BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig11383

Length=805
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP06960.1|  unnamed protein product                                340   2e-111   Coffea canephora [robusta coffee]
dbj|BAF37798.1|  hypothetical protein                                   340   2e-110   Ipomoea trifida
gb|KDO51343.1|  hypothetical protein CISIN_1g0130382mg                  326   7e-109   Citrus sinensis [apfelsine]
ref|XP_004251031.1|  PREDICTED: histone deacetylase 9                   333   1e-108   Solanum lycopersicum
ref|XP_010661436.1|  PREDICTED: histone deacetylase 9 isoform X2        326   1e-108   Vitis vinifera
ref|XP_009605994.1|  PREDICTED: histone deacetylase 9                   332   2e-108   Nicotiana tomentosiformis
ref|XP_010093211.1|  Histone deacetylase 9                              332   2e-108   Morus notabilis
ref|XP_006349095.1|  PREDICTED: histone deacetylase 9-like              332   3e-108   Solanum tuberosum [potatoes]
ref|XP_010243527.1|  PREDICTED: histone deacetylase 9                   330   1e-107   Nelumbo nucifera [Indian lotus]
ref|XP_009364273.1|  PREDICTED: histone deacetylase 9                   330   1e-107   Pyrus x bretschneideri [bai li]
ref|XP_010692976.1|  PREDICTED: histone deacetylase 9 isoform X4        320   3e-106   
ref|XP_010031478.1|  PREDICTED: histone deacetylase 9 isoform X2        320   3e-106   Eucalyptus grandis [rose gum]
ref|XP_008349785.1|  PREDICTED: histone deacetylase 9                   327   4e-106   Malus domestica [apple tree]
ref|XP_009364877.1|  PREDICTED: histone deacetylase 9-like              326   5e-106   Pyrus x bretschneideri [bai li]
ref|XP_004506146.1|  PREDICTED: histone deacetylase 9-like              326   5e-106   Cicer arietinum [garbanzo]
ref|XP_008227403.1|  PREDICTED: histone deacetylase 9 isoform X2        323   6e-106   
ref|XP_012075872.1|  PREDICTED: histone deacetylase 9                   326   7e-106   Jatropha curcas
ref|XP_002266492.1|  PREDICTED: histone deacetylase 9 isoform X1        325   1e-105   Vitis vinifera
ref|XP_007205234.1|  hypothetical protein PRUPE_ppa006053mg             325   1e-105   Prunus persica
emb|CAN77816.1|  hypothetical protein VITISV_020659                     325   1e-105   Vitis vinifera
ref|XP_006471388.1|  PREDICTED: histone deacetylase 9-like              325   2e-105   Citrus sinensis [apfelsine]
ref|XP_011005322.1|  PREDICTED: histone deacetylase 9 isoform X3        324   2e-105   Populus euphratica
gb|KEH29890.1|  histone deacetylase family protein                      323   2e-105   Medicago truncatula
ref|XP_002300554.1|  histone deacetylase-related family protein         324   3e-105   Populus trichocarpa [western balsam poplar]
ref|XP_006424306.1|  hypothetical protein CICLE_v10029823mg             324   3e-105   Citrus clementina [clementine]
ref|XP_007142469.1|  hypothetical protein PHAVU_008G283200g             323   5e-105   Phaseolus vulgaris [French bean]
gb|KHG07653.1|  Histone deacetylase 9 -like protein                     317   8e-105   Gossypium arboreum [tree cotton]
ref|XP_008227393.1|  PREDICTED: histone deacetylase 9 isoform X1        323   8e-105   Prunus mume [ume]
ref|XP_003606237.1|  Histone deacetylase                                323   8e-105   Medicago truncatula
ref|XP_008788401.1|  PREDICTED: histone deacetylase 17 isoform X3       316   1e-104   Phoenix dactylifera
ref|XP_010651716.1|  PREDICTED: histone deacetylase 9                   323   1e-104   Vitis vinifera
gb|KCW50786.1|  hypothetical protein EUGRSUZ_J00456                     322   2e-104   Eucalyptus grandis [rose gum]
emb|CDY08684.1|  BnaC03g54980D                                          321   2e-104   Brassica napus [oilseed rape]
ref|XP_007132395.1|  hypothetical protein PHAVU_011G091100g             322   2e-104   Phaseolus vulgaris [French bean]
ref|XP_009150313.1|  PREDICTED: histone deacetylase 9                   321   5e-104   
ref|XP_004300044.1|  PREDICTED: histone deacetylase 9                   320   8e-104   Fragaria vesca subsp. vesca
ref|XP_010692974.1|  PREDICTED: histone deacetylase 9 isoform X2        320   8e-104   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008458610.1|  PREDICTED: histone deacetylase 9 isoform X4        318   1e-103   Cucumis melo [Oriental melon]
ref|XP_008458609.1|  PREDICTED: histone deacetylase 9 isoform X3        319   1e-103   Cucumis melo [Oriental melon]
ref|XP_002529076.1|  histone deacetylase 1, 2 ,3, putative              320   2e-103   Ricinus communis
ref|XP_006591090.1|  PREDICTED: histone deacetylase 9-like isofor...    319   2e-103   
ref|XP_010692973.1|  PREDICTED: histone deacetylase 9 isoform X1        319   2e-103   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB35350.1|  hypothetical protein B456_006G110500                    313   2e-103   Gossypium raimondii
ref|XP_003538135.1|  PREDICTED: histone deacetylase 9-like isofor...    319   3e-103   Glycine max [soybeans]
gb|KHN38656.1|  Histone deacetylase 9                                   319   3e-103   Glycine soja [wild soybean]
ref|XP_006592310.1|  PREDICTED: histone deacetylase 9 isoform X2        316   4e-103   Glycine max [soybeans]
ref|XP_011657063.1|  PREDICTED: histone deacetylase 9 isoform X3        318   4e-103   Cucumis sativus [cucumbers]
ref|XP_008458605.1|  PREDICTED: histone deacetylase 9 isoform X1        318   4e-103   Cucumis melo [Oriental melon]
ref|XP_004145792.1|  PREDICTED: histone deacetylase 9 isoform X1        318   6e-103   Cucumis sativus [cucumbers]
ref|XP_006419115.1|  hypothetical protein EUTSA_v10002540mg             318   6e-103   Eutrema salsugineum [saltwater cress]
ref|XP_009404814.1|  PREDICTED: histone deacetylase 9 isoform X3        315   7e-103   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006279377.1|  hypothetical protein CARUB_v10007995mg             317   1e-102   Capsella rubella
ref|XP_010031477.1|  PREDICTED: histone deacetylase 9 isoform X1        317   1e-102   Eucalyptus grandis [rose gum]
ref|XP_003539814.1|  PREDICTED: histone deacetylase 9 isoform X1        317   3e-102   Glycine max [soybeans]
ref|XP_009404813.1|  PREDICTED: histone deacetylase 9 isoform X2        314   4e-102   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011625968.1|  PREDICTED: histone deacetylase 9                   317   4e-102   
ref|XP_010514792.1|  PREDICTED: histone deacetylase 9                   315   7e-102   Camelina sativa [gold-of-pleasure]
gb|ACU20217.1|  unknown                                                 315   9e-102   Glycine max [soybeans]
ref|NP_190054.2|  histone deacetylase 9                                 315   1e-101   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009404815.1|  PREDICTED: histone deacetylase 9 isoform X4        314   1e-101   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010425885.1|  PREDICTED: histone deacetylase 9 isoform X1        314   2e-101   Camelina sativa [gold-of-pleasure]
ref|XP_007015910.1|  Histone deacetylase 9 isoform 7                    313   4e-101   
ref|XP_010503116.1|  PREDICTED: histone deacetylase 9-like              313   5e-101   Camelina sativa [gold-of-pleasure]
ref|XP_010940301.1|  PREDICTED: histone deacetylase 9                   313   7e-101   Elaeis guineensis
ref|XP_009404812.1|  PREDICTED: histone deacetylase 9 isoform X1        313   7e-101   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008788384.1|  PREDICTED: histone deacetylase 9 isoform X1        313   7e-101   Phoenix dactylifera
ref|XP_007015904.1|  Histone deacetylase 9 isoform 1                    313   9e-101   Theobroma cacao [chocolate]
gb|ERN13133.1|  hypothetical protein AMTR_s00040p00182290               312   1e-100   Amborella trichopoda
ref|XP_010541292.1|  PREDICTED: histone deacetylase 9 isoform X2        305   2e-100   Tarenaya hassleriana [spider flower]
emb|CAE04901.1|  OSJNBa0042I15.23                                       305   6e-100   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011005321.1|  PREDICTED: histone deacetylase 9 isoform X2        309   2e-99    Populus euphratica
ref|NP_001052725.1|  Os04g0409600                                       304   5e-99    
ref|XP_008668621.1|  PREDICTED: histone deacetylase isoform X1          306   5e-99    Zea mays [maize]
ref|XP_011005320.1|  PREDICTED: histone deacetylase 9 isoform X1        309   6e-99    Populus euphratica
emb|CAB72470.1|  putative protein                                       306   2e-98    Arabidopsis thaliana [mouse-ear cress]
gb|ACR37742.1|  unknown                                                 306   2e-98    Zea mays [maize]
ref|NP_001105077.1|  histone deacetylase                                305   7e-98    Zea mays [maize]
tpg|DAA37954.1|  TPA: histone deacetylase                               305   8e-98    
gb|EMT12816.1|  Histone deacetylase 9                                   303   8e-98    
tpg|DAA37953.1|  TPA: histone deacetylase, mRNA                         305   1e-97    
gb|ACD50313.1|  histone deacetylase RPD3/HDA1 class I isoform 1         305   1e-97    Hordeum vulgare [barley]
ref|XP_004975539.1|  PREDICTED: histone deacetylase 9-like isofor...    302   2e-97    
ref|XP_003579685.1|  PREDICTED: histone deacetylase 9 isoform X1        304   2e-97    Brachypodium distachyon [annual false brome]
ref|XP_010541291.1|  PREDICTED: histone deacetylase 9 isoform X1        303   3e-97    Tarenaya hassleriana [spider flower]
emb|CAH66503.1|  H0321H01.12                                            303   7e-97    Oryza sativa [red rice]
ref|XP_008458611.1|  PREDICTED: histone deacetylase 17 isoform X5       294   7e-97    
ref|XP_006652253.1|  PREDICTED: histone deacetylase 9-like              302   1e-96    Oryza brachyantha
ref|XP_004975538.1|  PREDICTED: histone deacetylase 9-like isofor...    302   1e-96    Setaria italica
ref|XP_002446401.1|  hypothetical protein SORBIDRAFT_06g015420          302   2e-96    Sorghum bicolor [broomcorn]
ref|XP_011090014.1|  PREDICTED: histone deacetylase 17 isoform X2       294   6e-96    Sesamum indicum [beniseed]
ref|XP_011657064.1|  PREDICTED: histone deacetylase 17 isoform X4       291   7e-96    Cucumis sativus [cucumbers]
gb|EYU36088.1|  hypothetical protein MIMGU_mgv1a006831mg                298   7e-95    Erythranthe guttata [common monkey flower]
gb|KCW50787.1|  hypothetical protein EUGRSUZ_J00456                     296   8e-95    Eucalyptus grandis [rose gum]
ref|XP_001774667.1|  class I RPD3 type histone deacetylase protein      295   1e-93    
ref|XP_002877352.1|  hypothetical protein ARALYDRAFT_347545             311   2e-93    
ref|XP_011090013.1|  PREDICTED: histone deacetylase 9 isoform X1        293   3e-93    Sesamum indicum [beniseed]
ref|XP_007015905.1|  Histone deacetylase 9 isoform 2                    292   4e-93    
ref|XP_008458608.1|  PREDICTED: histone deacetylase 9 isoform X2        291   2e-92    Cucumis melo [Oriental melon]
ref|XP_011657062.1|  PREDICTED: histone deacetylase 9 isoform X2        291   2e-92    Cucumis sativus [cucumbers]
emb|CAN75079.1|  hypothetical protein VITISV_007579                     286   7e-91    Vitis vinifera
ref|XP_002966032.1|  hypothetical protein SELMODRAFT_84957              285   5e-90    
ref|XP_002971460.1|  hypothetical protein SELMODRAFT_172161             284   2e-89    
gb|EYU36089.1|  hypothetical protein MIMGU_mgv1a006831mg                281   1e-88    Erythranthe guttata [common monkey flower]
gb|KHN21123.1|  Histone deacetylase 9                                   273   1e-84    Glycine soja [wild soybean]
ref|XP_010692975.1|  PREDICTED: histone deacetylase 17 isoform X3       254   1e-81    Beta vulgaris subsp. vulgaris [field beet]
ref|NP_190035.1|  histone deacetylase 17                                253   6e-81    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010425886.1|  PREDICTED: histone deacetylase 17 isoform X2       248   3e-79    Camelina sativa [gold-of-pleasure]
gb|KCW50788.1|  hypothetical protein EUGRSUZ_J00456                     253   3e-78    Eucalyptus grandis [rose gum]
gb|KCW50789.1|  hypothetical protein EUGRSUZ_J00456                     253   6e-78    Eucalyptus grandis [rose gum]
ref|XP_007015911.1|  Histone deacetylase 9 isoform 8                    250   6e-77    
ref|XP_007015906.1|  Histone deacetylase 9 isoform 3                    250   5e-76    
ref|XP_003060152.1|  histone deacetylase                                226   4e-67    Micromonas pusilla CCMP1545
ref|NP_190052.1|  histone deacetylase 10                                214   3e-66    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002504208.1|  histone deacetylase                                222   1e-65    Micromonas commoda
ref|XP_005652289.1|  class I RPD3 type histone deacetylase protein      218   4e-64    Coccomyxa subellipsoidea C-169
ref|XP_001162233.1|  PREDICTED: histone deacetylase 1 isoform X3        216   4e-63    
ref|XP_010227570.1|  PREDICTED: probable histone deacetylase 19 i...    217   4e-63    
ref|XP_003563706.1|  PREDICTED: probable histone deacetylase 19 i...    217   7e-63    Brachypodium distachyon [annual false brome]
gb|EMS54283.1|  putative histone deacetylase 19                         217   8e-63    Triticum urartu
ref|XP_010028889.1|  PREDICTED: histone deacetylase 19 isoform X1       216   9e-63    Eucalyptus grandis [rose gum]
ref|XP_519834.2|  PREDICTED: histone deacetylase 1 isoform X1           216   1e-62    
ref|XP_010028890.1|  PREDICTED: histone deacetylase 19 isoform X2       215   1e-62    Eucalyptus grandis [rose gum]
ref|XP_009451191.1|  PREDICTED: histone deacetylase 1 isoform X2        215   1e-62    
ref|XP_009389921.1|  PREDICTED: probable histone deacetylase 19         215   3e-62    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008809711.1|  PREDICTED: probable histone deacetylase 19         215   4e-62    Phoenix dactylifera
gb|AFK48350.1|  unknown                                                 209   4e-62    Lotus japonicus
ref|XP_006158173.1|  PREDICTED: histone deacetylase 1                   214   5e-62    Tupaia chinensis
ref|XP_011099710.1|  PREDICTED: histone deacetylase 19 isoform X2       214   5e-62    Sesamum indicum [beniseed]
gb|KDO51346.1|  hypothetical protein CISIN_1g0130382mg                  204   6e-62    Citrus sinensis [apfelsine]
ref|XP_011260199.1|  PREDICTED: histone deacetylase Rpd3                213   6e-62    
ref|XP_010881163.1|  PREDICTED: histone deacetylase 2                   214   8e-62    Esox lucius
ref|XP_002424887.1|  histone deacetylase RPD3, putative                 209   2e-61    Pediculus humanus corporis [human body lice]
ref|XP_010008493.1|  PREDICTED: histone deacetylase 1                   206   2e-61    Nestor notabilis
ref|XP_011099707.1|  PREDICTED: histone deacetylase 19 isoform X1       213   2e-61    Sesamum indicum [beniseed]
ref|XP_008482135.1|  PREDICTED: histone deacetylase Rpd3-like           210   3e-61    Diaphorina citri
ref|XP_394976.4|  PREDICTED: histone deacetylase Rpd3 isoform 1         212   4e-61    Apis mellifera [bee]
ref|XP_003690250.1|  PREDICTED: histone deacetylase Rpd3-like           211   5e-61    
gb|ELW48624.1|  Histone deacetylase 1                                   212   5e-61    Tupaia chinensis
ref|XP_004225492.1|  PREDICTED: LOW QUALITY PROTEIN: histone deac...    213   5e-61    Ciona intestinalis [sea vase]
ref|XP_003707550.1|  PREDICTED: histone deacetylase Rpd3                211   8e-61    Megachile rotundata
ref|XP_003485786.1|  PREDICTED: histone deacetylase Rpd3-like           211   8e-61    
ref|XP_004358601.1|  histone deacetylase family protein                 210   1e-60    Cavenderia fasciculata
ref|NP_001161325.1|  Rpd3 histone deacetylase                           210   1e-60    Nasonia vitripennis
gb|KDR17587.1|  Histone deacetylase Rpd3                                209   1e-60    Zootermopsis nevadensis
ref|XP_011154868.1|  PREDICTED: histone deacetylase Rpd3                211   2e-60    Harpegnathos saltator
ref|XP_011181414.1|  PREDICTED: histone deacetylase Rpd3 isoform X2     209   2e-60    
ref|XP_011494484.1|  PREDICTED: histone deacetylase Rpd3                209   3e-60    Ceratosolen solmsi marchali
ref|XP_011204627.1|  PREDICTED: histone deacetylase Rpd3                209   4e-60    Bactrocera dorsalis [papaya fruit fly]
ref|XP_004519082.1|  PREDICTED: histone deacetylase Rpd3-like           209   4e-60    Ceratitis capitata [medfly]
ref|XP_011334448.1|  PREDICTED: histone deacetylase Rpd3-like           209   4e-60    Ooceraea biroi
ref|XP_010934971.1|  PREDICTED: histone deacetylase 19-like isofo...    209   4e-60    Elaeis guineensis
ref|XP_011311168.1|  PREDICTED: histone deacetylase Rpd3                209   4e-60    Fopius arisanus
gb|EFN65822.1|  Histone deacetylase Rpd3                                209   4e-60    Camponotus floridanus
ref|XP_010935047.1|  PREDICTED: histone deacetylase 19-like isofo...    209   4e-60    Elaeis guineensis
ref|XP_011181413.1|  PREDICTED: histone deacetylase Rpd3 isoform X1     209   4e-60    Zeugodacus cucurbitae [melon fruit fly]
ref|XP_005984211.1|  PREDICTED: histone deacetylase 2-like              209   5e-60    Pantholops hodgsonii [Tibetan antelope]
ref|XP_011260173.1|  PREDICTED: histone deacetylase Rpd3-like           209   5e-60    Camponotus floridanus
ref|XP_011158304.1|  PREDICTED: histone deacetylase Rpd3-like           209   6e-60    Solenopsis invicta [imported red fire ant]
ref|XP_011334447.1|  PREDICTED: histone deacetylase Rpd3-like           209   6e-60    Ooceraea biroi
gb|KFP83316.1|  Histone deacetylase 1                                   205   7e-60    Acanthisitta chloris
ref|XP_011539611.1|  PREDICTED: histone deacetylase 1 isoform X1        202   9e-60    Homo sapiens [man]
ref|XP_009202183.1|  PREDICTED: histone deacetylase 1                   202   9e-60    
ref|XP_006537073.1|  PREDICTED: histone deacetylase 1 isoform X1        202   1e-59    
ref|XP_011061203.1|  PREDICTED: histone deacetylase Rpd3 isoform X2     207   1e-59    Acromyrmex echinatior
gb|KFP50838.1|  Histone deacetylase 1                                   205   1e-59    Cathartes aura
ref|XP_011061204.1|  PREDICTED: histone deacetylase Rpd3 isoform X3     207   1e-59    Acromyrmex echinatior
ref|XP_004329860.1|  PREDICTED: histone deacetylase 1-like              202   1e-59    
ref|XP_011061205.1|  PREDICTED: histone deacetylase Rpd3 isoform X4     207   1e-59    Acromyrmex echinatior
dbj|BAG61272.1|  unnamed protein product                                202   1e-59    Homo sapiens [man]
gb|ETN61439.1|  histone deacetylase                                     208   1e-59    Anopheles darlingi [American malaria mosquito]
ref|XP_002060037.1|  GJ15512                                            209   1e-59    Drosophila virilis
ref|XP_001848775.1|  histone deacetylase Rpd3                           208   1e-59    Culex quinquefasciatus
ref|XP_009076065.1|  PREDICTED: histone deacetylase 1                   205   1e-59    Acanthisitta chloris
ref|XP_002983212.1|  hypothetical protein SELMODRAFT_234196             206   1e-59    
ref|XP_008554767.1|  PREDICTED: histone deacetylase Rpd3                207   1e-59    
ref|XP_011876393.1|  PREDICTED: histone deacetylase Rpd3-like           207   2e-59    Vollenhovia emeryi
ref|XP_011639811.1|  PREDICTED: histone deacetylase Rpd3-like           207   2e-59    Pogonomyrmex barbatus
ref|XP_011061202.1|  PREDICTED: histone deacetylase Rpd3 isoform X1     207   2e-59    Acromyrmex echinatior
ref|XP_001943175.3|  PREDICTED: histone deacetylase Rpd3-like           207   2e-59    
gb|KFO76881.1|  Histone deacetylase 1                                   204   2e-59    Cuculus canorus
gb|KFB51427.1|  histone deacetylase Rpd3                                207   2e-59    Anopheles sinensis
ref|XP_001946674.2|  PREDICTED: histone deacetylase Rpd3-like           206   2e-59    
ref|XP_012058200.1|  PREDICTED: histone deacetylase Rpd3-like           207   2e-59    Atta cephalotes
ref|XP_011639814.1|  PREDICTED: histone deacetylase Rpd3-like iso...    206   2e-59    Pogonomyrmex barbatus
ref|XP_010073968.1|  PREDICTED: LOW QUALITY PROTEIN: histone deac...    206   2e-59    Pterocles gutturalis
gb|KDO16344.1|  hypothetical protein SPRG_18127                         198   3e-59    Saprolegnia parasitica CBS 223.65
ref|XP_316539.2|  AGAP006511-PA                                         206   3e-59    Anopheles gambiae str. PEST
ref|XP_010721789.1|  PREDICTED: histone deacetylase 1                   206   3e-59    
ref|XP_002114310.1|  hypothetical protein TRIADDRAFT_64072              208   3e-59    Trichoplax adhaerens
ref|XP_005142468.1|  PREDICTED: histone deacetylase 1                   206   3e-59    Melopsittacus undulatus
ref|XP_009469103.1|  PREDICTED: histone deacetylase 1                   206   3e-59    Nipponia nippon
gb|EPQ15222.1|  Histone deacetylase 1                                   204   3e-59    Myotis brandtii
ref|XP_009968174.1|  PREDICTED: histone deacetylase 1                   206   3e-59    Tyto alba [Schleiereule]
ref|XP_009906717.1|  PREDICTED: histone deacetylase 1                   206   3e-59    Picoides pubescens
ref|XP_009679321.1|  PREDICTED: histone deacetylase 1                   206   3e-59    Struthio camelus australis
dbj|GAN08679.1|  histone deacetylase 1/2                                211   3e-59    Mucor ambiguus
ref|XP_010209083.1|  PREDICTED: histone deacetylase 1                   206   3e-59    Colius striatus
ref|XP_005509669.1|  PREDICTED: histone deacetylase 1                   206   3e-59    Columba livia [carrier pigeon]
ref|XP_009330447.1|  PREDICTED: histone deacetylase 1                   206   3e-59    Pygoscelis adeliae
ref|XP_012057424.1|  PREDICTED: histone deacetylase Rpd3-like           207   3e-59    Atta cephalotes
ref|XP_010129593.1|  PREDICTED: histone deacetylase 1                   206   3e-59    Buceros rhinoceros silvestris
ref|XP_008491052.1|  PREDICTED: histone deacetylase 1                   206   3e-59    Calypte anna
ref|XP_009699610.1|  PREDICTED: histone deacetylase 1                   206   3e-59    Cariama cristata
ref|XP_011050777.1|  PREDICTED: histone deacetylase Rpd3-like           207   3e-59    Acromyrmex echinatior
ref|XP_009560131.1|  PREDICTED: histone deacetylase 1                   206   3e-59    Cuculus canorus
ref|XP_011882428.1|  PREDICTED: histone deacetylase Rpd3-like           207   3e-59    Vollenhovia emeryi
ref|XP_008918838.1|  PREDICTED: histone deacetylase 1                   206   3e-59    
ref|XP_003397521.1|  PREDICTED: hypothetical protein LOC100642763       214   4e-59    
ref|XP_011694402.1|  PREDICTED: histone deacetylase Rpd3-like iso...    206   4e-59    Wasmannia auropunctata
gb|KHJ79031.1|  hypothetical protein OESDEN_21332                       200   4e-59    Oesophagostomum dentatum [nodule worm]
gb|KFV75060.1|  Histone deacetylase 1                                   205   4e-59    Picoides pubescens
gb|KFR06102.1|  Histone deacetylase 1                                   204   4e-59    Opisthocomus hoazin [hoatzin]
gb|KFR03534.1|  Histone deacetylase 1                                   205   4e-59    Nipponia nippon
ref|XP_007444029.1|  PREDICTED: histone deacetylase 1-like              201   4e-59    
gb|EPB86954.1|  histone deacetylase 1/2                                 211   4e-59    Mucor circinelloides f. circinelloides 1006PhL
ref|XP_005427182.1|  PREDICTED: histone deacetylase 1                   205   5e-59    
gb|EOB00696.1|  Histone deacetylase 1                                   205   5e-59    Anas platyrhynchos [duck]
ref|XP_008633314.1|  PREDICTED: histone deacetylase 1                   205   5e-59    
gb|KFV55204.1|  Histone deacetylase 1                                   205   5e-59    Tyto alba [Schleiereule]
ref|XP_005058307.1|  PREDICTED: histone deacetylase 1 isoform X2        205   5e-59    
gb|KFO60221.1|  Histone deacetylase 1                                   205   5e-59    Corvus brachyrhynchos
gb|KFP28914.1|  Histone deacetylase 1                                   205   5e-59    Colius striatus
gb|KFM11275.1|  Histone deacetylase 1                                   205   5e-59    Aptenodytes forsteri
gb|KGL79664.1|  Histone deacetylase 1                                   205   5e-59    Tinamus guttatus
gb|KFU91820.1|  Histone deacetylase 1                                   205   5e-59    Chaetura pelagica
gb|KFP10889.1|  Histone deacetylase 1                                   205   5e-59    Egretta garzetta
ref|XP_002961351.1|  hypothetical protein SELMODRAFT_74186              206   6e-59    
gb|KFP00125.1|  Histone deacetylase 1                                   205   6e-59    Calypte anna
gb|KFQ67796.1|  Histone deacetylase 1                                   205   6e-59    Phaethon lepturus
gb|EUB61434.1|  Histone deacetylase                                     207   6e-59    Echinococcus granulosus
ref|XP_009929569.1|  PREDICTED: histone deacetylase 1                   204   6e-59    Opisthocomus hoazin [hoatzin]
gb|AHW42410.1|  hdac1                                                   206   6e-59    Echinococcus multilocularis
ref|XP_011639813.1|  PREDICTED: histone deacetylase Rpd3-like iso...    206   6e-59    Pogonomyrmex barbatus
ref|XP_007669959.1|  PREDICTED: histone deacetylase 1                   204   6e-59    
ref|XP_008869930.1|  hypothetical protein H310_06587                    205   6e-59    Aphanomyces invadans
gb|KFW72873.1|  Histone deacetylase 1                                   205   7e-59    Pygoscelis adeliae
gb|EMC82692.1|  Histone deacetylase 1                                   205   7e-59    
gb|KFV84480.1|  Histone deacetylase 1                                   205   7e-59    Struthio camelus australis
gb|ACN25329.1|  unknown                                                 204   8e-59    Zea mays [maize]
ref|XP_002438614.1|  hypothetical protein SORBIDRAFT_10g022820          206   8e-59    Sorghum bicolor [broomcorn]
ref|XP_005191575.1|  PREDICTED: histone deacetylase Rpd3                206   8e-59    Musca domestica
ref|XP_004643035.1|  PREDICTED: histone deacetylase 1                   203   8e-59    
ref|NP_989487.1|  histone deacetylase 1                                 205   9e-59    Gallus gallus [bantam]
emb|CDS23263.1|  histone deacetylase 1                                  206   9e-59    Echinococcus granulosus
gb|AAB99850.1|  histone deacetylase 1                                   205   9e-59    Gallus gallus [bantam]
ref|XP_002194370.2|  PREDICTED: histone deacetylase 1                   205   1e-58    
gb|ADO79635.1|  histone deacetylase                                     206   1e-58    Drosophila nasuta
gb|ADO79632.1|  histone deacetylase                                     206   1e-58    Drosophila albomicans
ref|XP_005058306.1|  PREDICTED: histone deacetylase 1 isoform X1        205   1e-58    
ref|XP_009096801.1|  PREDICTED: histone deacetylase 1                   205   1e-58    
ref|XP_011694401.1|  PREDICTED: histone deacetylase Rpd3-like iso...    206   1e-58    Wasmannia auropunctata
gb|AAK11182.1|AF321129_1  histone deacetylase 1                         199   1e-58    Rattus norvegicus [brown rat]
ref|XP_005529817.1|  PREDICTED: histone deacetylase 1                   205   1e-58    Pseudopodoces humilis [Tibetan ground-jay]
gb|ADO79638.1|  histone deacetylase                                     206   1e-58    Drosophila nasuta
ref|XP_008788392.1|  PREDICTED: histone deacetylase 9 isoform X2        202   1e-58    Phoenix dactylifera
ref|XP_010406403.1|  PREDICTED: histone deacetylase 1                   205   1e-58    
ref|XP_009827282.1|  hypothetical protein, variant 1                    202   1e-58    Aphanomyces astaci
ref|XP_001946324.2|  PREDICTED: histone deacetylase Rpd3-like           205   1e-58    Acyrthosiphon pisum
gb|EPY87302.1|  histone deacetylase 1 isoform 5-like protein            204   1e-58    Camelus ferus
ref|XP_006777443.1|  PREDICTED: histone deacetylase 1                   204   2e-58    
ref|XP_004966013.1|  PREDICTED: probable histone deacetylase 19-like    206   2e-58    Setaria italica
gb|ADO79639.1|  histone deacetylase                                     206   2e-58    Drosophila nasuta
ref|XP_005020509.1|  PREDICTED: LOW QUALITY PROTEIN: histone deac...    205   2e-58    
ref|XP_004358133.1|  histone deacetylase family protein                 199   2e-58    Cavenderia fasciculata
ref|XP_002007081.1|  GI12742                                            206   2e-58    Drosophila mojavensis
ref|XP_009030811.1|  hypothetical protein HELRODRAFT_194553             207   2e-58    Helobdella robusta
gb|EFX81904.1|  putative histone deacetylase HDAC3 protein              203   2e-58    Daphnia pulex
gb|EDL30187.1|  mCG12239                                                203   2e-58    Mus musculus [mouse]
ref|XP_010216417.1|  PREDICTED: histone deacetylase 1                   206   2e-58    Tinamus guttatus
ref|NP_001079396.1|  histone deacetylase 1                              204   2e-58    Xenopus laevis [clawed frog]
ref|XP_011935082.1|  PREDICTED: histone deacetylase 1 isoform X2        203   2e-58    Cercocebus atys
ref|XP_006117612.1|  PREDICTED: histone deacetylase 1                   204   2e-58    Pelodiscus sinensis [Chinese softshell turtle]
emb|CDJ05997.1|  histone deacetylase 1                                  206   2e-58    
ref|XP_012004956.1|  PREDICTED: histone deacetylase 1 isoform X3        202   3e-58    
ref|XP_009827280.1|  hypothetical protein H257_04460                    202   3e-58    Aphanomyces astaci
ref|XP_008658381.1|  PREDICTED: uncharacterized protein LOC100276...    204   3e-58    
gb|AEP04145.1|  histone deacetylase 19                                  196   3e-58    Musa acuminata AAA Group [Cavendish banana]
ref|XP_005302255.1|  PREDICTED: histone deacetylase 1                   204   3e-58    Chrysemys picta bellii
ref|XP_006734228.1|  PREDICTED: histone deacetylase 1 isoform X2        203   3e-58    Leptonychotes weddellii
ref|XP_007977778.1|  PREDICTED: histone deacetylase 1 isoform X2        203   4e-58    
ref|XP_003276412.1|  PREDICTED: histone deacetylase 1 isoform 2         203   4e-58    
ref|XP_006734229.1|  PREDICTED: histone deacetylase 1 isoform X3        202   4e-58    
ref|XP_006019411.1|  PREDICTED: histone deacetylase 1 isoform X1        204   4e-58    
ref|XP_011810815.1|  PREDICTED: histone deacetylase 1                   203   4e-58    
ref|XP_011829440.1|  PREDICTED: histone deacetylase 1 isoform X2        203   4e-58    
ref|XP_004025420.1|  PREDICTED: histone deacetylase 1 isoform 2         203   4e-58    
ref|XP_005544163.1|  PREDICTED: histone deacetylase 1 isoform X2        203   4e-58    
ref|XP_005665257.1|  PREDICTED: histone deacetylase 1                   202   4e-58    
ref|XP_006274872.1|  PREDICTED: histone deacetylase 1 isoform X1        204   4e-58    
ref|XP_006054695.1|  PREDICTED: histone deacetylase 1 isoform X2        203   4e-58    
ref|XP_006176266.1|  PREDICTED: histone deacetylase 1                   203   4e-58    
ref|XP_005676762.1|  PREDICTED: histone deacetylase 1                   203   4e-58    
ref|XP_005202952.1|  PREDICTED: histone deacetylase 1 isoform X1        203   4e-58    
gb|EDL75478.1|  rCG23915                                                197   4e-58    
ref|XP_008064942.1|  PREDICTED: histone deacetylase 1                   203   4e-58    
ref|XP_007507970.1|  PREDICTED: LOW QUALITY PROTEIN: histone deac...    203   4e-58    
ref|XP_001946595.2|  PREDICTED: histone deacetylase Rpd3-like           204   4e-58    
sp|O42227.1|HDA1B_XENLA  RecName: Full=Probable histone deacetyla...    204   4e-58    
ref|XP_006094298.1|  PREDICTED: histone deacetylase 1                   204   4e-58    
ref|XP_006924353.1|  PREDICTED: histone deacetylase 1                   203   5e-58    
ref|XP_007170675.1|  PREDICTED: histone deacetylase 1 isoform X2        203   5e-58    
ref|XP_005878413.1|  PREDICTED: histone deacetylase 1                   203   5e-58    
gb|EEE65931.1|  hypothetical protein OsJ_21797                          203   5e-58    
ref|XP_004425952.1|  PREDICTED: histone deacetylase 1                   203   5e-58    
gb|EFB27370.1|  hypothetical protein PANDA_010851                       202   6e-58    
gb|AAF82385.1|  histone deacetylase                                     204   6e-58    
dbj|BAD68731.1|  putative histone deacetylase HDAC1                     202   6e-58    
gb|EMP28416.1|  Histone deacetylase 1                                   203   7e-58    
ref|NP_001273520.1|  histone deacetylase 1                              203   7e-58    
gb|ELU06885.1|  hypothetical protein CAPTEDRAFT_184599                  202   7e-58    
ref|XP_007092478.1|  PREDICTED: histone deacetylase 1                   202   8e-58    
gb|EDL38458.1|  mCG128529                                               203   8e-58    
ref|XP_010184404.1|  PREDICTED: histone deacetylase 1                   202   8e-58    
ref|XP_010619862.1|  PREDICTED: histone deacetylase 1                   203   8e-58    
ref|XP_007468739.1|  PREDICTED: histone deacetylase 1 isoform X2        203   8e-58    
ref|NP_001143835.1|  uncharacterized protein LOC100276617               202   8e-58    
ref|XP_006734227.1|  PREDICTED: histone deacetylase 1 isoform X1        203   8e-58    
ref|XP_004740974.1|  PREDICTED: histone deacetylase 1 isoform X2        203   8e-58    
ref|XP_002921911.1|  PREDICTED: histone deacetylase 1                   203   8e-58    
ref|NP_001057943.1|  Os06g0583400                                       204   8e-58    
ref|XP_004591679.1|  PREDICTED: histone deacetylase 1                   203   8e-58    
emb|CEP19880.1|  hypothetical protein                                   208   9e-58    
ref|XP_009412377.1|  PREDICTED: histone deacetylase 19-like             201   9e-58    
gb|ELR48738.1|  Histone deacetylase 1                                   202   9e-58    
ref|XP_004678799.1|  PREDICTED: histone deacetylase 1                   202   1e-57    
ref|XP_011829439.1|  PREDICTED: histone deacetylase 1 isoform X1        202   1e-57    
ref|XP_003828201.1|  PREDICTED: histone deacetylase 1                   202   1e-57    
ref|XP_004665328.1|  PREDICTED: histone deacetylase 1                   202   1e-57    
ref|XP_004406478.1|  PREDICTED: histone deacetylase 1                   202   1e-57    
ref|XP_004025419.1|  PREDICTED: histone deacetylase 1 isoform 1         202   1e-57    
ref|NP_004955.2|  histone deacetylase 1                                 202   1e-57    
ref|XP_003276411.1|  PREDICTED: histone deacetylase 1 isoform 1         202   1e-57    
ref|XP_002720761.1|  PREDICTED: histone deacetylase 1                   202   1e-57    
ref|XP_007170674.1|  PREDICTED: histone deacetylase 1 isoform X1        202   1e-57    
ref|XP_008846179.1|  PREDICTED: histone deacetylase 1                   202   1e-57    
ref|XP_003801297.1|  PREDICTED: histone deacetylase 1                   202   1e-57    
ref|NP_032254.1|  histone deacetylase 1                                 202   1e-57    
ref|XP_007523321.1|  PREDICTED: histone deacetylase 1                   202   1e-57    
ref|XP_002750618.1|  PREDICTED: histone deacetylase 1                   202   1e-57    
ref|XP_008070975.1|  PREDICTED: histone deacetylase 1                   202   1e-57    
gb|AAB68398.1|  putative histone deacetylase                            202   1e-57    
ref|XP_004850908.1|  PREDICTED: histone deacetylase 1                   202   1e-57    
gb|KFQ23420.1|  Histone deacetylase 1                                   201   1e-57    
ref|XP_006196994.1|  PREDICTED: histone deacetylase 1                   202   1e-57    
ref|XP_004266568.1|  PREDICTED: histone deacetylase 1                   202   1e-57    
ref|NP_001020580.1|  histone deacetylase 1                              202   1e-57    
ref|XP_004887243.1|  PREDICTED: histone deacetylase 1                   202   1e-57    
ref|XP_010149876.1|  PREDICTED: LOW QUALITY PROTEIN: histone deac...    200   1e-57    
ref|XP_005739016.1|  PREDICTED: histone deacetylase 1-like              202   1e-57    
ref|XP_010346435.1|  PREDICTED: histone deacetylase 1                   202   1e-57    
ref|NP_001032521.1|  histone deacetylase 1                              202   1e-57    
ref|XP_006054694.1|  PREDICTED: histone deacetylase 1 isoform X1        202   1e-57    
ref|XP_003500683.1|  PREDICTED: histone deacetylase 1 isoform X1        202   1e-57    
ref|XP_009453837.1|  PREDICTED: histone deacetylase 1 isoform X2        202   1e-57    
ref|XP_008877470.1|  hypothetical protein H310_12254                    201   1e-57    
ref|XP_003471128.1|  PREDICTED: histone deacetylase 1                   202   1e-57    
ref|XP_002287594.1|  histone deactylase 1 HDAC Hda1p HDA1               201   1e-57    
gb|AAP36140.1|  Homo sapiens histone deacetylase 1                      202   1e-57    
ref|XP_007015912.1|  Histone deacetylase 9 isoform 9                    200   1e-57    
ref|XP_003356353.2|  PREDICTED: histone deacetylase 1-like              202   1e-57    
ref|XP_010239874.1|  PREDICTED: histone deacetylase 9 isoform X2        199   1e-57    
ref|XP_004603624.1|  PREDICTED: histone deacetylase 1                   202   1e-57    
ref|XP_002952849.1|  hypothetical protein VOLCADRAFT_62995              201   1e-57    
ref|XP_006085432.1|  PREDICTED: histone deacetylase 1-like              202   2e-57    
ref|XP_001695812.1|  histone deacetylase                                201   2e-57    
gb|EPB75200.1|  histone deacetylase family protein                      202   2e-57    
dbj|GAA41197.2|  histone deacetylase 1/2                                201   2e-57    
ref|XP_001499986.4|  PREDICTED: histone deacetylase 1                   202   2e-57    
ref|XP_544435.2|  PREDICTED: histone deacetylase 1 isoform 1            202   2e-57    
ref|XP_007468738.1|  PREDICTED: histone deacetylase 1 isoform X1        203   2e-57    
ref|XP_002742058.1|  PREDICTED: histone deacetylase 3-like              201   2e-57    
ref|XP_007125154.1|  PREDICTED: histone deacetylase 1 isoform X1        203   2e-57    
ref|XP_006678427.1|  hypothetical protein BATDEDRAFT_24371              203   3e-57    
ref|XP_002594632.1|  hypothetical protein BRAFLDRAFT_217516             201   3e-57    
ref|XP_004740973.1|  PREDICTED: histone deacetylase 1 isoform X1        202   3e-57    
gb|KHJ90568.1|  histone deacetylase family protein                      200   3e-57    
gb|EHJ72565.1|  histone deacetylase Rpd3                                201   3e-57    
ref|XP_009174258.1|  hypothetical protein T265_09811                    202   3e-57    
emb|CAC19454.1|  histone deacetylase                                    203   3e-57    
ref|XP_009827426.1|  hypothetical protein H257_04553                    200   3e-57    
ref|XP_005717961.1|  histone deacetylase                                200   3e-57    
ref|XP_004931440.1|  PREDICTED: LOW QUALITY PROTEIN: histone deac...    201   4e-57    
ref|XP_007637109.1|  PREDICTED: histone deacetylase 1 isoform X2        202   4e-57    
ref|XP_007125155.1|  PREDICTED: histone deacetylase 1 isoform X2        202   5e-57    
gb|EHB04555.1|  Histone deacetylase 1                                   203   5e-57    
dbj|BAG70111.1|  histone deacetylase 1                                  201   5e-57    
ref|XP_004705065.1|  PREDICTED: histone deacetylase 1                   201   5e-57    
ref|XP_001096929.2|  PREDICTED: histone deacetylase 1-like              201   6e-57    
ref|XP_001655108.1|  AAEL011117-PA                                      199   6e-57    
ref|XP_011387414.1|  histone deacetylase                                202   6e-57    
ref|XP_008120699.1|  PREDICTED: histone deacetylase 1                   201   6e-57    
gb|AEE62688.1|  unknown                                                 200   7e-57    
gb|KHJ80932.1|  hypothetical protein OESDEN_19387                       191   7e-57    
ref|XP_008520120.1|  PREDICTED: histone deacetylase 1                   202   8e-57    
gb|ENN73569.1|  hypothetical protein YQE_09818                          200   8e-57    
ref|XP_003292577.1|  hypothetical protein DICPUDRAFT_40779              200   9e-57    
gb|KHJ82537.1|  hypothetical protein OESDEN_17769                       191   1e-56    
ref|XP_011687397.1|  PREDICTED: histone deacetylase Rpd3-like           200   1e-56    
ref|XP_008364370.1|  PREDICTED: histone deacetylase 19-like isofo...    200   1e-56    
ref|XP_007840320.1|  hypothetical protein PFICI_13548                   203   1e-56    
ref|XP_008364371.1|  PREDICTED: histone deacetylase 19-like isofo...    200   1e-56    
ref|XP_010380656.1|  PREDICTED: histone deacetylase 1-like isofor...    199   1e-56    
emb|CDI52252.1|  histone deacetylase                                    200   1e-56    
ref|XP_010925053.1|  PREDICTED: histone deacetylase 19-like             200   2e-56    
gb|EYU34888.1|  hypothetical protein MIMGU_mgv1a006051mg                199   2e-56    
ref|XP_007873421.1|  hypothetical protein PNEG_01482                    197   2e-56    
ref|XP_006862222.1|  PREDICTED: histone deacetylase 1                   199   2e-56    
ref|XP_003283132.1|  hypothetical protein DICPUDRAFT_85725              198   2e-56    
ref|XP_004372056.1|  PREDICTED: histone deacetylase 1                   199   2e-56    
ref|XP_009399782.1|  PREDICTED: probable histone deacetylase 19         200   2e-56    
ref|XP_006895025.1|  PREDICTED: histone deacetylase 1                   199   2e-56    
ref|XP_009358923.1|  PREDICTED: histone deacetylase 19                  199   3e-56    
ref|XP_646719.1|  histone deacetylase family protein                    197   3e-56    
gb|EST06072.1|  histone deacetylase                                     201   3e-56    
ref|XP_006360329.1|  PREDICTED: histone deacetylase 19-like             199   3e-56    
ref|XP_004322371.1|  PREDICTED: LOW QUALITY PROTEIN: histone deac...    199   3e-56    
ref|XP_003571679.1|  PREDICTED: probable histone deacetylase 19         199   3e-56    
ref|XP_004471453.1|  PREDICTED: histone deacetylase 1                   201   4e-56    
gb|EFX74892.1|  putative histone deacetylase Rpd3 protein               199   4e-56    
ref|XP_966633.1|  PREDICTED: histone deacetylase Rpd3                   199   4e-56    
ref|XP_007948636.1|  PREDICTED: histone deacetylase 1                   198   4e-56    
ref|XP_007043130.1|  Histone deacetylase 1 isoform 1                    199   4e-56    
emb|CCX17442.1|  Similar to Histone deacetylase RPD3; acc. no. P3...    200   5e-56    
gb|KIW34517.1|  histone deacetylase RPD3                                202   5e-56    
ref|XP_007043132.1|  Histone deacetylase 1 isoform 3                    198   5e-56    
dbj|BAA08909.1|  RPD3 protein                                           198   6e-56    
dbj|BAE22585.1|  unnamed protein product                                192   6e-56    
ref|XP_003415511.1|  PREDICTED: histone deacetylase 1                   198   6e-56    
ref|XP_008382752.1|  PREDICTED: histone deacetylase 19                  198   7e-56    
ref|NP_445898.1|  histone deacetylase 1-like                            198   7e-56    
ref|XP_008348955.1|  PREDICTED: histone deacetylase 19-like             198   7e-56    
dbj|GAC96889.1|  potential Sin3.Rpd3 histone deacetylase complex ...    199   8e-56    
ref|XP_008558948.1|  PREDICTED: histone deacetylase 3                   196   8e-56    
ref|XP_001592901.1|  hypothetical protein SS1G_05823                    200   8e-56    
ref|XP_009629140.1|  PREDICTED: histone deacetylase 19                  198   9e-56    
ref|XP_004247825.1|  PREDICTED: histone deacetylase 19                  198   9e-56    
gb|EEC74955.1|  hypothetical protein OsI_10942                          203   9e-56    
ref|XP_001732472.1|  hypothetical protein MGL_0247                      197   1e-55    
ref|XP_011678211.1|  PREDICTED: histone deacetylase 3 isoform X2        196   1e-55    
gb|EAZ22226.1|  hypothetical protein OsJ_05881                          198   1e-55    
ref|XP_011435047.1|  PREDICTED: histone deacetylase 3-like              196   1e-55    
ref|XP_010925380.1|  PREDICTED: probable histone deacetylase 19         198   1e-55    
gb|KFB43744.1|  AGAP001143-PA-like protein                              196   1e-55    
gb|ETL49347.1|  hypothetical protein L916_01156                         197   1e-55    
emb|CCJ31025.1|  unnamed protein product                                192   1e-55    
ref|XP_010915158.1|  PREDICTED: probable histone deacetylase 19         197   1e-55    
ref|XP_008619746.1|  histone deacetylase 1                              196   1e-55    
ref|XP_001631125.1|  predicted protein                                  196   1e-55    
emb|CDS28565.1|  histone deacetylase 1                                  197   1e-55    
ref|XP_647498.1|  histone deacetylase family protein                    197   1e-55    
emb|CBI37705.3|  unnamed protein product                                195   2e-55    
ref|XP_004922748.1|  PREDICTED: histone deacetylase 3-like              194   2e-55    
gb|EYU41223.1|  hypothetical protein MIMGU_mgv1a005940mg                196   2e-55    
gb|ETI56169.1|  hypothetical protein F443_01243                         196   2e-55    
ref|XP_008890897.1|  hypothetical protein PPTG_01052                    196   2e-55    
gb|EYU41225.1|  hypothetical protein MIMGU_mgv1a005940mg                196   2e-55    
gb|EYU41224.1|  hypothetical protein MIMGU_mgv1a005940mg                196   2e-55    
ref|XP_008810081.1|  PREDICTED: histone deacetylase 19-like             196   2e-55    
ref|XP_011083370.1|  PREDICTED: histone deacetylase 19                  196   2e-55    
ref|XP_004083964.1|  PREDICTED: histone deacetylase 2                   197   2e-55    
ref|XP_009770456.1|  PREDICTED: histone deacetylase 19                  197   2e-55    
gb|ERE77200.1|  histone deacetylase 1-like protein                      197   2e-55    
gb|ETN59692.1|  histone deacetylase                                     195   2e-55    
ref|XP_794761.1|  PREDICTED: histone deacetylase 3 isoform X1           195   2e-55    
gb|EZF25634.1|  hypothetical protein H100_02064                         196   2e-55    
ref|XP_007563814.1|  PREDICTED: probable histone deacetylase 1-B        196   2e-55    
ref|XP_002171858.1|  histone deacetylase Clr6                           194   2e-55    
emb|CEG73087.1|  Putative Histone deacetylase domain-containing p...    198   2e-55    
gb|KIM97807.1|  hypothetical protein OIDMADRAFT_168005                  199   2e-55    
ref|NP_001046284.1|  Os02g0214900                                       197   2e-55    
gb|KIW81766.1|  histone deacetylase RPD3                                200   3e-55    
ref|XP_007787138.1|  hypothetical protein EPUS_08444                    199   3e-55    
ref|XP_010266325.1|  PREDICTED: histone deacetylase 19 isoform X1       197   3e-55    
ref|XP_007265905.1|  hypothetical protein FOMMEDRAFT_81600              198   3e-55    
ref|XP_002029476.1|  GL22005                                            191   3e-55    
ref|XP_007624850.1|  PREDICTED: LOW QUALITY PROTEIN: histone deac...    196   3e-55    
gb|EIE85135.1|  histone deacetylase RPD3                                196   3e-55    
ref|XP_001560049.1|  hypothetical protein BC1G_01608                    199   3e-55    
gb|KEF55411.1|  histone deacetylase 1/2                                 199   3e-55    
ref|XP_011566592.1|  PREDICTED: histone deacetylase 3-like              191   3e-55    
ref|XP_003742933.1|  PREDICTED: histone deacetylase 1-like              196   3e-55    
emb|CCD46681.1|  similar to histone deacetylase RpdA/Rpd3               199   4e-55    
ref|XP_008235847.1|  PREDICTED: histone deacetylase 19                  196   4e-55    
ref|XP_010128574.1|  PREDICTED: histone deacetylase 2                   194   4e-55    
ref|XP_002908492.1|  histone deacetylase, putative                      195   5e-55    
ref|XP_010690952.1|  PREDICTED: histone deacetylase 19                  196   5e-55    
gb|KFQ37861.1|  Histone deacetylase 2                                   194   5e-55    
ref|XP_001649445.1|  AAEL004586-PB                                      196   5e-55    
emb|CEI90063.1|  Putative Histone deacetylase                           197   5e-55    
ref|XP_010526532.1|  PREDICTED: histone deacetylase 19                  196   5e-55    
ref|XP_004537015.1|  PREDICTED: histone deacetylase 3-like              194   5e-55    
ref|XP_004343197.1|  histone deacetylase-3                              194   5e-55    
ref|XP_007747235.1|  histone deacetylase 1/2                            199   5e-55    
ref|XP_008300137.1|  PREDICTED: probable histone deacetylase 1-B        195   5e-55    
emb|CEI89045.1|  Putative Histone deacetylase                           197   5e-55    
gb|KIW94273.1|  histone deacetylase RPD3                                199   5e-55    
ref|XP_001649446.1|  AAEL004586-PA                                      195   5e-55    
emb|CEG73086.1|  Putative Histone deacetylase                           197   6e-55    
ref|XP_010185293.1|  PREDICTED: histone deacetylase 2                   194   6e-55    
gb|KDO68452.1|  hypothetical protein CISIN_1g010834mg                   194   6e-55    



>emb|CDP06960.1| unnamed protein product [Coffea canephora]
Length=430

 Score =   340 bits (872),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 174/199 (87%), Positives = 188/199 (94%), Gaps = 0/199 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  F   +  IISKVVETY+PGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFN+
Sbjct  231  DNSFTRLFKTIISKVVETYLPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNL  290

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            PLL+TGGGGYTKENVARCWA+ETGVLLD+ELPNEIP+NDYIK+F PDYSLKIPGGHIENL
Sbjct  291  PLLITGGGGYTKENVARCWAFETGVLLDTELPNEIPENDYIKFFEPDYSLKIPGGHIENL  350

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQI  189
            NSKSYLGTIK +VLENLRYIQHAP VQMQEVPPDFY+PDFDED QNPDER+DQHTQDKQI
Sbjct  351  NSKSYLGTIKMNVLENLRYIQHAPGVQMQEVPPDFYLPDFDEDEQNPDERMDQHTQDKQI  410

Query  188  QRddeyyegdndnDHSMDD  132
            QRDDEYY+GDNDNDH+M+D
Sbjct  411  QRDDEYYDGDNDNDHNMED  429



>dbj|BAF37798.1| hypothetical protein [Ipomoea trifida]
Length=496

 Score =   340 bits (871),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 189/251 (75%), Positives = 192/251 (76%), Gaps = 51/251 (20%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDG-------------  588
            D  F   +  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDG             
Sbjct  246  DSSFIRLFRTIISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGASLLVIKVLFGHH  305

Query  587  --------------------------------------HAECVRFVKKFNIPLLVTGGGG  522
                                                  HAECVRFVKKFNIPLLVTGGGG
Sbjct  306  STFCKDISVVYLFPSTNLSCNFLGDFYMGMFYLMLLAGHAECVRFVKKFNIPLLVTGGGG  365

Query  521  YTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTI  342
            YTKENVARCW YETG+LLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTI
Sbjct  366  YTKENVARCWTYETGILLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTI  425

Query  341  KSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQIQRddeyyeg  162
            K+HVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQIQRDDEYYEG
Sbjct  426  KTHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQIQRDDEYYEG  485

Query  161  dndnDHSMDDA  129
            DNDNDHSMDDA
Sbjct  486  DNDNDHSMDDA  496



>gb|KDO51343.1| hypothetical protein CISIN_1g0130382mg, partial [Citrus sinensis]
 gb|KDO51344.1| hypothetical protein CISIN_1g0130382mg, partial [Citrus sinensis]
 gb|KDO51345.1| hypothetical protein CISIN_1g0130382mg, partial [Citrus sinensis]
Length=220

 Score =   326 bits (835),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 154/182 (85%), Positives = 164/182 (90%), Gaps = 0/182 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  F   +  IISKVVETY PGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFN+
Sbjct  22   DTSFTRLFKTIISKVVETYAPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNL  81

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            PLLVTGGGGYTKENVARCW  ETG+LLD+ELPNEIP+N+YIKYF P+ SL+IP GHIENL
Sbjct  82   PLLVTGGGGYTKENVARCWTVETGILLDTELPNEIPENEYIKYFAPECSLRIPNGHIENL  141

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQI  189
            NSKSYL TIK  VLENLR IQHAPSVQMQEVPPDFYIP+FDED QNPDER+DQHTQDKQI
Sbjct  142  NSKSYLSTIKMQVLENLRSIQHAPSVQMQEVPPDFYIPEFDEDEQNPDERMDQHTQDKQI  201

Query  188  QR  183
            QR
Sbjct  202  QR  203



>ref|XP_004251031.1| PREDICTED: histone deacetylase 9 [Solanum lycopersicum]
Length=430

 Score =   333 bits (853),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 158/182 (87%), Positives = 168/182 (92%), Gaps = 0/182 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  F   +  IISKVVETY+PGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFN+
Sbjct  231  DGSFTRLFKTIISKVVETYLPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNL  290

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            PLLVTGGGGYTKENVARCWA ETGVLLD+ELPNEIPDNDYIKYF PDYSLK+PGGHIENL
Sbjct  291  PLLVTGGGGYTKENVARCWALETGVLLDTELPNEIPDNDYIKYFAPDYSLKLPGGHIENL  350

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQI  189
            NSKSY+GTIK  V+ENLR +QHAPSVQMQEVPPDFYIPDFDED QNPDER++QHTQDK I
Sbjct  351  NSKSYIGTIKMQVMENLRCLQHAPSVQMQEVPPDFYIPDFDEDEQNPDERVNQHTQDKHI  410

Query  188  QR  183
            QR
Sbjct  411  QR  412



>ref|XP_010661436.1| PREDICTED: histone deacetylase 9 isoform X2 [Vitis vinifera]
Length=241

 Score =   326 bits (836),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 154/182 (85%), Positives = 165/182 (91%), Gaps = 0/182 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  F   +  II+KVVETY PG IVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFN+
Sbjct  42   DTSFTRLFKTIIAKVVETYQPGVIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNL  101

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            PLLVTGGGGYTKENVARCW  ETGVLLD+ELPNEIP+N+YIKYF P+YSLKIP GHIENL
Sbjct  102  PLLVTGGGGYTKENVARCWTVETGVLLDTELPNEIPENEYIKYFAPEYSLKIPNGHIENL  161

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQI  189
            NSKSY+GTIK  VLENLR IQHAPSVQMQEVPPDFYIPDFDED QNPDER+DQHT+D+QI
Sbjct  162  NSKSYIGTIKMQVLENLRCIQHAPSVQMQEVPPDFYIPDFDEDEQNPDERVDQHTRDRQI  221

Query  188  QR  183
            QR
Sbjct  222  QR  223



>ref|XP_009605994.1| PREDICTED: histone deacetylase 9 [Nicotiana tomentosiformis]
 ref|XP_009788798.1| PREDICTED: histone deacetylase 9 isoform X1 [Nicotiana sylvestris]
 ref|XP_009788799.1| PREDICTED: histone deacetylase 9 isoform X2 [Nicotiana sylvestris]
Length=430

 Score =   332 bits (852),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 158/179 (88%), Positives = 166/179 (93%), Gaps = 0/179 (0%)
 Frame = -3

Query  719  FXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLL  540
            F   +  II+KVVETY PGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFN+PLL
Sbjct  234  FTRLFKTIIAKVVETYSPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNLPLL  293

Query  539  VTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSK  360
            VTGGGGYTKENVARCWA ETGVLLD+ELPNEIPDNDYIKYFGPDYSLK+PGGHIENLNSK
Sbjct  294  VTGGGGYTKENVARCWALETGVLLDTELPNEIPDNDYIKYFGPDYSLKLPGGHIENLNSK  353

Query  359  SYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQIQR  183
            SY+GTIK  V+ENLR IQHAP VQMQEVPPDFYIPDFDED QNPDER+DQHTQDK IQR
Sbjct  354  SYIGTIKMQVMENLRCIQHAPGVQMQEVPPDFYIPDFDEDEQNPDERVDQHTQDKHIQR  412



>ref|XP_010093211.1| Histone deacetylase 9 [Morus notabilis]
 gb|EXB53709.1| Histone deacetylase 9 [Morus notabilis]
Length=429

 Score =   332 bits (852),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 158/182 (87%), Positives = 167/182 (92%), Gaps = 0/182 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  F   +  IISKVVETY+PGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFN+
Sbjct  231  DASFTRLFKTIISKVVETYLPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNL  290

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            PLLVTGGGGYTKENVARCW  ETGVLLD+ELPNEIPDN+YIKYF P++SLKIP GHIENL
Sbjct  291  PLLVTGGGGYTKENVARCWTLETGVLLDTELPNEIPDNEYIKYFAPEFSLKIPHGHIENL  350

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQI  189
            NSKSYLGTIK  VLENLRYIQHAPSVQMQEVPPDFYIPDFDED QNPDER+DQH +DKQI
Sbjct  351  NSKSYLGTIKVQVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDEQNPDERVDQHARDKQI  410

Query  188  QR  183
            QR
Sbjct  411  QR  412



>ref|XP_006349095.1| PREDICTED: histone deacetylase 9-like [Solanum tuberosum]
Length=430

 Score =   332 bits (850),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 157/182 (86%), Positives = 168/182 (92%), Gaps = 0/182 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  F   +  IISKVVETY+PGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFN+
Sbjct  231  DGSFTRLFKTIISKVVETYLPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNL  290

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            PLLVTGGGGYTKENVARCWA ETGVLLD+ELPNEIPDNDYIKYF PDYSLK+PGGHIENL
Sbjct  291  PLLVTGGGGYTKENVARCWALETGVLLDTELPNEIPDNDYIKYFAPDYSLKLPGGHIENL  350

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQI  189
            NSKSY+GTIK  V+ENLR +QHAPSVQMQEVPPDF+IPDFDED QNPDER++QHTQDK I
Sbjct  351  NSKSYIGTIKMQVMENLRCLQHAPSVQMQEVPPDFFIPDFDEDEQNPDERVNQHTQDKHI  410

Query  188  QR  183
            QR
Sbjct  411  QR  412



>ref|XP_010243527.1| PREDICTED: histone deacetylase 9 [Nelumbo nucifera]
Length=430

 Score =   330 bits (847),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 172/200 (86%), Positives = 182/200 (91%), Gaps = 0/200 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  F   +  II+KVVETY+PG IVLQCGADSLAGDRLGCFNLSIDGH+ECVRFVKKFN+
Sbjct  231  DSSFTRLFKTIIAKVVETYLPGVIVLQCGADSLAGDRLGCFNLSIDGHSECVRFVKKFNL  290

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            PLLVTGGGGYTKENVARCWA ETG LLD+ELPNEIPDN+YIKYF PDYSLKIP G++ENL
Sbjct  291  PLLVTGGGGYTKENVARCWAVETGALLDTELPNEIPDNEYIKYFAPDYSLKIPNGNLENL  350

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQI  189
            NSKSYLGTIK  V ENLR IQHAPSVQMQEVPPDFYIPDFDED QNPDER+DQHTQDKQI
Sbjct  351  NSKSYLGTIKMQVFENLRCIQHAPSVQMQEVPPDFYIPDFDEDEQNPDERVDQHTQDKQI  410

Query  188  QRddeyyegdndnDHSMDDA  129
            QRDDEYYEGDNDND SMDDA
Sbjct  411  QRDDEYYEGDNDNDQSMDDA  430



>ref|XP_009364273.1| PREDICTED: histone deacetylase 9 [Pyrus x bretschneideri]
Length=430

 Score =   330 bits (846),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 174/199 (87%), Positives = 181/199 (91%), Gaps = 0/199 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  F   +  IISKVVETY+PGAIVLQCGADSLAGDRLGCFNLSIDGHAECV+FVKKFNI
Sbjct  231  DASFSRLFNTIISKVVETYLPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVKFVKKFNI  290

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            PLLVTGGGGYTKENVARCW  ETGVLLDSELPNEIPDN+YIKYF PD SL+IP GHIENL
Sbjct  291  PLLVTGGGGYTKENVARCWTVETGVLLDSELPNEIPDNEYIKYFSPDCSLRIPSGHIENL  350

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQI  189
            NSKSYL TIK  VLENLR IQHAPSVQMQEVPPDFYIPDFDED QNPDERLDQHTQDK I
Sbjct  351  NSKSYLSTIKIQVLENLRCIQHAPSVQMQEVPPDFYIPDFDEDEQNPDERLDQHTQDKNI  410

Query  188  QRddeyyegdndnDHSMDD  132
            QRDDEYYEGDNDNDH+M+D
Sbjct  411  QRDDEYYEGDNDNDHNMED  429



>ref|XP_010692976.1| PREDICTED: histone deacetylase 9 isoform X4 [Beta vulgaris subsp. 
vulgaris]
Length=240

 Score =   320 bits (820),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 167/199 (84%), Positives = 179/199 (90%), Gaps = 1/199 (1%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  F   +  IISKVVE Y PG IVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFN+
Sbjct  42   DTSFTRLFKTIISKVVEFYQPGVIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNL  101

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            PLLVTGGGGYTKENVARCW  ETGVLLD++LPNEIPDN+YIKYFGPDYSL+IP GHIENL
Sbjct  102  PLLVTGGGGYTKENVARCWTVETGVLLDTDLPNEIPDNEYIKYFGPDYSLRIPNGHIENL  161

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQI  189
            NSKSYL TIK  VLENLR IQHAPSVQMQEVPPDFY+PDFDED +NPDER++QHTQDK I
Sbjct  162  NSKSYLTTIKMQVLENLRCIQHAPSVQMQEVPPDFYVPDFDED-ENPDERINQHTQDKLI  220

Query  188  QRddeyyegdndnDHSMDD  132
            QRDDEYY+GD DNDH+MDD
Sbjct  221  QRDDEYYDGDQDNDHNMDD  239



>ref|XP_010031478.1| PREDICTED: histone deacetylase 9 isoform X2 [Eucalyptus grandis]
Length=243

 Score =   320 bits (820),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 155/184 (84%), Positives = 163/184 (89%), Gaps = 2/184 (1%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  F   +  IISKVVETY PGAIVLQCGADSLAGDRLGCFNLSIDGH+ECVRFVKKFN+
Sbjct  42   DTSFTRLFKAIISKVVETYQPGAIVLQCGADSLAGDRLGCFNLSIDGHSECVRFVKKFNL  101

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHI--E  375
            PLLVTGGGGYTKENVARCW  ETGVLLD+ELPNEIP+N+Y KYF PDYSLKIP G+I  E
Sbjct  102  PLLVTGGGGYTKENVARCWVVETGVLLDTELPNEIPENEYFKYFAPDYSLKIPRGNIVLE  161

Query  374  NLNSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDK  195
            NLNSKSYL  IK  VLENLR IQHAPSVQMQEVPPDFYIPDFDED QNPDER+DQHTQDK
Sbjct  162  NLNSKSYLSAIKVQVLENLRNIQHAPSVQMQEVPPDFYIPDFDEDEQNPDERMDQHTQDK  221

Query  194  QIQR  183
            QIQR
Sbjct  222  QIQR  225



>ref|XP_008349785.1| PREDICTED: histone deacetylase 9 [Malus domestica]
Length=430

 Score =   327 bits (837),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 159/182 (87%), Positives = 164/182 (90%), Gaps = 0/182 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  F   +  IISKVVETY+PGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI
Sbjct  231  DASFNRLFKTIISKVVETYLPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  290

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            PLLVTGGGGYTKENVARCW  ETGVLLDSELPNEIPDN+YIKYF PD SL+IP GHIENL
Sbjct  291  PLLVTGGGGYTKENVARCWTVETGVLLDSELPNEIPDNEYIKYFSPDCSLRIPNGHIENL  350

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQI  189
            NSKSYL TIK  VLENLR IQHAPSVQMQEVPPDFYIPDFDED QNPDERLDQ+TQDK I
Sbjct  351  NSKSYLSTIKIQVLENLRCIQHAPSVQMQEVPPDFYIPDFDEDEQNPDERLDQNTQDKHI  410

Query  188  QR  183
            QR
Sbjct  411  QR  412



>ref|XP_009364877.1| PREDICTED: histone deacetylase 9-like [Pyrus x bretschneideri]
 ref|XP_009339956.1| PREDICTED: histone deacetylase 9-like [Pyrus x bretschneideri]
Length=429

 Score =   326 bits (836),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 158/182 (87%), Positives = 164/182 (90%), Gaps = 0/182 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  F   +  IISKVVETY+PGAIVLQCGADSLAGDRLGCFNLSIDGHAECV+FVKKFNI
Sbjct  231  DASFSRLFNTIISKVVETYLPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVKFVKKFNI  290

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            PLLVTGGGGYTKENVARCW  ETGVLLDSELPNEIPDN+YIKYF PD SL+IP GHIENL
Sbjct  291  PLLVTGGGGYTKENVARCWTVETGVLLDSELPNEIPDNEYIKYFSPDCSLRIPSGHIENL  350

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQI  189
            NSKSYL TIK  VLENLR IQHAPSVQMQEVPPDFYIPDFDED QNPDERL+QHTQDK I
Sbjct  351  NSKSYLSTIKIQVLENLRCIQHAPSVQMQEVPPDFYIPDFDEDEQNPDERLNQHTQDKNI  410

Query  188  QR  183
            QR
Sbjct  411  QR  412



>ref|XP_004506146.1| PREDICTED: histone deacetylase 9-like [Cicer arietinum]
Length=430

 Score =   326 bits (836),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 172/200 (86%), Positives = 180/200 (90%), Gaps = 0/200 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  F   +  IISKVVETY PGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVK+FN+
Sbjct  231  DSSFTRLFKTIISKVVETYQPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKRFNL  290

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            PLLVTGGGGYTKENVARCW  ETGVLLD+ELPNEIP+N YIKYFGPD+SLKIP GHIENL
Sbjct  291  PLLVTGGGGYTKENVARCWTVETGVLLDTELPNEIPENVYIKYFGPDFSLKIPHGHIENL  350

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQI  189
            NSKSYL TIK  VLENLR IQHAPSVQMQEVPPDFYIP+FDED QNPDER+DQHTQDK I
Sbjct  351  NSKSYLSTIKMQVLENLRCIQHAPSVQMQEVPPDFYIPEFDEDLQNPDERIDQHTQDKHI  410

Query  188  QRddeyyegdndnDHSMDDA  129
            QRDDEYYEGDNDNDH MD A
Sbjct  411  QRDDEYYEGDNDNDHQMDIA  430



>ref|XP_008227403.1| PREDICTED: histone deacetylase 9 isoform X2 [Prunus mume]
Length=343

 Score =   323 bits (827),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 152/182 (84%), Positives = 165/182 (91%), Gaps = 0/182 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  F   +  IISKVVETY+PG IVLQCGADSLAGDRLGCFNLSIDGHA+CVRFVKKFN+
Sbjct  144  DTSFNRLFKTIISKVVETYLPGVIVLQCGADSLAGDRLGCFNLSIDGHADCVRFVKKFNL  203

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            PLLVTGGGGYTKENVARCW  ETGVLLDSELPNEIP+N+YIKYF PD+SL+IP GHIENL
Sbjct  204  PLLVTGGGGYTKENVARCWTVETGVLLDSELPNEIPENEYIKYFSPDFSLRIPNGHIENL  263

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQI  189
            NSKSY+ TIK+ VLENLR IQHAP+VQMQEVPPDFYIPDFDED QNPDER+DQHT+DK I
Sbjct  264  NSKSYISTIKTQVLENLRCIQHAPNVQMQEVPPDFYIPDFDEDAQNPDERVDQHTEDKHI  323

Query  188  QR  183
            QR
Sbjct  324  QR  325



>ref|XP_012075872.1| PREDICTED: histone deacetylase 9 [Jatropha curcas]
 gb|KDP34706.1| hypothetical protein JCGZ_10911 [Jatropha curcas]
Length=430

 Score =   326 bits (835),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 156/182 (86%), Positives = 164/182 (90%), Gaps = 0/182 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  F   +  IISKVVETY+PG IVLQCGADSLA DRLGCFNLSIDGHAECVRFVKKFN+
Sbjct  231  DTSFTRLFKTIISKVVETYLPGVIVLQCGADSLARDRLGCFNLSIDGHAECVRFVKKFNL  290

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            PLLVTGGGGYTKENVARCW  ETGVLL++ELPNEIPDN+YIKYFGP+YSLKIPGG IENL
Sbjct  291  PLLVTGGGGYTKENVARCWTVETGVLLETELPNEIPDNEYIKYFGPEYSLKIPGGQIENL  350

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQI  189
            NSKSYL TIK  VLENLR IQHAPSVQMQEVPPDFYIPDFDED QNPDER+DQHTQDK I
Sbjct  351  NSKSYLSTIKMQVLENLRCIQHAPSVQMQEVPPDFYIPDFDEDEQNPDERMDQHTQDKHI  410

Query  188  QR  183
            QR
Sbjct  411  QR  412



>ref|XP_002266492.1| PREDICTED: histone deacetylase 9 isoform X1 [Vitis vinifera]
 emb|CBI16725.3| unnamed protein product [Vitis vinifera]
Length=430

 Score =   325 bits (834),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 154/182 (85%), Positives = 165/182 (91%), Gaps = 0/182 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  F   +  II+KVVETY PG IVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFN+
Sbjct  231  DTSFTRLFKTIIAKVVETYQPGVIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNL  290

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            PLLVTGGGGYTKENVARCW  ETGVLLD+ELPNEIP+N+YIKYF P+YSLKIP GHIENL
Sbjct  291  PLLVTGGGGYTKENVARCWTVETGVLLDTELPNEIPENEYIKYFAPEYSLKIPNGHIENL  350

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQI  189
            NSKSY+GTIK  VLENLR IQHAPSVQMQEVPPDFYIPDFDED QNPDER+DQHT+D+QI
Sbjct  351  NSKSYIGTIKMQVLENLRCIQHAPSVQMQEVPPDFYIPDFDEDEQNPDERVDQHTRDRQI  410

Query  188  QR  183
            QR
Sbjct  411  QR  412



>ref|XP_007205234.1| hypothetical protein PRUPE_ppa006053mg [Prunus persica]
 gb|EMJ06433.1| hypothetical protein PRUPE_ppa006053mg [Prunus persica]
Length=430

 Score =   325 bits (834),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 154/182 (85%), Positives = 164/182 (90%), Gaps = 0/182 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  F   +  IISKVVETY+PG IVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFN+
Sbjct  231  DTSFNRLFKTIISKVVETYLPGVIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNL  290

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            PLLVTGGGGYTKENVARCW  ETGVLLDSELPNEIP+N+YIKYF PD+SL+IP GHIENL
Sbjct  291  PLLVTGGGGYTKENVARCWTVETGVLLDSELPNEIPENEYIKYFSPDFSLRIPNGHIENL  350

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQI  189
            NSKSY+ TIK  VLENLR IQHAP+VQMQEVPPDFYIPDFDED QNPDER+DQHTQDK I
Sbjct  351  NSKSYISTIKMQVLENLRCIQHAPNVQMQEVPPDFYIPDFDEDAQNPDERVDQHTQDKHI  410

Query  188  QR  183
            QR
Sbjct  411  QR  412



>emb|CAN77816.1| hypothetical protein VITISV_020659 [Vitis vinifera]
Length=430

 Score =   325 bits (833),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 154/182 (85%), Positives = 165/182 (91%), Gaps = 0/182 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  F   +  II+KVVETY PG IVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFN+
Sbjct  231  DTSFTRLFKTIIAKVVETYQPGVIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNL  290

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            PLLVTGGGGYTKENVARCW  ETGVLLD+ELPNEIP+N+YIKYF P+YSLKIP GHIENL
Sbjct  291  PLLVTGGGGYTKENVARCWTVETGVLLDTELPNEIPENEYIKYFAPEYSLKIPNGHIENL  350

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQI  189
            NSKSY+GTIK  VLENLR IQHAPSVQMQEVPPDFYIPDFDED QNPDER+DQHT+D+QI
Sbjct  351  NSKSYIGTIKMQVLENLRCIQHAPSVQMQEVPPDFYIPDFDEDEQNPDERVDQHTRDRQI  410

Query  188  QR  183
            QR
Sbjct  411  QR  412



>ref|XP_006471388.1| PREDICTED: histone deacetylase 9-like [Citrus sinensis]
Length=429

 Score =   325 bits (832),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 155/182 (85%), Positives = 164/182 (90%), Gaps = 0/182 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  F   +  IISKVVETY PGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFN+
Sbjct  231  DTSFTRLFKTIISKVVETYAPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNL  290

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            PLLVTGGGGYTKENVARCW  ETGVLLD+ELPNEIP+N+YIKYF P+ SL+IP GHIENL
Sbjct  291  PLLVTGGGGYTKENVARCWTVETGVLLDTELPNEIPENEYIKYFAPECSLRIPNGHIENL  350

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQI  189
            NSKSYL TIK  VLENLR IQHAPSVQMQEVPPDFYIP+FDED QNPDER+DQHTQDKQI
Sbjct  351  NSKSYLSTIKMQVLENLRSIQHAPSVQMQEVPPDFYIPEFDEDEQNPDERMDQHTQDKQI  410

Query  188  QR  183
            QR
Sbjct  411  QR  412



>ref|XP_011005322.1| PREDICTED: histone deacetylase 9 isoform X3 [Populus euphratica]
Length=429

 Score =   324 bits (831),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 156/182 (86%), Positives = 164/182 (90%), Gaps = 0/182 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  F   +  IISKVVETY PGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFN+
Sbjct  231  DTSFTRLFKTIISKVVETYQPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNL  290

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            PLLVTGGGGYTKENVARCW  ETGVLLD+ELPNEIP+N+YIKYF PDYSLK PGG +ENL
Sbjct  291  PLLVTGGGGYTKENVARCWTVETGVLLDTELPNEIPENEYIKYFAPDYSLKSPGGLVENL  350

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQI  189
            NSKSYL TIK  VL+NLR IQHAPSVQMQEVPPDFYIPDFDED QNPDER+DQHTQDKQI
Sbjct  351  NSKSYLSTIKMQVLDNLRCIQHAPSVQMQEVPPDFYIPDFDEDEQNPDERMDQHTQDKQI  410

Query  188  QR  183
            QR
Sbjct  411  QR  412



>gb|KEH29890.1| histone deacetylase family protein [Medicago truncatula]
Length=405

 Score =   323 bits (829),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 170/198 (86%), Positives = 177/198 (89%), Gaps = 0/198 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  F   +  IISKVVETY PGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFN+
Sbjct  206  DSSFTRLFKTIISKVVETYQPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNV  265

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            PLLVTGGGGYTKENVARCW  ETGVLLD+ELPNEIP+NDYIKYFGPD+SLKIP G IENL
Sbjct  266  PLLVTGGGGYTKENVARCWTVETGVLLDTELPNEIPENDYIKYFGPDFSLKIPNGFIENL  325

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQI  189
            NSKSYL TIK  V+ENLR IQHAPSVQMQEVPPDFYIPD DED QNPDER DQHTQDK I
Sbjct  326  NSKSYLSTIKMQVMENLRCIQHAPSVQMQEVPPDFYIPDIDEDLQNPDERNDQHTQDKHI  385

Query  188  QRddeyyegdndnDHSMD  135
            QRDDEYY+GDNDNDH MD
Sbjct  386  QRDDEYYDGDNDNDHQMD  403



>ref|XP_002300554.1| histone deacetylase-related family protein [Populus trichocarpa]
 gb|EEE85359.1| histone deacetylase-related family protein [Populus trichocarpa]
Length=429

 Score =   324 bits (831),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 156/182 (86%), Positives = 164/182 (90%), Gaps = 0/182 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  F   +  IISKVVETY PGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFN+
Sbjct  231  DTSFTRLFKTIISKVVETYQPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNL  290

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            PLLVTGGGGYTKENVARCW  ETGVLLD+ELPNEIP+N+YIKYF PDYSLK PGG +ENL
Sbjct  291  PLLVTGGGGYTKENVARCWTVETGVLLDTELPNEIPENEYIKYFAPDYSLKSPGGLMENL  350

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQI  189
            NSKSYL TIK  VLENLR IQHAPSVQMQEVPPDF+IPDFDED QNPDER+DQHTQDKQI
Sbjct  351  NSKSYLSTIKMQVLENLRCIQHAPSVQMQEVPPDFFIPDFDEDEQNPDERMDQHTQDKQI  410

Query  188  QR  183
            QR
Sbjct  411  QR  412



>ref|XP_006424306.1| hypothetical protein CICLE_v10029823mg [Citrus clementina]
 gb|ESR37546.1| hypothetical protein CICLE_v10029823mg [Citrus clementina]
Length=429

 Score =   324 bits (831),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 154/182 (85%), Positives = 164/182 (90%), Gaps = 0/182 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  F   +  IISKVVETY PGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFN+
Sbjct  231  DTSFTRLFKTIISKVVETYAPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNL  290

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            PLLVTGGGGYTKENVARCW  ETG+LLD+ELPNEIP+N+YIKYF P+ SL+IP GHIENL
Sbjct  291  PLLVTGGGGYTKENVARCWTVETGILLDTELPNEIPENEYIKYFAPECSLRIPNGHIENL  350

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQI  189
            NSKSYL TIK  VLENLR IQHAPSVQMQEVPPDFYIP+FDED QNPDER+DQHTQDKQI
Sbjct  351  NSKSYLSTIKMQVLENLRSIQHAPSVQMQEVPPDFYIPEFDEDEQNPDERMDQHTQDKQI  410

Query  188  QR  183
            QR
Sbjct  411  QR  412



>ref|XP_007142469.1| hypothetical protein PHAVU_008G283200g [Phaseolus vulgaris]
 gb|ESW14463.1| hypothetical protein PHAVU_008G283200g [Phaseolus vulgaris]
Length=429

 Score =   323 bits (829),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 155/182 (85%), Positives = 164/182 (90%), Gaps = 0/182 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            DL F   +  IISKVVETY PGAIVLQCGADSLAGDRLGCFNLSIDGH+ECV FVKKFN+
Sbjct  231  DLSFTRLFKTIISKVVETYQPGAIVLQCGADSLAGDRLGCFNLSIDGHSECVSFVKKFNL  290

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            PLLVTGGGGYTKENVARCW  ETGVLLD+ELPNEIP+NDYIKYF P++SLKIP G IENL
Sbjct  291  PLLVTGGGGYTKENVARCWTVETGVLLDTELPNEIPENDYIKYFAPEFSLKIPNGQIENL  350

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQI  189
            NSKSYL TIK  VLENLR IQHAPSVQMQEVPPDFYIPDFDED QNPDER+DQHTQDK+I
Sbjct  351  NSKSYLSTIKMQVLENLRCIQHAPSVQMQEVPPDFYIPDFDEDEQNPDERIDQHTQDKRI  410

Query  188  QR  183
            QR
Sbjct  411  QR  412



>gb|KHG07653.1| Histone deacetylase 9 -like protein [Gossypium arboreum]
Length=240

 Score =   317 bits (811),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 165/198 (83%), Positives = 174/198 (88%), Gaps = 0/198 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  F   +  IISKVVE Y PGAIVLQCGADSLAGDRLGCFNLSIDGHAECV+ VKKFN+
Sbjct  42   DTSFTRLFKIIISKVVEMYRPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVKIVKKFNL  101

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            PLLVTGGGGYTKENVARCW  ETGVLLD+ELPNEIP+N+YIKYF PD  L IP GHIENL
Sbjct  102  PLLVTGGGGYTKENVARCWTVETGVLLDTELPNEIPENEYIKYFAPDCLLNIPNGHIENL  161

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQI  189
            NSKSYL TIK  VLENLR IQHAP VQMQEVPPDFYIPDFDED  NPDER+DQHTQDKQI
Sbjct  162  NSKSYLSTIKMQVLENLRSIQHAPGVQMQEVPPDFYIPDFDEDEHNPDERMDQHTQDKQI  221

Query  188  QRddeyyegdndnDHSMD  135
            QRDDEYY+GDNDNDH+MD
Sbjct  222  QRDDEYYDGDNDNDHNMD  239



>ref|XP_008227393.1| PREDICTED: histone deacetylase 9 isoform X1 [Prunus mume]
Length=430

 Score =   323 bits (828),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 152/182 (84%), Positives = 165/182 (91%), Gaps = 0/182 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  F   +  IISKVVETY+PG IVLQCGADSLAGDRLGCFNLSIDGHA+CVRFVKKFN+
Sbjct  231  DTSFNRLFKTIISKVVETYLPGVIVLQCGADSLAGDRLGCFNLSIDGHADCVRFVKKFNL  290

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            PLLVTGGGGYTKENVARCW  ETGVLLDSELPNEIP+N+YIKYF PD+SL+IP GHIENL
Sbjct  291  PLLVTGGGGYTKENVARCWTVETGVLLDSELPNEIPENEYIKYFSPDFSLRIPNGHIENL  350

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQI  189
            NSKSY+ TIK+ VLENLR IQHAP+VQMQEVPPDFYIPDFDED QNPDER+DQHT+DK I
Sbjct  351  NSKSYISTIKTQVLENLRCIQHAPNVQMQEVPPDFYIPDFDEDAQNPDERVDQHTEDKHI  410

Query  188  QR  183
            QR
Sbjct  411  QR  412



>ref|XP_003606237.1| Histone deacetylase [Medicago truncatula]
 gb|AES88434.1| histone deacetylase family protein [Medicago truncatula]
Length=430

 Score =   323 bits (828),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 170/198 (86%), Positives = 177/198 (89%), Gaps = 0/198 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  F   +  IISKVVETY PGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFN+
Sbjct  231  DSSFTRLFKTIISKVVETYQPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNV  290

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            PLLVTGGGGYTKENVARCW  ETGVLLD+ELPNEIP+NDYIKYFGPD+SLKIP G IENL
Sbjct  291  PLLVTGGGGYTKENVARCWTVETGVLLDTELPNEIPENDYIKYFGPDFSLKIPNGFIENL  350

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQI  189
            NSKSYL TIK  V+ENLR IQHAPSVQMQEVPPDFYIPD DED QNPDER DQHTQDK I
Sbjct  351  NSKSYLSTIKMQVMENLRCIQHAPSVQMQEVPPDFYIPDIDEDLQNPDERNDQHTQDKHI  410

Query  188  QRddeyyegdndnDHSMD  135
            QRDDEYY+GDNDNDH MD
Sbjct  411  QRDDEYYDGDNDNDHQMD  428



>ref|XP_008788401.1| PREDICTED: histone deacetylase 17 isoform X3 [Phoenix dactylifera]
Length=241

 Score =   316 bits (810),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 149/182 (82%), Positives = 162/182 (89%), Gaps = 0/182 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  F   +  II+KVVETY+PG IVLQCGADSLAGDRLGCFNLSI+GH+ECV+FVKKFN+
Sbjct  41   DASFTRLFKTIIAKVVETYLPGVIVLQCGADSLAGDRLGCFNLSIEGHSECVKFVKKFNL  100

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            PLLVTGGGGYTKENVARCW  ETGVLLD+ELPNEIPDN+YIKYF PDY+LK   G+IENL
Sbjct  101  PLLVTGGGGYTKENVARCWTVETGVLLDTELPNEIPDNEYIKYFSPDYTLKTQNGNIENL  160

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQI  189
            NSKSYL TIK  VLE+LR IQHAPSVQMQEVPPDFYIPDFDED QNPDER+ QHTQDKQI
Sbjct  161  NSKSYLSTIKVQVLESLRCIQHAPSVQMQEVPPDFYIPDFDEDEQNPDERVGQHTQDKQI  220

Query  188  QR  183
            QR
Sbjct  221  QR  222



>ref|XP_010651716.1| PREDICTED: histone deacetylase 9 [Vitis vinifera]
 emb|CBI17064.3| unnamed protein product [Vitis vinifera]
Length=430

 Score =   323 bits (827),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 154/182 (85%), Positives = 164/182 (90%), Gaps = 0/182 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  F   +  II+KVVE Y PG IVLQCGADSLAGDRLGCFNLSIDGHAECVR VKKFN+
Sbjct  231  DTSFTRLFKTIIAKVVEIYQPGVIVLQCGADSLAGDRLGCFNLSIDGHAECVRIVKKFNL  290

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            PLLVTGGGGYTKENVARCW  ETGVLLD+ELPNEIP+N+YIKYFGP++SLKIP GHIENL
Sbjct  291  PLLVTGGGGYTKENVARCWTVETGVLLDTELPNEIPENEYIKYFGPEHSLKIPNGHIENL  350

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQI  189
            NSKSYLGTIK  VLENLR IQHAPSVQMQEVPPDFYIPDFDED QNPDER+DQHT+DKQI
Sbjct  351  NSKSYLGTIKQQVLENLRCIQHAPSVQMQEVPPDFYIPDFDEDEQNPDERVDQHTKDKQI  410

Query  188  QR  183
            QR
Sbjct  411  QR  412



>gb|KCW50786.1| hypothetical protein EUGRSUZ_J00456 [Eucalyptus grandis]
Length=430

 Score =   322 bits (826),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 155/182 (85%), Positives = 163/182 (90%), Gaps = 0/182 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  F   +  IISKVVETY PGAIVLQCGADSLAGDRLGCFNLSIDGH+ECVRFVKKFN+
Sbjct  231  DTSFTRLFKAIISKVVETYQPGAIVLQCGADSLAGDRLGCFNLSIDGHSECVRFVKKFNL  290

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            PLLVTGGGGYTKENVARCW  ETGVLLD+ELPNEIP+N+Y KYF PDYSLKIP G+IENL
Sbjct  291  PLLVTGGGGYTKENVARCWVVETGVLLDTELPNEIPENEYFKYFAPDYSLKIPRGNIENL  350

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQI  189
            NSKSYL  IK  VLENLR IQHAPSVQMQEVPPDFYIPDFDED QNPDER+DQHTQDKQI
Sbjct  351  NSKSYLSAIKVQVLENLRNIQHAPSVQMQEVPPDFYIPDFDEDEQNPDERMDQHTQDKQI  410

Query  188  QR  183
            QR
Sbjct  411  QR  412



>emb|CDY08684.1| BnaC03g54980D [Brassica napus]
Length=401

 Score =   321 bits (823),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 152/182 (84%), Positives = 165/182 (91%), Gaps = 0/182 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  F   +  IISKVVE Y PGAIVLQCGADSLA DRLGCFNLSIDGHAECV+FVKKFNI
Sbjct  206  DSSFNRLFRAIISKVVEIYQPGAIVLQCGADSLARDRLGCFNLSIDGHAECVKFVKKFNI  265

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            PLLVTGGGGYTKENVARCW  ETG+LLD+ELPNEIPDNDYIKYFGPDYSLKIPGGHIENL
Sbjct  266  PLLVTGGGGYTKENVARCWTVETGILLDTELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  325

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQI  189
            N+KSY+ TIK+ +L+NLRYIQHAPSVQMQEVPPDFYIPDFDED +NPD R+DQ ++DKQI
Sbjct  326  NTKSYISTIKAQILDNLRYIQHAPSVQMQEVPPDFYIPDFDEDERNPDVRVDQRSRDKQI  385

Query  188  QR  183
            QR
Sbjct  386  QR  387



>ref|XP_007132395.1| hypothetical protein PHAVU_011G091100g [Phaseolus vulgaris]
 gb|ESW04389.1| hypothetical protein PHAVU_011G091100g [Phaseolus vulgaris]
Length=429

 Score =   322 bits (825),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 153/182 (84%), Positives = 164/182 (90%), Gaps = 0/182 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            DL F   +  I+SKVVETY PGAIVLQCGADSLAGDRLGCFNLSIDGH+ECV FVK+FN+
Sbjct  231  DLSFTRLFKTIVSKVVETYQPGAIVLQCGADSLAGDRLGCFNLSIDGHSECVSFVKRFNL  290

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            PLLVTGGGGYTKENVARCW  ETGVLLD+ELPNEIP+NDYIKYF P++SLKIP G IENL
Sbjct  291  PLLVTGGGGYTKENVARCWTVETGVLLDTELPNEIPENDYIKYFAPEFSLKIPNGQIENL  350

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQI  189
            NSKSYL TIK  VLENLR IQHAPSVQMQEVPPDFYIPDFDED QNPDER+DQHTQDK+I
Sbjct  351  NSKSYLSTIKIQVLENLRCIQHAPSVQMQEVPPDFYIPDFDEDEQNPDERIDQHTQDKRI  410

Query  188  QR  183
            QR
Sbjct  411  QR  412



>ref|XP_009150313.1| PREDICTED: histone deacetylase 9 [Brassica rapa]
 emb|CDX99186.1| BnaA06g18770D [Brassica napus]
Length=426

 Score =   321 bits (823),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 152/182 (84%), Positives = 165/182 (91%), Gaps = 0/182 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  F   +  IISKVVE Y PGAIVLQCGADSLA DRLGCFNLSIDGHAECV+FVKKFNI
Sbjct  231  DSSFNRLFRAIISKVVEIYQPGAIVLQCGADSLARDRLGCFNLSIDGHAECVKFVKKFNI  290

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            PLLVTGGGGYTKENVARCW  ETG+LLD+ELPNEIPDNDYIKYFGPDYSLKIPGGHIENL
Sbjct  291  PLLVTGGGGYTKENVARCWTVETGILLDTELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  350

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQI  189
            N+KSY+ TIK+ +L+NLRYIQHAPSVQMQEVPPDFYIPDFDED +NPD R+DQ ++DKQI
Sbjct  351  NTKSYISTIKAQILDNLRYIQHAPSVQMQEVPPDFYIPDFDEDERNPDVRVDQRSRDKQI  410

Query  188  QR  183
            QR
Sbjct  411  QR  412



>ref|XP_004300044.1| PREDICTED: histone deacetylase 9 [Fragaria vesca subsp. vesca]
Length=430

 Score =   320 bits (821),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 167/200 (84%), Positives = 179/200 (90%), Gaps = 0/200 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  F   +  IISKV+ETY PGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI
Sbjct  231  DTSFTRLFKTIISKVIETYQPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  290

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            PLLVTGGGGYTKENVARCW  ETGVLLDS+LPNEIP+N+YIKYF P++SL+IP GHIENL
Sbjct  291  PLLVTGGGGYTKENVARCWTVETGVLLDSDLPNEIPENEYIKYFSPEFSLRIPNGHIENL  350

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQI  189
            NSKSYL TIK  VLENLR IQHAPSVQ+ EVPPDFYIPDFDED QNPDER+ QHTQDK I
Sbjct  351  NSKSYLSTIKMQVLENLRCIQHAPSVQLHEVPPDFYIPDFDEDEQNPDERVHQHTQDKHI  410

Query  188  QRddeyyegdndnDHSMDDA  129
            QRDDEYYEGDNDNDH+M+D 
Sbjct  411  QRDDEYYEGDNDNDHNMEDT  430



>ref|XP_010692974.1| PREDICTED: histone deacetylase 9 isoform X2 [Beta vulgaris subsp. 
vulgaris]
Length=403

 Score =   320 bits (819),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 167/199 (84%), Positives = 179/199 (90%), Gaps = 1/199 (1%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  F   +  IISKVVE Y PG IVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFN+
Sbjct  205  DTSFTRLFKTIISKVVEFYQPGVIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNL  264

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            PLLVTGGGGYTKENVARCW  ETGVLLD++LPNEIPDN+YIKYFGPDYSL+IP GHIENL
Sbjct  265  PLLVTGGGGYTKENVARCWTVETGVLLDTDLPNEIPDNEYIKYFGPDYSLRIPNGHIENL  324

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQI  189
            NSKSYL TIK  VLENLR IQHAPSVQMQEVPPDFY+PDFDED +NPDER++QHTQDK I
Sbjct  325  NSKSYLTTIKMQVLENLRCIQHAPSVQMQEVPPDFYVPDFDED-ENPDERINQHTQDKLI  383

Query  188  QRddeyyegdndnDHSMDD  132
            QRDDEYY+GD DNDH+MDD
Sbjct  384  QRDDEYYDGDQDNDHNMDD  402



>ref|XP_008458610.1| PREDICTED: histone deacetylase 9 isoform X4 [Cucumis melo]
Length=382

 Score =   318 bits (816),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 150/182 (82%), Positives = 163/182 (90%), Gaps = 0/182 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  F   +  IISKVVE Y PG IVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFN+
Sbjct  183  DGSFTRLFRTIISKVVEMYRPGVIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNL  242

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            PLLVTGGGGYTKENVARCW  ETGVLLD+ELPNEIPDN+YIKYF PD+ L+IP GH+ENL
Sbjct  243  PLLVTGGGGYTKENVARCWTVETGVLLDTELPNEIPDNEYIKYFSPDHLLRIPNGHMENL  302

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQI  189
            N+KSYL TIK+ VLENLR+IQHAP VQMQEVPPDFYIPDFDED QNPDER+++HTQDKQI
Sbjct  303  NTKSYLSTIKTQVLENLRFIQHAPGVQMQEVPPDFYIPDFDEDGQNPDERMNRHTQDKQI  362

Query  188  QR  183
            QR
Sbjct  363  QR  364



>ref|XP_008458609.1| PREDICTED: histone deacetylase 9 isoform X3 [Cucumis melo]
Length=405

 Score =   319 bits (818),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 150/182 (82%), Positives = 163/182 (90%), Gaps = 0/182 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  F   +  IISKVVE Y PG IVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFN+
Sbjct  206  DGSFTRLFRTIISKVVEMYRPGVIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNL  265

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            PLLVTGGGGYTKENVARCW  ETGVLLD+ELPNEIPDN+YIKYF PD+ L+IP GH+ENL
Sbjct  266  PLLVTGGGGYTKENVARCWTVETGVLLDTELPNEIPDNEYIKYFSPDHLLRIPNGHMENL  325

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQI  189
            N+KSYL TIK+ VLENLR+IQHAP VQMQEVPPDFYIPDFDED QNPDER+++HTQDKQI
Sbjct  326  NTKSYLSTIKTQVLENLRFIQHAPGVQMQEVPPDFYIPDFDEDGQNPDERMNRHTQDKQI  385

Query  188  QR  183
            QR
Sbjct  386  QR  387



>ref|XP_002529076.1| histone deacetylase 1, 2 ,3, putative [Ricinus communis]
 gb|EEF33320.1| histone deacetylase 1, 2, 3, putative [Ricinus communis]
Length=429

 Score =   320 bits (819),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 166/198 (84%), Positives = 177/198 (89%), Gaps = 0/198 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  F   +  IISKVVETY PG IVLQCGADSLA DRLGCFNLSIDGHAECVRFVKKFN+
Sbjct  231  DTSFTRLFKTIISKVVETYQPGVIVLQCGADSLARDRLGCFNLSIDGHAECVRFVKKFNL  290

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            PLLVTGGGGYTKENVARCW  ETGVLLD+ELPNEIPDNDYI+YF P+YSLKIPGG IEN 
Sbjct  291  PLLVTGGGGYTKENVARCWTVETGVLLDTELPNEIPDNDYIEYFAPEYSLKIPGGQIENF  350

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQI  189
            NSKSYL TIK  VLENLR IQHAPSVQ+QEVPPDFY+PDFDED QNPDER++QHTQDK I
Sbjct  351  NSKSYLSTIKMQVLENLRCIQHAPSVQLQEVPPDFYVPDFDEDEQNPDERVNQHTQDKHI  410

Query  188  QRddeyyegdndnDHSMD  135
            QRDDEYYEGDND+DH+MD
Sbjct  411  QRDDEYYEGDNDHDHNMD  428



>ref|XP_006591090.1| PREDICTED: histone deacetylase 9-like isoform X2 [Glycine max]
Length=421

 Score =   319 bits (818),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 153/182 (84%), Positives = 162/182 (89%), Gaps = 0/182 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  F   +  IISKV+ETY PGAIVLQCGADSLAGDRLGCFNLSIDGHAECV FVK+FN+
Sbjct  223  DSSFTRLFKTIISKVLETYQPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVSFVKRFNL  282

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            PLLVTGGGGYTKENVARCW  ETGVLLD+ELPNEIP+NDYIKYF P++SLKIP G IENL
Sbjct  283  PLLVTGGGGYTKENVARCWTVETGVLLDTELPNEIPENDYIKYFAPEFSLKIPNGQIENL  342

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQI  189
            NSKSYL TIK  VLENLR IQHAPSVQMQEVPPDFYIP+FDED QNPDERLDQHTQDK I
Sbjct  343  NSKSYLSTIKMQVLENLRCIQHAPSVQMQEVPPDFYIPEFDEDEQNPDERLDQHTQDKHI  402

Query  188  QR  183
            QR
Sbjct  403  QR  404



>ref|XP_010692973.1| PREDICTED: histone deacetylase 9 isoform X1 [Beta vulgaris subsp. 
vulgaris]
Length=429

 Score =   319 bits (818),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 167/199 (84%), Positives = 179/199 (90%), Gaps = 1/199 (1%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  F   +  IISKVVE Y PG IVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFN+
Sbjct  231  DTSFTRLFKTIISKVVEFYQPGVIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNL  290

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            PLLVTGGGGYTKENVARCW  ETGVLLD++LPNEIPDN+YIKYFGPDYSL+IP GHIENL
Sbjct  291  PLLVTGGGGYTKENVARCWTVETGVLLDTDLPNEIPDNEYIKYFGPDYSLRIPNGHIENL  350

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQI  189
            NSKSYL TIK  VLENLR IQHAPSVQMQEVPPDFY+PDFDED +NPDER++QHTQDK I
Sbjct  351  NSKSYLTTIKMQVLENLRCIQHAPSVQMQEVPPDFYVPDFDED-ENPDERINQHTQDKLI  409

Query  188  QRddeyyegdndnDHSMDD  132
            QRDDEYY+GD DNDH+MDD
Sbjct  410  QRDDEYYDGDQDNDHNMDD  428



>gb|KJB35350.1| hypothetical protein B456_006G110500 [Gossypium raimondii]
Length=240

 Score =   313 bits (801),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 164/198 (83%), Positives = 173/198 (87%), Gaps = 0/198 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  F   +  IISKVVE Y PGAIVLQCGADSLAGDRLGCFNLSIDGHAECV+ VKKFN+
Sbjct  42   DNSFTRLFKIIISKVVEMYQPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVKIVKKFNL  101

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            PLLVTGGGGYTKENVARCW  ETGVLLD+ELPNEIP+N+YIKYF PD  L IP GHIENL
Sbjct  102  PLLVTGGGGYTKENVARCWTVETGVLLDTELPNEIPENEYIKYFAPDCLLNIPNGHIENL  161

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQI  189
            NSKSYL TI   VLENLR IQHAP VQMQEVPPDFYIPDFDED QN DER+DQHTQDKQI
Sbjct  162  NSKSYLKTITMQVLENLRSIQHAPGVQMQEVPPDFYIPDFDEDEQNADERMDQHTQDKQI  221

Query  188  QRddeyyegdndnDHSMD  135
            QRDDEYY+GDNDNDH+MD
Sbjct  222  QRDDEYYDGDNDNDHNMD  239



>ref|XP_003538135.1| PREDICTED: histone deacetylase 9-like isoform X1 [Glycine max]
Length=429

 Score =   319 bits (817),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 153/182 (84%), Positives = 162/182 (89%), Gaps = 0/182 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  F   +  IISKV+ETY PGAIVLQCGADSLAGDRLGCFNLSIDGHAECV FVK+FN+
Sbjct  231  DSSFTRLFKTIISKVLETYQPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVSFVKRFNL  290

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            PLLVTGGGGYTKENVARCW  ETGVLLD+ELPNEIP+NDYIKYF P++SLKIP G IENL
Sbjct  291  PLLVTGGGGYTKENVARCWTVETGVLLDTELPNEIPENDYIKYFAPEFSLKIPNGQIENL  350

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQI  189
            NSKSYL TIK  VLENLR IQHAPSVQMQEVPPDFYIP+FDED QNPDERLDQHTQDK I
Sbjct  351  NSKSYLSTIKMQVLENLRCIQHAPSVQMQEVPPDFYIPEFDEDEQNPDERLDQHTQDKHI  410

Query  188  QR  183
            QR
Sbjct  411  QR  412



>gb|KHN38656.1| Histone deacetylase 9 [Glycine soja]
Length=429

 Score =   319 bits (817),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 153/182 (84%), Positives = 162/182 (89%), Gaps = 0/182 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  F   +  IISKV+ETY PGAIVLQCGADSLAGDRLGCFNLSIDGHAECV FVK+FN+
Sbjct  231  DSSFTRLFKTIISKVLETYQPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVSFVKRFNL  290

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            PLLVTGGGGYTKENVARCW  ETGVLLD+ELPNEIP+NDYIKYF P++SLKIP G IENL
Sbjct  291  PLLVTGGGGYTKENVARCWTVETGVLLDTELPNEIPENDYIKYFAPEFSLKIPNGQIENL  350

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQI  189
            NSKSYL TIK  VLENLR IQHAPSVQMQEVPPDFYIP+FDED QNPDERLDQHTQDK I
Sbjct  351  NSKSYLSTIKMQVLENLRCIQHAPSVQMQEVPPDFYIPEFDEDEQNPDERLDQHTQDKHI  410

Query  188  QR  183
            QR
Sbjct  411  QR  412



>ref|XP_006592310.1| PREDICTED: histone deacetylase 9 isoform X2 [Glycine max]
Length=352

 Score =   316 bits (810),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 152/182 (84%), Positives = 161/182 (88%), Gaps = 0/182 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  F   +  IISKVVETY PGAIVLQCGADSLAGDRLGCFNLSIDGHAECV FVK+FN+
Sbjct  154  DSSFTRLFKTIISKVVETYQPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVSFVKRFNL  213

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            PLLVTGGGGYTKENVARCW  ETGVLLD+ELPNEIP NDYIKYF P++SLK+P G IENL
Sbjct  214  PLLVTGGGGYTKENVARCWTVETGVLLDTELPNEIPQNDYIKYFAPEFSLKVPNGPIENL  273

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQI  189
            NSKSYL TIK  VLENLR IQHAPSVQMQEVPPDFYIP+FDED QNPDER+DQHTQDK I
Sbjct  274  NSKSYLSTIKMQVLENLRCIQHAPSVQMQEVPPDFYIPEFDEDEQNPDERIDQHTQDKHI  333

Query  188  QR  183
            QR
Sbjct  334  QR  335



>ref|XP_011657063.1| PREDICTED: histone deacetylase 9 isoform X3 [Cucumis sativus]
Length=404

 Score =   318 bits (814),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 150/182 (82%), Positives = 163/182 (90%), Gaps = 0/182 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  F   +  IISKVVE Y PG IVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFN+
Sbjct  205  DGSFNRLFRTIISKVVEMYRPGVIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNL  264

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            PLLVTGGGGYTKENVARCW  ETGVLLD+ELPNEIPDN+YIKYF PD+ L+IP GH+ENL
Sbjct  265  PLLVTGGGGYTKENVARCWTVETGVLLDTELPNEIPDNEYIKYFSPDHLLRIPNGHMENL  324

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQI  189
            N+KSYL TIK+ VLENLR+IQHAP VQMQEVPPDFYIPDFDED QNPDER+++HTQDKQI
Sbjct  325  NTKSYLSTIKTQVLENLRFIQHAPGVQMQEVPPDFYIPDFDEDGQNPDERMNRHTQDKQI  384

Query  188  QR  183
            QR
Sbjct  385  QR  386



>ref|XP_008458605.1| PREDICTED: histone deacetylase 9 isoform X1 [Cucumis melo]
 ref|XP_008458606.1| PREDICTED: histone deacetylase 9 isoform X1 [Cucumis melo]
Length=430

 Score =   318 bits (816),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 150/182 (82%), Positives = 163/182 (90%), Gaps = 0/182 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  F   +  IISKVVE Y PG IVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFN+
Sbjct  231  DGSFTRLFRTIISKVVEMYRPGVIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNL  290

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            PLLVTGGGGYTKENVARCW  ETGVLLD+ELPNEIPDN+YIKYF PD+ L+IP GH+ENL
Sbjct  291  PLLVTGGGGYTKENVARCWTVETGVLLDTELPNEIPDNEYIKYFSPDHLLRIPNGHMENL  350

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQI  189
            N+KSYL TIK+ VLENLR+IQHAP VQMQEVPPDFYIPDFDED QNPDER+++HTQDKQI
Sbjct  351  NTKSYLSTIKTQVLENLRFIQHAPGVQMQEVPPDFYIPDFDEDGQNPDERMNRHTQDKQI  410

Query  188  QR  183
            QR
Sbjct  411  QR  412



>ref|XP_004145792.1| PREDICTED: histone deacetylase 9 isoform X1 [Cucumis sativus]
 ref|XP_011657061.1| PREDICTED: histone deacetylase 9 isoform X1 [Cucumis sativus]
 gb|KGN46931.1| hypothetical protein Csa_6G151680 [Cucumis sativus]
Length=430

 Score =   318 bits (816),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 150/182 (82%), Positives = 163/182 (90%), Gaps = 0/182 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  F   +  IISKVVE Y PG IVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFN+
Sbjct  231  DGSFNRLFRTIISKVVEMYRPGVIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNL  290

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            PLLVTGGGGYTKENVARCW  ETGVLLD+ELPNEIPDN+YIKYF PD+ L+IP GH+ENL
Sbjct  291  PLLVTGGGGYTKENVARCWTVETGVLLDTELPNEIPDNEYIKYFSPDHLLRIPNGHMENL  350

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQI  189
            N+KSYL TIK+ VLENLR+IQHAP VQMQEVPPDFYIPDFDED QNPDER+++HTQDKQI
Sbjct  351  NTKSYLSTIKTQVLENLRFIQHAPGVQMQEVPPDFYIPDFDEDGQNPDERMNRHTQDKQI  410

Query  188  QR  183
            QR
Sbjct  411  QR  412



>ref|XP_006419115.1| hypothetical protein EUTSA_v10002540mg [Eutrema salsugineum]
 gb|ESQ37551.1| hypothetical protein EUTSA_v10002540mg [Eutrema salsugineum]
Length=426

 Score =   318 bits (815),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 149/182 (82%), Positives = 164/182 (90%), Gaps = 0/182 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  F   +  IISKVVE Y PGAIVLQCGADSLA DRLGCFNLSIDGHAECV+FVKKFN+
Sbjct  231  DSSFNRLFRTIISKVVEIYQPGAIVLQCGADSLARDRLGCFNLSIDGHAECVKFVKKFNL  290

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            PLLVTGGGGYTKENVARCW  ETG+LLD+ELPNEIP+NDYIKYF PD+SLKIPGGHIEN+
Sbjct  291  PLLVTGGGGYTKENVARCWTVETGILLDTELPNEIPENDYIKYFAPDFSLKIPGGHIENM  350

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQI  189
            N+KSY+ +IK  +LENLRYIQHAPSVQMQEVPPDFYIPDFDED QNPDER+DQ ++DKQI
Sbjct  351  NTKSYISSIKVQILENLRYIQHAPSVQMQEVPPDFYIPDFDEDEQNPDERVDQRSRDKQI  410

Query  188  QR  183
            QR
Sbjct  411  QR  412



>ref|XP_009404814.1| PREDICTED: histone deacetylase 9 isoform X3 [Musa acuminata subsp. 
malaccensis]
Length=324

 Score =   315 bits (806),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 160/200 (80%), Positives = 180/200 (90%), Gaps = 0/200 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  F   +  II+KVVETY+PG IVLQCGADSLAGDRLGCFNLSI+GH+ECV+FVKKFN+
Sbjct  124  DASFTRLFKTIIAKVVETYLPGVIVLQCGADSLAGDRLGCFNLSIEGHSECVKFVKKFNL  183

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            PLLVTGGGGYTKENVARCW  ETGVLLD++LPNEIP+N+YIKYF PDY+LKIP G++ENL
Sbjct  184  PLLVTGGGGYTKENVARCWTVETGVLLDADLPNEIPENEYIKYFAPDYTLKIPNGNMENL  243

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQI  189
            NSKSYL TIK  VLE+LR IQHAP VQMQEVPPDFYIP+FDED QNPDER+DQHT DKQI
Sbjct  244  NSKSYLSTIKVQVLESLRCIQHAPGVQMQEVPPDFYIPEFDEDEQNPDERVDQHTTDKQI  303

Query  188  QRddeyyegdndnDHSMDDA  129
            QRDDEY+EGDNDNDH+M+D 
Sbjct  304  QRDDEYFEGDNDNDHNMEDG  323



>ref|XP_006279377.1| hypothetical protein CARUB_v10007995mg [Capsella rubella]
 gb|EOA12275.1| hypothetical protein CARUB_v10007995mg [Capsella rubella]
Length=426

 Score =   317 bits (813),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 149/182 (82%), Positives = 164/182 (90%), Gaps = 0/182 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  F   +  IISKVVE Y PGAIVLQCGADSLA DRLGCFNLSIDGHAECV+FVKKFN+
Sbjct  231  DSSFNRLFRTIISKVVEIYQPGAIVLQCGADSLARDRLGCFNLSIDGHAECVKFVKKFNL  290

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            PLLVTGGGGYTKENVARCW  ETG+LLD+ELPNEIP+NDYIKYF PD+SLKIPGGHIENL
Sbjct  291  PLLVTGGGGYTKENVARCWTVETGILLDTELPNEIPENDYIKYFAPDFSLKIPGGHIENL  350

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQI  189
            N+KSY+ +IK  +LENLRYIQHAPSVQMQEVPPDFYIPDFDED QNPDER+DQ ++DKQ+
Sbjct  351  NTKSYISSIKVQILENLRYIQHAPSVQMQEVPPDFYIPDFDEDEQNPDERVDQRSRDKQV  410

Query  188  QR  183
            QR
Sbjct  411  QR  412



>ref|XP_010031477.1| PREDICTED: histone deacetylase 9 isoform X1 [Eucalyptus grandis]
 gb|KCW50785.1| hypothetical protein EUGRSUZ_J00456 [Eucalyptus grandis]
Length=432

 Score =   317 bits (813),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 155/184 (84%), Positives = 163/184 (89%), Gaps = 2/184 (1%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  F   +  IISKVVETY PGAIVLQCGADSLAGDRLGCFNLSIDGH+ECVRFVKKFN+
Sbjct  231  DTSFTRLFKAIISKVVETYQPGAIVLQCGADSLAGDRLGCFNLSIDGHSECVRFVKKFNL  290

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHI--E  375
            PLLVTGGGGYTKENVARCW  ETGVLLD+ELPNEIP+N+Y KYF PDYSLKIP G+I  E
Sbjct  291  PLLVTGGGGYTKENVARCWVVETGVLLDTELPNEIPENEYFKYFAPDYSLKIPRGNIVLE  350

Query  374  NLNSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDK  195
            NLNSKSYL  IK  VLENLR IQHAPSVQMQEVPPDFYIPDFDED QNPDER+DQHTQDK
Sbjct  351  NLNSKSYLSAIKVQVLENLRNIQHAPSVQMQEVPPDFYIPDFDEDEQNPDERMDQHTQDK  410

Query  194  QIQR  183
            QIQR
Sbjct  411  QIQR  414



>ref|XP_003539814.1| PREDICTED: histone deacetylase 9 isoform X1 [Glycine max]
Length=429

 Score =   317 bits (811),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 152/182 (84%), Positives = 161/182 (88%), Gaps = 0/182 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  F   +  IISKVVETY PGAIVLQCGADSLAGDRLGCFNLSIDGHAECV FVK+FN+
Sbjct  231  DSSFTRLFKTIISKVVETYQPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVSFVKRFNL  290

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            PLLVTGGGGYTKENVARCW  ETGVLLD+ELPNEIP NDYIKYF P++SLK+P G IENL
Sbjct  291  PLLVTGGGGYTKENVARCWTVETGVLLDTELPNEIPQNDYIKYFAPEFSLKVPNGPIENL  350

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQI  189
            NSKSYL TIK  VLENLR IQHAPSVQMQEVPPDFYIP+FDED QNPDER+DQHTQDK I
Sbjct  351  NSKSYLSTIKMQVLENLRCIQHAPSVQMQEVPPDFYIPEFDEDEQNPDERIDQHTQDKHI  410

Query  188  QR  183
            QR
Sbjct  411  QR  412



>ref|XP_009404813.1| PREDICTED: histone deacetylase 9 isoform X2 [Musa acuminata subsp. 
malaccensis]
Length=354

 Score =   314 bits (804),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 160/200 (80%), Positives = 180/200 (90%), Gaps = 0/200 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  F   +  II+KVVETY+PG IVLQCGADSLAGDRLGCFNLSI+GH+ECV+FVKKFN+
Sbjct  154  DASFTRLFKTIIAKVVETYLPGVIVLQCGADSLAGDRLGCFNLSIEGHSECVKFVKKFNL  213

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            PLLVTGGGGYTKENVARCW  ETGVLLD++LPNEIP+N+YIKYF PDY+LKIP G++ENL
Sbjct  214  PLLVTGGGGYTKENVARCWTVETGVLLDADLPNEIPENEYIKYFAPDYTLKIPNGNMENL  273

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQI  189
            NSKSYL TIK  VLE+LR IQHAP VQMQEVPPDFYIP+FDED QNPDER+DQHT DKQI
Sbjct  274  NSKSYLSTIKVQVLESLRCIQHAPGVQMQEVPPDFYIPEFDEDEQNPDERVDQHTTDKQI  333

Query  188  QRddeyyegdndnDHSMDDA  129
            QRDDEY+EGDNDNDH+M+D 
Sbjct  334  QRDDEYFEGDNDNDHNMEDG  353



>ref|XP_011625968.1| PREDICTED: histone deacetylase 9 [Amborella trichopoda]
Length=436

 Score =   317 bits (811),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 163/200 (82%), Positives = 180/200 (90%), Gaps = 0/200 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  F   +  II+KV+ETY PGAIVLQCGADSLAGDRLGCFNLSIDGH+ECVRFVKKFN+
Sbjct  231  DASFTRLFKTIIAKVLETYQPGAIVLQCGADSLAGDRLGCFNLSIDGHSECVRFVKKFNL  290

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            PLLVTGGGGYTKENVARCW  ETGVLLD+ELPNEIPDNDYIKYFGPDYSLKI  G++ENL
Sbjct  291  PLLVTGGGGYTKENVARCWTVETGVLLDTELPNEIPDNDYIKYFGPDYSLKIQNGNVENL  350

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQI  189
            NSKSYL +IK  V+E+LR IQHAP VQMQEVP DFYIPD DED QNPDER+DQHT+DKQI
Sbjct  351  NSKSYLSSIKVQVMESLRCIQHAPGVQMQEVPRDFYIPDSDEDEQNPDERVDQHTEDKQI  410

Query  188  QRddeyyegdndnDHSMDDA  129
            QR+DEYY+GDNDNDH+M+DA
Sbjct  411  QREDEYYDGDNDNDHTMEDA  430



>ref|XP_010514792.1| PREDICTED: histone deacetylase 9 [Camelina sativa]
Length=426

 Score =   315 bits (808),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 149/182 (82%), Positives = 163/182 (90%), Gaps = 0/182 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  F   +  IISKVVE Y PGAIVLQCGADSLA DRLGCFNLSIDGHAECV+FVKKFN+
Sbjct  231  DSSFNRLFRTIISKVVEIYQPGAIVLQCGADSLARDRLGCFNLSIDGHAECVKFVKKFNL  290

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            PLLVTGGGGYTKENVARCW  ETG+LLD+ELPNEIP+NDYIKYF PD+SLKIPGGHIENL
Sbjct  291  PLLVTGGGGYTKENVARCWTVETGILLDTELPNEIPENDYIKYFAPDFSLKIPGGHIENL  350

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQI  189
            N+KSY+ +IK  +LENLRYIQHAPSVQMQEVPPDFYIPDFDED QNPD R+DQ ++DKQI
Sbjct  351  NTKSYISSIKVQILENLRYIQHAPSVQMQEVPPDFYIPDFDEDEQNPDVRVDQRSRDKQI  410

Query  188  QR  183
            QR
Sbjct  411  QR  412



>gb|ACU20217.1| unknown [Glycine max]
Length=429

 Score =   315 bits (807),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 151/182 (83%), Positives = 160/182 (88%), Gaps = 0/182 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  F   +  IISKVVETY PGAIVLQCGADSLAGDRLGCFNLSIDGHAECV FVK+FN+
Sbjct  231  DSSFTRLFKTIISKVVETYQPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVSFVKRFNL  290

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            PLLVTGGGGYTKENVARCW  ETGVLLD+ELPNEIP NDYIKYF P++SLK+P G IENL
Sbjct  291  PLLVTGGGGYTKENVARCWTVETGVLLDTELPNEIPQNDYIKYFAPEFSLKVPNGPIENL  350

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQI  189
            NSKSYL TIK  VLEN R IQHAPSVQMQEVPPDFYIP+FDED QNPDER+DQHTQDK I
Sbjct  351  NSKSYLSTIKMQVLENFRCIQHAPSVQMQEVPPDFYIPEFDEDEQNPDERIDQHTQDKHI  410

Query  188  QR  183
            QR
Sbjct  411  QR  412



>ref|NP_190054.2| histone deacetylase 9 [Arabidopsis thaliana]
 sp|Q8H0W2.1|HDA9_ARATH RecName: Full=Histone deacetylase 9 [Arabidopsis thaliana]
 gb|AAN72014.1| putative protein [Arabidopsis thaliana]
 gb|AAP31920.1| At3g44680 [Arabidopsis thaliana]
 gb|AEE77930.1| histone deacetylase 9 [Arabidopsis thaliana]
Length=426

 Score =   315 bits (807),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 149/182 (82%), Positives = 162/182 (89%), Gaps = 0/182 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  F   +  IISKVVE Y PGAIVLQCGADSLA DRLGCFNLSIDGHAECV+FVKKFN+
Sbjct  231  DSSFNRLFRTIISKVVEIYQPGAIVLQCGADSLARDRLGCFNLSIDGHAECVKFVKKFNL  290

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            PLLVTGGGGYTKENVARCW  ETG+LLD+ELPNEIP+NDYIKYF PD+SLKIPGGHIENL
Sbjct  291  PLLVTGGGGYTKENVARCWTVETGILLDTELPNEIPENDYIKYFAPDFSLKIPGGHIENL  350

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQI  189
            N+KSY+ +IK  +LENLRYIQHAPSVQMQEVPPDFYIPDFDED QNPD R DQ ++DKQI
Sbjct  351  NTKSYISSIKVQILENLRYIQHAPSVQMQEVPPDFYIPDFDEDEQNPDVRADQRSRDKQI  410

Query  188  QR  183
            QR
Sbjct  411  QR  412



>ref|XP_009404815.1| PREDICTED: histone deacetylase 9 isoform X4 [Musa acuminata subsp. 
malaccensis]
Length=406

 Score =   314 bits (804),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 160/200 (80%), Positives = 180/200 (90%), Gaps = 0/200 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  F   +  II+KVVETY+PG IVLQCGADSLAGDRLGCFNLSI+GH+ECV+FVKKFN+
Sbjct  206  DASFTRLFKTIIAKVVETYLPGVIVLQCGADSLAGDRLGCFNLSIEGHSECVKFVKKFNL  265

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            PLLVTGGGGYTKENVARCW  ETGVLLD++LPNEIP+N+YIKYF PDY+LKIP G++ENL
Sbjct  266  PLLVTGGGGYTKENVARCWTVETGVLLDADLPNEIPENEYIKYFAPDYTLKIPNGNMENL  325

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQI  189
            NSKSYL TIK  VLE+LR IQHAP VQMQEVPPDFYIP+FDED QNPDER+DQHT DKQI
Sbjct  326  NSKSYLSTIKVQVLESLRCIQHAPGVQMQEVPPDFYIPEFDEDEQNPDERVDQHTTDKQI  385

Query  188  QRddeyyegdndnDHSMDDA  129
            QRDDEY+EGDNDNDH+M+D 
Sbjct  386  QRDDEYFEGDNDNDHNMEDG  405



>ref|XP_010425885.1| PREDICTED: histone deacetylase 9 isoform X1 [Camelina sativa]
Length=426

 Score =   314 bits (805),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 148/182 (81%), Positives = 163/182 (90%), Gaps = 0/182 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  F   +  IISKVVE Y PGAIVLQCGADSLA DRLGCFNLSIDGHAECV+FVKKFN+
Sbjct  231  DSSFNRLFRTIISKVVEIYQPGAIVLQCGADSLARDRLGCFNLSIDGHAECVKFVKKFNL  290

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            PLLVTGGGGYTKENVARCW  ETG+LLD+ELPNEIP+NDYIKYF PD+SLKIPGGHIENL
Sbjct  291  PLLVTGGGGYTKENVARCWTVETGILLDTELPNEIPENDYIKYFAPDFSLKIPGGHIENL  350

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQI  189
            N+KSY+ +IK  +LENLR+IQHAPSVQMQEVPPDFYIPDFDED QNPD R+DQ ++DKQI
Sbjct  351  NTKSYISSIKVQILENLRFIQHAPSVQMQEVPPDFYIPDFDEDEQNPDVRVDQRSRDKQI  410

Query  188  QR  183
            QR
Sbjct  411  QR  412



>ref|XP_007015910.1| Histone deacetylase 9 isoform 7, partial [Theobroma cacao]
 gb|EOY33529.1| Histone deacetylase 9 isoform 7, partial [Theobroma cacao]
Length=406

 Score =   313 bits (801),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 150/182 (82%), Positives = 159/182 (87%), Gaps = 0/182 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  F   +  IISKVVE Y PGAIVLQCGADSLAGDRLGCFNLSIDGHAECVR VKKFN+
Sbjct  225  DTSFTRLFKTIISKVVEMYQPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRIVKKFNL  284

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            PLLVTGGGGYTKENVARCW  ETGVLLD+ELPNEIP+N+YIKYF P+  L IP GHIENL
Sbjct  285  PLLVTGGGGYTKENVARCWTVETGVLLDTELPNEIPENEYIKYFAPECLLNIPNGHIENL  344

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQI  189
            NSKSY+ TIK  VLENLR IQHAP VQMQEVPPDF+IPDFDED QNPDER+DQHTQDKQI
Sbjct  345  NSKSYISTIKMQVLENLRCIQHAPGVQMQEVPPDFFIPDFDEDEQNPDERMDQHTQDKQI  404

Query  188  QR  183
            QR
Sbjct  405  QR  406



>ref|XP_010503116.1| PREDICTED: histone deacetylase 9-like [Camelina sativa]
Length=426

 Score =   313 bits (802),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 149/182 (82%), Positives = 162/182 (89%), Gaps = 0/182 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  F   +  IISKVVE Y PGAIVLQCGADSLA DRLGCFNLSIDGHAECV+FVKKFNI
Sbjct  231  DSSFNRLFRTIISKVVEIYQPGAIVLQCGADSLARDRLGCFNLSIDGHAECVKFVKKFNI  290

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            PLLVTGGGGYTKENVARCW  ETG+LLD+ELPNEIP+NDYIKYF PD+SLKIPGGHIENL
Sbjct  291  PLLVTGGGGYTKENVARCWTVETGILLDTELPNEIPENDYIKYFAPDFSLKIPGGHIENL  350

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQI  189
            N+KSY+ +IK  +LENLRYIQHAPSVQMQEVPPDFYIPDFDED QN D R+DQ ++DKQI
Sbjct  351  NTKSYISSIKVQILENLRYIQHAPSVQMQEVPPDFYIPDFDEDEQNRDVRVDQRSRDKQI  410

Query  188  QR  183
            QR
Sbjct  411  QR  412



>ref|XP_010940301.1| PREDICTED: histone deacetylase 9 [Elaeis guineensis]
Length=431

 Score =   313 bits (802),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 162/200 (81%), Positives = 178/200 (89%), Gaps = 0/200 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  F   +  II+KVVETY+PG IVLQCGADSLAGDRLGCFNLSI+GH+ECVRFVKKFN+
Sbjct  231  DASFTRLFKTIIAKVVETYLPGVIVLQCGADSLAGDRLGCFNLSIEGHSECVRFVKKFNL  290

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            PLLVTGGGGYTKENVARCW  ETGVLLD+ELPNEIPDN+Y KYF PDY+LKI  G++ENL
Sbjct  291  PLLVTGGGGYTKENVARCWTVETGVLLDAELPNEIPDNEYAKYFAPDYTLKIQNGNMENL  350

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQI  189
            NSKSYL TIK  VLE+LR IQHAP VQMQEVPPDFYIPDFDED QNPDER+ QHTQDKQI
Sbjct  351  NSKSYLSTIKVQVLESLRCIQHAPGVQMQEVPPDFYIPDFDEDEQNPDERVGQHTQDKQI  410

Query  188  QRddeyyegdndnDHSMDDA  129
            QRDDEYY+GDNDNDH+M+D 
Sbjct  411  QRDDEYYDGDNDNDHNMEDG  430



>ref|XP_009404812.1| PREDICTED: histone deacetylase 9 isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=431

 Score =   313 bits (802),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 160/200 (80%), Positives = 180/200 (90%), Gaps = 0/200 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  F   +  II+KVVETY+PG IVLQCGADSLAGDRLGCFNLSI+GH+ECV+FVKKFN+
Sbjct  231  DASFTRLFKTIIAKVVETYLPGVIVLQCGADSLAGDRLGCFNLSIEGHSECVKFVKKFNL  290

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            PLLVTGGGGYTKENVARCW  ETGVLLD++LPNEIP+N+YIKYF PDY+LKIP G++ENL
Sbjct  291  PLLVTGGGGYTKENVARCWTVETGVLLDADLPNEIPENEYIKYFAPDYTLKIPNGNMENL  350

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQI  189
            NSKSYL TIK  VLE+LR IQHAP VQMQEVPPDFYIP+FDED QNPDER+DQHT DKQI
Sbjct  351  NSKSYLSTIKVQVLESLRCIQHAPGVQMQEVPPDFYIPEFDEDEQNPDERVDQHTTDKQI  410

Query  188  QRddeyyegdndnDHSMDDA  129
            QRDDEY+EGDNDNDH+M+D 
Sbjct  411  QRDDEYFEGDNDNDHNMEDG  430



>ref|XP_008788384.1| PREDICTED: histone deacetylase 9 isoform X1 [Phoenix dactylifera]
Length=431

 Score =   313 bits (802),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 149/182 (82%), Positives = 162/182 (89%), Gaps = 0/182 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  F   +  II+KVVETY+PG IVLQCGADSLAGDRLGCFNLSI+GH+ECV+FVKKFN+
Sbjct  231  DASFTRLFKTIIAKVVETYLPGVIVLQCGADSLAGDRLGCFNLSIEGHSECVKFVKKFNL  290

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            PLLVTGGGGYTKENVARCW  ETGVLLD+ELPNEIPDN+YIKYF PDY+LK   G+IENL
Sbjct  291  PLLVTGGGGYTKENVARCWTVETGVLLDTELPNEIPDNEYIKYFSPDYTLKTQNGNIENL  350

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQI  189
            NSKSYL TIK  VLE+LR IQHAPSVQMQEVPPDFYIPDFDED QNPDER+ QHTQDKQI
Sbjct  351  NSKSYLSTIKVQVLESLRCIQHAPSVQMQEVPPDFYIPDFDEDEQNPDERVGQHTQDKQI  410

Query  188  QR  183
            QR
Sbjct  411  QR  412



>ref|XP_007015904.1| Histone deacetylase 9 isoform 1 [Theobroma cacao]
 gb|EOY33523.1| Histone deacetylase 9 isoform 1 [Theobroma cacao]
Length=429

 Score =   313 bits (801),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 150/182 (82%), Positives = 159/182 (87%), Gaps = 0/182 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  F   +  IISKVVE Y PGAIVLQCGADSLAGDRLGCFNLSIDGHAECVR VKKFN+
Sbjct  231  DTSFTRLFKTIISKVVEMYQPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRIVKKFNL  290

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            PLLVTGGGGYTKENVARCW  ETGVLLD+ELPNEIP+N+YIKYF P+  L IP GHIENL
Sbjct  291  PLLVTGGGGYTKENVARCWTVETGVLLDTELPNEIPENEYIKYFAPECLLNIPNGHIENL  350

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQI  189
            NSKSY+ TIK  VLENLR IQHAP VQMQEVPPDF+IPDFDED QNPDER+DQHTQDKQI
Sbjct  351  NSKSYISTIKMQVLENLRCIQHAPGVQMQEVPPDFFIPDFDEDEQNPDERMDQHTQDKQI  410

Query  188  QR  183
            QR
Sbjct  411  QR  412



>gb|ERN13133.1| hypothetical protein AMTR_s00040p00182290 [Amborella trichopoda]
Length=432

 Score =   312 bits (800),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 163/201 (81%), Positives = 180/201 (90%), Gaps = 1/201 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  F   +  II+KV+ETY PGAIVLQCGADSLAGDRLGCFNLSIDGH+ECVRFVKKFN+
Sbjct  231  DASFTRLFKTIIAKVLETYQPGAIVLQCGADSLAGDRLGCFNLSIDGHSECVRFVKKFNL  290

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHI-EN  372
            PLLVTGGGGYTKENVARCW  ETGVLLD+ELPNEIPDNDYIKYFGPDYSLKI  G++ EN
Sbjct  291  PLLVTGGGGYTKENVARCWTVETGVLLDTELPNEIPDNDYIKYFGPDYSLKIQNGNVQEN  350

Query  371  LNSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQ  192
            LNSKSYL +IK  V+E+LR IQHAP VQMQEVP DFYIPD DED QNPDER+DQHT+DKQ
Sbjct  351  LNSKSYLSSIKVQVMESLRCIQHAPGVQMQEVPRDFYIPDSDEDEQNPDERVDQHTEDKQ  410

Query  191  IQRddeyyegdndnDHSMDDA  129
            IQR+DEYY+GDNDNDH+M+DA
Sbjct  411  IQREDEYYDGDNDNDHTMEDA  431



>ref|XP_010541292.1| PREDICTED: histone deacetylase 9 isoform X2 [Tarenaya hassleriana]
Length=237

 Score =   305 bits (781),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 146/183 (80%), Positives = 160/183 (87%), Gaps = 1/183 (1%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  F   +  IISKVVE Y PGAIVLQCGADSLA DRLGCFNLSIDGH+ECV+FVKKFNI
Sbjct  42   DNSFNRLFRTIISKVVEMYQPGAIVLQCGADSLARDRLGCFNLSIDGHSECVKFVKKFNI  101

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGH-IEN  372
            PLLVTGGGGYTKENVARCW  ETGVLLD+EL NEIP+NDYIKYF PD+SLKIPGGH IEN
Sbjct  102  PLLVTGGGGYTKENVARCWTVETGVLLDAELSNEIPENDYIKYFAPDFSLKIPGGHIIEN  161

Query  371  LNSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQ  192
            +N+KSY+ +IK  +LENLRYIQHAPSVQMQEVPPDFYIPDF+ED QNPD R+DQ  +DK 
Sbjct  162  MNTKSYISSIKVQILENLRYIQHAPSVQMQEVPPDFYIPDFNEDEQNPDVRVDQRARDKH  221

Query  191  IQR  183
            IQR
Sbjct  222  IQR  224



>emb|CAE04901.1| OSJNBa0042I15.23 [Oryza sativa Japonica Group]
Length=254

 Score =   305 bits (780),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 143/182 (79%), Positives = 161/182 (88%), Gaps = 0/182 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D GF   +  +I+KVVETY+PGAIVLQCGADSLA DRLGCFNLSI+GHAECV+FVKKFNI
Sbjct  55   DSGFTRLFKTVIAKVVETYLPGAIVLQCGADSLARDRLGCFNLSIEGHAECVKFVKKFNI  114

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            PLLVTGGGGYTKENVARCWA ETGVLLD+ELPNEIPDN+YIKYF PDY+LK+   +++NL
Sbjct  115  PLLVTGGGGYTKENVARCWAVETGVLLDTELPNEIPDNEYIKYFAPDYTLKVSNVNMDNL  174

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQI  189
            NSKSYL +IK  V+E+LR IQHAP VQMQEVPPDFYIPD DED  +PDER+DQHTQDKQI
Sbjct  175  NSKSYLSSIKVQVMESLRAIQHAPGVQMQEVPPDFYIPDIDEDELDPDERVDQHTQDKQI  234

Query  188  QR  183
             R
Sbjct  235  HR  236



>ref|XP_011005321.1| PREDICTED: histone deacetylase 9 isoform X2 [Populus euphratica]
Length=433

 Score =   309 bits (792),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 156/211 (74%), Positives = 164/211 (78%), Gaps = 29/211 (14%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  F   +  IISKVVETY PGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFN+
Sbjct  206  DTSFTRLFKTIISKVVETYQPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNL  265

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHI---  378
            PLLVTGGGGYTKENVARCW  ETGVLLD+ELPNEIP+N+YIKYF PDYSLK PGG +   
Sbjct  266  PLLVTGGGGYTKENVARCWTVETGVLLDTELPNEIPENEYIKYFAPDYSLKSPGGLVVCN  325

Query  377  --------------------------ENLNSKSYLGTIKSHVLENLRYIQHAPSVQMQEV  276
                                      ENLNSKSYL TIK  VL+NLR IQHAPSVQMQEV
Sbjct  326  CTETPCDFCILAAFLIFLLLFCLSEQENLNSKSYLSTIKMQVLDNLRCIQHAPSVQMQEV  385

Query  275  PPDFYIPDFDEDTQNPDERLDQHTQDKQIQR  183
            PPDFYIPDFDED QNPDER+DQHTQDKQIQR
Sbjct  386  PPDFYIPDFDEDEQNPDERMDQHTQDKQIQR  416



>ref|NP_001052725.1| Os04g0409600 [Oryza sativa Japonica Group]
 dbj|BAF14639.1| Os04g0409600, partial [Oryza sativa Japonica Group]
Length=309

 Score =   304 bits (779),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 143/182 (79%), Positives = 161/182 (88%), Gaps = 0/182 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D GF   +  +I+KVVETY+PGAIVLQCGADSLA DRLGCFNLSI+GHAECV+FVKKFNI
Sbjct  110  DSGFTRLFKTVIAKVVETYLPGAIVLQCGADSLARDRLGCFNLSIEGHAECVKFVKKFNI  169

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            PLLVTGGGGYTKENVARCWA ETGVLLD+ELPNEIPDN+YIKYF PDY+LK+   +++NL
Sbjct  170  PLLVTGGGGYTKENVARCWAVETGVLLDTELPNEIPDNEYIKYFAPDYTLKVSNVNMDNL  229

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQI  189
            NSKSYL +IK  V+E+LR IQHAP VQMQEVPPDFYIPD DED  +PDER+DQHTQDKQI
Sbjct  230  NSKSYLSSIKVQVMESLRAIQHAPGVQMQEVPPDFYIPDIDEDELDPDERVDQHTQDKQI  289

Query  188  QR  183
             R
Sbjct  290  HR  291



>ref|XP_008668621.1| PREDICTED: histone deacetylase isoform X1 [Zea mays]
Length=363

 Score =   306 bits (783),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 143/182 (79%), Positives = 162/182 (89%), Gaps = 0/182 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  F   +  II+KVVETY+PGAIVLQCGADSLA DRLGCFNLSI+GHAECV+FVKKFNI
Sbjct  164  DTSFTRLFKTIIAKVVETYLPGAIVLQCGADSLARDRLGCFNLSIEGHAECVKFVKKFNI  223

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            PLLVTGGGGYTKENVARCWA ETGVLLD+ELPNEIP N+YI+YF PDY+LK+P  +++NL
Sbjct  224  PLLVTGGGGYTKENVARCWAVETGVLLDTELPNEIPKNEYIEYFAPDYTLKVPNLNMDNL  283

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQI  189
            NSK+YL +IK  V+E+LRYIQHAP VQMQEVPPDFYIPDFDED  +PDER+DQHTQDKQI
Sbjct  284  NSKTYLSSIKVQVMESLRYIQHAPGVQMQEVPPDFYIPDFDEDELDPDERVDQHTQDKQI  343

Query  188  QR  183
             R
Sbjct  344  HR  345



>ref|XP_011005320.1| PREDICTED: histone deacetylase 9 isoform X1 [Populus euphratica]
Length=458

 Score =   309 bits (791),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 156/211 (74%), Positives = 164/211 (78%), Gaps = 29/211 (14%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  F   +  IISKVVETY PGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFN+
Sbjct  231  DTSFTRLFKTIISKVVETYQPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNL  290

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHI---  378
            PLLVTGGGGYTKENVARCW  ETGVLLD+ELPNEIP+N+YIKYF PDYSLK PGG +   
Sbjct  291  PLLVTGGGGYTKENVARCWTVETGVLLDTELPNEIPENEYIKYFAPDYSLKSPGGLVVCN  350

Query  377  --------------------------ENLNSKSYLGTIKSHVLENLRYIQHAPSVQMQEV  276
                                      ENLNSKSYL TIK  VL+NLR IQHAPSVQMQEV
Sbjct  351  CTETPCDFCILAAFLIFLLLFCLSEQENLNSKSYLSTIKMQVLDNLRCIQHAPSVQMQEV  410

Query  275  PPDFYIPDFDEDTQNPDERLDQHTQDKQIQR  183
            PPDFYIPDFDED QNPDER+DQHTQDKQIQR
Sbjct  411  PPDFYIPDFDEDEQNPDERMDQHTQDKQIQR  441



>emb|CAB72470.1| putative protein [Arabidopsis thaliana]
Length=419

 Score =   306 bits (785),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 143/172 (83%), Positives = 156/172 (91%), Gaps = 0/172 (0%)
 Frame = -3

Query  698  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  519
            +   VVE Y PGAIVLQCGADSLA DRLGCFNLSIDGHAECV+FVKKFN+PLLVTGGGGY
Sbjct  234  LFRTVVEIYQPGAIVLQCGADSLARDRLGCFNLSIDGHAECVKFVKKFNLPLLVTGGGGY  293

Query  518  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  339
            TKENVARCW  ETG+LLD+ELPNEIP+NDYIKYF PD+SLKIPGGHIENLN+KSY+ +IK
Sbjct  294  TKENVARCWTVETGILLDTELPNEIPENDYIKYFAPDFSLKIPGGHIENLNTKSYISSIK  353

Query  338  SHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQIQR  183
              +LENLRYIQHAPSVQMQEVPPDFYIPDFDED QNPD R DQ ++DKQIQR
Sbjct  354  VQILENLRYIQHAPSVQMQEVPPDFYIPDFDEDEQNPDVRADQRSRDKQIQR  405



>gb|ACR37742.1| unknown [Zea mays]
Length=405

 Score =   306 bits (783),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 143/182 (79%), Positives = 162/182 (89%), Gaps = 0/182 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  F   +  II+KVVETY+PGAIVLQCGADSLA DRLGCFNLSI+GHAECV+FVKKFNI
Sbjct  206  DTSFTRLFKTIIAKVVETYLPGAIVLQCGADSLARDRLGCFNLSIEGHAECVKFVKKFNI  265

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            PLLVTGGGGYTKENVARCWA ETGVLLD+ELPNEIP N+YI+YF PDY+LK+P  +++NL
Sbjct  266  PLLVTGGGGYTKENVARCWAVETGVLLDTELPNEIPKNEYIEYFAPDYTLKVPNLNMDNL  325

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQI  189
            NSK+YL +IK  V+E+LRYIQHAP VQMQEVPPDFYIPDFDED  +PDER+DQHTQDKQI
Sbjct  326  NSKTYLSSIKVQVMESLRYIQHAPGVQMQEVPPDFYIPDFDEDELDPDERVDQHTQDKQI  385

Query  188  QR  183
             R
Sbjct  386  HR  387



>ref|NP_001105077.1| histone deacetylase [Zea mays]
 gb|AAL33655.1|AF440228_1 histone deacetylase [Zea mays]
 gb|ACF83162.1| unknown [Zea mays]
 gb|ACG38577.1| histone deacetylase [Zea mays]
Length=430

 Score =   305 bits (782),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 143/182 (79%), Positives = 162/182 (89%), Gaps = 0/182 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  F   +  II+KVVETY+PGAIVLQCGADSLA DRLGCFNLSI+GHAECV+FVKKFNI
Sbjct  231  DTSFTRLFKTIIAKVVETYLPGAIVLQCGADSLARDRLGCFNLSIEGHAECVKFVKKFNI  290

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            PLLVTGGGGYTKENVARCWA ETGVLLD+ELPNEIP N+YI+YF PDY+LK+P  +++NL
Sbjct  291  PLLVTGGGGYTKENVARCWAVETGVLLDTELPNEIPKNEYIEYFAPDYTLKVPNLNMDNL  350

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQI  189
            NSK+YL +IK  V+E+LRYIQHAP VQMQEVPPDFYIPDFDED  +PDER+DQHTQDKQI
Sbjct  351  NSKTYLSSIKVQVMESLRYIQHAPGVQMQEVPPDFYIPDFDEDELDPDERVDQHTQDKQI  410

Query  188  QR  183
             R
Sbjct  411  HR  412



>tpg|DAA37954.1| TPA: histone deacetylase [Zea mays]
Length=427

 Score =   305 bits (781),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 143/182 (79%), Positives = 162/182 (89%), Gaps = 0/182 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  F   +  II+KVVETY+PGAIVLQCGADSLA DRLGCFNLSI+GHAECV+FVKKFNI
Sbjct  228  DTSFTRLFKTIIAKVVETYLPGAIVLQCGADSLARDRLGCFNLSIEGHAECVKFVKKFNI  287

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            PLLVTGGGGYTKENVARCWA ETGVLLD+ELPNEIP N+YI+YF PDY+LK+P  +++NL
Sbjct  288  PLLVTGGGGYTKENVARCWAVETGVLLDTELPNEIPKNEYIEYFAPDYTLKVPNLNMDNL  347

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQI  189
            NSK+YL +IK  V+E+LRYIQHAP VQMQEVPPDFYIPDFDED  +PDER+DQHTQDKQI
Sbjct  348  NSKTYLSSIKVQVMESLRYIQHAPGVQMQEVPPDFYIPDFDEDELDPDERVDQHTQDKQI  407

Query  188  QR  183
             R
Sbjct  408  HR  409



>gb|EMT12816.1| Histone deacetylase 9 [Aegilops tauschii]
Length=381

 Score =   303 bits (777),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 141/182 (77%), Positives = 162/182 (89%), Gaps = 0/182 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  F   +  II+KVVETY+PGAIVLQCGADSLA DRLGCFNLSI+GHAECV+FVKKF I
Sbjct  182  DTSFTRLFKTIIAKVVETYLPGAIVLQCGADSLARDRLGCFNLSIEGHAECVKFVKKFKI  241

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            PLLVTGGGGYTKENVARCWA ETGVLLD+ELPNEIPDN+YI+YFGPDY+LK+P  +++NL
Sbjct  242  PLLVTGGGGYTKENVARCWAVETGVLLDTELPNEIPDNEYIEYFGPDYTLKVPNLNMDNL  301

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQI  189
            NSK+YL +IK  V+E+LR IQHAP VQMQEVPPDFY+PDFDED  +PDER+DQHTQDKQ+
Sbjct  302  NSKTYLSSIKVQVMESLRAIQHAPGVQMQEVPPDFYVPDFDEDELDPDERVDQHTQDKQV  361

Query  188  QR  183
             R
Sbjct  362  HR  363



>tpg|DAA37953.1| TPA: histone deacetylase, mRNA [Zea mays]
Length=432

 Score =   305 bits (781),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 143/182 (79%), Positives = 162/182 (89%), Gaps = 0/182 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  F   +  II+KVVETY+PGAIVLQCGADSLA DRLGCFNLSI+GHAECV+FVKKFNI
Sbjct  233  DTSFTRLFKTIIAKVVETYLPGAIVLQCGADSLARDRLGCFNLSIEGHAECVKFVKKFNI  292

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            PLLVTGGGGYTKENVARCWA ETGVLLD+ELPNEIP N+YI+YF PDY+LK+P  +++NL
Sbjct  293  PLLVTGGGGYTKENVARCWAVETGVLLDTELPNEIPKNEYIEYFAPDYTLKVPNLNMDNL  352

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQI  189
            NSK+YL +IK  V+E+LRYIQHAP VQMQEVPPDFYIPDFDED  +PDER+DQHTQDKQI
Sbjct  353  NSKTYLSSIKVQVMESLRYIQHAPGVQMQEVPPDFYIPDFDEDELDPDERVDQHTQDKQI  412

Query  188  QR  183
             R
Sbjct  413  HR  414



>gb|ACD50313.1| histone deacetylase RPD3/HDA1 class I isoform 1 [Hordeum vulgare]
Length=430

 Score =   305 bits (781),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 142/182 (78%), Positives = 162/182 (89%), Gaps = 0/182 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  F   +  II+KVVETY+PGAIVLQCGADSLA DRLGCFNLSI+GHAECV+FVKKF I
Sbjct  231  DTSFTRLFKTIIAKVVETYLPGAIVLQCGADSLARDRLGCFNLSIEGHAECVKFVKKFKI  290

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            PLLVTGGGGYTKENVARCWA ETGVLLD+ELPNEIPDN+YIKYFGPDY+LK+P  +++NL
Sbjct  291  PLLVTGGGGYTKENVARCWAVETGVLLDTELPNEIPDNEYIKYFGPDYTLKVPNLNMDNL  350

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQI  189
            NSK+YL +IK  V+E+LR IQHAP VQMQEVPPDFY+PDFDED  +PDER+DQHTQDKQ+
Sbjct  351  NSKTYLSSIKVQVMESLRAIQHAPGVQMQEVPPDFYVPDFDEDELDPDERVDQHTQDKQV  410

Query  188  QR  183
             R
Sbjct  411  HR  412



>ref|XP_004975539.1| PREDICTED: histone deacetylase 9-like isoform X2 [Setaria italica]
Length=364

 Score =   302 bits (774),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 142/182 (78%), Positives = 161/182 (88%), Gaps = 0/182 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  F   +  II+KVVETY+PGAIVLQCGADSLA DRLGCFNLSI+GHAECV+FVKKFNI
Sbjct  165  DASFTRLFKTIIAKVVETYLPGAIVLQCGADSLARDRLGCFNLSIEGHAECVKFVKKFNI  224

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            PLLVTGGGGYTKENVARCWA ETGVLLD+ELPNEIP+NDYI+YF PDY+LK+P  +++NL
Sbjct  225  PLLVTGGGGYTKENVARCWAVETGVLLDTELPNEIPNNDYIEYFAPDYTLKVPNLNMDNL  284

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQI  189
            NSK+YL +IK  V+E+LR IQHAP VQMQEVPPDFYIPDFDED  +PDER+DQH QDKQI
Sbjct  285  NSKTYLSSIKVQVMESLRSIQHAPGVQMQEVPPDFYIPDFDEDELDPDERVDQHIQDKQI  344

Query  188  QR  183
             R
Sbjct  345  HR  346



>ref|XP_003579685.1| PREDICTED: histone deacetylase 9 isoform X1 [Brachypodium distachyon]
Length=430

 Score =   304 bits (779),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 142/182 (78%), Positives = 162/182 (89%), Gaps = 0/182 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  F   +  II+KVVETY+PGAIVLQCGADSLA DRLGCFNLSI+GHAECV+FVKKF I
Sbjct  231  DTSFTRLFKTIIAKVVETYLPGAIVLQCGADSLARDRLGCFNLSIEGHAECVKFVKKFKI  290

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            PLLVTGGGGYTKENVARCWA ETGVLLD++LPNEIPDN+YIKYFGPDY+LK+P  +++NL
Sbjct  291  PLLVTGGGGYTKENVARCWAVETGVLLDTDLPNEIPDNEYIKYFGPDYTLKVPNLNMDNL  350

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQI  189
            NSK+YL +IK  V+E+LR IQHAP VQMQEVPPDFYIPDFDED  +PDER+DQHTQDKQ+
Sbjct  351  NSKTYLSSIKVQVMESLRAIQHAPGVQMQEVPPDFYIPDFDEDELDPDERVDQHTQDKQV  410

Query  188  QR  183
             R
Sbjct  411  HR  412



>ref|XP_010541291.1| PREDICTED: histone deacetylase 9 isoform X1 [Tarenaya hassleriana]
Length=426

 Score =   303 bits (777),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 146/183 (80%), Positives = 160/183 (87%), Gaps = 1/183 (1%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  F   +  IISKVVE Y PGAIVLQCGADSLA DRLGCFNLSIDGH+ECV+FVKKFNI
Sbjct  231  DNSFNRLFRTIISKVVEMYQPGAIVLQCGADSLARDRLGCFNLSIDGHSECVKFVKKFNI  290

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGH-IEN  372
            PLLVTGGGGYTKENVARCW  ETGVLLD+EL NEIP+NDYIKYF PD+SLKIPGGH IEN
Sbjct  291  PLLVTGGGGYTKENVARCWTVETGVLLDAELSNEIPENDYIKYFAPDFSLKIPGGHIIEN  350

Query  371  LNSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQ  192
            +N+KSY+ +IK  +LENLRYIQHAPSVQMQEVPPDFYIPDF+ED QNPD R+DQ  +DK 
Sbjct  351  MNTKSYISSIKVQILENLRYIQHAPSVQMQEVPPDFYIPDFNEDEQNPDVRVDQRARDKH  410

Query  191  IQR  183
            IQR
Sbjct  411  IQR  413



>emb|CAH66503.1| H0321H01.12 [Oryza sativa Indica Group]
 gb|EEC77239.1| hypothetical protein OsI_15792 [Oryza sativa Indica Group]
 gb|EEE60951.1| hypothetical protein OsJ_14708 [Oryza sativa Japonica Group]
Length=430

 Score =   303 bits (775),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 143/182 (79%), Positives = 161/182 (88%), Gaps = 0/182 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D GF   +  +I+KVVETY+PGAIVLQCGADSLA DRLGCFNLSI+GHAECV+FVKKFNI
Sbjct  231  DSGFTRLFKTVIAKVVETYLPGAIVLQCGADSLARDRLGCFNLSIEGHAECVKFVKKFNI  290

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            PLLVTGGGGYTKENVARCWA ETGVLLD+ELPNEIPDN+YIKYF PDY+LK+   +++NL
Sbjct  291  PLLVTGGGGYTKENVARCWAVETGVLLDTELPNEIPDNEYIKYFAPDYTLKVSNVNMDNL  350

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQI  189
            NSKSYL +IK  V+E+LR IQHAP VQMQEVPPDFYIPD DED  +PDER+DQHTQDKQI
Sbjct  351  NSKSYLSSIKVQVMESLRAIQHAPGVQMQEVPPDFYIPDIDEDELDPDERVDQHTQDKQI  410

Query  188  QR  183
             R
Sbjct  411  HR  412



>ref|XP_008458611.1| PREDICTED: histone deacetylase 17 isoform X5 [Cucumis melo]
Length=183

 Score =   294 bits (752),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 134/159 (84%), Positives = 149/159 (94%), Gaps = 0/159 (0%)
 Frame = -3

Query  659  IVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGYTKENVARCWAYET  480
            +++ CGADSLAGDRLGCFNLSIDGHAECVRFVKKFN+PLLVTGGGGYTKENVARCW  ET
Sbjct  7    LLIMCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNLPLLVTGGGGYTKENVARCWTVET  66

Query  479  GVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIKSHVLENLRYIQHA  300
            GVLLD+ELPNEIPDN+YIKYF PD+ L+IP GH+ENLN+KSYL TIK+ VLENLR+IQHA
Sbjct  67   GVLLDTELPNEIPDNEYIKYFSPDHLLRIPNGHMENLNTKSYLSTIKTQVLENLRFIQHA  126

Query  299  PSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQIQR  183
            P VQMQEVPPDFYIPDFDED QNPDER+++HTQDKQIQR
Sbjct  127  PGVQMQEVPPDFYIPDFDEDGQNPDERMNRHTQDKQIQR  165



>ref|XP_006652253.1| PREDICTED: histone deacetylase 9-like [Oryza brachyantha]
Length=430

 Score =   302 bits (774),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 143/182 (79%), Positives = 161/182 (88%), Gaps = 0/182 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  F   +  +I+KVVETY+PGAIVLQCGADSLA DRLGCFNLSI+GHAECV+FVKKFNI
Sbjct  231  DSCFTRLFKTVIAKVVETYLPGAIVLQCGADSLARDRLGCFNLSIEGHAECVKFVKKFNI  290

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            PLLVTGGGGYTKENVARCWA ETGVLLD+ELPNEIPDN+YIKYF PDY+LK+   +++NL
Sbjct  291  PLLVTGGGGYTKENVARCWAVETGVLLDTELPNEIPDNEYIKYFAPDYTLKVSNLNMDNL  350

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQI  189
            NSKSYL +IK  V+E+LR IQHAP VQMQEVPPDFYIPDFDED  +PDER+DQHTQDKQI
Sbjct  351  NSKSYLSSIKVQVMESLRAIQHAPGVQMQEVPPDFYIPDFDEDELDPDERVDQHTQDKQI  410

Query  188  QR  183
             R
Sbjct  411  HR  412



>ref|XP_004975538.1| PREDICTED: histone deacetylase 9-like isoform X1 [Setaria italica]
Length=430

 Score =   302 bits (773),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 142/182 (78%), Positives = 161/182 (88%), Gaps = 0/182 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  F   +  II+KVVETY+PGAIVLQCGADSLA DRLGCFNLSI+GHAECV+FVKKFNI
Sbjct  231  DASFTRLFKTIIAKVVETYLPGAIVLQCGADSLARDRLGCFNLSIEGHAECVKFVKKFNI  290

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            PLLVTGGGGYTKENVARCWA ETGVLLD+ELPNEIP+NDYI+YF PDY+LK+P  +++NL
Sbjct  291  PLLVTGGGGYTKENVARCWAVETGVLLDTELPNEIPNNDYIEYFAPDYTLKVPNLNMDNL  350

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQI  189
            NSK+YL +IK  V+E+LR IQHAP VQMQEVPPDFYIPDFDED  +PDER+DQH QDKQI
Sbjct  351  NSKTYLSSIKVQVMESLRSIQHAPGVQMQEVPPDFYIPDFDEDELDPDERVDQHIQDKQI  410

Query  188  QR  183
             R
Sbjct  411  HR  412



>ref|XP_002446401.1| hypothetical protein SORBIDRAFT_06g015420 [Sorghum bicolor]
 gb|EES10729.1| hypothetical protein SORBIDRAFT_06g015420 [Sorghum bicolor]
Length=430

 Score =   302 bits (773),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 141/182 (77%), Positives = 162/182 (89%), Gaps = 0/182 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  F   +  II+KV+ETY+PGAIVLQCGADSLA DRLGCFNLSI+GHAECV+FVKKFNI
Sbjct  231  DSSFTRLFKTIIAKVIETYLPGAIVLQCGADSLARDRLGCFNLSIEGHAECVKFVKKFNI  290

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            PLLVTGGGGYTKENVARCWA ETGVLLD+ELPNEIP+N+YI+YF PDY+LK+P  +++NL
Sbjct  291  PLLVTGGGGYTKENVARCWAVETGVLLDTELPNEIPNNEYIEYFAPDYTLKVPNLNMDNL  350

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQI  189
            NSK+YL +IK  V+E+LR IQHAP VQMQEVPPDFYIPDFDED  +PDER+DQHTQDKQI
Sbjct  351  NSKTYLSSIKVQVMESLRSIQHAPGVQMQEVPPDFYIPDFDEDELDPDERVDQHTQDKQI  410

Query  188  QR  183
             R
Sbjct  411  HR  412



>ref|XP_011090014.1| PREDICTED: histone deacetylase 17 isoform X2 [Sesamum indicum]
Length=252

 Score =   294 bits (753),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 154/200 (77%), Positives = 167/200 (84%), Gaps = 0/200 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  F   +  II KV+E Y PGAIVLQCGADSLAGDRLGCFNLSIDGHA CV+FVK+ N+
Sbjct  53   DGSFLRLFKTIILKVMECYAPGAIVLQCGADSLAGDRLGCFNLSIDGHAACVKFVKQLNL  112

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            PLLVTGGGGYTKENVARCW  ETG LL  ELPNEIP+NDYIKYF PDYSLK P GH+ENL
Sbjct  113  PLLVTGGGGYTKENVARCWTVETGALLGVELPNEIPENDYIKYFAPDYSLKCPSGHLENL  172

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQI  189
            NSKSYL TI+  V ENL  IQHAP VQM EVPPDFYIPDFDED  NPDER+++H QDK I
Sbjct  173  NSKSYLNTIRQQVCENLSSIQHAPGVQMHEVPPDFYIPDFDEDELNPDERVNRHIQDKHI  232

Query  188  QRddeyyegdndnDHSMDDA  129
            QRDDEYYEGDNDND +MDD+
Sbjct  233  QRDDEYYEGDNDNDQTMDDS  252



>ref|XP_011657064.1| PREDICTED: histone deacetylase 17 isoform X4 [Cucumis sativus]
Length=183

 Score =   291 bits (746),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 134/155 (86%), Positives = 146/155 (94%), Gaps = 0/155 (0%)
 Frame = -3

Query  647  CGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGYTKENVARCWAYETGVLL  468
            CGADSLAGDRLGCFNLSIDGHAECVRFVKKFN+PLLVTGGGGYTKENVARCW  ETGVLL
Sbjct  11   CGADSLAGDRLGCFNLSIDGHAECVRFVKKFNLPLLVTGGGGYTKENVARCWTVETGVLL  70

Query  467  DSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIKSHVLENLRYIQHAPSVQ  288
            D+ELPNEIPDN+YIKYF PD+ L+IP GH+ENLN+KSYL TIK+ VLENLR+IQHAP VQ
Sbjct  71   DTELPNEIPDNEYIKYFSPDHLLRIPNGHMENLNTKSYLSTIKTQVLENLRFIQHAPGVQ  130

Query  287  MQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQIQR  183
            MQEVPPDFYIPDFDED QNPDER+++HTQDKQIQR
Sbjct  131  MQEVPPDFYIPDFDEDGQNPDERMNRHTQDKQIQR  165



>gb|EYU36088.1| hypothetical protein MIMGU_mgv1a006831mg [Erythranthe guttata]
Length=430

 Score =   298 bits (762),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 139/182 (76%), Positives = 154/182 (85%), Gaps = 0/182 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  F   +  II KV+E Y+PGAIVLQCGADSLAGDRLGCFNLSIDGHA CV+FVK+ N+
Sbjct  231  DGSFFRLFKMIILKVMECYVPGAIVLQCGADSLAGDRLGCFNLSIDGHAACVKFVKQLNL  290

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            PLLVTGGGGYTKENVARCW  ETG LLD ELPNEIP+N+YIKYF PDYSLK P GH+ENL
Sbjct  291  PLLVTGGGGYTKENVARCWTVETGALLDVELPNEIPENEYIKYFAPDYSLKCPSGHMENL  350

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQI  189
            NSKSYL TI+  V ENL  IQHAP VQMQEVPPDFYIPDFDED  NPD+R+++H QDKQ+
Sbjct  351  NSKSYLNTIRQQVCENLSAIQHAPGVQMQEVPPDFYIPDFDEDQHNPDQRVNRHAQDKQV  410

Query  188  QR  183
            QR
Sbjct  411  QR  412



>gb|KCW50787.1| hypothetical protein EUGRSUZ_J00456 [Eucalyptus grandis]
Length=406

 Score =   296 bits (759),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 145/175 (83%), Positives = 154/175 (88%), Gaps = 2/175 (1%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  F   +  IISKVVETY PGAIVLQCGADSLAGDRLGCFNLSIDGH+ECVRFVKKFN+
Sbjct  231  DTSFTRLFKAIISKVVETYQPGAIVLQCGADSLAGDRLGCFNLSIDGHSECVRFVKKFNL  290

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHI--E  375
            PLLVTGGGGYTKENVARCW  ETGVLLD+ELPNEIP+N+Y KYF PDYSLKIP G+I  E
Sbjct  291  PLLVTGGGGYTKENVARCWVVETGVLLDTELPNEIPENEYFKYFAPDYSLKIPRGNIVLE  350

Query  374  NLNSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQ  210
            NLNSKSYL  IK  VLENLR IQHAPSVQMQEVPPDFYIPDFDED QNPDER+D+
Sbjct  351  NLNSKSYLSAIKVQVLENLRNIQHAPSVQMQEVPPDFYIPDFDEDEQNPDERMDR  405



>ref|XP_001774667.1| class I RPD3 type histone deacetylase protein [Physcomitrella 
patens]
 gb|EDQ60482.1| class I RPD3 type histone deacetylase protein [Physcomitrella 
patens]
Length=431

 Score =   295 bits (754),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 141/183 (77%), Positives = 154/183 (84%), Gaps = 1/183 (1%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  F   +  +I KVVE Y PGAIVLQCGADSLAGDRLGCFNLSIDGH+ECV+FVKKFNI
Sbjct  231  DANFIRMFRVVIQKVVEVYQPGAIVLQCGADSLAGDRLGCFNLSIDGHSECVKFVKKFNI  290

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGG-HIEN  372
            PLLVTGGGGYTKENVARCW  ETGVL+D+ELPNEIPDNDY+KYF PD +LK   G H+EN
Sbjct  291  PLLVTGGGGYTKENVARCWTVETGVLVDTELPNEIPDNDYLKYFKPDCTLKTTSGNHMEN  350

Query  371  LNSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQ  192
            LN K+YL TIK  V+ENLR I HAPSVQM EVPPD YIP+FDED  NPDER+DQHTQDK 
Sbjct  351  LNGKTYLSTIKQQVMENLRRIAHAPSVQMHEVPPDTYIPEFDEDELNPDERMDQHTQDKH  410

Query  191  IQR  183
            IQR
Sbjct  411  IQR  413



>ref|XP_002877352.1| hypothetical protein ARALYDRAFT_347545 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53611.1| hypothetical protein ARALYDRAFT_347545 [Arabidopsis lyrata subsp. 
lyrata]
Length=1443

 Score =   311 bits (796),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 148/198 (75%), Positives = 163/198 (82%), Gaps = 16/198 (8%)
 Frame = -3

Query  728   DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSID--------------  591
             D  F   +  IISKVVE Y PGAIVLQCGADSLA DRLGCFNLSID              
Sbjct  1232  DSSFNRLFRTIISKVVEIYQPGAIVLQCGADSLARDRLGCFNLSIDVSVTQILKRLSLMH  1291

Query  590   --GHAECVRFVKKFNIPLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYF  417
               GHAECV+FVKKFN+PLLVTGGGGYTKENVARCW  ETG+LLD+ELPNEIP+NDYIKYF
Sbjct  1292  FPGHAECVKFVKKFNLPLLVTGGGGYTKENVARCWTVETGILLDTELPNEIPENDYIKYF  1351

Query  416   GPDYSLKIPGGHIENLNSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDT  237
              PD+SLKIPGGHIENLN+KSY+ +IK  +LENLRYIQHAPSVQMQEVPPDFYIPDFDED 
Sbjct  1352  APDFSLKIPGGHIENLNTKSYISSIKVQILENLRYIQHAPSVQMQEVPPDFYIPDFDEDE  1411

Query  236   QNPDERLDQHTQDKQIQR  183
             QNPD R+DQ ++DKQ+QR
Sbjct  1412  QNPDVRVDQRSRDKQVQR  1429



>ref|XP_011090013.1| PREDICTED: histone deacetylase 9 isoform X1 [Sesamum indicum]
Length=430

 Score =   293 bits (751),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 154/200 (77%), Positives = 167/200 (84%), Gaps = 0/200 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  F   +  II KV+E Y PGAIVLQCGADSLAGDRLGCFNLSIDGHA CV+FVK+ N+
Sbjct  231  DGSFLRLFKTIILKVMECYAPGAIVLQCGADSLAGDRLGCFNLSIDGHAACVKFVKQLNL  290

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            PLLVTGGGGYTKENVARCW  ETG LL  ELPNEIP+NDYIKYF PDYSLK P GH+ENL
Sbjct  291  PLLVTGGGGYTKENVARCWTVETGALLGVELPNEIPENDYIKYFAPDYSLKCPSGHLENL  350

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQI  189
            NSKSYL TI+  V ENL  IQHAP VQM EVPPDFYIPDFDED  NPDER+++H QDK I
Sbjct  351  NSKSYLNTIRQQVCENLSSIQHAPGVQMHEVPPDFYIPDFDEDELNPDERVNRHIQDKHI  410

Query  188  QRddeyyegdndnDHSMDDA  129
            QRDDEYYEGDNDND +MDD+
Sbjct  411  QRDDEYYEGDNDNDQTMDDS  430



>ref|XP_007015905.1| Histone deacetylase 9 isoform 2 [Theobroma cacao]
 gb|EOY33524.1| Histone deacetylase 9 isoform 2 [Theobroma cacao]
Length=404

 Score =   292 bits (748),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 140/173 (81%), Positives = 150/173 (87%), Gaps = 0/173 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  F   +  IISKVVE Y PGAIVLQCGADSLAGDRLGCFNLSIDGHAECVR VKKFN+
Sbjct  231  DTSFTRLFKTIISKVVEMYQPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRIVKKFNL  290

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            PLLVTGGGGYTKENVARCW  ETGVLLD+ELPNEIP+N+YIKYF P+  L IP GHIENL
Sbjct  291  PLLVTGGGGYTKENVARCWTVETGVLLDTELPNEIPENEYIKYFAPECLLNIPNGHIENL  350

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQ  210
            NSKSY+ TIK  VLENLR IQHAP VQMQEVPPDF+IPDFDED QNPDER+D+
Sbjct  351  NSKSYISTIKMQVLENLRCIQHAPGVQMQEVPPDFFIPDFDEDEQNPDERMDR  403



>ref|XP_008458608.1| PREDICTED: histone deacetylase 9 isoform X2 [Cucumis melo]
Length=413

 Score =   291 bits (744),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 134/155 (86%), Positives = 146/155 (94%), Gaps = 0/155 (0%)
 Frame = -3

Query  647  CGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGYTKENVARCWAYETGVLL  468
            CGADSLAGDRLGCFNLSIDGHAECVRFVKKFN+PLLVTGGGGYTKENVARCW  ETGVLL
Sbjct  241  CGADSLAGDRLGCFNLSIDGHAECVRFVKKFNLPLLVTGGGGYTKENVARCWTVETGVLL  300

Query  467  DSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIKSHVLENLRYIQHAPSVQ  288
            D+ELPNEIPDN+YIKYF PD+ L+IP GH+ENLN+KSYL TIK+ VLENLR+IQHAP VQ
Sbjct  301  DTELPNEIPDNEYIKYFSPDHLLRIPNGHMENLNTKSYLSTIKTQVLENLRFIQHAPGVQ  360

Query  287  MQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQIQR  183
            MQEVPPDFYIPDFDED QNPDER+++HTQDKQIQR
Sbjct  361  MQEVPPDFYIPDFDEDGQNPDERMNRHTQDKQIQR  395



>ref|XP_011657062.1| PREDICTED: histone deacetylase 9 isoform X2 [Cucumis sativus]
Length=413

 Score =   291 bits (744),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 134/155 (86%), Positives = 146/155 (94%), Gaps = 0/155 (0%)
 Frame = -3

Query  647  CGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGYTKENVARCWAYETGVLL  468
            CGADSLAGDRLGCFNLSIDGHAECVRFVKKFN+PLLVTGGGGYTKENVARCW  ETGVLL
Sbjct  241  CGADSLAGDRLGCFNLSIDGHAECVRFVKKFNLPLLVTGGGGYTKENVARCWTVETGVLL  300

Query  467  DSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIKSHVLENLRYIQHAPSVQ  288
            D+ELPNEIPDN+YIKYF PD+ L+IP GH+ENLN+KSYL TIK+ VLENLR+IQHAP VQ
Sbjct  301  DTELPNEIPDNEYIKYFSPDHLLRIPNGHMENLNTKSYLSTIKTQVLENLRFIQHAPGVQ  360

Query  287  MQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQIQR  183
            MQEVPPDFYIPDFDED QNPDER+++HTQDKQIQR
Sbjct  361  MQEVPPDFYIPDFDEDGQNPDERMNRHTQDKQIQR  395



>emb|CAN75079.1| hypothetical protein VITISV_007579 [Vitis vinifera]
Length=393

 Score =   286 bits (732),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 142/182 (78%), Positives = 151/182 (83%), Gaps = 12/182 (7%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  F   +  II+KVVE Y PG IVLQCGADSLAGDRLGCFNLSIDG             
Sbjct  206  DTSFTRLFKTIIAKVVEIYQPGVIVLQCGADSLAGDRLGCFNLSIDG------------A  253

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
             LLVTGGGGYTKENVARCW  ETGVLLD+ELPNEIP+N+YIKYFGP++SLKIP GHIENL
Sbjct  254  NLLVTGGGGYTKENVARCWTVETGVLLDTELPNEIPENEYIKYFGPEHSLKIPNGHIENL  313

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQI  189
            NSKSYLGTIK  VLENLR IQHAPSVQMQEVPPDFYIPDFDED QNPDER+DQHT+DKQI
Sbjct  314  NSKSYLGTIKQQVLENLRCIQHAPSVQMQEVPPDFYIPDFDEDEQNPDERVDQHTKDKQI  373

Query  188  QR  183
            QR
Sbjct  374  QR  375



>ref|XP_002966032.1| hypothetical protein SELMODRAFT_84957 [Selaginella moellendorffii]
 gb|EFJ33452.1| hypothetical protein SELMODRAFT_84957 [Selaginella moellendorffii]
Length=432

 Score =   285 bits (729),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 150/199 (75%), Positives = 166/199 (83%), Gaps = 1/199 (1%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  F   +  +ISKVVE Y PGA+VLQCGADSLAGDRLGCFNLSI GHAECV FVKK  I
Sbjct  233  DSSFIRLFRVVISKVVEFYQPGAVVLQCGADSLAGDRLGCFNLSIQGHAECVNFVKKLGI  292

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGG-HIEN  372
            PLLVTGGGGYTKENVARCW  ETGVLLD+ELPNEIP NDYIKYF PDY+LK   G +++N
Sbjct  293  PLLVTGGGGYTKENVARCWTVETGVLLDTELPNEIPSNDYIKYFKPDYTLKTNHGLNLDN  352

Query  371  LNSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQ  192
            LN+K+YL  IK  VLENLR+IQHAP VQM EVPPD Y PDFDE+  NPDERLDQHTQDK 
Sbjct  353  LNTKAYLSAIKMQVLENLRHIQHAPGVQMHEVPPDTYFPDFDEEDFNPDERLDQHTQDKS  412

Query  191  IQRddeyyegdndnDHSMD  135
            +QRD+E+Y+GDNDNDH MD
Sbjct  413  VQRDEEFYDGDNDNDHDMD  431



>ref|XP_002971460.1| hypothetical protein SELMODRAFT_172161 [Selaginella moellendorffii]
 gb|EFJ27209.1| hypothetical protein SELMODRAFT_172161 [Selaginella moellendorffii]
Length=432

 Score =   284 bits (726),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 150/199 (75%), Positives = 165/199 (83%), Gaps = 1/199 (1%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  F   +  +ISKVVE Y PGA+VLQCGADSLAGDRLGCFNLSI GHAECV FVKK  I
Sbjct  233  DSSFIRLFRVVISKVVEFYQPGAVVLQCGADSLAGDRLGCFNLSIQGHAECVNFVKKLGI  292

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGG-HIEN  372
            PLLVTGGGGYTKENVARCW  ETGVLLD+ELPNEIP NDYIKYF PDY+LK   G +++N
Sbjct  293  PLLVTGGGGYTKENVARCWTVETGVLLDTELPNEIPSNDYIKYFKPDYTLKTNHGLNLDN  352

Query  371  LNSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQ  192
            LN+K+YL  IK  VLENLR+IQHAP VQM EVPPD Y PDFDE   NPDERLDQHTQDK 
Sbjct  353  LNTKAYLSAIKMQVLENLRHIQHAPGVQMHEVPPDTYFPDFDEGDFNPDERLDQHTQDKS  412

Query  191  IQRddeyyegdndnDHSMD  135
            +QRD+E+Y+GDNDNDH MD
Sbjct  413  VQRDEEFYDGDNDNDHDMD  431



>gb|EYU36089.1| hypothetical protein MIMGU_mgv1a006831mg [Erythranthe guttata]
Length=404

 Score =   281 bits (718),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 132/173 (76%), Positives = 146/173 (84%), Gaps = 0/173 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  F   +  II KV+E Y+PGAIVLQCGADSLAGDRLGCFNLSIDGHA CV+FVK+ N+
Sbjct  231  DGSFFRLFKMIILKVMECYVPGAIVLQCGADSLAGDRLGCFNLSIDGHAACVKFVKQLNL  290

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            PLLVTGGGGYTKENVARCW  ETG LLD ELPNEIP+N+YIKYF PDYSLK P GH+ENL
Sbjct  291  PLLVTGGGGYTKENVARCWTVETGALLDVELPNEIPENEYIKYFAPDYSLKCPSGHMENL  350

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQ  210
            NSKSYL TI+  V ENL  IQHAP VQMQEVPPDFYIPDFDED  NPD+R+++
Sbjct  351  NSKSYLNTIRQQVCENLSAIQHAPGVQMQEVPPDFYIPDFDEDQHNPDQRVNR  403



>gb|KHN21123.1| Histone deacetylase 9 [Glycine soja]
Length=477

 Score =   273 bits (697),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 139/199 (70%), Positives = 151/199 (76%), Gaps = 17/199 (9%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  F   +  IISKVVETY PGAIVLQCGADSLAGDRLGCFNLSIDGHAECV FVK+FN+
Sbjct  262  DSSFTRLFKTIISKVVETYQPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVSFVKRFNL  321

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYF--GPDYSL--------  399
            PLLVTGGGGYTKENVARCW  ETGVLLD+ELPNE P    + +F   P   +        
Sbjct  322  PLLVTGGGGYTKENVARCWTVETGVLLDTELPNEFPCGISLDFFSCAPQSGMMEKYVIPY  381

Query  398  -------KIPGGHIENLNSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDED  240
                   ++    +ENLNSKSYL TIK  VLENLR IQHAPSVQMQEVPPDFYIP+FDED
Sbjct  382  VSFGSIERLQHIIVENLNSKSYLSTIKMQVLENLRCIQHAPSVQMQEVPPDFYIPEFDED  441

Query  239  TQNPDERLDQHTQDKQIQR  183
             QNPDER+DQHTQDK IQR
Sbjct  442  EQNPDERIDQHTQDKHIQR  460



>ref|XP_010692975.1| PREDICTED: histone deacetylase 17 isoform X3 [Beta vulgaris subsp. 
vulgaris]
Length=168

 Score =   254 bits (650),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 134/159 (84%), Positives = 145/159 (91%), Gaps = 1/159 (1%)
 Frame = -3

Query  608  FNLSIDGHAECVRFVKKFNIPLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDY  429
            F L   GHAECVRFVKKFN+PLLVTGGGGYTKENVARCW  ETGVLLD++LPNEIPDN+Y
Sbjct  10   FVLLFAGHAECVRFVKKFNLPLLVTGGGGYTKENVARCWTVETGVLLDTDLPNEIPDNEY  69

Query  428  IKYFGPDYSLKIPGGHIENLNSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDF  249
            IKYFGPDYSL+IP GHIENLNSKSYL TIK  VLENLR IQHAPSVQMQEVPPDFY+PDF
Sbjct  70   IKYFGPDYSLRIPNGHIENLNSKSYLTTIKMQVLENLRCIQHAPSVQMQEVPPDFYVPDF  129

Query  248  DEDTQNPDERLDQHTQDKQIQRddeyyegdndnDHSMDD  132
            DED +NPDER++QHTQDK IQRDDEYY+GD DNDH+MDD
Sbjct  130  DED-ENPDERINQHTQDKLIQRDDEYYDGDQDNDHNMDD  167



>ref|NP_190035.1| histone deacetylase 17 [Arabidopsis thaliana]
 sp|Q9LXN8.1|HDA17_ARATH RecName: Full=Histone deacetylase 17 [Arabidopsis thaliana]
 emb|CAB88531.1| putative protein [Arabidopsis thaliana]
 gb|AEE77907.1| histone deacetylase 17 [Arabidopsis thaliana]
Length=158

 Score =   253 bits (645),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 114/143 (80%), Positives = 129/143 (90%), Gaps = 0/143 (0%)
 Frame = -3

Query  611  CFNLSIDGHAECVRFVKKFNIPLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDND  432
             F++   GHAECV+FVKKFN+PLLVTGGGGYTKENVARCW  ETG+LLD+ELPNEI +ND
Sbjct  2    AFSMLFTGHAECVKFVKKFNLPLLVTGGGGYTKENVARCWTVETGILLDTELPNEISEND  61

Query  431  YIKYFGPDYSLKIPGGHIENLNSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPD  252
            YIKYF PD+SLKIPGGHIENLN+KSY+ +IK  +LENLRYIQHAPSVQMQEVPPDFYIPD
Sbjct  62   YIKYFAPDFSLKIPGGHIENLNTKSYISSIKVQILENLRYIQHAPSVQMQEVPPDFYIPD  121

Query  251  FDEDTQNPDERLDQHTQDKQIQR  183
            FDED QNPD R+DQ ++DKQIQR
Sbjct  122  FDEDEQNPDVRVDQRSRDKQIQR  144



>ref|XP_010425886.1| PREDICTED: histone deacetylase 17 isoform X2 [Camelina sativa]
Length=156

 Score =   248 bits (633),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 112/135 (83%), Positives = 126/135 (93%), Gaps = 0/135 (0%)
 Frame = -3

Query  587  HAECVRFVKKFNIPLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPD  408
            HAECV+FVKKFN+PLLVTGGGGYTKENVARCW  ETG+LLD+ELPNEIP+NDYIKYF PD
Sbjct  8    HAECVKFVKKFNLPLLVTGGGGYTKENVARCWTVETGILLDTELPNEIPENDYIKYFAPD  67

Query  407  YSLKIPGGHIENLNSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNP  228
            +SLKIPGGHIENLN+KSY+ +IK  +LENLR+IQHAPSVQMQEVPPDFYIPDFDED QNP
Sbjct  68   FSLKIPGGHIENLNTKSYISSIKVQILENLRFIQHAPSVQMQEVPPDFYIPDFDEDEQNP  127

Query  227  DERLDQHTQDKQIQR  183
            D R+DQ ++DKQIQR
Sbjct  128  DVRVDQRSRDKQIQR  142



>gb|KCW50788.1| hypothetical protein EUGRSUZ_J00456 [Eucalyptus grandis]
Length=393

 Score =   253 bits (647),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 126/153 (82%), Positives = 133/153 (87%), Gaps = 2/153 (1%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  F   +  IISKVVETY PGAIVLQCGADSLAGDRLGCFNLSIDGH+ECVRFVKKFN+
Sbjct  231  DTSFTRLFKAIISKVVETYQPGAIVLQCGADSLAGDRLGCFNLSIDGHSECVRFVKKFNL  290

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHI--E  375
            PLLVTGGGGYTKENVARCW  ETGVLLD+ELPNEIP+N+Y KYF PDYSLKIP G+I  E
Sbjct  291  PLLVTGGGGYTKENVARCWVVETGVLLDTELPNEIPENEYFKYFAPDYSLKIPRGNIVLE  350

Query  374  NLNSKSYLGTIKSHVLENLRYIQHAPSVQMQEV  276
            NLNSKSYL  IK  VLENLR IQHAPSVQMQEV
Sbjct  351  NLNSKSYLSAIKVQVLENLRNIQHAPSVQMQEV  383



>gb|KCW50789.1| hypothetical protein EUGRSUZ_J00456 [Eucalyptus grandis]
Length=405

 Score =   253 bits (647),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 126/153 (82%), Positives = 133/153 (87%), Gaps = 2/153 (1%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  F   +  IISKVVETY PGAIVLQCGADSLAGDRLGCFNLSIDGH+ECVRFVKKFN+
Sbjct  231  DTSFTRLFKAIISKVVETYQPGAIVLQCGADSLAGDRLGCFNLSIDGHSECVRFVKKFNL  290

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHI--E  375
            PLLVTGGGGYTKENVARCW  ETGVLLD+ELPNEIP+N+Y KYF PDYSLKIP G+I  E
Sbjct  291  PLLVTGGGGYTKENVARCWVVETGVLLDTELPNEIPENEYFKYFAPDYSLKIPRGNIVLE  350

Query  374  NLNSKSYLGTIKSHVLENLRYIQHAPSVQMQEV  276
            NLNSKSYL  IK  VLENLR IQHAPSVQMQEV
Sbjct  351  NLNSKSYLSAIKVQVLENLRNIQHAPSVQMQEV  383



>ref|XP_007015911.1| Histone deacetylase 9 isoform 8, partial [Theobroma cacao]
 gb|EOY33530.1| Histone deacetylase 9 isoform 8, partial [Theobroma cacao]
Length=394

 Score =   250 bits (639),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 122/151 (81%), Positives = 129/151 (85%), Gaps = 0/151 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  F   +  IISKVVE Y PGAIVLQCGADSLAGDRLGCFNLSIDGHAECVR VKKFN+
Sbjct  169  DTSFTRLFKTIISKVVEMYQPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRIVKKFNL  228

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            PLLVTGGGGYTKENVARCW  ETGVLLD+ELPNEIP+N+YIKYF P+  L IP GHIENL
Sbjct  229  PLLVTGGGGYTKENVARCWTVETGVLLDTELPNEIPENEYIKYFAPECLLNIPNGHIENL  288

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEV  276
            NSKSY+ TIK  VLENLR IQHAP VQMQEV
Sbjct  289  NSKSYISTIKMQVLENLRCIQHAPGVQMQEV  319



>ref|XP_007015906.1| Histone deacetylase 9 isoform 3 [Theobroma cacao]
 ref|XP_007015909.1| Histone deacetylase 9 isoform 3 [Theobroma cacao]
 gb|EOY33525.1| Histone deacetylase 9 isoform 3 [Theobroma cacao]
 gb|EOY33528.1| Histone deacetylase 9 isoform 3 [Theobroma cacao]
Length=456

 Score =   250 bits (638),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 122/151 (81%), Positives = 129/151 (85%), Gaps = 0/151 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  F   +  IISKVVE Y PGAIVLQCGADSLAGDRLGCFNLSIDGHAECVR VKKFN+
Sbjct  231  DTSFTRLFKTIISKVVEMYQPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRIVKKFNL  290

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            PLLVTGGGGYTKENVARCW  ETGVLLD+ELPNEIP+N+YIKYF P+  L IP GHIENL
Sbjct  291  PLLVTGGGGYTKENVARCWTVETGVLLDTELPNEIPENEYIKYFAPECLLNIPNGHIENL  350

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEV  276
            NSKSY+ TIK  VLENLR IQHAP VQMQEV
Sbjct  351  NSKSYISTIKMQVLENLRCIQHAPGVQMQEV  381



>ref|XP_003060152.1| histone deacetylase [Micromonas pusilla CCMP1545]
 gb|EEH56104.1| histone deacetylase [Micromonas pusilla CCMP1545]
Length=430

 Score =   226 bits (576),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 105/173 (61%), Positives = 133/173 (77%), Gaps = 3/173 (2%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D GF A +  ++ KV++ Y PGA+VLQCGADSLA DRLGCFNL++DGHA+CV+F+K+FN+
Sbjct  232  DAGFRAIFKSVMQKVMDVYQPGAVVLQCGADSLAADRLGCFNLTLDGHADCVKFMKRFNV  291

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPD--YSLKI-PGGHI  378
            PLLVTGGGGYTK NVARCW YET  LLD  L  +IP++D+   +  D  Y +K+ P  +I
Sbjct  292  PLLVTGGGGYTKSNVARCWTYETAALLDKTLSTDIPEHDFYYEYYADVGYKMKVQPTNYI  351

Query  377  ENLNSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDER  219
            ENLN+K+YL  +K  V+ENLR ++HAP V M EVPPD  IP+FDED  NPDER
Sbjct  352  ENLNTKTYLQDVKQQVMENLRALEHAPGVGMHEVPPDSMIPEFDEDELNPDER  404



>ref|NP_190052.1| histone deacetylase 10 [Arabidopsis thaliana]
 sp|Q9M1N8.1|HDA10_ARATH RecName: Full=Putative histone deacetylase 10 [Arabidopsis thaliana]
 emb|CAB72468.1| putative protein [Arabidopsis thaliana]
 gb|AEE77927.1| histone deacetylase 10 [Arabidopsis thaliana]
Length=142

 Score =   214 bits (546),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 101/143 (71%), Positives = 114/143 (80%), Gaps = 16/143 (11%)
 Frame = -3

Query  611  CFNLSIDGHAECVRFVKKFNIPLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDND  432
             F++   GHAEC                GGYTKENVARCW  ETG+LLD+ELPNEIP+ND
Sbjct  2    AFSMLFTGHAEC----------------GGYTKENVARCWTVETGILLDTELPNEIPEND  45

Query  431  YIKYFGPDYSLKIPGGHIENLNSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPD  252
            YIKYF PD+SLKIPGGHIENLN+KSY+ +IK  +LENLRYIQHAPSVQMQEVPPDFYIPD
Sbjct  46   YIKYFAPDFSLKIPGGHIENLNTKSYISSIKVQILENLRYIQHAPSVQMQEVPPDFYIPD  105

Query  251  FDEDTQNPDERLDQHTQDKQIQR  183
            FDED QNPD R+DQ ++DKQIQR
Sbjct  106  FDEDEQNPDVRVDQRSRDKQIQR  128



>ref|XP_002504208.1| histone deacetylase [Micromonas sp. RCC299]
 gb|ACO65466.1| histone deacetylase [Micromonas sp. RCC299]
Length=430

 Score =   222 bits (565),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 112/186 (60%), Positives = 139/186 (75%), Gaps = 4/186 (2%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D GF   +  ++ KV++ Y PGAIVLQCGADSLA DRLGCFNLS+DGHA+CV+F+KKF +
Sbjct  232  DDGFQDIFQTVMQKVMDVYRPGAIVLQCGADSLAADRLGCFNLSLDGHADCVKFMKKFGV  291

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDND-YIKYFG-PDYSLKI-PGGHI  378
            PLLVTGGGGYTK NV+RCW  ET VLLD +LP +IP++D Y +Y+   DY LK+ P  +I
Sbjct  292  PLLVTGGGGYTKSNVSRCWTNETAVLLDRKLPKDIPEHDFYYEYYADQDYKLKVEPTNYI  351

Query  377  ENLNSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERL-DQHTQ  201
            ENLN+K+Y+  +K  V+ENLR I+HAP V M EVPPD  IP+FDED  N DER   Q   
Sbjct  352  ENLNNKTYVHEVKKEVMENLRAIEHAPGVAMHEVPPDSMIPEFDEDDLNYDERYGGQFGL  411

Query  200  DKQIQR  183
            DK + R
Sbjct  412  DKIVDR  417



>ref|XP_005652289.1| class I RPD3 type histone deacetylase protein [Coccomyxa subellipsoidea 
C-169]
 gb|EIE27745.1| class I RPD3 type histone deacetylase protein [Coccomyxa subellipsoidea 
C-169]
Length=428

 Score =   218 bits (555),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 102/184 (55%), Positives = 135/184 (73%), Gaps = 2/184 (1%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  F   +  I++KV+E + PGA+VLQCGADSLA DRLGCFNLS++GHAE VRF+KKFN+
Sbjct  231  DATFHRLFKPIMAKVMEVFSPGAVVLQCGADSLAADRLGCFNLSLEGHAEAVRFMKKFNV  290

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKI-PGGHIEN  372
            P+LVTGGGGYTK NV+RCW  ET VL+D  + +++P NDY +Y+ PDY L + P  H++N
Sbjct  291  PMLVTGGGGYTKNNVSRCWTAETAVLVDQNIADDLPPNDYYEYYAPDYRLHVTPHRHMDN  350

Query  371  LNSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFD-EDTQNPDERLDQHTQDK  195
             N+K  +  IK  VLENLR + H PSVQM E PPD Y+P++D E+ +N D RL ++  D 
Sbjct  351  NNAKPDIERIKREVLENLRELAHTPSVQMHEAPPDTYVPEYDIEEEENADVRLGKYACDH  410

Query  194  QIQR  183
             + R
Sbjct  411  LVVR  414



>ref|XP_001162233.1| PREDICTED: histone deacetylase 1 isoform X3 [Pan troglodytes]
Length=453

 Score =   216 bits (551),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 101/182 (55%), Positives = 133/182 (73%), Gaps = 3/182 (2%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  + A +  ++SKV+E + P A+VLQCG+DSL+GDRLGCFNL+I GHA+CV FVK FN+
Sbjct  205  DESYEAIFKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNL  264

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            P+L+ GGGGYT  NVARCW YET V LD+E+PNE+P NDY +YFGPD+ L I   ++ N 
Sbjct  265  PMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQ  324

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPD--FDEDTQNPDERLDQHTQDK  195
            N+  YL  IK  + ENLR + HAP VQMQ +P D  IP+   DED ++PD+R+   + DK
Sbjct  325  NTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPED-AIPEESGDEDKEDPDKRISICSSDK  383

Query  194  QI  189
            +I
Sbjct  384  RI  385



>ref|XP_010227570.1| PREDICTED: probable histone deacetylase 19 isoform X2 [Brachypodium 
distachyon]
Length=499

 Score =   217 bits (553),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 100/181 (55%), Positives = 134/181 (74%), Gaps = 3/181 (2%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  + + +  I+ KV+E + PGA+VLQCGADSL+GDRLGCFNLSI GHAECVRF++ FN+
Sbjct  246  DESYQSLFKPIMGKVMEIFRPGAVVLQCGADSLSGDRLGCFNLSIKGHAECVRFMRSFNV  305

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            P+L+ GGGGYT  NVARCW YETGV L  EL +++P N+Y +YFGPDY+L +   ++EN 
Sbjct  306  PVLLLGGGGYTIRNVARCWCYETGVALGHELTDKMPLNEYYEYFGPDYTLHVAPSNMENK  365

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQI  189
            N+   L  I+S +L+NL  ++HAPSVQ QE PP+  +P+ DED +NPDER   H  D  +
Sbjct  366  NTNRQLDEIRSRLLDNLTKLRHAPSVQFQERPPEAELPEQDEDQENPDER---HHADSDV  422

Query  188  Q  186
            +
Sbjct  423  E  423



>ref|XP_003563706.1| PREDICTED: probable histone deacetylase 19 isoform X1 [Brachypodium 
distachyon]
Length=521

 Score =   217 bits (553),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 100/181 (55%), Positives = 134/181 (74%), Gaps = 3/181 (2%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  + + +  I+ KV+E + PGA+VLQCGADSL+GDRLGCFNLSI GHAECVRF++ FN+
Sbjct  246  DESYQSLFKPIMGKVMEIFRPGAVVLQCGADSLSGDRLGCFNLSIKGHAECVRFMRSFNV  305

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            P+L+ GGGGYT  NVARCW YETGV L  EL +++P N+Y +YFGPDY+L +   ++EN 
Sbjct  306  PVLLLGGGGYTIRNVARCWCYETGVALGHELTDKMPLNEYYEYFGPDYTLHVAPSNMENK  365

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQI  189
            N+   L  I+S +L+NL  ++HAPSVQ QE PP+  +P+ DED +NPDER   H  D  +
Sbjct  366  NTNRQLDEIRSRLLDNLTKLRHAPSVQFQERPPEAELPEQDEDQENPDER---HHADSDV  422

Query  188  Q  186
            +
Sbjct  423  E  423



>gb|EMS54283.1| putative histone deacetylase 19 [Triticum urartu]
Length=529

 Score =   217 bits (553),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 101/181 (56%), Positives = 134/181 (74%), Gaps = 3/181 (2%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  + + +  I+ KV+E + PGA+VLQCGADSL+GDRLGCFNLSI GHAECVRF++ FN+
Sbjct  182  DESYQSLFKPIMGKVMEIFRPGAVVLQCGADSLSGDRLGCFNLSIKGHAECVRFMRSFNV  241

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            P+L+ GGGGYT  NVARCW YETGV L  EL +++P N+Y +YFGPDY+L +   ++EN 
Sbjct  242  PVLLLGGGGYTIRNVARCWCYETGVALGHELTDKMPLNEYYEYFGPDYTLHVAPSNMENK  301

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQI  189
            N+  +L  I+S +LENL  ++HAPSVQ QE PP+   P+ DED +NPDER   H  D  +
Sbjct  302  NTHRHLDEIRSRLLENLTKLRHAPSVQFQERPPEAEQPEQDEDQENPDER---HHADSDV  358

Query  188  Q  186
            +
Sbjct  359  E  359



>ref|XP_010028889.1| PREDICTED: histone deacetylase 19 isoform X1 [Eucalyptus grandis]
 gb|KCW55716.1| hypothetical protein EUGRSUZ_I01553 [Eucalyptus grandis]
 gb|KCW55717.1| hypothetical protein EUGRSUZ_I01553 [Eucalyptus grandis]
 gb|KCW55718.1| hypothetical protein EUGRSUZ_I01553 [Eucalyptus grandis]
 gb|KCW55719.1| hypothetical protein EUGRSUZ_I01553 [Eucalyptus grandis]
Length=499

 Score =   216 bits (551),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 99/172 (58%), Positives = 131/172 (76%), Gaps = 0/172 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  + + +  II KV+E + PGA+VLQCGADSL+GDRLGCFNLSI GHAECVR+++ FN+
Sbjct  242  DESYHSLFKPIIGKVMEVFKPGAVVLQCGADSLSGDRLGCFNLSIKGHAECVRYMRSFNV  301

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            P+L+ GGGGYT  NVARCW YETGV L  E+ +++P ++Y +YFGPDY+L +   ++EN 
Sbjct  302  PVLLLGGGGYTIRNVARCWCYETGVALGLEVDDKMPQHEYYEYFGPDYTLHVAPSNMENK  361

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLD  213
            NS+  L  I+S +LENL  +QHAPSV  QE PPD  +P+ DED ++PDER D
Sbjct  362  NSRQLLEEIRSKLLENLSKLQHAPSVPFQERPPDTELPEADEDQEDPDERWD  413



>ref|XP_519834.2| PREDICTED: histone deacetylase 1 isoform X1 [Pan troglodytes]
Length=482

 Score =   216 bits (549),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 101/182 (55%), Positives = 133/182 (73%), Gaps = 3/182 (2%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  + A +  ++SKV+E + P A+VLQCG+DSL+GDRLGCFNL+I GHA+CV FVK FN+
Sbjct  234  DESYEAIFKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNL  293

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            P+L+ GGGGYT  NVARCW YET V LD+E+PNE+P NDY +YFGPD+ L I   ++ N 
Sbjct  294  PMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQ  353

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPD--FDEDTQNPDERLDQHTQDK  195
            N+  YL  IK  + ENLR + HAP VQMQ +P D  IP+   DED ++PD+R+   + DK
Sbjct  354  NTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPEDA-IPEESGDEDKEDPDKRISICSSDK  412

Query  194  QI  189
            +I
Sbjct  413  RI  414



>ref|XP_010028890.1| PREDICTED: histone deacetylase 19 isoform X2 [Eucalyptus grandis]
Length=458

 Score =   215 bits (548),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 99/172 (58%), Positives = 131/172 (76%), Gaps = 0/172 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  + + +  II KV+E + PGA+VLQCGADSL+GDRLGCFNLSI GHAECVR+++ FN+
Sbjct  242  DESYHSLFKPIIGKVMEVFKPGAVVLQCGADSLSGDRLGCFNLSIKGHAECVRYMRSFNV  301

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            P+L+ GGGGYT  NVARCW YETGV L  E+ +++P ++Y +YFGPDY+L +   ++EN 
Sbjct  302  PVLLLGGGGYTIRNVARCWCYETGVALGLEVDDKMPQHEYYEYFGPDYTLHVAPSNMENK  361

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLD  213
            NS+  L  I+S +LENL  +QHAPSV  QE PPD  +P+ DED ++PDER D
Sbjct  362  NSRQLLEEIRSKLLENLSKLQHAPSVPFQERPPDTELPEADEDQEDPDERWD  413



>ref|XP_009451191.1| PREDICTED: histone deacetylase 1 isoform X2 [Pan troglodytes]
Length=476

 Score =   215 bits (548),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 101/182 (55%), Positives = 133/182 (73%), Gaps = 3/182 (2%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  + A +  ++SKV+E + P A+VLQCG+DSL+GDRLGCFNL+I GHA+CV FVK FN+
Sbjct  234  DESYEAIFKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNL  293

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            P+L+ GGGGYT  NVARCW YET V LD+E+PNE+P NDY +YFGPD+ L I   ++ N 
Sbjct  294  PMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQ  353

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPD--FDEDTQNPDERLDQHTQDK  195
            N+  YL  IK  + ENLR + HAP VQMQ +P D  IP+   DED ++PD+R+   + DK
Sbjct  354  NTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPEDA-IPEESGDEDKEDPDKRISICSSDK  412

Query  194  QI  189
            +I
Sbjct  413  RI  414



>ref|XP_009389921.1| PREDICTED: probable histone deacetylase 19 [Musa acuminata subsp. 
malaccensis]
Length=516

 Score =   215 bits (548),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 97/172 (56%), Positives = 131/172 (76%), Gaps = 0/172 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  + + +  I+ KV+E + PGA+VLQCGADSL+GDRLGCFNLSI GHAECVR+++ FN+
Sbjct  243  DESYQSLFRPIMGKVMEVFRPGAVVLQCGADSLSGDRLGCFNLSIRGHAECVRYMRSFNV  302

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            PLL+ GGGGYT  NVARCW YETGV L  E+ +++P ++Y +YFGPDY+L +   ++EN 
Sbjct  303  PLLLVGGGGYTIRNVARCWCYETGVALGIEVDDKMPQHEYYEYFGPDYTLHVAPSNMENK  362

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLD  213
            NS+  L  I++ +L+NL  ++HAPSVQ QE PPD   P+ DED ++PDER D
Sbjct  363  NSRQQLDEIRARLLDNLSKLRHAPSVQFQERPPDTEFPEPDEDQEDPDERHD  414



>ref|XP_008809711.1| PREDICTED: probable histone deacetylase 19 [Phoenix dactylifera]
Length=515

 Score =   215 bits (547),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 97/172 (56%), Positives = 131/172 (76%), Gaps = 0/172 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  + + +  II KV+E + PGA+VLQCGADSL+GDRLGCFNLSI GHAECVRF++ FN+
Sbjct  242  DESYQSLFKPIIGKVMEVFRPGAVVLQCGADSLSGDRLGCFNLSIKGHAECVRFMRSFNV  301

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            P+L+ GGGGYT  NVARCW YETGV L  E+ +++P ++Y +YFGPDY+L +   ++EN 
Sbjct  302  PVLLLGGGGYTIRNVARCWCYETGVALGIEIDDKMPQHEYYEYFGPDYTLHVAPSNMENK  361

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLD  213
            N++  L  I++ +L+NL  ++HAPSVQ QE PPD   P+ DED ++PDER D
Sbjct  362  NTRQQLDEIRAKLLDNLSKLRHAPSVQFQERPPDAEFPEPDEDLEDPDERHD  413



>gb|AFK48350.1| unknown [Lotus japonicus]
Length=297

 Score =   209 bits (532),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 94/162 (58%), Positives = 124/162 (77%), Gaps = 0/162 (0%)
 Frame = -3

Query  698  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  519
            ++ KV+E + PGA+VLQCGADSL+GDRLGCFNLSI GHAECVR+++ FN+PLL+ GGGGY
Sbjct  51   LVGKVMEVFKPGAVVLQCGADSLSGDRLGCFNLSIKGHAECVRYMRSFNVPLLLVGGGGY  110

Query  518  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  339
            T  NVARCW YETGV L  E+ +++P ++Y +YFGPDY+L +   ++EN NS   L  ++
Sbjct  111  TIRNVARCWCYETGVALGIEVDDKMPQHEYYEYFGPDYTLHVAPSNMENKNSHHLLEEVR  170

Query  338  SHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLD  213
            S +LENL  +QHAPS Q QE PPD+ + + DED  + DER D
Sbjct  171  SKLLENLSKLQHAPSAQFQERPPDYDLGEADEDHDDGDERWD  212



>ref|XP_006158173.1| PREDICTED: histone deacetylase 1 [Tupaia chinensis]
Length=481

 Score =   214 bits (545),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 98/180 (54%), Positives = 128/180 (71%), Gaps = 0/180 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  + A +  + SKV+E + P A+VLQCG+DSL+GDRLGCFNL+I GHA+CV FVK FN+
Sbjct  234  DESYEAIFKPVTSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNL  293

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            P+L+ GGGGYT  NVARCW YET V LD+E+PNE+P NDY +YFGPD+ L I   ++ N 
Sbjct  294  PMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQ  353

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQI  189
            N+  YL  IK  + ENLR + HAP VQMQ +P D    +  ED  +PD+R+   + DK+I
Sbjct  354  NTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPEDAVPEESGEDEDDPDKRISICSSDKRI  413



>ref|XP_011099710.1| PREDICTED: histone deacetylase 19 isoform X2 [Sesamum indicum]
 ref|XP_011099711.1| PREDICTED: histone deacetylase 19 isoform X2 [Sesamum indicum]
Length=464

 Score =   214 bits (544),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 98/170 (58%), Positives = 128/170 (75%), Gaps = 0/170 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  + + +  IISKV+E + PGA+VLQCGADSL+GDRLGCFNLS+ GHAECVRF++ FN+
Sbjct  205  DESYQSLFKPIISKVMEVFRPGAVVLQCGADSLSGDRLGCFNLSVKGHAECVRFMRSFNV  264

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            PLL+ GGGGYT  NVARCW YETGV L  E+ +++P ++YI+YFGP+Y+L +   ++EN 
Sbjct  265  PLLLVGGGGYTIRNVARCWCYETGVALGIEVDDKMPQHEYIEYFGPEYTLHVAPSNMENK  324

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDER  219
            NS+  L  I+  +L+NL  +QHAPSVQ QE PPD    + DED  N DER
Sbjct  325  NSRELLEHIRVKLLDNLSKLQHAPSVQFQERPPDTQFLEADEDEDNKDER  374



>gb|KDO51346.1| hypothetical protein CISIN_1g0130382mg, partial [Citrus sinensis]
Length=162

 Score =   204 bits (519),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 96/117 (82%), Positives = 104/117 (89%), Gaps = 0/117 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  F   +  IISKVVETY PGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFN+
Sbjct  22   DTSFTRLFKTIISKVVETYAPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNL  81

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHI  378
            PLLVTGGGGYTKENVARCW  ETG+LLD+ELPNEIP+N+YIKYF P+ SL+IP GHI
Sbjct  82   PLLVTGGGGYTKENVARCWTVETGILLDTELPNEIPENEYIKYFAPECSLRIPNGHI  138



>ref|XP_011260199.1| PREDICTED: histone deacetylase Rpd3 [Camponotus floridanus]
Length=460

 Score =   213 bits (542),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 101/183 (55%), Positives = 130/183 (71%), Gaps = 2/183 (1%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  + + ++ IISKV+ET+ P A+VLQCGADSL GDRLGCFNL++ GH +CV FVK++N+
Sbjct  231  DESYESIFVPIISKVMETFQPSAVVLQCGADSLTGDRLGCFNLTVKGHGKCVEFVKRYNL  290

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            P L+ GGGGYT  NV+RCW YET V L SE+ NE+P NDY +YFGPD+ L I   ++ N 
Sbjct  291  PFLMVGGGGYTIRNVSRCWTYETSVALGSEIANELPYNDYFEYFGPDFKLHISPSNMTNQ  350

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDF--DEDTQNPDERLDQHTQDK  195
            N+  YL  IK+ + ENLR + HAP VQ+Q +P D  I D    E+  N DERL QH  DK
Sbjct  351  NTPEYLEKIKTRLFENLRMLPHAPGVQVQAIPEDGAIVDVFEPEEKMNLDERLSQHDLDK  410

Query  194  QIQ  186
            +IQ
Sbjct  411  RIQ  413



>ref|XP_010881163.1| PREDICTED: histone deacetylase 2 [Esox lucius]
Length=489

 Score =   214 bits (544),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 96/172 (56%), Positives = 128/172 (74%), Gaps = 3/172 (2%)
 Frame = -3

Query  698  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  519
            +++KV+E Y P A+VLQCGADSL+GDRLGCFNL+I GHA+CV ++K FN+P+L+ GGGGY
Sbjct  246  VMAKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTIRGHAKCVEYIKSFNLPMLMLGGGGY  305

Query  518  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  339
            T  NVARCW YET V LD+E+P+E+P NDY +YFGPD+ L I   ++ N N+  Y+  IK
Sbjct  306  TIRNVARCWTYETAVALDTEIPDELPYNDYFEYFGPDFKLHISPSNMTNQNTSEYMDKIK  365

Query  338  SHVLENLRYIQHAPSVQMQEVPPDFYIPD--FDEDTQNPDERLDQHTQDKQI  189
              + ENLR + HAP VQM  +P D  +PD   DEDT++PD+R+     DK+I
Sbjct  366  QRLFENLRMLPHAPGVQMHAIPEDA-VPDDIADEDTEDPDKRVSIRASDKRI  416



>ref|XP_002424887.1| histone deacetylase RPD3, putative [Pediculus humanus corporis]
 gb|EEB12149.1| histone deacetylase RPD3, putative [Pediculus humanus corporis]
Length=340

 Score =   209 bits (531),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 97/178 (54%), Positives = 127/178 (71%), Gaps = 1/178 (1%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  + + ++ IISKV+ET+ P A+VLQCGADSL GDRLGCFNL++ GH +CV FVKK+ +
Sbjct  134  DESYESIFVPIISKVMETFQPSAVVLQCGADSLTGDRLGCFNLTVRGHGKCVEFVKKYGM  193

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            P L+ GGGGYT  NV+RCW YET V L +E+ NE+P NDY +YFGPD+ L I   ++ N 
Sbjct  194  PFLMVGGGGYTIRNVSRCWTYETSVALGTEIANELPYNDYFEYFGPDFKLHISPSNMANQ  253

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPD-FYIPDFDEDTQNPDERLDQHTQD  198
            N+  YL  IK+ + ENLR + HAP VQ+Q +P D  +  + DED  NPDERL Q  +D
Sbjct  254  NTPEYLEKIKTRLFENLRMLPHAPGVQVQAIPEDGVHESEEDEDKVNPDERLPQSEKD  311



>ref|XP_010008493.1| PREDICTED: histone deacetylase 1, partial [Nestor notabilis]
 gb|KFQ41826.1| Histone deacetylase 1, partial [Nestor notabilis]
Length=268

 Score =   206 bits (525),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 92/154 (60%), Positives = 116/154 (75%), Gaps = 0/154 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  + A +  +ISKV+ET+ P A+VLQCG+DSL+GDRLGCFNL+I GHA+CV FVK FN+
Sbjct  22   DESYEAIFKPVISKVMETFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNL  81

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            P+L+ GGGGYT  NVARCW YET V LD+E+PNE+P NDY +YFGPD+ L I   ++ N 
Sbjct  82   PMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQ  141

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPD  267
            N+  YL  IK  + ENLR + HAP VQMQ +P D
Sbjct  142  NTNEYLEKIKQRLFENLRMLPHAPGVQMQPIPED  175



>ref|XP_011099707.1| PREDICTED: histone deacetylase 19 isoform X1 [Sesamum indicum]
 ref|XP_011099708.1| PREDICTED: histone deacetylase 19 isoform X1 [Sesamum indicum]
 ref|XP_011099709.1| PREDICTED: histone deacetylase 19 isoform X1 [Sesamum indicum]
Length=501

 Score =   213 bits (542),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 98/170 (58%), Positives = 128/170 (75%), Gaps = 0/170 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  + + +  IISKV+E + PGA+VLQCGADSL+GDRLGCFNLS+ GHAECVRF++ FN+
Sbjct  242  DESYQSLFKPIISKVMEVFRPGAVVLQCGADSLSGDRLGCFNLSVKGHAECVRFMRSFNV  301

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            PLL+ GGGGYT  NVARCW YETGV L  E+ +++P ++YI+YFGP+Y+L +   ++EN 
Sbjct  302  PLLLVGGGGYTIRNVARCWCYETGVALGIEVDDKMPQHEYIEYFGPEYTLHVAPSNMENK  361

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDER  219
            NS+  L  I+  +L+NL  +QHAPSVQ QE PPD    + DED  N DER
Sbjct  362  NSRELLEHIRVKLLDNLSKLQHAPSVQFQERPPDTQFLEADEDEDNKDER  411



>ref|XP_008482135.1| PREDICTED: histone deacetylase Rpd3-like [Diaphorina citri]
Length=420

 Score =   210 bits (535),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 99/183 (54%), Positives = 130/183 (71%), Gaps = 3/183 (2%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  + + ++ IISKV+ET+ P A+VLQCGADSL GDRLGCFNL++ GH +CV FVK++N+
Sbjct  144  DESYESIFVPIISKVMETFQPSAVVLQCGADSLTGDRLGCFNLTVRGHGKCVEFVKRYNL  203

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            P L+ GGGGYT  NV+RCW YET V L SE+ NE+P NDY +YFGPD+ L I   ++ N 
Sbjct  204  PFLMVGGGGYTIRNVSRCWTYETSVALGSEIANELPYNDYFEYFGPDFKLHISPSNMANQ  263

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDF---DEDTQNPDERLDQHTQD  198
            N+  YL  IK+ + ENLR + HAP VQ+Q +P D    D    DED ++PDER  Q  +D
Sbjct  264  NTPEYLEKIKTRLFENLRMLPHAPGVQVQAIPEDGIRDDSAGEDEDKESPDERNPQSVRD  323

Query  197  KQI  189
            K+I
Sbjct  324  KRI  326



>ref|XP_394976.4| PREDICTED: histone deacetylase Rpd3 isoform 1 [Apis mellifera]
 ref|XP_006617807.1| PREDICTED: histone deacetylase Rpd3-like [Apis dorsata]
Length=492

 Score =   212 bits (539),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 102/183 (56%), Positives = 131/183 (72%), Gaps = 2/183 (1%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  + + ++ IISKV+ET+ P A+VLQCGADSL GDRLGCFNL++ GH +CV FVKK+N+
Sbjct  234  DESYESIFVPIISKVMETFQPSAVVLQCGADSLTGDRLGCFNLTVRGHGKCVEFVKKYNL  293

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            P L+ GGGGYT  NV+RCW YET V L SE+ NE+P NDY +YFGPD+ L I   ++ N 
Sbjct  294  PFLMVGGGGYTIRNVSRCWTYETSVALGSEIANELPYNDYFEYFGPDFKLHISPSNMANQ  353

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPD-FYIPDFD-EDTQNPDERLDQHTQDK  195
            N+  YL  IK+ + ENLR + HAP VQ+Q +P D   I D + E+  NPDERL Q   DK
Sbjct  354  NTPEYLEKIKTRLFENLRMLPHAPGVQVQSIPEDGAVIEDSEAEEKVNPDERLPQRDLDK  413

Query  194  QIQ  186
            +IQ
Sbjct  414  RIQ  416



>ref|XP_003690250.1| PREDICTED: histone deacetylase Rpd3-like, partial [Apis florea]
Length=486

 Score =   211 bits (538),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 102/183 (56%), Positives = 131/183 (72%), Gaps = 2/183 (1%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  + + ++ IISKV+ET+ P A+VLQCGADSL GDRLGCFNL++ GH +CV FVKK+N+
Sbjct  228  DESYESIFVPIISKVMETFQPSAVVLQCGADSLTGDRLGCFNLTVRGHGKCVEFVKKYNL  287

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            P L+ GGGGYT  NV+RCW YET V L SE+ NE+P NDY +YFGPD+ L I   ++ N 
Sbjct  288  PFLMVGGGGYTIRNVSRCWTYETSVALGSEIANELPYNDYFEYFGPDFKLHISPSNMANQ  347

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPD-FYIPDFD-EDTQNPDERLDQHTQDK  195
            N+  YL  IK+ + ENLR + HAP VQ+Q +P D   I D + E+  NPDERL Q   DK
Sbjct  348  NTPEYLEKIKTRLFENLRMLPHAPGVQVQSIPEDGAVIEDSEAEEKVNPDERLPQRDLDK  407

Query  194  QIQ  186
            +IQ
Sbjct  408  RIQ  410



>gb|ELW48624.1| Histone deacetylase 1 [Tupaia chinensis]
Length=509

 Score =   212 bits (540),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 96/170 (56%), Positives = 124/170 (73%), Gaps = 0/170 (0%)
 Frame = -3

Query  698  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  519
            + SKV+E + P A+VLQCG+DSL+GDRLGCFNL+I GHA+CV FVK FN+P+L+ GGGGY
Sbjct  272  VTSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGY  331

Query  518  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  339
            T  NVARCW YET V LD+E+PNE+P NDY +YFGPD+ L I   ++ N N+  YL  IK
Sbjct  332  TIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIK  391

Query  338  SHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQI  189
              + ENLR + HAP VQMQ +P D    +  ED  +PD+R+   + DK+I
Sbjct  392  QRLFENLRMLPHAPGVQMQAIPEDAVPEESGEDEDDPDKRISICSSDKRI  441



>ref|XP_004225492.1| PREDICTED: LOW QUALITY PROTEIN: histone deacetylase 1-like [Ciona 
intestinalis]
Length=569

 Score =   213 bits (543),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 95/173 (55%), Positives = 126/173 (73%), Gaps = 1/173 (1%)
 Frame = -3

Query  698  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  519
            +I+KV+E Y P A+VLQCGADSL GDRLGCFNL++ GHA+C+ +VKKFN+P+L+ GGGGY
Sbjct  245  VITKVMEYYQPSAVVLQCGADSLXGDRLGCFNLTVKGHAKCLEYVKKFNVPILMLGGGGY  304

Query  518  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  339
            T  NVARCW YET V L  E+PNE+P NDY +YFGPD+ L I   ++ N N+  YL  I+
Sbjct  305  TIRNVARCWTYETAVALGQEIPNELPYNDYFEYFGPDFKLHISPSNMSNQNTMEYLQKIR  364

Query  338  SHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQ-NPDERLDQHTQDKQIQR  183
              + ENLR + HAP VQMQ++PPD  +   D++   +PD++      DK+IQR
Sbjct  365  QRLFENLRMLPHAPGVQMQDIPPDAVVSGSDDEAMDDPDKKTSIRASDKRIQR  417



>ref|XP_003707550.1| PREDICTED: histone deacetylase Rpd3 [Megachile rotundata]
Length=492

 Score =   211 bits (537),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 102/183 (56%), Positives = 131/183 (72%), Gaps = 2/183 (1%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  + + ++ IISKV+ET+ P A+VLQCGADSL GDRLGCFNL++ GH +CV FVKK+N+
Sbjct  234  DESYESIFVPIISKVMETFQPSAVVLQCGADSLTGDRLGCFNLTVRGHGKCVEFVKKYNL  293

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            P L+ GGGGYT  NV+RCW YET V L SE+ NE+P NDY +YFGPD+ L I   ++ N 
Sbjct  294  PFLMVGGGGYTIRNVSRCWTYETSVALGSEIANELPYNDYFEYFGPDFKLHISPSNMANQ  353

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPD-FYIPDFD-EDTQNPDERLDQHTQDK  195
            N+  YL  IK+ + ENLR + HAP VQ+Q +P D   I D + E+  NPDERL Q   DK
Sbjct  354  NTPEYLEKIKTRLFENLRMLPHAPGVQVQPIPEDGAVIEDSEAEEKVNPDERLPQRDLDK  413

Query  194  QIQ  186
            +IQ
Sbjct  414  RIQ  416



>ref|XP_003485786.1| PREDICTED: histone deacetylase Rpd3-like [Bombus impatiens]
Length=492

 Score =   211 bits (537),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 102/183 (56%), Positives = 131/183 (72%), Gaps = 2/183 (1%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  + + ++ IISKV+ET+ P A+VLQCGADSL GDRLGCFNL++ GH +CV FVKK+N+
Sbjct  234  DESYESIFVPIISKVMETFQPSAVVLQCGADSLTGDRLGCFNLTVRGHGKCVEFVKKYNL  293

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            P L+ GGGGYT  NV+RCW YET V L SE+ NE+P NDY +YFGPD+ L I   ++ N 
Sbjct  294  PFLMVGGGGYTIRNVSRCWTYETSVALGSEIANELPYNDYFEYFGPDFKLHISPSNMANQ  353

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPD-FYIPDFD-EDTQNPDERLDQHTQDK  195
            N+  YL  IK+ + ENLR + HAP VQ+Q +P D   I D + E+  NPDERL Q   DK
Sbjct  354  NTPEYLEKIKTRLFENLRMLPHAPGVQVQPIPEDGAVIEDSEAEEKVNPDERLPQRDLDK  413

Query  194  QIQ  186
            +IQ
Sbjct  414  RIQ  416



>ref|XP_004358601.1| histone deacetylase family protein [Dictyostelium fasciculatum]
 gb|EGG20751.1| histone deacetylase family protein [Dictyostelium fasciculatum]
Length=491

 Score =   210 bits (535),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 98/180 (54%), Positives = 136/180 (76%), Gaps = 0/180 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  + + +  +I  V+++Y P A+VLQCGADSL GDRLGCFNLS+ GHA+CV F+K FN+
Sbjct  251  DQSYQSVFRPVIQSVMDSYRPEAVVLQCGADSLTGDRLGCFNLSLKGHAQCVEFMKSFNL  310

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            PL++ GGGGYT +NVARCW YET +L+D ELP+E+P NDY++Y+GPDY L I   ++EN 
Sbjct  311  PLVILGGGGYTIKNVARCWTYETSILVDHELPDELPYNDYLEYYGPDYRLHITPNNMENQ  370

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQI  189
            NSK YL  +K  +LENLR++QHAPS+   E+PPD Y    DED ++PD R+ +  +D+++
Sbjct  371  NSKDYLEKLKIQILENLRHLQHAPSIAHTEIPPDSYSYSDDEDDEDPDVRISESDRDRRV  430



>ref|NP_001161325.1| Rpd3 histone deacetylase [Nasonia vitripennis]
Length=492

 Score =   210 bits (535),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 101/183 (55%), Positives = 131/183 (72%), Gaps = 2/183 (1%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  + + ++ IISKV+ET+ P A+VLQCGADSL GDRLGCFNL++ GH +CV FVKK+N+
Sbjct  234  DDSYESIFVPIISKVMETFQPSAVVLQCGADSLTGDRLGCFNLTVRGHGKCVEFVKKYNL  293

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            P L+ GGGGYT  NV+RCW YET V L SE+ NE+P NDY +YFGPD+ L I   ++ N 
Sbjct  294  PFLMVGGGGYTIRNVSRCWTYETSVALGSEIANELPYNDYFEYFGPDFKLHISPSNMANQ  353

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPD-FYIPDFDEDTQ-NPDERLDQHTQDK  195
            N+  YL  IK+ + ENLR + HAP VQ+Q +P D   I D + D + NPDERL Q   DK
Sbjct  354  NTPEYLEKIKTRLFENLRMLPHAPGVQVQAIPEDGAVIEDSEADEKVNPDERLPQRDIDK  413

Query  194  QIQ  186
            ++Q
Sbjct  414  RLQ  416



>gb|KDR17587.1| Histone deacetylase Rpd3, partial [Zootermopsis nevadensis]
Length=426

 Score =   209 bits (531),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 99/181 (55%), Positives = 128/181 (71%), Gaps = 1/181 (1%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  + + ++ IISKV+ET+ P A+VLQCGADSL GDRLGCFNL++ GH +CV FVKK+ +
Sbjct  225  DESYESIFVPIISKVMETFQPSAVVLQCGADSLTGDRLGCFNLTVRGHGKCVEFVKKYGL  284

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            P L+ GGGGYT  NV+RCW YET V L +E+ NE+P NDY +YFGPD+ L I   ++ N 
Sbjct  285  PFLMVGGGGYTIRNVSRCWTYETSVALGTEIANELPYNDYFEYFGPDFKLHISPSNMANQ  344

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPD-FYIPDFDEDTQNPDERLDQHTQDKQ  192
            N+  YL  IK+ + ENLR + HAP VQ+Q +P D     + DED  NPDERL Q   DK+
Sbjct  345  NTPEYLEKIKTRLFENLRMLPHAPGVQVQAIPEDAVNDSEDDEDKGNPDERLTQAALDKR  404

Query  191  I  189
            I
Sbjct  405  I  405



>ref|XP_011154868.1| PREDICTED: histone deacetylase Rpd3 [Harpegnathos saltator]
 gb|EFN89982.1| Histone deacetylase Rpd3 [Harpegnathos saltator]
Length=498

 Score =   211 bits (536),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 102/183 (56%), Positives = 130/183 (71%), Gaps = 2/183 (1%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  + + ++ IISKV+ET+ P A+VLQCGADSL GDRLGCFNL++ GH +CV FVKK+N+
Sbjct  239  DESYESIFVPIISKVMETFQPSAVVLQCGADSLTGDRLGCFNLTVRGHGKCVEFVKKYNL  298

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            P L+ GGGGYT  NV+RCW YET V L  E+ NE+P NDY +YFGPD+ L I   ++ N 
Sbjct  299  PFLMVGGGGYTIRNVSRCWTYETSVALGCEIANELPYNDYFEYFGPDFKLHISPSNMANQ  358

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPD-FYIPDFD-EDTQNPDERLDQHTQDK  195
            N+  YL  IK+ + ENLR + HAP VQ+Q +P D   I D + ED  NPDERL Q   DK
Sbjct  359  NTPEYLEKIKTRLFENLRMLPHAPGVQVQAIPEDGAVIEDSEAEDKINPDERLPQRDLDK  418

Query  194  QIQ  186
            +IQ
Sbjct  419  RIQ  421



>ref|XP_011181414.1| PREDICTED: histone deacetylase Rpd3 isoform X2 [Bactrocera cucurbitae]
Length=457

 Score =   209 bits (533),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 98/181 (54%), Positives = 128/181 (71%), Gaps = 1/181 (1%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  + + ++ IISKV+ET+ P A+VLQCGADSL GDRLGCFNL++ GH +CV FVKK+N+
Sbjct  205  DEAYESIFVPIISKVMETFQPAAVVLQCGADSLTGDRLGCFNLTVKGHGKCVEFVKKYNL  264

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            P L+ GGGGYT  NV+RCW YET V L  E+ NE+P NDY +YFGPD+ L I   ++ N 
Sbjct  265  PFLMVGGGGYTIRNVSRCWTYETSVALGVEIANELPYNDYFEYFGPDFKLHISPSNMTNQ  324

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDF-DEDTQNPDERLDQHTQDKQ  192
            N+  YL  IK+ + ENLR + HAP VQ+Q +P D    +  DED  N DER+ Q  +DK+
Sbjct  325  NTSEYLEKIKNRLFENLRMLPHAPGVQIQTIPEDAINDESEDEDKVNKDERITQSDKDKR  384

Query  191  I  189
            I
Sbjct  385  I  385



>ref|XP_011494484.1| PREDICTED: histone deacetylase Rpd3 [Ceratosolen solmsi marchali]
Length=492

 Score =   209 bits (533),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 101/183 (55%), Positives = 131/183 (72%), Gaps = 2/183 (1%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  + + ++ IISKV+ET+ P A+VLQCGADSL GDRLGCFNL++ GH +CV FVKK+N+
Sbjct  234  DESYESIFVPIISKVMETFQPSAVVLQCGADSLTGDRLGCFNLTVRGHGKCVEFVKKYNL  293

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            P L+ GGGGYT  NV+RCW YET V L S++ NE+P NDY +YFGPD+ L I   ++ N 
Sbjct  294  PFLMVGGGGYTIRNVSRCWTYETSVALGSDIANELPYNDYFEYFGPDFKLHISPSNMANQ  353

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPD-FYIPDFD-EDTQNPDERLDQHTQDK  195
            N+  YL  IK+ + ENLR + HAP VQ+Q +P D   I D + E+  NPDERL Q   DK
Sbjct  354  NTPEYLEKIKTRLFENLRMLPHAPGVQVQAIPEDGAVIEDSEAEEKVNPDERLPQRDIDK  413

Query  194  QIQ  186
            +IQ
Sbjct  414  RIQ  416



>ref|XP_011204627.1| PREDICTED: histone deacetylase Rpd3 [Bactrocera dorsalis]
Length=484

 Score =   209 bits (532),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 98/181 (54%), Positives = 128/181 (71%), Gaps = 1/181 (1%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  + + ++ IISKV+ET+ P A+VLQCGADSL GDRLGCFNL++ GH +CV FVKK+N+
Sbjct  232  DEAYESIFVPIISKVMETFQPAAVVLQCGADSLTGDRLGCFNLTVKGHGKCVEFVKKYNL  291

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            P L+ GGGGYT  NV+RCW YET V L  E+ NE+P NDY +YFGPD+ L I   ++ N 
Sbjct  292  PFLMVGGGGYTIRNVSRCWTYETSVALGVEIANELPYNDYFEYFGPDFKLHISPSNMTNQ  351

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDF-DEDTQNPDERLDQHTQDKQ  192
            N+  YL  IK+ + ENLR + HAP VQ+Q +P D    +  DED  N DER+ Q  +DK+
Sbjct  352  NTSEYLEKIKNRLFENLRMLPHAPGVQIQSIPEDAINDESEDEDKVNKDERITQSDKDKR  411

Query  191  I  189
            I
Sbjct  412  I  412



>ref|XP_004519082.1| PREDICTED: histone deacetylase Rpd3-like [Ceratitis capitata]
Length=484

 Score =   209 bits (532),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 98/181 (54%), Positives = 128/181 (71%), Gaps = 1/181 (1%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  + + ++ IISKV+ET+ P A+VLQCGADSL GDRLGCFNL++ GH +CV FVKK+N+
Sbjct  232  DEAYESIFVPIISKVMETFQPAAVVLQCGADSLTGDRLGCFNLTVKGHGKCVEFVKKYNL  291

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            P L+ GGGGYT  NV+RCW YET V L  E+ NE+P NDY +YFGPD+ L I   ++ N 
Sbjct  292  PFLMVGGGGYTIRNVSRCWTYETSVALGVEIANELPYNDYFEYFGPDFKLHISPSNMTNQ  351

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDF-DEDTQNPDERLDQHTQDKQ  192
            N+  YL  IK+ + ENLR + HAP VQ+Q +P D    +  DED  N DER+ Q  +DK+
Sbjct  352  NTSEYLEKIKNRLFENLRMLPHAPGVQIQSIPEDAINDESEDEDKVNKDERIPQSDKDKR  411

Query  191  I  189
            I
Sbjct  412  I  412



>ref|XP_011334448.1| PREDICTED: histone deacetylase Rpd3-like [Cerapachys biroi]
 gb|EZA57151.1| Histone deacetylase Rpd3 [Cerapachys biroi]
Length=497

 Score =   209 bits (532),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 99/183 (54%), Positives = 129/183 (70%), Gaps = 2/183 (1%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  + + ++ IISKV+ET+ P A+VLQCGADSL GDRLGCFNL++ GH +CV FVKK+N+
Sbjct  239  DESYESIFVPIISKVMETFQPSAVVLQCGADSLTGDRLGCFNLTVRGHGKCVEFVKKYNL  298

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            P L+ GGGGYT  NV+RCW YET V L  E+ NE+P NDY +YFGPD+ L I   ++ N 
Sbjct  299  PFLMVGGGGYTIRNVSRCWTYETSVALGCEIANELPYNDYFEYFGPDFKLHISPSNMANQ  358

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQ--NPDERLDQHTQDK  195
            N+  YL  IK+ + ENLR + HAP VQ+Q +P D  + +  E  +  NPDERL Q   DK
Sbjct  359  NTPEYLEKIKTRLFENLRMLPHAPGVQVQAIPEDGAVIEDSEAEEKINPDERLPQRDLDK  418

Query  194  QIQ  186
            +IQ
Sbjct  419  RIQ  421



>ref|XP_010934971.1| PREDICTED: histone deacetylase 19-like isoform X1 [Elaeis guineensis]
Length=507

 Score =   209 bits (533),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 94/174 (54%), Positives = 128/174 (74%), Gaps = 0/174 (0%)
 Frame = -3

Query  740  VSL*DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVK  561
            + + D  + + +  I+SKV+E + PGA+VLQCGADSL+GDRLGCFNLS+ GHAECVR+++
Sbjct  240  IGMDDDSYESLFKPIVSKVMEVFRPGAVVLQCGADSLSGDRLGCFNLSVKGHAECVRYMR  299

Query  560  KFNIPLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGH  381
             FN+PLL+ GGGGYT  NVARCW YETGV L  E+ +++P N+Y  YF PDY+L     +
Sbjct  300  SFNVPLLLVGGGGYTIRNVARCWCYETGVALGIEIDDKVPPNEYQGYFAPDYTLHFAASN  359

Query  380  IENLNSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDER  219
            +EN NS+  L  I++ +L+N+  +QHAPSVQ QE P D   P+ DED Q+ +ER
Sbjct  360  MENKNSRQSLDDIRTRILDNVSKLQHAPSVQFQERPLDTEFPEEDEDQQDENER  413



>ref|XP_011311168.1| PREDICTED: histone deacetylase Rpd3 [Fopius arisanus]
Length=491

 Score =   209 bits (532),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 100/183 (55%), Positives = 128/183 (70%), Gaps = 2/183 (1%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  + + ++ IISKV+ET+ P A+VLQCGADSL GDRLGCFNL++ GH +CV FVKK+N+
Sbjct  234  DESYESIFVPIISKVMETFQPSAVVLQCGADSLTGDRLGCFNLTVRGHGKCVEFVKKYNL  293

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            P L+ GGGGYT  NV+RCW YET V L  E+ NE+P NDY +YFGPD+ L I   ++ N 
Sbjct  294  PFLMVGGGGYTIRNVSRCWTYETSVALGCEIANELPYNDYFEYFGPDFKLHISPSNMGNQ  353

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQ--NPDERLDQHTQDK  195
            N+  YL  IK+ + ENLR + HAP VQ+Q +P D    D  E  +  NPDERL Q   DK
Sbjct  354  NTVEYLEKIKTRLFENLRMLPHAPGVQVQAIPEDGATVDDSEAEEKVNPDERLPQRDLDK  413

Query  194  QIQ  186
            +IQ
Sbjct  414  RIQ  416



>gb|EFN65822.1| Histone deacetylase Rpd3 [Camponotus floridanus]
Length=494

 Score =   209 bits (532),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 100/183 (55%), Positives = 131/183 (72%), Gaps = 2/183 (1%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  + + ++ IISKV+ET+ P A+VLQCGADSL GDRLGCFNL++ GH +CV FVKK+N+
Sbjct  234  DESYESIFVPIISKVMETFQPSAVVLQCGADSLTGDRLGCFNLTVRGHGKCVEFVKKYNL  293

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            P L+ GGGGYT  NV+RCW YET V L SE+ NE+P NDY +YFGPD+ L I   ++ N 
Sbjct  294  PFLMVGGGGYTIRNVSRCWTYETSVALGSEIANELPYNDYFEYFGPDFKLHISPSNMANQ  353

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPD-FYIPDFD-EDTQNPDERLDQHTQDK  195
            N+  YL  IK+ + ENLR + HAP VQ+Q +P D   I D + E+  NPD+RL Q   DK
Sbjct  354  NTPEYLEKIKTRLFENLRMLPHAPGVQVQAIPEDGAVIEDSEAEEKVNPDDRLPQRDLDK  413

Query  194  QIQ  186
            ++Q
Sbjct  414  RMQ  416



>ref|XP_010935047.1| PREDICTED: histone deacetylase 19-like isoform X2 [Elaeis guineensis]
Length=506

 Score =   209 bits (533),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 94/174 (54%), Positives = 128/174 (74%), Gaps = 0/174 (0%)
 Frame = -3

Query  740  VSL*DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVK  561
            + + D  + + +  I+SKV+E + PGA+VLQCGADSL+GDRLGCFNLS+ GHAECVR+++
Sbjct  240  IGMDDDSYESLFKPIVSKVMEVFRPGAVVLQCGADSLSGDRLGCFNLSVKGHAECVRYMR  299

Query  560  KFNIPLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGH  381
             FN+PLL+ GGGGYT  NVARCW YETGV L  E+ +++P N+Y  YF PDY+L     +
Sbjct  300  SFNVPLLLVGGGGYTIRNVARCWCYETGVALGIEIDDKVPPNEYQGYFAPDYTLHFAASN  359

Query  380  IENLNSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDER  219
            +EN NS+  L  I++ +L+N+  +QHAPSVQ QE P D   P+ DED Q+ +ER
Sbjct  360  MENKNSRQSLDDIRTRILDNVSKLQHAPSVQFQERPLDTEFPEEDEDQQDENER  413



>ref|XP_011181413.1| PREDICTED: histone deacetylase Rpd3 isoform X1 [Bactrocera cucurbitae]
Length=484

 Score =   209 bits (531),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 98/181 (54%), Positives = 128/181 (71%), Gaps = 1/181 (1%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  + + ++ IISKV+ET+ P A+VLQCGADSL GDRLGCFNL++ GH +CV FVKK+N+
Sbjct  232  DEAYESIFVPIISKVMETFQPAAVVLQCGADSLTGDRLGCFNLTVKGHGKCVEFVKKYNL  291

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            P L+ GGGGYT  NV+RCW YET V L  E+ NE+P NDY +YFGPD+ L I   ++ N 
Sbjct  292  PFLMVGGGGYTIRNVSRCWTYETSVALGVEIANELPYNDYFEYFGPDFKLHISPSNMTNQ  351

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDF-DEDTQNPDERLDQHTQDKQ  192
            N+  YL  IK+ + ENLR + HAP VQ+Q +P D    +  DED  N DER+ Q  +DK+
Sbjct  352  NTSEYLEKIKNRLFENLRMLPHAPGVQIQTIPEDAINDESEDEDKVNKDERITQSDKDKR  411

Query  191  I  189
            I
Sbjct  412  I  412



>ref|XP_005984211.1| PREDICTED: histone deacetylase 2-like [Pantholops hodgsonii]
Length=479

 Score =   209 bits (531),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 98/171 (57%), Positives = 123/171 (72%), Gaps = 1/171 (1%)
 Frame = -3

Query  698  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  519
            IISKV+E Y P A+VLQCGADSL+GDRLG FNL++ GHA+CV  VK FN+P+L+ GGGGY
Sbjct  236  IISKVMEMYQPSAVVLQCGADSLSGDRLGWFNLTVKGHAKCVEVVKTFNLPILMLGGGGY  295

Query  518  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  339
            T  NVARCW YET V LD E+PNE+P NDY +YFGPD+ L I   ++ N N+  Y+  IK
Sbjct  296  TIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIK  355

Query  338  SHVLENLRYIQHAPSVQMQEVPPDFYIPDF-DEDTQNPDERLDQHTQDKQI  189
              + ENLR + HAP VQMQ +P D    D  DED ++PD+R+     DK+I
Sbjct  356  QRLFENLRMLPHAPGVQMQAIPEDAVHEDSGDEDGEDPDKRISIRASDKRI  406



>ref|XP_011260173.1| PREDICTED: histone deacetylase Rpd3-like [Camponotus floridanus]
Length=499

 Score =   209 bits (532),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 100/183 (55%), Positives = 131/183 (72%), Gaps = 2/183 (1%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  + + ++ IISKV+ET+ P A+VLQCGADSL GDRLGCFNL++ GH +CV FVKK+N+
Sbjct  239  DESYESIFVPIISKVMETFQPSAVVLQCGADSLTGDRLGCFNLTVRGHGKCVEFVKKYNL  298

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            P L+ GGGGYT  NV+RCW YET V L SE+ NE+P NDY +YFGPD+ L I   ++ N 
Sbjct  299  PFLMVGGGGYTIRNVSRCWTYETSVALGSEIANELPYNDYFEYFGPDFKLHISPSNMANQ  358

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPD-FYIPDFD-EDTQNPDERLDQHTQDK  195
            N+  YL  IK+ + ENLR + HAP VQ+Q +P D   I D + E+  NPD+RL Q   DK
Sbjct  359  NTPEYLEKIKTRLFENLRMLPHAPGVQVQAIPEDGAVIEDSEAEEKVNPDDRLPQRDLDK  418

Query  194  QIQ  186
            ++Q
Sbjct  419  RMQ  421



>ref|XP_011158304.1| PREDICTED: histone deacetylase Rpd3-like [Solenopsis invicta]
Length=497

 Score =   209 bits (532),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 100/183 (55%), Positives = 130/183 (71%), Gaps = 2/183 (1%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  + + ++ IISKV+ET+ P A+VLQCGADSL GDRLGCFNL++ GH +CV FVKK+N+
Sbjct  239  DDSYESIFVPIISKVMETFQPSAVVLQCGADSLTGDRLGCFNLTVRGHGKCVEFVKKYNL  298

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            P L+ GGGGYT  NV+RCW YET V L  E+ NE+P NDY +YFGPD+ L I   ++ N 
Sbjct  299  PFLMVGGGGYTIRNVSRCWTYETSVALGCEIANELPYNDYFEYFGPDFKLHISPSNMANQ  358

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPD-FYIPDFD-EDTQNPDERLDQHTQDK  195
            N+  YL  IK+ + ENLR + HAP VQ+Q +P D   I D + ED  NPD+RL Q   DK
Sbjct  359  NTPEYLDKIKTRLFENLRMLPHAPGVQVQAIPEDGAVIEDSEAEDKTNPDDRLPQRDLDK  418

Query  194  QIQ  186
            ++Q
Sbjct  419  RMQ  421



>ref|XP_011334447.1| PREDICTED: histone deacetylase Rpd3-like [Cerapachys biroi]
 gb|EZA57149.1| Histone deacetylase Rpd3 [Cerapachys biroi]
Length=493

 Score =   209 bits (531),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 99/183 (54%), Positives = 129/183 (70%), Gaps = 2/183 (1%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  + + ++ IISKV+ET+ P A+VLQCGADSL GDRLGCFNL++ GH +CV FVKK+N+
Sbjct  233  DESYESIFVPIISKVMETFQPSAVVLQCGADSLTGDRLGCFNLTVRGHGKCVEFVKKYNL  292

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            P L+ GGGGYT  NV+RCW +ET V L  E+ NE+P NDY +YFGPD+ L I   ++ N 
Sbjct  293  PFLMVGGGGYTIRNVSRCWTHETSVALGCEIANELPYNDYFEYFGPDFKLHISPSNMTNQ  352

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFD--EDTQNPDERLDQHTQDK  195
            N+  YL  IK+ + ENLR + HAP VQ+Q +P D  + D    E+  NPDERL Q   DK
Sbjct  353  NTPEYLEKIKTRLFENLRMLPHAPGVQVQAIPEDGAVIDDSEVEEKINPDERLPQRDLDK  412

Query  194  QIQ  186
            +IQ
Sbjct  413  RIQ  415



>gb|KFP83316.1| Histone deacetylase 1, partial [Acanthisitta chloris]
Length=360

 Score =   205 bits (522),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 92/154 (60%), Positives = 116/154 (75%), Gaps = 0/154 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  + A +  +ISKV+ET+ P A+VLQCG+DSL+GDRLGCFNL+I GHA+CV FVK FN+
Sbjct  132  DESYEAIFKPVISKVMETFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNL  191

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            P+L+ GGGGYT  NVARCW YET V LD+E+PNE+P NDY +YFGPD+ L I   ++ N 
Sbjct  192  PMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQ  251

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPD  267
            N+  YL  IK  + ENLR + HAP VQMQ +P D
Sbjct  252  NTNEYLEKIKQRLFENLRMLPHAPGVQMQPIPED  285



>ref|XP_011539611.1| PREDICTED: histone deacetylase 1 isoform X1 [Homo sapiens]
Length=289

 Score =   202 bits (515),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 90/154 (58%), Positives = 115/154 (75%), Gaps = 0/154 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  + A +  ++SKV+E + P A+VLQCG+DSL+GDRLGCFNL+I GHA+CV FVK FN+
Sbjct  41   DESYEAIFKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNL  100

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            P+L+ GGGGYT  NVARCW YET V LD+E+PNE+P NDY +YFGPD+ L I   ++ N 
Sbjct  101  PMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQ  160

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPD  267
            N+  YL  IK  + ENLR + HAP VQMQ +P D
Sbjct  161  NTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPED  194



>ref|XP_009202183.1| PREDICTED: histone deacetylase 1 [Papio anubis]
 ref|XP_009202188.1| PREDICTED: histone deacetylase 1 [Papio anubis]
Length=289

 Score =   202 bits (515),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 90/154 (58%), Positives = 115/154 (75%), Gaps = 0/154 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  + A +  ++SKV+E + P A+VLQCG+DSL+GDRLGCFNL+I GHA+CV FVK FN+
Sbjct  41   DESYEAIFKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNL  100

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            P+L+ GGGGYT  NVARCW YET V LD+E+PNE+P NDY +YFGPD+ L I   ++ N 
Sbjct  101  PMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQ  160

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPD  267
            N+  YL  IK  + ENLR + HAP VQMQ +P D
Sbjct  161  NTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPED  194



>ref|XP_006537073.1| PREDICTED: histone deacetylase 1 isoform X1 [Mus musculus]
 ref|XP_011238873.1| PREDICTED: histone deacetylase 1 isoform X1 [Mus musculus]
Length=289

 Score =   202 bits (515),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 90/154 (58%), Positives = 115/154 (75%), Gaps = 0/154 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  + A +  ++SKV+E + P A+VLQCG+DSL+GDRLGCFNL+I GHA+CV FVK FN+
Sbjct  41   DESYEAIFKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNL  100

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            P+L+ GGGGYT  NVARCW YET V LD+E+PNE+P NDY +YFGPD+ L I   ++ N 
Sbjct  101  PMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQ  160

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPD  267
            N+  YL  IK  + ENLR + HAP VQMQ +P D
Sbjct  161  NTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPED  194



>ref|XP_011061203.1| PREDICTED: histone deacetylase Rpd3 isoform X2 [Acromyrmex echinatior]
Length=449

 Score =   207 bits (527),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 99/183 (54%), Positives = 130/183 (71%), Gaps = 2/183 (1%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  + + ++ IISKV+ET+ P A+VLQCGADSL GDRLGCFNL++ GH +CV FVKK+N+
Sbjct  239  DDSYESIFVPIISKVMETFQPSAVVLQCGADSLTGDRLGCFNLTVRGHGKCVEFVKKYNL  298

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            P L+ GGGGYT  NV+RCW YET V L  E+ NE+P NDY +YFGPD+ L I   ++ N 
Sbjct  299  PFLMVGGGGYTIRNVSRCWTYETSVALGCEIANELPYNDYFEYFGPDFKLHISPSNMANQ  358

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPD-FYIPDFD-EDTQNPDERLDQHTQDK  195
            N+  YL  IK+ + ENLR + HAP VQ+Q +P D   I D + E+  NPD+RL Q   DK
Sbjct  359  NTPEYLDKIKTRLFENLRMLPHAPGVQVQAIPEDGAVIEDSEAEEKTNPDDRLPQRELDK  418

Query  194  QIQ  186
            ++Q
Sbjct  419  RMQ  421



>gb|KFP50838.1| Histone deacetylase 1, partial [Cathartes aura]
Length=363

 Score =   205 bits (521),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 92/154 (60%), Positives = 116/154 (75%), Gaps = 0/154 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  + A +  +ISKV+ET+ P A+VLQCG+DSL+GDRLGCFNL+I GHA+CV FVK FN+
Sbjct  142  DESYEAIFKPVISKVMETFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNL  201

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            P+L+ GGGGYT  NVARCW YET V LD+E+PNE+P NDY +YFGPD+ L I   ++ N 
Sbjct  202  PMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQ  261

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPD  267
            N+  YL  IK  + ENLR + HAP VQMQ +P D
Sbjct  262  NTNEYLEKIKQRLFENLRMLPHAPGVQMQPIPED  295



>ref|XP_011061204.1| PREDICTED: histone deacetylase Rpd3 isoform X3 [Acromyrmex echinatior]
Length=448

 Score =   207 bits (527),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 99/183 (54%), Positives = 130/183 (71%), Gaps = 2/183 (1%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  + + ++ IISKV+ET+ P A+VLQCGADSL GDRLGCFNL++ GH +CV FVKK+N+
Sbjct  239  DDSYESIFVPIISKVMETFQPSAVVLQCGADSLTGDRLGCFNLTVRGHGKCVEFVKKYNL  298

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            P L+ GGGGYT  NV+RCW YET V L  E+ NE+P NDY +YFGPD+ L I   ++ N 
Sbjct  299  PFLMVGGGGYTIRNVSRCWTYETSVALGCEIANELPYNDYFEYFGPDFKLHISPSNMANQ  358

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPD-FYIPDFD-EDTQNPDERLDQHTQDK  195
            N+  YL  IK+ + ENLR + HAP VQ+Q +P D   I D + E+  NPD+RL Q   DK
Sbjct  359  NTPEYLDKIKTRLFENLRMLPHAPGVQVQAIPEDGAVIEDSEAEEKTNPDDRLPQRELDK  418

Query  194  QIQ  186
            ++Q
Sbjct  419  RMQ  421



>ref|XP_004329860.1| PREDICTED: histone deacetylase 1-like [Tursiops truncatus]
Length=289

 Score =   202 bits (515),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 90/154 (58%), Positives = 115/154 (75%), Gaps = 0/154 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  + A +  ++SKV+E + P A+VLQCG+DSL+GDRLGCFNL+I GHA+CV FVK FN+
Sbjct  41   DESYEAIFKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNL  100

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            P+L+ GGGGYT  NVARCW YET V LD+E+PNE+P NDY +YFGPD+ L I   ++ N 
Sbjct  101  PMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQ  160

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPD  267
            N+  YL  IK  + ENLR + HAP VQMQ +P D
Sbjct  161  NTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPED  194



>ref|XP_011061205.1| PREDICTED: histone deacetylase Rpd3 isoform X4 [Acromyrmex echinatior]
Length=447

 Score =   207 bits (526),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 99/183 (54%), Positives = 130/183 (71%), Gaps = 2/183 (1%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  + + ++ IISKV+ET+ P A+VLQCGADSL GDRLGCFNL++ GH +CV FVKK+N+
Sbjct  239  DDSYESIFVPIISKVMETFQPSAVVLQCGADSLTGDRLGCFNLTVRGHGKCVEFVKKYNL  298

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            P L+ GGGGYT  NV+RCW YET V L  E+ NE+P NDY +YFGPD+ L I   ++ N 
Sbjct  299  PFLMVGGGGYTIRNVSRCWTYETSVALGCEIANELPYNDYFEYFGPDFKLHISPSNMANQ  358

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPD-FYIPDFD-EDTQNPDERLDQHTQDK  195
            N+  YL  IK+ + ENLR + HAP VQ+Q +P D   I D + E+  NPD+RL Q   DK
Sbjct  359  NTPEYLDKIKTRLFENLRMLPHAPGVQVQAIPEDGAVIEDSEAEEKTNPDDRLPQRELDK  418

Query  194  QIQ  186
            ++Q
Sbjct  419  RMQ  421



>dbj|BAG61272.1| unnamed protein product [Homo sapiens]
Length=289

 Score =   202 bits (515),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 90/154 (58%), Positives = 115/154 (75%), Gaps = 0/154 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  + A +  ++SKV+E + P A+VLQCG+DSL+GDRLGCFNL+I GHA+CV FVK FN+
Sbjct  41   DESYEAIFKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNL  100

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            P+L+ GGGGYT  NVARCW YET V LD+E+PNE+P NDY +YFGPD+ L I   ++ N 
Sbjct  101  PMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLLISPSNMTNQ  160

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPD  267
            N+  YL  IK  + ENLR + HAP VQMQ +P D
Sbjct  161  NTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPED  194



>gb|ETN61439.1| histone deacetylase [Anopheles darlingi]
Length=491

 Score =   208 bits (529),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 98/181 (54%), Positives = 128/181 (71%), Gaps = 1/181 (1%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  + + ++ IISKV+ET+ P A+VLQCGADSL GDRLGCFNL++ GH +CV FVKK+N+
Sbjct  232  DESYDSIFVPIISKVMETFQPSAVVLQCGADSLTGDRLGCFNLTVKGHGKCVEFVKKYNL  291

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            P L+ GGGGYT  NV+RCW YET V L  E+ NE+P NDY +YFGPD+ L I   ++ N 
Sbjct  292  PFLMVGGGGYTIRNVSRCWTYETSVALGVEIANELPYNDYFEYFGPDFKLHISPSNMSNQ  351

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDF-DEDTQNPDERLDQHTQDKQ  192
            N+  YL  IK+ + ENLR + HAP VQ+Q +P D    +  DED  + DERL Q  +DK+
Sbjct  352  NTTEYLEKIKNRLFENLRMLPHAPGVQVQAIPEDAVNEESEDEDKVDKDERLPQQDKDKR  411

Query  191  I  189
            I
Sbjct  412  I  412



>ref|XP_002060037.1| GJ15512 [Drosophila virilis]
 gb|EDW58248.1| GJ15512 [Drosophila virilis]
Length=527

 Score =   209 bits (531),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 99/181 (55%), Positives = 128/181 (71%), Gaps = 1/181 (1%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  + + ++ IISKV+ET+ P A+VLQCGADSL GDRLGCFNL++ GH +CV FVKK+N+
Sbjct  232  DDAYESIFVPIISKVMETFQPAAVVLQCGADSLTGDRLGCFNLTVKGHGKCVEFVKKYNL  291

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            P L+ GGGGYT  NV+RCW YET V L  E+ NE+P NDY +YFGPD+ L I   ++ N 
Sbjct  292  PFLMVGGGGYTIRNVSRCWTYETSVALAVEIANELPYNDYFEYFGPDFKLHISPSNMTNQ  351

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDF-DEDTQNPDERLDQHTQDKQ  192
            N+  YL  IKS + ENLR + HAP VQ+Q +P D    +  DED  + DERL Q  +DK+
Sbjct  352  NTAEYLEKIKSRLFENLRMLPHAPGVQIQAIPEDAINDESEDEDKVDKDERLPQSDKDKR  411

Query  191  I  189
            I
Sbjct  412  I  412



>ref|XP_001848775.1| histone deacetylase Rpd3 [Culex quinquefasciatus]
 gb|EDS29016.1| histone deacetylase Rpd3 [Culex quinquefasciatus]
Length=489

 Score =   208 bits (529),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 98/181 (54%), Positives = 128/181 (71%), Gaps = 1/181 (1%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  + + ++ IISKV+ET+ P A+VLQCGADSL GDRLGCFNL++ GH +CV FVKK+N+
Sbjct  232  DESYESIFVPIISKVMETFQPSAVVLQCGADSLTGDRLGCFNLTVKGHGKCVEFVKKYNL  291

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            P L+ GGGGYT  NV+RCW YET V L  E+ NE+P NDY +YFGPD+ L I   ++ N 
Sbjct  292  PFLMVGGGGYTIRNVSRCWTYETSVALGCEIANELPYNDYFEYFGPDFKLHISPSNMSNQ  351

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDF-DEDTQNPDERLDQHTQDKQ  192
            N+  YL  IK+ + ENLR + HAP VQ+Q +P D    +  DED  + DERL Q  +DK+
Sbjct  352  NTTEYLEKIKNRLFENLRMLPHAPGVQVQAIPEDAVNDESEDEDKVDKDERLPQTDKDKR  411

Query  191  I  189
            I
Sbjct  412  I  412



>ref|XP_009076065.1| PREDICTED: histone deacetylase 1, partial [Acanthisitta chloris]
Length=386

 Score =   205 bits (522),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 92/154 (60%), Positives = 116/154 (75%), Gaps = 0/154 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  + A +  +ISKV+ET+ P A+VLQCG+DSL+GDRLGCFNL+I GHA+CV FVK FN+
Sbjct  140  DESYEAIFKPVISKVMETFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNL  199

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            P+L+ GGGGYT  NVARCW YET V LD+E+PNE+P NDY +YFGPD+ L I   ++ N 
Sbjct  200  PMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQ  259

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPD  267
            N+  YL  IK  + ENLR + HAP VQMQ +P D
Sbjct  260  NTNEYLEKIKQRLFENLRMLPHAPGVQMQPIPED  293



>ref|XP_002983212.1| hypothetical protein SELMODRAFT_234196 [Selaginella moellendorffii]
 gb|EFJ15554.1| hypothetical protein SELMODRAFT_234196 [Selaginella moellendorffii]
Length=408

 Score =   206 bits (523),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 93/145 (64%), Positives = 114/145 (79%), Gaps = 0/145 (0%)
 Frame = -3

Query  698  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  519
            +ISKV+E Y PGAIVLQCGADSL+GDRLGCFNLS+ GHAECVRFV+ FN+PLL+ GGGGY
Sbjct  254  VISKVMEVYQPGAIVLQCGADSLSGDRLGCFNLSVKGHAECVRFVRSFNVPLLLVGGGGY  313

Query  518  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  339
            T  NVARCW YETGV +  EL N++P NDY +YFGP+Y+L +P  + EN NS  YL +++
Sbjct  314  TVRNVARCWCYETGVAVGVELENQMPYNDYYEYFGPEYTLLVPASNKENANSPEYLDSLR  373

Query  338  SHVLENLRYIQHAPSVQMQEVPPDF  264
              +LEN+  +QHAPSV   E PPD 
Sbjct  374  QQLLENISKLQHAPSVPFYERPPDM  398



>ref|XP_008554767.1| PREDICTED: histone deacetylase Rpd3 [Microplitis demolitor]
Length=490

 Score =   207 bits (528),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 101/183 (55%), Positives = 130/183 (71%), Gaps = 2/183 (1%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  + + ++ IISKV+ET+ P A+VLQCGADSL GDRLGCFNL++ GH +CV FVKK+N+
Sbjct  234  DDSYESIFVPIISKVMETFQPSAVVLQCGADSLTGDRLGCFNLTVRGHGKCVEFVKKYNL  293

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            P L+ GGGGYT  NV+RCW YET V L  E+ NE+P NDY +YFGPD+ L I   ++ N 
Sbjct  294  PFLMVGGGGYTIRNVSRCWTYETSVALGCEIANELPYNDYFEYFGPDFKLHISPSNMGNQ  353

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPD-FYIPDFD-EDTQNPDERLDQHTQDK  195
            N+  YL  IK+ + ENLR + HAP VQ+Q +P D   I D + E+  NPDERL Q   DK
Sbjct  354  NTIEYLEKIKTRLFENLRMLPHAPGVQVQAIPEDGATIEDSEAEEKVNPDERLPQRDIDK  413

Query  194  QIQ  186
            +IQ
Sbjct  414  RIQ  416



>ref|XP_011876393.1| PREDICTED: histone deacetylase Rpd3-like [Vollenhovia emeryi]
Length=495

 Score =   207 bits (528),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 100/184 (54%), Positives = 130/184 (71%), Gaps = 2/184 (1%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  + + ++ IISKV+ET+ P A+VLQCGADSL GDRLGCFNL++ GH +CV FVKK+N+
Sbjct  233  DDSYESIFVPIISKVMETFQPSAVVLQCGADSLTGDRLGCFNLTVRGHGKCVEFVKKYNL  292

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            P L+ GGGGYT  NV+RCW YET V L  E+ NE+P NDY +YFGPD+ L I   ++ N 
Sbjct  293  PFLMVGGGGYTIRNVSRCWTYETSVALGCEIANELPYNDYFEYFGPDFKLHISPSNMTNQ  352

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPD-FYIPDFD-EDTQNPDERLDQHTQDK  195
            N+  YL  IK+ + ENLR + HAP VQ+Q +P D   I D + E+  + DERL Q   DK
Sbjct  353  NTTEYLDKIKTRLFENLRMLPHAPGVQVQAIPEDGAIIEDTEMEEKMSLDERLPQRDLDK  412

Query  194  QIQR  183
            +IQR
Sbjct  413  RIQR  416



>ref|XP_011639811.1| PREDICTED: histone deacetylase Rpd3-like [Pogonomyrmex barbatus]
Length=495

 Score =   207 bits (528),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 99/183 (54%), Positives = 128/183 (70%), Gaps = 2/183 (1%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  + + ++ IISKV+ET+ P A+VLQCGADSL GDRLGCFNL++ GH +CV FVKK+N+
Sbjct  233  DESYDSIFVPIISKVMETFQPSAVVLQCGADSLTGDRLGCFNLTVRGHGKCVEFVKKYNL  292

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            P L+ GGGGYT  NV+RCW YET V L  E+ NE+P NDY +YFGPD+ L I   ++ N 
Sbjct  293  PFLMVGGGGYTIRNVSRCWTYETSVALSCEIANELPYNDYFEYFGPDFKLHISPSNMTNQ  352

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFD--EDTQNPDERLDQHTQDK  195
            N+  YL  IK+ + ENLR + HAP VQ+Q +P D  I +    E+  N DERL Q   DK
Sbjct  353  NTPEYLEKIKTRLFENLRMLPHAPGVQVQAIPEDGAIIEDSEIEEKLNLDERLSQRDLDK  412

Query  194  QIQ  186
            +IQ
Sbjct  413  RIQ  415



>ref|XP_011061202.1| PREDICTED: histone deacetylase Rpd3 isoform X1 [Acromyrmex echinatior]
 gb|EGI61327.1| Histone deacetylase Rpd3 [Acromyrmex echinatior]
Length=497

 Score =   207 bits (528),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 99/183 (54%), Positives = 130/183 (71%), Gaps = 2/183 (1%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  + + ++ IISKV+ET+ P A+VLQCGADSL GDRLGCFNL++ GH +CV FVKK+N+
Sbjct  239  DDSYESIFVPIISKVMETFQPSAVVLQCGADSLTGDRLGCFNLTVRGHGKCVEFVKKYNL  298

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            P L+ GGGGYT  NV+RCW YET V L  E+ NE+P NDY +YFGPD+ L I   ++ N 
Sbjct  299  PFLMVGGGGYTIRNVSRCWTYETSVALGCEIANELPYNDYFEYFGPDFKLHISPSNMANQ  358

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPD-FYIPDFD-EDTQNPDERLDQHTQDK  195
            N+  YL  IK+ + ENLR + HAP VQ+Q +P D   I D + E+  NPD+RL Q   DK
Sbjct  359  NTPEYLDKIKTRLFENLRMLPHAPGVQVQAIPEDGAVIEDSEAEEKTNPDDRLPQRELDK  418

Query  194  QIQ  186
            ++Q
Sbjct  419  RMQ  421



>ref|XP_001943175.3| PREDICTED: histone deacetylase Rpd3-like [Acyrthosiphon pisum]
Length=480

 Score =   207 bits (527),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 99/181 (55%), Positives = 126/181 (70%), Gaps = 1/181 (1%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  + + ++ II+KV+ET+ P AIVLQCGADSL GDRLGCFNL+I GH +CV FVK++ +
Sbjct  231  DDSYESIFVPIITKVMETFQPSAIVLQCGADSLTGDRLGCFNLTIKGHGKCVEFVKRYGV  290

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            P+L+ GGGGYT +NV+RCW YET V L  E+ NE+P NDY +YF PD  L I    ++N 
Sbjct  291  PILMVGGGGYTTQNVSRCWTYETAVALGVEISNELPYNDYFEYFLPDSKLHISPSKMKNT  350

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPD-FYIPDFDEDTQNPDERLDQHTQDKQ  192
            NS  YL  IK+ + ENLR + HAP VQ+Q +P D  +    DED  NPDER  Q   DKQ
Sbjct  351  NSTKYLEKIKNRIFENLRMLPHAPGVQVQAIPEDGIHSESEDEDIVNPDERNPQSITDKQ  410

Query  191  I  189
            I
Sbjct  411  I  411



>gb|KFO76881.1| Histone deacetylase 1, partial [Cuculus canorus]
Length=380

 Score =   204 bits (520),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 92/154 (60%), Positives = 116/154 (75%), Gaps = 0/154 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  + A +  +ISKV+ET+ P A+VLQCG+DSL+GDRLGCFNL+I GHA+CV FVK FN+
Sbjct  142  DESYEAIFKPVISKVMETFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNL  201

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            P+L+ GGGGYT  NVARCW YET V LD+E+PNE+P NDY +YFGPD+ L I   ++ N 
Sbjct  202  PMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQ  261

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPD  267
            N+  YL  IK  + ENLR + HAP VQMQ +P D
Sbjct  262  NTNEYLEKIKQRLFENLRMLPHAPGVQMQPIPED  295



>gb|KFB51427.1| histone deacetylase Rpd3 [Anopheles sinensis]
Length=488

 Score =   207 bits (527),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 98/181 (54%), Positives = 128/181 (71%), Gaps = 1/181 (1%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  + + ++ IISKV+ET+ P A+VLQCGADSL GDRLGCFNL++ GH +CV FVKK+N+
Sbjct  232  DESYDSIFVPIISKVMETFQPSAVVLQCGADSLTGDRLGCFNLTVKGHGKCVEFVKKYNL  291

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            P L+ GGGGYT  NV+RCW YET V L  E+ NE+P NDY +YFGPD+ L I   ++ N 
Sbjct  292  PFLMVGGGGYTIRNVSRCWTYETSVALGVEIANELPYNDYFEYFGPDFKLHISPSNMSNQ  351

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDF-DEDTQNPDERLDQHTQDKQ  192
            N+  YL  IK+ + ENLR + HAP VQ+Q +P D    +  DED  + DERL Q  +DK+
Sbjct  352  NTTEYLEKIKNRLFENLRMLPHAPGVQVQPIPEDAINDESEDEDKVDKDERLPQQDKDKR  411

Query  191  I  189
            I
Sbjct  412  I  412



>ref|XP_001946674.2| PREDICTED: histone deacetylase Rpd3-like, partial [Acyrthosiphon 
pisum]
Length=461

 Score =   206 bits (525),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 100/181 (55%), Positives = 125/181 (69%), Gaps = 1/181 (1%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  + + ++ II+KV+ET+ P AIVLQCGADSL GDRLGCFNL+I GH +CV FVK + +
Sbjct  233  DDSYESIFVPIITKVMETFQPSAIVLQCGADSLTGDRLGCFNLTIKGHGKCVEFVKLYGV  292

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            P+L+ GGGGYT +NV+RCW YET V L  E+ NE+P NDY KYF PD  L I    ++N 
Sbjct  293  PILMVGGGGYTTQNVSRCWTYETAVALGVEISNELPYNDYFKYFLPDSKLHISPSKMKNT  352

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPD-FYIPDFDEDTQNPDERLDQHTQDKQ  192
            NS  YL  IK+ + ENLR + HAP VQ+Q +P D  +    DED  NPDER  Q   DKQ
Sbjct  353  NSTKYLEKIKNRIFENLRMLPHAPGVQVQAIPEDGIHSESEDEDNVNPDERNPQSITDKQ  412

Query  191  I  189
            I
Sbjct  413  I  413



>ref|XP_012058200.1| PREDICTED: histone deacetylase Rpd3-like [Atta cephalotes]
Length=497

 Score =   207 bits (528),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 99/183 (54%), Positives = 130/183 (71%), Gaps = 2/183 (1%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  + + ++ IISKV+ET+ P A+VLQCGADSL GDRLGCFNL++ GH +CV FVKK+N+
Sbjct  239  DDSYESIFVPIISKVMETFQPSAVVLQCGADSLTGDRLGCFNLTVRGHGKCVEFVKKYNL  298

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            P L+ GGGGYT  NV+RCW YET V L  E+ NE+P NDY +YFGPD+ L I   ++ N 
Sbjct  299  PFLMVGGGGYTIRNVSRCWTYETSVALGCEIANELPYNDYFEYFGPDFKLHISPSNMANQ  358

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPD-FYIPDFD-EDTQNPDERLDQHTQDK  195
            N+  YL  IK+ + ENLR + HAP VQ+Q +P D   I D + E+  NPD+RL Q   DK
Sbjct  359  NTPEYLDKIKTRLFENLRMLPHAPGVQVQAIPEDGAVIEDSEAEEKTNPDDRLPQRDLDK  418

Query  194  QIQ  186
            ++Q
Sbjct  419  RMQ  421



>ref|XP_011639814.1| PREDICTED: histone deacetylase Rpd3-like isoform X2 [Pogonomyrmex 
barbatus]
Length=463

 Score =   206 bits (525),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 99/183 (54%), Positives = 130/183 (71%), Gaps = 2/183 (1%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  + + ++ IISKV+ET+ P A+VLQCGADSL GDRLGCFNL++ GH +CV FVKK+N+
Sbjct  205  DESYESIFVPIISKVMETFQPSAVVLQCGADSLTGDRLGCFNLTVRGHGKCVEFVKKYNL  264

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            P L+ GGGGYT  NV+RCW YET V L  E+ NE+P NDY +YFGPD+ L I   ++ N 
Sbjct  265  PFLMVGGGGYTIRNVSRCWTYETSVALGCEIANELPYNDYFEYFGPDFKLHISPSNMANQ  324

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPD-FYIPDFD-EDTQNPDERLDQHTQDK  195
            N+  YL  IK+ + +NLR + HAP VQ+Q +P D   I D + E+  NPD+RL Q   DK
Sbjct  325  NTPEYLEKIKTRLFDNLRMLPHAPGVQIQAIPEDGAVIEDSEAEEKVNPDDRLPQRDLDK  384

Query  194  QIQ  186
            +IQ
Sbjct  385  RIQ  387



>ref|XP_010073968.1| PREDICTED: LOW QUALITY PROTEIN: histone deacetylase 1-like [Pterocles 
gutturalis]
Length=447

 Score =   206 bits (524),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 92/154 (60%), Positives = 116/154 (75%), Gaps = 0/154 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  + A +  +ISKV+ET+ P A+VLQCG+DSL+GDRLGCFNL+I GHA+CV FVK FN+
Sbjct  201  DESYEAIFKPVISKVMETFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNL  260

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            P+L+ GGGGYT  NVARCW YET V LD+E+PNE+P NDY +YFGPD+ L I   ++ N 
Sbjct  261  PMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQ  320

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPD  267
            N+  YL  IK  + ENLR + HAP VQMQ +P D
Sbjct  321  NTNEYLEKIKQRLFENLRMLPHAPGVQMQPIPED  354



>gb|KDO16344.1| hypothetical protein SPRG_18127 [Saprolegnia parasitica CBS 223.65]
Length=188

 Score =   198 bits (504),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 95/172 (55%), Positives = 118/172 (69%), Gaps = 2/172 (1%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  F A +  +ISKV+E + PGA+VLQCGADSL+GDRLGCFNLS+ GH +CV FVK FNI
Sbjct  3    DESFTAVFRDVISKVMEHFAPGAVVLQCGADSLSGDRLGCFNLSVKGHGDCVAFVKSFNI  62

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            P+LV GGGGYT  NV RCW YET V L  E+P+ +P NDY +YFGP+Y L +P  ++ENL
Sbjct  63   PMLVLGGGGYTLRNVPRCWCYETSVALGVEIPDAMPYNDYFEYFGPEYRLHMPVSNMENL  122

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIP--DFDEDTQNPDER  219
            N+ SYL   K  + E LR I+  PSV  Q VP        + +ED  +PD R
Sbjct  123  NTPSYLNDTKQRLFEQLRQIEPVPSVPFQHVPAKMVDASDNVNEDMADPDAR  174



>ref|XP_316539.2| AGAP006511-PA [Anopheles gambiae str. PEST]
 gb|EAA11382.2| AGAP006511-PA [Anopheles gambiae str. PEST]
Length=470

 Score =   206 bits (525),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 98/181 (54%), Positives = 128/181 (71%), Gaps = 1/181 (1%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  + + ++ IISKV+ET+ P A+VLQCGADSL GDRLGCFNL++ GH +CV FVKK+N+
Sbjct  232  DESYDSIFVPIISKVMETFQPSAVVLQCGADSLTGDRLGCFNLTVKGHGKCVEFVKKYNL  291

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            P L+ GGGGYT  NV+RCW YET V L  E+ NE+P NDY +YFGPD+ L I   ++ N 
Sbjct  292  PFLMVGGGGYTIRNVSRCWTYETSVALGVEIANELPYNDYFEYFGPDFKLHISPSNMSNQ  351

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDF-DEDTQNPDERLDQHTQDKQ  192
            N+  YL  IK+ + ENLR + HAP VQ+Q +P D    +  DED  + DERL Q  +DK+
Sbjct  352  NTTEYLEKIKNRLFENLRMLPHAPGVQVQPIPEDAINDESEDEDKVDKDERLPQQDKDKR  411

Query  191  I  189
            I
Sbjct  412  I  412



>ref|XP_010721789.1| PREDICTED: histone deacetylase 1 [Meleagris gallopavo]
Length=451

 Score =   206 bits (524),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 92/154 (60%), Positives = 116/154 (75%), Gaps = 0/154 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  + A +  +ISKV+ET+ P A+VLQCG+DSL+GDRLGCFNL+I GHA+CV FVK FN+
Sbjct  205  DESYEAIFKPVISKVMETFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNL  264

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            P+L+ GGGGYT  NVARCW YET V LD+E+PNE+P NDY +YFGPD+ L I   ++ N 
Sbjct  265  PMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQ  324

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPD  267
            N+  YL  IK  + ENLR + HAP VQMQ +P D
Sbjct  325  NTNEYLEKIKQRLFENLRMLPHAPGVQMQPIPED  358



>ref|XP_002114310.1| hypothetical protein TRIADDRAFT_64072 [Trichoplax adhaerens]
 gb|EDV23400.1| hypothetical protein TRIADDRAFT_64072 [Trichoplax adhaerens]
Length=565

 Score =   208 bits (530),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 96/170 (56%), Positives = 123/170 (72%), Gaps = 1/170 (1%)
 Frame = -3

Query  698  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  519
            +ISKV+E Y P  IVLQCGADSLAGDRLGCFNLS+ GH+ CV F+KKFN+P+++ GGGGY
Sbjct  215  VISKVMEMYQPSVIVLQCGADSLAGDRLGCFNLSLKGHSACVEFMKKFNLPIVLLGGGGY  274

Query  518  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  339
            T  NVARCWA ET   L  E+PNE+P NDY +YFGPD+ L I   ++ N N+  Y+  IK
Sbjct  275  TIRNVARCWAQETSAALGVEIPNELPYNDYFEYFGPDFKLNISPTNMTNQNTPDYIDRIK  334

Query  338  SHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQI  189
            + + ENLR + HAP VQMQ +P D    + DE+  +PD R+  H +DK+I
Sbjct  335  TRLFENLRMLPHAPGVQMQPIPSDVQY-ESDEEENDPDTRISMHDKDKRI  383



>ref|XP_005142468.1| PREDICTED: histone deacetylase 1 [Melopsittacus undulatus]
 ref|XP_005239843.1| PREDICTED: histone deacetylase 1 [Falco peregrinus]
 ref|XP_005432818.1| PREDICTED: histone deacetylase 1 [Falco cherrug]
 ref|XP_009283043.1| PREDICTED: histone deacetylase 1 [Aptenodytes forsteri]
 ref|XP_009485613.1| PREDICTED: histone deacetylase 1 [Pelecanus crispus]
 ref|XP_009499265.1| PREDICTED: histone deacetylase 1 [Phalacrocorax carbo]
 ref|XP_009572738.1| PREDICTED: histone deacetylase 1 [Fulmarus glacialis]
 ref|XP_009646827.1| PREDICTED: histone deacetylase 1 [Egretta garzetta]
 ref|XP_009807682.1| PREDICTED: histone deacetylase 1 [Gavia stellata]
 ref|XP_009882830.1| PREDICTED: histone deacetylase 1 [Charadrius vociferus]
 ref|XP_009928476.1| PREDICTED: histone deacetylase 1 [Haliaeetus albicilla]
 ref|XP_009944423.1| PREDICTED: histone deacetylase 1 [Leptosomus discolor]
 ref|XP_009985789.1| PREDICTED: histone deacetylase 1 [Tauraco erythrolophus]
 ref|XP_009998860.1| PREDICTED: histone deacetylase 1 [Chaetura pelagica]
 ref|XP_010174338.1| PREDICTED: histone deacetylase 1 [Caprimulgus carolinensis]
 ref|XP_010118810.1| PREDICTED: histone deacetylase 1 [Chlamydotis macqueenii]
 ref|XP_010288082.1| PREDICTED: histone deacetylase 1 [Phaethon lepturus]
 ref|XP_010310727.1| PREDICTED: histone deacetylase 1 [Balearica regulorum gibbericeps]
 ref|XP_010574320.1| PREDICTED: histone deacetylase 1 [Haliaeetus leucocephalus]
 ref|XP_011582237.1| PREDICTED: histone deacetylase 1 [Aquila chrysaetos canadensis]
Length=451

 Score =   206 bits (524),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 92/154 (60%), Positives = 116/154 (75%), Gaps = 0/154 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  + A +  +ISKV+ET+ P A+VLQCG+DSL+GDRLGCFNL+I GHA+CV FVK FN+
Sbjct  205  DESYEAIFKPVISKVMETFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNL  264

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            P+L+ GGGGYT  NVARCW YET V LD+E+PNE+P NDY +YFGPD+ L I   ++ N 
Sbjct  265  PMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQ  324

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPD  267
            N+  YL  IK  + ENLR + HAP VQMQ +P D
Sbjct  325  NTNEYLEKIKQRLFENLRMLPHAPGVQMQPIPED  358



>ref|XP_009469103.1| PREDICTED: histone deacetylase 1 [Nipponia nippon]
Length=451

 Score =   206 bits (524),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 92/154 (60%), Positives = 116/154 (75%), Gaps = 0/154 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  + A +  +ISKV+ET+ P A+VLQCG+DSL+GDRLGCFNL+I GHA+CV FVK FN+
Sbjct  205  DESYEAIFKPVISKVMETFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNL  264

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            P+L+ GGGGYT  NVARCW YET V LD+E+PNE+P NDY +YFGPD+ L I   ++ N 
Sbjct  265  PMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQ  324

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPD  267
            N+  YL  IK  + ENLR + HAP VQMQ +P D
Sbjct  325  NTNEYLEKIKQRLFENLRMLPHAPGVQMQPIPED  358



>gb|EPQ15222.1| Histone deacetylase 1 [Myotis brandtii]
Length=392

 Score =   204 bits (520),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 91/154 (59%), Positives = 115/154 (75%), Gaps = 0/154 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  + A +  +ISKV+E + P A+VLQCG+DSL+GDRLGCFNL+I GHA+CV FVK FN+
Sbjct  144  DESYEAIFKLVISKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNL  203

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            P+L+ GGGGYT  NVARCW YET V LD+E+PNE+P NDY +YFGPD+ L I   ++ N 
Sbjct  204  PMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQ  263

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPD  267
            N+  YL  IK  + ENLR + HAP VQMQ +P D
Sbjct  264  NTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPED  297



>ref|XP_009968174.1| PREDICTED: histone deacetylase 1 [Tyto alba]
Length=451

 Score =   206 bits (524),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 92/154 (60%), Positives = 116/154 (75%), Gaps = 0/154 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  + A +  +ISKV+ET+ P A+VLQCG+DSL+GDRLGCFNL+I GHA+CV FVK FN+
Sbjct  205  DESYEAIFKPVISKVMETFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNL  264

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            P+L+ GGGGYT  NVARCW YET V LD+E+PNE+P NDY +YFGPD+ L I   ++ N 
Sbjct  265  PMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQ  324

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPD  267
            N+  YL  IK  + ENLR + HAP VQMQ +P D
Sbjct  325  NTNEYLEKIKQRLFENLRMLPHAPGVQMQPIPED  358



>ref|XP_009906717.1| PREDICTED: histone deacetylase 1 [Picoides pubescens]
Length=451

 Score =   206 bits (524),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 92/154 (60%), Positives = 116/154 (75%), Gaps = 0/154 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  + A +  +ISKV+ET+ P A+VLQCG+DSL+GDRLGCFNL+I GHA+CV FVK FN+
Sbjct  205  DESYEAIFKPVISKVMETFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNL  264

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            P+L+ GGGGYT  NVARCW YET V LD+E+PNE+P NDY +YFGPD+ L I   ++ N 
Sbjct  265  PMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQ  324

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPD  267
            N+  YL  IK  + ENLR + HAP VQMQ +P D
Sbjct  325  NTNEYLEKIKQRLFENLRMLPHAPGVQMQPIPED  358



>ref|XP_009679321.1| PREDICTED: histone deacetylase 1 [Struthio camelus australis]
 ref|XP_009866216.1| PREDICTED: histone deacetylase 1 [Apaloderma vittatum]
Length=451

 Score =   206 bits (524),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 92/154 (60%), Positives = 116/154 (75%), Gaps = 0/154 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  + A +  +ISKV+ET+ P A+VLQCG+DSL+GDRLGCFNL+I GHA+CV FVK FN+
Sbjct  205  DESYEAIFKPVISKVMETFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNL  264

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            P+L+ GGGGYT  NVARCW YET V LD+E+PNE+P NDY +YFGPD+ L I   ++ N 
Sbjct  265  PMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQ  324

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPD  267
            N+  YL  IK  + ENLR + HAP VQMQ +P D
Sbjct  325  NTNEYLEKIKQRLFENLRMLPHAPGVQMQPIPED  358



>dbj|GAN08679.1| histone deacetylase 1/2 [Mucor ambiguus]
Length=750

 Score =   211 bits (537),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 100/180 (56%), Positives = 130/180 (72%), Gaps = 1/180 (1%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  + + +  +I KV+E Y P A+VLQCG DSL+GD+LGCFNLS+ GHA CV+FVKKFN+
Sbjct  232  DDSYQSTFEPVIEKVMEWYRPAAVVLQCGGDSLSGDKLGCFNLSMKGHANCVKFVKKFNL  291

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            P LV GGGGYT  NVAR WAYETGV++  E+  ++P NDY +YFGPDY L +   ++EN+
Sbjct  292  PTLVLGGGGYTMRNVARTWAYETGVVVGEEMGPDMPYNDYYEYFGPDYKLDVRPSNMENM  351

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQI  189
            N+  YL  IK+ V ENL     APSVQMQEVP D  + + DED Q+PD R+ Q+  D++I
Sbjct  352  NTPDYLEKIKTEVFENLSRTLFAPSVQMQEVPRDHDMSE-DEDEQDPDNRMGQNYWDRRI  410



>ref|XP_010209083.1| PREDICTED: histone deacetylase 1 [Colius striatus]
Length=451

 Score =   206 bits (524),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 92/154 (60%), Positives = 116/154 (75%), Gaps = 0/154 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  + A +  +ISKV+ET+ P A+VLQCG+DSL+GDRLGCFNL+I GHA+CV FVK FN+
Sbjct  205  DESYEAIFKPVISKVMETFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNL  264

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            P+L+ GGGGYT  NVARCW YET V LD+E+PNE+P NDY +YFGPD+ L I   ++ N 
Sbjct  265  PMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQ  324

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPD  267
            N+  YL  IK  + ENLR + HAP VQMQ +P D
Sbjct  325  NTNEYLEKIKQRLFENLRMLPHAPGVQMQPIPED  358



>ref|XP_005509669.1| PREDICTED: histone deacetylase 1 [Columba livia]
 ref|XP_008944742.1| PREDICTED: histone deacetylase 1 [Merops nubicus]
Length=451

 Score =   206 bits (524),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 92/154 (60%), Positives = 116/154 (75%), Gaps = 0/154 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  + A +  +ISKV+ET+ P A+VLQCG+DSL+GDRLGCFNL+I GHA+CV FVK FN+
Sbjct  205  DESYEAIFKPVISKVMETFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNL  264

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            P+L+ GGGGYT  NVARCW YET V LD+E+PNE+P NDY +YFGPD+ L I   ++ N 
Sbjct  265  PMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQ  324

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPD  267
            N+  YL  IK  + ENLR + HAP VQMQ +P D
Sbjct  325  NTNEYLEKIKQRLFENLRMLPHAPGVQMQPIPED  358



>ref|XP_009330447.1| PREDICTED: histone deacetylase 1 [Pygoscelis adeliae]
Length=451

 Score =   206 bits (524),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 92/154 (60%), Positives = 116/154 (75%), Gaps = 0/154 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  + A +  +ISKV+ET+ P A+VLQCG+DSL+GDRLGCFNL+I GHA+CV FVK FN+
Sbjct  205  DESYEAIFKPVISKVMETFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNL  264

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            P+L+ GGGGYT  NVARCW YET V LD+E+PNE+P NDY +YFGPD+ L I   ++ N 
Sbjct  265  PMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQ  324

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPD  267
            N+  YL  IK  + ENLR + HAP VQMQ +P D
Sbjct  325  NTNEYLEKIKQRLFENLRMLPHAPGVQMQPIPED  358



>ref|XP_012057424.1| PREDICTED: histone deacetylase Rpd3-like [Atta cephalotes]
Length=495

 Score =   207 bits (526),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 99/183 (54%), Positives = 129/183 (70%), Gaps = 2/183 (1%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  + + ++ IISKV+ET+ P A+VLQCGADSL GDRLGCFNL++ GH +CV FVK++N+
Sbjct  233  DESYESIFVPIISKVMETFQPSAVVLQCGADSLTGDRLGCFNLTVRGHGKCVEFVKRYNL  292

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            P L+ GGGGYT  NV+RCW YET V L  E+ NE+P NDY +YFGPD+ L I   ++ N 
Sbjct  293  PFLMVGGGGYTIRNVSRCWTYETSVALGCEIANELPYNDYFEYFGPDFKLHISPSNMTNQ  352

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPD-FYIPDFD-EDTQNPDERLDQHTQDK  195
            N+  YL  IK+ + ENLR + HAP VQ+Q +P D   I D + E+  N DERL Q   DK
Sbjct  353  NTSEYLDKIKTRLFENLRMLPHAPGVQVQAIPEDGAVIEDSEIEEKMNLDERLPQRDLDK  412

Query  194  QIQ  186
            +IQ
Sbjct  413  RIQ  415



>ref|XP_010129593.1| PREDICTED: histone deacetylase 1 [Buceros rhinoceros silvestris]
Length=451

 Score =   206 bits (523),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 92/154 (60%), Positives = 116/154 (75%), Gaps = 0/154 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  + A +  +ISKV+ET+ P A+VLQCG+DSL+GDRLGCFNL+I GHA+CV FVK FN+
Sbjct  205  DESYEAIFKPVISKVMETFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNL  264

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            P+L+ GGGGYT  NVARCW YET V LD+E+PNE+P NDY +YFGPD+ L I   ++ N 
Sbjct  265  PMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQ  324

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPD  267
            N+  YL  IK  + ENLR + HAP VQMQ +P D
Sbjct  325  NTNEYLEKIKQRLFENLRMLPHAPGVQMQPIPED  358



>ref|XP_008491052.1| PREDICTED: histone deacetylase 1 [Calypte anna]
Length=451

 Score =   206 bits (523),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 92/154 (60%), Positives = 116/154 (75%), Gaps = 0/154 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  + A +  +ISKV+ET+ P A+VLQCG+DSL+GDRLGCFNL+I GHA+CV FVK FN+
Sbjct  205  DESYEAIFKPVISKVMETFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNL  264

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            P+L+ GGGGYT  NVARCW YET V LD+E+PNE+P NDY +YFGPD+ L I   ++ N 
Sbjct  265  PMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQ  324

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPD  267
            N+  YL  IK  + ENLR + HAP VQMQ +P D
Sbjct  325  NTNEYLEKIKQRLFENLRMLPHAPGVQMQPIPED  358



>ref|XP_009699610.1| PREDICTED: histone deacetylase 1 [Cariama cristata]
Length=451

 Score =   206 bits (523),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 92/154 (60%), Positives = 116/154 (75%), Gaps = 0/154 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  + A +  +ISKV+ET+ P A+VLQCG+DSL+GDRLGCFNL+I GHA+CV FVK FN+
Sbjct  205  DESYEAIFKPVISKVMETFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNL  264

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            P+L+ GGGGYT  NVARCW YET V LD+E+PNE+P NDY +YFGPD+ L I   ++ N 
Sbjct  265  PMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQ  324

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPD  267
            N+  YL  IK  + ENLR + HAP VQMQ +P D
Sbjct  325  NTNEYLEKIKQRLFENLRMLPHAPGVQMQPIPED  358



>ref|XP_011050777.1| PREDICTED: histone deacetylase Rpd3-like [Acromyrmex echinatior]
 gb|EGI67731.1| Histone deacetylase Rpd3 [Acromyrmex echinatior]
Length=495

 Score =   207 bits (526),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 99/183 (54%), Positives = 129/183 (70%), Gaps = 2/183 (1%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  + + ++ IISKV+ET+ P A+VLQCGADSL GDRLGCFNL++ GH +CV FVK++N+
Sbjct  233  DESYESIFVPIISKVMETFQPSAVVLQCGADSLTGDRLGCFNLTVRGHGKCVEFVKRYNL  292

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            P L+ GGGGYT  NV+RCW YET V L  E+ NE+P NDY +YFGPD+ L I   ++ N 
Sbjct  293  PFLMVGGGGYTIRNVSRCWTYETSVALGCEIANELPYNDYFEYFGPDFKLHISPSNMTNQ  352

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPD-FYIPDFD-EDTQNPDERLDQHTQDK  195
            N+  YL  IK+ + ENLR + HAP VQ+Q +P D   I D + E+  N DERL Q   DK
Sbjct  353  NTSEYLDKIKTRLFENLRMLPHAPGVQVQAIPEDGAVIEDSEIEEKMNLDERLPQRDLDK  412

Query  194  QIQ  186
            +IQ
Sbjct  413  RIQ  415



>ref|XP_009560131.1| PREDICTED: histone deacetylase 1 [Cuculus canorus]
Length=451

 Score =   206 bits (523),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 92/154 (60%), Positives = 116/154 (75%), Gaps = 0/154 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  + A +  +ISKV+ET+ P A+VLQCG+DSL+GDRLGCFNL+I GHA+CV FVK FN+
Sbjct  205  DESYEAIFKPVISKVMETFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNL  264

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            P+L+ GGGGYT  NVARCW YET V LD+E+PNE+P NDY +YFGPD+ L I   ++ N 
Sbjct  265  PMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQ  324

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPD  267
            N+  YL  IK  + ENLR + HAP VQMQ +P D
Sbjct  325  NTNEYLEKIKQRLFENLRMLPHAPGVQMQPIPED  358



>ref|XP_011882428.1| PREDICTED: histone deacetylase Rpd3-like [Vollenhovia emeryi]
Length=497

 Score =   207 bits (526),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 99/183 (54%), Positives = 130/183 (71%), Gaps = 2/183 (1%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  + + ++ IISKV+ET+ P A+VLQCGADSL GDRLGCFNL++ GH +CV FVKK+N+
Sbjct  239  DESYESIFVPIISKVMETFQPSAVVLQCGADSLTGDRLGCFNLTVRGHGKCVEFVKKYNL  298

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            P L+ GGGGYT  NV+RCW YET V L  E+ NE+P NDY +YFGPD+ L I   ++ N 
Sbjct  299  PFLMVGGGGYTIRNVSRCWTYETSVALGCEIANELPYNDYFEYFGPDFKLHISPSNMANQ  358

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPD-FYIPDFD-EDTQNPDERLDQHTQDK  195
            N+  YL  IK+ + ENLR + HAP VQ+Q +P D   I D + E+  NPD+RL Q   DK
Sbjct  359  NTPEYLEKIKTRLFENLRMLPHAPGVQVQAIPEDGAVIEDSEAEEKVNPDDRLPQRDLDK  418

Query  194  QIQ  186
            ++Q
Sbjct  419  RMQ  421



>ref|XP_008918838.1| PREDICTED: histone deacetylase 1 [Manacus vitellinus]
Length=451

 Score =   206 bits (523),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 92/154 (60%), Positives = 116/154 (75%), Gaps = 0/154 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  + A +  +ISKV+ET+ P A+VLQCG+DSL+GDRLGCFNL+I GHA+CV FVK FN+
Sbjct  205  DESYEAIFKPVISKVMETFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNL  264

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            P+L+ GGGGYT  NVARCW YET V LD+E+PNE+P NDY +YFGPD+ L I   ++ N 
Sbjct  265  PMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQ  324

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPD  267
            N+  YL  IK  + ENLR + HAP VQMQ +P D
Sbjct  325  NTNEYLEKIKQRLFENLRMLPHAPGVQMQPIPED  358



>ref|XP_003397521.1| PREDICTED: hypothetical protein LOC100642763 [Bombus terrestris]
Length=1431

 Score =   214 bits (546),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 102/183 (56%), Positives = 131/183 (72%), Gaps = 2/183 (1%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  + + ++ IISKV+ET+ P A+VLQCGADSL GDRLGCFNL++ GH +CV FVKK+N+
Sbjct  234  DESYESIFVPIISKVMETFQPSAVVLQCGADSLTGDRLGCFNLTVRGHGKCVEFVKKYNL  293

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            P L+ GGGGYT  NV+RCW YET V L SE+ NE+P NDY +YFGPD+ L I   ++ N 
Sbjct  294  PFLMVGGGGYTIRNVSRCWTYETSVALGSEIANELPYNDYFEYFGPDFKLHISPSNMANQ  353

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPD-FYIPDFD-EDTQNPDERLDQHTQDK  195
            N+  YL  IK+ + ENLR + HAP VQ+Q +P D   I D + E+  NPDERL Q   DK
Sbjct  354  NTPEYLEKIKTRLFENLRMLPHAPGVQVQPIPEDGAVIEDSEAEEKVNPDERLPQRDLDK  413

Query  194  QIQ  186
            +IQ
Sbjct  414  RIQ  416



>ref|XP_011694402.1| PREDICTED: histone deacetylase Rpd3-like isoform X2 [Wasmannia 
auropunctata]
 ref|XP_011694404.1| PREDICTED: histone deacetylase Rpd3-like isoform X2 [Wasmannia 
auropunctata]
Length=463

 Score =   206 bits (524),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 98/183 (54%), Positives = 130/183 (71%), Gaps = 2/183 (1%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  + + ++ IISKV+ET+ P A+VLQCGADSL GDRLGCFNL++ GH +CV FVKK+N+
Sbjct  205  DESYESIFVPIISKVMETFQPSAVVLQCGADSLTGDRLGCFNLTVRGHGKCVEFVKKYNL  264

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            P L+ GGGGYT  NV+RCW YET V L  ++ NE+P NDY +YFGPD+ L I   ++ N 
Sbjct  265  PFLMVGGGGYTIRNVSRCWTYETSVALGCDIANELPYNDYFEYFGPDFKLHISPSNMANQ  324

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPD-FYIPDFD-EDTQNPDERLDQHTQDK  195
            N+  YL  IK+ + ENLR + HAP VQ+Q +P D   I D + E+  NPD+RL Q   DK
Sbjct  325  NTPEYLDKIKTRLFENLRMLPHAPGVQVQAIPEDGAVIEDSEAEEKVNPDDRLPQRDLDK  384

Query  194  QIQ  186
            ++Q
Sbjct  385  RMQ  387



>gb|KHJ79031.1| hypothetical protein OESDEN_21332, partial [Oesophagostomum dentatum]
Length=257

 Score =   200 bits (508),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 94/174 (54%), Positives = 124/174 (71%), Gaps = 3/174 (2%)
 Frame = -3

Query  698  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  519
            +I KV+E++ P AIVLQCGADSL GDRLGCFNL++ GH +CV F+KKF IPL++ GGGGY
Sbjct  37   VIQKVMESFQPCAIVLQCGADSLVGDRLGCFNLTLKGHGKCVAFLKKFGIPLMLVGGGGY  96

Query  518  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  339
            T  NV+RCW YET V +D+E+ NE+P NDY +YFGPD+ L I   ++ N N++ YL    
Sbjct  97   TIRNVSRCWTYETSVAVDTEIANELPYNDYFEYFGPDFKLHIEKSNMTNQNTQDYLEKTM  156

Query  338  SHVLENLRYIQHAPSVQMQEVPPD-FYIPD--FDEDTQNPDERLDQHTQDKQIQ  186
            + + ENLR + +APSVQMQ +PPD  Y+P+    ED  NPD R      D+ I+
Sbjct  157  TRLFENLRELPYAPSVQMQPIPPDSIYVPEKSLLEDHSNPDMRNPSAIYDRAIE  210



>gb|KFV75060.1| Histone deacetylase 1, partial [Picoides pubescens]
Length=439

 Score =   205 bits (522),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 92/154 (60%), Positives = 116/154 (75%), Gaps = 0/154 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  + A +  +ISKV+ET+ P A+VLQCG+DSL+GDRLGCFNL+I GHA+CV FVK FN+
Sbjct  218  DESYEAIFKPVISKVMETFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNL  277

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            P+L+ GGGGYT  NVARCW YET V LD+E+PNE+P NDY +YFGPD+ L I   ++ N 
Sbjct  278  PMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQ  337

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPD  267
            N+  YL  IK  + ENLR + HAP VQMQ +P D
Sbjct  338  NTNEYLEKIKQRLFENLRMLPHAPGVQMQPIPED  371



>gb|KFR06102.1| Histone deacetylase 1, partial [Opisthocomus hoazin]
Length=405

 Score =   204 bits (520),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 91/154 (59%), Positives = 115/154 (75%), Gaps = 0/154 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  + A +  +ISKV+ET+ P A+ LQCG+DSL+GDRLGCFNL+I GHA+CV FVK FN+
Sbjct  184  DESYEAIFKPVISKVMETFQPSAVALQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNL  243

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            P+L+ GGGGYT  NVARCW YET V LD+E+PNE+P NDY +YFGPD+ L I   ++ N 
Sbjct  244  PMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQ  303

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPD  267
            N+  YL  IK  + ENLR + HAP VQMQ +P D
Sbjct  304  NTNEYLEKIKQRLFENLRMLPHAPGVQMQPIPED  337



>gb|KFR03534.1| Histone deacetylase 1, partial [Nipponia nippon]
Length=441

 Score =   205 bits (522),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 92/154 (60%), Positives = 116/154 (75%), Gaps = 0/154 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  + A +  +ISKV+ET+ P A+VLQCG+DSL+GDRLGCFNL+I GHA+CV FVK FN+
Sbjct  220  DESYEAIFKPVISKVMETFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNL  279

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            P+L+ GGGGYT  NVARCW YET V LD+E+PNE+P NDY +YFGPD+ L I   ++ N 
Sbjct  280  PMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQ  339

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPD  267
            N+  YL  IK  + ENLR + HAP VQMQ +P D
Sbjct  340  NTNEYLEKIKQRLFENLRMLPHAPGVQMQPIPED  373



>ref|XP_007444029.1| PREDICTED: histone deacetylase 1-like, partial [Python bivittatus]
Length=283

 Score =   201 bits (510),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 88/154 (57%), Positives = 115/154 (75%), Gaps = 0/154 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  + A +  ++SKV+ET+ P A+ LQCG+DSL+GDRLGCFNL+I GHA+CV F+K FN+
Sbjct  37   DESYEAIFKPVMSKVMETFQPSAVALQCGSDSLSGDRLGCFNLTIKGHAKCVEFIKSFNL  96

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            P+L+ GGGGYT  NVARCW YET V L++E+PNE+P NDY +YFGPD+ L I   ++ N 
Sbjct  97   PMLMLGGGGYTIRNVARCWTYETAVALNTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQ  156

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPD  267
            N+  YL  IK  + ENLR + HAP VQMQ +P D
Sbjct  157  NTNEYLEKIKQRLFENLRMLPHAPGVQMQPIPED  190



>gb|EPB86954.1| histone deacetylase 1/2 [Mucor circinelloides f. circinelloides 
1006PhL]
Length=740

 Score =   211 bits (536),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 100/180 (56%), Positives = 130/180 (72%), Gaps = 1/180 (1%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  + + +  +I KV+E Y P A+VLQCG DSL+GD+LGCFNLS+ GHA CV+FVKKFN+
Sbjct  232  DDSYQSTFEPVIEKVMEWYRPAAVVLQCGGDSLSGDKLGCFNLSMKGHANCVKFVKKFNL  291

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            P LV GGGGYT  NVAR WAYETGV++  E+  ++P NDY +YFGPDY L +   ++EN+
Sbjct  292  PTLVLGGGGYTMRNVARTWAYETGVVVGEEMGPDMPYNDYYEYFGPDYKLDVRPSNMENM  351

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQI  189
            N+  YL  IK+ V ENL     APSVQMQEVP D  + + DED Q+PD R+ Q+  D++I
Sbjct  352  NTPDYLEKIKTQVFENLSRTLFAPSVQMQEVPRDHDMSE-DEDEQDPDNRMGQNYWDRRI  410



>ref|XP_005427182.1| PREDICTED: histone deacetylase 1 [Geospiza fortis]
Length=450

 Score =   205 bits (522),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 92/154 (60%), Positives = 116/154 (75%), Gaps = 0/154 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  + A +  +ISKV+ET+ P A+VLQCG+DSL+GDRLGCFNL+I GHA+CV FVK FN+
Sbjct  205  DESYEAIFKPVISKVMETFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNL  264

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            P+L+ GGGGYT  NVARCW YET V LD+E+PNE+P NDY +YFGPD+ L I   ++ N 
Sbjct  265  PMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQ  324

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPD  267
            N+  YL  IK  + ENLR + HAP VQMQ +P D
Sbjct  325  NTNEYLEKIKQRLFENLRMLPHAPGVQMQPIPED  358



>gb|EOB00696.1| Histone deacetylase 1, partial [Anas platyrhynchos]
Length=446

 Score =   205 bits (522),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 92/154 (60%), Positives = 116/154 (75%), Gaps = 0/154 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  + A +  +ISKV+ET+ P A+VLQCG+DSL+GDRLGCFNL+I GHA+CV FVK FN+
Sbjct  208  DESYEAIFKPVISKVMETFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNL  267

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            P+L+ GGGGYT  NVARCW YET V LD+E+PNE+P NDY +YFGPD+ L I   ++ N 
Sbjct  268  PMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQ  327

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPD  267
            N+  YL  IK  + ENLR + HAP VQMQ +P D
Sbjct  328  NTNEYLEKIKQRLFENLRMLPHAPGVQMQPIPED  361



>ref|XP_008633314.1| PREDICTED: histone deacetylase 1 [Corvus brachyrhynchos]
Length=453

 Score =   205 bits (522),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 92/154 (60%), Positives = 116/154 (75%), Gaps = 0/154 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  + A +  +ISKV+ET+ P A+VLQCG+DSL+GDRLGCFNL+I GHA+CV FVK FN+
Sbjct  205  DESYEAIFKPVISKVMETFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNL  264

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            P+L+ GGGGYT  NVARCW YET V LD+E+PNE+P NDY +YFGPD+ L I   ++ N 
Sbjct  265  PMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQ  324

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPD  267
            N+  YL  IK  + ENLR + HAP VQMQ +P D
Sbjct  325  NTNEYLEKIKQRLFENLRMLPHAPGVQMQPIPED  358



>gb|KFV55204.1| Histone deacetylase 1, partial [Tyto alba]
Length=439

 Score =   205 bits (521),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 92/154 (60%), Positives = 116/154 (75%), Gaps = 0/154 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  + A +  +ISKV+ET+ P A+VLQCG+DSL+GDRLGCFNL+I GHA+CV FVK FN+
Sbjct  218  DESYEAIFKPVISKVMETFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNL  277

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            P+L+ GGGGYT  NVARCW YET V LD+E+PNE+P NDY +YFGPD+ L I   ++ N 
Sbjct  278  PMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQ  337

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPD  267
            N+  YL  IK  + ENLR + HAP VQMQ +P D
Sbjct  338  NTNEYLEKIKQRLFENLRMLPHAPGVQMQPIPED  371



>ref|XP_005058307.1| PREDICTED: histone deacetylase 1 isoform X2 [Ficedula albicollis]
Length=449

 Score =   205 bits (522),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 92/154 (60%), Positives = 116/154 (75%), Gaps = 0/154 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  + A +  +ISKV+ET+ P A+VLQCG+DSL+GDRLGCFNL+I GHA+CV FVK FN+
Sbjct  205  DESYEAIFKPVISKVMETFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNL  264

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            P+L+ GGGGYT  NVARCW YET V LD+E+PNE+P NDY +YFGPD+ L I   ++ N 
Sbjct  265  PMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQ  324

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPD  267
            N+  YL  IK  + ENLR + HAP VQMQ +P D
Sbjct  325  NTNEYLEKIKQRLFENLRMLPHAPGVQMQPIPED  358



>gb|KFO60221.1| Histone deacetylase 1, partial [Corvus brachyrhynchos]
 gb|KFW78231.1| Histone deacetylase 1, partial [Manacus vitellinus]
Length=439

 Score =   205 bits (521),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 92/154 (60%), Positives = 116/154 (75%), Gaps = 0/154 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  + A +  +ISKV+ET+ P A+VLQCG+DSL+GDRLGCFNL+I GHA+CV FVK FN+
Sbjct  218  DESYEAIFKPVISKVMETFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNL  277

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            P+L+ GGGGYT  NVARCW YET V LD+E+PNE+P NDY +YFGPD+ L I   ++ N 
Sbjct  278  PMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQ  337

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPD  267
            N+  YL  IK  + ENLR + HAP VQMQ +P D
Sbjct  338  NTNEYLEKIKQRLFENLRMLPHAPGVQMQPIPED  371



>gb|KFP28914.1| Histone deacetylase 1, partial [Colius striatus]
Length=439

 Score =   205 bits (521),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 92/154 (60%), Positives = 116/154 (75%), Gaps = 0/154 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  + A +  +ISKV+ET+ P A+VLQCG+DSL+GDRLGCFNL+I GHA+CV FVK FN+
Sbjct  218  DESYEAIFKPVISKVMETFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNL  277

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            P+L+ GGGGYT  NVARCW YET V LD+E+PNE+P NDY +YFGPD+ L I   ++ N 
Sbjct  278  PMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQ  337

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPD  267
            N+  YL  IK  + ENLR + HAP VQMQ +P D
Sbjct  338  NTNEYLEKIKQRLFENLRMLPHAPGVQMQPIPED  371



>gb|KFM11275.1| Histone deacetylase 1, partial [Aptenodytes forsteri]
 gb|KFP36148.1| Histone deacetylase 1, partial [Chlamydotis macqueenii]
 gb|KFP58730.1| Histone deacetylase 1, partial [Cariama cristata]
 gb|KFP87340.1| Histone deacetylase 1, partial [Apaloderma vittatum]
 gb|KFP93147.1| Histone deacetylase 1, partial [Haliaeetus albicilla]
 gb|KFQ06137.1| Histone deacetylase 1, partial [Leptosomus discolor]
 gb|KFQ22896.1| Histone deacetylase 1, partial [Merops nubicus]
 gb|KFQ53700.1| Histone deacetylase 1, partial [Pelecanus crispus]
 gb|KFQ79739.1| Histone deacetylase 1, partial [Phoenicopterus ruber ruber]
 gb|KFV18789.1| Histone deacetylase 1, partial [Tauraco erythrolophus]
 gb|KFV41775.1| Histone deacetylase 1, partial [Gavia stellata]
 gb|KFV90773.1| Histone deacetylase 1, partial [Fulmarus glacialis]
 gb|KFW88736.1| Histone deacetylase 1, partial [Phalacrocorax carbo]
 gb|KFZ49051.1| Histone deacetylase 1, partial [Caprimulgus carolinensis]
 gb|KFZ69359.1| Histone deacetylase 1, partial [Podiceps cristatus]
 gb|KGL92857.1| Histone deacetylase 1, partial [Charadrius vociferus]
Length=439

 Score =   205 bits (521),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 92/154 (60%), Positives = 116/154 (75%), Gaps = 0/154 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  + A +  +ISKV+ET+ P A+VLQCG+DSL+GDRLGCFNL+I GHA+CV FVK FN+
Sbjct  218  DESYEAIFKPVISKVMETFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNL  277

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            P+L+ GGGGYT  NVARCW YET V LD+E+PNE+P NDY +YFGPD+ L I   ++ N 
Sbjct  278  PMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQ  337

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPD  267
            N+  YL  IK  + ENLR + HAP VQMQ +P D
Sbjct  338  NTNEYLEKIKQRLFENLRMLPHAPGVQMQPIPED  371



>gb|KGL79664.1| Histone deacetylase 1, partial [Tinamus guttatus]
Length=440

 Score =   205 bits (521),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 92/154 (60%), Positives = 116/154 (75%), Gaps = 0/154 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  + A +  +ISKV+ET+ P A+VLQCG+DSL+GDRLGCFNL+I GHA+CV FVK FN+
Sbjct  204  DESYEAIFKPVISKVMETFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNL  263

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            P+L+ GGGGYT  NVARCW YET V LD+E+PNE+P NDY +YFGPD+ L I   ++ N 
Sbjct  264  PMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQ  323

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPD  267
            N+  YL  IK  + ENLR + HAP VQMQ +P D
Sbjct  324  NTNEYLEKIKQRLFENLRMLPHAPGVQMQPIPED  357



>gb|KFU91820.1| Histone deacetylase 1, partial [Chaetura pelagica]
Length=447

 Score =   205 bits (522),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 92/154 (60%), Positives = 116/154 (75%), Gaps = 0/154 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  + A +  +ISKV+ET+ P A+VLQCG+DSL+GDRLGCFNL+I GHA+CV FVK FN+
Sbjct  218  DESYEAIFKPVISKVMETFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNL  277

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            P+L+ GGGGYT  NVARCW YET V LD+E+PNE+P NDY +YFGPD+ L I   ++ N 
Sbjct  278  PMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQ  337

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPD  267
            N+  YL  IK  + ENLR + HAP VQMQ +P D
Sbjct  338  NTNEYLEKIKQRLFENLRMLPHAPGVQMQPIPED  371



>gb|KFP10889.1| Histone deacetylase 1, partial [Egretta garzetta]
Length=443

 Score =   205 bits (521),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 92/154 (60%), Positives = 116/154 (75%), Gaps = 0/154 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  + A +  +ISKV+ET+ P A+VLQCG+DSL+GDRLGCFNL+I GHA+CV FVK FN+
Sbjct  222  DESYEAIFKPVISKVMETFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNL  281

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            P+L+ GGGGYT  NVARCW YET V LD+E+PNE+P NDY +YFGPD+ L I   ++ N 
Sbjct  282  PMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQ  341

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPD  267
            N+  YL  IK  + ENLR + HAP VQMQ +P D
Sbjct  342  NTNEYLEKIKQRLFENLRMLPHAPGVQMQPIPED  375



>ref|XP_002961351.1| hypothetical protein SELMODRAFT_74186 [Selaginella moellendorffii]
 gb|EFJ38890.1| hypothetical protein SELMODRAFT_74186 [Selaginella moellendorffii]
Length=488

 Score =   206 bits (524),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 93/145 (64%), Positives = 114/145 (79%), Gaps = 0/145 (0%)
 Frame = -3

Query  698  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  519
            +ISKV+E Y PGAIVLQCGADSL+GDRLGCFNLS+ GHAECVRFV+ FN+PLL+ GGGGY
Sbjct  254  VISKVMEVYQPGAIVLQCGADSLSGDRLGCFNLSVKGHAECVRFVRSFNVPLLLVGGGGY  313

Query  518  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  339
            T  NVARCW YETGV +  EL N++P NDY +YFGP+Y+L +P  + EN NS  YL +++
Sbjct  314  TVRNVARCWCYETGVAVGVELENQMPYNDYYEYFGPEYTLLVPASNKENANSPEYLDSLR  373

Query  338  SHVLENLRYIQHAPSVQMQEVPPDF  264
              +LEN+  +QHAPSV   E PPD 
Sbjct  374  QQLLENISKLQHAPSVPFYERPPDM  398



>gb|KFP00125.1| Histone deacetylase 1, partial [Calypte anna]
Length=439

 Score =   205 bits (521),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 92/154 (60%), Positives = 116/154 (75%), Gaps = 0/154 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  + A +  +ISKV+ET+ P A+VLQCG+DSL+GDRLGCFNL+I GHA+CV FVK FN+
Sbjct  218  DESYEAIFKPVISKVMETFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNL  277

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            P+L+ GGGGYT  NVARCW YET V LD+E+PNE+P NDY +YFGPD+ L I   ++ N 
Sbjct  278  PMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQ  337

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPD  267
            N+  YL  IK  + ENLR + HAP VQMQ +P D
Sbjct  338  NTNEYLEKIKQRLFENLRMLPHAPGVQMQPIPED  371



>gb|KFQ67796.1| Histone deacetylase 1, partial [Phaethon lepturus]
Length=447

 Score =   205 bits (522),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 92/154 (60%), Positives = 116/154 (75%), Gaps = 0/154 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  + A +  +ISKV+ET+ P A+VLQCG+DSL+GDRLGCFNL+I GHA+CV FVK FN+
Sbjct  218  DESYEAIFKPVISKVMETFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNL  277

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            P+L+ GGGGYT  NVARCW YET V LD+E+PNE+P NDY +YFGPD+ L I   ++ N 
Sbjct  278  PMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQ  337

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPD  267
            N+  YL  IK  + ENLR + HAP VQMQ +P D
Sbjct  338  NTNEYLEKIKQRLFENLRMLPHAPGVQMQPIPED  371



>gb|EUB61434.1| Histone deacetylase [Echinococcus granulosus]
Length=520

 Score =   207 bits (526),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 95/176 (54%), Positives = 128/176 (73%), Gaps = 4/176 (2%)
 Frame = -3

Query  698  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  519
            ++SKV+ET+ PGA VLQCGADSL+GDRLGCFNLS+ GH +CV F++ F IPLL+ GGGGY
Sbjct  260  VVSKVMETFRPGAAVLQCGADSLSGDRLGCFNLSLKGHGKCVEFLRSFPIPLLMLGGGGY  319

Query  518  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  339
            T  NVARCW YET + L++E+PN++P NDY +YFGPD+ L I   ++ NLN+  Y+  IK
Sbjct  320  TIRNVARCWTYETSIALNTEVPNDLPYNDYYEYFGPDFKLHISPSNMTNLNTPDYIERIK  379

Query  338  SHVLENLRYIQHAPSVQMQEVPPDFYIPDFDE----DTQNPDERLDQHTQDKQIQR  183
            + + ENLR + HAPSVQM +VPPD    +  E    + ++PD+R+     DK + R
Sbjct  380  NKLFENLRMLPHAPSVQMVDVPPDTIDVEEQEKEAIENEDPDKRISIMASDKAVHR  435



>ref|XP_009929569.1| PREDICTED: histone deacetylase 1 [Opisthocomus hoazin]
Length=417

 Score =   204 bits (519),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 91/154 (59%), Positives = 115/154 (75%), Gaps = 0/154 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  + A +  +ISKV+ET+ P A+ LQCG+DSL+GDRLGCFNL+I GHA+CV FVK FN+
Sbjct  171  DESYEAIFKPVISKVMETFQPSAVALQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNL  230

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            P+L+ GGGGYT  NVARCW YET V LD+E+PNE+P NDY +YFGPD+ L I   ++ N 
Sbjct  231  PMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQ  290

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPD  267
            N+  YL  IK  + ENLR + HAP VQMQ +P D
Sbjct  291  NTNEYLEKIKQRLFENLRMLPHAPGVQMQPIPED  324



>gb|AHW42410.1| hdac1 [Echinococcus multilocularis]
 emb|CDS43279.1| histone deacetylase 1 [Echinococcus multilocularis]
Length=502

 Score =   206 bits (525),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 95/176 (54%), Positives = 128/176 (73%), Gaps = 4/176 (2%)
 Frame = -3

Query  698  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  519
            ++SKV+ET+ PGA VLQCGADSL+GDRLGCFNLS+ GH +CV F++ F IPLL+ GGGGY
Sbjct  242  VVSKVMETFRPGAAVLQCGADSLSGDRLGCFNLSLKGHGKCVEFLRSFPIPLLMLGGGGY  301

Query  518  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  339
            T  NVARCW YET + L++E+PN++P NDY +YFGPD+ L I   ++ NLN+  Y+  IK
Sbjct  302  TIRNVARCWTYETSIALNTEVPNDLPYNDYYEYFGPDFKLHISPSNMTNLNTPDYIERIK  361

Query  338  SHVLENLRYIQHAPSVQMQEVPPDFYIPDFDE----DTQNPDERLDQHTQDKQIQR  183
            + + ENLR + HAPSVQM +VPPD    +  E    + ++PD+R+     DK + R
Sbjct  362  NKLFENLRMLPHAPSVQMVDVPPDTIDVEEQEKEAIENEDPDKRISIMASDKAVHR  417



>ref|XP_011639813.1| PREDICTED: histone deacetylase Rpd3-like isoform X1 [Pogonomyrmex 
barbatus]
Length=497

 Score =   206 bits (524),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 99/183 (54%), Positives = 130/183 (71%), Gaps = 2/183 (1%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  + + ++ IISKV+ET+ P A+VLQCGADSL GDRLGCFNL++ GH +CV FVKK+N+
Sbjct  239  DESYESIFVPIISKVMETFQPSAVVLQCGADSLTGDRLGCFNLTVRGHGKCVEFVKKYNL  298

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            P L+ GGGGYT  NV+RCW YET V L  E+ NE+P NDY +YFGPD+ L I   ++ N 
Sbjct  299  PFLMVGGGGYTIRNVSRCWTYETSVALGCEIANELPYNDYFEYFGPDFKLHISPSNMANQ  358

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPD-FYIPDFD-EDTQNPDERLDQHTQDK  195
            N+  YL  IK+ + +NLR + HAP VQ+Q +P D   I D + E+  NPD+RL Q   DK
Sbjct  359  NTPEYLEKIKTRLFDNLRMLPHAPGVQIQAIPEDGAVIEDSEAEEKVNPDDRLPQRDLDK  418

Query  194  QIQ  186
            +IQ
Sbjct  419  RIQ  421



>ref|XP_007669959.1| PREDICTED: histone deacetylase 1 [Ornithorhynchus anatinus]
Length=428

 Score =   204 bits (520),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 91/154 (59%), Positives = 116/154 (75%), Gaps = 0/154 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  + A +  ++SKV+ET+ P A+VLQCG+DSL+GDRLGCFNL+I GHA+CV FVK FN+
Sbjct  188  DESYEAIFKPVMSKVMETFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNL  247

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            P+L+ GGGGYT  NVARCW YET V LD+E+PNE+P NDY +YFGPD+ L I   ++ N 
Sbjct  248  PMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQ  307

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPD  267
            N+  YL  IK  + ENLR + HAP VQMQ +P D
Sbjct  308  NTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPED  341



>ref|XP_008869930.1| hypothetical protein H310_06587 [Aphanomyces invadans]
 gb|ETW00932.1| hypothetical protein H310_06587 [Aphanomyces invadans]
Length=438

 Score =   205 bits (521),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 92/170 (54%), Positives = 124/170 (73%), Gaps = 1/170 (1%)
 Frame = -3

Query  698  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  519
            +I KV+E++ PGAIVLQCGADSL GDRLGCFNL++ GH ECV+FVK F +P +V GGGGY
Sbjct  241  VIEKVIESFRPGAIVLQCGADSLTGDRLGCFNLTVQGHGECVKFVKSFGLPTMVLGGGGY  300

Query  518  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKI-PGGHIENLNSKSYLGTI  342
            T  NV+RCWAYET V LD  + N+IP N+Y +Y+ P + L + P   +EN NS++YL  I
Sbjct  301  TIRNVSRCWAYETAVCLDETVSNDIPFNEYFEYYAPSFKLHLDPNTDLENCNSRAYLEDI  360

Query  341  KSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQ  192
            K+ + E+LR +  APSVQM  +PPDF + + D+D  +PD+R+D     +Q
Sbjct  361  KAKIFEHLRMLNGAPSVQMSVMPPDFVLKEEDDDAIDPDQRVDHDGTKRQ  410



>gb|KFW72873.1| Histone deacetylase 1, partial [Pygoscelis adeliae]
Length=453

 Score =   205 bits (521),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 92/154 (60%), Positives = 116/154 (75%), Gaps = 0/154 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  + A +  +ISKV+ET+ P A+VLQCG+DSL+GDRLGCFNL+I GHA+CV FVK FN+
Sbjct  218  DESYEAIFKPVISKVMETFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNL  277

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            P+L+ GGGGYT  NVARCW YET V LD+E+PNE+P NDY +YFGPD+ L I   ++ N 
Sbjct  278  PMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQ  337

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPD  267
            N+  YL  IK  + ENLR + HAP VQMQ +P D
Sbjct  338  NTNEYLEKIKQRLFENLRMLPHAPGVQMQPIPED  371



>gb|EMC82692.1| Histone deacetylase 1, partial [Columba livia]
Length=464

 Score =   205 bits (522),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 92/154 (60%), Positives = 116/154 (75%), Gaps = 0/154 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  + A +  +ISKV+ET+ P A+VLQCG+DSL+GDRLGCFNL+I GHA+CV FVK FN+
Sbjct  218  DESYEAIFKPVISKVMETFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNL  277

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            P+L+ GGGGYT  NVARCW YET V LD+E+PNE+P NDY +YFGPD+ L I   ++ N 
Sbjct  278  PMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQ  337

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPD  267
            N+  YL  IK  + ENLR + HAP VQMQ +P D
Sbjct  338  NTNEYLEKIKQRLFENLRMLPHAPGVQMQPIPED  371



>gb|KFV84480.1| Histone deacetylase 1, partial [Struthio camelus australis]
Length=446

 Score =   205 bits (521),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 92/154 (60%), Positives = 116/154 (75%), Gaps = 0/154 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  + A +  +ISKV+ET+ P A+VLQCG+DSL+GDRLGCFNL+I GHA+CV FVK FN+
Sbjct  218  DESYEAIFKPVISKVMETFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNL  277

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            P+L+ GGGGYT  NVARCW YET V LD+E+PNE+P NDY +YFGPD+ L I   ++ N 
Sbjct  278  PMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQ  337

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPD  267
            N+  YL  IK  + ENLR + HAP VQMQ +P D
Sbjct  338  NTNEYLEKIKQRLFENLRMLPHAPGVQMQPIPED  371



>gb|ACN25329.1| unknown [Zea mays]
Length=439

 Score =   204 bits (520),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 101/172 (59%), Positives = 132/172 (77%), Gaps = 0/172 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  + + +  I+ KV+E + PGA+VLQCGADSL+GDRLGCFNLSI GHAECVRF++ FN+
Sbjct  246  DESYQSLFKPIMGKVMEVFNPGAVVLQCGADSLSGDRLGCFNLSIKGHAECVRFMRSFNV  305

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            PLL+ GGGGYT  NVARCW YETGV L  EL +++P N+Y +YFGPDY+L +   ++EN 
Sbjct  306  PLLLLGGGGYTIRNVARCWCYETGVALGHELTDKMPPNEYYEYFGPDYTLHVAPSNMENK  365

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLD  213
            N++  L  IKS +L+NL  ++HAPSVQ QE PP+  +P+ DED +NPDER D
Sbjct  366  NTRHQLDDIKSKLLDNLSKLRHAPSVQFQERPPEAELPEQDEDKENPDERHD  417



>ref|XP_002438614.1| hypothetical protein SORBIDRAFT_10g022820 [Sorghum bicolor]
 gb|EER89981.1| hypothetical protein SORBIDRAFT_10g022820 [Sorghum bicolor]
Length=518

 Score =   206 bits (525),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 101/172 (59%), Positives = 132/172 (77%), Gaps = 0/172 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  + + +  I+ KV+E + PGA+VLQCGADSL+GDRLGCFNLSI GHAECVRF++ FN+
Sbjct  246  DESYQSLFKPIMGKVMEVFNPGAVVLQCGADSLSGDRLGCFNLSIKGHAECVRFMRSFNV  305

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            PLL+ GGGGYT  NVARCW YETGV L  EL +++P N+Y +YFGPDY+L +   ++EN 
Sbjct  306  PLLLLGGGGYTIRNVARCWCYETGVALGHELTDKMPPNEYYEYFGPDYTLHVAPSNMENK  365

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLD  213
            N++  L  IKS +L+NL  ++HAPSVQ QE PP+  +P+ DED +NPDER D
Sbjct  366  NTRHQLDDIKSKLLDNLSKLRHAPSVQFQERPPEAELPEQDEDKENPDERRD  417



>ref|XP_005191575.1| PREDICTED: histone deacetylase Rpd3 [Musca domestica]
Length=485

 Score =   206 bits (523),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 97/181 (54%), Positives = 126/181 (70%), Gaps = 1/181 (1%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  + + +  IISKV+ET+ P A+VLQCGADSL GDRLGCFNL++ GH  CV FVKK+N+
Sbjct  233  DEAYESIFEPIISKVMETFQPAAVVLQCGADSLTGDRLGCFNLTVKGHGRCVEFVKKYNL  292

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            P L+ GGGGYT  NV+RCW YET V L  E+ NE+P NDY +YFGPD+ L I   ++ N 
Sbjct  293  PFLMVGGGGYTIRNVSRCWTYETSVALGVEIANELPYNDYFEYFGPDFKLHISPSNMTNQ  352

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDF-DEDTQNPDERLDQHTQDKQ  192
            N+  YL  I++ + ENLR + HAP VQ+Q +P D    +  DED  + DERL Q  +DK+
Sbjct  353  NTTEYLEKIRNRLFENLRMLPHAPGVQIQAIPEDAINDESEDEDKVDKDERLTQADKDKR  412

Query  191  I  189
            I
Sbjct  413  I  413



>ref|XP_004643035.1| PREDICTED: histone deacetylase 1 [Octodon degus]
Length=390

 Score =   203 bits (517),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 88/144 (61%), Positives = 111/144 (77%), Gaps = 0/144 (0%)
 Frame = -3

Query  698  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  519
            ++SKV+E + P A+VLQCG+DSL+GDRLGCFNL+I GHA+CV FVK FN+P+L+ GGGGY
Sbjct  152  VMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGY  211

Query  518  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  339
            T  NVARCW YET V LD+E+PNE+P NDY +YFGPD+ L I   ++ N N+  YL  IK
Sbjct  212  TIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIK  271

Query  338  SHVLENLRYIQHAPSVQMQEVPPD  267
              + ENLR + HAP VQMQ +P D
Sbjct  272  QRLFENLRMLPHAPGVQMQAIPED  295



>ref|NP_989487.1| histone deacetylase 1 [Gallus gallus]
 sp|P56517.1|HDAC1_CHICK RecName: Full=Histone deacetylase 1; Short=HD1 [Gallus gallus]
 gb|AAB96923.1| histone deacetylase-1 [Gallus gallus]
 gb|AAC00504.1| erythrocyte histone deacetylase [Gallus gallus]
Length=480

 Score =   205 bits (522),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 92/154 (60%), Positives = 116/154 (75%), Gaps = 0/154 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  + A +  +ISKV+ET+ P A+VLQCG+DSL+GDRLGCFNL+I GHA+CV FVK FN+
Sbjct  234  DESYEAIFKPVISKVMETFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNL  293

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            P+L+ GGGGYT  NVARCW YET V LD+E+PNE+P NDY +YFGPD+ L I   ++ N 
Sbjct  294  PMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQ  353

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPD  267
            N+  YL  IK  + ENLR + HAP VQMQ +P D
Sbjct  354  NTNEYLEKIKQRLFENLRMLPHAPGVQMQPIPED  387



>emb|CDS23263.1| histone deacetylase 1 [Echinococcus granulosus]
Length=516

 Score =   206 bits (524),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 95/176 (54%), Positives = 128/176 (73%), Gaps = 4/176 (2%)
 Frame = -3

Query  698  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  519
            ++SKV+ET+ PGA VLQCGADSL+GDRLGCFNLS+ GH +CV F++ F IPLL+ GGGGY
Sbjct  242  VVSKVMETFRPGAAVLQCGADSLSGDRLGCFNLSLKGHGKCVEFLRSFPIPLLMLGGGGY  301

Query  518  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  339
            T  NVARCW YET + L++E+PN++P NDY +YFGPD+ L I   ++ NLN+  Y+  IK
Sbjct  302  TIRNVARCWTYETSIALNTEVPNDLPYNDYYEYFGPDFKLHISPSNMTNLNTPDYIERIK  361

Query  338  SHVLENLRYIQHAPSVQMQEVPPDFYIPDFDE----DTQNPDERLDQHTQDKQIQR  183
            + + ENLR + HAPSVQM +VPPD    +  E    + ++PD+R+     DK + R
Sbjct  362  NKLFENLRMLPHAPSVQMVDVPPDTIDVEEQEKEAIENEDPDKRISIMASDKAVHR  417



>gb|AAB99850.1| histone deacetylase 1 [Gallus gallus]
Length=480

 Score =   205 bits (522),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 92/154 (60%), Positives = 116/154 (75%), Gaps = 0/154 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  + A +  +ISKV+ET+ P A+VLQCG+DSL+GDRLGCFNL+I GHA+CV FVK FN+
Sbjct  234  DESYEAIFKPVISKVMETFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNL  293

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            P+L+ GGGGYT  NVARCW YET V LD+E+PNE+P NDY +YFGPD+ L I   ++ N 
Sbjct  294  PMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQ  353

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPD  267
            N+  YL  IK  + ENLR + HAP VQMQ +P D
Sbjct  354  NTNEYLEKIKQRLFENLRMLPHAPGVQMQPIPED  387



>ref|XP_002194370.2| PREDICTED: histone deacetylase 1, partial [Taeniopygia guttata]
Length=466

 Score =   205 bits (521),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 92/154 (60%), Positives = 116/154 (75%), Gaps = 0/154 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  + A +  +ISKV+ET+ P A+VLQCG+DSL+GDRLGCFNL+I GHA+CV FVK FN+
Sbjct  234  DESYEAIFKPVISKVMETFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNL  293

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            P+L+ GGGGYT  NVARCW YET V LD+E+PNE+P NDY +YFGPD+ L I   ++ N 
Sbjct  294  PMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQ  353

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPD  267
            N+  YL  IK  + ENLR + HAP VQMQ +P D
Sbjct  354  NTNEYLEKIKQRLFENLRMLPHAPGVQMQPIPED  387



>gb|ADO79635.1| histone deacetylase [Drosophila nasuta]
Length=518

 Score =   206 bits (524),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 99/182 (54%), Positives = 129/182 (71%), Gaps = 3/182 (2%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  + + ++ IISKV+ET+ P A+VLQCGADSL GDRLGCFNL++ GH +CV FVKK+N+
Sbjct  232  DDAYESIFVPIISKVMETFQPAAVVLQCGADSLTGDRLGCFNLTVKGHGKCVEFVKKYNL  291

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            P L+ GGGGYT  NV+RCW YET V L  E+ NE+P NDY +YFGPD+ L I   ++ N 
Sbjct  292  PFLMVGGGGYTIRNVSRCWTYETSVALAVEIANELPYNDYFEYFGPDFKLHISPSNMTNQ  351

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQ--NPDERLDQHTQDK  195
            N+  YL  IK+ + ENLR + HAP VQ+Q +P D  I D  ED +  + DERL Q  +DK
Sbjct  352  NTSEYLEKIKNRLFENLRMLPHAPGVQIQAIPEDA-INDESEDDEKVDKDERLPQSDKDK  410

Query  194  QI  189
            +I
Sbjct  411  RI  412



>gb|ADO79632.1| histone deacetylase [Drosophila albomicans]
 gb|ADO79633.1| histone deacetylase [Drosophila nasuta]
 gb|ADO79634.1| histone deacetylase [Drosophila nasuta]
 gb|ADO79636.1| histone deacetylase [Drosophila nasuta]
 gb|ADO79637.1| histone deacetylase [Drosophila nasuta]
Length=518

 Score =   206 bits (524),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 99/182 (54%), Positives = 129/182 (71%), Gaps = 3/182 (2%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  + + ++ IISKV+ET+ P A+VLQCGADSL GDRLGCFNL++ GH +CV FVKK+N+
Sbjct  232  DDAYESIFVPIISKVMETFQPAAVVLQCGADSLTGDRLGCFNLTVKGHGKCVEFVKKYNL  291

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            P L+ GGGGYT  NV+RCW YET V L  E+ NE+P NDY +YFGPD+ L I   ++ N 
Sbjct  292  PFLMVGGGGYTIRNVSRCWTYETSVALAVEIANELPYNDYFEYFGPDFKLHISPSNMTNQ  351

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQ--NPDERLDQHTQDK  195
            N+  YL  IK+ + ENLR + HAP VQ+Q +P D  I D  ED +  + DERL Q  +DK
Sbjct  352  NTSEYLEKIKNRLFENLRMLPHAPGVQIQAIPEDA-INDESEDDEKVDKDERLPQSDKDK  410

Query  194  QI  189
            +I
Sbjct  411  RI  412



>ref|XP_005058306.1| PREDICTED: histone deacetylase 1 isoform X1 [Ficedula albicollis]
Length=478

 Score =   205 bits (522),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 92/154 (60%), Positives = 116/154 (75%), Gaps = 0/154 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  + A +  +ISKV+ET+ P A+VLQCG+DSL+GDRLGCFNL+I GHA+CV FVK FN+
Sbjct  205  DESYEAIFKPVISKVMETFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNL  264

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            P+L+ GGGGYT  NVARCW YET V LD+E+PNE+P NDY +YFGPD+ L I   ++ N 
Sbjct  265  PMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQ  324

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPD  267
            N+  YL  IK  + ENLR + HAP VQMQ +P D
Sbjct  325  NTNEYLEKIKQRLFENLRMLPHAPGVQMQPIPED  358



>ref|XP_009096801.1| PREDICTED: histone deacetylase 1 [Serinus canaria]
Length=475

 Score =   205 bits (521),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 92/154 (60%), Positives = 116/154 (75%), Gaps = 0/154 (0%)
 Frame = -3

Query  728  DLGFXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  549
            D  + A +  +ISKV+ET+ P A+VLQCG+DSL+GDRLGCFNL+I GHA+CV FVK FN+
Sbjct  234  DESYEAIFKPVISKVMETFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNL  293

Query  548  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  369
            P+L+ GGGGYT  NVARCW YET V LD+E+PNE+P NDY +YFGPD+ L I   ++ N 
Sbjct  294  PMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQ  353

Query  368  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPD  267
            N+  YL  IK  + ENLR + HAP VQMQ +P D
Sbjct  354  NTNEYLEKIKQRLFENLRMLPHAPGVQMQPIPED  387



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1669417592084