGLPGETLHSYIADNRLENIPWHGVDEWMLKDEVNNLISSTLRERES  447

Query  499  EIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAMLIK  329
            EIIRLYYG+ DNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRR+L+AML+K
Sbjct  448  EIIRLYYGL-DNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRRLDAMLVK  503



>ref|XP_004235299.1| PREDICTED: RNA polymerase sigma factor sigA [Solanum lycopersicum]
Length=509

 Score =   309 bits (791),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 150/178 (84%), Positives = 161/178 (90%), Gaps = 1/178 (1%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAIS  680
             L +NSR LRLPTH+HERL LIRNAK RLEEKGI PS+  IA SLNMSQKKVRNATEA S
Sbjct  333  TLVENSRTLRLPTHLHERLGLIRNAKMRLEEKGINPSVNNIAASLNMSQKKVRNATEASS  392

Query  679  RVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLREREG  500
            +VYSLDRE FPSLNGLPG TLHSYIADNHLENNPWHGVD WALKDEV NLI +TLRERE 
Sbjct  393  KVYSLDREVFPSLNGLPGTTLHSYIADNHLENNPWHGVDVWALKDEVNNLISSTLRERER  452

Query  499  EIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAMLIKQ  326
            EIIRLYYG+ D+ECLTWEDIS+RIGLSRERVRQVGLVALEKLKHAAR+R+L+AMLIKQ
Sbjct  453  EIIRLYYGL-DSECLTWEDISKRIGLSRERVRQVGLVALEKLKHAARKRRLDAMLIKQ  509



>ref|XP_010275189.1| PREDICTED: RNA polymerase sigma factor sigA-like [Nelumbo nucifera]
 ref|XP_010275190.1| PREDICTED: RNA polymerase sigma factor sigA-like [Nelumbo nucifera]
 ref|XP_010275191.1| PREDICTED: RNA polymerase sigma factor sigA-like [Nelumbo nucifera]
Length=516

 Score =   307 bits (787),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 148/178 (83%), Positives = 166/178 (93%), Gaps = 1/178 (1%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAIS  680
            AL +NSR LRLP+H+HERLSLIRNAK RLEEKGITPSI+RIAE LN+SQKKVRNATEA++
Sbjct  340  ALVENSRTLRLPSHMHERLSLIRNAKIRLEEKGITPSIDRIAECLNISQKKVRNATEAVN  399

Query  679  RVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLREREG  500
            +V SLDREAFPSLNGLPGETLHSYIADN +ENNPWHGVDEW+LKDEV NL+ TTLRERE 
Sbjct  400  KVISLDREAFPSLNGLPGETLHSYIADNRIENNPWHGVDEWSLKDEVNNLLNTTLRERER  459

Query  499  EIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAMLIKQ  326
            +IIRLYYG+ D ECLTWEDISRRIGLSRERVRQVGLVALEKLKHAAR+++L+AML+K 
Sbjct  460  DIIRLYYGL-DEECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARKKRLDAMLVKH  516



>ref|XP_006419162.1| hypothetical protein EUTSA_v10002486mg [Eutrema salsugineum]
 gb|ESQ37598.1| hypothetical protein EUTSA_v10002486mg [Eutrema salsugineum]
Length=519

 Score =   307 bits (786),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 148/177 (84%), Positives = 162/177 (92%), Gaps = 1/177 (1%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAIS  680
            AL DNSR LRLPTH+HERL LIRNAK RL+EKGITPSI+RIAESLNMSQKKVRNATEA+S
Sbjct  343  ALVDNSRTLRLPTHLHERLGLIRNAKLRLQEKGITPSIDRIAESLNMSQKKVRNATEAVS  402

Query  679  RVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLREREG  500
            +++SLDR+AFPSLNGLPGET HSYIADN LENNPWHG DEWALKDEV  LI  TL ERE 
Sbjct  403  KIFSLDRDAFPSLNGLPGETHHSYIADNRLENNPWHGYDEWALKDEVSKLISATLGERER  462

Query  499  EIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAMLIK  329
            EIIRLYYG+ D ECLTWEDIS+RIGLSRERVRQVGLVALEKLKHAAR+RK+EAM++K
Sbjct  463  EIIRLYYGL-DKECLTWEDISKRIGLSRERVRQVGLVALEKLKHAARKRKMEAMILK  518



>ref|XP_002524027.1| RNA polymerase sigma factor rpoD, putative [Ricinus communis]
 gb|EEF38395.1| RNA polymerase sigma factor rpoD, putative [Ricinus communis]
Length=508

 Score =   305 bits (781),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 148/177 (84%), Positives = 163/177 (92%), Gaps = 1/177 (1%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAIS  680
            AL +NSR LRLP H+HERL LIRNAK RLEEKG+TPSI+RIAESLN+SQKKVRNATEA+S
Sbjct  332  ALVENSRTLRLPNHLHERLGLIRNAKIRLEEKGVTPSIDRIAESLNISQKKVRNATEAVS  391

Query  679  RVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLREREG  500
            +V+SLDREAFPSLNGLPGET HSYIADN LENNPWHGVD+WALKDEV  LI  TL+ERE 
Sbjct  392  KVFSLDREAFPSLNGLPGETHHSYIADNCLENNPWHGVDDWALKDEVNKLINLTLQEREQ  451

Query  499  EIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAMLIK  329
            EIIRLYYG+ DNE LTWEDIS+RIGLSRERVRQVGLVALEKLKHAAR++KLEAML+K
Sbjct  452  EIIRLYYGL-DNESLTWEDISKRIGLSRERVRQVGLVALEKLKHAARKKKLEAMLVK  507



>ref|XP_009629626.1| PREDICTED: RNA polymerase sigma factor sigA-like isoform X2 [Nicotiana 
tomentosiformis]
Length=502

 Score =   305 bits (781),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 149/177 (84%), Positives = 163/177 (92%), Gaps = 1/177 (1%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAIS  680
            AL +NSR LRLP H+HERLSLIRNAK +L+E GITPSIE+IAE LNMSQKKVRNATEA S
Sbjct  326  ALVENSRTLRLPIHLHERLSLIRNAKIKLKENGITPSIEKIAECLNMSQKKVRNATEASS  385

Query  679  RVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLREREG  500
            +V+SLDREAFPSLNGLPGETLHSYIADN LEN PWHGVDEW LKDEV NLI +TLRERE 
Sbjct  386  KVFSLDREAFPSLNGLPGETLHSYIADNRLENIPWHGVDEWMLKDEVNNLISSTLRERER  445

Query  499  EIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAMLIK  329
            EI+RLYYG+ DNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAAR+R+L+AML+K
Sbjct  446  EIVRLYYGL-DNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARKRRLDAMLVK  501



>dbj|BAA88922.1| sigma factor [Nicotiana tabacum]
Length=502

 Score =   305 bits (781),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 149/177 (84%), Positives = 163/177 (92%), Gaps = 1/177 (1%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAIS  680
            AL +NSR LRLP H+HERLSLIRNAK +L+E GITPSIE+IAE LNMSQKKVRNATEA S
Sbjct  326  ALVENSRTLRLPIHLHERLSLIRNAKIKLKENGITPSIEKIAECLNMSQKKVRNATEASS  385

Query  679  RVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLREREG  500
            +V+SLDREAFPSLNGLPGETLHSYIADN LEN PWHGVDEW LKDEV NLI +TLRERE 
Sbjct  386  KVFSLDREAFPSLNGLPGETLHSYIADNRLENIPWHGVDEWMLKDEVNNLISSTLRERER  445

Query  499  EIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAMLIK  329
            EI+RLYYG+ DNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAAR+R+L+AML+K
Sbjct  446  EIVRLYYGL-DNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARKRRLDAMLVK  501



>ref|XP_009629625.1| PREDICTED: RNA polymerase sigma factor sigA-like isoform X1 [Nicotiana 
tomentosiformis]
Length=513

 Score =   305 bits (781),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 149/177 (84%), Positives = 163/177 (92%), Gaps = 1/177 (1%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAIS  680
            AL +NSR LRLP H+HERLSLIRNAK +L+E GITPSIE+IAE LNMSQKKVRNATEA S
Sbjct  337  ALVENSRTLRLPIHLHERLSLIRNAKIKLKENGITPSIEKIAECLNMSQKKVRNATEASS  396

Query  679  RVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLREREG  500
            +V+SLDREAFPSLNGLPGETLHSYIADN LEN PWHGVDEW LKDEV NLI +TLRERE 
Sbjct  397  KVFSLDREAFPSLNGLPGETLHSYIADNRLENIPWHGVDEWMLKDEVNNLISSTLRERER  456

Query  499  EIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAMLIK  329
            EI+RLYYG+ DNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAAR+R+L+AML+K
Sbjct  457  EIVRLYYGL-DNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARKRRLDAMLVK  512



>ref|XP_009128472.1| PREDICTED: RNA polymerase sigma factor sigA [Brassica rapa]
 ref|XP_009128474.1| PREDICTED: RNA polymerase sigma factor sigA [Brassica rapa]
 ref|XP_009128475.1| PREDICTED: RNA polymerase sigma factor sigA [Brassica rapa]
Length=492

 Score =   304 bits (779),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 146/177 (82%), Positives = 161/177 (91%), Gaps = 1/177 (1%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAIS  680
            AL DNSR LRLPTH+HERL LIRNAK RL+EKG+TPSI+RIAESLNMSQKKVRNATEA+S
Sbjct  316  ALVDNSRTLRLPTHLHERLGLIRNAKLRLQEKGVTPSIDRIAESLNMSQKKVRNATEAVS  375

Query  679  RVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLREREG  500
            +++SLDR+AFPSLNGLPGET HSYIADN LENNPWHG DEWALKDEV  LI  TL ERE 
Sbjct  376  KIFSLDRDAFPSLNGLPGETHHSYIADNRLENNPWHGYDEWALKDEVSKLISATLGERER  435

Query  499  EIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAMLIK  329
            EIIRLYYG+ D ECLTWEDIS+RIGLSRERVRQVGLVALEKLKHAAR+ K+EAM++K
Sbjct  436  EIIRLYYGL-DKECLTWEDISKRIGLSRERVRQVGLVALEKLKHAARKSKMEAMILK  491



>gb|EYU44877.1| hypothetical protein MIMGU_mgv1a004509mg [Erythranthe guttata]
 gb|EYU44878.1| hypothetical protein MIMGU_mgv1a004509mg [Erythranthe guttata]
Length=520

 Score =   305 bits (781),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 150/178 (84%), Positives = 162/178 (91%), Gaps = 1/178 (1%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAIS  680
            AL +NSR LRLPTH+HERLSLIRNAK RLEEKGITPSI RIAESLNMSQKKVRNATEA S
Sbjct  344  ALVENSRTLRLPTHLHERLSLIRNAKARLEEKGITPSISRIAESLNMSQKKVRNATEANS  403

Query  679  RVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLREREG  500
            +V+SLDREAFPSLNG+PG+TLHSYIADNH+EN PWHGVDEWALKDEV  LI  TLRERE 
Sbjct  404  KVFSLDREAFPSLNGIPGKTLHSYIADNHVENIPWHGVDEWALKDEVDKLITLTLRERER  463

Query  499  EIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAMLIKQ  326
            EIIRLYYG+ DNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAAR  +L+A+ I+ 
Sbjct  464  EIIRLYYGL-DNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARNTRLDALFIQH  520



>ref|XP_006347341.1| PREDICTED: RNA polymerase sigma factor sigA-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006347342.1| PREDICTED: RNA polymerase sigma factor sigA-like isoform X2 [Solanum 
tuberosum]
Length=505

 Score =   305 bits (780),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 146/177 (82%), Positives = 163/177 (92%), Gaps = 1/177 (1%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAIS  680
            AL DNSR LRLP H+HERLSLIRNAK +L++ GITPSIE+IAE LNMSQKKVRNATEA S
Sbjct  329  ALVDNSRTLRLPIHLHERLSLIRNAKVKLKDNGITPSIEKIAECLNMSQKKVRNATEASS  388

Query  679  RVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLREREG  500
            +V+SLDREA+PSLNGLPG TLHSYIADN LENNPWHGVD WALKDEV NLI +TLRERE 
Sbjct  389  KVFSLDREAYPSLNGLPGATLHSYIADNRLENNPWHGVDGWALKDEVNNLISSTLRERER  448

Query  499  EIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAMLIK  329
            +I+RLYYG+ DNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAAR+++L+AML+K
Sbjct  449  DIVRLYYGL-DNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARKKQLDAMLVK  504



>emb|CDY56127.1| BnaA02g20170D [Brassica napus]
Length=491

 Score =   304 bits (779),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 146/177 (82%), Positives = 161/177 (91%), Gaps = 1/177 (1%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAIS  680
            AL DNSR LRLPTH+HERL LIRNAK RL+EKG+TPSI+RIAESLNMSQKKVRNATEA+S
Sbjct  315  ALVDNSRTLRLPTHLHERLGLIRNAKLRLQEKGVTPSIDRIAESLNMSQKKVRNATEAVS  374

Query  679  RVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLREREG  500
            +++SLDR+AFPSLNGLPGET HSYIADN LENNPWHG DEWALKDEV  LI  TL ERE 
Sbjct  375  KIFSLDRDAFPSLNGLPGETHHSYIADNRLENNPWHGYDEWALKDEVSKLISATLGERER  434

Query  499  EIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAMLIK  329
            EIIRLYYG+ D ECLTWEDIS+RIGLSRERVRQVGLVALEKLKHAAR+ K+EAM++K
Sbjct  435  EIIRLYYGL-DKECLTWEDISKRIGLSRERVRQVGLVALEKLKHAARKSKMEAMILK  490



>gb|EYU44876.1| hypothetical protein MIMGU_mgv1a004509mg [Erythranthe guttata]
Length=523

 Score =   305 bits (781),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 150/178 (84%), Positives = 162/178 (91%), Gaps = 1/178 (1%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAIS  680
            AL +NSR LRLPTH+HERLSLIRNAK RLEEKGITPSI RIAESLNMSQKKVRNATEA S
Sbjct  347  ALVENSRTLRLPTHLHERLSLIRNAKARLEEKGITPSISRIAESLNMSQKKVRNATEANS  406

Query  679  RVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLREREG  500
            +V+SLDREAFPSLNG+PG+TLHSYIADNH+EN PWHGVDEWALKDEV  LI  TLRERE 
Sbjct  407  KVFSLDREAFPSLNGIPGKTLHSYIADNHVENIPWHGVDEWALKDEVDKLITLTLRERER  466

Query  499  EIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAMLIKQ  326
            EIIRLYYG+ DNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAAR  +L+A+ I+ 
Sbjct  467  EIIRLYYGL-DNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARNTRLDALFIQH  523



>ref|XP_010662046.1| PREDICTED: RNA polymerase sigma factor sigA isoform X2 [Vitis 
vinifera]
Length=507

 Score =   304 bits (779),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 150/177 (85%), Positives = 164/177 (93%), Gaps = 1/177 (1%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAIS  680
            AL +NSR LRLP+H+HERLSLIRNAK RLEEKGITPSI+RIAE LNMSQKKVRNATEAIS
Sbjct  331  ALVENSRTLRLPSHLHERLSLIRNAKIRLEEKGITPSIDRIAECLNMSQKKVRNATEAIS  390

Query  679  RVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLREREG  500
            +V+SLDREAFPSLNGLPGETLHSYIAD  LENNPWHGVDEWALKDEV  LI TTL ERE 
Sbjct  391  KVFSLDREAFPSLNGLPGETLHSYIADVRLENNPWHGVDEWALKDEVNKLINTTLGERER  450

Query  499  EIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAMLIK  329
            +IIRLYYG+ DNECLTWEDIS+RIGLSRERVRQVGLVALEKLK+AAR+ ++EAML+K
Sbjct  451  DIIRLYYGL-DNECLTWEDISKRIGLSRERVRQVGLVALEKLKNAARKGRMEAMLVK  506



>emb|CDY52962.1| BnaCnng23900D [Brassica napus]
Length=480

 Score =   303 bits (777),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 146/177 (82%), Positives = 161/177 (91%), Gaps = 1/177 (1%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAIS  680
            AL DNSR LRLPTH+HERL LIRNAK RL+EKGITPSI+RIAESLNMSQKKVRNATEA+S
Sbjct  304  ALVDNSRTLRLPTHLHERLGLIRNAKLRLQEKGITPSIDRIAESLNMSQKKVRNATEAVS  363

Query  679  RVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLREREG  500
            +++SLDR+AFPSLNGLPGET HSYIADN LENNPWHG DEWALKDEV  LI  TL +RE 
Sbjct  364  KIFSLDRDAFPSLNGLPGETHHSYIADNRLENNPWHGYDEWALKDEVSKLISATLGDRER  423

Query  499  EIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAMLIK  329
            EIIRLYYG+ D ECLTWEDIS+RIGLSRERVRQVGLVALEKLKHAAR+ K+EAM++K
Sbjct  424  EIIRLYYGL-DKECLTWEDISKRIGLSRERVRQVGLVALEKLKHAARKSKMEAMILK  479



>ref|XP_010662045.1| PREDICTED: RNA polymerase sigma factor sigA isoform X1 [Vitis 
vinifera]
Length=513

 Score =   304 bits (779),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 150/177 (85%), Positives = 164/177 (93%), Gaps = 1/177 (1%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAIS  680
            AL +NSR LRLP+H+HERLSLIRNAK RLEEKGITPSI+RIAE LNMSQKKVRNATEAIS
Sbjct  337  ALVENSRTLRLPSHLHERLSLIRNAKIRLEEKGITPSIDRIAECLNMSQKKVRNATEAIS  396

Query  679  RVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLREREG  500
            +V+SLDREAFPSLNGLPGETLHSYIAD  LENNPWHGVDEWALKDEV  LI TTL ERE 
Sbjct  397  KVFSLDREAFPSLNGLPGETLHSYIADVRLENNPWHGVDEWALKDEVNKLINTTLGERER  456

Query  499  EIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAMLIK  329
            +IIRLYYG+ DNECLTWEDIS+RIGLSRERVRQVGLVALEKLK+AAR+ ++EAML+K
Sbjct  457  DIIRLYYGL-DNECLTWEDISKRIGLSRERVRQVGLVALEKLKNAARKGRMEAMLVK  512



>emb|CDP04910.1| unnamed protein product [Coffea canephora]
Length=503

 Score =   304 bits (778),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 147/177 (83%), Positives = 165/177 (93%), Gaps = 1/177 (1%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAIS  680
            AL +NSR LRLPTH+HERLSLIRNAK RLEEKGITPS+++IAESLNMSQKKVRNATEA+ 
Sbjct  327  ALVENSRTLRLPTHLHERLSLIRNAKIRLEEKGITPSVDKIAESLNMSQKKVRNATEAVC  386

Query  679  RVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLREREG  500
            +V SLDREAFPSLNGLPGETLHSYIADN LENNPWHGVD+WALKDEV  LI +TLRERE 
Sbjct  387  KVISLDREAFPSLNGLPGETLHSYIADNRLENNPWHGVDQWALKDEVNKLITSTLRERER  446

Query  499  EIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAMLIK  329
            +IIRLYYG+ +NECLTWEDIS+RIGLSRERVRQVGLVALEKLK+AAR+R+LEAM+ +
Sbjct  447  DIIRLYYGL-ENECLTWEDISKRIGLSRERVRQVGLVALEKLKYAARKRRLEAMIAR  502



>emb|CBI26421.3| unnamed protein product [Vitis vinifera]
Length=555

 Score =   305 bits (781),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 150/177 (85%), Positives = 164/177 (93%), Gaps = 1/177 (1%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAIS  680
            AL +NSR LRLP+H+HERLSLIRNAK RLEEKGITPSI+RIAE LNMSQKKVRNATEAIS
Sbjct  379  ALVENSRTLRLPSHLHERLSLIRNAKIRLEEKGITPSIDRIAECLNMSQKKVRNATEAIS  438

Query  679  RVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLREREG  500
            +V+SLDREAFPSLNGLPGETLHSYIAD  LENNPWHGVDEWALKDEV  LI TTL ERE 
Sbjct  439  KVFSLDREAFPSLNGLPGETLHSYIADVRLENNPWHGVDEWALKDEVNKLINTTLGERER  498

Query  499  EIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAMLIK  329
            +IIRLYYG+ DNECLTWEDIS+RIGLSRERVRQVGLVALEKLK+AAR+ ++EAML+K
Sbjct  499  DIIRLYYGL-DNECLTWEDISKRIGLSRERVRQVGLVALEKLKNAARKGRMEAMLVK  554



>ref|XP_012070278.1| PREDICTED: RNA polymerase sigma factor sigA [Jatropha curcas]
 ref|XP_012070279.1| PREDICTED: RNA polymerase sigma factor sigA [Jatropha curcas]
 gb|KDP39565.1| hypothetical protein JCGZ_02585 [Jatropha curcas]
Length=508

 Score =   303 bits (777),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 149/177 (84%), Positives = 162/177 (92%), Gaps = 1/177 (1%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAIS  680
            AL +NSR LRLP H+HERL LIRNAK RLEEKG+TPSI+RIAESLNMSQKKVRNATEAIS
Sbjct  332  ALVENSRTLRLPNHLHERLGLIRNAKIRLEEKGVTPSIDRIAESLNMSQKKVRNATEAIS  391

Query  679  RVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLREREG  500
            +V+SLDREAFPSLNGLPGET HSYIADN  ENNPWHGVDEWALKDEV  LI  TL++RE 
Sbjct  392  KVFSLDREAFPSLNGLPGETHHSYIADNCPENNPWHGVDEWALKDEVNKLIDLTLQQRER  451

Query  499  EIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAMLIK  329
            EIIRLYYG+ DNE LTWEDIS+RIGLSRERVRQVGLVALEKLKHAAR++KLEAML+K
Sbjct  452  EIIRLYYGL-DNETLTWEDISKRIGLSRERVRQVGLVALEKLKHAARKKKLEAMLVK  507



>ref|XP_010511140.1| PREDICTED: RNA polymerase sigma factor sigA [Camelina sativa]
Length=541

 Score =   305 bits (780),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 147/181 (81%), Positives = 163/181 (90%), Gaps = 1/181 (1%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAIS  680
            AL DNSR LRLPTH+HERL LIRNAK RL+EKGITPSI+RIAESLNMSQKKVRNATEA+S
Sbjct  347  ALVDNSRTLRLPTHLHERLGLIRNAKLRLQEKGITPSIDRIAESLNMSQKKVRNATEAVS  406

Query  679  RVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLREREG  500
            +++SLDR+AFPSLNGLPGET HSYIADN LENNPW+G DEWALK+EV  LI  TL ERE 
Sbjct  407  KIFSLDRDAFPSLNGLPGETHHSYIADNRLENNPWYGYDEWALKEEVSKLISATLGERER  466

Query  499  EIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAMLIKQ*F  320
            EIIRLYYG+ D ECLTWEDIS+RIGLSRERVRQVGLVALEKLKHAAR+RK+EAM++K  F
Sbjct  467  EIIRLYYGL-DKECLTWEDISKRIGLSRERVRQVGLVALEKLKHAARKRKMEAMILKNCF  525

Query  319  L  317
             
Sbjct  526  F  526



>ref|XP_010414870.1| PREDICTED: RNA polymerase sigma factor sigA-like [Camelina sativa]
 ref|XP_010414871.1| PREDICTED: RNA polymerase sigma factor sigA-like [Camelina sativa]
Length=519

 Score =   303 bits (777),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 146/177 (82%), Positives = 162/177 (92%), Gaps = 1/177 (1%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAIS  680
            AL DNSR LRLPTH+HERL LIRNAK RL+EKGITPSI+RIAESLNMSQKKVRNATEA+S
Sbjct  343  ALVDNSRTLRLPTHLHERLGLIRNAKLRLQEKGITPSIDRIAESLNMSQKKVRNATEAVS  402

Query  679  RVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLREREG  500
            +++SLDR+AFPSLNGLPGET HSYIADN LENNPW+G DEWALK+EV  LI  TL ERE 
Sbjct  403  KIFSLDRDAFPSLNGLPGETHHSYIADNRLENNPWYGYDEWALKEEVSKLISATLGERER  462

Query  499  EIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAMLIK  329
            EIIRLYYG+ D ECLTWEDIS+RIGLSRERVRQVGLVALEKLKHAAR+RK+EAM++K
Sbjct  463  EIIRLYYGL-DKECLTWEDISKRIGLSRERVRQVGLVALEKLKHAARKRKMEAMILK  518



>ref|XP_007029766.1| Sigma factor A isoform 1 [Theobroma cacao]
 gb|EOY10268.1| Sigma factor A isoform 1 [Theobroma cacao]
Length=508

 Score =   303 bits (775),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 147/177 (83%), Positives = 162/177 (92%), Gaps = 1/177 (1%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAIS  680
            AL +NSR LRLPTH+HERL LIRNAK RLEEKGITP+I+RIAESLNMSQKKVRNATEA+S
Sbjct  332  ALVENSRTLRLPTHLHERLGLIRNAKIRLEEKGITPTIDRIAESLNMSQKKVRNATEAVS  391

Query  679  RVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLREREG  500
            +V+SLDR+AFPSLNGLPGET HSYIADNH+EN PWHGVDEWALKDEV  LI  TL ERE 
Sbjct  392  KVFSLDRDAFPSLNGLPGETHHSYIADNHVENIPWHGVDEWALKDEVNRLITITLGERER  451

Query  499  EIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAMLIK  329
            EIIRLYYG+ D E LTWEDIS+RIGLSRERVRQVGLVALEKLKHAAR++K+EAML+K
Sbjct  452  EIIRLYYGL-DKESLTWEDISKRIGLSRERVRQVGLVALEKLKHAARKKKMEAMLVK  507



>ref|XP_004241445.1| PREDICTED: RNA polymerase sigma factor sigA [Solanum lycopersicum]
 ref|XP_010322501.1| PREDICTED: RNA polymerase sigma factor sigA [Solanum lycopersicum]
Length=505

 Score =   303 bits (775),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 146/177 (82%), Positives = 162/177 (92%), Gaps = 1/177 (1%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAIS  680
            AL DNSR LRLP H+HERLSLIRNAK +L++ GITPSIE+IAE LNMSQKKVRNATEA S
Sbjct  329  ALVDNSRTLRLPIHLHERLSLIRNAKVKLKDSGITPSIEKIAECLNMSQKKVRNATEASS  388

Query  679  RVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLREREG  500
            +V+SLDREA+PSLNGLPG TLHSYIADN LENNPWHGVD WALKDEV NLI + LRERE 
Sbjct  389  KVFSLDREAYPSLNGLPGATLHSYIADNRLENNPWHGVDGWALKDEVNNLISSILRERER  448

Query  499  EIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAMLIK  329
            +IIRLYYG+ DNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAAR+++L+AML+K
Sbjct  449  DIIRLYYGL-DNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARKKQLDAMLVK  504



>gb|KDO48034.1| hypothetical protein CISIN_1g010521mg [Citrus sinensis]
Length=499

 Score =   301 bits (771),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 145/177 (82%), Positives = 160/177 (90%), Gaps = 1/177 (1%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAIS  680
            AL +NSR LRLP H+HERL LIRNAK RLEEKG+TPS++RIAE LNMSQKKVRNATEAI 
Sbjct  323  ALVENSRTLRLPNHLHERLGLIRNAKLRLEEKGVTPSVDRIAEYLNMSQKKVRNATEAIG  382

Query  679  RVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLREREG  500
            +V+SLDREAFPSLNGLPGET HSYIADN +ENNPWHGVD+WALKDEV  LI  TL ERE 
Sbjct  383  KVFSLDREAFPSLNGLPGETHHSYIADNRVENNPWHGVDDWALKDEVNKLIIVTLGERER  442

Query  499  EIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAMLIK  329
            EIIRLYYG+ D ECLTWEDIS+RIGLSRERVRQVGLVALEKLKHAAR++K+EAML+K
Sbjct  443  EIIRLYYGL-DKECLTWEDISKRIGLSRERVRQVGLVALEKLKHAARKKKMEAMLVK  498



>ref|XP_006484698.1| PREDICTED: RNA polymerase sigma factor sigA-like isoform X1 [Citrus 
sinensis]
 ref|XP_006484699.1| PREDICTED: RNA polymerase sigma factor sigA-like isoform X2 [Citrus 
sinensis]
 ref|XP_006484700.1| PREDICTED: RNA polymerase sigma factor sigA-like isoform X3 [Citrus 
sinensis]
Length=508

 Score =   301 bits (771),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 145/177 (82%), Positives = 160/177 (90%), Gaps = 1/177 (1%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAIS  680
            AL +NSR LRLP H+HERL LIRNAK RLEEKG+TPS++RIAE LNMSQKKVRNATEAI 
Sbjct  332  ALVENSRTLRLPNHLHERLGLIRNAKLRLEEKGVTPSVDRIAEYLNMSQKKVRNATEAIG  391

Query  679  RVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLREREG  500
            +V+SLDREAFPSLNGLPGET HSYIADN +ENNPWHGVD+WALKDEV  LI  TL ERE 
Sbjct  392  KVFSLDREAFPSLNGLPGETHHSYIADNRVENNPWHGVDDWALKDEVNKLIIVTLGERER  451

Query  499  EIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAMLIK  329
            EIIRLYYG+ D ECLTWEDIS+RIGLSRERVRQVGLVALEKLKHAAR++K+EAML+K
Sbjct  452  EIIRLYYGL-DKECLTWEDISKRIGLSRERVRQVGLVALEKLKHAARKKKMEAMLVK  507



>ref|XP_010470329.1| PREDICTED: RNA polymerase sigma factor sigA-like [Camelina sativa]
 ref|XP_010470330.1| PREDICTED: RNA polymerase sigma factor sigA-like [Camelina sativa]
Length=520

 Score =   301 bits (772),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 146/177 (82%), Positives = 162/177 (92%), Gaps = 1/177 (1%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAIS  680
            AL DNSR LRLPTH+HERL LIRNAK RL+EKGITPSI+RIAESLNMSQKKVRNATEA+S
Sbjct  344  ALVDNSRTLRLPTHLHERLGLIRNAKLRLQEKGITPSIDRIAESLNMSQKKVRNATEAVS  403

Query  679  RVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLREREG  500
            +++SLDR+AFPSLNGLPGET HSYIADN LENNPW+G DEWALK+EV  LI  TL ERE 
Sbjct  404  KIFSLDRDAFPSLNGLPGETHHSYIADNRLENNPWYGYDEWALKEEVSKLINGTLGERER  463

Query  499  EIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAMLIK  329
            EIIRLYYG+ D ECLTWEDIS+RIGLSRERVRQVGLVALEKLKHAAR+RK+EAM++K
Sbjct  464  EIIRLYYGL-DKECLTWEDISKRIGLSRERVRQVGLVALEKLKHAARKRKMEAMILK  519



>gb|KDO48032.1| hypothetical protein CISIN_1g010521mg [Citrus sinensis]
 gb|KDO48033.1| hypothetical protein CISIN_1g010521mg [Citrus sinensis]
Length=508

 Score =   301 bits (771),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 145/177 (82%), Positives = 160/177 (90%), Gaps = 1/177 (1%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAIS  680
            AL +NSR LRLP H+HERL LIRNAK RLEEKG+TPS++RIAE LNMSQKKVRNATEAI 
Sbjct  332  ALVENSRTLRLPNHLHERLGLIRNAKLRLEEKGVTPSVDRIAEYLNMSQKKVRNATEAIG  391

Query  679  RVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLREREG  500
            +V+SLDREAFPSLNGLPGET HSYIADN +ENNPWHGVD+WALKDEV  LI  TL ERE 
Sbjct  392  KVFSLDREAFPSLNGLPGETHHSYIADNRVENNPWHGVDDWALKDEVNKLIIVTLGERER  451

Query  499  EIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAMLIK  329
            EIIRLYYG+ D ECLTWEDIS+RIGLSRERVRQVGLVALEKLKHAAR++K+EAML+K
Sbjct  452  EIIRLYYGL-DKECLTWEDISKRIGLSRERVRQVGLVALEKLKHAARKKKMEAMLVK  507



>ref|XP_002325882.1| RNA POLYMERASE SIGMA SUBUNIT 1 family protein [Populus trichocarpa]
 gb|EEF00264.1| RNA POLYMERASE SIGMA SUBUNIT 1 family protein [Populus trichocarpa]
Length=509

 Score =   301 bits (770),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 146/177 (82%), Positives = 161/177 (91%), Gaps = 1/177 (1%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAIS  680
            AL DNSR LRLP H+HERL LIRNAK RLEEKG+TPSI+RIAESLNMSQ+KVRNATEAIS
Sbjct  333  ALVDNSRTLRLPNHLHERLGLIRNAKIRLEEKGVTPSIDRIAESLNMSQRKVRNATEAIS  392

Query  679  RVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLREREG  500
            +V+SLDREAFPSLNGLPGET HSYIADN  ENNPWHGVDEWALK+EV  LI +TL+ERE 
Sbjct  393  KVFSLDREAFPSLNGLPGETHHSYIADNRPENNPWHGVDEWALKEEVNKLIDSTLQEREK  452

Query  499  EIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAMLIK  329
            EIIRLY+G+ D ECLTWEDIS+R+GLSRERVRQVGLVALEKLKHAAR+R  EAML+K
Sbjct  453  EIIRLYHGL-DQECLTWEDISKRMGLSRERVRQVGLVALEKLKHAARKRNTEAMLVK  508



>gb|KJB44350.1| hypothetical protein B456_007G247500 [Gossypium raimondii]
Length=508

 Score =   300 bits (769),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 146/178 (82%), Positives = 163/178 (92%), Gaps = 1/178 (1%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAIS  680
            AL +NSR LRLPT++HERL LIRNAK RLEEKGITP+I+RIAESLNMSQKKVRNATEA+S
Sbjct  332  ALVENSRTLRLPTYLHERLGLIRNAKYRLEEKGITPTIDRIAESLNMSQKKVRNATEAVS  391

Query  679  RVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLREREG  500
            +V+SLDR+AFPSLNGLPGET HSYIADNH+ENNPWHGVDEWALKDEV  LI  TL ERE 
Sbjct  392  KVFSLDRDAFPSLNGLPGETHHSYIADNHVENNPWHGVDEWALKDEVNRLINITLGERER  451

Query  499  EIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAMLIKQ  326
            EIIRLY+G+ D E LTWEDIS+RIGLSRERVRQVGLVALEKLKHAAR++K+EAML+K 
Sbjct  452  EIIRLYHGL-DKESLTWEDISKRIGLSRERVRQVGLVALEKLKHAARKKKMEAMLVKH  508



>ref|XP_010266387.1| PREDICTED: RNA polymerase sigma factor sigA-like [Nelumbo nucifera]
Length=506

 Score =   300 bits (769),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 145/178 (81%), Positives = 162/178 (91%), Gaps = 1/178 (1%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAIS  680
            AL +NSR LRLPTH+HERL LIRNAK RL EKGITPSI+RIAE LNMS+KKVRNATEA++
Sbjct  330  ALVENSRTLRLPTHLHERLCLIRNAKIRLAEKGITPSIDRIAECLNMSEKKVRNATEAVN  389

Query  679  RVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLREREG  500
            +V+SLDREAFPSLNGLP ETLHSYIADN LENNPWHGVDEW+LKDEV NL+ TTL ERE 
Sbjct  390  KVFSLDREAFPSLNGLPRETLHSYIADNRLENNPWHGVDEWSLKDEVNNLLSTTLEERER  449

Query  499  EIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAMLIKQ  326
            +IIRLYYG+ D ECLTWEDISRRIGLSRERVRQVGLVALEKLKHAAR+++L+ ML+K 
Sbjct  450  DIIRLYYGL-DKECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARKKRLDTMLVKH  506



>ref|XP_006302143.1| hypothetical protein CARUB_v10020145mg [Capsella rubella]
 gb|EOA35041.1| hypothetical protein CARUB_v10020145mg [Capsella rubella]
Length=521

 Score =   301 bits (770),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 146/177 (82%), Positives = 161/177 (91%), Gaps = 1/177 (1%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAIS  680
            AL DNSR LRLPTH+HERL LIRNAK RL+EKGITPSI+RIAESLNMSQKKVRNATEA+S
Sbjct  345  ALVDNSRTLRLPTHLHERLGLIRNAKLRLQEKGITPSIDRIAESLNMSQKKVRNATEAVS  404

Query  679  RVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLREREG  500
            +++SLDR+AFPSLNGLPGET HSYIADN LENNPWHG DE ALK+EV  LI  TL ERE 
Sbjct  405  KIFSLDRDAFPSLNGLPGETHHSYIADNRLENNPWHGYDELALKEEVSKLITATLGERER  464

Query  499  EIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAMLIK  329
            EIIRLYYG+ D ECLTWEDIS+RIGLSRERVRQVGLVALEKLKHAAR+RK+EAM++K
Sbjct  465  EIIRLYYGL-DKECLTWEDISKRIGLSRERVRQVGLVALEKLKHAARKRKMEAMILK  520



>ref|XP_011012457.1| PREDICTED: RNA polymerase sigma factor sigA [Populus euphratica]
 ref|XP_011012458.1| PREDICTED: RNA polymerase sigma factor sigA [Populus euphratica]
Length=509

 Score =   300 bits (768),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 146/177 (82%), Positives = 161/177 (91%), Gaps = 1/177 (1%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAIS  680
            AL DNSR LRLP H+HERL LIRNAK RLEEKG+TPSI+RIAESLNMSQ+KVRNATEAIS
Sbjct  333  ALVDNSRTLRLPNHLHERLGLIRNAKIRLEEKGVTPSIDRIAESLNMSQRKVRNATEAIS  392

Query  679  RVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLREREG  500
            +V+SLDREAFPSLNGLPGET HSYIADN  ENNPWHGVDEWALK+EV  LI +TL+ERE 
Sbjct  393  KVFSLDREAFPSLNGLPGETHHSYIADNRPENNPWHGVDEWALKEEVNKLIDSTLQEREK  452

Query  499  EIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAMLIK  329
            EIIRLY+G+ D ECLTWEDIS+R+GLSRERVRQVGLVALEKLKHAAR+R  EAML+K
Sbjct  453  EIIRLYHGL-DQECLTWEDISKRMGLSRERVRQVGLVALEKLKHAARKRNTEAMLVK  508



>emb|CAA75859.1| Sig1 [Sinapis alba]
Length=481

 Score =   299 bits (766),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 146/177 (82%), Positives = 160/177 (90%), Gaps = 1/177 (1%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAIS  680
            AL DNSR LRLPTH+HERL LIRNAK RL+EKGITPSI+RIAESLNMSQKKVRNATEA+S
Sbjct  305  ALVDNSRTLRLPTHLHERLGLIRNAKLRLQEKGITPSIDRIAESLNMSQKKVRNATEAVS  364

Query  679  RVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLREREG  500
            +++SLDR+AFPSLNGLPGET HSYIADN LENNPWHG D  ALKDEV  LI  TL ERE 
Sbjct  365  KIFSLDRDAFPSLNGLPGETHHSYIADNRLENNPWHGYDALALKDEVSKLISVTLGERER  424

Query  499  EIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAMLIK  329
            EIIRLYYG+ D ECLTWEDIS+RIGLSRERVRQVGLVALEKLKHAAR+RK+EAM++K
Sbjct  425  EIIRLYYGL-DKECLTWEDISQRIGLSRERVRQVGLVALEKLKHAARKRKMEAMILK  480



>gb|KHG03684.1| RNA polymerase sigma factor rpoD [Gossypium arboreum]
 gb|KHG18047.1| RNA polymerase sigma factor rpoD [Gossypium arboreum]
Length=508

 Score =   300 bits (768),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 146/178 (82%), Positives = 163/178 (92%), Gaps = 1/178 (1%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAIS  680
            AL +NSR LRLPT++HERL LIRNAK RLEEKGITP+I+RIAESLNMSQKKVRNATEA+S
Sbjct  332  ALVENSRTLRLPTYLHERLGLIRNAKYRLEEKGITPTIDRIAESLNMSQKKVRNATEAVS  391

Query  679  RVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLREREG  500
            +V+SLDR+AFPSLNGLPGET HSYIADNH+ENNPWHGVDEWALKDEV  LI  TL ERE 
Sbjct  392  KVFSLDRDAFPSLNGLPGETHHSYIADNHVENNPWHGVDEWALKDEVNRLIDITLGERER  451

Query  499  EIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAMLIKQ  326
            EIIRLY+G+ D E LTWEDIS+RIGLSRERVRQVGLVALEKLKHAAR++K+EAML+K 
Sbjct  452  EIIRLYHGL-DKESLTWEDISKRIGLSRERVRQVGLVALEKLKHAARKKKMEAMLVKH  508



>ref|XP_006437403.1| hypothetical protein CICLE_v10031289mg [Citrus clementina]
 gb|ESR50643.1| hypothetical protein CICLE_v10031289mg [Citrus clementina]
Length=508

 Score =   300 bits (768),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 144/177 (81%), Positives = 160/177 (90%), Gaps = 1/177 (1%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAIS  680
            AL +NSR LRLP H+HERL LIRNAK RLEEKG+TP+++RIAE LNMSQKKVRNATEAI 
Sbjct  332  ALVENSRTLRLPNHLHERLGLIRNAKLRLEEKGVTPAVDRIAEYLNMSQKKVRNATEAIG  391

Query  679  RVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLREREG  500
            +V+SLDREAFPSLNGLPGET HSYIADN +ENNPWHGVD+WALKDEV  LI  TL ERE 
Sbjct  392  KVFSLDREAFPSLNGLPGETHHSYIADNRVENNPWHGVDDWALKDEVNKLIIVTLGERER  451

Query  499  EIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAMLIK  329
            EIIRLYYG+ D ECLTWEDIS+RIGLSRERVRQVGLVALEKLKHAAR++K+EAML+K
Sbjct  452  EIIRLYYGL-DKECLTWEDISKRIGLSRERVRQVGLVALEKLKHAARKKKMEAMLVK  507



>ref|XP_010087437.1| RNA polymerase sigma factor rpoD [Morus notabilis]
 gb|EXB29118.1| RNA polymerase sigma factor rpoD [Morus notabilis]
Length=508

 Score =   300 bits (767),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 147/178 (83%), Positives = 162/178 (91%), Gaps = 1/178 (1%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAIS  680
            AL +NSR LRLPTH+HERLS IRNAK RL+EKGITPSI+RIAE LNMS+KKVRNATEAIS
Sbjct  332  ALVENSRTLRLPTHLHERLSSIRNAKIRLQEKGITPSIDRIAECLNMSKKKVRNATEAIS  391

Query  679  RVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLREREG  500
            +V+SLDREAFPSLNGLPGET HSYIADN  EN PWHGVDEWALK+EV  LI TTL ERE 
Sbjct  392  KVFSLDREAFPSLNGLPGETHHSYIADNCSENIPWHGVDEWALKEEVNKLINTTLGERET  451

Query  499  EIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAMLIKQ  326
            +IIRLYYG+ DNECLTWEDIS+RIGLSRERVRQVGLVALEKLKHAARR+++EAML+K 
Sbjct  452  DIIRLYYGL-DNECLTWEDISKRIGLSRERVRQVGLVALEKLKHAARRKQMEAMLVKH  508



>ref|XP_002886771.1| RNA polymerase sigma subunit 1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH63030.1| RNA polymerase sigma subunit 1 [Arabidopsis lyrata subsp. lyrata]
Length=503

 Score =   297 bits (761),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 144/177 (81%), Positives = 161/177 (91%), Gaps = 1/177 (1%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAIS  680
            AL DNSR LRLPTH+HERL LIRNAK RL+EKGITPSI+RIAESLNMSQKKVRNATEA+S
Sbjct  327  ALVDNSRTLRLPTHLHERLGLIRNAKLRLQEKGITPSIDRIAESLNMSQKKVRNATEAVS  386

Query  679  RVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLREREG  500
            +++SLDR+AFPSLNGLPGET HSYIADN +ENNPWHG D+ ALK+EV  LI  TL ERE 
Sbjct  387  KIFSLDRDAFPSLNGLPGETHHSYIADNRVENNPWHGYDDLALKEEVSKLISATLGERER  446

Query  499  EIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAMLIK  329
            EIIRLYYG+ D ECLTWEDIS+RIGLSRERVRQVGLVALEKLKHAAR+RK+EAM++K
Sbjct  447  EIIRLYYGL-DKECLTWEDISKRIGLSRERVRQVGLVALEKLKHAARKRKMEAMILK  502



>ref|NP_176666.1| RNA polymerase sigma subunit 1 [Arabidopsis thaliana]
 sp|O24629.1|SIGA_ARATH RecName: Full=RNA polymerase sigma factor sigA; Short=Sigma factor 
A; Short=Sigma-A; AltName: Full=RNA polymerase sigma factor 
sig1; Short=Atsig1; Short=Sigma factor 1; AltName: Full=RNA 
polymerase sigma factor sig2; Short=Atsig2; Short=Sigma 
factor 2; AltName: Full=RNA polymerase sigma factor sigB; 
Short=Sigma factor B; Short=Sigma-B; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAD38260.1|AC006193_16 RNA polymerase sigma subunit 1 [Arabidopsis thaliana]
 gb|AAB69384.1| sigma factor 1 [Arabidopsis thaliana]
 dbj|BAA22421.1| SigA [Arabidopsis thaliana]
 emb|CAA74640.1| plastid RNA polymerase sigma factor [Arabidopsis thaliana]
 dbj|BAA82448.1| sigma factor SigA [Arabidopsis thaliana]
 gb|AAL32604.1| RNA polymerase sigma subunit 1 [Arabidopsis thaliana]
 gb|AAM13305.1| RNA polymerase sigma subunit 1 [Arabidopsis thaliana]
 dbj|BAH19492.1| AT1G64860 [Arabidopsis thaliana]
 gb|AEE34298.1| RNA polymerase sigma subunit 1 [Arabidopsis thaliana]
Length=502

 Score =   297 bits (761),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 145/177 (82%), Positives = 160/177 (90%), Gaps = 1/177 (1%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAIS  680
            AL DNSR LRLPTH+HERL LIRNAK RL+EKGITPSI+RIAESLNMSQKKVRNATEA+S
Sbjct  326  ALVDNSRTLRLPTHLHERLGLIRNAKLRLQEKGITPSIDRIAESLNMSQKKVRNATEAVS  385

Query  679  RVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLREREG  500
            +V+SLDR+AFPSLNGLPGET HSYIAD  LENNPWHG D+ ALK+EV  LI  TL ERE 
Sbjct  386  KVFSLDRDAFPSLNGLPGETHHSYIADTRLENNPWHGYDDLALKEEVSKLISATLGEREK  445

Query  499  EIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAMLIK  329
            EIIRLYYG+ D ECLTWEDIS+RIGLSRERVRQVGLVALEKLKHAAR+RK+EAM++K
Sbjct  446  EIIRLYYGL-DKECLTWEDISKRIGLSRERVRQVGLVALEKLKHAARKRKMEAMILK  501



>gb|AAG40388.1|AF325036_1 At1g64860 [Arabidopsis thaliana]
Length=502

 Score =   297 bits (761),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 145/177 (82%), Positives = 160/177 (90%), Gaps = 1/177 (1%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAIS  680
            AL DNSR LRLPTH+HERL LIRNAK RL+EKGITPSI+RIAESLNMSQKKVRNATEA+S
Sbjct  326  ALVDNSRTLRLPTHLHERLGLIRNAKLRLQEKGITPSIDRIAESLNMSQKKVRNATEAVS  385

Query  679  RVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLREREG  500
            +V+SLDR+AFPSLNGLPGET HSYIAD  LENNPWHG D+ ALK+EV  LI  TL ERE 
Sbjct  386  KVFSLDRDAFPSLNGLPGETHHSYIADTRLENNPWHGYDDLALKEEVSKLISATLGEREK  445

Query  499  EIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAMLIK  329
            EIIRLYYG+ D ECLTWEDIS+RIGLSRERVRQVGLVALEKLKHAAR+RK+EAM++K
Sbjct  446  EIIRLYYGL-DKECLTWEDISKRIGLSRERVRQVGLVALEKLKHAARKRKMEAMILK  501



>emb|CAA74896.1| sigma factorB [Arabidopsis thaliana]
Length=500

 Score =   297 bits (761),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 145/177 (82%), Positives = 160/177 (90%), Gaps = 1/177 (1%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAIS  680
            AL DNSR LRLPTH+HERL LIRNAK RL+EKGITPSI+RIAESLNMSQKKVRNATEA+S
Sbjct  324  ALVDNSRTLRLPTHLHERLGLIRNAKLRLQEKGITPSIDRIAESLNMSQKKVRNATEAVS  383

Query  679  RVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLREREG  500
            +V+SLDR+AFPSLNGLPGET HSYIAD  LENNPWHG D+ ALK+EV  LI  TL ERE 
Sbjct  384  KVFSLDRDAFPSLNGLPGETHHSYIADTRLENNPWHGYDDLALKEEVSKLISATLGEREK  443

Query  499  EIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAMLIK  329
            EIIRLYYG+ D ECLTWEDIS+RIGLSRERVRQVGLVALEKLKHAAR+RK+EAM++K
Sbjct  444  EIIRLYYGL-DKECLTWEDISKRIGLSRERVRQVGLVALEKLKHAARKRKMEAMILK  499



>gb|AAB81958.1| RNA polymerase sigma subunit 1 [Arabidopsis thaliana]
Length=502

 Score =   297 bits (761),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 145/177 (82%), Positives = 160/177 (90%), Gaps = 1/177 (1%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAIS  680
            AL DNSR LRLPTH+HERL LIRNAK RL+EKGITPSI+RIAESLNMSQKKVRNATEA+S
Sbjct  326  ALVDNSRTLRLPTHLHERLGLIRNAKLRLQEKGITPSIDRIAESLNMSQKKVRNATEAVS  385

Query  679  RVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLREREG  500
            +V+SLDR+AFPSLNGLPGET HSYIAD  LENNPWHG D+ ALK+EV  LI  TL ERE 
Sbjct  386  KVFSLDRDAFPSLNGLPGETHHSYIADTRLENNPWHGYDDLALKEEVSKLISATLGEREK  445

Query  499  EIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAMLIK  329
            EIIRLYYG+ D ECLTWEDIS+RIGLSRERVRQVGLVALEKLKHAAR+RK+EAM++K
Sbjct  446  EIIRLYYGL-DKECLTWEDISKRIGLSRERVRQVGLVALEKLKHAARKRKMEAMILK  501



>ref|XP_010550940.1| PREDICTED: RNA polymerase sigma factor sigA [Tarenaya hassleriana]
Length=512

 Score =   297 bits (761),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 144/178 (81%), Positives = 161/178 (90%), Gaps = 1/178 (1%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAIS  680
            AL +NSR LRLPTH+HERL LIRNAK RLEEKGITPSIERIA+SLNMSQKKV+NATEA+S
Sbjct  336  ALVENSRTLRLPTHLHERLGLIRNAKLRLEEKGITPSIERIAKSLNMSQKKVKNATEAVS  395

Query  679  RVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLREREG  500
            +V+SLDR+AFPSLNGLPGET HSYIADN LENNPWHG DEWALK+EV  L+   L +RE 
Sbjct  396  KVFSLDRDAFPSLNGLPGETHHSYIADNRLENNPWHGYDEWALKNEVNKLLNAILGDRER  455

Query  499  EIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAMLIKQ  326
            EI+RLYYG+ D E LTWEDIS+RIGLSRERVRQVGLVALEKLKHAAR+RK+EAML+KQ
Sbjct  456  EIVRLYYGL-DRESLTWEDISKRIGLSRERVRQVGLVALEKLKHAARKRKMEAMLVKQ  512



>dbj|BAA22214.1| plastid RNA polymerase sigma-subunit [Arabidopsis thaliana]
Length=502

 Score =   297 bits (760),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 145/177 (82%), Positives = 160/177 (90%), Gaps = 1/177 (1%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAIS  680
            AL DNSR LRLPTH+HERL LIRNAK RL+EKGITPSI+RIAESLNMSQKKVRNATEA+S
Sbjct  326  ALVDNSRTLRLPTHLHERLGLIRNAKLRLQEKGITPSIDRIAESLNMSQKKVRNATEAVS  385

Query  679  RVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLREREG  500
            +V+SLDR+AFPSLNGLPGET HSYIAD  LENNPWHG D+ ALK+EV  LI  TL ERE 
Sbjct  386  KVFSLDRDAFPSLNGLPGETHHSYIADTRLENNPWHGYDDLALKEEVSKLISATLGEREK  445

Query  499  EIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAMLIK  329
            EIIRLYYG+ D ECLTWEDIS+RIGLSRERVRQVGLVALEKLKHAAR+RK+EAM++K
Sbjct  446  EIIRLYYGL-DKECLTWEDISKRIGLSRERVRQVGLVALEKLKHAARKRKMEAMILK  501



>ref|XP_002319237.2| hypothetical protein POPTR_0013s07290g [Populus trichocarpa]
 gb|EEE95160.2| hypothetical protein POPTR_0013s07290g [Populus trichocarpa]
Length=499

 Score =   297 bits (760),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 145/178 (81%), Positives = 161/178 (90%), Gaps = 1/178 (1%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAIS  680
            AL +N R LRLP H+HERL LIRNAK RLEEKG+TPSI+RIAESLNMSQ+KVRNATEAIS
Sbjct  323  ALVENPRTLRLPNHLHERLGLIRNAKIRLEEKGVTPSIDRIAESLNMSQRKVRNATEAIS  382

Query  679  RVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLREREG  500
            +V+SLDREAFPSLNGLPGET HSYIADN LENNPWHGVDEWALK+EV  LI + L+ERE 
Sbjct  383  KVFSLDREAFPSLNGLPGETHHSYIADNRLENNPWHGVDEWALKEEVNKLIDSALQERER  442

Query  499  EIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAMLIKQ  326
            EIIRLY+G+ D ECLTWEDIS+R+GLSRERVRQVGLVALEKLKHAAR+ KLEAML+K 
Sbjct  443  EIIRLYHGL-DKECLTWEDISKRMGLSRERVRQVGLVALEKLKHAARKGKLEAMLVKH  499



>ref|XP_011011636.1| PREDICTED: RNA polymerase sigma factor sigA-like [Populus euphratica]
 ref|XP_011011637.1| PREDICTED: RNA polymerase sigma factor sigA-like [Populus euphratica]
Length=508

 Score =   296 bits (759),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 144/178 (81%), Positives = 161/178 (90%), Gaps = 1/178 (1%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAIS  680
            AL +NSR LRLP H+HERL LIRNA+ RLEEKG+TPSI+RIAESLNMSQ+KVRNATEAI 
Sbjct  332  ALVENSRTLRLPNHLHERLGLIRNARIRLEEKGVTPSIDRIAESLNMSQRKVRNATEAIG  391

Query  679  RVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLREREG  500
            +V+SLDREAFPSLNGLPGET HSYIADNHL NNPWHGVDEWALK+EV  LI + L+ERE 
Sbjct  392  KVFSLDREAFPSLNGLPGETHHSYIADNHLGNNPWHGVDEWALKEEVNKLIDSALQERER  451

Query  499  EIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAMLIKQ  326
            EIIRLY+G+ D ECLTWEDIS+R+GLSRERVRQVGLVALEKLKHAAR+ KLEAML+K 
Sbjct  452  EIIRLYHGL-DKECLTWEDISKRMGLSRERVRQVGLVALEKLKHAARKGKLEAMLVKH  508



>ref|XP_010063584.1| PREDICTED: RNA polymerase sigma factor sigA [Eucalyptus grandis]
 gb|KCW90983.1| hypothetical protein EUGRSUZ_A02994 [Eucalyptus grandis]
Length=521

 Score =   296 bits (758),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 144/178 (81%), Positives = 159/178 (89%), Gaps = 1/178 (1%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAIS  680
            AL +NSR LRLP H+HERL LIRNAK RLEEKGITPS++RIAE LNMSQKKVRNATEAI 
Sbjct  345  ALVENSRTLRLPAHLHERLGLIRNAKVRLEEKGITPSVDRIAECLNMSQKKVRNATEAIG  404

Query  679  RVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLREREG  500
            +V+SLDR+AFPSLNGLPGET HSYIAD H+ENNPWHGVDEWALKDEV  L+  TL +RE 
Sbjct  405  KVFSLDRDAFPSLNGLPGETHHSYIADIHVENNPWHGVDEWALKDEVNKLMNVTLSKRER  464

Query  499  EIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAMLIKQ  326
            EIIRLYYG+ DNECLTWEDIS+RIGLSRERVRQVGLVALEKLKH AR+R +EAML+K 
Sbjct  465  EIIRLYYGL-DNECLTWEDISKRIGLSRERVRQVGLVALEKLKHMARKRMMEAMLLKH  521



>ref|XP_007219023.1| hypothetical protein PRUPE_ppa004393mg [Prunus persica]
 gb|EMJ20222.1| hypothetical protein PRUPE_ppa004393mg [Prunus persica]
Length=512

 Score =   295 bits (754),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 145/178 (81%), Positives = 161/178 (90%), Gaps = 1/178 (1%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAIS  680
            AL +NSR LRLPTH+HERL LIRNAK RLEEKGITPSI+RIAESLNMS+KKVRNATEAIS
Sbjct  336  ALVENSRTLRLPTHLHERLGLIRNAKIRLEEKGITPSIDRIAESLNMSKKKVRNATEAIS  395

Query  679  RVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLREREG  500
            +V+SLDR+AFPSLNGLPGET HSYIADN LEN PWHGVD WALK+EV  LI   L ERE 
Sbjct  396  KVFSLDRDAFPSLNGLPGETHHSYIADNRLENIPWHGVDAWALKEEVSKLINMMLGEREK  455

Query  499  EIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAMLIKQ  326
            EII+LYYG+ +NECLTWEDIS+RIGLSRERVRQVGLVALEKLKHAAR+R++EAML+K 
Sbjct  456  EIIQLYYGL-ENECLTWEDISKRIGLSRERVRQVGLVALEKLKHAARKREMEAMLLKH  512



>ref|XP_008234513.1| PREDICTED: RNA polymerase sigma factor sigA [Prunus mume]
Length=512

 Score =   294 bits (752),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 145/178 (81%), Positives = 161/178 (90%), Gaps = 1/178 (1%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAIS  680
            AL +NSR LRLPTH+HERL LIRNAK RLEEKGITPSI+RIAESLNMS+KKVRNATEAIS
Sbjct  336  ALVENSRTLRLPTHLHERLGLIRNAKIRLEEKGITPSIDRIAESLNMSKKKVRNATEAIS  395

Query  679  RVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLREREG  500
            +V+SLDR+AFPSLNGLPGET HSYIADN LEN PWHGVD WALK+EV  LI   L ERE 
Sbjct  396  KVFSLDRDAFPSLNGLPGETHHSYIADNRLENIPWHGVDAWALKEEVSKLINMMLGERER  455

Query  499  EIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAMLIKQ  326
            EII+LYYG+ +NECLTWEDIS+RIGLSRERVRQVGLVALEKLKHAAR+R++EAML+K 
Sbjct  456  EIIQLYYGL-ENECLTWEDISKRIGLSRERVRQVGLVALEKLKHAARKREMEAMLLKH  512



>ref|XP_010670766.1| PREDICTED: RNA polymerase sigma factor sigA [Beta vulgaris subsp. 
vulgaris]
Length=502

 Score =   293 bits (750),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 143/177 (81%), Positives = 159/177 (90%), Gaps = 1/177 (1%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAIS  680
            AL +NSR LRLPTH+HERLSLIR+AK +LEEKGITPSI+RIAESLNMS KK++NATEA+ 
Sbjct  326  ALVENSRTLRLPTHLHERLSLIRSAKNKLEEKGITPSIDRIAESLNMSHKKIKNATEAVR  385

Query  679  RVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLREREG  500
             V SLDRE FPSLNGLPGET HSYIADN LENNPWHGVDEWALK EV NLI T LRERE 
Sbjct  386  SVLSLDREVFPSLNGLPGETFHSYIADNRLENNPWHGVDEWALKHEVSNLIDTALREREK  445

Query  499  EIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAMLIK  329
            EIIRLYYG+ D E LTWE+IS+RIGLSRERVRQVGLVALEKLKHAAR+R++EA+L+K
Sbjct  446  EIIRLYYGLED-ESLTWEEISKRIGLSRERVRQVGLVALEKLKHAARKRRMEALLVK  501



>ref|XP_009361126.1| PREDICTED: RNA polymerase sigma factor sigA isoform X1 [Pyrus 
x bretschneideri]
Length=514

 Score =   292 bits (748),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 144/178 (81%), Positives = 160/178 (90%), Gaps = 1/178 (1%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAIS  680
            AL +NS+ LRLPTH+HERL LIRNAK RLEEKGITPSI+RIAESLNMS+KKVRNATEAIS
Sbjct  338  ALVENSKTLRLPTHLHERLGLIRNAKIRLEEKGITPSIDRIAESLNMSKKKVRNATEAIS  397

Query  679  RVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLREREG  500
            +V+SLDR+AFPSLNGLPGET HSYIADN LEN PW+GVD WALKDEV  LI   L ERE 
Sbjct  398  KVFSLDRDAFPSLNGLPGETHHSYIADNRLENIPWNGVDAWALKDEVNKLINMMLGERER  457

Query  499  EIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAMLIKQ  326
            EIIRLYYG+ DNECLTWEDIS+RIGLSRERVRQVGLVALEKLKHAAR+ ++EA+L+K 
Sbjct  458  EIIRLYYGL-DNECLTWEDISKRIGLSRERVRQVGLVALEKLKHAARKTEMEALLVKH  514



>ref|XP_008376946.1| PREDICTED: RNA polymerase sigma factor sigA-like isoform X1 [Malus 
domestica]
Length=515

 Score =   291 bits (746),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 144/178 (81%), Positives = 159/178 (89%), Gaps = 1/178 (1%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAIS  680
            AL +NS+ LRLPTH+HERL LIRNAK RLEEKGITPSI+RIAESLNMS+KKVRNATEAIS
Sbjct  339  ALVENSKTLRLPTHLHERLGLIRNAKIRLEEKGITPSIDRIAESLNMSKKKVRNATEAIS  398

Query  679  RVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLREREG  500
            +V+SLDR+AFPSLNGLPGET HSYIADN LEN PW GVD WALKDEV  LI   L ERE 
Sbjct  399  KVFSLDRDAFPSLNGLPGETHHSYIADNRLENIPWTGVDAWALKDEVNKLINMMLGERER  458

Query  499  EIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAMLIKQ  326
            EIIRLYYG+ DNECLTWEDIS+RIGLSRERVRQVGLVALEKLKHAAR+ ++EA+L+K 
Sbjct  459  EIIRLYYGL-DNECLTWEDISKRIGLSRERVRQVGLVALEKLKHAARKTEMEALLVKH  515



>ref|XP_004307835.2| PREDICTED: RNA polymerase sigma factor sigA [Fragaria vesca subsp. 
vesca]
Length=512

 Score =   288 bits (738),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 143/178 (80%), Positives = 158/178 (89%), Gaps = 1/178 (1%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAIS  680
            AL +NSR LRLPTH+HERL LIRNAK RLEEKGITPSI+ IAESLNMS+KKVRNATEAIS
Sbjct  336  ALVENSRTLRLPTHLHERLGLIRNAKVRLEEKGITPSIDSIAESLNMSKKKVRNATEAIS  395

Query  679  RVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLREREG  500
            +V+SLDR+AFPSLNGLPGET HSYIADN  EN PWHG+DE ALKDEV  LI   L ERE 
Sbjct  396  KVFSLDRDAFPSLNGLPGETHHSYIADNRHENIPWHGLDELALKDEVNKLINLMLGERER  455

Query  499  EIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAMLIKQ  326
            EIIRLYYG+ DNECLTWEDIS+RIGLSRERVRQVGLVALEKLKH AR+++LEAML++ 
Sbjct  456  EIIRLYYGL-DNECLTWEDISKRIGLSRERVRQVGLVALEKLKHGARKKELEAMLVQH  512



>ref|XP_006878659.1| PREDICTED: RNA polymerase sigma factor sigA [Amborella trichopoda]
 gb|ERM94804.1| hypothetical protein AMTR_s00011p00266100 [Amborella trichopoda]
Length=497

 Score =   286 bits (733),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 138/178 (78%), Positives = 161/178 (90%), Gaps = 1/178 (1%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAIS  680
            A+ +NSR LRLPTH+HERLSLIRNAK RL+E+G+TPSI RIA+SLNMS+KKV+NATEA++
Sbjct  321  AMVENSRTLRLPTHLHERLSLIRNAKIRLKEQGLTPSIHRIAKSLNMSKKKVKNATEAMT  380

Query  679  RVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLREREG  500
            +V+SLDREAFP+LNGLPGETLHSYIADN+L NNPWHGVDEW LK EV  LI +TL ERE 
Sbjct  381  KVFSLDREAFPTLNGLPGETLHSYIADNNLMNNPWHGVDEWLLKAEVNKLISSTLAEREQ  440

Query  499  EIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAMLIKQ  326
            +IIRLYYG+ D EC TWEDISR+IGLSRERVRQVGLVALEKLK+AAR ++LEAML+K 
Sbjct  441  DIIRLYYGL-DKECHTWEDISRKIGLSRERVRQVGLVALEKLKNAARNKRLEAMLVKH  497



>ref|XP_003539986.1| PREDICTED: RNA polymerase sigma factor sigA-like [Glycine max]
 gb|KHN46496.1| RNA polymerase sigma factor rpoD [Glycine soja]
Length=503

 Score =   286 bits (732),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 142/177 (80%), Positives = 159/177 (90%), Gaps = 1/177 (1%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAIS  680
            AL +NSR LRLP H+HERLSLIRNAK RLEE+GITP+I+RIA+ LNMSQKKVRNATEAIS
Sbjct  327  ALVENSRTLRLPAHLHERLSLIRNAKFRLEERGITPTIDRIAKYLNMSQKKVRNATEAIS  386

Query  679  RVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLREREG  500
            ++ SLDREAFPSLNGL GET HSYIADN +EN PW+GVDEWALKDEV  LI  TL ERE 
Sbjct  387  KIISLDREAFPSLNGLQGETHHSYIADNRVENIPWNGVDEWALKDEVNRLINVTLVERER  446

Query  499  EIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAMLIK  329
            EIIRLYYG+ + ECLTWEDIS+RIGLSRERVRQVGLVALEKLKHAAR+R++EAML+K
Sbjct  447  EIIRLYYGL-EKECLTWEDISKRIGLSRERVRQVGLVALEKLKHAARKRQMEAMLLK  502



>ref|XP_008462812.1| PREDICTED: RNA polymerase sigma factor sigA [Cucumis melo]
Length=509

 Score =   286 bits (732),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 141/177 (80%), Positives = 158/177 (89%), Gaps = 1/177 (1%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAIS  680
            AL +NSR LRLPTH+HERL LIRNAK +L+EKGITPS++RIAESLNMS+KKV+NATEAIS
Sbjct  333  ALVENSRTLRLPTHLHERLGLIRNAKVKLQEKGITPSLDRIAESLNMSKKKVKNATEAIS  392

Query  679  RVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLREREG  500
            +V+SLDREAFPSLNGLPGET HSYIADN LENNPWHG D W LK EV  LI  TL +RE 
Sbjct  393  KVFSLDREAFPSLNGLPGETHHSYIADNCLENNPWHGTDTWILKAEVNKLINMTLGDRER  452

Query  499  EIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAMLIK  329
            EIIRLY+G+ DNECLTWE+IS+RIGLSRERVRQVGLVALEKLK AA+ RK+EAMLIK
Sbjct  453  EIIRLYHGL-DNECLTWEEISKRIGLSRERVRQVGLVALEKLKKAAKTRKMEAMLIK  508



>gb|KJB44354.1| hypothetical protein B456_007G247500 [Gossypium raimondii]
Length=535

 Score =   287 bits (734),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 146/204 (72%), Positives = 163/204 (80%), Gaps = 28/204 (14%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEEKGITPSI----------------------  746
            AL +NSR LRLPT++HERL LIRNAK RLEEKGITP+I                      
Sbjct  332  ALVENSRTLRLPTYLHERLGLIRNAKYRLEEKGITPTIDSLLYASSQVSYSLNEPSFKYL  391

Query  745  -----ERIAESLNMSQKKVRNATEAISRVYSLDREAFPSLNGLPGETLHSYIADNHLENN  581
                 +RIAESLNMSQKKVRNATEA+S+V+SLDR+AFPSLNGLPGET HSYIADNH+ENN
Sbjct  392  ILLYFQRIAESLNMSQKKVRNATEAVSKVFSLDRDAFPSLNGLPGETHHSYIADNHVENN  451

Query  580  PWHGVDEWALKDEVKNLICTTLREREGEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQ  401
            PWHGVDEWALKDEV  LI  TL ERE EIIRLY+G+ D E LTWEDIS+RIGLSRERVRQ
Sbjct  452  PWHGVDEWALKDEVNRLINITLGEREREIIRLYHGL-DKESLTWEDISKRIGLSRERVRQ  510

Query  400  VGLVALEKLKHAARRRKLEAMLIK  329
            VGLVALEKLKHAAR++K+EAML+K
Sbjct  511  VGLVALEKLKHAARKKKMEAMLVK  534



>ref|XP_004151855.1| PREDICTED: RNA polymerase sigma factor sigA [Cucumis sativus]
 gb|KGN63339.1| hypothetical protein Csa_2G431090 [Cucumis sativus]
Length=508

 Score =   285 bits (730),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 140/177 (79%), Positives = 158/177 (89%), Gaps = 1/177 (1%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAIS  680
            AL +NSR LRLPTH+HERL LIRNAK +L+EKGITPS++RIAESLNMS+KKV+NATEAIS
Sbjct  332  ALVENSRTLRLPTHLHERLGLIRNAKVKLQEKGITPSLDRIAESLNMSKKKVQNATEAIS  391

Query  679  RVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLREREG  500
            +V+SLDREAFPSLNGLPGET HSYIADN LENNPWHG D W LK EV  LI  TL +RE 
Sbjct  392  KVFSLDREAFPSLNGLPGETHHSYIADNCLENNPWHGTDTWILKVEVNQLINMTLGDRER  451

Query  499  EIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAMLIK  329
            EIIRLY+G+ DNECLTWE+IS+RIGLSRERVRQVGLVALEKLK AA+ RK+EAML+K
Sbjct  452  EIIRLYHGL-DNECLTWEEISKRIGLSRERVRQVGLVALEKLKKAAKTRKMEAMLLK  507



>gb|KJB26696.1| hypothetical protein B456_004G255000 [Gossypium raimondii]
 gb|KJB26697.1| hypothetical protein B456_004G255000 [Gossypium raimondii]
Length=499

 Score =   284 bits (726),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 142/178 (80%), Positives = 157/178 (88%), Gaps = 1/178 (1%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAIS  680
            AL DNSR LRLPTH+HERL LIRNAK RLEEKGITP+I+RIAESLNMSQKKVRNAT+A S
Sbjct  323  ALVDNSRTLRLPTHMHERLGLIRNAKYRLEEKGITPTIDRIAESLNMSQKKVRNATKADS  382

Query  679  RVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLREREG  500
            +V+SLDR AFPSLNGLPGET HSYIADNH ENNPWHGVDE ALKDEV  LI  TL ERE 
Sbjct  383  KVFSLDRVAFPSLNGLPGETHHSYIADNHEENNPWHGVDEGALKDEVNRLIGITLGERER  442

Query  499  EIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAMLIKQ  326
            EII+LY+G+   E LTWEDIS+RIGLSRERVRQ+GLVALEKLK+AAR+  +EAML+KQ
Sbjct  443  EIIKLYHGL-GKESLTWEDISKRIGLSRERVRQIGLVALEKLKNAARKNGMEAMLLKQ  499



>ref|XP_010910228.1| PREDICTED: RNA polymerase sigma factor sigA isoform X3 [Elaeis 
guineensis]
 ref|XP_010910229.1| PREDICTED: RNA polymerase sigma factor sigA isoform X3 [Elaeis 
guineensis]
 ref|XP_010910230.1| PREDICTED: RNA polymerase sigma factor sigA isoform X3 [Elaeis 
guineensis]
 ref|XP_010910231.1| PREDICTED: RNA polymerase sigma factor sigA isoform X3 [Elaeis 
guineensis]
 ref|XP_010910232.1| PREDICTED: RNA polymerase sigma factor sigA isoform X3 [Elaeis 
guineensis]
 ref|XP_010910234.1| PREDICTED: RNA polymerase sigma factor sigA isoform X3 [Elaeis 
guineensis]
 ref|XP_010910235.1| PREDICTED: RNA polymerase sigma factor sigA isoform X3 [Elaeis 
guineensis]
 ref|XP_010910236.1| PREDICTED: RNA polymerase sigma factor sigA isoform X3 [Elaeis 
guineensis]
Length=508

 Score =   284 bits (726),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 139/178 (78%), Positives = 155/178 (87%), Gaps = 1/178 (1%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAIS  680
            AL +NSR LRLP H+HERLSLIRNAK RLE+KGI PSI+ IAESLNMSQKKVRNATEA+S
Sbjct  332  ALVENSRTLRLPAHLHERLSLIRNAKVRLEDKGIIPSIDNIAESLNMSQKKVRNATEAVS  391

Query  679  RVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLREREG  500
            +V+SLDREAFPSLNGLPGETLHSYIAD +L NNPWHG + W+LKDEV  L+  TL +RE 
Sbjct  392  KVFSLDREAFPSLNGLPGETLHSYIADKNLGNNPWHGFENWSLKDEVDKLLRATLNKRER  451

Query  499  EIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAMLIKQ  326
             IIRLYYGI   EC TWE ISR+ GLSRERVRQVGLVALEKLKHAARRR+LEA+L+KQ
Sbjct  452  AIIRLYYGI-GGECHTWEGISRQFGLSRERVRQVGLVALEKLKHAARRRRLEALLVKQ  508



>ref|XP_008382369.1| PREDICTED: RNA polymerase sigma factor sigA-like [Malus domestica]
Length=514

 Score =   283 bits (723),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 140/178 (79%), Positives = 157/178 (88%), Gaps = 1/178 (1%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAIS  680
            AL +NS+ LRLPTH+HERL LIRNAK RLEEKGITPSI+RIAESLNMS+KKVRNATEAI 
Sbjct  338  ALVENSKTLRLPTHLHERLGLIRNAKIRLEEKGITPSIDRIAESLNMSRKKVRNATEAIG  397

Query  679  RVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLREREG  500
            +V+SLDR+AFPSLNGLPGET HSYIADN LEN PW+GVD  ALKDEV  LI   L +RE 
Sbjct  398  KVFSLDRDAFPSLNGLPGETHHSYIADNRLENVPWNGVDALALKDEVNKLINMMLGDRER  457

Query  499  EIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAMLIKQ  326
            EIIRLYYG+ DNECLTWEDIS+RIGLSRERVRQVGLVALEKLKH AR+ ++EA+L+K 
Sbjct  458  EIIRLYYGL-DNECLTWEDISKRIGLSRERVRQVGLVALEKLKHGARKNEMEALLVKH  514



>ref|XP_007131471.1| hypothetical protein PHAVU_011G016400g [Phaseolus vulgaris]
 gb|ESW03465.1| hypothetical protein PHAVU_011G016400g [Phaseolus vulgaris]
Length=504

 Score =   281 bits (719),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 140/177 (79%), Positives = 155/177 (88%), Gaps = 1/177 (1%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAIS  680
            AL +NSR LRLP H+HERLSLIRNAK RLEE+GITP+I+RIA+ LNMSQKKVRNATEAIS
Sbjct  328  ALIENSRTLRLPAHLHERLSLIRNAKLRLEERGITPTIDRIAQHLNMSQKKVRNATEAIS  387

Query  679  RVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLREREG  500
            +  SLDREAFPSLNGL G+T HSYIADN +EN PW GVDEWALKDEV  LI  TL+ERE 
Sbjct  388  KTISLDREAFPSLNGLRGDTHHSYIADNRVENIPWEGVDEWALKDEVNRLINVTLKERER  447

Query  499  EIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAMLIK  329
            EIIRLYYG+   ECLTWEDIS+R+GLSRERVRQVGLVALEKLKH AR R+LEAML+K
Sbjct  448  EIIRLYYGL-GKECLTWEDISKRMGLSRERVRQVGLVALEKLKHGARNRELEAMLLK  503



>ref|XP_010910226.1| PREDICTED: RNA polymerase sigma factor sigA isoform X1 [Elaeis 
guineensis]
Length=593

 Score =   283 bits (725),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 139/178 (78%), Positives = 155/178 (87%), Gaps = 1/178 (1%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAIS  680
            AL +NSR LRLP H+HERLSLIRNAK RLE+KGI PSI+ IAESLNMSQKKVRNATEA+S
Sbjct  417  ALVENSRTLRLPAHLHERLSLIRNAKVRLEDKGIIPSIDNIAESLNMSQKKVRNATEAVS  476

Query  679  RVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLREREG  500
            +V+SLDREAFPSLNGLPGETLHSYIAD +L NNPWHG + W+LKDEV  L+  TL +RE 
Sbjct  477  KVFSLDREAFPSLNGLPGETLHSYIADKNLGNNPWHGFENWSLKDEVDKLLRATLNKRER  536

Query  499  EIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAMLIKQ  326
             IIRLYYGI   EC TWE ISR+ GLSRERVRQVGLVALEKLKHAARRR+LEA+L+KQ
Sbjct  537  AIIRLYYGI-GGECHTWEGISRQFGLSRERVRQVGLVALEKLKHAARRRRLEALLVKQ  593



>gb|KHG22597.1| RNA polymerase sigma factor rpoD [Gossypium arboreum]
Length=499

 Score =   280 bits (717),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 141/178 (79%), Positives = 157/178 (88%), Gaps = 1/178 (1%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAIS  680
            AL DNSR LRLPTH+HERL LIRNAK RL+EKGITP+I+RIAESLNMSQKKVRNATEA S
Sbjct  323  ALVDNSRTLRLPTHMHERLGLIRNAKYRLKEKGITPTIDRIAESLNMSQKKVRNATEADS  382

Query  679  RVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLREREG  500
            +V+SLDR AFPSLNGLPGET HSYIAD+H ENNPWHGVDE ALKDEV  LI  TL ERE 
Sbjct  383  KVFSLDRVAFPSLNGLPGETHHSYIADHHEENNPWHGVDEGALKDEVNRLIGITLGERER  442

Query  499  EIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAMLIKQ  326
            EII+LY+G+   E LTWEDIS+RIGLSRERVRQ+GLVALEKLK+AAR+  +EAML+KQ
Sbjct  443  EIIKLYHGL-GKESLTWEDISKRIGLSRERVRQIGLVALEKLKNAARKDGMEAMLLKQ  499



>ref|XP_003534364.1| PREDICTED: RNA polymerase sigma factor sigA-like isoform X1 [Glycine 
max]
 ref|XP_006587676.1| PREDICTED: RNA polymerase sigma factor sigA-like isoform X2 [Glycine 
max]
Length=503

 Score =   280 bits (717),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 140/177 (79%), Positives = 157/177 (89%), Gaps = 1/177 (1%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAIS  680
            AL +NSR LRLP H+HERLSLIRNAK RLEE+GITP+I+RIA+ LNMSQKKVRNATEAIS
Sbjct  327  ALVENSRTLRLPAHLHERLSLIRNAKFRLEERGITPTIDRIAKYLNMSQKKVRNATEAIS  386

Query  679  RVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLREREG  500
            +  SLDREAFPSLNG+ GET HSYIAD+ +EN PW+GVDEWALKDEV  LI  TL ERE 
Sbjct  387  KTISLDREAFPSLNGIQGETHHSYIADDRVENIPWNGVDEWALKDEVNKLINVTLVERER  446

Query  499  EIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAMLIK  329
            EIIRLYYG+ D E LTWEDIS+RIGLSRERVRQVGLVALEKLKHAAR+R++EAML+K
Sbjct  447  EIIRLYYGL-DKEGLTWEDISKRIGLSRERVRQVGLVALEKLKHAARKRQMEAMLLK  502



>ref|XP_009397520.1| PREDICTED: RNA polymerase sigma factor sigA-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009397527.1| PREDICTED: RNA polymerase sigma factor sigA-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009397536.1| PREDICTED: RNA polymerase sigma factor sigA-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009397544.1| PREDICTED: RNA polymerase sigma factor sigA-like [Musa acuminata 
subsp. malaccensis]
Length=498

 Score =   280 bits (717),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 135/178 (76%), Positives = 159/178 (89%), Gaps = 1/178 (1%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAIS  680
            AL  NSR LRLPTH+HERLS IR+AK RLEEKGITPSI+++AE+LNMSQKK+R+AT+A S
Sbjct  322  ALFKNSRTLRLPTHLHERLSSIRHAKIRLEEKGITPSIDKLAETLNMSQKKIRDATQAAS  381

Query  679  RVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLREREG  500
            +V SLDREAFPSLNGLPGETLHSYIAD ++ENNPW+G +EW+LKDEVK L+ TTL +RE 
Sbjct  382  KVLSLDREAFPSLNGLPGETLHSYIADRNVENNPWYGFEEWSLKDEVKKLLYTTLSKRER  441

Query  499  EIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAMLIKQ  326
            EIIRLY+GI D+EC TWEDI +R GLSRERVRQVGL+A+EKLKH ARRRKLEA+L+K 
Sbjct  442  EIIRLYHGI-DSECHTWEDIGKRFGLSRERVRQVGLIAMEKLKHVARRRKLEAVLVKH  498



>ref|XP_004499501.1| PREDICTED: RNA polymerase sigma factor sigA-like isoform X3 [Cicer 
arietinum]
Length=513

 Score =   279 bits (713),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 136/178 (76%), Positives = 159/178 (89%), Gaps = 1/178 (1%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAIS  680
            AL +NSR LRLPTH+HERLSLIRNA+ RLEE+GITP+I+RIA+ LNMSQKKVRNATEAI+
Sbjct  337  ALVENSRTLRLPTHLHERLSLIRNAEYRLEERGITPTIDRIAKCLNMSQKKVRNATEAIN  396

Query  679  RVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLREREG  500
            +V+S+DREAFPSLNGLPG+T H++IAD   EN PW+GVDEWALK+EV  LI  TL ERE 
Sbjct  397  KVFSIDREAFPSLNGLPGDTHHNFIADKRHENIPWNGVDEWALKEEVNRLINVTLVERER  456

Query  499  EIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAMLIKQ  326
            EI+RLYYG+ D ECLTWEDIS+RIGLSRERVRQVGLVALEKLKH AR+R++EAML+K 
Sbjct  457  EIVRLYYGL-DKECLTWEDISKRIGLSRERVRQVGLVALEKLKHEARKREMEAMLLKH  513



>gb|KEH16477.1| RNA polymerase sigma factor [Medicago truncatula]
Length=504

 Score =   278 bits (712),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 137/177 (77%), Positives = 158/177 (89%), Gaps = 1/177 (1%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAIS  680
            AL +NSR LRLP H+HERLSLIRNA+ +LEE+GITP+I+RIA+SLNMSQ+KVRNATEA S
Sbjct  328  ALVENSRTLRLPAHLHERLSLIRNAEYKLEERGITPTIDRIAKSLNMSQRKVRNATEATS  387

Query  679  RVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLREREG  500
            +V+SLDREAFPSLNGLPG+T HS+IAD   EN PW+ VDEWALK+EV  LI  TL ERE 
Sbjct  388  KVFSLDREAFPSLNGLPGDTHHSFIADKQNENIPWNVVDEWALKEEVNRLINLTLVERER  447

Query  499  EIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAMLIK  329
            EIIRLYYG+ D ECLTWEDIS+RIGLSRERVRQVGLVALEKLKHAAR+R++EAML+K
Sbjct  448  EIIRLYYGL-DKECLTWEDISKRIGLSRERVRQVGLVALEKLKHAARKREMEAMLLK  503



>ref|XP_004499499.1| PREDICTED: RNA polymerase sigma factor sigA-like isoform X1 [Cicer 
arietinum]
 ref|XP_004499500.1| PREDICTED: RNA polymerase sigma factor sigA-like isoform X2 [Cicer 
arietinum]
Length=514

 Score =   278 bits (712),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 136/178 (76%), Positives = 159/178 (89%), Gaps = 1/178 (1%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAIS  680
            AL +NSR LRLPTH+HERLSLIRNA+ RLEE+GITP+I+RIA+ LNMSQKKVRNATEAI+
Sbjct  338  ALVENSRTLRLPTHLHERLSLIRNAEYRLEERGITPTIDRIAKCLNMSQKKVRNATEAIN  397

Query  679  RVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLREREG  500
            +V+S+DREAFPSLNGLPG+T H++IAD   EN PW+GVDEWALK+EV  LI  TL ERE 
Sbjct  398  KVFSIDREAFPSLNGLPGDTHHNFIADKRHENIPWNGVDEWALKEEVNRLINVTLVERER  457

Query  499  EIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAMLIKQ  326
            EI+RLYYG+ D ECLTWEDIS+RIGLSRERVRQVGLVALEKLKH AR+R++EAML+K 
Sbjct  458  EIVRLYYGL-DKECLTWEDISKRIGLSRERVRQVGLVALEKLKHEARKREMEAMLLKH  514



>ref|XP_008808794.1| PREDICTED: RNA polymerase sigma factor sigA [Phoenix dactylifera]
 ref|XP_008808795.1| PREDICTED: RNA polymerase sigma factor sigA [Phoenix dactylifera]
 ref|XP_008808796.1| PREDICTED: RNA polymerase sigma factor sigA [Phoenix dactylifera]
 ref|XP_008808797.1| PREDICTED: RNA polymerase sigma factor sigA [Phoenix dactylifera]
Length=508

 Score =   278 bits (711),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 136/178 (76%), Positives = 156/178 (88%), Gaps = 1/178 (1%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAIS  680
            AL +NSR LRLP+H+HERLSLIRNAK RLE+KG+ PSI+ IAESLNMS KKV+NATEA+S
Sbjct  332  ALVENSRTLRLPSHLHERLSLIRNAKIRLEDKGVMPSIDNIAESLNMSPKKVKNATEAVS  391

Query  679  RVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLREREG  500
            +V+SLDREAFPSLNGLPGETLHSYIAD +L N PWHG ++W+LKDEV  L+  TL +RE 
Sbjct  392  KVFSLDREAFPSLNGLPGETLHSYIADKNLANIPWHGFEDWSLKDEVNKLLHATLSKRER  451

Query  499  EIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAMLIKQ  326
             IIRLYYGI  NE  TWEDISR+ GLSRERVRQVGLVALEKLKHAARRR+LEA+L+KQ
Sbjct  452  AIIRLYYGI-GNETHTWEDISRQFGLSRERVRQVGLVALEKLKHAARRRRLEALLVKQ  508



>gb|EPS67249.1| sigma factor [Genlisea aurea]
Length=517

 Score =   276 bits (707),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 133/177 (75%), Positives = 156/177 (88%), Gaps = 1/177 (1%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAIS  680
            +L +NSR LRLP+H+HERLSLIR AK RL EKG+ P++ +IAE LNMS+KKV NATEA+S
Sbjct  341  SLMENSRTLRLPSHLHERLSLIRTAKARLAEKGVLPTVAKIAECLNMSEKKVINATEAVS  400

Query  679  RVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLREREG  500
             V SLDREAFPSLNGLPGET HSYIADN ++NNPW+G DEWALKDE+  L+ +TLRERE 
Sbjct  401  IVISLDREAFPSLNGLPGETYHSYIADNQMDNNPWYGFDEWALKDEIDRLLSSTLRERER  460

Query  499  EIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAMLIK  329
            EIIRLYYG+ ++E LTWEDISRRIGLSRERVRQVGLVALEKLKHAAR +KL+AML++
Sbjct  461  EIIRLYYGL-EHESLTWEDISRRIGLSRERVRQVGLVALEKLKHAARNKKLDAMLVQ  516



>ref|XP_009348922.1| PREDICTED: RNA polymerase sigma factor sigA-like [Pyrus x bretschneideri]
Length=514

 Score =   276 bits (705),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 139/178 (78%), Positives = 155/178 (87%), Gaps = 1/178 (1%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAIS  680
            AL +NS+ LRLPTH+HERL LIRNAK RLEEKGI PSI+RIAESLNMS+KKVRNATEAIS
Sbjct  338  ALVENSKTLRLPTHLHERLGLIRNAKIRLEEKGIAPSIDRIAESLNMSRKKVRNATEAIS  397

Query  679  RVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLREREG  500
            +V SLDR+AFPSLNGLPGET HSYIADN LEN PW+GVD  ALKDEV  LI   L +RE 
Sbjct  398  KVLSLDRDAFPSLNGLPGETHHSYIADNRLENVPWNGVDALALKDEVNKLINMMLGDRER  457

Query  499  EIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAMLIKQ  326
            EIIRLYYG+ DNE LTWEDIS+RIGLSRERVRQVGLVALEKLKH AR+ ++EA+L+K 
Sbjct  458  EIIRLYYGL-DNEGLTWEDISKRIGLSRERVRQVGLVALEKLKHGARKNEMEALLVKH  514



>ref|XP_009382828.1| PREDICTED: RNA polymerase sigma factor sigA-like [Musa acuminata 
subsp. malaccensis]
Length=491

 Score =   274 bits (700),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 134/177 (76%), Positives = 152/177 (86%), Gaps = 1/177 (1%)
 Frame = -3

Query  856  LADNSRMLRLPTHVHERLSLIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAISR  677
            L  NSR LRLP H+HERL  IR+AK RLEEKGI PSI+++AESLNMSQKKVRNAT+A S 
Sbjct  316  LFKNSRTLRLPAHLHERLGSIRHAKIRLEEKGIAPSIDKLAESLNMSQKKVRNATQAASI  375

Query  676  VYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLREREGE  497
            V S+DREAFPSLNGLPG+TLHSYIAD +LENNPWHG +EW+LKDEV  L+  TL  RE +
Sbjct  376  VLSIDREAFPSLNGLPGKTLHSYIADRNLENNPWHGFEEWSLKDEVDKLLYMTLSNRERD  435

Query  496  IIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAMLIKQ  326
            II LY+GI DNEC TWEDI ++ GLSRERVRQVGLVA+EKLKHAARRRKLEAML+KQ
Sbjct  436  IISLYHGI-DNECHTWEDIGKKFGLSRERVRQVGLVAMEKLKHAARRRKLEAMLVKQ  491



>ref|XP_004499502.1| PREDICTED: RNA polymerase sigma factor sigA-like isoform X1 [Cicer 
arietinum]
 ref|XP_004499503.1| PREDICTED: RNA polymerase sigma factor sigA-like isoform X2 [Cicer 
arietinum]
Length=513

 Score =   273 bits (697),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 132/178 (74%), Positives = 156/178 (88%), Gaps = 1/178 (1%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAIS  680
            AL +NSR LRLPTH+H+RLSLIRNA+ RLEE+GITP+I+RIA+ LNMS KKVRNATEAI+
Sbjct  337  ALVENSRTLRLPTHLHDRLSLIRNAEYRLEERGITPTIDRIAKCLNMSPKKVRNATEAIN  396

Query  679  RVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLREREG  500
            +V+S+DREAFPSLNGLPG+T H++IAD   EN PW+GVDEW LK+EV  LI  TL ERE 
Sbjct  397  KVFSIDREAFPSLNGLPGDTHHNFIADKRFENIPWNGVDEWILKEEVNRLINVTLVERER  456

Query  499  EIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAMLIKQ  326
            EI+RLYYG+ D  CLTWEDIS+RIGLSRERVRQVGLVALEKLKH AR+R++EAML+K 
Sbjct  457  EIVRLYYGL-DKACLTWEDISKRIGLSRERVRQVGLVALEKLKHEARKREMEAMLLKH  513



>ref|XP_010662047.1| PREDICTED: RNA polymerase sigma factor sigA isoform X3 [Vitis 
vinifera]
Length=524

 Score =   251 bits (640),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 122/144 (85%), Positives = 132/144 (92%), Gaps = 1/144 (1%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAIS  680
            AL +NSR LRLP+H+HERLSLIRNAK RLEEKGITPSI+RIAE LNMSQKKVRNATEAIS
Sbjct  337  ALVENSRTLRLPSHLHERLSLIRNAKIRLEEKGITPSIDRIAECLNMSQKKVRNATEAIS  396

Query  679  RVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLREREG  500
            +V+SLDREAFPSLNGLPGETLHSYIAD  LENNPWHGVDEWALKDEV  LI TTL ERE 
Sbjct  397  KVFSLDREAFPSLNGLPGETLHSYIADVRLENNPWHGVDEWALKDEVNKLINTTLGERER  456

Query  499  EIIRLYYGIVDNECLTWEDISRRI  428
            +IIRLYYG+ DNECLTWEDIS+R+
Sbjct  457  DIIRLYYGL-DNECLTWEDISKRV  479



>gb|EAZ05701.1| hypothetical protein OsI_27933 [Oryza sativa Indica Group]
Length=372

 Score =   246 bits (628),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 118/175 (67%), Positives = 147/175 (84%), Gaps = 1/175 (1%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAIS  680
            ALA+NS+  RLPT++HERL  IR AK  LE++GI P+IE IA SLN+S+KKV NATEA++
Sbjct  196  ALAENSKTFRLPTYLHERLIAIRGAKYELEDQGIAPTIENIAGSLNISEKKVLNATEAVN  255

Query  679  RVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLREREG  500
            +V SLD++AFPSLNGLPGETLHSYI D ++ N+PWHG +EW LK+EV  L+ +TL ERE 
Sbjct  256  KVLSLDQQAFPSLNGLPGETLHSYIEDQNVANDPWHGFEEWYLKEEVNKLLNSTLNERER  315

Query  499  EIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAML  335
            +IIRLY+GI   +C TWEDISR+ GLSRERVRQVGL+A+EKLKHAARR+ LEA+L
Sbjct  316  DIIRLYHGI-GKQCHTWEDISRQFGLSRERVRQVGLIAMEKLKHAARRKNLEALL  369



>dbj|BAC99906.1| putative plastid RNA polymerase sigma factor [Oryza sativa Japonica 
Group]
Length=342

 Score =   245 bits (625),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 118/175 (67%), Positives = 147/175 (84%), Gaps = 1/175 (1%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAIS  680
            ALA+NS+  RLPT++HERL  IR AK  LE++GI P+IE IA SLN+S+KKV NATEA++
Sbjct  166  ALAENSKTFRLPTYLHERLIAIRGAKYELEDQGIAPTIENIAGSLNISEKKVLNATEAVN  225

Query  679  RVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLREREG  500
            +V SLD++AFPSLNGLPGETLHSYI D ++ N+PWHG +EW LK+EV  L+ +TL ERE 
Sbjct  226  KVLSLDQQAFPSLNGLPGETLHSYIEDQNVANDPWHGFEEWYLKEEVNKLLNSTLNERER  285

Query  499  EIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAML  335
            +IIRLY+GI   +C TWEDISR+ GLSRERVRQVGL+A+EKLKHAARR+ LEA+L
Sbjct  286  DIIRLYHGI-GKQCHTWEDISRQFGLSRERVRQVGLIAMEKLKHAARRKNLEALL  339



>dbj|BAC99905.1| putative plastid RNA polymerase sigma factor [Oryza sativa Japonica 
Group]
Length=388

 Score =   246 bits (628),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 118/175 (67%), Positives = 147/175 (84%), Gaps = 1/175 (1%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAIS  680
            ALA+NS+  RLPT++HERL  IR AK  LE++GI P+IE IA SLN+S+KKV NATEA++
Sbjct  212  ALAENSKTFRLPTYLHERLIAIRGAKYELEDQGIAPTIENIAGSLNISEKKVLNATEAVN  271

Query  679  RVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLREREG  500
            +V SLD++AFPSLNGLPGETLHSYI D ++ N+PWHG +EW LK+EV  L+ +TL ERE 
Sbjct  272  KVLSLDQQAFPSLNGLPGETLHSYIEDQNVANDPWHGFEEWYLKEEVNKLLNSTLNERER  331

Query  499  EIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAML  335
            +IIRLY+GI   +C TWEDISR+ GLSRERVRQVGL+A+EKLKHAARR+ LEA+L
Sbjct  332  DIIRLYHGI-GKQCHTWEDISRQFGLSRERVRQVGLIAMEKLKHAARRKNLEALL  385



>gb|EAZ41616.1| hypothetical protein OsJ_26150 [Oryza sativa Japonica Group]
Length=420

 Score =   246 bits (628),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 118/175 (67%), Positives = 147/175 (84%), Gaps = 1/175 (1%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAIS  680
            ALA+NS+  RLPT++HERL  IR AK  LE++GI P+IE IA SLN+S+KKV NATEA++
Sbjct  244  ALAENSKTFRLPTYLHERLIAIRGAKYELEDQGIAPTIENIAGSLNISEKKVLNATEAVN  303

Query  679  RVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLREREG  500
            +V SLD++AFPSLNGLPGETLHSYI D ++ N+PWHG +EW LK+EV  L+ +TL ERE 
Sbjct  304  KVLSLDQQAFPSLNGLPGETLHSYIEDQNVANDPWHGFEEWYLKEEVNKLLNSTLNERER  363

Query  499  EIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAML  335
            +IIRLY+GI   +C TWEDISR+ GLSRERVRQVGL+A+EKLKHAARR+ LEA+L
Sbjct  364  DIIRLYHGI-GKQCHTWEDISRQFGLSRERVRQVGLIAMEKLKHAARRKNLEALL  417



>ref|XP_003573435.1| PREDICTED: RNA polymerase sigma factor sigA [Brachypodium distachyon]
Length=531

 Score =   248 bits (633),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 116/175 (66%), Positives = 149/175 (85%), Gaps = 1/175 (1%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAIS  680
            ALADNS+  RLPT++HERL  IR AK  LE++GI+P+ E IAESLN+S+KKV NAT+A++
Sbjct  355  ALADNSKTFRLPTYLHERLIAIRGAKYALEDQGISPTTENIAESLNISEKKVHNATDAVN  414

Query  679  RVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLREREG  500
            +V SLDR+AFPSLNGLPG+TLHSYI D ++ N+PWHG ++W LK+EV  L+ +TL ERE 
Sbjct  415  KVLSLDRQAFPSLNGLPGDTLHSYIEDQNVANDPWHGFEQWYLKEEVNKLLNSTLTERER  474

Query  499  EIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAML  335
            +IIRLY+GI   +C TWEDISR+ GLSRERVRQVGL+A++KLKHAARR+KL+A+L
Sbjct  475  DIIRLYHGI-GKQCHTWEDISRQFGLSRERVRQVGLIAMQKLKHAARRKKLDALL  528



>gb|AAC78467.1| RNA polymerase sigma factor 1 [Zea mays]
Length=398

 Score =   243 bits (621),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 119/175 (68%), Positives = 146/175 (83%), Gaps = 1/175 (1%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAIS  680
            ALADNSR  RLPT++HERL  IR AK  LE++GI P++E IAESLN+S+KKV NATEA+ 
Sbjct  222  ALADNSRSFRLPTYLHERLVAIRGAKYALEDQGIAPTVENIAESLNISEKKVHNATEAVH  281

Query  679  RVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLREREG  500
            +V SLD++AFPSLNGLPG+TLHSYI D ++ N+PWHG +E  LK+EV +LI +TL ERE 
Sbjct  282  KVISLDQQAFPSLNGLPGDTLHSYIEDQNVANDPWHGFEERYLKEEVNSLINSTLNERER  341

Query  499  EIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAML  335
            +IIRLY+GI   +C TWEDISR+ GLSRERVRQVGLVA+EKLKHAARR  L+A+L
Sbjct  342  DIIRLYHGI-GKQCHTWEDISRQFGLSRERVRQVGLVAMEKLKHAARREHLDALL  395



>ref|XP_008678254.1| PREDICTED: RNA polymerase sigma factor sigA isoform X2 [Zea mays]
 gb|AFW61126.1| RNA polymerase sigma factor 2 [Zea mays]
Length=504

 Score =   246 bits (629),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 119/175 (68%), Positives = 147/175 (84%), Gaps = 1/175 (1%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAIS  680
            ALADNS+  RLPT++HERL  IR AK  LE++GI P+IE IAESLN+S+KKV NATEA++
Sbjct  328  ALADNSKTFRLPTYLHERLIAIRGAKYALEDQGIAPTIENIAESLNISEKKVHNATEAVN  387

Query  679  RVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLREREG  500
            +V SLD++AFPSLNGLPG+TLHSYI D ++ N+PWHG +E  LK+EV NLI + L ERE 
Sbjct  388  KVLSLDQQAFPSLNGLPGDTLHSYIEDQNVANDPWHGFEEMYLKEEVNNLINSNLNERER  447

Query  499  EIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAML  335
            +IIRLY+GI   +C TWEDISR+ GLSRERVRQVGLVA+EKLKHAARR+ L+A+L
Sbjct  448  DIIRLYHGI-GKQCHTWEDISRQFGLSRERVRQVGLVAMEKLKHAARRKHLDALL  501



>ref|XP_002443917.1| hypothetical protein SORBIDRAFT_07g004340 [Sorghum bicolor]
 gb|EES13412.1| hypothetical protein SORBIDRAFT_07g004340 [Sorghum bicolor]
Length=500

 Score =   246 bits (629),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 119/175 (68%), Positives = 148/175 (85%), Gaps = 1/175 (1%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAIS  680
            ALADNS+  RLPT++HERL  IR AK  LE++GI P++E IAESLN+S+KKV NATEA++
Sbjct  324  ALADNSKAFRLPTYLHERLIAIRGAKYALEDQGIAPTVENIAESLNISEKKVHNATEAVN  383

Query  679  RVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLREREG  500
            +V SLD++AFPSLNGLPG+TLHSYI D ++ N+PWHG +E  LK+EV NLI +TL ERE 
Sbjct  384  KVLSLDQQAFPSLNGLPGDTLHSYIEDQNVANDPWHGFEERYLKEEVNNLINSTLNERER  443

Query  499  EIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAML  335
            +IIRLY+GI   +C TWEDISR+ GLSRERVRQVGLVA+EKLKHAARR+ L+A+L
Sbjct  444  DIIRLYHGI-GKQCHTWEDISRQFGLSRERVRQVGLVAMEKLKHAARRKHLDALL  497



>dbj|BAA24364.1| plastid RNA polymerase sigma factor [Oryza sativa Japonica Group]
Length=519

 Score =   246 bits (629),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 118/175 (67%), Positives = 147/175 (84%), Gaps = 1/175 (1%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAIS  680
            ALA+NS+  RLPT++HERL  IR AK  LE++GI P+IE IA SLN+S+KKV NATEA++
Sbjct  343  ALAENSKTFRLPTYLHERLIAIRGAKYELEDQGIAPTIENIAGSLNISEKKVLNATEAVN  402

Query  679  RVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLREREG  500
            +V SLD++AFPSLNGLPGETLHSYI D ++ N+PWHG +EW LK+EV  L+ +TL ERE 
Sbjct  403  KVLSLDQQAFPSLNGLPGETLHSYIEDQNVANDPWHGFEEWYLKEEVNKLLNSTLNERER  462

Query  499  EIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAML  335
            +IIRLY+GI   +C TWEDISR+ GLSRERVRQVGL+A+EKLKHAARR+ LEA+L
Sbjct  463  DIIRLYHGI-GKQCHTWEDISRQFGLSRERVRQVGLIAMEKLKHAARRKNLEALL  516



>ref|NP_001061065.2| Os08g0163400 [Oryza sativa Japonica Group]
 dbj|BAF22979.2| Os08g0163400 [Oryza sativa Japonica Group]
Length=520

 Score =   246 bits (628),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 118/175 (67%), Positives = 147/175 (84%), Gaps = 1/175 (1%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAIS  680
            ALA+NS+  RLPT++HERL  IR AK  LE++GI P+IE IA SLN+S+KKV NATEA++
Sbjct  344  ALAENSKTFRLPTYLHERLIAIRGAKYELEDQGIAPTIENIAGSLNISEKKVLNATEAVN  403

Query  679  RVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLREREG  500
            +V SLD++AFPSLNGLPGETLHSYI D ++ N+PWHG +EW LK+EV  L+ +TL ERE 
Sbjct  404  KVLSLDQQAFPSLNGLPGETLHSYIEDQNVANDPWHGFEEWYLKEEVNKLLNSTLNERER  463

Query  499  EIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAML  335
            +IIRLY+GI   +C TWEDISR+ GLSRERVRQVGL+A+EKLKHAARR+ LEA+L
Sbjct  464  DIIRLYHGI-GKQCHTWEDISRQFGLSRERVRQVGLIAMEKLKHAARRKNLEALL  517



>dbj|BAJ99592.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=506

 Score =   245 bits (626),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 115/175 (66%), Positives = 146/175 (83%), Gaps = 1/175 (1%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAIS  680
            ALADNSR  RLPT++HERL  IR AK  LE++G++P+ + IAE LN+S+KKV NATEA++
Sbjct  330  ALADNSRTFRLPTYMHERLIAIRAAKYALEDQGVSPTTQNIAELLNISEKKVHNATEAVN  389

Query  679  RVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLREREG  500
            +  SLD++AFPSLNGLPG+TLHSYI D ++ N+PWHG +EW LK+EV NL+ + L ERE 
Sbjct  390  KALSLDQQAFPSLNGLPGDTLHSYIEDQNVANDPWHGFEEWYLKEEVNNLLISNLTERER  449

Query  499  EIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAML  335
             IIRLY+GI   +C TWEDISR+ GLSRERVRQVGL+A+EKLKHAARR+KL+A+L
Sbjct  450  HIIRLYHGI-GKQCHTWEDISRQFGLSRERVRQVGLIAMEKLKHAARRKKLDALL  503



>ref|XP_008662828.1| PREDICTED: RNA polymerase sigma factor sigA [Zea mays]
 gb|ACF83862.1| unknown [Zea mays]
 gb|ACN26422.1| unknown [Zea mays]
 gb|AFW57214.1| RNA polymerase sigma factor 1 isoform 1 [Zea mays]
 gb|AFW57215.1| RNA polymerase sigma factor 1 isoform 2 [Zea mays]
 gb|AFW57216.1| RNA polymerase sigma factor 1 isoform 3 [Zea mays]
 gb|AIB05282.1| sigma70-like transcription factor, partial [Zea mays]
Length=496

 Score =   244 bits (623),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 119/175 (68%), Positives = 146/175 (83%), Gaps = 1/175 (1%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAIS  680
            ALADNSR  RLPT++HERL  IR AK  LE++GI P++E IAESLN+S+KKV NATEA+ 
Sbjct  320  ALADNSRSFRLPTYLHERLVAIRGAKYALEDQGIAPTVENIAESLNISEKKVHNATEAVH  379

Query  679  RVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLREREG  500
            +V SLD++AFPSLNGLPG+TLHSYI D ++ N+PWHG +E  LK+EV +LI +TL ERE 
Sbjct  380  KVISLDQQAFPSLNGLPGDTLHSYIEDQNVANDPWHGFEERYLKEEVNSLINSTLNERER  439

Query  499  EIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAML  335
            +IIRLY+GI   +C TWEDISR+ GLSRERVRQVGLVA+EKLKHAARR  L+A+L
Sbjct  440  DIIRLYHGI-GKQCHTWEDISRQFGLSRERVRQVGLVAMEKLKHAARREHLDALL  493



>emb|CAA74653.1| plastid RNA polymerase sigma factor [Sorghum bicolor]
Length=500

 Score =   244 bits (623),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 118/175 (67%), Positives = 147/175 (84%), Gaps = 1/175 (1%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAIS  680
            ALADNS+  RLPT++HERL  IR AK  LE++GI P++E IAESLN+S+KKV NATEA++
Sbjct  324  ALADNSKAFRLPTYLHERLIAIRGAKYALEDQGIAPTVENIAESLNISEKKVHNATEAVN  383

Query  679  RVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLREREG  500
            +V SLD++AFPSLNGLPG+TLHSYI D ++ N+PWHG +E  LK+EV NLI + L ERE 
Sbjct  384  KVLSLDQQAFPSLNGLPGDTLHSYIEDQNVANDPWHGFEERYLKEEVNNLINSNLNERER  443

Query  499  EIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAML  335
            +IIRLY+GI   +C TWEDISR+ GLSRERVRQVGLVA+EKLKHAARR+ L+A+L
Sbjct  444  DIIRLYHGI-GKQCHTWEDISRQFGLSRERVRQVGLVAMEKLKHAARRKHLDALL  497



>dbj|BAJ92935.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=506

 Score =   244 bits (623),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 114/175 (65%), Positives = 146/175 (83%), Gaps = 1/175 (1%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAIS  680
            ALADNS+  RLPT++HERL  IR AK  LE++G++P+ + IAE LN+S+KKV NATEA++
Sbjct  330  ALADNSKTFRLPTYMHERLIAIRAAKYALEDQGVSPTTQNIAELLNISEKKVHNATEAVN  389

Query  679  RVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLREREG  500
            +  SLD++AFPSLNGLPG+TLHSYI D ++ N+PWHG +EW LK+EV NL+ + L ERE 
Sbjct  390  KALSLDQQAFPSLNGLPGDTLHSYIEDQNVANDPWHGFEEWYLKEEVNNLLISNLTERER  449

Query  499  EIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAML  335
             IIRLY+GI   +C TWEDISR+ GLSRERVRQVGL+A+EKLKHAARR+KL+A+L
Sbjct  450  HIIRLYHGI-GKQCHTWEDISRQFGLSRERVRQVGLIAMEKLKHAARRKKLDALL  503



>gb|KDO48031.1| hypothetical protein CISIN_1g010521mg [Citrus sinensis]
Length=485

 Score =   242 bits (618),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 123/177 (69%), Positives = 138/177 (78%), Gaps = 24/177 (14%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAIS  680
            AL +NSR LRLP H+HERL LIRNAK RLEEKG+TPS++RIAE LNMSQKKVRNATE + 
Sbjct  332  ALVENSRTLRLPNHLHERLGLIRNAKLRLEEKGVTPSVDRIAEYLNMSQKKVRNATEVL-  390

Query  679  RVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLREREG  500
                                  +YIADN +ENNPWHGVD+WALKDEV  LI  TL ERE 
Sbjct  391  ----------------------AYIADNRVENNPWHGVDDWALKDEVNKLIIVTLGERER  428

Query  499  EIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAMLIK  329
            EIIRLYYG+ D ECLTWEDIS+RIGLSRERVRQVGLVALEKLKHAAR++K+EAML+K
Sbjct  429  EIIRLYYGL-DKECLTWEDISKRIGLSRERVRQVGLVALEKLKHAARKKKMEAMLVK  484



>gb|AAC78468.1| RNA polymerase sigma factor 2 [Zea mays]
Length=349

 Score =   238 bits (607),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 118/175 (67%), Positives = 143/175 (82%), Gaps = 1/175 (1%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAIS  680
            ALADNS+  RLPT++HERL  IR AK  LE++GI P+IE IAESLN+S KKV NATEA+ 
Sbjct  173  ALADNSKTFRLPTYLHERLLAIRGAKYALEDQGIAPTIENIAESLNISVKKVHNATEAVH  232

Query  679  RVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLREREG  500
            +V SLD++AFPSLNGLPG+TLHSYI D ++ N+PWHG +E  LK+EV NLI + L ERE 
Sbjct  233  KVLSLDQQAFPSLNGLPGDTLHSYIEDQNVANDPWHGFEEMYLKEEVNNLINSNLNERER  292

Query  499  EIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAML  335
            +IIRLY+GI   +C TWEDISR+ GLSRERVRQV LVA+EKLKHAARR+ L A+L
Sbjct  293  DIIRLYHGI-GKQCHTWEDISRQFGLSRERVRQVRLVAMEKLKHAARRKHLNALL  346



>ref|XP_004972754.1| PREDICTED: RNA polymerase sigma factor sigA-like isoform X1 [Setaria 
italica]
 ref|XP_004972755.1| PREDICTED: RNA polymerase sigma factor sigA-like isoform X2 [Setaria 
italica]
Length=499

 Score =   243 bits (619),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 118/175 (67%), Positives = 147/175 (84%), Gaps = 1/175 (1%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAIS  680
            ALA+NS+  RLPT++HERL  IR+AK  LE++GI P+ E IA SLN+S+KKV NATEA++
Sbjct  323  ALAENSKTFRLPTYLHERLIAIRSAKYALEDQGIAPTTENIAGSLNISEKKVNNATEAVN  382

Query  679  RVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLREREG  500
            +V SLD++AFPSLNGLPGETLHSYI D ++ N+PWHG +E  LK+EV NLI +TL ERE 
Sbjct  383  KVLSLDQQAFPSLNGLPGETLHSYIEDENVANDPWHGFEERYLKEEVNNLINSTLNERER  442

Query  499  EIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAML  335
            +IIRLY+GI   +C TWEDISR+ GLSRERVRQVGLVA+EKLKHAARR+ L+A+L
Sbjct  443  DIIRLYHGI-GKQCHTWEDISRQFGLSRERVRQVGLVAMEKLKHAARRKHLDALL  496



>gb|EMT32448.1| RNA polymerase sigma factor rpoD [Aegilops tauschii]
Length=388

 Score =   239 bits (609),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 111/175 (63%), Positives = 146/175 (83%), Gaps = 1/175 (1%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAIS  680
            ALADNS+  RLPT++HERL  IR AK  LE++G++P+ + IA+ LN+S+KKV NATEA++
Sbjct  212  ALADNSKTFRLPTYLHERLIAIRGAKYALEDQGVSPTTQNIAKLLNISEKKVHNATEAVN  271

Query  679  RVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLREREG  500
            +  SLD++AFPSLNGLPG+TLHSYI D ++ N+PWHG +EW LK+EV  L+ + L ERE 
Sbjct  272  KALSLDQQAFPSLNGLPGDTLHSYIEDQNVANDPWHGFEEWYLKEEVNKLLNSNLTERER  331

Query  499  EIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAML  335
            +II+LY+GI   +C TWEDISR+ GLSRERVRQVGL+A+EKLKHAARR+KL+A+L
Sbjct  332  DIIQLYHGI-GKQCHTWEDISRQFGLSRERVRQVGLIAMEKLKHAARRKKLDALL  385



>ref|XP_008678253.1| PREDICTED: RNA polymerase sigma factor sigA isoform X1 [Zea mays]
Length=509

 Score =   240 bits (613),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 119/180 (66%), Positives = 147/180 (82%), Gaps = 6/180 (3%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATE---  689
            ALADNS+  RLPT++HERL  IR AK  LE++GI P+IE IAESLN+S+KKV NATE   
Sbjct  328  ALADNSKTFRLPTYLHERLIAIRGAKYALEDQGIAPTIENIAESLNISEKKVHNATENSR  387

Query  688  --AISRVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTL  515
              A+++V SLD++AFPSLNGLPG+TLHSYI D ++ N+PWHG +E  LK+EV NLI + L
Sbjct  388  LQAVNKVLSLDQQAFPSLNGLPGDTLHSYIEDQNVANDPWHGFEEMYLKEEVNNLINSNL  447

Query  514  REREGEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAML  335
             ERE +IIRLY+GI   +C TWEDISR+ GLSRERVRQVGLVA+EKLKHAARR+ L+A+L
Sbjct  448  NERERDIIRLYHGI-GKQCHTWEDISRQFGLSRERVRQVGLVAMEKLKHAARRKHLDALL  506



>ref|NP_001185314.1| RNA polymerase sigma subunit 1 [Arabidopsis thaliana]
 gb|AEE34299.1| RNA polymerase sigma subunit 1 [Arabidopsis thaliana]
Length=498

 Score =   239 bits (610),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 116/144 (81%), Positives = 127/144 (88%), Gaps = 1/144 (1%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAIS  680
            AL DNSR LRLPTH+HERL LIRNAK RL+EKGITPSI+RIAESLNMSQKKVRNATEA+S
Sbjct  326  ALVDNSRTLRLPTHLHERLGLIRNAKLRLQEKGITPSIDRIAESLNMSQKKVRNATEAVS  385

Query  679  RVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLREREG  500
            +V+SLDR+AFPSLNGLPGET HSYIAD  LENNPWHG D+ ALK+EV  LI  TL ERE 
Sbjct  386  KVFSLDRDAFPSLNGLPGETHHSYIADTRLENNPWHGYDDLALKEEVSKLISATLGEREK  445

Query  499  EIIRLYYGIVDNECLTWEDISRRI  428
            EIIRLYYG+ D ECLTWEDIS+RI
Sbjct  446  EIIRLYYGL-DKECLTWEDISKRI  468



>gb|KCW90982.1| hypothetical protein EUGRSUZ_A02994 [Eucalyptus grandis]
Length=530

 Score =   240 bits (612),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 115/144 (80%), Positives = 127/144 (88%), Gaps = 1/144 (1%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAIS  680
            AL +NSR LRLP H+HERL LIRNAK RLEEKGITPS++RIAE LNMSQKKVRNATEAI 
Sbjct  345  ALVENSRTLRLPAHLHERLGLIRNAKVRLEEKGITPSVDRIAECLNMSQKKVRNATEAIG  404

Query  679  RVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLREREG  500
            +V+SLDR+AFPSLNGLPGET HSYIAD H+ENNPWHGVDEWALKDEV  L+  TL +RE 
Sbjct  405  KVFSLDRDAFPSLNGLPGETHHSYIADIHVENNPWHGVDEWALKDEVNKLMNVTLSKRER  464

Query  499  EIIRLYYGIVDNECLTWEDISRRI  428
            EIIRLYYG+ DNECLTWEDIS+R 
Sbjct  465  EIIRLYYGL-DNECLTWEDISKRF  487



>ref|XP_009361127.1| PREDICTED: RNA polymerase sigma factor sigA isoform X2 [Pyrus 
x bretschneideri]
Length=485

 Score =   238 bits (608),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 117/144 (81%), Positives = 128/144 (89%), Gaps = 1/144 (1%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAIS  680
            AL +NS+ LRLPTH+HERL LIRNAK RLEEKGITPSI+RIAESLNMS+KKVRNATEAIS
Sbjct  338  ALVENSKTLRLPTHLHERLGLIRNAKIRLEEKGITPSIDRIAESLNMSKKKVRNATEAIS  397

Query  679  RVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLREREG  500
            +V+SLDR+AFPSLNGLPGET HSYIADN LEN PW+GVD WALKDEV  LI   L ERE 
Sbjct  398  KVFSLDRDAFPSLNGLPGETHHSYIADNRLENIPWNGVDAWALKDEVNKLINMMLGERER  457

Query  499  EIIRLYYGIVDNECLTWEDISRRI  428
            EIIRLYYG+ DNECLTWEDIS+RI
Sbjct  458  EIIRLYYGL-DNECLTWEDISKRI  480



>gb|EMS46133.1| RNA polymerase sigma factor rpoD [Triticum urartu]
Length=508

 Score =   238 bits (607),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 110/175 (63%), Positives = 146/175 (83%), Gaps = 1/175 (1%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAIS  680
            ALADNS+  RLPT++HERL  IR AK  LE++G++P+ + IA+ LN+S+KKV NAT+A++
Sbjct  332  ALADNSKTFRLPTYLHERLIAIRGAKYALEDQGVSPTTQNIAKLLNISEKKVHNATQAVN  391

Query  679  RVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLREREG  500
            +  SLD++AFPSLNGLPG+TLHSYI D ++ N+PWHG +EW LK+EV  L+ + L ERE 
Sbjct  392  KALSLDQQAFPSLNGLPGDTLHSYIEDQNVANDPWHGFEEWYLKEEVNKLLNSNLTERER  451

Query  499  EIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAML  335
            +II+LY+GI   +C TWEDISR+ GLSRERVRQVGL+A+EKLKHAARR+KL+A+L
Sbjct  452  DIIQLYHGI-GKQCHTWEDISRQFGLSRERVRQVGLIAMEKLKHAARRKKLDALL  505



>ref|XP_008376947.1| PREDICTED: RNA polymerase sigma factor sigA-like isoform X2 [Malus 
domestica]
Length=486

 Score =   237 bits (605),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 117/144 (81%), Positives = 127/144 (88%), Gaps = 1/144 (1%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAIS  680
            AL +NS+ LRLPTH+HERL LIRNAK RLEEKGITPSI+RIAESLNMS+KKVRNATEAIS
Sbjct  339  ALVENSKTLRLPTHLHERLGLIRNAKIRLEEKGITPSIDRIAESLNMSKKKVRNATEAIS  398

Query  679  RVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLREREG  500
            +V+SLDR+AFPSLNGLPGET HSYIADN LEN PW GVD WALKDEV  LI   L ERE 
Sbjct  399  KVFSLDRDAFPSLNGLPGETHHSYIADNRLENIPWTGVDAWALKDEVNKLINMMLGERER  458

Query  499  EIIRLYYGIVDNECLTWEDISRRI  428
            EIIRLYYG+ DNECLTWEDIS+RI
Sbjct  459  EIIRLYYGL-DNECLTWEDISKRI  481



>ref|XP_006659164.1| PREDICTED: LOW QUALITY PROTEIN: RNA polymerase sigma factor sigA-like 
[Oryza brachyantha]
Length=521

 Score =   236 bits (603),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 113/175 (65%), Positives = 147/175 (84%), Gaps = 1/175 (1%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAIS  680
            ALA+NS+  RLPT++HERL  IR+AK  LE++GI P+IE IAESLN+S+KKV NAT A++
Sbjct  345  ALAENSKTFRLPTYLHERLIAIRSAKYALEDQGIAPTIENIAESLNISEKKVHNATGAVN  404

Query  679  RVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLREREG  500
            +V SLD++AFPSLNGLPGETLHSYI D ++ N+PW+G +E  LK+EV  L+ +TL ERE 
Sbjct  405  KVLSLDQQAFPSLNGLPGETLHSYIEDQNVANDPWYGFEEQYLKEEVNKLLNSTLNERER  464

Query  499  EIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAML  335
            +IIRLY+GI   +C TWEDISR+ GLSRERVRQ+GL+A+EKLKHAARR+ ++A+L
Sbjct  465  DIIRLYHGI-GKQCHTWEDISRQFGLSRERVRQLGLIAMEKLKHAARRKNMDALL  518



>emb|CAA10725.1| chloroplast sigma factor [Triticum aestivum]
Length=461

 Score =   233 bits (595),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 109/175 (62%), Positives = 144/175 (82%), Gaps = 1/175 (1%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAIS  680
            ALADNS+  RLPT++HERL  IR AK  LE++G++P+ + IA+ LN+S+KKV NATEA++
Sbjct  285  ALADNSKTFRLPTYLHERLIAIRGAKYALEDQGVSPTTQNIAKLLNISEKKVHNATEAVN  344

Query  679  RVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLREREG  500
            +  SLD++AFPSLNGLPG+TLHSYI D ++ N+PWHG +EW LK+EV  L+ + L ERE 
Sbjct  345  KALSLDQQAFPSLNGLPGDTLHSYIEDQNVANDPWHGFEEWYLKEEVNKLLNSNLTERER  404

Query  499  EIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAML  335
            +II+LY+GI   +C TWEDISR+ GLSRERVRQVGL+A+EKLK  ARR+KL+A+L
Sbjct  405  DIIQLYHGI-GKQCHTWEDISRQFGLSRERVRQVGLIAMEKLKQRARRKKLDALL  458



>ref|XP_010910227.1| PREDICTED: RNA polymerase sigma factor sigA isoform X2 [Elaeis 
guineensis]
Length=550

 Score =   225 bits (573),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 109/138 (79%), Positives = 121/138 (88%), Gaps = 1/138 (1%)
 Frame = -3

Query  739  IAESLNMSQKKVRNATEAISRVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDE  560
            IAESLNMSQKKVRNATEA+S+V+SLDREAFPSLNGLPGETLHSYIAD +L NNPWHG + 
Sbjct  414  IAESLNMSQKKVRNATEAVSKVFSLDREAFPSLNGLPGETLHSYIADKNLGNNPWHGFEN  473

Query  559  WALKDEVKNLICTTLREREGEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALE  380
            W+LKDEV  L+  TL +RE  IIRLYYGI   EC TWE ISR+ GLSRERVRQVGLVALE
Sbjct  474  WSLKDEVDKLLRATLNKRERAIIRLYYGI-GGECHTWEGISRQFGLSRERVRQVGLVALE  532

Query  379  KLKHAARRRKLEAMLIKQ  326
            KLKHAARRR+LEA+L+KQ
Sbjct  533  KLKHAARRRRLEALLVKQ  550



>gb|KHN11742.1| Maltose excess protein 1, chloroplastic [Glycine soja]
Length=608

 Score =   221 bits (563),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 110/143 (77%), Positives = 123/143 (86%), Gaps = 1/143 (1%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAIS  680
            AL +NSR LRLP H+HERLSLIRNAK RLEE+GITP+I+RIA+ LNMSQKKVRNATEAIS
Sbjct  327  ALVENSRTLRLPAHLHERLSLIRNAKFRLEERGITPTIDRIAKYLNMSQKKVRNATEAIS  386

Query  679  RVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLREREG  500
            +  SLDREAFPSLNG+ GET HSYIAD+ +EN PW+GVDEWALKDEV  LI  TL ERE 
Sbjct  387  KTISLDREAFPSLNGIQGETHHSYIADDRVENIPWNGVDEWALKDEVNKLINVTLVERER  446

Query  499  EIIRLYYGIVDNECLTWEDISRR  431
            EIIRLYYG+ D E LTWEDIS+R
Sbjct  447  EIIRLYYGL-DKEGLTWEDISKR  468



>ref|XP_010094612.1| RNA polymerase sigma factor rpoD [Morus notabilis]
 gb|EXB56431.1| RNA polymerase sigma factor rpoD [Morus notabilis]
Length=176

 Score =   202 bits (513),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 117/142 (82%), Gaps = 8/142 (6%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAIS  680
            AL +NSR LRLPTH+HERLS IRNAK RL+EKGITPSI+RIAE LNMS+KKVRNATEAI 
Sbjct  28   ALVENSRTLRLPTHLHERLSTIRNAKNRLQEKGITPSIDRIAECLNMSKKKVRNATEAIR  87

Query  679  RVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALK-------DEVKNLICT  521
            +V SL+REAFPSLNGLPGET HSY+ADN  E+ PWHGVDEW LK       +EV  LI T
Sbjct  88   KVLSLNREAFPSLNGLPGETHHSYVADNCAEDIPWHGVDEWVLKLSKVRVQEEVNKLIST  147

Query  520  TLREREGEIIRLYYGIVDNECL  455
            TL ERE +II+LYYG+ DNECL
Sbjct  148  TLGERERDIIQLYYGL-DNECL  168



>ref|XP_006371210.1| hypothetical protein POPTR_0019s06020g [Populus trichocarpa]
 gb|ERP49007.1| hypothetical protein POPTR_0019s06020g [Populus trichocarpa]
Length=451

 Score =   197 bits (500),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 94/119 (79%), Positives = 105/119 (88%), Gaps = 1/119 (1%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAIS  680
            AL DNSR LRLP H+HERL LIRNAK RLEEKG+TPSI+RIAESLNMSQ+KVRNATEAIS
Sbjct  333  ALVDNSRTLRLPNHLHERLGLIRNAKIRLEEKGVTPSIDRIAESLNMSQRKVRNATEAIS  392

Query  679  RVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLRERE  503
            +V+SLDREAFPSLNGLPGET HSYIADN  ENNPWHGVDEWALK ++   IC  +RE++
Sbjct  393  KVFSLDREAFPSLNGLPGETHHSYIADNRPENNPWHGVDEWALKVKITR-ICVFIREKK  450



>gb|KJB44352.1| hypothetical protein B456_007G247500 [Gossypium raimondii]
 gb|KJB44353.1| hypothetical protein B456_007G247500 [Gossypium raimondii]
Length=453

 Score =   194 bits (492),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 93/117 (79%), Positives = 105/117 (90%), Gaps = 3/117 (3%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAIS  680
            AL +NSR LRLPT++HERL LIRNAK RLEEKGITP+I+RIAESLNMSQKKVRNATEA+S
Sbjct  332  ALVENSRTLRLPTYLHERLGLIRNAKYRLEEKGITPTIDRIAESLNMSQKKVRNATEAVS  391

Query  679  RVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLRE  509
            +V+SLDR+AFPSLNGLPGET HSYIADNH+ENNPWHGVDEWALK    N++ T  RE
Sbjct  392  KVFSLDRDAFPSLNGLPGETHHSYIADNHVENNPWHGVDEWALK---VNILDTVRRE  445



>ref|XP_007029767.1| Sigma factor A isoform 2 [Theobroma cacao]
 gb|EOY10269.1| Sigma factor A isoform 2 [Theobroma cacao]
Length=450

 Score =   192 bits (488),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 89/104 (86%), Positives = 98/104 (94%), Gaps = 0/104 (0%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAIS  680
            AL +NSR LRLPTH+HERL LIRNAK RLEEKGITP+I+RIAESLNMSQKKVRNATEA+S
Sbjct  332  ALVENSRTLRLPTHLHERLGLIRNAKIRLEEKGITPTIDRIAESLNMSQKKVRNATEAVS  391

Query  679  RVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALK  548
            +V+SLDR+AFPSLNGLPGET HSYIADNH+EN PWHGVDEWALK
Sbjct  392  KVFSLDRDAFPSLNGLPGETHHSYIADNHVENIPWHGVDEWALK  435



>gb|KDO48035.1| hypothetical protein CISIN_1g010521mg [Citrus sinensis]
Length=443

 Score =   187 bits (476),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 89/112 (79%), Positives = 99/112 (88%), Gaps = 2/112 (2%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAIS  680
            AL +NSR LRLP H+HERL LIRNAK RLEEKG+TPS++RIAE LNMSQKKVRNATEAI 
Sbjct  332  ALVENSRTLRLPNHLHERLGLIRNAKLRLEEKGVTPSVDRIAEYLNMSQKKVRNATEAIG  391

Query  679  RVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLIC  524
            +V+SLDREAFPSLNGLPGET HSYIADN +ENNPWHGVD+WALK  VK + C
Sbjct  392  KVFSLDREAFPSLNGLPGETHHSYIADNRVENNPWHGVDDWALK--VKRMHC  441



>gb|KCW90985.1| hypothetical protein EUGRSUZ_A02994 [Eucalyptus grandis]
Length=492

 Score =   188 bits (478),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 88/109 (81%), Positives = 99/109 (91%), Gaps = 0/109 (0%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAIS  680
            AL +NSR LRLP H+HERL LIRNAK RLEEKGITPS++RIAE LNMSQKKVRNATEAI 
Sbjct  345  ALVENSRTLRLPAHLHERLGLIRNAKVRLEEKGITPSVDRIAECLNMSQKKVRNATEAIG  404

Query  679  RVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKN  533
            +V+SLDR+AFPSLNGLPGET HSYIAD H+ENNPWHGVDEWALK E+++
Sbjct  405  KVFSLDRDAFPSLNGLPGETHHSYIADIHVENNPWHGVDEWALKVELQS  453



>gb|KDO48036.1| hypothetical protein CISIN_1g010521mg [Citrus sinensis]
Length=419

 Score =   143 bits (361),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 69/85 (81%), Positives = 76/85 (89%), Gaps = 0/85 (0%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAIS  680
            AL +NSR LRLP H+HERL LIRNAK RLEEKG+TPS++RIAE LNMSQKKVRNATEAI 
Sbjct  332  ALVENSRTLRLPNHLHERLGLIRNAKLRLEEKGVTPSVDRIAEYLNMSQKKVRNATEAIG  391

Query  679  RVYSLDREAFPSLNGLPGETLHSYI  605
            +V+SLDREAFPSLNGLPGET HS I
Sbjct  392  KVFSLDREAFPSLNGLPGETHHSVI  416



>gb|KDO48037.1| hypothetical protein CISIN_1g010521mg [Citrus sinensis]
Length=417

 Score =   140 bits (353),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 67/82 (82%), Positives = 74/82 (90%), Gaps = 0/82 (0%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAIS  680
            AL +NSR LRLP H+HERL LIRNAK RLEEKG+TPS++RIAE LNMSQKKVRNATEAI 
Sbjct  332  ALVENSRTLRLPNHLHERLGLIRNAKLRLEEKGVTPSVDRIAEYLNMSQKKVRNATEAIG  391

Query  679  RVYSLDREAFPSLNGLPGETLH  614
            +V+SLDREAFPSLNGLPGET H
Sbjct  392  KVFSLDREAFPSLNGLPGETHH  413



>ref|XP_001770550.1| plastid sigma factor SIG1 [Physcomitrella patens]
 dbj|BAB62006.1| PpSIG1 [Physcomitrella patens]
 dbj|BAB62007.1| PpSIG1 [Physcomitrella patens]
 gb|EDQ64719.1| plastid sigma factor SIG1 [Physcomitrella patens]
Length=677

 Score =   139 bits (349),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 74/178 (42%), Positives = 112/178 (63%), Gaps = 3/178 (2%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAIS  680
            A+AD+SR +RLP HVH+ L  IR AK  L  +G T S++ I+E+ N++  K++N  +   
Sbjct  496  AIADHSRTVRLPVHVHDTLGRIRKAKSTLLSEGCTASVQEISEATNLTGTKIKNTLQVTK  555

Query  679  RVYSLDRE-AFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLRERE  503
            ++ SLD+E    +L    GETLHS +AD  +EN PW  V+   +KD+V  L+ + L  RE
Sbjct  556  KLVSLDKEIGRNTLQSGDGETLHSLVADRDIENQPWTIVERMLMKDDVDKLLTSQLGPRE  615

Query  502  GEIIRLYYGIV--DNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAML  335
             +I+RL+YG+   D   ++ E IS R G+SRERVRQ+   A+ KL+  +R + L+  L
Sbjct  616  RDIVRLHYGVGREDGSVMSLESISYRYGVSRERVRQLETAAMRKLQIKSREQGLDRYL  673



>gb|KCW90984.1| hypothetical protein EUGRSUZ_A02994 [Eucalyptus grandis]
Length=465

 Score =   125 bits (315),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 66/109 (61%), Positives = 74/109 (68%), Gaps = 27/109 (25%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAIS  680
            AL +NSR LRLP H+HERL LIRNAK RLEEKGITPS++RIAE LNMSQKKVRNATEAI 
Sbjct  345  ALVENSRTLRLPAHLHERLGLIRNAKVRLEEKGITPSVDRIAECLNMSQKKVRNATEAI-  403

Query  679  RVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKN  533
                                      D H+ENNPWHGVDEWALK E+++
Sbjct  404  --------------------------DIHVENNPWHGVDEWALKVELQS  426



>dbj|BAM45408.1| sigma factor 1 [Marchantia polymorpha]
 dbj|BAM95330.1| plastid RNA polymerase sigma factor 1 [Marchantia polymorpha]
Length=574

 Score =   122 bits (306),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 66/167 (40%), Positives = 106/167 (63%), Gaps = 4/167 (2%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAIS  680
            A+AD+SR +RLP HVH+ L  IR  + R+ + G   +++ ++++LN+S  +V+NA +   
Sbjct  394  AIADHSRTVRLPVHVHDTLGRIRRTRARMLQDGAPATVQTLSKALNLSDNQVKNALKVPK  453

Query  679  RVYSLDREAFPSLNGLPG--ETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLRER  506
            ++ SLD +     + L G  ET HS +AD   EN+PW  V++  +K++V  ++ T L  R
Sbjct  454  KLKSLDMQVGHQKSVLTGDTETFHSLVADQDSENHPWAVVEKAHMKEDVDKMLNTQLGSR  513

Query  505  EGEIIRLYYGI--VDNECLTWEDISRRIGLSRERVRQVGLVALEKLK  371
            E EII+++YG+  VD   ++ E IS R G+SRERVRQ+   A  KL+
Sbjct  514  EREIIKMHYGVDSVDGYPMSLESISHRYGVSRERVRQLERAAKRKLQ  560



>gb|KHE92742.1| RNA polymerase sigma factor RpoD, partial [Candidatus Scalindua 
brodae]
Length=227

 Score =   102 bits (253),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 65/176 (37%), Positives = 102/176 (58%), Gaps = 7/176 (4%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRN-AKKRLEEKGITPSIERIAESLNMSQKKVRNATEAI  683
            ++AD +R +R+P H+ E +S IRN +KK L+E G  PSIE +A+ + +S  + R   +  
Sbjct  51   SIADQARTIRIPVHMIETMSKIRNVSKKLLQENGREPSIEEMAKEIKISVSEARRVLKIS  110

Query  682  SRVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLRERE  503
                SLDR    S +   G+    +I D+  E+ P     +  LK+++++ +  TL  RE
Sbjct  111  RHQISLDRTVGESADSAFGD----FIEDDKAES-PVFAAAQEMLKEKIES-VLETLTYRE  164

Query  502  GEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAML  335
             EII+L YGI D    T E++ ++  ++RERVRQ+   A+ KL+H  R RKLE  L
Sbjct  165  REIIKLRYGIGDGYTYTLEEVGKKFMVTRERVRQIEAKAVRKLQHPIRSRKLEGFL  220



>ref|WP_013565889.1| RNA polymerase sigma70 [Isosphaera pallida]
 gb|ADV63601.1| RNA polymerase, sigma 70 subunit, RpoD [Isosphaera pallida ATCC 
43644]
Length=592

 Score =   103 bits (258),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 67/179 (37%), Positives = 99/179 (55%), Gaps = 13/179 (7%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNA-KKRLEEKGITPSIERIAESLNMSQKKVRNATEAI  683
            A+AD +R +R+P H+ E +S +RN  KK L+EKG  P+IE  A + N+S ++ R   +  
Sbjct  418  AIADQARTIRIPVHMIETMSKLRNVNKKLLQEKGREPTIEETARAANISIEETRRVMKIS  477

Query  682  SRVYSLDREAFPSLNGLPGETLHSYIAD---NHLENNPWHGVDEWALKDEVKNLICTTLR  512
                SLDR          GE+  SY  D   +    NP +   +  LKD++ + +  TL 
Sbjct  478  RHPISLDRPV--------GESEDSYFGDFIEDTTAENPINSATQEMLKDKI-DQVLKTLT  528

Query  511  EREGEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAML  335
             RE EII+L YG+ D    T E++ R   ++RERVRQ+   A+ KL+H  R R+LE  L
Sbjct  529  YREREIIKLRYGLGDGYTYTLEEVGRIFKVTRERVRQIEAKAVRKLQHPVRSRQLEGFL  587



>ref|XP_006302141.1| hypothetical protein CARUB_v10020145mg [Capsella rubella]
 ref|XP_006302142.1| hypothetical protein CARUB_v10020145mg [Capsella rubella]
 gb|EOA35039.1| hypothetical protein CARUB_v10020145mg [Capsella rubella]
 gb|EOA35040.1| hypothetical protein CARUB_v10020145mg [Capsella rubella]
Length=464

 Score =   102 bits (254),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 50/57 (88%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATE  689
            AL DNSR LRLPTH+HERL LIRNAK RL+EKGITPSI+RIAESLNMSQKKVRNATE
Sbjct  346  ALVDNSRTLRLPTHLHERLGLIRNAKLRLQEKGITPSIDRIAESLNMSQKKVRNATE  402



>ref|WP_015245113.1| RNA polymerase sigma70 [Singulisphaera acidiphila]
 gb|AGA25943.1| RNA polymerase sigma factor, sigma-70 family [Singulisphaera 
acidiphila DSM 18658]
Length=556

 Score =   101 bits (252),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 65/179 (36%), Positives = 101/179 (56%), Gaps = 13/179 (7%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRN-AKKRLEEKGITPSIERIAESLNMSQKKVRNATEAI  683
            A+AD +R +R+P H+ E +S +RN +KK L+EKG  P+IE  A++ N+S ++ R   +  
Sbjct  383  AIADQARTIRIPVHMIETMSKLRNVSKKLLQEKGREPTIEETAKAANISIEETRRVMKIS  442

Query  682  SRVYSLDREAFPSLNGLPGETLHSYIAD---NHLENNPWHGVDEWALKDEVKNLICTTLR  512
                SLDR          GE+  SY  D   +    +P +   +  LK+++ + +  TL 
Sbjct  443  RHPISLDRPV--------GESEDSYFGDFIEDEAAESPINAATQEMLKEKI-DQVLKTLT  493

Query  511  EREGEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAML  335
             RE EII+L YG+ D    T E++ R   ++RERVRQ+   A+ KL+H  R R+LE  L
Sbjct  494  YREREIIKLRYGLGDGYTYTLEEVGRIFKVTRERVRQIEAKAVRKLQHPVRSRQLEGFL  552



>dbj|GAN34376.1| RNA polymerase primary sigma factor [Candidatus Brocadia sinica 
JPN1]
Length=550

 Score =   100 bits (250),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 66/176 (38%), Positives = 100/176 (57%), Gaps = 7/176 (4%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRN-AKKRLEEKGITPSIERIAESLNMSQKKVRNATEAI  683
            ++AD +R +R+P H+ E +S IRN +KK L+EKG  P+IE IA  + ++  + R   +  
Sbjct  375  SIADQARTIRIPVHMIETMSKIRNVSKKLLQEKGREPTIEEIAREVKITVSEARRVLKIS  434

Query  682  SRVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLRERE  503
                SLDR    S +   G+    +I D   E+ P     +  LKD++++ +  TL  RE
Sbjct  435  RHQISLDRPVGESEDSSFGD----FIEDEKAES-PVSAATQEMLKDKIES-VLETLTYRE  488

Query  502  GEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAML  335
             EII+L YGI D    T E++ +   ++RERVRQ+   A+ KL+H  R RKLE  L
Sbjct  489  REIIKLRYGIGDGYTYTLEEVGKIFKVTRERVRQIEAKAVRKLQHPIRSRKLEGFL  544



>ref|WP_007219995.1| RNA polymerase sigma70 [planctomycete KSU-1]
 dbj|GAB60868.1| RNA polymerase sigma factor RpoD [planctomycete KSU-1]
Length=550

 Score =   100 bits (250),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 65/176 (37%), Positives = 102/176 (58%), Gaps = 7/176 (4%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRN-AKKRLEEKGITPSIERIAESLNMSQKKVRNATEAI  683
            ++AD +R +R+P H+ E +S IRN +KK L+EKG  P+IE I++ + ++ ++ R   +  
Sbjct  375  SIADQARTIRIPVHMIETMSKIRNVSKKLLQEKGREPTIEEISKEVKITVEEARRVLKIS  434

Query  682  SRVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLRERE  503
                SLDR    S +   G+    +I D   E+ P     +  LKD++++ +  TL  RE
Sbjct  435  RHQISLDRPVGESEDSSFGD----FIEDEKAES-PVSAATQEMLKDKIES-VLETLTYRE  488

Query  502  GEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAML  335
             EII+L YGI D    T E++ +   ++RERVRQ+   A+ KL+H  R RKLE  L
Sbjct  489  REIIKLRYGIGDGYTYTLEEVGKIFKVTRERVRQIEAKAVRKLQHPIRSRKLEGFL  544



>gb|KJB44351.1| hypothetical protein B456_007G247500 [Gossypium raimondii]
Length=389

 Score = 98.6 bits (244),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATE  689
            AL +NSR LRLPT++HERL LIRNAK RLEEKGITP+I+RIAESLNMSQKKVRNATE
Sbjct  332  ALVENSRTLRLPTYLHERLGLIRNAKYRLEEKGITPTIDRIAESLNMSQKKVRNATE  388



>emb|CAJ71462.1| strongly similar to transcription initiation factor sigma RpoD 
[Candidatus Kuenenia stuttgartiensis]
Length=551

 Score =   100 bits (248),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 66/176 (38%), Positives = 100/176 (57%), Gaps = 7/176 (4%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRN-AKKRLEEKGITPSIERIAESLNMSQKKVRNATEAI  683
            ++AD +R +R+P H+ E +S IRN +KK L++KG  P+IE IA  + +S  + R   +  
Sbjct  375  SIADQARTIRIPVHMIETMSKIRNISKKLLQDKGREPTIEEIAREVKISVPEARRVLKIS  434

Query  682  SRVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLRERE  503
                SLDR    S +   G+    +I D   E+ P     +  LKD++++ +  TL  RE
Sbjct  435  RHQISLDRPVGESEDSSFGD----FIEDEKAES-PVAAATQEMLKDKIES-VLETLTYRE  488

Query  502  GEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAML  335
             EII+L YGI D    T E++ +   ++RERVRQ+   A+ KL+H  R RKLE  L
Sbjct  489  REIIKLRYGIGDGYTYTLEEVGKIFKVTRERVRQIEAKAVRKLQHPIRSRKLEGFL  544



>ref|WP_010581773.1| RNA polymerase sigma70 [Schlesneria paludicola]
Length=553

 Score =   100 bits (248),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 63/176 (36%), Positives = 101/176 (57%), Gaps = 7/176 (4%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRL-EEKGITPSIERIAESLNMSQKKVRNATEAI  683
            A+AD +R +R+P H+ E +S +R   KRL +EKG  P+IE  AE+  +S ++ R   +  
Sbjct  373  AIADQARTIRIPVHMIETMSKLRKVSKRLLQEKGREPTIEETAEAAGVSLEETRRVLKIS  432

Query  682  SRVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLRERE  503
                SLDR    S +   G+    +I D+  E+ P +   +  LKD++ +++  TL  RE
Sbjct  433  RHPISLDRPVGESEDSYFGD----FIEDDSTES-PVNSATQEMLKDKI-DVVLKTLTYRE  486

Query  502  GEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAML  335
             EII+L YG+ D    T E++ R   ++RERVRQ+   A+ KL+H  R ++L+  L
Sbjct  487  REIIKLRYGLGDGYTYTLEEVGRIFKVTRERVRQIEAKAVRKLQHPVRSKQLKGFL  542



>ref|WP_024544660.1| RNA polymerase sigma factor SigC [Synechococcus sp. NKBG15041c]
Length=398

 Score = 97.8 bits (242),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 61/169 (36%), Positives = 103/169 (61%), Gaps = 8/169 (5%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEE-KGITPSIERIAESLNMSQKKVRNATEAI  683
            A+A  SR +RLP HV E+L+ I+ A++++ + +G TPSIE +A+SL+M+ ++VR   + +
Sbjct  226  AIATQSRTIRLPVHVTEKLNKIKKAQRQISQTQGCTPSIEDVAQSLDMTAEQVREVLQKV  285

Query  682  SRVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLRERE  503
             R  SL+       +   G+ L +  A      +P   +   +L+ +++NL+ T L +RE
Sbjct  286  PRSVSLEIRVGKDRDTELGDLLETQDA------SPEENLVRESLQRDLENLL-TELTDRE  338

Query  502  GEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARR  356
             E+I+L YG+ D +  +  +I R + LSRERVRQ+   AL+KL+   RR
Sbjct  339  REVIQLRYGLGDGKTYSLAEIGRMLELSRERVRQIEAKALQKLRQPKRR  387



>ref|WP_044276944.1| RNA polymerase sigma factor RpoD [Caldilinea aerophila]
Length=390

 Score = 97.8 bits (242),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 61/180 (34%), Positives = 102/180 (57%), Gaps = 15/180 (8%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLS-LIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAI  683
            A+AD  R +R+P H++E+++ L R +++ ++E G  P+ E IAE L +S +KV +     
Sbjct  221  AIADQGRTIRVPVHMYEQINRLTRTSRQLVQELGRDPTTEEIAEELGVSPRKVEHIMRVS  280

Query  682  SRVYSLDREAFPSLNGLP-GETLHSYIAD---NHLENNPWHGVDEWALKDEVKNLICTTL  515
             R  SL+         +P GE   SY+ D   +   + P     +  L+ EV + I  +L
Sbjct  281  QRPLSLE---------MPVGEEEDSYLGDFIEDEDADAPGEAAGQQLLR-EVIDEIFQSL  330

Query  514  REREGEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAML  335
              RE  I++L +G+VD  C T E++ ++ G++RER+RQ+   AL +L+H +R RKL   L
Sbjct  331  TPREVRILQLRFGLVDGYCYTLEEVGKKFGVTRERIRQIEAQALSRLRHPSRSRKLRDYL  390



>dbj|BAL98787.1| putative RNA polymerase sigma factor [Caldilinea aerophila DSM 
14535 = NBRC 104270]
Length=433

 Score = 97.8 bits (242),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 60/176 (34%), Positives = 101/176 (57%), Gaps = 15/176 (9%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLS-LIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAI  683
            A+AD  R +R+P H++E+++ L R +++ ++E G  P+ E IAE L +S +KV +     
Sbjct  264  AIADQGRTIRVPVHMYEQINRLTRTSRQLVQELGRDPTTEEIAEELGVSPRKVEHIMRVS  323

Query  682  SRVYSLDREAFPSLNGLP-GETLHSYIAD---NHLENNPWHGVDEWALKDEVKNLICTTL  515
             R  SL+         +P GE   SY+ D   +   + P     +  L+ EV + I  +L
Sbjct  324  QRPLSLE---------MPVGEEEDSYLGDFIEDEDADAPGEAAGQQLLR-EVIDEIFQSL  373

Query  514  REREGEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKL  347
              RE  I++L +G+VD  C T E++ ++ G++RER+RQ+   AL +L+H +R RKL
Sbjct  374  TPREVRILQLRFGLVDGYCYTLEEVGKKFGVTRERIRQIEAQALSRLRHPSRSRKL  429



>gb|EKD62776.1| hypothetical protein ACD_52C00059G0002 [uncultured bacterium]
Length=359

 Score = 96.7 bits (239),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 61/178 (34%), Positives = 108/178 (61%), Gaps = 11/178 (6%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLS-LIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAI  683
            A+AD +R +R+P H+ E ++ L R ++K ++E G  P+ E IAE + +++++VR   +  
Sbjct  189  AIADQARTIRIPVHMVETINKLYRTSRKLMQELGREPTPEEIAEEMELTEERVREIFKIS  248

Query  682  SRVYSLDREAFPSLNGLPGET-LHSYIAD-NHLENNPWHGVDEWALKDEVKNLICTTLRE  509
              V SL+        G  GE+ L  +I D +HL  +P     +  LKD +   + +TL E
Sbjct  249  QEVTSLETPV-----GDDGESVLGDFIPDESHL--SPVDQASKQLLKDHLDE-VLSTLTE  300

Query  508  REGEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAML  335
            RE ++++L +G+  ++ +T E++ +  G++RER+RQ+   AL KLKH +RR+KL+  L
Sbjct  301  REAKVLKLRFGLDGSKQMTLEEVGKVFGVTRERIRQIEAKALRKLKHPSRRKKLQDYL  358



>ref|WP_004405548.1| MULTISPECIES: RNA polymerase sigma factor RpoD [Thermoanaerobacter]
 gb|ADD02660.1| RNA polymerase, sigma 70 subunit, RpoD subfamily [Thermoanaerobacter 
italicus Ab9]
 gb|EMT37939.1| RNA polymerase sigma factor, sigma-70 family [Thermoanaerobacter 
thermohydrosulfuricus WC1]
Length=273

 Score = 95.9 bits (237),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 62/177 (35%), Positives = 105/177 (59%), Gaps = 8/177 (5%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLS-LIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAI  683
            A+AD +R +R+P H+ E ++ L++  K+ L++ G  PSIE IAE +N+S+KK +   E +
Sbjct  103  AIADQARTIRIPVHMVESVNKLLKIQKQFLQKLGREPSIEEIAEEMNISEKKAKVLLEIV  162

Query  682  SRVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLRERE  503
              + SL+       NG     L   IAD     +P   ++   LK++V   + +TL  RE
Sbjct  163  QGIVSLEEPVGEDENG----KLGDIIADKEA-VDPVEELESMLLKEQVDE-VLSTLAPRE  216

Query  502  GEIIRLYYGIVDNECLTWEDISRRI-GLSRERVRQVGLVALEKLKHAARRRKLEAML  335
             +++RL +G+ D +  T E++ + + G+SRERVRQ+   AL++L+H  R R+L+  L
Sbjct  217  EKVLRLRFGLDDGKIRTLEEVGKELGGISRERVRQIETKALKRLRHPNRSRRLKEFL  273



>ref|WP_013108497.1| RNA polymerase sigma70 [Planctomyces limnophilus]
 gb|ADG66066.1| RNA polymerase sigma factor RpoD [Planctomyces limnophilus DSM 
3776]
Length=550

 Score = 97.8 bits (242),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 63/176 (36%), Positives = 100/176 (57%), Gaps = 7/176 (4%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRN-AKKRLEEKGITPSIERIAESLNMSQKKVRNATEAI  683
            A+AD +R +R+P H+ E +S +R  AKK L+E G  P++E  AE+  +S ++ R   +  
Sbjct  372  AIADQARTIRIPVHMIETMSKLRKVAKKLLQEMGREPTLEETAEAAGVSLEETRRVMKIS  431

Query  682  SRVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLRERE  503
                SLDR    S +   G+    +I D++ E+ P     +  LKD++ N +  TL  RE
Sbjct  432  RHPISLDRPVGESEDSYFGD----FIEDDNTES-PVMAATQEMLKDKIDN-VLKTLTYRE  485

Query  502  GEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAML  335
             EII+L YG+ D    T E++ R   ++RERVRQ+   A+ KL+H  R ++L+  L
Sbjct  486  REIIKLRYGLGDGYTYTLEEVGRIFKVTRERVRQIEAKAVRKLQHPVRSKQLKGFL  541



>ref|WP_010049964.1| RNA polymerase sigma70 [Gemmata obscuriglobus]
Length=556

 Score = 97.4 bits (241),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 61/176 (35%), Positives = 101/176 (57%), Gaps = 7/176 (4%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRL-EEKGITPSIERIAESLNMSQKKVRNATEAI  683
            A+AD +R +R+P H+ E +S +RN  K+L +E G  P+++  A++  +S ++ +   +  
Sbjct  379  AIADQARTIRIPVHMIETMSKLRNVSKQLLQELGREPTVQETADAAKISYEECKRVLKIS  438

Query  682  SRVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLRERE  503
             +  SLDR    S +   G+    +I DN +E+ P +      LKD+++  +  TL  RE
Sbjct  439  RQPISLDRPVGESEDSYFGD----FIEDNSVES-PVNAATNEMLKDKIEG-VLKTLTYRE  492

Query  502  GEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAML  335
             EII+L YG+ D    T E++ R   ++RERVRQ+   A+ KL+H  R R+LE  L
Sbjct  493  REIIKLRYGLGDGYTYTLEEVGRIFKVTRERVRQIEAKAVRKLQHPVRSRQLEGFL  548



>ref|WP_012842663.1| RNA polymerase sigma factor rpoD [Rhodothermus marinus]
 gb|ACY47051.1| RNA polymerase, sigma 70 subunit, RpoD subfamily [Rhodothermus 
marinus DSM 4252]
Length=279

 Score = 94.4 bits (233),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 67/173 (39%), Positives = 98/173 (57%), Gaps = 7/173 (4%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRL-EEKGITPSIERIAESLNMSQKKVRNATEAI  683
            ALA+ SR++RLP +    +S IR    RL +E    PS E +AE LN+  +K+R A +  
Sbjct  109  ALAEQSRVVRLPLNRIGTISKIRKVSARLAQEHERAPSAEELAEELNIDVEKIREALQHT  168

Query  682  SRVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLRERE  503
             R  S+D    P  +      L   +  N  + +P  G+ E +LK +++  + +TL  RE
Sbjct  169  GRALSMD---APFTDDDDNSLLD--VLPNEEDTSPDEGLMEESLKIDIERAL-STLHPRE  222

Query  502  GEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLE  344
             EIIRLY+GI     LT E+I +R GL+RERVRQ+   AL KL+   RR +L+
Sbjct  223  AEIIRLYFGIGREHPLTLEEIGQRFGLTRERVRQIKEKALRKLRQKHRREELQ  275



>ref|WP_027131434.1| RNA polymerase sigma factor rpoD, partial [Gemmatimonadetes bacterium 
SCGC AAA240-J22]
Length=252

 Score = 94.0 bits (232),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 65/176 (37%), Positives = 106/176 (60%), Gaps = 9/176 (5%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLI-RNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAI  683
             LA+ SR++R+P +    L  I R + + L+E G  P+++ +A+ L++S+++VR  T A+
Sbjct  83   TLAEQSRIVRIPLNRAGALHRIGRRSSELLQELGRDPTVKELAQELDLSEEEVRR-TLAV  141

Query  682  SRVY-SLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLRER  506
            SR + SLD    P  NG     L  Y+ D +    P     E AL D ++ +   +L+ER
Sbjct  142  SRSHLSLDSPIKPGENG----RLLDYLPDQY-SPGPEQETYERALGDTIE-VALASLKER  195

Query  505  EGEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAM  338
            E +I+RLY+G+ D + +T E+I   +G++RERVRQ+   AL +L+HA+R R LE  
Sbjct  196  EAKILRLYFGLDDQKPMTLEEIGSILGVTRERVRQIKEKALVRLRHASRARFLETF  251



>ref|WP_014065864.1| RNA polymerase sigma factor rpoD [Rhodothermus marinus]
 gb|AEN72088.1| RNA polymerase, sigma 70 subunit, RpoD subfamily [Rhodothermus 
marinus SG0.5JP17-172]
Length=279

 Score = 93.6 bits (231),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 67/173 (39%), Positives = 97/173 (56%), Gaps = 7/173 (4%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRL-EEKGITPSIERIAESLNMSQKKVRNATEAI  683
            ALA+ SR++RLP +    +S IR    RL +E    PS E +AE LN+  +K+R A +  
Sbjct  109  ALAEQSRVVRLPLNRIGTISKIRKVSARLAQEHERAPSAEELAEELNIDVEKIREALQHT  168

Query  682  SRVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLRERE  503
             R  S+D    P  +      L   +  N  +  P  G+ E +LK +++  + +TL  RE
Sbjct  169  GRALSMD---APFTDDDDNSLLD--VLPNEEDTAPDEGLMEESLKIDIERAL-STLHPRE  222

Query  502  GEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLE  344
             EIIRLY+GI     LT E+I +R GL+RERVRQ+   AL KL+   RR +L+
Sbjct  223  AEIIRLYFGIGREHPLTLEEIGQRFGLTRERVRQIKEKALRKLRQKHRREELQ  275



>gb|EKE12962.1| hypothetical protein ACD_13C00110G0010 [uncultured bacterium]
Length=359

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 57/179 (32%), Positives = 104/179 (58%), Gaps = 13/179 (7%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLI-RNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAI  683
            A+AD +R +R+P H+ E ++ I R +++ ++E G  P+ E I E L M   ++R      
Sbjct  189  AIADQARTIRIPVHMVETINKIYRTSRRLMQELGREPTPEEIGEELEMDGNRIRE-----  243

Query  682  SRVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWA---LKDEVKNLICTTLR  512
              ++ + +E   SL    GE   S++ D   +      VD+ +   LKD ++ ++ T L 
Sbjct  244  --IFKIAQET-TSLEAPVGEDQESFLGDFIPDETTLSPVDQASKQLLKDHLEEVLGT-LS  299

Query  511  EREGEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAML  335
            ERE ++++L +G+  ++ +T E++ +  G++RER+RQ+   AL KLKH +RR+KL+  L
Sbjct  300  EREAKVLKLRFGLEGSKAMTLEEVGKVFGVTRERIRQIEAKALRKLKHPSRRKKLQDYL  358



>gb|ADN14192.1| RNA polymerase, sigma 70 subunit, RpoD subfamily [Cyanothece 
sp. PCC 7822]
Length=418

 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 59/174 (34%), Positives = 99/174 (57%), Gaps = 12/174 (7%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEE-KGITPSIERIAESLNMSQKKVRNATEAI  683
            A+A  SR++RLP H+ E+L+ I+ A++++ + KG TPSIE +++ L MS  ++R     +
Sbjct  246  AIATQSRIIRLPVHITEKLNKIKKAQRKIAQLKGATPSIEELSQELEMSPPQIREVLMRV  305

Query  682  SRVYSLDREAFPSLNGLPGETLHSYIAD--NHLENNPWHGVDEWALKDEVKNLICTTLRE  509
             R  SL+ +         G+   + + D     E +P   +   AL+ ++ NL+   L  
Sbjct  306  PRSVSLEIKV--------GKEKDTELIDLLETTEASPEDNIANEALRQDLHNLLAD-LTT  356

Query  508  REGEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKL  347
            RE E+I+L YG  D +  +  DI R + LSRERVRQ+   A++KL+   RR ++
Sbjct  357  REREVIQLRYGFKDGKSYSLADIGRTLQLSRERVRQIEAKAIQKLRQPKRRNQI  410



>ref|WP_041933648.1| RNA polymerase sigma factor SigC [Cyanothece sp. PCC 7822]
Length=414

 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 59/174 (34%), Positives = 99/174 (57%), Gaps = 12/174 (7%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEE-KGITPSIERIAESLNMSQKKVRNATEAI  683
            A+A  SR++RLP H+ E+L+ I+ A++++ + KG TPSIE +++ L MS  ++R     +
Sbjct  242  AIATQSRIIRLPVHITEKLNKIKKAQRKIAQLKGATPSIEELSQELEMSPPQIREVLMRV  301

Query  682  SRVYSLDREAFPSLNGLPGETLHSYIAD--NHLENNPWHGVDEWALKDEVKNLICTTLRE  509
             R  SL+ +         G+   + + D     E +P   +   AL+ ++ NL+   L  
Sbjct  302  PRSVSLEIKV--------GKEKDTELIDLLETTEASPEDNIANEALRQDLHNLLAD-LTT  352

Query  508  REGEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKL  347
            RE E+I+L YG  D +  +  DI R + LSRERVRQ+   A++KL+   RR ++
Sbjct  353  REREVIQLRYGFKDGKSYSLADIGRTLQLSRERVRQIEAKAIQKLRQPKRRNQI  406



>ref|WP_030006065.1| RNA polymerase sigma factor SigC [Synechococcus sp. NKBG042902]
Length=398

 Score = 93.2 bits (230),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 58/169 (34%), Positives = 101/169 (60%), Gaps = 8/169 (5%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEE-KGITPSIERIAESLNMSQKKVRNATEAI  683
            A+A  SR +RLP HV E+L+ I+ A++++ + +G TPS++ +A++L M+ ++VR   + +
Sbjct  226  AIATQSRTIRLPVHVTEKLNKIKKAQRQISQTQGCTPSLDDVAQALEMTPEQVREVLQKV  285

Query  682  SRVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLRERE  503
             R  SL+       +   G+ L +  A      +P   +   +L+ ++ NL+ T L +RE
Sbjct  286  PRSVSLEIRVGKDRDTELGDLLETQDA------SPEENLVRESLQRDLHNLL-TELTDRE  338

Query  502  GEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARR  356
             E+I+L YG+ D +  +  +I R + LSRERVRQ+   AL+KL+   RR
Sbjct  339  REVIQLRYGLGDGKTYSLAEIGRMLELSRERVRQIEAKALQKLRQPKRR  387



>ref|WP_012305904.1| RNA polymerase sigma factor SigC [Synechococcus sp. PCC 7002]
 gb|ACA98280.1| Group 2 sigma factor [Synechococcus sp. PCC 7002]
Length=398

 Score = 93.2 bits (230),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 58/169 (34%), Positives = 101/169 (60%), Gaps = 8/169 (5%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEE-KGITPSIERIAESLNMSQKKVRNATEAI  683
            A+A  SR +RLP HV E+L+ I+ A++++ + +G TPS++ +A++L M+ ++VR   + +
Sbjct  226  AIATQSRTIRLPVHVTEKLNKIKKAQRQISQTQGCTPSLDDVAQALEMTPEQVREVLQKV  285

Query  682  SRVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLRERE  503
             R  SL+       +   G+ L +  A      +P   +   +L+ ++ NL+ T L +RE
Sbjct  286  PRSVSLEIRVGKDRDTELGDLLETQDA------SPEENLVRESLQRDLHNLL-TELTDRE  338

Query  502  GEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARR  356
             E+I+L YG+ D +  +  +I R + LSRERVRQ+   AL+KL+   RR
Sbjct  339  REVIQLRYGLGDGKTYSLAEIGRMLELSRERVRQIEAKALQKLRQPKRR  387



>gb|EAQ77941.1| transcription initiation factor sigma 70 [Blastopirellula marina 
DSM 3645]
Length=567

 Score = 94.4 bits (233),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 63/176 (36%), Positives = 98/176 (56%), Gaps = 7/176 (4%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRL-EEKGITPSIERIAESLNMSQKKVRNATEAI  683
            A+AD +R +R+P H+ + LS +RN +KRL +E    P+++ IA    +  ++VR   +  
Sbjct  392  AIADQARTIRIPVHMIDVLSKLRNVQKRLLQELRREPTMDEIARRAEIDLEEVRRVMDIG  451

Query  682  SRVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLRERE  503
             +  SLDR    S +   GE    +I D+H E  P        L+D ++ L+  TL  RE
Sbjct  452  RQPVSLDRPIGESEDSSFGE----FIEDSH-EETPIRSASNQILRDRIQGLL-KTLTYRE  505

Query  502  GEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAML  335
             EII+L YG+ D    T E++ R   ++RERVRQ+   A+ KL+H  R ++LE  L
Sbjct  506  REIIKLRYGLGDGYTYTLEEVGRIFKVTRERVRQIEAKAVRKLQHPVRSQQLEGFL  561



>ref|WP_040352700.1| RNA polymerase sigma70 [Blastopirellula marina]
Length=557

 Score = 94.4 bits (233),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 63/176 (36%), Positives = 98/176 (56%), Gaps = 7/176 (4%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRL-EEKGITPSIERIAESLNMSQKKVRNATEAI  683
            A+AD +R +R+P H+ + LS +RN +KRL +E    P+++ IA    +  ++VR   +  
Sbjct  382  AIADQARTIRIPVHMIDVLSKLRNVQKRLLQELRREPTMDEIARRAEIDLEEVRRVMDIG  441

Query  682  SRVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLRERE  503
             +  SLDR    S +   GE    +I D+H E  P        L+D ++ L+  TL  RE
Sbjct  442  RQPVSLDRPIGESEDSSFGE----FIEDSH-EETPIRSASNQILRDRIQGLL-KTLTYRE  495

Query  502  GEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAML  335
             EII+L YG+ D    T E++ R   ++RERVRQ+   A+ KL+H  R ++LE  L
Sbjct  496  REIIKLRYGLGDGYTYTLEEVGRIFKVTRERVRQIEAKAVRKLQHPVRSQQLEGFL  551



>ref|WP_015133087.1| RNA polymerase, sigma subunit, RpsC/SigC [Leptolyngbya sp. PCC 
7376]
 gb|AFY37309.1| RNA polymerase, sigma subunit, RpsC/SigC [Leptolyngbya sp. PCC 
7376]
Length=396

 Score = 92.8 bits (229),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 59/169 (35%), Positives = 100/169 (59%), Gaps = 8/169 (5%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEE-KGITPSIERIAESLNMSQKKVRNATEAI  683
            A+A  SR +RLP HV E+L+ I+ A++++ + +G TPS+E +A+ LNM+  +VR   + +
Sbjct  224  AIATQSRTIRLPVHVTEKLNKIKKAQRQISQTQGCTPSLEDVAKVLNMTAAQVREVLQKV  283

Query  682  SRVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLRERE  503
             R  SL+       +   G+ L +  A      +P   +   +L+ +++NL+   L +RE
Sbjct  284  PRSVSLEIRVGQDRDTELGDLLETKDA------SPEENLVRESLQRDLRNLLAE-LTDRE  336

Query  502  GEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARR  356
             E+I+L YG+ D +  +  +I R + LSRERVRQ+   AL+KL+   RR
Sbjct  337  QEVIQLRYGLDDGKTHSLAEIGRVLELSRERVRQIEAKALQKLRQPKRR  385



>ref|WP_026389920.1| DNA-directed RNA polymerase subunit sigma [Acholeplasma axanthum]
Length=409

 Score = 92.8 bits (229),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 60/178 (34%), Positives = 103/178 (58%), Gaps = 19/178 (11%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLS-LIRNAKKRLEEKGITPSIERIAESLNMSQKKVRN----A  695
            A+AD +R +R+P H+ E ++ + R  ++ ++E G  PS E I E + MS +KV+N    +
Sbjct  236  AVADQARTIRIPVHMVETINKMARIQRQLIQELGREPSPEEIGEKMEMSAEKVQNIQRIS  295

Query  694  TEAISRVYSLDREAFPSLNGL--PGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICT  521
             E IS   ++  E   SL      G TL+ +  ++ L++     +DE          I +
Sbjct  296  KEPISLESTVGEEEDSSLGDFISDGGTLNPH--ESMLQDMTIQALDE----------ILS  343

Query  520  TLREREGEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKL  347
            TL +RE +++RL YG++D +  T E++ R  G++RER+RQ+   A+ KLKH +R++KL
Sbjct  344  TLTDREEKVLRLRYGLLDGKTYTLEEVGREFGVTRERIRQIEAKAMRKLKHPSRQQKL  401



>ref|WP_015954827.1| RNA polymerase sigma factor SigC [Cyanothece sp. PCC 7424]
 gb|ACK71227.1| RNA polymerase, sigma 70 subunit, RpoD subfamily [Cyanothece 
sp. PCC 7424]
Length=418

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 55/174 (32%), Positives = 100/174 (57%), Gaps = 12/174 (7%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEE-KGITPSIERIAESLNMSQKKVRNATEAI  683
            A+A  SR++RLP H+ E+L+ I+ A++++ + KG TP++E +A  ++M+  ++R     +
Sbjct  246  AIATQSRIIRLPVHITEKLNKIKKAQRKMAQIKGRTPTMEELAVEVDMTAPQIREVLMRV  305

Query  682  SRVYSLDREAFPSLNGLPGETLHSYIAD--NHLENNPWHGVDEWALKDEVKNLICTTLRE  509
             R  SL+ +         G+   + + D     E +P   +    L+ +++NL+   L  
Sbjct  306  PRSVSLEIKV--------GKEKDTELVDLLETTEASPEESLVNETLRQDLQNLLAD-LTT  356

Query  508  REGEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKL  347
            RE E+I++ YG  D +C +  DI R + LSRERVRQ+   A++KL+   RR ++
Sbjct  357  REREVIQMRYGFKDGKCYSLADIGRALQLSRERVRQIEAKAIQKLRQPKRRNQI  410



>dbj|BAL57223.1| RNA polymerase primary sigma factor [uncultured Chloroflexi bacterium]
 dbj|BAL58041.1| RNA polymerase primary sigma factor [uncultured Chloroflexi bacterium]
Length=405

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 58/176 (33%), Positives = 99/176 (56%), Gaps = 7/176 (4%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEEK-GITPSIERIAESLNMSQKKVRNATEAI  683
            A+AD  R +R+P H+ ++++ +   + +L +K G  P+I+ +AE+L +  +KV N  +  
Sbjct  234  AIADQGRTIRVPVHMGDQINKLLRVQHQLTQKLGREPTIDELAEALGVPPRKVENMIQVA  293

Query  682  SRVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLRERE  503
             R  SL+       + + G+    +I D   E  P      + L  E  N I +TL  RE
Sbjct  294  RRPLSLETPTDDEEDSVLGD----FIEDE--EAAPPDETATYNLLREQLNEILSTLPPRE  347

Query  502  GEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAML  335
              I++L YG++D +  T E++ R++G++RERVRQ+   AL +L+H + RRKL   L
Sbjct  348  VRILQLRYGLLDGQSYTLEEVGRKMGVTRERVRQIEAQALSRLRHPSIRRKLRDYL  403



>gb|ADY58255.1| RNA polymerase, sigma 70 subunit, RpoD [Planctomyces brasiliensis 
DSM 5305]
Length=590

 Score = 92.4 bits (228),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 61/179 (34%), Positives = 97/179 (54%), Gaps = 13/179 (7%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRL-EEKGITPSIERIAESLNMSQKKVRNATEAI  683
            A+AD +R +R+P H+ E +S +R   K L +E G  P+IE +AE+  +S ++ R   +  
Sbjct  410  AIADQARTIRIPVHMIETMSKLRKVGKDLVQELGREPTIEEMAEAAEVSLEEARRVMKIS  469

Query  682  SRVYSLDREAFPSLNGLPGETLHSYIAD---NHLENNPWHGVDEWALKDEVKNLICTTLR  512
             +  SLDR          GE   SY  D   +H  ++P     +  LKD++ + +  TL 
Sbjct  470  RQPISLDRPI--------GEGEDSYFGDFIEDHSTDSPVSTATQEMLKDKIDH-VLKTLT  520

Query  511  EREGEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAML  335
             RE EII+L YG+ D    T E++ R   ++RERVRQ+   A+ KL+H  R  +L+  +
Sbjct  521  YREREIIKLRYGLGDGYTYTLEEVGRIFKVTRERVRQIEAKAVRKLQHPVRSHQLKGFI  579



>ref|WP_041398861.1| RNA polymerase sigma70 [Planctomyces brasiliensis]
Length=563

 Score = 92.4 bits (228),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 61/179 (34%), Positives = 97/179 (54%), Gaps = 13/179 (7%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRL-EEKGITPSIERIAESLNMSQKKVRNATEAI  683
            A+AD +R +R+P H+ E +S +R   K L +E G  P+IE +AE+  +S ++ R   +  
Sbjct  383  AIADQARTIRIPVHMIETMSKLRKVGKDLVQELGREPTIEEMAEAAEVSLEEARRVMKIS  442

Query  682  SRVYSLDREAFPSLNGLPGETLHSYIAD---NHLENNPWHGVDEWALKDEVKNLICTTLR  512
             +  SLDR          GE   SY  D   +H  ++P     +  LKD++ + +  TL 
Sbjct  443  RQPISLDRPI--------GEGEDSYFGDFIEDHSTDSPVSTATQEMLKDKIDH-VLKTLT  493

Query  511  EREGEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAML  335
             RE EII+L YG+ D    T E++ R   ++RERVRQ+   A+ KL+H  R  +L+  +
Sbjct  494  YREREIIKLRYGLGDGYTYTLEEVGRIFKVTRERVRQIEAKAVRKLQHPVRSHQLKGFI  552



>ref|WP_022462739.1| RNA polymerase sigma factor [Blautia sp. CAG:37]
 emb|CDE66839.1| rNA polymerase sigma factor [Blautia sp. CAG:37]
Length=380

 Score = 90.1 bits (222),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 59/179 (33%), Positives = 105/179 (59%), Gaps = 13/179 (7%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLS-LIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAI  683
            A+AD +R +R+P H+ E ++ LIR +++ L+E G  P+ E IAE ++MS ++VR      
Sbjct  210  AIADQARTIRIPVHMVETINKLIRVSRQLLQELGREPTPEEIAEEMHMSVERVRE-----  264

Query  682  SRVYSLDREAFPSLNGLPGETLHSYIADNHLENN---PWHGVDEWALKDEVKNLICTTLR  512
              +  + +E   SL    GE   S++ D   ++N   P        LK+++++ + +TL 
Sbjct  265  --ILKISQEPV-SLETPIGEEEDSHLGDFIQDDNVPVPADAAAFTMLKEQLED-VLSTLT  320

Query  511  EREGEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAML  335
            +RE +++RL +G+ D    T E++ +   ++RER+RQ+   AL KL+H +R RKL+  L
Sbjct  321  DREQKVLRLRFGLDDGRARTLEEVGKEFNVTRERIRQIEAKALRKLRHPSRSRKLKDYL  379



>ref|WP_021962254.1| RNA polymerase sigma factor [Mycoplasma sp. CAG:877]
 emb|CCY79536.1| rNA polymerase sigma factor [Mycoplasma sp. CAG:877]
Length=363

 Score = 89.7 bits (221),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 60/180 (33%), Positives = 106/180 (59%), Gaps = 15/180 (8%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRL-EEKGITPSIERIAESLNMSQKKVRNATEAI  683
            A+AD +R +R+P H+ E ++ +   +++L +E    P+ E IA+ L +S  KVR      
Sbjct  192  AIADQARTIRVPVHMVETINKLARVQRQLTQELNREPTDEEIAKKLGISIDKVRE-----  246

Query  682  SRVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWA----LKDEVKNLICTTL  515
              VY + ++   SL    GE   S++ D  +++    G +E+A    LK+E+   + +TL
Sbjct  247  --VYKISQDPV-SLETPIGEEDDSHLGD-FIKDERTMGPEEYATVEMLKEELSG-VLSTL  301

Query  514  REREGEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAML  335
             +RE +++RL +G+ D +C T E++ +  G++RER+RQ+   AL KL+H +R RKL+  L
Sbjct  302  TDREEKVLRLRFGLNDGQCRTLEEVGQIFGVTRERIRQIEAKALRKLRHPSRSRKLKDFL  361



>ref|WP_028529211.1| RNA polymerase sigma70 factor [Ruminococcus gauvreauii]
Length=376

 Score = 89.7 bits (221),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 61/179 (34%), Positives = 102/179 (57%), Gaps = 13/179 (7%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLS-LIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAI  683
            A+AD +R +R+P H+ E ++ LIR +++ L+E G  P+ E IAE +NMS ++VR      
Sbjct  206  AIADQARTIRIPVHMVETINKLIRVSRQLLQELGREPTPEEIAEEMNMSVERVRE-----  260

Query  682  SRVYSLDREAFPSLNGLPGETLHSYIADNHLENN---PWHGVDEWALKDEVKNLICTTLR  512
              +  + +E   SL    GE   S++ D   ++N   P        LK+++   +  TL 
Sbjct  261  --ILKISQEPV-SLETPIGEEEDSHLGDFIQDDNVPVPADAAAFTLLKEQLVE-VLGTLT  316

Query  511  EREGEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAML  335
            ERE +++RL +G+ D    T E++ +   ++RER+RQ+   AL KL+H +R RKL+  L
Sbjct  317  EREQKVLRLRFGLDDGRARTLEEVGKEFNVTRERIRQIEAKALRKLRHPSRSRKLKDYL  375



>gb|EKD53587.1| hypothetical protein ACD_61C00009G0004 [uncultured bacterium]
Length=367

 Score = 89.7 bits (221),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 54/176 (31%), Positives = 101/176 (57%), Gaps = 7/176 (4%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLS-LIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAI  683
            A+AD +R +R+P H+ E ++ LIR  +K +++ G  P+ E +AE L  + +KVR   +  
Sbjct  197  AIADQARTIRIPVHMVETINKLIRTQRKLMQDLGREPTDEEVAEELETTPEKVREILKIA  256

Query  682  SRVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLRERE  503
             +  SL+       + L G+    +I D   +  P+       + + ++  + + L ERE
Sbjct  257  QKTTSLETPIGDDEDSLLGD----FIPDER-QATPYEATSRQLMHENLEEALGS-LTERE  310

Query  502  GEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAML  335
             +++R+ +G+  ++ LT E++ +  G++RER+RQ+   AL KL+H +RRRKL+  L
Sbjct  311  SKVLRMRFGLDGSKPLTLEEVGKVFGVTRERIRQIESKALRKLRHPSRRRKLQDYL  366



>ref|XP_001712214.1| rpoD [Hemiselmis andersenii]
 gb|ABW97889.1| rpoD [Hemiselmis andersenii]
Length=485

 Score = 90.9 bits (224),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 57/168 (34%), Positives = 99/168 (59%), Gaps = 7/168 (4%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLE-EKGITPSIERIAESLNMSQKKVRNATEAI  683
            A+AD+SR +RLP H+++ +S IR   + L  E G +P+ E IAE ++MS +K+R+  ++ 
Sbjct  272  AIADHSRTIRLPVHLYDTISAIRKTTRTLNIEIGRSPTEEEIAEKMDMSVEKLRSVLQSA  331

Query  682  SRVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLRERE  503
                SL+R   P  N      L  +I  +  + +P   V++  L+D+++N+I  +L  RE
Sbjct  332  QPTLSLER---PLKNDDDASQLSDFIEAD--QESPEEHVEKSMLRDDLENVI-NSLSPRE  385

Query  502  GEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAAR  359
             +++R+ YG+ D    T E+I +   ++RERVRQ+   A+ KL+   R
Sbjct  386  RDVVRMRYGLDDGRIKTLEEIGQIFSVTRERVRQIEAKAIRKLRQPYR  433



>ref|WP_022319742.1| RNA polymerase sigma factor [Dorea sp. CAG:317]
 emb|CDD06528.1| rNA polymerase sigma factor [Dorea sp. CAG:317]
Length=370

 Score = 89.4 bits (220),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 59/175 (34%), Positives = 100/175 (57%), Gaps = 13/175 (7%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLS-LIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAI  683
            A+AD +R +R+P H+ E ++ LIR +++ L+E G  P+ E IAE L+M  ++VR      
Sbjct  200  AIADQARTIRIPVHMVETINKLIRVSRQLLQELGREPTPEEIAEELDMPVERVRE-----  254

Query  682  SRVYSLDREAFPSLNGLPGETLHSYIADNHLENN---PWHGVDEWALKDEVKNLICTTLR  512
              +  + +E   SL    GE   S++ D   ++N   P     +  LK+++   +  TL 
Sbjct  255  --ILKISQEPV-SLETPIGEEEDSHLGDFIQDDNVPVPAEAAAQTLLKEQLDE-VLDTLT  310

Query  511  EREGEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKL  347
            ERE +++RL +G+ D    T E++ +   ++RER+RQ+   AL KL+H +R RKL
Sbjct  311  EREQKVLRLRFGMNDGRARTLEEVGKEFDVTRERIRQIEAKALRKLRHPSRSRKL  365



>ref|WP_026369250.1| RNA polymerase sigma factor RpoD [bacterium JKG1]
Length=379

 Score = 89.7 bits (221),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 60/176 (34%), Positives = 96/176 (55%), Gaps = 7/176 (4%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEEKGI-TPSIERIAESLNMSQKKVRNATEAI  683
            A+AD SR +RLP H+ E +S ++ A  +L++     P+ E IAE+L ++  KVR   EA 
Sbjct  209  AIADQSRTIRLPVHMGEAISQVKRASHKLQQSMQREPTPEEIAEALGITAGKVRRTLEAS  268

Query  682  SRVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLRERE  503
                SL+        G  G+    +I D+ L   P     +  L+++++  +   L ERE
Sbjct  269  MHPLSLEMPVGQDGEGRMGD----FIEDDRL-ATPAEAAAQSMLREQIEE-VLEKLPERE  322

Query  502  GEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAML  335
             +II+L YG+ D +  T E++    G++RER+RQ+  VAL KL+H    +KL   L
Sbjct  323  RKIIQLRYGLKDGKYRTLEEVGLEFGITRERIRQIEAVALRKLRHPYLGKKLRGYL  378



>ref|WP_016218807.1| RNA polymerase sigma factor rpoD [Dorea sp. 5-2]
 gb|EOS80197.1| RNA polymerase sigma factor rpoD [Dorea sp. 5-2]
Length=371

 Score = 89.4 bits (220),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 59/175 (34%), Positives = 100/175 (57%), Gaps = 13/175 (7%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLS-LIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAI  683
            A+AD +R +R+P H+ E ++ LIR +++ L+E G  P+ E IAE L+M  ++VR      
Sbjct  201  AIADQARTIRIPVHMVETINKLIRVSRQLLQELGREPTPEEIAEELDMPVERVRE-----  255

Query  682  SRVYSLDREAFPSLNGLPGETLHSYIADNHLENN---PWHGVDEWALKDEVKNLICTTLR  512
              +  + +E   SL    GE   S++ D   ++N   P     +  LK+++   +  TL 
Sbjct  256  --ILKISQEPV-SLETPIGEEEDSHLGDFIQDDNVPVPAEAAAQTLLKEQLDE-VLDTLT  311

Query  511  EREGEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKL  347
            ERE +++RL +G+ D    T E++ +   ++RER+RQ+   AL KL+H +R RKL
Sbjct  312  EREQKVLRLRFGMNDGRARTLEEVGKEFDVTRERIRQIEAKALRKLRHPSRSRKL  366



>ref|WP_041904229.1| RNA polymerase sigma factor rpoD [Latescibacteria bacterium SCGC 
AAA252-B13]
Length=286

 Score = 88.6 bits (218),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 64/176 (36%), Positives = 99/176 (56%), Gaps = 7/176 (4%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLE-EKGITPSIERIAESLNMSQKKVRNATEAI  683
            ALA+ SR++RLP +    L  I     +LE E G  PS   IA+ L MS  +V ++ +  
Sbjct  115  ALAEQSRIVRLPLNRVGTLHKIGKVSSKLEQEFGRKPSSYEIADYLEMSPDEVSDSLKIS  174

Query  682  SRVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLRERE  503
            SR +SLD    P   G   + L   + ++  +  P   + + +LK+EV+  I +TL ERE
Sbjct  175  SRHFSLDA---PFKVGESNKLLD--VLEDKFQPKPDKEIMKVSLKEEVEKAI-STLTERE  228

Query  502  GEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAML  335
             E+I LY+GI  +  LT E+I  +  L+R+RVRQ+   AL++LKH  R + L+  +
Sbjct  229  AEVISLYFGINRDHALTLEEIGVKFNLTRKRVRQIKGKALKRLKHPKRSKPLKTFI  284



>gb|AFP65672.1| RNA-polymerase sigma factor [Chroomonas mesostigmatica CCMP1168]
Length=485

 Score = 90.5 bits (223),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 57/168 (34%), Positives = 99/168 (59%), Gaps = 7/168 (4%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLE-EKGITPSIERIAESLNMSQKKVRNATEAI  683
            A+AD+SR +RLP H+++ +S IR   + L  E G +P+ E IAE ++MS +K+R+  ++ 
Sbjct  275  AIADHSRTIRLPVHLYDTISAIRKTTRTLNIEIGRSPTEEEIAEKMDMSVEKLRSVLQSA  334

Query  682  SRVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLRERE  503
                SL+R   P  N      L  +I  +  + +P   V++  L+D+++N+I  +L  RE
Sbjct  335  QPTLSLER---PLKNDDDASQLSDFIEAD--QESPEEHVEKSMLRDDLENVI-NSLSPRE  388

Query  502  GEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAAR  359
             +++R+ YG+ D    T E+I +   ++RERVRQ+   A+ KL+   R
Sbjct  389  RDVVRMRYGLDDGRIKTLEEIGQIFSVTRERVRQIEAKAIRKLRQPYR  436



>ref|WP_022172950.1| RNA polymerase sigma factor [Blautia sp. CAG:52]
 emb|CDB20928.1| rNA polymerase sigma factor [Blautia sp. CAG:52]
Length=369

 Score = 89.4 bits (220),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 60/179 (34%), Positives = 102/179 (57%), Gaps = 13/179 (7%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLS-LIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAI  683
            A+AD +R +R+P H+ E ++ LIR +++ L+E G  P+ E IAE +NM  ++VR      
Sbjct  199  AIADQARTIRIPVHMVETINKLIRVSRQLLQELGREPTPEEIAEEMNMPVERVRE-----  253

Query  682  SRVYSLDREAFPSLNGLPGETLHSYIADNHLENN---PWHGVDEWALKDEVKNLICTTLR  512
              +  + +E   SL    GE   S++ D   ++N   P        LK+++   + +TL 
Sbjct  254  --ILKISQEPV-SLETPIGEEEDSHLGDFIQDDNVPVPADAAAFTLLKEQLVE-VLSTLT  309

Query  511  EREGEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAML  335
            ERE +++RL +G+ D    T E++ +   ++RER+RQ+   AL KL+H +R RKL+  L
Sbjct  310  EREQKVLRLRFGLDDGRARTLEEVGKEFSVTRERIRQIEAKALRKLRHPSRSRKLKDYL  368



>ref|WP_022338948.1| RNA polymerase sigma factor [Clostridium sp. CAG:433]
 emb|CDD29951.1| rNA polymerase sigma factor [Clostridium sp. CAG:433]
Length=363

 Score = 89.0 bits (219),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 60/182 (33%), Positives = 108/182 (59%), Gaps = 17/182 (9%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLE-EKGITPSIERIAESLNMSQKKVRNATEAI  683
            A+AD ++ +R+P H+ E ++ ++  ++++  E    P+ E +A++LN ++ KVR   +  
Sbjct  192  AIADQAKTIRVPVHMVETINKLKRVQRQMTLELDREPTEEELAKALNTTEDKVREIIK--  249

Query  682  SRVYSLDREAFP-SLNGLPGETLHSYIADNHLENNPWHGVDEWA----LKDEVKNLICTT  518
                SLD    P SL    GE   S++ D  ++++     +E+A    LKDE+  L+ T 
Sbjct  250  ---ISLD----PLSLETPIGEEDDSHLGD-FVKDDSSLSPEEYAINEVLKDEISELLLT-  300

Query  517  LREREGEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAM  338
            L ERE ++I+L +G++D  C T E++    G++RER+RQ+   AL KL+H +R +KL+  
Sbjct  301  LTEREEQVIKLRFGLIDGTCRTLEEVGTIFGVTRERIRQIEAKALRKLRHPSRSKKLKDY  360

Query  337  LI  332
            L+
Sbjct  361  LV  362



>dbj|BAB87262.1| RNA polymerase sigma factor [Guillardia theta]
Length=490

 Score = 90.5 bits (223),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 57/168 (34%), Positives = 99/168 (59%), Gaps = 7/168 (4%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLE-EKGITPSIERIAESLNMSQKKVRNATEAI  683
            A+AD+SR +RLP H+++ +S IR   + L  E G +P+ E IAE ++MS +K+R+  ++ 
Sbjct  272  AIADHSRTIRLPVHLYDTISAIRKTTRTLNIEIGRSPTEEEIAEKMDMSVEKLRSVLQSA  331

Query  682  SRVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLRERE  503
                SL+R   P  N      L  +I  +  + +P   V++  L+D+++N+I  +L  RE
Sbjct  332  QPTLSLER---PLKNDDDASQLSDFIEAD--QESPEEHVEKSMLRDDLENVI-NSLSPRE  385

Query  502  GEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAAR  359
             +++R+ YG+ D    T E+I +   ++RERVRQ+   A+ KL+   R
Sbjct  386  RDVVRMRYGLDDGRIKTLEEIGQIFSVTRERVRQIEAKAIRKLRQPYR  433



>ref|WP_022270001.1| RNA polymerase sigma factor [Firmicutes bacterium CAG:424]
 emb|CDC42675.1| rNA polymerase sigma factor [Firmicutes bacterium CAG:424]
Length=373

 Score = 89.4 bits (220),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 61/179 (34%), Positives = 101/179 (56%), Gaps = 13/179 (7%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLS-LIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAI  683
            A+AD +R +R+P H+ E ++ LIR +++ L+E G  P  E IAE +NMS ++VR      
Sbjct  203  AIADQARTIRIPVHMVETINKLIRVSRQLLQELGREPQPEEIAEEMNMSVERVRE-----  257

Query  682  SRVYSLDREAFPSLNGLPGETLHSYIADNHLENN---PWHGVDEWALKDEVKNLICTTLR  512
              +  + +E   SL    GE   S++ D   ++N   P        LK+++   +  TL 
Sbjct  258  --ILKISQEPV-SLETPIGEEEDSHLGDFIQDDNVPVPADAAAFTLLKEQLVE-VLGTLT  313

Query  511  EREGEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAML  335
            ERE +++RL +G+ D    T E++ +   ++RER+RQ+   AL KL+H +R RKL+  L
Sbjct  314  EREQKVLRLRFGLDDGRARTLEEVGKEFNVTRERIRQIEAKALRKLRHPSRSRKLKDYL  372



>ref|WP_022398535.1| RNA polymerase sigma factor [Roseburia sp. CAG:471]
 emb|CDD99583.1| rNA polymerase sigma factor [Roseburia sp. CAG:471]
Length=369

 Score = 89.0 bits (219),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 60/179 (34%), Positives = 102/179 (57%), Gaps = 13/179 (7%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLS-LIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAI  683
            A+AD +R +R+P H+ E ++ LIR +++ L+E G  P+ E IAE +NM  ++VR      
Sbjct  199  AIADQARTIRIPVHMVETINKLIRVSRQLLQELGREPTPEEIAEEMNMPVERVRE-----  253

Query  682  SRVYSLDREAFPSLNGLPGETLHSYIADNHLENN---PWHGVDEWALKDEVKNLICTTLR  512
              +  + +E   SL    GE   S++ D   ++N   P        LK+++   + +TL 
Sbjct  254  --ILKISQEPV-SLETPIGEEEDSHLGDFIQDDNVPVPADAAAFTLLKEQLVE-VLSTLT  309

Query  511  EREGEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAML  335
            ERE +++RL +G+ D    T E++ +   ++RER+RQ+   AL KL+H +R RKL+  L
Sbjct  310  EREQKVLRLRFGLDDGRARTLEEVGKEFSVTRERIRQIEAKALRKLRHPSRSRKLKDYL  368



>ref|WP_035642681.1| RNA polymerase sigma70 factor [Lachnospiraceae bacterium FE2018]
Length=374

 Score = 89.0 bits (219),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 61/179 (34%), Positives = 103/179 (58%), Gaps = 13/179 (7%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLS-LIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAI  683
            A+AD +R +R+P H+ E ++ LIR +++ L+E G  P+ E I++ +NMS  +VR      
Sbjct  204  AIADQARTIRIPVHMVETINKLIRVSRQLLQELGREPTPEEISKEMNMSVDRVRE-----  258

Query  682  SRVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWA---LKDEVKNLICTTLR  512
              +  + +E   SL    GE   S++ D   ++N     D  A   LK++++  +  TL 
Sbjct  259  --ILKISQEPV-SLETPIGEEEDSHLGDFIRDDNAPIPADAAAFTMLKEQLEE-VLDTLT  314

Query  511  EREGEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAML  335
            ERE +++RL +G+ D    T E++ R   ++RER+RQ+   AL KL+H +R RKL+  L
Sbjct  315  EREQKVLRLRFGLDDGRARTLEEVGREFNVTRERIRQIEAKALRKLRHPSRSRKLKDYL  373



>ref|WP_003021111.1| RNA polymerase sigma factor RpoD [Blautia hansenii]
 gb|EEX21618.1| RNA polymerase sigma factor RpoD [Blautia hansenii DSM 20583]
Length=330

 Score = 88.6 bits (218),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 61/179 (34%), Positives = 101/179 (56%), Gaps = 13/179 (7%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLS-LIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAI  683
            A+AD +R +R+P H+ E ++ LIR +++ L+E G  P  E IAE +NMS ++VR      
Sbjct  160  AIADQARTIRIPVHMVETINKLIRVSRQLLQELGREPHPEEIAEEMNMSVERVRE-----  214

Query  682  SRVYSLDREAFPSLNGLPGETLHSYIADNHLENN---PWHGVDEWALKDEVKNLICTTLR  512
              +  + +E   SL    GE   S++ D   ++N   P        LK+++   +  TL 
Sbjct  215  --ILKISQEPV-SLETPIGEEEDSHLGDFIQDDNVPVPADAAAFTLLKEQLVE-VLGTLT  270

Query  511  EREGEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAML  335
            ERE +++RL +G+ D    T E++ +   ++RER+RQ+   AL KL+H +R RKL+  L
Sbjct  271  EREQKVLRLRFGLDDGRARTLEEVGKEFNVTRERIRQIEAKALRKLRHPSRSRKLKDYL  329



>dbj|GAN34470.1| RNA polymerase primary sigma factor [Candidatus Brocadia sinica 
JPN1]
Length=493

 Score = 90.1 bits (222),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 63/185 (34%), Positives = 103/185 (56%), Gaps = 25/185 (14%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLS----LIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNAT  692
            A+ D +RM+R+P H+ + ++    ++RN+++ L++K   P +E IA          + A 
Sbjct  318  AIDDKARMVRIPVHMTDVINKTNKVLRNSQECLDKK---PKLETIA----------KEAK  364

Query  691  EAISRVYSLDREAFPSLN-----GLPGETLH-SYIADNHLENNPWHGVDEWALKDEVKNL  530
              +S VY + R A   ++     G  GET+   +I D  +E+ P   V +  LKD+++  
Sbjct  365  IPVSEVYRVFRIASQPISLENPIGDDGETMFEDFIQDKKMES-PISAVHQSLLKDQLQK-  422

Query  529  ICTTLREREGEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRK  350
            +  TL  RE E+I+L +GI D    T E+I  R  ++RER+RQ+  VA+ KL+H  R RK
Sbjct  423  VLNTLNHREREVIKLRFGIGDGYTHTLEEIGERFNITRERIRQIETVAIRKLQHPLRSRK  482

Query  349  LEAML  335
            LE  L
Sbjct  483  LEGFL  487



>ref|XP_001713512.1| RNA-polymerase sigma factor [Guillardia theta]
 gb|AAK39807.1|AF165818_15 RNA-polymerase sigma factor [Guillardia theta]
Length=460

 Score = 90.1 bits (222),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 57/168 (34%), Positives = 99/168 (59%), Gaps = 7/168 (4%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLE-EKGITPSIERIAESLNMSQKKVRNATEAI  683
            A+AD+SR +RLP H+++ +S IR   + L  E G +P+ E IA+ ++MS +K+RN  ++ 
Sbjct  255  AIADHSRTIRLPVHLYDTISAIRKTTRNLNIEIGRSPTEEEIAKRMDMSVEKLRNVLQSA  314

Query  682  SRVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLRERE  503
                SL+R   P  N      L  +I  +  + +P   V++  L+D+++N+I  +L  RE
Sbjct  315  QPTLSLER---PLKNDDDTSQLSDFIEAD--QESPEEHVEKSMLRDDLENVI-NSLSPRE  368

Query  502  GEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAAR  359
             +++R+ YG+ D    T E+I +   ++RERVRQ+   A+ KL+   R
Sbjct  369  RDVVRMRYGLDDGRIKTLEEIGQIFSVTRERVRQIEAKAIRKLRQPYR  416



>ref|WP_035614203.1| RNA polymerase sigma factor [Haloferula sp. BvORR071]
Length=641

 Score = 90.9 bits (224),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 57/176 (32%), Positives = 100/176 (57%), Gaps = 7/176 (4%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLS-LIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAI  683
            ++AD +R +R+P H+ E ++ L+R  K+ ++E G  PS E IAE +++  ++VR   +  
Sbjct  467  SIADQARTIRIPVHMIETINKLMRVQKQLVQEYGREPSPEEIAEEIHLPVERVRAVLKMA  526

Query  682  SRVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLRERE  503
             +  SL      S +   G+ +    ADN +E   +       LKD++K+++  TL ERE
Sbjct  527  QQPISLQAPVGDSDDTSFGDFIEDKSADNPMEEAGFS-----MLKDKIKDVL-DTLTERE  580

Query  502  GEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAML  335
             E++   +G+ D    T E++ R+  ++RER+RQ+   AL K++H  R RKLE  +
Sbjct  581  REVLEQRFGLKDGYSRTLEEVGRQFQVTRERIRQIEAKALRKMRHPTRIRKLEGFI  636



>ref|WP_045646239.1| RNA polymerase sigma factor RpoD [Peptococcaceae bacterium BRH_c4b]
 gb|KJS15243.1| RNA polymerase sigma factor RpoD [Peptococcaceae bacterium BRH_c4b]
Length=362

 Score = 89.0 bits (219),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 57/179 (32%), Positives = 100/179 (56%), Gaps = 13/179 (7%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLS-LIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAI  683
            A+AD +R +R+P H+ E ++ LIR +++ L+E G  P  E IA+ +N+SQ+KVR   +  
Sbjct  192  AIADQARTIRIPVHMVETINKLIRVSRQLLQELGREPLPEEIAQEMNISQEKVREIMKIA  251

Query  682  SRVYSLDREAFPSLNGLPGETLHSYIAD---NHLENNPWHGVDEWALKDEVKNLICTTLR  512
                SL+           GE   S++ D   +H    P        L++++   +  TL 
Sbjct  252  QEPVSLETPI--------GEEEDSHLGDFIEDHDARAPAEEASFTLLREQLDE-VLKTLT  302

Query  511  EREGEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAML  335
            +RE +++RL +G+ D    T E++ ++ G++RER+RQ+    L KL+H +R +KL+  L
Sbjct  303  DREQKVLRLRFGLDDGRARTLEEVGQKFGVTRERIRQIEAKTLRKLRHPSRSKKLKDYL  361



>ref|WP_027641114.1| RNA polymerase sigma70 factor [[Clostridium] clostridioforme]
Length=406

 Score = 89.4 bits (220),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 57/176 (32%), Positives = 100/176 (57%), Gaps = 7/176 (4%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEEK-GITPSIERIAESLNMSQKKVRNATEAI  683
            +LAD SR +RLP H+ E ++ IR A++ L  K G  PS+E +AE +NMS+K+V    +A 
Sbjct  236  SLADQSRTIRLPVHMVEAVNKIRRAQRSLSVKLGREPSMEEVAEEVNMSEKRVAELIQAS  295

Query  682  SRVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLRERE  503
                SL+      +    G  L  ++AD+    +     + + L++E+ +++   L  RE
Sbjct  296  GDTVSLE----TPVGDEEGSNLGDFVADDA-NASTEDKAESFLLREEIDSML-QGLNPRE  349

Query  502  GEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAML  335
             E+I L +G+     LT E++ +R  ++RER+RQ+   AL KL++ ++ +K+   L
Sbjct  350  REVIILRFGLETGHPLTLEEVGKRFNVTRERIRQIETAALRKLRNPSKSKKIRDFL  405



>ref|WP_044902992.1| RNA polymerase sigma70 factor [Lachnospiraceae bacterium P6B14]
Length=382

 Score = 89.0 bits (219),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 60/179 (34%), Positives = 99/179 (55%), Gaps = 13/179 (7%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLS-LIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAI  683
            A+AD +R +R+P H+ E ++ LIR  ++ L+E G  P  E IAE +N+   +VR      
Sbjct  212  AIADQARTIRIPVHMVETINKLIRVQRQLLQELGREPYPEEIAEKMNLPVDRVRE-----  266

Query  682  SRVYSLDREAFPSLNGLPGETLHSYIADNHLENN---PWHGVDEWALKDEVKNLICTTLR  512
              +  + +E   SL    GE   S++ D   ++N   P     E  LK+++   +  TL 
Sbjct  267  --IQKISQEPV-SLETPIGEEEDSHLGDFIQDDNVPVPSEAAAETMLKEQLDE-VLKTLT  322

Query  511  EREGEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAML  335
            ERE +++RL +G+ D    T E++ +   ++RER+RQ+   AL KL+H +R RKL+  L
Sbjct  323  EREKKVLRLRFGLDDQRARTLEEVGKEFDVTRERIRQIEAKALRKLRHPSRSRKLKDYL  381



>ref|WP_002645726.1| RNA polymerase sigma70 [Planctomyces maris]
 gb|EDL60213.1| transcription initiation factor sigma 70 [Planctomyces maris 
DSM 8797]
Length=561

 Score = 90.5 bits (223),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 58/179 (32%), Positives = 97/179 (54%), Gaps = 13/179 (7%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRL-EEKGITPSIERIAESLNMSQKKVRNATEAI  683
            A+AD +R +R+P H+ E +S +R   K+L +E G  P++E  AE   +S ++ R   +  
Sbjct  367  AIADQARTIRIPVHMIETMSKLRKVSKQLLQENGREPTLEETAEVAGISLEETRRVLKIS  426

Query  682  SRVYSLDREAFPSLNGLPGETLHSYIAD---NHLENNPWHGVDEWALKDEVKNLICTTLR  512
                SLDR          GE+  SY  D   +   ++P +   +  LKD++ + +  TL 
Sbjct  427  RHPISLDRPV--------GESEDSYFGDFIEDSDSDSPVNTASQEMLKDKIDH-VLKTLT  477

Query  511  EREGEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAML  335
             RE EII+L +G+ D    T E++ R   ++RERVRQ+   A+ KL+H  R ++L+  +
Sbjct  478  YREREIIKLRFGLGDGYTYTLEEVGRIFKVTRERVRQIEAKAVRKLQHPVRSKQLQGFI  536



>ref|WP_004602370.1| RNA polymerase sigma factor RpoD [[Eubacterium] cellulosolvens]
 gb|EIM56231.1| RNA polymerase sigma factor, sigma-70 family [ [[Eubacterium] 
cellulosolvens 6]
Length=373

 Score = 89.0 bits (219),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 60/179 (34%), Positives = 103/179 (58%), Gaps = 13/179 (7%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLS-LIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAI  683
            A+AD +R +R+P H+ E ++ LIR +++ L+E G  P+ E IA+++NMS ++VR      
Sbjct  203  AIADQARTIRIPVHMVETINKLIRVSRQLLQEYGREPTPEEIAKNMNMSVERVRE-----  257

Query  682  SRVYSLDREAFPSLNGLPGETLHSYIADNHLENN---PWHGVDEWALKDEVKNLICTTLR  512
              +  + +E   SL    GE   S++ D   + N   P        LK++++  +  TL 
Sbjct  258  --ILKISQEPV-SLETPIGEEEDSHLGDFIQDENVPVPADAAAFTMLKEQLEE-VLGTLA  313

Query  511  EREGEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAML  335
            ERE +++RL +G+ D    T E++ +   ++RER+RQ+   AL KL+H +R RKL+  L
Sbjct  314  EREQKVLRLRFGLDDGRARTLEEVGKEFNVTRERIRQIEAKALRKLRHPSRSRKLKDYL  372



>gb|AEV88019.1| RNA polymerase principal sigma factor hrdB [Actinoplanes sp. 
SE50/110]
Length=329

 Score = 88.2 bits (217),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 61/180 (34%), Positives = 98/180 (54%), Gaps = 13/180 (7%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEEK-GITPSIERIAESLNMSQKKVRNATEAI  683
            A+AD +R +R+P H+ E+++ +  A++ L  + G  PSI  IA ++ + + +V       
Sbjct  159  AMADQARTIRIPVHMVEQVNRMVRARRDLSAQLGREPSIAEIATAMAVPEFQV-------  211

Query  682  SRVYSLDREAFPSLNGLPGETLHSYIADNHLE---NNPWHGVDEWALKDEVKNLICTTLR  512
              + S DRE   SL+   GE   S + D       N P  GV +  L+ EV+ ++  TL 
Sbjct  212  IELISYDREPV-SLDQAVGEDGESALGDFVAAVDPNQPGEGVSQGELRSEVE-IVLATLS  269

Query  511  EREGEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAMLI  332
            ERE  +IRL +G+ D    T +++ R  GLSRER+RQ+  V + KL+   R  +LEA  +
Sbjct  270  ERESAVIRLRFGLDDGRQRTLDEVGREFGLSRERIRQIEKVTMLKLRDPERASRLEAYAV  329



>ref|WP_044916468.1| RNA polymerase sigma70 factor [Clostridiales bacterium VE202-27]
Length=375

 Score = 89.0 bits (219),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 60/178 (34%), Positives = 101/178 (57%), Gaps = 11/178 (6%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLS-LIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAI  683
            A+AD +R +R+P H+ E ++ LIR +++ L+E G  P+ E IAE ++M  ++VR      
Sbjct  205  AIADQARTIRIPVHMVETINKLIRVSRQLLQELGREPTPEEIAEEMSMPVERVRE-----  259

Query  682  SRVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDE--WALKDEVKNLICTTLRE  509
              +  + +E   SL    GE   S++ D   ++N     D   ++L  E  N +  TL E
Sbjct  260  --ILKISQEPV-SLETPIGEEEDSHLGDFIQDDNVPVPADAAAFSLLKEQLNEVLGTLTE  316

Query  508  REGEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAML  335
            RE +++RL +G+ D    T E++ +   ++RER+RQ+   AL KL+H +R RKL+  L
Sbjct  317  REQKVLRLRFGLDDGRARTLEEVGKEFNVTRERIRQIEAKALRKLRHPSRSRKLKDYL  374



>ref|WP_043516178.1| RNA polymerase sigma factor SigB [Actinoplanes sp. SE50/110]
Length=317

 Score = 88.2 bits (217),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 61/180 (34%), Positives = 98/180 (54%), Gaps = 13/180 (7%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEEK-GITPSIERIAESLNMSQKKVRNATEAI  683
            A+AD +R +R+P H+ E+++ +  A++ L  + G  PSI  IA ++ + + +V       
Sbjct  147  AMADQARTIRIPVHMVEQVNRMVRARRDLSAQLGREPSIAEIATAMAVPEFQV-------  199

Query  682  SRVYSLDREAFPSLNGLPGETLHSYIADNHLE---NNPWHGVDEWALKDEVKNLICTTLR  512
              + S DRE   SL+   GE   S + D       N P  GV +  L+ EV+ ++  TL 
Sbjct  200  IELISYDREPV-SLDQAVGEDGESALGDFVAAVDPNQPGEGVSQGELRSEVE-IVLATLS  257

Query  511  EREGEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAMLI  332
            ERE  +IRL +G+ D    T +++ R  GLSRER+RQ+  V + KL+   R  +LEA  +
Sbjct  258  ERESAVIRLRFGLDDGRQRTLDEVGREFGLSRERIRQIEKVTMLKLRDPERASRLEAYAV  317



>ref|WP_009246158.1| MULTISPECIES: RNA polymerase sigma factor RpoD [Lachnospiraceae]
 gb|EGG85194.1| RNA polymerase sigma factor rpoD [Lachnospiraceae bacterium 6_1_63FAA]
 emb|CDC10967.1| rNA polymerase sigma factor [Lachnospiraceae bacterium CAG:364]
Length=374

 Score = 88.6 bits (218),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 61/179 (34%), Positives = 101/179 (56%), Gaps = 13/179 (7%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLS-LIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAI  683
            A+AD +R +R+P H+ E ++ LIR +++ L+E G  P  E IAE +NMS ++VR      
Sbjct  204  AIADQARTIRIPVHMVETINKLIRVSRQLLQELGREPHPEEIAEEMNMSVERVRE-----  258

Query  682  SRVYSLDREAFPSLNGLPGETLHSYIADNHLENN---PWHGVDEWALKDEVKNLICTTLR  512
              +  + +E   SL    GE   S++ D   ++N   P        LK+++   +  TL 
Sbjct  259  --ILKISQEPV-SLETPIGEEEDSHLGDFIQDDNVPVPADAAAFTLLKEQLVE-VLGTLT  314

Query  511  EREGEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAML  335
            ERE +++RL +G+ D    T E++ +   ++RER+RQ+   AL KL+H +R RKL+  L
Sbjct  315  EREQKVLRLRFGLDDGRARTLEEVGKEFNVTRERIRQIEAKALRKLRHPSRSRKLKDYL  373



>ref|WP_021620497.1| RNA polymerase sigma factor RpoD [Aneurinibacillus aneurinilyticus]
 gb|ERI09902.1| RNA polymerase sigma factor RpoD [Aneurinibacillus aneurinilyticus 
ATCC 12856]
Length=377

 Score = 88.6 bits (218),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 58/179 (32%), Positives = 102/179 (57%), Gaps = 13/179 (7%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLS-LIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAI  683
            A+AD +R +R+P H+ E ++ LIR +++ L+E G  PS E IAE ++++ +KVR   +  
Sbjct  207  AIADQARTIRIPVHMVETINKLIRVSRQLLQELGREPSPEEIAEKMDLTPEKVREIMKIA  266

Query  682  SRVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWA---LKDEVKNLICTTLR  512
                SL+           GE   S++ D   + +     D  A   LK+++++ +  TL 
Sbjct  267  QEPVSLETPI--------GEEDDSHLGDFIEDQDALAPSDAAAYELLKEQLED-VLDTLT  317

Query  511  EREGEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAML  335
            ERE  ++RL +G+ D    T E++ +  G++RER+RQ+   AL KL+H +R ++L+  L
Sbjct  318  EREENVLRLRFGLDDGRTRTLEEVGKVFGVTRERIRQIEAKALRKLRHPSRSKRLKDFL  376



>ref|WP_016214220.1| RNA polymerase sigma factor rpoD [Eubacterium sp. 14-2]
 gb|EOT27058.1| RNA polymerase sigma factor rpoD [Eubacterium sp. 14-2]
Length=365

 Score = 88.6 bits (218),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 61/179 (34%), Positives = 100/179 (56%), Gaps = 13/179 (7%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLS-LIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAI  683
            A+AD +R +R+P H+ E ++ LIR +++ L+E G  PS E IAE +NM   +VR      
Sbjct  195  AIADQARTIRIPVHMVETINKLIRVSRQLLQELGREPSPEEIAEEMNMPVDRVRE-----  249

Query  682  SRVYSLDREAFPSLNGLPGETLHSYIADNHLENN---PWHGVDEWALKDEVKNLICTTLR  512
              +  + +E   SL    GE   S++ D   ++N   P        LK+++   +  TL 
Sbjct  250  --ILKISQEPV-SLETPIGEEEDSHLGDFIQDDNVPVPADAAAFTLLKEQLVE-VLGTLT  305

Query  511  EREGEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAML  335
            ERE +++RL +G+ D    T E++ +   ++RER+RQ+   AL KL+H +R RKL+  L
Sbjct  306  EREQKVLRLRFGLDDGRARTLEEVGKEFNVTRERIRQIEAKALRKLRHPSRSRKLKDYL  364



>ref|WP_009250189.1| RNA polymerase sigma factor RpoD [Clostridiales bacterium VE202-29]
 gb|EGN37879.1| RNA polymerase sigma factor rpoD [Lachnospiraceae bacterium 3_1_57FAA_CT1]
Length=397

 Score = 89.0 bits (219),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 60/178 (34%), Positives = 101/178 (57%), Gaps = 11/178 (6%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLS-LIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAI  683
            A+AD +R +R+P H+ E ++ LIR +++ L+E G  P+ E IAE ++M  ++VR      
Sbjct  227  AIADQARTIRIPVHMVETINKLIRVSRQLLQELGREPTPEEIAEEMSMPVERVRE-----  281

Query  682  SRVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDE--WALKDEVKNLICTTLRE  509
              +  + +E   SL    GE   S++ D   ++N     D   ++L  E  N +  TL E
Sbjct  282  --ILKISQEPV-SLETPIGEEEDSHLGDFIQDDNVPVPADAAAFSLLKEQLNEVLGTLTE  338

Query  508  REGEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAML  335
            RE +++RL +G+ D    T E++ +   ++RER+RQ+   AL KL+H +R RKL+  L
Sbjct  339  REQKVLRLRFGLDDGRARTLEEVGKEFNVTRERIRQIEAKALRKLRHPSRSRKLKDYL  396



>ref|WP_031389425.1| RNA polymerase sigma70 factor [Clostridium sp. KNHs209]
Length=370

 Score = 88.6 bits (218),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 61/179 (34%), Positives = 100/179 (56%), Gaps = 13/179 (7%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLS-LIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAI  683
            A+AD +R +R+P H+ E ++ LIR +++ L+E G  PS E IAE +NM   +VR      
Sbjct  200  AIADQARTIRIPVHMVETINKLIRVSRQLLQELGREPSPEEIAEEMNMPVDRVRE-----  254

Query  682  SRVYSLDREAFPSLNGLPGETLHSYIADNHLENN---PWHGVDEWALKDEVKNLICTTLR  512
              +  + +E   SL    GE   S++ D   ++N   P        LK+++   +  TL 
Sbjct  255  --ILKISQEPV-SLETPIGEEEDSHLGDFIQDDNVPVPADAAAFTLLKEQLVE-VLGTLT  310

Query  511  EREGEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAML  335
            ERE +++RL +G+ D    T E++ +   ++RER+RQ+   AL KL+H +R RKL+  L
Sbjct  311  EREQKVLRLRFGLDDGRARTLEEVGKEFNVTRERIRQIEAKALRKLRHPSRSRKLKDYL  369



>ref|WP_044971698.1| MULTISPECIES: RNA polymerase sigma70 factor [Clostridiales]
Length=375

 Score = 88.6 bits (218),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 60/178 (34%), Positives = 101/178 (57%), Gaps = 11/178 (6%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLS-LIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAI  683
            A+AD +R +R+P H+ E ++ LIR +++ L+E G  P+ E IAE ++M  ++VR      
Sbjct  205  AIADQARTIRIPVHMVETINKLIRVSRQLLQELGREPTPEEIAEEMSMPVERVRE-----  259

Query  682  SRVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDE--WALKDEVKNLICTTLRE  509
              +  + +E   SL    GE   S++ D   ++N     D   ++L  E  N +  TL E
Sbjct  260  --ILKISQEPV-SLETPIGEEEDSHLGDFIQDDNVPVPADAAAFSLLKEQLNEVLGTLTE  316

Query  508  REGEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAML  335
            RE +++RL +G+ D    T E++ +   ++RER+RQ+   AL KL+H +R RKL+  L
Sbjct  317  REQKVLRLRFGLDDGRARTLEEVGKEFNVTRERIRQIEAKALRKLRHPSRSRKLKDYL  374



>ref|WP_025491372.1| RNA polymerase sigma70 factor [Clostridium sp. KLE 1755]
Length=397

 Score = 89.0 bits (219),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 60/178 (34%), Positives = 101/178 (57%), Gaps = 11/178 (6%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLS-LIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAI  683
            A+AD +R +R+P H+ E ++ LIR +++ L+E G  P+ E IAE ++M  ++VR      
Sbjct  227  AIADQARTIRIPVHMVETINKLIRVSRQLLQELGREPTPEEIAEEMSMPVERVRE-----  281

Query  682  SRVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDE--WALKDEVKNLICTTLRE  509
              +  + +E   SL    GE   S++ D   ++N     D   ++L  E  N +  TL E
Sbjct  282  --ILKISQEPV-SLETPIGEEEDSHLGDFIQDDNVPVPADAAAFSLLKEQLNEVLGTLTE  338

Query  508  REGEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAML  335
            RE +++RL +G+ D    T E++ +   ++RER+RQ+   AL KL+H +R RKL+  L
Sbjct  339  REQKVLRLRFGLDDGRARTLEEVGKEFNVTRERIRQIEAKALRKLRHPSRSRKLKDYL  396



>ref|WP_008374891.1| MULTISPECIES: RNA polymerase sigma factor RpoD [Coprococcus]
 gb|EEG89380.1| RNA polymerase sigma factor RpoD [Coprococcus comes ATCC 27758]
 emb|CDB84314.1| rNA polymerase sigma factor [Coprococcus comes CAG:19]
Length=371

 Score = 88.6 bits (218),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 58/175 (33%), Positives = 99/175 (57%), Gaps = 13/175 (7%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLS-LIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAI  683
            A+AD +R +R+P H+ E ++ LIR +++ L+E G  P+ E IA  L+M   +VR      
Sbjct  201  AIADQARTIRIPVHMVETINKLIRVSRQLLQELGREPTPEEIAAELDMPVDRVRE-----  255

Query  682  SRVYSLDREAFPSLNGLPGETLHSYIADNHLENN---PWHGVDEWALKDEVKNLICTTLR  512
              +  + +E   SL    GE   S++ D   ++N   P     +  LK+++   + +TL 
Sbjct  256  --ILKISQEPV-SLETPIGEEEDSHLGDFIQDDNVPVPAEAAAQTLLKEQLDE-VLSTLT  311

Query  511  EREGEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKL  347
            ERE +++RL +G+ D    T E++ +   ++RER+RQ+   AL KL+H +R RKL
Sbjct  312  EREQKVLRLRFGMSDGRARTLEEVGKEFDVTRERIRQIEAKALRKLRHPSRSRKL  366



>gb|ERI65918.1| RNA polymerase sigma factor RpoD [Clostridium sp. KLE 1755]
Length=405

 Score = 89.0 bits (219),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 60/178 (34%), Positives = 101/178 (57%), Gaps = 11/178 (6%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLS-LIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAI  683
            A+AD +R +R+P H+ E ++ LIR +++ L+E G  P+ E IAE ++M  ++VR      
Sbjct  235  AIADQARTIRIPVHMVETINKLIRVSRQLLQELGREPTPEEIAEEMSMPVERVRE-----  289

Query  682  SRVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDE--WALKDEVKNLICTTLRE  509
              +  + +E   SL    GE   S++ D   ++N     D   ++L  E  N +  TL E
Sbjct  290  --ILKISQEPV-SLETPIGEEEDSHLGDFIQDDNVPVPADAAAFSLLKEQLNEVLGTLTE  346

Query  508  REGEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAML  335
            RE +++RL +G+ D    T E++ +   ++RER+RQ+   AL KL+H +R RKL+  L
Sbjct  347  REQKVLRLRFGLDDGRARTLEEVGKEFNVTRERIRQIEAKALRKLRHPSRSRKLKDYL  404



>ref|WP_043065621.1| RNA polymerase sigma factor RpoD [Aneurinibacillus migulanus]
 gb|KIV55224.1| RNA polymerase sigma factor RpoD [Aneurinibacillus migulanus]
 gb|KIV56670.1| RNA polymerase sigma factor RpoD [Aneurinibacillus migulanus]
Length=376

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 58/179 (32%), Positives = 102/179 (57%), Gaps = 13/179 (7%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLS-LIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAI  683
            A+AD +R +R+P H+ E ++ LIR +++ L+E G  PS E IAE ++++ +KVR   +  
Sbjct  206  AIADQARTIRIPVHMVETINKLIRVSRQLLQELGREPSPEEIAEKMDLTPEKVREIMKIA  265

Query  682  SRVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWA---LKDEVKNLICTTLR  512
                SL+           GE   S++ D   + +     D  A   LK+++++ +  TL 
Sbjct  266  QEPVSLETPI--------GEEDDSHLGDFIEDQDALAPSDAAAYELLKEQLED-VLDTLT  316

Query  511  EREGEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAML  335
            ERE  ++RL +G+ D    T E++ +  G++RER+RQ+   AL KL+H +R ++L+  L
Sbjct  317  EREENVLRLRFGLDDGRTRTLEEVGKVFGVTRERIRQIEAKALRKLRHPSRSKRLKDFL  375



>ref|WP_016294465.1| RNA polymerase sigma factor rpoD [Lachnospiraceae bacterium M18-1]
 gb|EOS40728.1| RNA polymerase sigma factor rpoD [Lachnospiraceae bacterium M18-1]
Length=371

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 59/175 (34%), Positives = 100/175 (57%), Gaps = 13/175 (7%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLS-LIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAI  683
            A+AD +R +R+P H+ E ++ LIR +++ L+E G  PS E IA+ L+M  ++VR      
Sbjct  201  AIADQARTIRIPVHMVETINKLIRVSRQLLQELGREPSPEEIAKELDMPVERVRE-----  255

Query  682  SRVYSLDREAFPSLNGLPGETLHSYIADNHLENN---PWHGVDEWALKDEVKNLICTTLR  512
              +  + +E   SL    GE   S++ D   ++N   P     +  LK+++   +  TL 
Sbjct  256  --ILKISQEPV-SLETPIGEEEDSHLGDFIQDDNVPVPAEAAAQTLLKEQLDE-VLDTLT  311

Query  511  EREGEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKL  347
            ERE +++RL +G+ D    T E++ +   ++RER+RQ+   AL KL+H +R RKL
Sbjct  312  EREQKVLRLRFGMNDGRARTLEEVGKEFDVTRERIRQIEAKALRKLRHPSRSRKL  366



>gb|AAB39998.1| sigma factor [Synechococcus sp. PCC 7002]
Length=398

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 55/165 (33%), Positives = 98/165 (59%), Gaps = 8/165 (5%)
 Frame = -3

Query  847  NSRMLRLPTHVHERLSLIRNAKKRLEE-KGITPSIERIAESLNMSQKKVRNATEAISRVY  671
             SR +RLP HV E+L+ I+ A++++ + +G TPS++ +A++L M+ ++VR   + + R  
Sbjct  230  QSRTIRLPVHVTEKLNKIKKAQRQISQTQGCTPSLDDVAQALEMTPEQVREVLQKVPRSV  289

Query  670  SLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLREREGEII  491
            SL+       +   G+ L +  A      +P   +   +L+ ++ NL+ T L +RE E+I
Sbjct  290  SLEIRVGKDRDTELGDLLETQDA------SPEENLVRESLQRDLHNLL-TELTDREREVI  342

Query  490  RLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARR  356
            +L YG+ D +  +  +I R + +SRERVRQ+   AL+KL+   RR
Sbjct  343  QLRYGLGDGKTYSLAEIGRMLDVSRERVRQIEAKALQKLRQPKRR  387



>ref|WP_027870836.1| RNA polymerase sigma70 factor [[Eubacterium] cellulosolvens]
Length=373

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 60/179 (34%), Positives = 102/179 (57%), Gaps = 13/179 (7%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLS-LIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAI  683
            A+AD +R +R+P H+ E ++ LIR +++ L+E G  P+ E IA+ +NMS ++VR      
Sbjct  203  AIADQARTIRIPVHMVETINKLIRVSRQLLQELGREPTPEEIAKDMNMSVERVRE-----  257

Query  682  SRVYSLDREAFPSLNGLPGETLHSYIADNHLENN---PWHGVDEWALKDEVKNLICTTLR  512
              +  + +E   SL    GE   S++ D   + N   P        LK++++  +  TL 
Sbjct  258  --ILKISQEPV-SLETPIGEEEDSHLGDFIQDENVPVPADAAAFTMLKEQLEE-VLGTLA  313

Query  511  EREGEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAML  335
            ERE +++RL +G+ D    T E++ +   ++RER+RQ+   AL KL+H +R RKL+  L
Sbjct  314  EREQKVLRLRFGLDDGRARTLEEVGKEFNVTRERIRQIEAKALRKLRHPSRSRKLKDYL  372



>ref|WP_022068647.1| RNA polymerase sigma factor [Blautia sp. CAG:257]
 emb|CDA05901.1| rNA polymerase sigma factor [Blautia sp. CAG:257]
Length=374

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 61/179 (34%), Positives = 101/179 (56%), Gaps = 13/179 (7%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLS-LIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAI  683
            A+AD +R +R+P H+ E ++ LIR +++ L+E G  PS E IAE ++MS  +VR      
Sbjct  204  AIADQARTIRIPVHMVETINKLIRVSRQLLQELGREPSPEEIAEEMDMSVDRVRE-----  258

Query  682  SRVYSLDREAFPSLNGLPGETLHSYIADNHLENN---PWHGVDEWALKDEVKNLICTTLR  512
              +  + +E   SL    GE   S++ D   ++N   P        LK+++   +  TL 
Sbjct  259  --ILKISQEPV-SLETPIGEEEDSHLGDFIQDDNVPVPADAAAFTLLKEQLIE-VLGTLT  314

Query  511  EREGEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAML  335
            ERE +++RL +G+ D    T E++ +   ++RER+RQ+   AL KL+H +R RKL+  L
Sbjct  315  EREQKVLRLRFGLDDGRARTLEEVGKEFNVTRERIRQIEAKALRKLRHPSRSRKLKDYL  373



>ref|WP_025960939.1| RNA polymerase sigma factor RpoD, partial [Prochlorococcus sp. 
scB245a_519L21]
Length=192

 Score = 85.9 bits (211),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 58/168 (35%), Positives = 94/168 (56%), Gaps = 8/168 (5%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRL-EEKGITPSIERIAESLNMSQKKVRNATEAI  683
            A+AD SR +RLP H++E +S I+   K L +E G  PS E IAES+ M+ +K+R   ++ 
Sbjct  23   AIADQSRTIRLPVHLYETISRIKKTTKVLSQEFGRKPSEEEIAESMEMTIEKLRFIAKSA  82

Query  682  SRVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLRERE  503
                SL+       +   G+ + + I       NP   V +  L+++++ ++ T L  RE
Sbjct  83   QLPISLETPIGKEEDSRLGDFIEADI------ENPEQDVSKTLLREDLEGVLAT-LSPRE  135

Query  502  GEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAAR  359
             +++RL YGI D    T E+I +   ++RER+RQ+   AL KL+H  R
Sbjct  136  RDVLRLRYGIDDGRMKTLEEIGQIFDVTRERIRQIEAKALRKLRHPNR  183



>ref|WP_029244874.1| RNA polymerase sigma factor rpoD, partial [Streptococcus sobrinus]
Length=279

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 55/176 (31%), Positives = 98/176 (56%), Gaps = 7/176 (4%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLS-LIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAI  683
            A+AD +R +R+P H+ E ++ L+R  +  L+E G  P+ E+IAE ++M+  KVR   +  
Sbjct  108  AIADQARTIRIPVHMVETINKLVREQRNLLQELGQDPTPEQIAERMDMTPDKVREILKIA  167

Query  682  SRVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLRERE  503
                SL+      +       L  +I D  +EN P        L++++ N +  TL +RE
Sbjct  168  QEPVSLE----TPIGEEDDSHLGDFIEDEVIEN-PVDYTTRIVLREQL-NEVLDTLTDRE  221

Query  502  GEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAML  335
              ++RL +G+ D +  T ED+ +   ++RER+RQ+   AL KL+H +R ++L+  +
Sbjct  222  ENVLRLRFGLDDGKMRTLEDVGKVFNVTRERIRQIEAKALRKLRHPSRSKQLKDFM  277



>gb|AFN76004.1| DNA-directed RNA polymerase sigma subunit RpoD [Melioribacter 
roseus P3M-2]
Length=286

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 64/176 (36%), Positives = 100/176 (57%), Gaps = 5/176 (3%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLE-EKGITPSIERIAESLNMSQKKVRNATEAI  683
            A+A+ SRM+RLP +    L+ +  A  +LE E    PS E IAE L+M  + V  A +  
Sbjct  114  AIAEQSRMVRLPLNRVGALNKMGKALSQLEQEYERKPSAEEIAEQLDMDVQDVNYAMQIA  173

Query  682  SRVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLRERE  503
             R  S+D   F   +      L   +  N  + +P H + + +LK E++  + +TL ERE
Sbjct  174  GRHISMD-APFAHSDDSNNSLLD--VMPNEDQPSPDHTLLKESLKTEIERSL-STLTERE  229

Query  502  GEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAML  335
             E+IRLY+G+     LT E+I  ++ L+RERVRQ+   AL +L+H++R + L+A L
Sbjct  230  AEVIRLYFGLGKEHSLTLEEIGEKLNLTRERVRQIKEKALIRLRHSSRSKNLKAYL  285



>ref|WP_009645128.1| RNA polymerase sigma factor RpoD [Selenomonas sp. CM52]
 gb|EJU30364.1| RNA polymerase sigma factor RpoD [Selenomonas sp. CM52]
Length=375

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 59/180 (33%), Positives = 101/180 (56%), Gaps = 15/180 (8%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLS-LIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAI  683
            A+AD +R +R+P H+ E ++ LIR +++ L++ G  PS E IAE++ +S ++VR   +  
Sbjct  205  AIADQARTIRIPVHMVETINKLIRVSRQLLQQLGREPSPEEIAEAMEISVERVREIMKIA  264

Query  682  SRVYSLDREAFPSLNGLPGETLHSYIADNHLENN----PWHGVDEWALKDEVKNLICTTL  515
                SL+           GE   S++ D  +E+     P        LK++++  +  TL
Sbjct  265  QEPVSLETPI--------GEEEDSHLGD-FIEDQDAPAPAEAASFMLLKEQLEE-VLDTL  314

Query  514  REREGEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAML  335
             ERE  ++RL +G+ D    T E++ +  G++RER+RQ+   AL KL+H +R RKL+  L
Sbjct  315  TEREERVLRLRFGLDDGRARTLEEVGQNFGVTRERIRQIEAKALRKLRHPSRSRKLKDFL  374



>ref|WP_045170522.1| RNA polymerase sigma factor RpoD [Caldicellulosiruptor sp. Rt8.B8]
Length=355

 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 56/179 (31%), Positives = 100/179 (56%), Gaps = 13/179 (7%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLS-LIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAI  683
            A+AD +R +R+P H+ E ++ L+R +++ L+EKG  P+ E IA+ +NM  +KVR   +  
Sbjct  185  AIADQARTIRIPVHMVETINKLVRVSRQLLQEKGREPTPEEIAKEMNMPVEKVREIMKIA  244

Query  682  SRVYSLDREAFPSLNGLPGETLHSYIADNHLENN---PWHGVDEWALKDEVKNLICTTLR  512
                SL+           GE   S++ D   +++   P        LK+++   +  +L 
Sbjct  245  QEPVSLETPI--------GEEEDSHLGDFIPDDDALAPSEAAAHSMLKEQLME-VLDSLN  295

Query  511  EREGEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAML  335
            ERE ++++L +G+ D    T E++ R   ++RER+RQ+   AL KL+H +R +KL+  L
Sbjct  296  EREKKVLKLRFGLEDGRARTLEEVGREFNVTRERIRQIEAKALRKLRHPSRSKKLKDFL  354



>ref|WP_022034187.1| RNA polymerase sigma factor [Clostridium sp. CAG:710]
 emb|CCZ58965.1| rNA polymerase sigma factor [Clostridium sp. CAG:710]
Length=364

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 60/181 (33%), Positives = 107/181 (59%), Gaps = 15/181 (8%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRL-EEKGITPSIERIAESLNMSQKKVRNATEAI  683
            A+AD +R +R+P H+ E ++ +   +++L +E    P+ E IA+ L ++  KVR      
Sbjct  193  AIADQARTIRVPVHMVETINKLARVQRQLTQELNREPTEEEIAKKLGVTVDKVRE-----  247

Query  682  SRVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWA----LKDEVKNLICTTL  515
              VY + ++   SL    GE   S++ D  +++      +E+A    LK+E+ +++ T L
Sbjct  248  --VYKISQDPV-SLETPIGEEDDSHLGD-FIKDERTMSPEEYATVELLKEELASVLLT-L  302

Query  514  REREGEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAML  335
             ERE +++RL +G+ D +C T E++ +  G++RER+RQ+   AL KL+H +R RKL+  L
Sbjct  303  TEREEKVLRLRFGLDDGQCRTLEEVGQIFGVTRERIRQIEAKALRKLRHPSRSRKLKDFL  362

Query  334  I  332
            I
Sbjct  363  I  363



>ref|WP_013669912.1| RNA polymerase sigma factor RpoD [Aerococcus urinae]
 gb|AEA01693.1| RNA polymerase sigma factor RpoD [Aerococcus urinae ACS-120-V-Col10a]
Length=401

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 56/179 (31%), Positives = 103/179 (58%), Gaps = 13/179 (7%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLS-LIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAI  683
            ++AD +R +R+P H+ E ++ L+R  ++ L+E G  P+ E I   +++  +KVRN     
Sbjct  230  SIADQARTIRIPVHMVETINKLVRIQRQLLQELGREPTPEEIGAEMDLPTEKVRN-----  284

Query  682  SRVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVK---NLICTTLR  512
              +  + +E   SL    GE   S++ D  +E+N     DE+  ++ +K   N +  TL 
Sbjct  285  --IMKISQEPV-SLETPIGEEDDSHLGD-FIEDNDAMQPDEYTNQELLKEQLNEVLDTLT  340

Query  511  EREGEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAML  335
            +RE  ++RL +G+ D +  T E + ++ G++RER+RQ+   AL KL+H +R ++L+  L
Sbjct  341  DREENVLRLRFGLEDGQTKTLEQVGQQFGVTRERIRQIEAKALRKLRHPSRLKQLKDFL  399



>ref|WP_041356134.1| RNA polymerase sigma factor rpoD [Melioribacter roseus]
Length=292

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 64/176 (36%), Positives = 100/176 (57%), Gaps = 5/176 (3%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLE-EKGITPSIERIAESLNMSQKKVRNATEAI  683
            A+A+ SRM+RLP +    L+ +  A  +LE E    PS E IAE L+M  + V  A +  
Sbjct  120  AIAEQSRMVRLPLNRVGALNKMGKALSQLEQEYERKPSAEEIAEQLDMDVQDVNYAMQIA  179

Query  682  SRVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLRERE  503
             R  S+D   F   +      L   +  N  + +P H + + +LK E++  + +TL ERE
Sbjct  180  GRHISMD-APFAHSDDSNNSLLD--VMPNEDQPSPDHTLLKESLKTEIERSL-STLTERE  235

Query  502  GEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAML  335
             E+IRLY+G+     LT E+I  ++ L+RERVRQ+   AL +L+H++R + L+A L
Sbjct  236  AEVIRLYFGLGKEHSLTLEEIGEKLNLTRERVRQIKEKALIRLRHSSRSKNLKAYL  291



>ref|WP_006191682.1| RNA polymerase sigma factor RpoD [Selenomonas sputigena]
 gb|EEX77955.1| RNA polymerase sigma factor RpoD [Selenomonas sputigena ATCC 
35185]
 gb|AEC00465.1| RNA polymerase, sigma 70 subunit, RpoD subfamily [Selenomonas 
sputigena ATCC 35185]
Length=375

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 59/180 (33%), Positives = 101/180 (56%), Gaps = 15/180 (8%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLS-LIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAI  683
            A+AD +R +R+P H+ E ++ LIR +++ L++ G  PS E IAE++ +S ++VR   +  
Sbjct  205  AIADQARTIRIPVHMVETINKLIRVSRQLLQQLGREPSPEEIAEAMEISVERVREIMKIA  264

Query  682  SRVYSLDREAFPSLNGLPGETLHSYIADNHLENN----PWHGVDEWALKDEVKNLICTTL  515
                SL+           GE   S++ D  +E+     P        LK++++  +  TL
Sbjct  265  QEPVSLETPI--------GEEEDSHLGD-FIEDQDAPAPAEAASFMLLKEQLEE-VLDTL  314

Query  514  REREGEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAML  335
             ERE  ++RL +G+ D    T E++ +  G++RER+RQ+   AL KL+H +R RKL+  L
Sbjct  315  TEREERVLRLRFGLDDGRARTLEEVGQNFGVTRERIRQIEAKALRKLRHPSRSRKLKDFL  374



>ref|WP_022201595.1| RNA polymerase sigma factor [Clostridium clostridioforme CAG:132]
 emb|CDB61544.1| rNA polymerase sigma factor [Clostridium clostridioforme CAG:132]
Length=407

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 56/176 (32%), Positives = 100/176 (57%), Gaps = 7/176 (4%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEEK-GITPSIERIAESLNMSQKKVRNATEAI  683
            +LAD SR +RLP H+ E ++ IR A++ L  K G  PS+E +AE +NMS+K+V    +A 
Sbjct  237  SLADQSRTIRLPVHMVEAVNKIRRAQRSLSVKLGREPSMEEVAEEVNMSEKRVTELIQAS  296

Query  682  SRVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLRERE  503
                SL+      +    G  L  ++AD+    +     + + L++E+ +++   L  RE
Sbjct  297  GDTVSLE----TPVGDEEGSNLGDFVADDT-NASTEDKAESFLLREEIDSML-QGLNPRE  350

Query  502  GEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAML  335
             ++I L +G+     LT E++ +R  ++RER+RQ+   AL KL++ ++ +K+   L
Sbjct  351  RDVIILRFGLETGHPLTLEEVGKRFNVTRERIRQIETAALRKLRNPSKSKKIRDFL  406



>ref|WP_002587616.1| RNA polymerase sigma70 factor [[Clostridium] clostridioforme]
 gb|EHG30127.1| hypothetical protein HMPREF9467_03330 [ [[Clostridium] clostridioforme 
2_1_49FAA]
 gb|ENY91042.1| RNA polymerase sigma factor RpoD [ [[Clostridium] clostridioforme 
CM201]
 gb|ENZ04647.1| RNA polymerase sigma factor RpoD [ [[Clostridium] clostridioforme 
90B1]
 gb|ENZ08915.1| RNA polymerase sigma factor RpoD [ [[Clostridium] clostridioforme 
90A8]
 gb|ENZ18080.1| RNA polymerase sigma factor RpoD [ [[Clostridium] clostridioforme 
90A3]
 gb|ENZ29990.1| RNA polymerase sigma factor RpoD [ [[Clostridium] clostridioforme 
90A1]
 gb|ENZ60935.1| RNA polymerase sigma factor RpoD [ [[Clostridium] clostridioforme 
90A6]
 gb|ENZ67643.1| RNA polymerase sigma factor RpoD [ [[Clostridium] clostridioforme 
90A4]
Length=407

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 56/176 (32%), Positives = 100/176 (57%), Gaps = 7/176 (4%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEEK-GITPSIERIAESLNMSQKKVRNATEAI  683
            +LAD SR +RLP H+ E ++ IR A++ L  K G  PS+E +AE +NMS+K+V    +A 
Sbjct  237  SLADQSRTIRLPVHMVEAVNKIRRAQRSLSVKLGREPSMEEVAEEVNMSEKRVTELIQAS  296

Query  682  SRVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLRERE  503
                SL+      +    G  L  ++AD+    +     + + L++E+ +++   L  RE
Sbjct  297  GDTVSLE----TPVGDEEGSNLGDFVADDT-NASTEDKAESFLLREEIDSML-QGLNPRE  350

Query  502  GEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAML  335
             ++I L +G+     LT E++ +R  ++RER+RQ+   AL KL++ ++ +K+   L
Sbjct  351  RDVIILRFGLETGHPLTLEEVGKRFNVTRERIRQIETAALRKLRNPSKSKKIRDFL  406



>gb|EFQ56572.1| RNA polymerase sigma factor RpoD [Streptococcus downei F0415]
Length=338

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 55/179 (31%), Positives = 99/179 (55%), Gaps = 13/179 (7%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLS-LIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAI  683
            A+AD +R +R+P H+ E ++ L+R  +  L+E G  P+ E+IAE ++M+  KVR   +  
Sbjct  167  AIADQARTIRIPVHMVETINKLVREQRNLLQELGQDPTPEQIAERMDMTPDKVREILKIA  226

Query  682  SRVYSLDREAFPSLNGLPGETLHSYIAD---NHLENNPWHGVDEWALKDEVKNLICTTLR  512
                SL+           GE   S++ D   + +  NP        L++++ N +  TL 
Sbjct  227  QEPVSLETPI--------GEEDDSHLGDFIEDEVIENPVDYTTRIVLREQL-NEVLDTLT  277

Query  511  EREGEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAML  335
            +RE  ++RL +G+ D +  T ED+ +   ++RER+RQ+   AL KL+H +R ++L+  +
Sbjct  278  DREENVLRLRFGLDDGKMRTLEDVGKVFNVTRERIRQIEAKALRKLRHPSRSKQLKDFM  336



>ref|WP_036709770.1| RNA polymerase sigma factor RpoD, partial [Paenibacillus pinihumi]
Length=315

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 58/179 (32%), Positives = 98/179 (55%), Gaps = 13/179 (7%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLS-LIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAI  683
            A+AD +R +R+P H+ E ++  IR +++ L+E G  PS E IA+ + +S  KVR   +  
Sbjct  145  AIADQARTIRIPVHMVETINKFIRVSRQLLQELGRDPSPEEIAKEMELSPDKVREIMKIA  204

Query  682  SRVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWA---LKDEVKNLICTTLR  512
                SL+           GE   S + D   +       D  A   LK++++N +  TL 
Sbjct  205  QEPVSLESPV--------GEENDSKLGDFIEDQEAMAPADSAAYELLKEQLEN-VLDTLT  255

Query  511  EREGEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAML  335
            ERE  ++RL +G+ D +  T E++ +  G++RER+RQ+   AL KL+H +R ++L+  L
Sbjct  256  EREENVLRLRFGLDDGQPRTLEEVGKFFGVTRERIRQIEAKALRKLRHPSRSKQLKDFL  314



>ref|WP_022057754.1| RNA polymerase sigma factor [Clostridium sp. CAG:167]
 emb|CCZ91054.1| rNA polymerase sigma factor [Clostridium sp. CAG:167]
Length=377

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 60/179 (34%), Positives = 101/179 (56%), Gaps = 13/179 (7%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLS-LIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAI  683
            A+AD +R +R+P H+ E ++ LIR  ++ L+EKG  P  E IAE +N+  ++VR      
Sbjct  207  AIADQARTIRIPVHMVETINKLIRVQRQLLQEKGREPYPEEIAEKMNLPVERVRE-----  261

Query  682  SRVYSLDREAFPSLNGLPGETLHSYIADNHLENN---PWHGVDEWALKDEVKNLICTTLR  512
              +  + +E   SL    GE   S++ D   ++N   P        LK+++  ++ T L 
Sbjct  262  --IQKISQEPV-SLETPIGEEEDSHLGDFIQDDNVPVPAEAAAFTLLKEQLVEVLGT-LT  317

Query  511  EREGEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAML  335
            ERE +++RL +G+ D    T E++ +   ++RER+RQ+   AL KL+H +R RKL+  L
Sbjct  318  EREQKVLRLRFGLDDGRARTLEEVGKEFNVTRERIRQIEAKALRKLRHPSRSRKLKDYL  376



>ref|WP_044945206.1| RNA polymerase sigma70 factor [Blautia schinkii]
Length=375

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 60/179 (34%), Positives = 101/179 (56%), Gaps = 13/179 (7%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLS-LIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAI  683
            A+AD +R +R+P H+ E ++ LIR +++ L+E G  P+ E IAE ++MS  +VR      
Sbjct  205  AIADQARTIRIPVHMVETINKLIRVSRQLLQELGREPTPEEIAEEMDMSVDRVRE-----  259

Query  682  SRVYSLDREAFPSLNGLPGETLHSYIADNHLENN---PWHGVDEWALKDEVKNLICTTLR  512
              +  + +E   SL    GE   S++ D   ++N   P        LK+++   +  TL 
Sbjct  260  --ILKISQEPV-SLETPIGEEEDSHLGDFIQDDNVPVPADAAAFTLLKEQLVE-VLGTLT  315

Query  511  EREGEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAML  335
            ERE +++RL +G+ D    T E++ +   ++RER+RQ+   AL KL+H +R RKL+  L
Sbjct  316  EREQKVLRLRFGLDDGRARTLEEVGKEFNVTRERIRQIEAKALRKLRHPSRSRKLKDYL  374



>ref|WP_002564777.1| RNA polymerase sigma70 factor [[Clostridium] bolteae]
 gb|EDP13478.1| hypothetical protein CLOBOL_06043 [ [[Clostridium] bolteae ATCC 
BAA-613]
 gb|ENZ37903.1| RNA polymerase sigma factor RpoD [ [[Clostridium] bolteae 90B8]
 gb|ENZ55436.1| RNA polymerase sigma factor RpoD [ [[Clostridium] bolteae 90A5]
 gb|ENZ74007.1| RNA polymerase sigma factor RpoD [ [[Clostridium] bolteae 90B7]
Length=406

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 57/176 (32%), Positives = 99/176 (56%), Gaps = 7/176 (4%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEEK-GITPSIERIAESLNMSQKKVRNATEAI  683
            +LAD SR +RLP H+ E ++ IR A++ L  K G  PS+E +AE +NMS K+V    +A 
Sbjct  236  SLADQSRTIRLPVHMVEAVNKIRRAQRSLSVKLGREPSMEEVAEEVNMSGKRVAELIQAS  295

Query  682  SRVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLRERE  503
                SL+      +    G  L  ++AD+    +     + + L++E+ +++   L  RE
Sbjct  296  GDTVSLE----TPVGDEEGSNLGDFVADDA-NASTEDKAESFLLREEIDSML-QGLNPRE  349

Query  502  GEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAML  335
             E+I L +G+     LT E++ +R  ++RER+RQ+   AL KL++ ++ +K+   L
Sbjct  350  REVIILRFGLETGHPLTLEEVGKRFNVTRERIRQIETAALRKLRNPSKSKKIRDFL  405



>ref|WP_044123975.1| RNA polymerase sigma factor RpoD [Streptococcus downei]
Length=352

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 55/179 (31%), Positives = 99/179 (55%), Gaps = 13/179 (7%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLS-LIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAI  683
            A+AD +R +R+P H+ E ++ L+R  +  L+E G  P+ E+IAE ++M+  KVR   +  
Sbjct  181  AIADQARTIRIPVHMVETINKLVREQRNLLQELGQDPTPEQIAERMDMTPDKVREILKIA  240

Query  682  SRVYSLDREAFPSLNGLPGETLHSYIAD---NHLENNPWHGVDEWALKDEVKNLICTTLR  512
                SL+           GE   S++ D   + +  NP        L++++ N +  TL 
Sbjct  241  QEPVSLETPI--------GEEDDSHLGDFIEDEVIENPVDYTTRIVLREQL-NEVLDTLT  291

Query  511  EREGEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAML  335
            +RE  ++RL +G+ D +  T ED+ +   ++RER+RQ+   AL KL+H +R ++L+  +
Sbjct  292  DREENVLRLRFGLDDGKMRTLEDVGKVFNVTRERIRQIEAKALRKLRHPSRSKQLKDFM  350



>ref|WP_016291595.1| RNA polymerase sigma factor rpoD [Lachnospiraceae bacterium 28-4]
 gb|EOS31274.1| RNA polymerase sigma factor rpoD [Lachnospiraceae bacterium 28-4]
Length=370

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 60/179 (34%), Positives = 100/179 (56%), Gaps = 13/179 (7%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLS-LIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAI  683
            A+AD +R +R+P H+ E ++ LIR +++ L+E G  P+ E IAE +NM   +VR      
Sbjct  200  AIADQARTIRIPVHMVETINKLIRVSRQLLQELGREPTPEEIAEEMNMPVDRVRE-----  254

Query  682  SRVYSLDREAFPSLNGLPGETLHSYIADNHLENN---PWHGVDEWALKDEVKNLICTTLR  512
              +  + +E   SL    GE   S++ D   ++N   P        LK+++   +  TL 
Sbjct  255  --ILKISQEPV-SLETPIGEEEDSHLGDFIQDDNVPVPADAAAFTLLKEQLVE-VLGTLT  310

Query  511  EREGEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAML  335
            ERE +++RL +G+ D    T E++ +   ++RER+RQ+   AL KL+H +R RKL+  L
Sbjct  311  EREQKVLRLRFGLDDGRARTLEEVGKEFNVTRERIRQIEAKALRKLRHPSRSRKLKDYL  369



>ref|WP_002575068.1| MULTISPECIES: RNA polymerase sigma factor RpoD [Clostridiales]
 gb|ENZ14845.1| RNA polymerase sigma factor RpoD [ [[Clostridium] clostridioforme 
90A7]
 gb|ENZ43519.1| RNA polymerase sigma factor RpoD [ [[Clostridium] bolteae 90B3]
 gb|ENZ51549.1| RNA polymerase sigma factor RpoD [ [[Clostridium] bolteae 90A9]
 emb|CCX97870.1| rNA polymerase sigma factor [Clostridium bolteae CAG:59]
Length=406

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 57/176 (32%), Positives = 99/176 (56%), Gaps = 7/176 (4%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEEK-GITPSIERIAESLNMSQKKVRNATEAI  683
            +LAD SR +RLP H+ E ++ IR A++ L  K G  PS+E +AE +NMS K+V    +A 
Sbjct  236  SLADQSRTIRLPVHMVEAVNKIRRAQRSLSVKLGREPSMEEVAEEVNMSGKRVAELIQAS  295

Query  682  SRVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLRERE  503
                SL+      +    G  L  ++AD+    +     + + L++E+ +++   L  RE
Sbjct  296  GDTVSLE----TPVGDEEGSNLGDFVADDA-NASTEDKAESFLLREEIDSML-QGLNPRE  349

Query  502  GEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAML  335
             E+I L +G+     LT E++ +R  ++RER+RQ+   AL KL++ ++ +K+   L
Sbjct  350  REVIILRFGLETGHPLTLEEVGKRFNVTRERIRQIETAALRKLRNPSKSKKIRDFL  405



>ref|WP_027890242.1| RNA polymerase sigma factor RpoD [Megamonas hypermegale]
Length=379

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 57/179 (32%), Positives = 100/179 (56%), Gaps = 13/179 (7%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLS-LIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAI  683
            A+AD +R +R+P H+ E ++ LIR +++ L+  G  P+ E IA+ +N+S  +VR   +  
Sbjct  209  AIADQARTIRIPVHMVETINKLIRVSRQLLQSLGREPTPEEIAKEMNVSVDRVREIMKIA  268

Query  682  SRVYSLDREAFPSLNGLPGETLHSYIAD---NHLENNPWHGVDEWALKDEVKNLICTTLR  512
                SL+           GE   S++ D   +H    P        LK+++++ +  TL 
Sbjct  269  QEPVSLETPI--------GEEEDSHLGDFIEDHDAPAPAEAASFVLLKEQLED-VLDTLT  319

Query  511  EREGEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAML  335
            ERE +++RL +G+ D    T E++ +  G++RER+RQ+   AL KL+H +R +KL+  L
Sbjct  320  EREEKVLRLRFGLDDGRARTLEEVGQNFGVTRERIRQIEAKALRKLRHPSRSKKLKDFL  378



>ref|WP_045166428.1| RNA polymerase sigma factor RpoD [Thermoanaerobacter cellulolyticus]
Length=348

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 56/179 (31%), Positives = 100/179 (56%), Gaps = 13/179 (7%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLS-LIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAI  683
            A+AD +R +R+P H+ E ++ L+R +++ L+EKG  P+ E IA+ +NM  +KVR   +  
Sbjct  178  AIADQARTIRIPVHMVETINKLVRVSRQLLQEKGREPTPEEIAKEMNMPVEKVREILKIA  237

Query  682  SRVYSLDREAFPSLNGLPGETLHSYIADNHLENN---PWHGVDEWALKDEVKNLICTTLR  512
                SL+           GE   S++ D   +++   P        LK+++   +  +L 
Sbjct  238  QEPVSLETPI--------GEEEDSHLGDFIPDDDALAPSEAAAHSMLKEQLME-VLDSLN  288

Query  511  EREGEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAML  335
            ERE ++++L +G+ D    T E++ R   ++RER+RQ+   AL KL+H +R +KL+  L
Sbjct  289  EREKKVLKLRFGLEDGRARTLEEVGREFNVTRERIRQIEAKALRKLRHPSRSKKLKDFL  347



>ref|WP_012911622.1| RNA polymerase sigma70 [Pirellula staleyi]
 gb|ADB17360.1| RNA polymerase, sigma 70 subunit, RpoD subfamily [Pirellula staleyi 
DSM 6068]
Length=544

 Score = 89.4 bits (220),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 59/176 (34%), Positives = 95/176 (54%), Gaps = 7/176 (4%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRL-EEKGITPSIERIAESLNMSQKKVRNATEAI  683
            A+AD +R +R+P H+ + LS +RN +K+L +E G  P+ E +   +++  ++V+   +  
Sbjct  370  AIADQARTIRIPVHMIDVLSKLRNVQKKLLQELGREPTTEEVTALVDLPLEEVKRVLDIG  429

Query  682  SRVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLRERE  503
                SLDR    S +   GE +    +DN     P        L++ +  L+  TL  RE
Sbjct  430  RHPVSLDRPVGDSEDSSFGEFIEDTASDN-----PVLCATNGILRERIDGLL-KTLTWRE  483

Query  502  GEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAML  335
             EIIRL YG+ D    T E++ R   ++RERVRQ+   A+ KL+H  R ++LE  L
Sbjct  484  REIIRLRYGLCDGYTYTLEEVGRIFKVTRERVRQIEAKAVRKLQHPVRSKQLEGFL  539



>ref|WP_020474117.1| hypothetical protein [Zavarzinella formosa]
Length=555

 Score = 89.4 bits (220),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 61/180 (34%), Positives = 94/180 (52%), Gaps = 15/180 (8%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEEK-GITPSIERIAESLNMSQKKVRNATEAI  683
            A+AD +R +R+P H+ E +S +RN  K+L +  G  P++E +A +   + ++ R   +  
Sbjct  380  AIADQARTIRIPVHMIETMSKLRNVTKKLVQTLGREPTVEEMAAAAETTVEEARRVLKIS  439

Query  682  SRVYSLDREAFPSLNGLPGETLHSYIADNHLENN----PWHGVDEWALKDEVKNLICTTL  515
                SLDR          GE   SY  D  +E++    P        LKD++   +  TL
Sbjct  440  RHPISLDRPV--------GEGDDSYFGD-FIEDDSVASPVSAATNEMLKDKIDG-VLKTL  489

Query  514  REREGEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAML  335
              RE EII+L YG+ D    T E++ R   ++RERVRQ+   A+ KL+H  R R+LE  L
Sbjct  490  TYREREIIKLRYGLGDGYTYTLEEVGRIFKVTRERVRQIEAKAVRKLQHPVRSRQLEGFL  549



>ref|WP_027415838.1| RNA polymerase sigma factor RpoD [Aneurinibacillus terranovensis]
Length=376

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 58/179 (32%), Positives = 101/179 (56%), Gaps = 13/179 (7%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLS-LIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAI  683
            A+AD +R +R+P H+ E ++ LIR +++ L+E G  PS E IAE ++++ +KVR   +  
Sbjct  206  AIADQARTIRIPVHMVETINKLIRVSRQLLQELGREPSPEEIAEKMDLTPEKVREIMKIA  265

Query  682  SRVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWA---LKDEVKNLICTTLR  512
                SL+           GE   S++ D   +       D  A   LK+++++ +  TL 
Sbjct  266  QEPVSLETPI--------GEEDDSHLGDFIEDQEALAPSDAAAYELLKEQLED-VLDTLT  316

Query  511  EREGEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAML  335
            ERE  ++RL +G+ D    T E++ +  G++RER+RQ+   AL KL+H +R ++L+  L
Sbjct  317  EREENVLRLRFGLDDGRTRTLEEVGKVFGVTRERIRQIEAKALRKLRHPSRSKRLKDFL  375



>ref|WP_025920634.1| RNA polymerase sigma factor RpoD, partial [Prochlorococcus sp. 
scB245a_521N3]
Length=235

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 58/168 (35%), Positives = 94/168 (56%), Gaps = 8/168 (5%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRL-EEKGITPSIERIAESLNMSQKKVRNATEAI  683
            A+AD SR +RLP H++E +S I+   K L +E G  PS E IAES+ M+ +K+R   ++ 
Sbjct  69   AIADQSRTIRLPVHLYETISRIKKTTKVLSQEFGRKPSEEEIAESMEMTIEKLRFIAKSA  128

Query  682  SRVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLRERE  503
                SL+       +   G+ + + I       NP   V +  L+++++ ++ T L  RE
Sbjct  129  QLPISLETPIGKEEDSRLGDFIEADI------ENPEQDVSKTLLREDLEGVLAT-LSPRE  181

Query  502  GEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAAR  359
             +++RL YGI D    T E+I +   ++RER+RQ+   AL KL+H  R
Sbjct  182  RDVLRLRYGIDDGRMKTLEEIGQIFDVTRERIRQIEAKALRKLRHPNR  229



>ref|WP_022075107.1| RNA polymerase sigma factor [Firmicutes bacterium CAG:212]
 emb|CDA15385.1| rNA polymerase sigma factor [Firmicutes bacterium CAG:212]
Length=370

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 58/175 (33%), Positives = 100/175 (57%), Gaps = 13/175 (7%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLS-LIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAI  683
            A+AD +R +R+P H+ E ++ LIR +++ L+E G  P+ E IA+ L+M  ++VR      
Sbjct  200  AIADQARTIRIPVHMVETINKLIRVSRQLLQELGREPTPEEIAKELDMPVERVRE-----  254

Query  682  SRVYSLDREAFPSLNGLPGETLHSYIADNHLENN---PWHGVDEWALKDEVKNLICTTLR  512
              +  + +E   SL    GE   S++ D   ++N   P     +  LK+++   +  TL 
Sbjct  255  --ILKISQEPV-SLETPIGEEEDSHLGDFIQDDNVPVPAEAAAQTLLKEQLDE-VLDTLT  310

Query  511  EREGEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKL  347
            ERE +++RL +G+ D    T E++ +   ++RER+RQ+   AL KL+H +R RKL
Sbjct  311  EREQKVLRLRFGMNDGRARTLEEVGKEFDVTRERIRQIEAKALRKLRHPSRSRKL  365



>ref|WP_018345375.1| RNA polymerase sigma factor RpoD [Enterococcus cecorum]
Length=370

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 57/176 (32%), Positives = 98/176 (56%), Gaps = 7/176 (4%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLS-LIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAI  683
            A+AD +R +R+P H+ E ++ LIR  ++ L+E G  P+ E+IAE + M  +KVR   +  
Sbjct  200  AIADQARTIRIPVHMVETINKLIRIQRQLLQELGKEPTPEQIAEKMEMPTEKVREILKIA  259

Query  682  SRVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLRERE  503
                SL+      +       L  +I D    +   H   E  LK+++++ +  TL +RE
Sbjct  260  QEPVSLE----TPIGEEDDSHLGDFIEDQEATSPAEHAAYEL-LKEQLED-VLDTLTDRE  313

Query  502  GEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAML  335
              ++RL +GI D    T E++ +  G++RER+RQ+   AL KL+H +R ++L+  L
Sbjct  314  ENVLRLRFGIDDGRTRTLEEVGKVFGVTRERIRQIEAKALRKLRHPSRSKQLKDFL  369



>ref|WP_016284218.1| RNA polymerase sigma factor rpoD [Lachnospiraceae bacterium A4]
 gb|EOS22539.1| RNA polymerase sigma factor rpoD [Lachnospiraceae bacterium A4]
Length=371

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 58/179 (32%), Positives = 102/179 (57%), Gaps = 13/179 (7%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLS-LIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAI  683
            A+AD +R +R+P H+ E ++ LIR +++ L+E G  P+ E IA+ +NM +++VR      
Sbjct  201  AIADQARTIRIPVHMVETINKLIRVSRQLLQELGREPTPEEIAKEMNMPEERVRE-----  255

Query  682  SRVYSLDREAFPSLNGLPGETLHSYIADNHLENN---PWHGVDEWALKDEVKNLICTTLR  512
              +  + +E   SL    GE   S++ D   ++N   P        LK+++   +  TL 
Sbjct  256  --ILKISQEPV-SLETPIGEEEDSHLGDFIQDDNVPVPADAAAFTLLKEQLVE-VLDTLT  311

Query  511  EREGEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAML  335
            +RE +++RL +G+ D    T E++ +   ++RER+RQ+   AL KL+H +R RKL+  L
Sbjct  312  DREQKVLRLRFGLDDGRARTLEEVGKEFNVTRERIRQIEAKALRKLRHPSRSRKLKDFL  370



>ref|WP_022313271.1| RNA polymerase sigma factor [Clostridium sp. CAG:91]
 emb|CDD01416.1| rNA polymerase sigma factor [Clostridium sp. CAG:91]
Length=370

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 60/179 (34%), Positives = 100/179 (56%), Gaps = 13/179 (7%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLS-LIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAI  683
            A+AD +R +R+P H+ E ++ LIR +++ L+E G  P+ E IAE +NM   +VR      
Sbjct  200  AIADQARTIRIPVHMVETINKLIRVSRQLLQELGREPTPEEIAEEMNMPVDRVRE-----  254

Query  682  SRVYSLDREAFPSLNGLPGETLHSYIADNHLENN---PWHGVDEWALKDEVKNLICTTLR  512
              +  + +E   SL    GE   S++ D   ++N   P        LK+++   +  TL 
Sbjct  255  --ILKISQEPV-SLETPIGEEEDSHLGDFIQDDNVPVPSDAAAFTLLKEQLVE-VLGTLT  310

Query  511  EREGEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAML  335
            ERE +++RL +G+ D    T E++ +   ++RER+RQ+   AL KL+H +R RKL+  L
Sbjct  311  EREQKVLRLRFGLDDGRARTLEEVGKEFNVTRERIRQIEAKALRKLRHPSRSRKLKDYL  369



>ref|WP_033405388.1| MULTISPECIES: RNA polymerase sigma factor RpoD [Megamonas]
Length=354

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 57/179 (32%), Positives = 100/179 (56%), Gaps = 13/179 (7%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLS-LIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAI  683
            A+AD +R +R+P H+ E ++ LIR +++ L+  G  PS E IA+ +++S  +VR   +  
Sbjct  184  AIADQARTIRIPVHMVETINKLIRVSRQLLQSLGREPSPEEIAKEMDVSVDRVREIMKIA  243

Query  682  SRVYSLDREAFPSLNGLPGETLHSYIAD---NHLENNPWHGVDEWALKDEVKNLICTTLR  512
                SL+           GE   S++ D   +H    P        LK+++++ +  TL 
Sbjct  244  QEPVSLETPI--------GEEEDSHLGDFIEDHDAPAPAEAASFVLLKEQLED-VLDTLT  294

Query  511  EREGEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAML  335
            ERE +++RL +G+ D    T E++ +  G++RER+RQ+   AL KL+H +R +KL+  L
Sbjct  295  EREEKVLRLRFGLDDGRARTLEEVGQNFGVTRERIRQIEAKALRKLRHPSRSKKLKDFL  353



>ref|WP_002960771.1| RNA polymerase sigma factor RpoD [Streptococcus sobrinus]
 gb|EMP72259.1| RNA polymerase sigma factor RpoD [Streptococcus sobrinus DSM 
20742 = ATCC 33478]
 gb|ERJ74222.1| RNA polymerase sigma factor RpoD [Streptococcus sobrinus W1703]
Length=369

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 55/179 (31%), Positives = 99/179 (55%), Gaps = 13/179 (7%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLS-LIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAI  683
            A+AD +R +R+P H+ E ++ L+R  +  L+E G  P+ E+IAE ++M+  KVR   +  
Sbjct  198  AIADQARTIRIPVHMVETINKLVREQRNLLQELGQDPTPEQIAERMDMTPDKVREILKIA  257

Query  682  SRVYSLDREAFPSLNGLPGETLHSYIAD---NHLENNPWHGVDEWALKDEVKNLICTTLR  512
                SL+           GE   S++ D   + +  NP        L++++ N +  TL 
Sbjct  258  QEPVSLETPI--------GEEDDSHLGDFIEDEVIENPVDYTTRIVLREQL-NEVLDTLT  308

Query  511  EREGEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAML  335
            +RE  ++RL +G+ D +  T ED+ +   ++RER+RQ+   AL KL+H +R ++L+  +
Sbjct  309  DREENVLRLRFGLDDGKMRTLEDVGKVFNVTRERIRQIEAKALRKLRHPSRSKQLKDFM  367



>gb|ERK42316.1| RNA polymerase sigma factor RpoD [Eubacterium ramulus ATCC 29099]
Length=380

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 59/179 (33%), Positives = 101/179 (56%), Gaps = 13/179 (7%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLS-LIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAI  683
            A+AD +R +R+P H+ E ++ LIR +++ L+E G  P+ E IAE +NM   +VR      
Sbjct  210  AIADQARTIRIPVHMVETINKLIRVSRQLLQELGREPTPEEIAEEMNMPVDRVRE-----  264

Query  682  SRVYSLDREAFPSLNGLPGETLHSYIADNHLENN---PWHGVDEWALKDEVKNLICTTLR  512
              +  + +E   SL    GE   S++ D   ++N   P        LK+++   + +TL 
Sbjct  265  --ILKISQEPV-SLETPIGEEEDSHLGDFIQDDNVPVPADAAAFTLLKEQLVE-VLSTLT  320

Query  511  EREGEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAML  335
            +RE +++RL +G+ D    T E++ +   ++RER+RQ+   AL KL+H +R RKL+  L
Sbjct  321  DREQKVLRLRFGLDDGRARTLEEVGKEFNVTRERIRQIEAKALRKLRHPSRSRKLKDYL  379



>ref|WP_025943963.1| RNA polymerase sigma factor RpoD, partial [Prochlorococcus sp. 
scB241_526B22]
Length=241

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 58/168 (35%), Positives = 94/168 (56%), Gaps = 8/168 (5%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRL-EEKGITPSIERIAESLNMSQKKVRNATEAI  683
            A+AD SR +RLP H++E +S I+   K L +E G  PS E IAES+ M+ +K+R   ++ 
Sbjct  72   AIADQSRTIRLPVHLYETISRIKKTTKVLSQEFGRKPSEEEIAESMEMTIEKLRFIAKSA  131

Query  682  SRVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLRERE  503
                SL+       +   G+ + + I       NP   V +  L+++++ ++ T L  RE
Sbjct  132  QLPISLETPIGKEEDSRLGDFIEADI------ENPEQDVSKTLLREDLEGVLAT-LSPRE  184

Query  502  GEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAAR  359
             +++RL YGI D    T E+I +   ++RER+RQ+   AL KL+H  R
Sbjct  185  RDVLRLRYGIDDGRMKTLEEIGQIFDVTRERIRQIEAKALRKLRHPNR  232



>ref|WP_022035513.1| MULTISPECIES: RNA polymerase sigma factor [Clostridiales]
 emb|CCZ66155.1| rNA polymerase sigma factor [Roseburia sp. CAG:50]
Length=377

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 59/179 (33%), Positives = 101/179 (56%), Gaps = 13/179 (7%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLS-LIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAI  683
            A+AD +R +R+P H+ E ++ LIR +++ L+E G  P+ E IAE +NM   +VR      
Sbjct  207  AIADQARTIRIPVHMVETINKLIRVSRQLLQELGREPTPEEIAEEMNMPVDRVRE-----  261

Query  682  SRVYSLDREAFPSLNGLPGETLHSYIADNHLENN---PWHGVDEWALKDEVKNLICTTLR  512
              +  + +E   SL    GE   S++ D   ++N   P        LK+++   + +TL 
Sbjct  262  --ILKISQEPV-SLETPIGEEEDSHLGDFIQDDNVPVPADAAAFTLLKEQLVE-VLSTLT  317

Query  511  EREGEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAML  335
            +RE +++RL +G+ D    T E++ +   ++RER+RQ+   AL KL+H +R RKL+  L
Sbjct  318  DREQKVLRLRFGLDDGRARTLEEVGKEFNVTRERIRQIEAKALRKLRHPSRSRKLKDYL  376



>ref|WP_025657366.1| RNA polymerase sigma70 factor [Clostridiales bacterium VE202-21]
Length=369

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 58/175 (33%), Positives = 100/175 (57%), Gaps = 13/175 (7%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLS-LIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAI  683
            A+AD +R +R+P H+ E ++ LIR +++ L+E G  P+ E IA+ L+M  ++VR      
Sbjct  199  AIADQARTIRIPVHMVETINKLIRVSRQLLQELGREPTPEEIAKELDMPVERVRE-----  253

Query  682  SRVYSLDREAFPSLNGLPGETLHSYIADNHLENN---PWHGVDEWALKDEVKNLICTTLR  512
              +  + +E   SL    GE   S++ D   ++N   P     +  LK+++   +  TL 
Sbjct  254  --ILKISQEPV-SLETPIGEEEDSHLGDFIQDDNVPVPAEAAAQTLLKEQLDE-VLDTLT  309

Query  511  EREGEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKL  347
            ERE +++RL +G+ D    T E++ +   ++RER+RQ+   AL KL+H +R RKL
Sbjct  310  EREQKVLRLRFGMNDGRARTLEEVGKEFDVTRERIRQIEAKALRKLRHPSRSRKL  364



>ref|WP_022005546.1| RNA polymerase sigma factor [Firmicutes bacterium CAG:194]
 emb|CCZ27609.1| rNA polymerase sigma factor [Firmicutes bacterium CAG:194]
Length=369

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 60/178 (34%), Positives = 99/178 (56%), Gaps = 11/178 (6%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLS-LIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAI  683
            A+AD +R +R+P H+ E ++ LIR +++ L+E G  P+ E IA+ +NM   +VR      
Sbjct  199  AIADQARTIRIPVHMVETINKLIRVSRQLLQELGREPTPEEIAKEMNMPVDRVRE-----  253

Query  682  SRVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDE--WALKDEVKNLICTTLRE  509
              +  + +E   SL    GE   S++ D   ++N     D   + L  E  N +  TL E
Sbjct  254  --ILKISQEPV-SLETPIGEEEDSHLGDFIQDDNVPVPADAAAFTLLREQLNEVLDTLTE  310

Query  508  REGEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAML  335
            RE ++++L +G+ D    T E++ R   ++RER+RQ+   AL KL+H +R RKL+  L
Sbjct  311  REQKVLKLRFGLDDGRARTLEEVGREFNVTRERIRQIEAKALRKLRHPSRSRKLKDYL  368



>gb|EOX17123.1| RNA polymerase sigma factor rpoD [Enterococcus cecorum DSM 20682 
= ATCC 43198]
 gb|ESK61891.1| RNA polymerase sigma factor rpoD [Enterococcus cecorum DSM 20682 
= ATCC 43198]
Length=376

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 57/176 (32%), Positives = 98/176 (56%), Gaps = 7/176 (4%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLS-LIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAI  683
            A+AD +R +R+P H+ E ++ LIR  ++ L+E G  P+ E+IAE + M  +KVR   +  
Sbjct  206  AIADQARTIRIPVHMVETINKLIRIQRQLLQELGKEPTPEQIAEKMEMPTEKVREILKIA  265

Query  682  SRVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLRERE  503
                SL+      +       L  +I D    +   H   E  LK+++++ +  TL +RE
Sbjct  266  QEPVSLE----TPIGEEDDSHLGDFIEDQEATSPAEHAAYEL-LKEQLED-VLDTLTDRE  319

Query  502  GEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAML  335
              ++RL +GI D    T E++ +  G++RER+RQ+   AL KL+H +R ++L+  L
Sbjct  320  ENVLRLRFGIDDGRTRTLEEVGKVFGVTRERIRQIEAKALRKLRHPSRSKQLKDFL  375



>ref|WP_019787874.1| RNA polymerase sigma factor RpoD [Streptococcus sobrinus]
Length=369

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 55/179 (31%), Positives = 99/179 (55%), Gaps = 13/179 (7%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLS-LIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAI  683
            A+AD +R +R+P H+ E ++ L+R  +  L+E G  P+ E+IAE ++M+  KVR   +  
Sbjct  198  AIADQARTIRIPVHMVETINKLVREQRNLLQELGQDPTPEQIAERMDMTPDKVREILKIA  257

Query  682  SRVYSLDREAFPSLNGLPGETLHSYIAD---NHLENNPWHGVDEWALKDEVKNLICTTLR  512
                SL+           GE   S++ D   + +  NP        L++++ N +  TL 
Sbjct  258  QEPVSLETPI--------GEEDDSHLGDFIEDEVIENPVDYTTRIVLREQL-NEVLDTLT  308

Query  511  EREGEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAML  335
            +RE  ++RL +G+ D +  T ED+ +   ++RER+RQ+   AL KL+H +R ++L+  +
Sbjct  309  DREENVLRLRFGLDDGKMRTLEDVGKVFNVTRERIRQIEAKALRKLRHPSRSKQLKDFM  367



>ref|WP_018367429.1| RNA polymerase sigma factor RpoD [Streptococcus entericus]
Length=369

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 55/179 (31%), Positives = 98/179 (55%), Gaps = 13/179 (7%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLS-LIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAI  683
            A+AD +R +R+P H+ E ++ L+R  +  L+E G  P+ E+IAE ++M+  KVR   +  
Sbjct  198  AIADQARTIRIPVHMVETINKLVREQRNLLQELGTEPTPEQIAERMDMTPDKVREILKIA  257

Query  682  SRVYSLDREAFPSLNGLPGETLHSYIAD---NHLENNPWHGVDEWALKDEVKNLICTTLR  512
                SL+           GE   S++ D   + +  NP        L++++   +  TL 
Sbjct  258  QEPVSLETPI--------GEEDDSHLGDFIEDEVIENPVDYTTRVVLREQLDE-VLDTLT  308

Query  511  EREGEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAML  335
            +RE  ++RL +G+ D +  T ED+ R   ++RER+RQ+   AL KL+H +R ++L+  +
Sbjct  309  DREENVLRLRFGLDDGKMRTLEDVGRVFNVTRERIRQIEAKALRKLRHPSRSKQLKDFI  367



>ref|WP_016224725.1| RNA polymerase sigma factor rpoD [Lachnospiraceae bacterium 3-2]
 gb|EOS69535.1| RNA polymerase sigma factor rpoD [Lachnospiraceae bacterium 3-2]
Length=370

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 58/175 (33%), Positives = 99/175 (57%), Gaps = 13/175 (7%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLS-LIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAI  683
            A+AD +R +R+P H+ E ++ LIR +++ L+E G  P+ E IA  L+M   +VR      
Sbjct  200  AIADQARTIRIPVHMVETINKLIRVSRQLLQELGREPTPEEIAAELDMPVDRVRE-----  254

Query  682  SRVYSLDREAFPSLNGLPGETLHSYIADNHLENN---PWHGVDEWALKDEVKNLICTTLR  512
              +  + +E   SL    GE   S++ D   ++N   P     +  LK+++ + +  TL 
Sbjct  255  --ILKISQEPV-SLETPIGEEEDSHLGDFIQDDNVPVPAEAAAQTLLKEQLDD-VLDTLT  310

Query  511  EREGEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKL  347
            ERE +++RL +G+ D    T E++ +   ++RER+RQ+   AL KL+H +R RKL
Sbjct  311  EREQKVLRLRFGMNDGRARTLEEVGKEFDVTRERIRQIEAKALRKLRHPSRSRKL  365



>ref|WP_019782236.1| RNA polymerase sigma factor RpoD [Streptococcus sobrinus]
Length=369

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 55/179 (31%), Positives = 99/179 (55%), Gaps = 13/179 (7%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLS-LIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAI  683
            A+AD +R +R+P H+ E ++ L+R  +  L+E G  P+ E+IAE ++M+  KVR   +  
Sbjct  198  AIADQARTIRIPVHMVETINKLVREQRNLLQELGQDPTPEQIAERMDMTPDKVREILKIA  257

Query  682  SRVYSLDREAFPSLNGLPGETLHSYIAD---NHLENNPWHGVDEWALKDEVKNLICTTLR  512
                SL+           GE   S++ D   + +  NP        L++++ N +  TL 
Sbjct  258  QEPVSLETPI--------GEEDDSHLGDFIEDEVIENPVDYTTRIVLREQL-NEVLDTLT  308

Query  511  EREGEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAML  335
            +RE  ++RL +G+ D +  T ED+ +   ++RER+RQ+   AL KL+H +R ++L+  +
Sbjct  309  DREENVLRLRFGLDDGKMRTLEDVGKVFNVTRERIRQIEAKALRKLRHPSRSKQLKDFM  367



>ref|WP_025927421.1| RNA polymerase sigma factor RpoD, partial [Prochlorococcus sp. 
scB241_528J14]
Length=246

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 58/168 (35%), Positives = 94/168 (56%), Gaps = 8/168 (5%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRL-EEKGITPSIERIAESLNMSQKKVRNATEAI  683
            A+AD SR +RLP H++E +S I+   K L +E G  PS E IAES+ M+ +K+R   ++ 
Sbjct  77   AIADQSRTIRLPVHLYETISRIKKTTKVLSQEFGRKPSEEEIAESMEMTIEKLRFIAKSA  136

Query  682  SRVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLRERE  503
                SL+       +   G+ + + I       NP   V +  L+++++ ++ T L  RE
Sbjct  137  QLPISLETPIGKEEDSRLGDFIEADI------ENPEQDVSKTLLREDLEGVLAT-LSPRE  189

Query  502  GEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAAR  359
             +++RL YGI D    T E+I +   ++RER+RQ+   AL KL+H  R
Sbjct  190  RDVLRLRYGIDDGRMKTLEEIGQIFDVTRERIRQIEAKALRKLRHPNR  237



>ref|WP_027424571.1| RNA polymerase sigma70 factor [Lachnospiraceae bacterium AC3007]
Length=376

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 60/178 (34%), Positives = 100/178 (56%), Gaps = 11/178 (6%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLS-LIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAI  683
            A+AD +R +R+P H+ E ++ LIR +++ L+E G  P+ E IAE + +  +KVR      
Sbjct  206  AIADQARTIRIPVHMVETINKLIRISRQLLQELGREPTPEEIAEEMKIPVEKVRE-----  260

Query  682  SRVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALK--DEVKNLICTTLRE  509
              +  + +E   SL    GE   S++ D   ++      D  A +   E  N +  TL E
Sbjct  261  --ILKISQEPV-SLETPIGEEEDSHLGDFIQDDQVPVPADAAAFELLKEQLNEVLDTLTE  317

Query  508  REGEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAML  335
            RE +++RL +G+ D +  T E++ R+  ++RER+RQ+   AL KL+H +R RKL+  L
Sbjct  318  REQKVLRLRFGLDDGKARTLEEVGRQFNVTRERIRQIEAKALRKLRHPSRSRKLKDYL  375



>ref|WP_004229816.1| RNA polymerase sigma factor RpoD [Streptococcus criceti]
 gb|EHI75419.1| RNA polymerase sigma factor RpoD [Streptococcus criceti HS-6]
Length=369

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 55/179 (31%), Positives = 99/179 (55%), Gaps = 13/179 (7%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLS-LIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAI  683
            A+AD +R +R+P H+ E ++ L+R  +  L+E G  P+ E+IAE ++M+  KVR   +  
Sbjct  198  AIADQARTIRIPVHMVETINKLVREQRNLLQELGQDPTPEQIAERMDMTPDKVREILKIA  257

Query  682  SRVYSLDREAFPSLNGLPGETLHSYIAD---NHLENNPWHGVDEWALKDEVKNLICTTLR  512
                SL+           GE   S++ D   + +  NP        L++++ N +  TL 
Sbjct  258  QEPVSLETPI--------GEEDDSHLGDFIEDEVIENPVDYTTRIVLREQL-NDVLDTLT  308

Query  511  EREGEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAML  335
            +RE  ++RL +G+ D +  T ED+ +   ++RER+RQ+   AL KL+H +R ++L+  +
Sbjct  309  DREENVLRLRFGLDDGKMRTLEDVGKVFNVTRERIRQIEAKALRKLRHPSRSKQLKDFM  367



>ref|WP_022469409.1| RNA polymerase sigma factor [Clostridium sp. CAG:451]
 emb|CDE73951.1| rNA polymerase sigma factor [Clostridium sp. CAG:451]
Length=364

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 59/179 (33%), Positives = 103/179 (58%), Gaps = 13/179 (7%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRL-EEKGITPSIERIAESLNMSQKKVRNATEAI  683
            ALAD +R +R+P H+ E ++ +   +++L ++    P+ E IA+ L +S  KVR      
Sbjct  193  ALADQARTIRVPVHMVETINKLARVQRQLTQDLNREPTDEEIAKKLGISVDKVRE-----  247

Query  682  SRVYSLDREAFPSLNGLPGETLHSYIAD---NHLENNPWHGVDEWALKDEVKNLICTTLR  512
              VY + ++   SL    GE   S++ D   +    +P     E  LK+E+ +++ T L 
Sbjct  248  --VYKISQDPV-SLETPIGEEDDSHLGDFIRDERTVSPEEYATEELLKEELADVLLT-LT  303

Query  511  EREGEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAML  335
            +RE +++RL +G+ D +C T E++ +  G++RER+RQ+   AL KL+H +R RKL+  L
Sbjct  304  DREEKVLRLRFGLDDGQCRTLEEVGQIFGVTRERIRQIEAKALRKLRHPSRSRKLKDFL  362



>ref|WP_009004137.1| RNA polymerase sigma factor RpoD [Clostridium sp. D5]
 gb|EGB92157.1| RNA polymerase sigma factor RpoD [Clostridium sp. D5]
Length=369

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 58/175 (33%), Positives = 100/175 (57%), Gaps = 13/175 (7%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLS-LIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAI  683
            A+AD +R +R+P H+ E ++ LIR +++ L+E G  P+ E IA+ L+M  ++VR      
Sbjct  199  AIADQARTIRIPVHMVETINKLIRVSRQLLQELGREPTPEEIAKELDMPVERVRE-----  253

Query  682  SRVYSLDREAFPSLNGLPGETLHSYIADNHLENN---PWHGVDEWALKDEVKNLICTTLR  512
              +  + +E   SL    GE   S++ D   ++N   P     +  LK+++   +  TL 
Sbjct  254  --ILKISQEPV-SLETPIGEEEDSHLGDFIQDDNVPVPAEAAAQTLLKEQLDE-VLDTLT  309

Query  511  EREGEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKL  347
            ERE +++RL +G+ D    T E++ +   ++RER+RQ+   AL KL+H +R RKL
Sbjct  310  EREQKVLRLRFGMNDGRARTLEEVGKEFDVTRERIRQIEAKALRKLRHPSRSRKL  364



>ref|WP_015810559.1| MULTISPECIES: RNA polymerase sigma factor rpoD [Dyadobacter]
 gb|ACT92305.1| RNA polymerase, sigma 70 subunit, RpoD subfamily [Dyadobacter 
fermentans DSM 18053]
Length=287

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 59/176 (34%), Positives = 97/176 (55%), Gaps = 7/176 (4%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEEKGI-TPSIERIAESLNMSQKKVRNATEAI  683
            ALA+ SR++RLP +    L+ I      LE++    PS E +AE L +S  +V +  +  
Sbjct  117  ALAEQSRIVRLPLNRVGSLNKISKTFSELEQRFEREPSPEELAEVLEISSSEVVDTMKIS  176

Query  682  SRVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLRERE  503
             R  S+D    P + G     L   + +N LE+ P  G+   +L+ EV+  +CT L +RE
Sbjct  177  GRHVSMDA---PFVQGEENSLLD--VLENDLEDKPDSGLVNESLRKEVQRALCT-LTQRE  230

Query  502  GEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAML  335
             ++I LY+G+     +T E+I  +  L+RERVRQ+   A+ +L+H +R + L+  L
Sbjct  231  ADVIALYFGLNGEHAMTLEEIGEKFNLTRERVRQIKEKAIRRLRHVSRSKALKTYL  286



>ref|WP_027429543.1| RNA polymerase sigma70 factor [Lachnospiraceae bacterium AD3010]
Length=371

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 59/179 (33%), Positives = 102/179 (57%), Gaps = 13/179 (7%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLS-LIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAI  683
            A+AD +R +R+P H+ E ++ LIR +++ L+E G  P+ + IAE++NM  ++VR      
Sbjct  201  AIADQARTIRIPVHMVETINKLIRVSRQLLQELGREPTPDEIAEAMNMPVERVRE-----  255

Query  682  SRVYSLDREAFPSLNGLPGETLHSYIADNHLENN---PWHGVDEWALKDEVKNLICTTLR  512
              +  + +E   SL    GE   S++ D   ++    P        LK++++  +  TL 
Sbjct  256  --ILKISQEPV-SLETPIGEEEDSHLGDFIQDDQVPVPADAAAFTLLKEQLEE-VLETLT  311

Query  511  EREGEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAML  335
            ERE +++RL +G+ D    T E++ R   ++RER+RQ+   AL KL+H +R RKL+  L
Sbjct  312  EREQKVLRLRFGLDDGRARTLEEVGRVFSVTRERIRQIEAKALRKLRHPSRSRKLKDYL  370



>ref|WP_004606297.1| RNA polymerase sigma factor RpoD [[Clostridium] scindens]
 gb|EDS08435.1| RNA polymerase sigma factor RpoD [ [[Clostridium] scindens ATCC 
35704]
 gb|EGN38397.1| RNA polymerase sigma factor rpoD [Lachnospiraceae bacterium 5_1_57FAA]
Length=371

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 58/175 (33%), Positives = 99/175 (57%), Gaps = 13/175 (7%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLS-LIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAI  683
            A+AD +R +R+P H+ E ++ LIR +++ L+E G  P+ E IA  L+M  ++VR      
Sbjct  201  AIADQARTIRIPVHMVETINKLIRVSRQLLQELGREPTPEEIAAQLDMPVERVRE-----  255

Query  682  SRVYSLDREAFPSLNGLPGETLHSYIADNHLENN---PWHGVDEWALKDEVKNLICTTLR  512
              +  + +E   SL    GE   S++ D   ++N   P     +  LK+++   +  TL 
Sbjct  256  --ILKISQEPV-SLETPIGEEEDSHLGDFIQDDNVPVPAEAAAQTLLKEQLDE-VLDTLT  311

Query  511  EREGEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKL  347
            ERE +++RL +G+ D    T E++ +   ++RER+RQ+   AL KL+H +R RKL
Sbjct  312  EREQKVLRLRFGMNDGRARTLEEVGKEFDVTRERIRQIEAKALRKLRHPSRSRKL  366



>emb|CDZ79786.1| Sigma-A [Chlamydia sp. 'Rubis']
Length=554

 Score = 89.0 bits (219),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 55/176 (31%), Positives = 99/176 (56%), Gaps = 7/176 (4%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLS-LIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAI  683
            A+AD +R +R+P H+ E ++ ++R AKK + E G  P+ E +A  L +S ++VR   +  
Sbjct  379  AIADQARTIRIPVHMIETINKVLRGAKKLMMETGREPTPEELALELGISAERVREIYKIA  438

Query  682  SRVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLRERE  503
                SL  E      G  GE+      ++   ++P        LKD++ N + +TL +RE
Sbjct  439  QHPISLQAEV-----GDGGESQFGDFLEDTAADSPAEATGYSILKDKM-NEVLSTLTDRE  492

Query  502  GEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAML  335
             E+++  +G+VD +  T E++  +  ++RER+RQ+   AL K++H  R ++L+A L
Sbjct  493  REVLKQRFGLVDGKPKTLEEVGVQFNVTRERIRQIEAKALRKMRHPTRSKQLKAFL  548



>ref|WP_034122048.1| RNA polymerase sigma factor RpoD [Peptococcaceae bacterium BICA1-7]
 gb|KJS68236.1| RNA polymerase sigma factor RpoD [Peptococcaceae bacterium BICA1-7]
Length=364

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 55/179 (31%), Positives = 101/179 (56%), Gaps = 13/179 (7%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLS-LIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAI  683
            A+AD +R +R+P H+ E ++ LIR +++ L+E G  PS + IA+ +N++++KVR   +  
Sbjct  194  AIADQARTIRIPVHMVETINKLIRVSRQLLQEYGREPSPDEIAKEMNITEEKVREIMKIA  253

Query  682  SRVYSLDREAFPSLNGLPGETLHSYIAD---NHLENNPWHGVDEWALKDEVKNLICTTLR  512
                SL+           GE   S++ D   +H    P        L++++   +  TL 
Sbjct  254  QEPVSLETPI--------GEEEDSHLGDFIEDHDARAPAEEASFTLLREQLDE-VLKTLT  304

Query  511  EREGEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAML  335
            +RE +++RL +G+ D    T E++ ++ G++RER+RQ+    L KL+H +R +KL+  L
Sbjct  305  DREQKVLRLRFGLDDGRARTLEEVGQKFGVTRERIRQIEAKTLRKLRHPSRSKKLKDYL  363



>ref|WP_026399781.1| DNA-directed RNA polymerase subunit sigma [Acholeplasma equifetale]
Length=421

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 62/183 (34%), Positives = 103/183 (56%), Gaps = 19/183 (10%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLS-LIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAI  683
            A+AD +R +R+P H+ E ++ +IR  ++ ++E G  P IE IAE + +S +KV+N     
Sbjct  245  AVADQARTIRIPVHMVETINKMIRIQRQLVQELGREPQIEEIAEKMGISPEKVQN-----  299

Query  682  SRVYSLDREAFPSLNGLPGE----TLHSYIADNHLENNPWHGVDEWALK--DEVKNLICT  521
              +  + +E   SL    GE    TL  +I+D +  N   + + E   K  DEV      
Sbjct  300  --IQRISKEPI-SLEAPVGEEEDSTLGDFISDPNALNPHDYMMQEMVKKTLDEV----LE  352

Query  520  TLREREGEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEA  341
            TL +RE +++RL YG++D +  T E++ R  G++RER+RQ+   AL KL+   R+ KL+ 
Sbjct  353  TLTDREEKVLRLRYGLLDGKTHTLEEVGREFGVTRERIRQIEAKALRKLRSPQRQNKLKE  412

Query  340  MLI  332
              +
Sbjct  413  FYV  415



>ref|WP_008538968.1| RNA polymerase sigma factor RpoD [Megamonas funiformis CAG:377]
 gb|EHR35989.1| RNA polymerase sigma factor rpoD [Megamonas funiformis YIT 11815]
 emb|CDB97788.1| rNA polymerase sigma factor [Megamonas funiformis CAG:377]
Length=378

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 57/179 (32%), Positives = 100/179 (56%), Gaps = 13/179 (7%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLS-LIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAI  683
            A+AD +R +R+P H+ E ++ LIR +++ L+  G  PS E IA+ +++S  +VR   +  
Sbjct  208  AIADQARTIRIPVHMVETINKLIRVSRQLLQSLGREPSPEEIAKEMDVSVDRVREIMKIA  267

Query  682  SRVYSLDREAFPSLNGLPGETLHSYIAD---NHLENNPWHGVDEWALKDEVKNLICTTLR  512
                SL+           GE   S++ D   +H    P        LK+++++ +  TL 
Sbjct  268  QEPVSLETPI--------GEEEDSHLGDFIEDHDAPAPAEAASFVLLKEQLED-VLDTLT  318

Query  511  EREGEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAML  335
            ERE +++RL +G+ D    T E++ +  G++RER+RQ+   AL KL+H +R +KL+  L
Sbjct  319  EREEKVLRLRFGLDDGRARTLEEVGQNFGVTRERIRQIEAKALRKLRHPSRSKKLKDFL  377



>ref|WP_016183140.1| RNA polymerase sigma factor rpoD [Enterococcus columbae]
 gb|EOT42502.1| RNA polymerase sigma factor rpoD [Enterococcus columbae DSM 7374 
= ATCC 51263]
 gb|EOW87562.1| RNA polymerase sigma factor rpoD [Enterococcus columbae DSM 7374 
= ATCC 51263]
Length=370

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 57/176 (32%), Positives = 98/176 (56%), Gaps = 7/176 (4%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLS-LIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAI  683
            A+AD +R +R+P H+ E ++ LIR  ++ L+E G  P+ E+IAE + M  +KVR   +  
Sbjct  200  AIADQARTIRIPVHMVETINKLIRIQRQLLQELGHEPTPEQIAEKMEMPTEKVREILKIA  259

Query  682  SRVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLRERE  503
                SL+      +       L  +I D    +   H   E  LK+++++ +  TL +RE
Sbjct  260  QEPVSLE----TPIGEEDDSHLGDFIEDQEATSPAEHAAYEL-LKEQLED-VLDTLTDRE  313

Query  502  GEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAML  335
              ++RL +GI D    T E++ +  G++RER+RQ+   AL KL+H +R ++L+  L
Sbjct  314  ENVLRLRFGIDDGRTRTLEEVGKVFGVTRERIRQIEAKALRKLRHPSRSKQLKDFL  369



>ref|WP_013560272.1| RNA polymerase sigma factor RpoD [Anaerolinea thermophila]
 dbj|BAJ63895.1| RNA polymerase sigma factor [Anaerolinea thermophila UNI-1]
Length=409

 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 55/176 (31%), Positives = 98/176 (56%), Gaps = 7/176 (4%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRLEEK-GITPSIERIAESLNMSQKKVRNATEAI  683
            A+AD  R +R+P H+ ++++ +   + +L ++ G  PS+E +AE+L++  +KV N  +  
Sbjct  238  AIADQGRTIRVPVHMGDQINKLLRVQHQLTQRLGREPSVEELAEALDVPPRKVENMIQVA  297

Query  682  SRVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLRERE  503
             R  SL+       + + G+    +I D   E  P      + L  +    +  TL  RE
Sbjct  298  RRPLSLETPTDDEEDSVLGD----FIEDE--EAPPPDDTATYNLLRQHLEEVLNTLPPRE  351

Query  502  GEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAML  335
              I++L YG++D +  T E++ R++G++RERVRQ+   AL +L+H + RRKL   L
Sbjct  352  VRILQLRYGLLDGQAYTLEEVGRKMGVTRERVRQIEAQALSRLRHPSIRRKLRDYL  407



>ref|WP_022433499.1| RNA polymerase sigma factor [Eubacterium sp. CAG:38]
 emb|CDE35597.1| rNA polymerase sigma factor [Eubacterium sp. CAG:38]
Length=401

 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 59/179 (33%), Positives = 102/179 (57%), Gaps = 13/179 (7%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLS-LIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAI  683
            A+AD +R +R+P H+ E ++ L+R +++ L+E G  PS E IAE++++  ++VR      
Sbjct  231  AIADQARTIRIPVHMVETINKLVRVSRQLLQELGREPSPEEIAEAMDIPVERVRE-----  285

Query  682  SRVYSLDREAFPSLNGLPGETLHSYIADNHLENN---PWHGVDEWALKDEVKNLICTTLR  512
              +  + +E   SL    GE   S++ D   ++N   P        LK+++   +  TL 
Sbjct  286  --IQKISQEPV-SLETPIGEEEDSHLGDFIQDDNVPVPAEAAASTLLKEQLVE-VLGTLT  341

Query  511  EREGEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAML  335
            ERE +++RL +G+ D    T E++ R   ++RER+RQ+   AL KL+H +R RKL+  L
Sbjct  342  EREQKVLRLRFGMDDGRARTLEEVGREFNVTRERIRQIEAKALRKLRHPSRSRKLKDYL  400



>ref|WP_011434275.1| RNA polymerase sigma factor SigC [Synechococcus sp. JA-2-3B'a(2-13)]
 gb|ABD03658.1| RNA polymerase sigma-70 factor family [Synechococcus sp. JA-2-3B'a(2-13)]
Length=366

 Score = 87.0 bits (214),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 59/176 (34%), Positives = 99/176 (56%), Gaps = 8/176 (5%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRL-EEKGITPSIERIAESLNMSQKKVRNATEAI  683
            A+A  SR +RLP H+ E+L+ I+ A+++L +EKG TP+IE IA  L M+  +VR     +
Sbjct  194  AIATQSRTIRLPVHITEKLNKIKKAQRKLSQEKGRTPTIEDIASELEMTPPQVRELLVRV  253

Query  682  SRVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLRERE  503
             R  SL+ +     +   G+ L +       + +P   +   AL  +++ L+ + L  RE
Sbjct  254  PRSVSLETKVGKDKDTELGDLLETD------DISPEETMMREALHRDLQQLL-SDLTSRE  306

Query  502  GEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKLEAML  335
             ++IR+ +G+ D    +  +I R + LSRERVRQ+   AL+KL+   RR ++   L
Sbjct  307  RDVIRMRFGLGDGRTYSLAEIGRALDLSRERVRQIEAKALQKLRQPKRRNRVRDYL  362



>ref|WP_006443915.1| RNA polymerase sigma factor RpoD [[Clostridium] hylemonae]
 gb|EEG73273.1| RNA polymerase sigma factor RpoD [ [[Clostridium] hylemonae DSM 
15053]
Length=370

 Score = 87.0 bits (214),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 58/175 (33%), Positives = 99/175 (57%), Gaps = 13/175 (7%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLS-LIRNAKKRLEEKGITPSIERIAESLNMSQKKVRNATEAI  683
            A+AD +R +R+P H+ E ++ LIR +++ L+E G  P+ E IA  L+M  ++VR      
Sbjct  200  AIADQARTIRIPVHMVETINKLIRVSRQLLQELGREPTPEEIAAELDMPVERVRE-----  254

Query  682  SRVYSLDREAFPSLNGLPGETLHSYIADNHLENN---PWHGVDEWALKDEVKNLICTTLR  512
              +  + +E   SL    GE   S++ D   ++N   P     +  LK+++   +  TL 
Sbjct  255  --ILKISQEPV-SLETPIGEEEDSHLGDFIQDDNVPVPAEAAAQTLLKEQLDE-VLDTLT  310

Query  511  EREGEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARRRKL  347
            ERE +++RL +G+ D    T E++ +   ++RER+RQ+   AL KL+H +R RKL
Sbjct  311  EREQKVLRLRFGMNDGRARTLEEVGKEFDVTRERIRQIEAKALRKLRHPSRSRKL  365



>ref|XP_001757475.1| predicted protein [Physcomitrella patens]
 gb|EDQ77532.1| predicted protein [Physcomitrella patens]
Length=591

 Score = 88.6 bits (218),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 58/168 (35%), Positives = 96/168 (57%), Gaps = 7/168 (4%)
 Frame = -3

Query  859  ALADNSRMLRLPTHVHERLSLIRNAKKRL-EEKGITPSIERIAESLNMSQKKVRNATEAI  683
            A+AD SR++RLP H++E +S I  AKK L +E G  P  E +AE + MS +K++   ++ 
Sbjct  417  AIADQSRIIRLPIHLYEVISRINKAKKMLIQEHGRQPRDEEVAELVGMSVEKLKFIVKSA  476

Query  682  SRVYSLDREAFPSLNGLPGETLHSYIADNHLENNPWHGVDEWALKDEVKNLICTTLRERE  503
                S+DR     +     +++   IAD  +E+ P   +    LK +V  ++CT L  RE
Sbjct  477  KTPSSMDR----LIGKEKDQSIGEMIADKDVES-PEDDLIRQVLKQDVDGVLCT-LNPRE  530

Query  502  GEIIRLYYGIVDNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAAR  359
             E++RL +G+ D +  T E+I     ++RER+RQ+   A+ KL+  +R
Sbjct  531  REVLRLRFGLDDGQSRTLEEIGTLFKVTRERIRQIEAKAMRKLRQPSR  578



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1908683925587