BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig11382

Length=1536
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009622218.1|  PREDICTED: pollen-specific protein C13-like        192   2e-54   Nicotiana tomentosiformis
ref|XP_009760524.1|  PREDICTED: pollen-specific protein C13-like        191   4e-54   Nicotiana sylvestris
ref|XP_009600627.1|  PREDICTED: major pollen allergen Lol p 11-like     187   2e-52   Nicotiana tomentosiformis
ref|XP_010321468.1|  PREDICTED: LOW QUALITY PROTEIN: major pollen...    186   3e-52   
ref|XP_006366520.1|  PREDICTED: olee1-like protein-like                 186   3e-52   Solanum tuberosum [potatoes]
ref|XP_009797814.1|  PREDICTED: major pollen allergen Lol p 11-like     185   5e-52   Nicotiana sylvestris
ref|XP_004237415.1|  PREDICTED: pollen-specific protein C13             184   1e-51   Solanum lycopersicum
ref|XP_009764546.1|  PREDICTED: protein DOWNSTREAM OF FLC-like          184   2e-51   Nicotiana sylvestris
ref|XP_006344595.1|  PREDICTED: protein DOWNSTREAM OF FLC-like          181   2e-50   Solanum tuberosum [potatoes]
ref|XP_006355373.1|  PREDICTED: pollen-specific protein C13-like        177   4e-49   Solanum tuberosum [potatoes]
gb|AAF16869.1|AF109693_1  allergen-like protein BRSn20                  169   7e-46   Sambucus nigra
gb|EPS62385.1|  hypothetical protein M569_12405                         167   1e-45   Genlisea aurea
gb|EYU31033.1|  hypothetical protein MIMGU_mgv1a015328mg                164   3e-44   Erythranthe guttata [common monkey flower]
ref|XP_011097595.1|  PREDICTED: major pollen allergen Lol p 11-like     162   2e-43   Sesamum indicum [beniseed]
ref|XP_011090511.1|  PREDICTED: major pollen allergen Lol p 11-like     157   1e-41   Sesamum indicum [beniseed]
gb|EYU24008.1|  hypothetical protein MIMGU_mgv1a015363mg                148   2e-38   Erythranthe guttata [common monkey flower]
ref|XP_009794836.1|  PREDICTED: pollen-specific protein C13-like        145   6e-38   Nicotiana sylvestris
ref|XP_002268073.1|  PREDICTED: pollen-specific protein C13             147   6e-38   Vitis vinifera
gb|EPS69662.1|  hypothetical protein M569_05103                         143   1e-36   Genlisea aurea
ref|XP_010261236.1|  PREDICTED: pollen-specific protein C13-like        144   1e-36   Nelumbo nucifera [Indian lotus]
ref|XP_002392460.1|  hypothetical protein MPER_07958                    142   2e-36   
ref|XP_004150698.1|  PREDICTED: protein DOWNSTREAM OF FLC               140   1e-35   Cucumis sativus [cucumbers]
emb|CDP01424.1|  unnamed protein product                                140   1e-35   Coffea canephora [robusta coffee]
ref|XP_008445353.1|  PREDICTED: protein DOWNSTREAM OF FLC               139   6e-35   Cucumis melo [Oriental melon]
ref|XP_010060161.1|  PREDICTED: protein DOWNSTREAM OF FLC               138   8e-35   Eucalyptus grandis [rose gum]
ref|XP_010676978.1|  PREDICTED: major pollen allergen Lol p 11-like     138   9e-35   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003634471.1|  PREDICTED: pollen-specific protein C13             138   1e-34   Vitis vinifera
ref|XP_008348540.1|  PREDICTED: protein DOWNSTREAM OF FLC-like          137   2e-34   Malus domestica [apple tree]
gb|ABC86745.1|  pollen-specific protein                                 136   6e-34   Vitis pseudoreticulata
ref|XP_010538956.1|  PREDICTED: major pollen allergen Lol p 11          134   3e-33   Tarenaya hassleriana [spider flower]
ref|XP_009366359.1|  PREDICTED: protein DOWNSTREAM OF FLC-like          133   5e-33   Pyrus x bretschneideri [bai li]
gb|AFK37732.1|  unknown                                                 133   6e-33   Lotus japonicus
ref|XP_010455288.1|  PREDICTED: protein DOWNSTREAM OF FLC-like          132   1e-32   Camelina sativa [gold-of-pleasure]
ref|XP_002533139.1|  Pollen-specific protein C13 precursor, putative    132   1e-32   Ricinus communis
ref|XP_008245042.1|  PREDICTED: protein DOWNSTREAM OF FLC-like          132   2e-32   Prunus mume [ume]
ref|XP_007206364.1|  hypothetical protein PRUPE_ppa017800mg             131   3e-32   
ref|XP_010436385.1|  PREDICTED: protein DOWNSTREAM OF FLC-like          130   4e-32   Camelina sativa [gold-of-pleasure]
ref|XP_004289324.1|  PREDICTED: protein DOWNSTREAM OF FLC-like          130   6e-32   Fragaria vesca subsp. vesca
ref|XP_010269200.1|  PREDICTED: pollen-specific protein C13-like        130   6e-32   Nelumbo nucifera [Indian lotus]
ref|XP_010090546.1|  hypothetical protein L484_016596                   131   7e-32   
gb|AFK47744.1|  unknown                                                 129   1e-31   Lotus japonicus
ref|XP_011621414.1|  PREDICTED: olee1-like protein                      129   2e-31   Amborella trichopoda
ref|XP_008234688.1|  PREDICTED: protein DOWNSTREAM OF FLC-like          129   2e-31   Prunus mume [ume]
ref|XP_002513885.1|  Pollen-specific protein C13 precursor, putative    129   2e-31   Ricinus communis
ref|XP_006289520.1|  hypothetical protein CARUB_v10003061mg             128   2e-31   Capsella rubella
emb|CDY12288.1|  BnaA09g24880D                                          127   7e-31   Brassica napus [oilseed rape]
ref|XP_009134109.1|  PREDICTED: pollen-specific protein C13             127   8e-31   Brassica rapa
ref|XP_002307393.1|  pollen Ole e 1 allergen and extensin family ...    126   1e-30   Populus trichocarpa [western balsam poplar]
ref|XP_006857531.1|  PREDICTED: pollen-specific protein C13             126   2e-30   Amborella trichopoda
ref|XP_002310579.1|  hypothetical protein POPTR_0007s05750g             126   2e-30   
ref|XP_002301038.1|  pollen Ole e 1 allergen and extensin family ...    125   3e-30   Populus trichocarpa [western balsam poplar]
gb|ABK94215.1|  unknown                                                 125   4e-30   Populus trichocarpa [western balsam poplar]
ref|XP_011016068.1|  PREDICTED: pollen-specific protein C13-like        124   6e-30   Populus euphratica
ref|XP_012078096.1|  PREDICTED: pollen-specific protein C13             124   6e-30   Jatropha curcas
ref|XP_011006159.1|  PREDICTED: pollen-specific protein C13-like        124   7e-30   Populus euphratica
gb|KJB59946.1|  hypothetical protein B456_009G282200                    124   8e-30   Gossypium raimondii
emb|CDY05022.1|  BnaC03g28200D                                          124   8e-30   
ref|NP_567338.1|  protein SAH7                                          124   1e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008797140.1|  PREDICTED: major pollen allergen Lol p 11-like     124   2e-29   Phoenix dactylifera
ref|XP_012093159.1|  PREDICTED: protein DOWNSTREAM OF FLC               123   2e-29   Jatropha curcas
gb|KFK32118.1|  hypothetical protein AALP_AA6G200700                    122   3e-29   Arabis alpina [alpine rockcress]
ref|XP_010105888.1|  hypothetical protein L484_021545                   122   5e-29   
gb|ABK92993.1|  unknown                                                 122   5e-29   Populus trichocarpa [western balsam poplar]
ref|XP_008234009.1|  PREDICTED: pollen-specific protein C13             122   6e-29   Prunus mume [ume]
gb|KDO80906.1|  hypothetical protein CISIN_1g031458mg                   122   6e-29   Citrus sinensis [apfelsine]
ref|XP_006472638.1|  PREDICTED: pollen-specific protein C13-like        122   7e-29   Citrus sinensis [apfelsine]
ref|XP_006434027.1|  hypothetical protein CICLE_v10002743mg             121   9e-29   Citrus clementina [clementine]
ref|XP_006397273.1|  hypothetical protein EUTSA_v10029031mg             121   1e-28   Eutrema salsugineum [saltwater cress]
ref|XP_006464247.1|  PREDICTED: protein DOWNSTREAM OF FLC-like          120   2e-28   
ref|XP_010424432.1|  PREDICTED: protein DOWNSTREAM OF FLC-like          123   3e-28   
ref|XP_002872410.1|  hypothetical protein ARALYDRAFT_489767             120   3e-28   
ref|XP_007018845.1|  Pollen-specific protein C13, putative              120   3e-28   
ref|NP_001238723.1|  uncharacterized protein LOC100499710 precursor     119   4e-28   Glycine max [soybeans]
gb|KHN19737.1|  Pollen-specific protein C13                             119   6e-28   Glycine soja [wild soybean]
ref|XP_007225977.1|  hypothetical protein PRUPE_ppa012675mg             119   6e-28   Prunus persica
ref|XP_006302909.1|  hypothetical protein CARUB_v10021044mg             119   7e-28   Capsella rubella
gb|AAT08700.1|  pollen-specific protein                                 119   7e-28   Hyacinthus orientalis [common hyacinth]
ref|XP_009421183.1|  PREDICTED: pollen-specific protein C13-like        119   8e-28   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007136225.1|  hypothetical protein PHAVU_009G028900g             118   1e-27   Phaseolus vulgaris [French bean]
ref|XP_009403224.1|  PREDICTED: pollen-specific protein C13-like        118   2e-27   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009408781.1|  PREDICTED: pollen-specific protein C13-like        117   4e-27   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006390031.1|  hypothetical protein EUTSA_v10019236mg             117   5e-27   Eutrema salsugineum [saltwater cress]
gb|AAM08621.1|AC107314_12  Putative Pollen specific protein C13 p...    116   7e-27   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006652233.1|  PREDICTED: pollen-specific protein C13-like        116   7e-27   
ref|XP_004500607.1|  PREDICTED: pollen-specific protein C13-like        116   7e-27   Cicer arietinum [garbanzo]
ref|XP_011030966.1|  PREDICTED: protein DOWNSTREAM OF FLC               116   8e-27   Populus euphratica
ref|XP_002307104.1|  hypothetical protein POPTR_0005s08000g             115   8e-27   Populus trichocarpa [western balsam poplar]
ref|XP_006428158.1|  hypothetical protein CICLE_v10027141mg             118   1e-26   
dbj|BAJ86956.1|  predicted protein                                      115   1e-26   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_011653120.1|  PREDICTED: major pollen allergen Lol p 11-like     115   2e-26   Cucumis sativus [cucumbers]
ref|NP_001064462.2|  Os10g0371000                                       116   2e-26   
ref|XP_010521200.1|  PREDICTED: major pollen allergen Lol p 11          115   2e-26   Tarenaya hassleriana [spider flower]
ref|XP_003566418.1|  PREDICTED: major pollen allergen Lol p 11-like     115   2e-26   Brachypodium distachyon [annual false brome]
ref|XP_007025385.1|  Olee1-like protein                                 115   2e-26   Theobroma cacao [chocolate]
ref|XP_010527375.1|  PREDICTED: major pollen allergen Lol p 11-like     115   2e-26   Tarenaya hassleriana [spider flower]
gb|KJB29302.1|  hypothetical protein B456_005G093100                    114   3e-26   Gossypium raimondii
gb|EMS52933.1|  hypothetical protein TRIUR3_31283                       115   3e-26   Triticum urartu
ref|XP_010535648.1|  PREDICTED: major pollen allergen Lol p 11-like     114   3e-26   Tarenaya hassleriana [spider flower]
ref|XP_010942359.1|  PREDICTED: major pollen allergen Lol p 11-like     114   4e-26   Elaeis guineensis
gb|ACQ44229.1|  putative pollen Ole e 1 allergen and extensin fam...    114   4e-26   Arabis alpina [alpine rockcress]
ref|XP_008453801.1|  PREDICTED: major pollen allergen Lol p 11-like     114   4e-26   Cucumis melo [Oriental melon]
ref|XP_004971474.1|  PREDICTED: pollen allergen Phl p 11-like           114   4e-26   Setaria italica
ref|NP_001237189.1|  uncharacterized protein LOC100305566 precursor     114   5e-26   
gb|KFK42186.1|  hypothetical protein AALP_AA2G222600                    114   5e-26   Arabis alpina [alpine rockcress]
ref|XP_008782123.1|  PREDICTED: pollen-specific protein C13-like        114   7e-26   Phoenix dactylifera
ref|XP_009383585.1|  PREDICTED: pollen-specific protein C13-like        114   7e-26   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008376286.1|  PREDICTED: pollen-specific protein C13-like        113   8e-26   
ref|XP_008378536.1|  PREDICTED: protein DOWNSTREAM OF FLC-like          115   9e-26   
ref|XP_010942360.1|  PREDICTED: pollen allergen Phl p 11-like           113   1e-25   Elaeis guineensis
ref|XP_006661725.1|  PREDICTED: pollen-specific protein C13-like        112   3e-25   Oryza brachyantha
ref|XP_006399503.1|  hypothetical protein EUTSA_v10014875mg             112   3e-25   Eutrema salsugineum [saltwater cress]
ref|XP_009106450.1|  PREDICTED: protein DOWNSTREAM OF FLC               112   3e-25   Brassica rapa
emb|CDX87484.1|  BnaA07g33890D                                          112   3e-25   
ref|XP_003638771.1|  Pollen allergen Phl p                              111   4e-25   
ref|XP_010472003.1|  PREDICTED: major pollen allergen Lol p 11-like     112   4e-25   Camelina sativa [gold-of-pleasure]
emb|CDX88408.1|  BnaC06g38520D                                          111   4e-25   
ref|XP_009409254.1|  PREDICTED: major pollen allergen Lol p 11-like     111   4e-25   
ref|XP_006601773.1|  PREDICTED: uncharacterized protein LOC100527...    111   4e-25   
gb|KHG30321.1|  Anther-specific LAT52                                   111   5e-25   Gossypium arboreum [tree cotton]
ref|XP_010428908.1|  PREDICTED: major pollen allergen Lol p 11-like     111   5e-25   Camelina sativa [gold-of-pleasure]
ref|XP_010911793.1|  PREDICTED: pollen-specific protein C13-like        111   7e-25   Elaeis guineensis
gb|AAN76546.1|AF393475_1  LLP-B3 protein                                110   7e-25   Lilium longiflorum [Easter lily]
ref|NP_001057857.1|  Os06g0556600                                       111   9e-25   
gb|EAY93952.1|  hypothetical protein OsI_15725                          110   1e-24   Oryza sativa Indica Group [Indian rice]
ref|XP_009396935.1|  PREDICTED: pollen-specific protein C13-like        110   1e-24   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007048005.1|  Pollen-specific protein C13, putative              109   2e-24   
ref|XP_007141147.1|  hypothetical protein PHAVU_008G171500g             108   3e-24   Phaseolus vulgaris [French bean]
ref|XP_009125327.1|  PREDICTED: protein DOWNSTREAM OF FLC-like          108   4e-24   Brassica rapa
emb|CDY40079.1|  BnaC02g00510D                                          108   4e-24   Brassica napus [oilseed rape]
emb|CDX85777.1|  BnaA02g00360D                                          108   5e-24   
emb|CAH66537.1|  H0209H04.4                                             108   5e-24   Oryza sativa [red rice]
ref|XP_010416770.1|  PREDICTED: major pollen allergen Lol p 11-like     108   5e-24   Camelina sativa [gold-of-pleasure]
ref|NP_001052674.1|  Os04g0398700                                       108   6e-24   
ref|XP_008803750.1|  PREDICTED: pollen-specific protein C13             108   1e-23   Phoenix dactylifera
gb|KCW69946.1|  hypothetical protein EUGRSUZ_F03264                     107   1e-23   Eucalyptus grandis [rose gum]
ref|XP_004143635.1|  PREDICTED: olee1-like protein                      107   2e-23   Cucumis sativus [cucumbers]
gb|AAM78186.1|  putative SAH7 protein                                   105   2e-23   Gossypium raimondii
ref|XP_009122085.1|  PREDICTED: protein DOWNSTREAM OF FLC-like          107   2e-23   
gb|AAZ67595.1|  80A08_10                                                107   2e-23   Brassica rapa subsp. pekinensis [bai cai]
ref|XP_010062811.1|  PREDICTED: olee1-like protein                      107   2e-23   
ref|XP_006645671.1|  PREDICTED: pollen allergen Phl p 11-like           106   2e-23   Oryza brachyantha
ref|NP_177927.1|  pollen Ole e 1 allergen and extensin family pro...    107   2e-23   Arabidopsis thaliana [mouse-ear cress]
ref|NP_196575.1|  pollen_Ole_e_I-domain containing protein              106   3e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004975466.1|  PREDICTED: pollen-specific protein C13-like        106   3e-23   Setaria italica
ref|XP_002873440.1|  pollen ole e 1 allergen and extensin family ...    106   4e-23   
ref|XP_009402012.1|  PREDICTED: pollen-specific protein C13-like        105   5e-23   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010277041.1|  PREDICTED: anther-specific protein LAT52           105   6e-23   Nelumbo nucifera [Indian lotus]
ref|XP_008467237.1|  PREDICTED: olee1-like protein                      105   6e-23   Cucumis melo [Oriental melon]
ref|XP_010491667.1|  PREDICTED: protein DOWNSTREAM OF FLC               105   8e-23   Camelina sativa [gold-of-pleasure]
ref|XP_010547621.1|  PREDICTED: protein DOWNSTREAM OF FLC               105   1e-22   Tarenaya hassleriana [spider flower]
ref|XP_010453035.1|  PREDICTED: protein DOWNSTREAM OF FLC-like          105   1e-22   Camelina sativa [gold-of-pleasure]
sp|O49813.1|OLEE1_BETPN  RecName: Full=Olee1-like protein; Flags:...    105   1e-22   Betula pendula [white birch]
gb|ACK44512.1|  AT5G10130-like protein                                  105   1e-22   Arabidopsis arenosa
ref|XP_010422886.1|  PREDICTED: protein DOWNSTREAM OF FLC               105   1e-22   Camelina sativa [gold-of-pleasure]
ref|XP_009386950.1|  PREDICTED: pollen-specific protein C13-like        105   1e-22   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010025486.1|  PREDICTED: protein DOWNSTREAM OF FLC               105   1e-22   Eucalyptus grandis [rose gum]
ref|XP_006288804.1|  hypothetical protein CARUB_v10002136mg             105   1e-22   
ref|XP_011006522.1|  PREDICTED: olee1-like protein                      104   1e-22   Populus euphratica
dbj|BAK06698.1|  predicted protein                                      104   1e-22   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010057097.1|  PREDICTED: olee1-like protein                      104   2e-22   Eucalyptus grandis [rose gum]
ref|XP_006370166.1|  pollen Ole e 1 allergen and extensin family ...    104   2e-22   Populus trichocarpa [western balsam poplar]
ref|XP_010478273.1|  PREDICTED: pollen-specific protein-like At4g...    104   2e-22   Camelina sativa [gold-of-pleasure]
ref|XP_010460686.1|  PREDICTED: pollen-specific protein-like At4g...    104   2e-22   Camelina sativa [gold-of-pleasure]
ref|XP_004983223.1|  PREDICTED: pollen-specific protein C13-like        104   2e-22   Setaria italica
ref|XP_010499433.1|  PREDICTED: pollen-specific protein-like At4g...    104   2e-22   Camelina sativa [gold-of-pleasure]
gb|AAM78187.1|  putative SAH7 protein                                   102   2e-22   Gossypium barbadense [Egyptian cotton]
ref|XP_003581152.1|  PREDICTED: pollen-specific protein C13-like        104   2e-22   Brachypodium distachyon [annual false brome]
ref|XP_004502439.1|  PREDICTED: pollen-specific protein C13-like        103   2e-22   Cicer arietinum [garbanzo]
ref|XP_002523378.1|  Anther-specific protein LAT52 precursor, put...    103   3e-22   Ricinus communis
ref|XP_010916905.1|  PREDICTED: pollen-specific protein C13-like        103   4e-22   Elaeis guineensis
gb|ACG32277.1|  pollen-specific protein C13 precursor                   103   4e-22   Zea mays [maize]
ref|XP_003573867.1|  PREDICTED: pollen-specific protein C13             103   4e-22   Brachypodium distachyon [annual false brome]
ref|NP_001146979.1|  LOC100280588 precursor                             103   5e-22   Zea mays [maize]
ref|XP_011029563.1|  PREDICTED: olee1-like protein                      102   7e-22   Populus euphratica
emb|CDY43319.1|  BnaC03g58910D                                          102   7e-22   Brassica napus [oilseed rape]
dbj|BAK07321.1|  predicted protein                                      102   8e-22   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AFO38383.1|  putative pollen-specific protein C13                    103   8e-22   Glycine max [soybeans]
gb|AAM78188.1|  putative SAH7 protein                                   101   9e-22   Gossypium barbadense [Egyptian cotton]
ref|XP_002889170.1|  pollen ole e 1 allergen and extensin family ...    102   1e-21   Arabidopsis lyrata subsp. lyrata
ref|XP_002887714.1|  pollen ole e 1 allergen and extensin family ...    101   1e-21   Arabidopsis lyrata subsp. lyrata
gb|AAM78185.1|  putative SAH7 protein                                   100   1e-21   Gossypium herbaceum [Arabian cotton]
ref|XP_011070069.1|  PREDICTED: anther-specific protein LAT52-like      101   2e-21   Sesamum indicum [beniseed]
ref|XP_002316866.1|  pollen Ole e 1 allergen and extensin family ...    101   2e-21   Populus trichocarpa [western balsam poplar]
gb|AAN60344.1|  unknown                                                 101   2e-21   Arabidopsis thaliana [mouse-ear cress]
gb|ADI55168.1|  AS1                                                     102   2e-21   Gossypium hirsutum [American cotton]
ref|XP_008439743.1|  PREDICTED: olee1-like protein isoform X2           101   2e-21   Cucumis melo [Oriental melon]
ref|XP_002454899.1|  hypothetical protein SORBIDRAFT_03g001020          101   3e-21   Sorghum bicolor [broomcorn]
gb|KFK44745.1|  hypothetical protein AALP_AA1G297400                    101   3e-21   Arabis alpina [alpine rockcress]
ref|XP_008439742.1|  PREDICTED: olee1-like protein isoform X1           101   3e-21   Cucumis melo [Oriental melon]
ref|XP_003543768.1|  PREDICTED: protein DOWNSTREAM OF FLC-like          100   3e-21   Glycine max [soybeans]
ref|NP_001148443.1|  pollen allergen Phl p 11 precursor                 101   3e-21   Zea mays [maize]
ref|XP_009109686.1|  PREDICTED: pollen-specific protein-like At4g...    101   3e-21   Brassica rapa
ref|NP_174209.1|  pollen Ole e 1 allergen and extensin family pro...    100   4e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004960638.1|  PREDICTED: pollen allergen Phl p 11-like           100   4e-21   Setaria italica
ref|XP_006664913.1|  PREDICTED: pollen allergen Phl p 11-like           100   5e-21   Oryza brachyantha
ref|XP_004134927.1|  PREDICTED: olee1-like protein                      100   5e-21   Cucumis sativus [cucumbers]
gb|KJB61584.1|  hypothetical protein B456_009G368100                    100   6e-21   Gossypium raimondii
gb|AEW90946.1|  pollen-specific protein F8-4                            100   7e-21   Secale cereale x Triticum turgidum subsp. durum [hexaploid triticale]
gb|AAM78189.1|  putative SAH7 protein                                 99.0    7e-21   Gossypioides kirkii
emb|CDY21637.1|  BnaC09g46550D                                          100   8e-21   Brassica napus [oilseed rape]
gb|EMT13715.1|  Pollen allergen Phl p 11                              99.8    1e-20   
ref|XP_003601984.1|  Pollen-specific protein C13                      99.4    1e-20   Medicago truncatula
ref|XP_002489221.1|  hypothetical protein SORBIDRAFT_0012s014630      99.4    1e-20   Sorghum bicolor [broomcorn]
ref|XP_011098227.1|  PREDICTED: anther-specific protein LAT52-like    99.4    1e-20   Sesamum indicum [beniseed]
sp|Q8LGR0.1|CHE1_CHEAL  RecName: Full=Pollen allergen Che a 1; Al...  99.4    1e-20   Chenopodium album [lamb's-quarters]
ref|XP_007021723.1|  Pollen Ole e 1 allergen and extensin family ...  99.0    2e-20   Theobroma cacao [chocolate]
gb|KHG10520.1|  Olee1-like protein                                    99.4    2e-20   Gossypium arboreum [tree cotton]
gb|AAF17689.1|AC009243_16  F28K19.26                                    104   2e-20   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001131377.1|  uncharacterized protein LOC100192702 precursor   98.6    2e-20   Zea mays [maize]
gb|EYU45018.1|  hypothetical protein MIMGU_mgv1a015317mg              98.2    3e-20   Erythranthe guttata [common monkey flower]
gb|KHG12773.1|  Olee1-like protein                                    99.0    3e-20   Gossypium arboreum [tree cotton]
ref|XP_004251892.1|  PREDICTED: anther-specific protein LAT52-like    97.8    4e-20   Solanum lycopersicum
emb|CDY21640.1|  BnaC09g46520D                                        97.4    4e-20   Brassica napus [oilseed rape]
gb|AEW90940.1|  group 11 grass pollen allergen F7-1                   98.2    4e-20   Secale cereale x Triticum turgidum subsp. durum [hexaploid triticale]
gb|AAX93750.1|  pollen allergen Cro s 1                               97.8    5e-20   Crocus sativus [saffron crocus]
gb|AFW77548.1|  pollen allergen Phl p 11                              97.8    5e-20   
ref|XP_004959259.1|  PREDICTED: pollen-specific protein C13-like      97.8    5e-20   
emb|CDX99789.1|  BnaC05g22110D                                        97.8    5e-20   
gb|KHG13789.1|  Anther-specific LAT52                                 98.2    6e-20   Gossypium arboreum [tree cotton]
ref|XP_008450951.1|  PREDICTED: olee1-like protein                    97.4    7e-20   Cucumis melo [Oriental melon]
ref|XP_004134662.2|  PREDICTED: olee1-like protein                    97.4    7e-20   Cucumis sativus [cucumbers]
gb|AFK46977.1|  unknown                                               97.4    8e-20   Lotus japonicus
gb|AEW90948.1|  pollen-specific protein F8-6                          97.1    8e-20   Secale cereale x Triticum turgidum subsp. durum [hexaploid triticale]
ref|XP_012078584.1|  PREDICTED: olee1-like protein                    97.1    9e-20   Jatropha curcas
ref|XP_004248244.1|  PREDICTED: anther-specific protein LAT52         97.1    9e-20   
gb|AFK47865.1|  unknown                                               97.1    9e-20   Lotus japonicus
ref|XP_010103032.1|  hypothetical protein L484_005787                 96.7    1e-19   Morus notabilis
ref|XP_003565925.1|  PREDICTED: pollen allergen Phl p 11              97.1    1e-19   Brachypodium distachyon [annual false brome]
ref|XP_006304746.1|  hypothetical protein CARUB_v10012122mg           97.1    1e-19   Capsella rubella
ref|XP_004144129.1|  PREDICTED: olee1-like protein                    96.7    1e-19   Cucumis sativus [cucumbers]
ref|NP_001150330.1|  pollen allergen Phl p 11 precursor               96.3    1e-19   Zea mays [maize]
ref|XP_008343344.1|  PREDICTED: LOW QUALITY PROTEIN: olee1-like p...  95.1    1e-19   
gb|AEW90941.1|  group 11 grass pollen allergen F7-4                   96.3    2e-19   Secale cereale x Triticum turgidum subsp. durum [hexaploid triticale]
ref|XP_009115274.1|  PREDICTED: pollen-specific protein-like At4g...  96.3    2e-19   Brassica rapa
gb|AEW90942.1|  group 11 grass pollen allergen F7-6                   96.3    2e-19   Secale cereale x Triticum turgidum subsp. durum [hexaploid triticale]
gb|AEW90943.1|  group 11 grass pollen allergen F8-6                   95.9    2e-19   Secale cereale x Triticum turgidum subsp. durum [hexaploid triticale]
ref|XP_003541705.1|  PREDICTED: olee1-like protein-like               95.5    3e-19   Glycine max [soybeans]
emb|CAA78897.1|  pollen specific gene                                 95.5    3e-19   Oryza sativa Indica Group [Indian rice]
ref|XP_009617824.1|  PREDICTED: olee1-like protein                    95.5    4e-19   Nicotiana tomentosiformis
ref|XP_009794171.1|  PREDICTED: anther-specific protein LAT52         95.1    4e-19   Nicotiana sylvestris
ref|XP_002522577.1|  Pollen allergen Che a 1 precursor, putative      95.1    4e-19   Ricinus communis
gb|EAZ45758.1|  hypothetical protein OsJ_30442                        94.7    4e-19   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009604804.1|  PREDICTED: anther-specific protein LAT52         94.7    6e-19   Nicotiana tomentosiformis
gb|KHN44330.1|  Pollen-specific protein C13                           93.6    6e-19   Glycine soja [wild soybean]
dbj|BAD46623.1|  putative Pollen specific protein C13 precursor       94.4    8e-19   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010941451.1|  PREDICTED: pollen-specific protein C13-like      94.4    8e-19   Elaeis guineensis
gb|EEC85106.1|  hypothetical protein OsI_32490                        94.4    8e-19   Oryza sativa Indica Group [Indian rice]
ref|NP_001064001.1|  Os09g0572800                                     94.4    8e-19   
ref|XP_003546028.1|  PREDICTED: olee1-like protein-like               94.4    8e-19   Glycine max [soybeans]
gb|ADK22842.1|  Sal k 5                                               94.0    9e-19   Kali turgidum [common saltwort]
gb|KJB61585.1|  hypothetical protein B456_009G368200                  94.4    1e-18   Gossypium raimondii
ref|XP_002447728.1|  hypothetical protein SORBIDRAFT_06g014740        94.4    1e-18   Sorghum bicolor [broomcorn]
ref|XP_002459879.1|  hypothetical protein SORBIDRAFT_02g012930        94.0    1e-18   
ref|XP_004485892.1|  PREDICTED: olee1-like protein-like               93.6    1e-18   Cicer arietinum [garbanzo]
ref|XP_006360048.1|  PREDICTED: anther-specific protein LAT52-like    93.6    1e-18   Solanum tuberosum [potatoes]
gb|ACG33223.1|  pollen-specific protein C13 precursor                 93.6    1e-18   Zea mays [maize]
ref|XP_009102877.1|  PREDICTED: pollen-specific protein-like At4g...  93.6    1e-18   Brassica rapa
emb|CDY69202.1|  BnaCnng62360D                                        93.6    1e-18   Brassica napus [oilseed rape]
gb|ACU23617.1|  unknown                                               93.6    1e-18   Glycine max [soybeans]
ref|XP_006415610.1|  hypothetical protein EUTSA_v10008921mg           93.6    2e-18   Eutrema salsugineum [saltwater cress]
ref|XP_010686203.1|  PREDICTED: pollen allergen Che a 1               93.6    2e-18   Beta vulgaris subsp. vulgaris [field beet]
gb|ACF82695.1|  unknown                                               93.6    2e-18   Zea mays [maize]
sp|Q8H6L7.1|PHLB_PHLPR  RecName: Full=Pollen allergen Phl p 11; A...  92.4    2e-18   Phleum pratense [timothy]
gb|AFB73932.1|  LAT52-like protein                                    93.2    2e-18   Lycium barbarum [Duke of Argyll's teatree]
gb|AFB73931.1|  LAT52-like protein                                    92.8    2e-18   Lycium barbarum [Duke of Argyll's teatree]
ref|XP_010680579.1|  PREDICTED: major pollen allergen Lol p 11-like   92.8    3e-18   Beta vulgaris subsp. vulgaris [field beet]
emb|CDY14639.1|  BnaC02g24740D                                        92.0    3e-18   Brassica napus [oilseed rape]
ref|XP_006661014.1|  PREDICTED: pollen-specific protein C13-like      92.8    3e-18   Oryza brachyantha
ref|XP_009778120.1|  PREDICTED: anther-specific protein LAT52-like    92.4    3e-18   Nicotiana sylvestris
gb|ACJ83911.1|  unknown                                               92.0    5e-18   Medicago truncatula
ref|XP_010540511.1|  PREDICTED: pollen-specific protein-like At4g...  92.0    5e-18   Tarenaya hassleriana [spider flower]
ref|XP_010518802.1|  PREDICTED: pollen-specific protein-like At4g...  92.0    6e-18   Tarenaya hassleriana [spider flower]
ref|XP_009773994.1|  PREDICTED: olee1-like protein                    92.0    7e-18   Nicotiana sylvestris
ref|XP_007148052.1|  hypothetical protein PHAVU_006G176500g           91.7    8e-18   Phaseolus vulgaris [French bean]
ref|XP_006358942.1|  PREDICTED: anther-specific protein LAT52-like    91.3    8e-18   Solanum tuberosum [potatoes]
ref|XP_008775180.1|  PREDICTED: pollen-specific protein C13-like      91.7    9e-18   
ref|NP_001148343.1|  LOC100281953 precursor                           91.3    1e-17   
ref|XP_012091767.1|  PREDICTED: olee1-like protein                    90.9    1e-17   Jatropha curcas
ref|XP_011079002.1|  PREDICTED: olee1-like protein                    90.9    1e-17   Sesamum indicum [beniseed]
ref|XP_008381078.1|  PREDICTED: protein DOWNSTREAM OF FLC-like        90.1    2e-17   
gb|EYU43331.1|  hypothetical protein MIMGU_mgv1a014984mg              90.5    2e-17   
ref|XP_011075462.1|  PREDICTED: olee1-like protein                    90.1    2e-17   
ref|XP_010549400.1|  PREDICTED: pollen-specific protein-like At4g...  90.1    3e-17   
ref|XP_009602640.1|  PREDICTED: anther-specific protein LAT52-like    89.7    3e-17   
ref|NP_001105351.1|  pollen-specific protein C13 precursor            89.7    4e-17   
emb|CDP06002.1|  unnamed protein product                              89.4    4e-17   
ref|XP_006414083.1|  hypothetical protein EUTSA_v10026398mg           89.4    5e-17   
ref|XP_010538209.1|  PREDICTED: pollen-specific protein-like At4g...  89.4    5e-17   
gb|KHG25858.1|  Olee1-like protein                                    89.0    6e-17   
gb|KFK31513.1|  hypothetical protein AALP_AA6G122400                  89.4    6e-17   
emb|CDP16230.1|  unnamed protein product                              89.0    6e-17   
ref|XP_010441660.1|  PREDICTED: pollen-specific protein-like At4g...  89.4    6e-17   
sp|Q7M1X5.1|LOLB_LOLPR  RecName: Full=Major pollen allergen Lol p...  88.2    6e-17   
emb|CDX87759.1|  BnaC02g31900D                                        89.0    6e-17   
ref|XP_006398273.1|  hypothetical protein EUTSA_v10001051mg           89.0    6e-17   
ref|XP_009128814.1|  PREDICTED: pollen-specific protein-like At4g...  89.0    7e-17   
emb|CDX77620.1|  BnaC07g18740D                                        89.0    8e-17   
ref|XP_010481521.1|  PREDICTED: pollen-specific protein-like At4g...  89.0    8e-17   
gb|KJB27014.1|  hypothetical protein B456_004G272200                  88.6    9e-17   
ref|XP_011101379.1|  PREDICTED: olee1-like protein                    88.6    1e-16   
ref|XP_002863445.1|  hypothetical protein ARALYDRAFT_494394           88.6    1e-16   
ref|XP_011080816.1|  PREDICTED: major pollen allergen Ole e 1-like    88.6    1e-16   
ref|XP_011075627.1|  PREDICTED: olee1-like protein                    88.2    1e-16   
ref|XP_010529196.1|  PREDICTED: pollen-specific protein-like At4g...  88.6    1e-16   
gb|ERN00833.1|  hypothetical protein AMTR_s00103p00069180             87.4    1e-16   
dbj|BAB09316.1|  Ole e I (main olive allergen)-like protein           88.2    1e-16   
ref|XP_002890794.1|  hypothetical protein ARALYDRAFT_336019           93.2    1e-16   
ref|XP_011085997.1|  PREDICTED: olee1-like protein                    88.2    1e-16   
ref|NP_568650.1|  pollen_Ole_e_I-domain containing protein            88.2    1e-16   
gb|AEW90945.1|  group 11 grass pollen allergen R1-2                   87.8    2e-16   
gb|KFK28529.1|  hypothetical protein AALP_AA7G008600                  88.2    2e-16   
gb|EYU26327.1|  hypothetical protein MIMGU_mgv1a015422mg              87.4    2e-16   
emb|CDY01556.1|  BnaC07g35460D                                        87.8    2e-16   
ref|XP_006348395.1|  PREDICTED: anther-specific protein LAT52-like    87.4    2e-16   
ref|XP_002273294.1|  PREDICTED: olee1-like protein                    87.4    2e-16   
ref|XP_010494740.1|  PREDICTED: pollen-specific protein-like At4g...  87.4    2e-16   
ref|XP_009761932.1|  PREDICTED: anther-specific protein LAT52-like    87.0    3e-16   
gb|KJB48905.1|  hypothetical protein B456_008G104000                  87.0    3e-16   
ref|XP_009136942.1|  PREDICTED: pollen-specific protein-like At4g...  87.0    3e-16   
ref|XP_002440811.1|  hypothetical protein SORBIDRAFT_09g007260        87.0    3e-16   
ref|XP_009132011.1|  PREDICTED: pollen-specific protein-like At4g...  86.3    6e-16   
emb|CDP16229.1|  unnamed protein product                              86.3    6e-16   
ref|XP_010496255.1|  PREDICTED: pollen-specific protein-like At4g...  86.3    6e-16   
ref|XP_009101556.1|  PREDICTED: pollen-specific protein-like At4g...  86.3    8e-16   
ref|XP_010439832.1|  PREDICTED: pollen-specific protein-like At4g...  85.9    8e-16   
ref|XP_004244268.1|  PREDICTED: anther-specific protein LAT52-like    85.9    9e-16   
ref|NP_567562.1|  pollen Ole e 1 allergen and extensin family pro...  85.5    1e-15   
ref|XP_011460779.1|  PREDICTED: olee1-like protein                    85.5    1e-15   
ref|XP_009759546.1|  PREDICTED: olee1-like protein                    85.1    2e-15   
emb|CDX99452.1|  BnaC01g11000D                                        85.1    2e-15   
ref|XP_009608960.1|  PREDICTED: olee1-like protein                    84.7    2e-15   
ref|XP_002870034.1|  pollen ole e 1 allergen and extensin family ...  84.7    2e-15   
gb|AAM65838.1|  Ole e I (main olive allergen)-like protein            84.7    2e-15   
ref|XP_009598969.1|  PREDICTED: anther-specific protein LAT52-like    84.3    2e-15   
ref|XP_009108374.1|  PREDICTED: pollen-specific protein-like At4g...  84.3    3e-15   
ref|XP_010434511.1|  PREDICTED: pollen-specific protein-like At4g...  84.0    4e-15   
ref|XP_006281481.1|  hypothetical protein CARUB_v10027565mg           84.0    4e-15   
ref|XP_004299638.1|  PREDICTED: pollen allergen Phl p 11-like         82.4    5e-15   
gb|KJB13197.1|  hypothetical protein B456_002G061500                  83.6    6e-15   
emb|CDY52214.1|  BnaAnng11370D                                        83.6    6e-15   
ref|XP_009114385.1|  PREDICTED: pollen-specific protein-like At4g...  83.2    7e-15   
ref|XP_011101449.1|  PREDICTED: olee1-like protein                    82.8    9e-15   
gb|EMT21854.1|  hypothetical protein F775_27590                       82.0    1e-14   
ref|XP_010906302.1|  PREDICTED: pollen-specific protein C13-like      81.6    1e-14   
emb|CDY65576.1|  BnaC09g52000D                                        82.8    1e-14   
emb|CAA16739.1|  pollen-specific protein - like                       86.7    2e-14   
ref|XP_006284941.1|  hypothetical protein CARUB_v10006240mg           81.6    2e-14   
ref|XP_008343324.1|  PREDICTED: olee1-like protein                    80.1    3e-14   
gb|KDO56621.1|  hypothetical protein CISIN_1g041753mg                 79.7    3e-14   
ref|XP_007212169.1|  hypothetical protein PRUPE_ppa012463mg           81.3    4e-14   
gb|EPS70684.1|  hypothetical protein M569_04073                       80.5    6e-14   
emb|CAA73037.1|  Ole e 1.0103 protein                                 79.7    8e-14   
gb|AAO41983.1|  unknown protein                                       78.6    9e-14   
ref|XP_007149397.1|  hypothetical protein PHAVU_005G066800g           79.3    1e-13   
ref|XP_007153183.1|  hypothetical protein PHAVU_003G013900g           79.3    1e-13   
pir||S43242  allergen-like protein Syr v I isoform 1 - Syringa vu...  77.8    3e-13
gb|KHG18492.1|  Anther-specific LAT52                                 77.8    5e-13   
pir||G53806  major allergen OLE26 - common olive (fragment)           76.6    7e-13
ref|XP_004293940.1|  PREDICTED: olee1-like protein                    77.4    7e-13   
gb|AFK42345.1|  unknown                                               77.0    8e-13   
ref|XP_004233077.1|  PREDICTED: major pollen allergen Lig v 1-like    77.4    9e-13   
gb|ABP58634.1|  major pollen allergen Ole e 1                         76.6    9e-13   
pir||S43243  allergen-like protein Syr v I isoform 2 - Syringa vu...  75.9    1e-12
ref|XP_008371469.1|  PREDICTED: olee1-like protein                    76.6    1e-12   
gb|ABP58633.1|  major pollen allergen Ole e 1                         75.9    1e-12   
ref|XP_009348994.1|  PREDICTED: olee1-like protein                    76.6    1e-12   
gb|EMS61378.1|  Pollen-specific protein C13                           75.9    1e-12   
gb|ABP58636.1|  major pollen allergen Ole e 1                         75.9    2e-12   
ref|XP_007149396.1|  hypothetical protein PHAVU_005G066700g           76.3    2e-12   
gb|AAV74343.1|  Fra e 1.0102 major allergen                           75.5    2e-12   
pir||B53806  major allergen OLE5c - common olive                      75.1    3e-12
gb|AEK85661.1|  major pollen allergen Ole e1                          74.7    3e-12   
emb|CAA73036.1|  Ole e 1 protein                                      75.1    3e-12   
sp|P19963.2|ALL1_OLEEU  RecName: Full=Major pollen allergen Ole e...  75.1    3e-12   
gb|ABP58635.1|  major pollen allergen Ole e 1                         74.7    3e-12   
ref|XP_007213539.1|  hypothetical protein PRUPE_ppa019680mg           75.1    4e-12   
emb|CAA73038.1|  Ole e 1.0102 protein                                 74.7    4e-12   
gb|AEK85660.1|  major pollen allergen Ole e1                          74.7    4e-12   
gb|AEK85659.1|  major pollen allergen Ole e1                          74.7    4e-12   
gb|AAQ08947.1|  allergen Fra e 1.0101                                 74.7    4e-12   
gb|ABP58632.1|  major pollen allergen Ole e 1                         74.7    4e-12   
ref|XP_009352776.1|  PREDICTED: olee1-like protein                    75.1    5e-12   
ref|XP_009342278.1|  PREDICTED: olee1-like protein                    74.7    5e-12   
pir||E53806  major allergen OLE17 - common olive (fragment)           73.9    5e-12
ref|XP_011460781.1|  PREDICTED: anther-specific protein LAT52-like    74.7    6e-12   
gb|AEK85663.1|  major pollen allergen Ole e1                          73.9    6e-12   
gb|KHN36879.1|  Olee1-like protein                                    74.3    7e-12   
gb|EPS72638.1|  hypothetical protein M569_02120                       73.9    8e-12   
pir||F53806  major allergen OLE19 - common olive (fragment)           73.2    1e-11
ref|NP_001237949.1|  uncharacterized protein LOC100527053             72.4    1e-11   
pir||C53806  major allergen OLE1c - common olive (fragment)           73.6    1e-11
pir||S43244  allergen-like protein Syr v I isoform 3 - Syringa vu...  73.2    1e-11
gb|AAN18042.1|  major pollen allergen Ole e 1                         73.2    1e-11   
ref|XP_009334049.1|  PREDICTED: olee1-like protein                    73.6    1e-11   
gb|EAZ04544.1|  hypothetical protein OsI_26693                        73.2    1e-11   
gb|KDP21093.1|  hypothetical protein JCGZ_21564                       74.3    1e-11   
ref|XP_008383629.1|  PREDICTED: olee1-like protein                    73.6    2e-11   
emb|CAA54819.1|  major allergen                                       72.8    2e-11   
ref|NP_001235303.1|  uncharacterized protein LOC100306199 precursor   73.2    2e-11   
gb|AFW82075.1|  hypothetical protein ZEAMMB73_949741                  72.0    2e-11   
gb|AAQ10277.1|  major pollen allergen Ole e 1                         71.6    3e-11   
sp|O82015.2|LIGV1_LIGVU  RecName: Full=Major pollen allergen Lig ...  71.6    5e-11   
gb|EMS67079.1|  hypothetical protein TRIUR3_25214                     70.9    5e-11   
gb|AEK85658.1|  major pollen allergen Ole e1                          70.5    8e-11   
ref|XP_007153182.1|  hypothetical protein PHAVU_003G013800g           71.2    8e-11   
gb|AAB32652.2|  main olive allergen                                   70.5    8e-11   
ref|XP_008226528.1|  PREDICTED: olee1-like protein                    71.2    9e-11   
gb|AEK85662.1|  major pollen allergen Ole e1                          70.5    9e-11   
ref|XP_008363638.1|  PREDICTED: olee1-like protein                    70.9    9e-11   
gb|AAQ10269.1|  major pollen allergen Ole e 1                         70.5    1e-10   
ref|XP_006442530.1|  hypothetical protein CICLE_v10024378mg           70.5    1e-10   
gb|EAZ40496.1|  hypothetical protein OsJ_24951                        70.5    1e-10   
gb|AAQ07442.1|  major pollen allergen Ole e 1                         69.7    1e-10   
gb|AAQ10273.1|  major pollen allergen Ole e 1                         69.7    1e-10   
gb|AAQ10267.1|  major pollen allergen Ole e 1                         69.7    2e-10   
ref|XP_008357485.1|  PREDICTED: uncharacterized protein LOC103421237  71.6    2e-10   
ref|XP_004489034.1|  PREDICTED: olee1-like protein-like               70.1    2e-10   
ref|XP_008225283.1|  PREDICTED: olee1-like protein                    70.1    2e-10   
ref|NP_001175282.1|  Os07g0590500                                     70.1    2e-10   
ref|XP_008359333.1|  PREDICTED: olee1-like protein                    69.7    3e-10   
gb|ADM76637.1|  extensin-like protein                                 68.9    4e-10   
ref|XP_009340070.1|  PREDICTED: olee1-like protein                    68.9    5e-10   
gb|AAO22132.1|  major pollen allergen Ole e 1                         68.2    5e-10   
gb|KEH38612.1|  pollen Ole e I family allergen                        68.9    5e-10   
ref|XP_009413179.1|  PREDICTED: pollen-specific protein C13-like      67.8    5e-10   
gb|AAQ08188.1|  major pollen allergen Ole e 1                         68.2    6e-10   
gb|AAQ83588.1|  allergen Fra e 1                                      68.2    7e-10   
pir||I53806  major allergen OLE16 - common olive (fragment)           67.8    7e-10
gb|ACJ86288.1|  unknown                                               67.8    1e-09   
gb|ACJ86286.1|  unknown                                               67.4    2e-09   
pir||H53806  major allergen OLE6 - common olive (fragment)            67.0    2e-09
ref|XP_010317514.1|  PREDICTED: olee1-like protein                    66.6    2e-09   
ref|XP_011101376.1|  PREDICTED: pollen allergen Che a 1-like isof...  67.4    2e-09   
gb|AAQ10274.1|  major pollen allergen Ole e 1                         66.6    2e-09   
ref|XP_011078225.1|  PREDICTED: pollen allergen Che a 1-like          67.0    2e-09   
gb|ABK21930.1|  unknown                                               66.6    2e-09   
gb|ABK22573.1|  unknown                                               66.6    3e-09   
gb|ADM76653.1|  extensin-like protein                                 66.6    3e-09   
gb|AAQ10272.1|  major pollen allergen Ole e 1                         65.5    4e-09   
gb|KEH38613.1|  pollen Ole e I family allergen                        66.2    4e-09   
gb|ADM76665.1|  extensin-like protein                                 65.9    4e-09   
ref|XP_011101377.1|  PREDICTED: olee1-like protein isoform X2         65.9    6e-09   
pir||A38968  major allergen OLE20 - common olive (fragment)           64.7    8e-09
ref|XP_007045674.1|  F-box/RNI-like superfamily protein               67.8    1e-08   
ref|XP_009628123.1|  PREDICTED: F-box/FBD/LRR-repeat protein At1g...  64.7    2e-08   
ref|XP_007222555.1|  hypothetical protein PRUPE_ppa006232mg           66.6    2e-08   
ref|XP_008391140.1|  PREDICTED: olee1-like protein                    62.8    2e-08   
ref|XP_009147847.1|  PREDICTED: pollen-specific protein-like At4g...  62.4    4e-08   
gb|EYU28924.1|  hypothetical protein MIMGU_mgv1a006986mg              65.5    5e-08   
gb|AAO22133.1|  major pollen allergen Ole e 1                         62.4    5e-08   
ref|XP_006468202.1|  PREDICTED: LOW QUALITY PROTEIN: olee1-like p...  62.0    7e-08   
ref|XP_009628124.1|  PREDICTED: F-box/FBD/LRR-repeat protein At1g...  65.1    8e-08   
emb|CDP17454.1|  unnamed protein product                              64.7    9e-08   
ref|XP_007045671.1|  F-box/RNI-like superfamily protein isoform 1     64.7    9e-08   
gb|ABP58637.1|  major pollen allergen Ole e 1                         61.2    1e-07   
ref|XP_009627730.1|  PREDICTED: pollen-specific protein C13-like      60.1    1e-07   
ref|XP_008339731.1|  PREDICTED: F-box/FBD/LRR-repeat protein At1g...  64.3    1e-07   
ref|XP_010681337.1|  PREDICTED: F-box/FBD/LRR-repeat protein At1g...  63.9    2e-07   
ref|XP_004297176.2|  PREDICTED: F-box/FBD/LRR-repeat protein At1g...  63.5    2e-07   
gb|KHG05226.1|  hypothetical protein F383_31468                       63.5    2e-07   
ref|XP_010528021.1|  PREDICTED: LOW QUALITY PROTEIN: F-box/FBD/LR...  63.2    3e-07   
gb|AAQ10280.1|  major pollen allergen Ole e 1                         60.1    3e-07   
ref|XP_009778381.1|  PREDICTED: F-box/FBD/LRR-repeat protein At1g...  63.2    3e-07   
ref|XP_012080507.1|  PREDICTED: F-box/FBD/LRR-repeat protein At1g...  62.8    3e-07   
ref|XP_011102257.1|  PREDICTED: olee1-like protein                    60.5    3e-07   
gb|AAQ10279.1|  major pollen allergen Ole e 1                         59.7    4e-07   
gb|KJB80540.1|  hypothetical protein B456_013G102700                  62.4    5e-07   
ref|XP_009355786.1|  PREDICTED: F-box/FBD/LRR-repeat protein At1g...  62.4    5e-07   
ref|XP_004236987.1|  PREDICTED: F-box/FBD/LRR-repeat protein At1g...  62.4    5e-07   
ref|XP_009778374.1|  PREDICTED: F-box/FBD/LRR-repeat protein At1g...  62.0    6e-07   
ref|XP_006364640.1|  PREDICTED: F-box/FBD/LRR-repeat protein At1g...  62.0    7e-07   
emb|CDP00517.1|  unnamed protein product                              61.2    1e-06   
ref|XP_008243754.1|  PREDICTED: F-box/FBD/LRR-repeat protein At1g...  61.2    1e-06   
ref|XP_008389349.1|  PREDICTED: F-box/FBD/LRR-repeat protein At1g...  61.2    1e-06   
ref|XP_002892759.1|  F-box family protein                             61.2    1e-06   
ref|XP_006344294.1|  PREDICTED: F-box/FBD/LRR-repeat protein At1g...  61.2    1e-06   
emb|CDY30027.1|  BnaC05g09930D                                        60.8    1e-06   
ref|XP_009148648.1|  PREDICTED: F-box/FBD/LRR-repeat protein At1g...  60.8    1e-06   
ref|XP_009148649.1|  PREDICTED: F-box/FBD/LRR-repeat protein At1g...  60.8    2e-06   
emb|CDX98105.1|  BnaA06g08560D                                        60.8    2e-06   
ref|XP_011460780.1|  PREDICTED: anther-specific protein LAT52-like    58.2    2e-06   
ref|XP_003550361.1|  PREDICTED: F-box/FBD/LRR-repeat protein At1g...  60.5    2e-06   
gb|ACU21033.1|  unknown                                               58.2    2e-06   
ref|XP_002514537.1|  ubiquitin-protein ligase, putative               60.5    2e-06   
ref|XP_006307650.1|  hypothetical protein CARUB_v10009278mg           60.5    2e-06   
ref|XP_009628534.1|  PREDICTED: F-box/FBD/LRR-repeat protein At1g...  60.1    2e-06   
emb|CDP00519.1|  unnamed protein product                              60.1    3e-06   
ref|XP_009596698.1|  PREDICTED: F-box/FBD/LRR-repeat protein At1g...  60.1    3e-06   
ref|XP_009598462.1|  PREDICTED: F-box/FBD/LRR-repeat protein At1g...  60.1    3e-06   
ref|XP_009598475.1|  PREDICTED: F-box/FBD/LRR-repeat protein At1g...  59.7    3e-06   
gb|KDO70182.1|  hypothetical protein CISIN_1g042404mg                 58.9    4e-06   
ref|XP_007153544.1|  hypothetical protein PHAVU_003G044500g           59.3    4e-06   
ref|XP_010458805.1|  PREDICTED: F-box/FBD/LRR-repeat protein At1g...  59.3    4e-06   
gb|AAQ10281.1|  major pollen allergen Ole e 1                         56.6    5e-06   
ref|XP_010495386.1|  PREDICTED: F-box/FBD/LRR-repeat protein At1g...  58.9    5e-06   
ref|XP_009614981.1|  PREDICTED: F-box/FBD/LRR-repeat protein At1g...  58.9    6e-06   
ref|XP_006437791.1|  hypothetical protein CICLE_v10031638mg           58.9    6e-06   
ref|XP_006437792.1|  hypothetical protein CICLE_v10031638mg           58.9    6e-06   
ref|XP_009803967.1|  PREDICTED: F-box/FBD/LRR-repeat protein At1g...  58.9    6e-06   
ref|XP_009356492.1|  PREDICTED: F-box/FBD/LRR-repeat protein At1g...  58.9    6e-06   



>ref|XP_009622218.1| PREDICTED: pollen-specific protein C13-like [Nicotiana tomentosiformis]
Length=158

 Score =   192 bits (487),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 88/136 (65%), Positives = 109/136 (80%), Gaps = 0/136 (0%)
 Frame = +1

Query  874   PFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILV  1053
             PFLVKGK Y DTC CGFET ATKYL  S V++ C +R TN +TY+ + VTNSQGEY+ILV
Sbjct  23    PFLVKGKCYCDTCRCGFETEATKYLAGSKVKIECRHRVTNEITYTIDGVTNSQGEYNILV  82

Query  1054  NGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  1233
             N D GDD+CDVVLV+SSD   GKP+ GRDRARVIL+RNNG+ +DVR+ANN+GF + +PL 
Sbjct  83    NRDCGDDVCDVVLVESSDKRCGKPNGGRDRARVILTRNNGMSSDVRYANNMGFLSDEPLK  142

Query  1234  SCTQVVAQYHLNDDNF  1281
             SCTQ++ QY L +D +
Sbjct  143   SCTQILQQYQLTEDQY  158



>ref|XP_009760524.1| PREDICTED: pollen-specific protein C13-like [Nicotiana sylvestris]
Length=158

 Score =   191 bits (485),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 86/136 (63%), Positives = 110/136 (81%), Gaps = 0/136 (0%)
 Frame = +1

Query  874   PFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILV  1053
             PFLVKGK Y DTC CGFET ATKYL  S V++ C NR TN +TY+   VTNSQGEY+ILV
Sbjct  23    PFLVKGKCYCDTCRCGFETEATKYLAGSKVKIECRNRVTNEITYTIGGVTNSQGEYNILV  82

Query  1054  NGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  1233
             + D GDD+CDVVLV+SSD   GKP+ GRDRARVIL+RNNG+++DVR+ANN+GF + +PL+
Sbjct  83    DRDCGDDVCDVVLVESSDKRCGKPNGGRDRARVILTRNNGMISDVRYANNMGFLSDEPLS  142

Query  1234  SCTQVVAQYHLNDDNF  1281
             +CT+++ QY L +D +
Sbjct  143   ACTRILQQYQLTEDQY  158



>ref|XP_009600627.1| PREDICTED: major pollen allergen Lol p 11-like [Nicotiana tomentosiformis]
Length=162

 Score =   187 bits (474),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 82/134 (61%), Positives = 108/134 (81%), Gaps = 0/134 (0%)
 Frame = +1

Query  877   FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  1056
             FLV GKVY DTC CGFET+A+KYL  S VR+ C NRDTN ++Y+   VTNS+GEY ILV 
Sbjct  27    FLVVGKVYCDTCRCGFETSASKYLAGSRVRIECKNRDTNDISYTIEGVTNSKGEYKILVY  86

Query  1057  GDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLAS  1236
              DRGD++CDVVL++SSDP+   P++GRDRARV+L+RNNG+V++ RFAN++GF + +PLAS
Sbjct  87    SDRGDEVCDVVLIRSSDPMCAVPNAGRDRARVVLTRNNGMVSNTRFANSIGFLSNEPLAS  146

Query  1237  CTQVVAQYHLNDDN  1278
             C Q++ QY L D +
Sbjct  147   CNQILQQYQLTDQD  160



>ref|XP_010321468.1| PREDICTED: LOW QUALITY PROTEIN: major pollen allergen Lol p 11-like 
[Solanum lycopersicum]
Length=162

 Score =   186 bits (472),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 81/135 (60%), Positives = 107/135 (79%), Gaps = 0/135 (0%)
 Frame = +1

Query  877   FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  1056
             FLV GKVY DTC CG+ET+A+KYLP S VR+ C NRDTN + Y+   VTNS+GEY ILVN
Sbjct  28    FLVIGKVYCDTCRCGYETSASKYLPGSRVRIECKNRDTNDLAYTVEGVTNSKGEYKILVN  87

Query  1057  GDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLAS  1236
              DR D+ CDVVL++SSDP+  +P++GRDR RV+L+ NNG+V++ RFAN+LGF   +PLAS
Sbjct  88    SDRRDEFCDVVLIRSSDPMCAEPNTGRDRTRVVLTSNNGMVSNTRFANSLGFLYNEPLAS  147

Query  1237  CTQVVAQYHLNDDNF  1281
             CT+++ QY  ++D F
Sbjct  148   CTKILKQYEFSEDQF  162



>ref|XP_006366520.1| PREDICTED: olee1-like protein-like [Solanum tuberosum]
Length=162

 Score =   186 bits (472),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 80/135 (59%), Positives = 107/135 (79%), Gaps = 0/135 (0%)
 Frame = +1

Query  877   FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  1056
             FLV GKVY DTC CGFET+A+ YLP S VR+ C NRDTN + Y+    TNS+GEY ILVN
Sbjct  28    FLVVGKVYCDTCRCGFETSASMYLPGSRVRIECKNRDTNDLAYTVEGFTNSKGEYKILVN  87

Query  1057  GDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLAS  1236
              DR D+ CDVVL++SSDP+  +P++GRDRARV+L+ NNG+V++ RFAN++GF + +PLAS
Sbjct  88    SDRRDEFCDVVLIRSSDPMCAEPNTGRDRARVVLTSNNGMVSNTRFANSMGFLSNEPLAS  147

Query  1237  CTQVVAQYHLNDDNF  1281
             CT+++ QY  ++D F
Sbjct  148   CTKILQQYEFSEDQF  162



>ref|XP_009797814.1| PREDICTED: major pollen allergen Lol p 11-like [Nicotiana sylvestris]
Length=161

 Score =   185 bits (470),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 81/135 (60%), Positives = 106/135 (79%), Gaps = 0/135 (0%)
 Frame = +1

Query  877   FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  1056
             FLV GKVY DTC CGFET+A+KYL  S VR+ C  RDTN V+Y+   VTNS+GEY ILV 
Sbjct  27    FLVVGKVYCDTCRCGFETSASKYLAGSRVRIECKKRDTNDVSYTIEGVTNSKGEYKILVY  86

Query  1057  GDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLAS  1236
              DRGD++CDVVL++SSDP+   P +GRDRARV+L+RNNG++++ RFAN++GF + +PLAS
Sbjct  87    SDRGDEVCDVVLIRSSDPMCATPAAGRDRARVVLTRNNGMISNTRFANSIGFLSDEPLAS  146

Query  1237  CTQVVAQYHLNDDNF  1281
             C Q++ QY L +D  
Sbjct  147   CNQILQQYQLTEDQI  161



>ref|XP_004237415.1| PREDICTED: pollen-specific protein C13 [Solanum lycopersicum]
Length=159

 Score =   184 bits (468),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 85/136 (63%), Positives = 106/136 (78%), Gaps = 0/136 (0%)
 Frame = +1

Query  874   PFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILV  1053
             PFLVKGK Y DTC CGFET ATKYL  S V++ C NR TN +TY+ + VTNSQGEY+ILV
Sbjct  24    PFLVKGKCYCDTCRCGFETPATKYLAGSKVKVECKNRVTNKITYTIDGVTNSQGEYNILV  83

Query  1054  NGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  1233
               D GDD+CDVVLV+S D     P++GRDRARV L+RNNG+ +DVRFANN+GF + +PLA
Sbjct  84    KRDCGDDVCDVVLVESGDKSCNIPNAGRDRARVALTRNNGMTSDVRFANNMGFLSNEPLA  143

Query  1234  SCTQVVAQYHLNDDNF  1281
             +CTQ++ QY L +D +
Sbjct  144   ACTQILQQYQLTEDQY  159



>ref|XP_009764546.1| PREDICTED: protein DOWNSTREAM OF FLC-like [Nicotiana sylvestris]
Length=161

 Score =   184 bits (467),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 84/137 (61%), Positives = 104/137 (76%), Gaps = 0/137 (0%)
 Frame = +1

Query  868   GKPFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSI  1047
             G PFLVKGK Y DTC CGFET ATKYL  + VR+ C +R   A TY+   VTNS+GEY+I
Sbjct  24    GNPFLVKGKAYCDTCRCGFETPATKYLAGAKVRIECRHRVIEASTYTVEGVTNSKGEYNI  83

Query  1048  LVNGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQP  1227
             LVN DRGDD CDV+LVKS D    KP++GRDR+RVIL+RNNG++++ RFAN +GF   +P
Sbjct  84    LVNSDRGDDACDVILVKSPDRTCTKPNAGRDRSRVILTRNNGMISNTRFANAMGFLRDEP  143

Query  1228  LASCTQVVAQYHLNDDN  1278
             L+SCTQ++ QY L DD 
Sbjct  144   LSSCTQILQQYQLTDDQ  160



>ref|XP_006344595.1| PREDICTED: protein DOWNSTREAM OF FLC-like [Solanum tuberosum]
Length=158

 Score =   181 bits (459),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 80/135 (59%), Positives = 102/135 (76%), Gaps = 0/135 (0%)
 Frame = +1

Query  874   PFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILV  1053
             P LV+GKVY DTC CGFET AT YLP++ V++ C +R T   TY+   VTNSQGEYSILV
Sbjct  23    PLLVEGKVYCDTCRCGFETPATTYLPDAKVKIECKSRITEEPTYTVEGVTNSQGEYSILV  82

Query  1054  NGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  1233
               DRGDD+CDVVL+KS DP   KP +GRDR+RV L+RNNG+++DV FAN +GF   +PLA
Sbjct  83    KSDRGDDVCDVVLIKSPDPTCAKPSAGRDRSRVTLTRNNGMISDVYFANAMGFIRDEPLA  142

Query  1234  SCTQVVAQYHLNDDN  1278
             SC +++ QY + D+ 
Sbjct  143   SCDEILRQYQVPDEQ  157



>ref|XP_006355373.1| PREDICTED: pollen-specific protein C13-like [Solanum tuberosum]
Length=159

 Score =   177 bits (450),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 81/136 (60%), Positives = 103/136 (76%), Gaps = 0/136 (0%)
 Frame = +1

Query  874   PFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILV  1053
             PFLVKGK Y DTC CGFET ATKYL    V++ C NR TN +TY  + V NS+GEY+ILV
Sbjct  24    PFLVKGKCYCDTCRCGFETPATKYLAGCKVKVECKNRVTNKITYRIDGVANSKGEYNILV  83

Query  1054  NGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  1233
               D GDD+CDVVLV+S D     P++GRDRARV L+RNNG+ +DVR+ANN+GF + +PLA
Sbjct  84    KRDCGDDVCDVVLVESGDKTCNIPNAGRDRARVALTRNNGMTSDVRYANNMGFLSNEPLA  143

Query  1234  SCTQVVAQYHLNDDNF  1281
             +CTQ++ QY L +D +
Sbjct  144   TCTQILQQYQLTEDQY  159



>gb|AAF16869.1|AF109693_1 allergen-like protein BRSn20 [Sambucus nigra]
Length=159

 Score =   169 bits (427),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 77/137 (56%), Positives = 101/137 (74%), Gaps = 0/137 (0%)
 Frame = +1

Query  868   GKPFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSI  1047
             G PFL+KG VY DTC  GFET ATKYL  + VR+ C +RDT  +TYS  AVT+S+G+YS+
Sbjct  23    GNPFLLKGSVYCDTCRAGFETDATKYLHGARVRIECKDRDTLRLTYSDEAVTDSKGKYSV  82

Query  1048  LVNGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQP  1227
             LV+ D GD +CD +LV S DP    PD GRDRA VIL+R+NG+ +D RFAN +GF   +P
Sbjct  83    LVSDDHGDQMCDAILVSSPDPECAVPDKGRDRACVILTRSNGMTSDERFANAMGFLKNEP  142

Query  1228  LASCTQVVAQYHLNDDN  1278
             +A CTQ++ +Y LN+D+
Sbjct  143   MAGCTQILQKYQLNEDD  159



>gb|EPS62385.1| hypothetical protein M569_12405, partial [Genlisea aurea]
Length=150

 Score =   167 bits (424),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 75/135 (56%), Positives = 98/135 (73%), Gaps = 0/135 (0%)
 Frame = +1

Query  868   GKPFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSI  1047
             G+P +VKG VY DTC CGFE  ATKY+  + VR+ C    T+ +TY  + VTNS G Y I
Sbjct  16    GQPLVVKGSVYCDTCRCGFENEATKYMAGAAVRIECREAHTSQITYVEDGVTNSAGHYEI  75

Query  1048  LVNGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQP  1227
              V+GDRGDD+CD VL+KSSDP    PD+GRDRARV+L+RNNG+ +D RFAN++GF    P
Sbjct  76    RVHGDRGDDVCDAVLLKSSDPECSTPDAGRDRARVVLTRNNGIASDHRFANSMGFLRNAP  135

Query  1228  LASCTQVVAQYHLND  1272
             LA+C QV+ +Y  ++
Sbjct  136   LAACAQVLQKYRSDE  150



>gb|EYU31033.1| hypothetical protein MIMGU_mgv1a015328mg [Erythranthe guttata]
Length=161

 Score =   164 bits (416),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 74/136 (54%), Positives = 100/136 (74%), Gaps = 0/136 (0%)
 Frame = +1

Query  868   GKPFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSI  1047
             G PFLVKG VY D+C CGFET  TKY+P + VR+ C +RD+  +TY+  AVT+  G YS 
Sbjct  26    GDPFLVKGCVYCDSCRCGFETDVTKYMPSAKVRIECRDRDSAKLTYTQEAVTDESGCYSA  85

Query  1048  LVNGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQP  1227
             +V  DRG+D CD VLVKSSD     P++GRDRARVIL+RNNG+ ++VR+ANN+GF    P
Sbjct  86    VVQSDRGEDFCDAVLVKSSDDECSVPNAGRDRARVILTRNNGMTDNVRYANNMGFLKNIP  145

Query  1228  LASCTQVVAQYHLNDD  1275
             L++C Q++ +Y + D+
Sbjct  146   LSNCAQILHKYQIIDN  161



>ref|XP_011097595.1| PREDICTED: major pollen allergen Lol p 11-like [Sesamum indicum]
Length=159

 Score =   162 bits (411),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 78/134 (58%), Positives = 96/134 (72%), Gaps = 0/134 (0%)
 Frame = +1

Query  874   PFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILV  1053
             P L+ G VY DTC CG+ET+ATKYL  + VR+ C  RD++ +TY+  AVT+S G Y ILV
Sbjct  26    PLLLTGCVYCDTCRCGYETSATKYLAGAVVRVECRKRDSSELTYTKEAVTDSTGHYKILV  85

Query  1054  NGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  1233
               DRGDD CD VLVKS DP    P++GRDRARVIL+RNNG+ ++ RFAN LGF    PLA
Sbjct  86    ETDRGDDYCDSVLVKSPDPECSIPNAGRDRARVILTRNNGMNSNARFANALGFLKNTPLA  145

Query  1234  SCTQVVAQYHLNDD  1275
             SC QV+ QY   +D
Sbjct  146   SCPQVLQQYQEAED  159



>ref|XP_011090511.1| PREDICTED: major pollen allergen Lol p 11-like [Sesamum indicum]
Length=159

 Score =   157 bits (397),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 71/130 (55%), Positives = 92/130 (71%), Gaps = 0/130 (0%)
 Frame = +1

Query  874   PFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILV  1053
             PF V G VY DTC CG+ET AT Y+  + VR+ C N+D   +TY+  AVT+S G YS+LV
Sbjct  26    PFHVTGSVYCDTCRCGYETDATTYIAGATVRIECRNKDNGQLTYTKEAVTDSTGHYSVLV  85

Query  1054  NGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  1233
               DRGDD CD VLVKS+DP    P+ GRDRARVIL+RNNG++++ RFAN +GF    PLA
Sbjct  86    ETDRGDDFCDAVLVKSADPECSTPNEGRDRARVILTRNNGMISNKRFANAMGFLKNTPLA  145

Query  1234  SCTQVVAQYH  1263
             +C  ++ +Y 
Sbjct  146   NCPMILQKYQ  155



>gb|EYU24008.1| hypothetical protein MIMGU_mgv1a015363mg [Erythranthe guttata]
Length=160

 Score =   148 bits (374),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/136 (51%), Positives = 93/136 (68%), Gaps = 0/136 (0%)
 Frame = +1

Query  868   GKPFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSI  1047
             G   L++G  Y D C CG+ET+A+K +  + V L C +R T+ +TYS   VT+S G+Y  
Sbjct  25    GDSLLLQGSTYCDACRCGYETSASKPVAGAVVGLECRSRTTSELTYSDETVTDSAGKYKF  84

Query  1048  LVNGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQP  1227
             LV  DRGDD CDV L KSSDP   +P+ GRDRARVIL+RNNG+ ++ RFAN +GF    P
Sbjct  85    LVQSDRGDDFCDVFLSKSSDPECSEPNVGRDRARVILTRNNGMDSNTRFANAMGFLANTP  144

Query  1228  LASCTQVVAQYHLNDD  1275
             LASC +++ QY  ++D
Sbjct  145   LASCQEILKQYQESED  160



>ref|XP_009794836.1| PREDICTED: pollen-specific protein C13-like, partial [Nicotiana 
sylvestris]
Length=109

 Score =   145 bits (366),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 65/109 (60%), Positives = 89/109 (82%), Gaps = 0/109 (0%)
 Frame = +1

Query  955   SHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVNGDRGDDLCDVVLVKSSDPLSGKPDSG  1134
             S V++ C NR TN +TY+   VTNSQGEY+ILV+ D GDD+CDVVLV+SSD   GKP+ G
Sbjct  1     SKVKIECRNRVTNEITYTIGGVTNSQGEYNILVDRDCGDDVCDVVLVESSDKRCGKPNGG  60

Query  1135  RDRARVILSRNNGLVNDVRFANNLGFTTKQPLASCTQVVAQYHLNDDNF  1281
             RDRARVIL+RNNG+++DVR+ANN+GF + +PL++CT+++ QY L +D +
Sbjct  61    RDRARVILTRNNGMISDVRYANNMGFLSDEPLSACTRILQQYQLTEDQY  109



>ref|XP_002268073.1| PREDICTED: pollen-specific protein C13 [Vitis vinifera]
 emb|CBI33037.3| unnamed protein product [Vitis vinifera]
Length=159

 Score =   147 bits (371),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 66/135 (49%), Positives = 92/135 (68%), Gaps = 0/135 (0%)
 Frame = +1

Query  871   KPFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSIL  1050
             KPF++ G+VY DTC  GFET+AT Y+  + VR+ C +R++  + YS   VT+S G Y   
Sbjct  25    KPFVLHGRVYCDTCRAGFETSATTYIAGARVRIECKDRNSLQLVYSVEGVTDSTGTYKFS  84

Query  1051  VNGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPL  1230
             +  D GD +CD VLVKS  P   K D+GRDR+R+ L+R+NGLV+D RFAN +GF   +P 
Sbjct  85    IADDHGDQMCDAVLVKSPQPDCAKVDAGRDRSRLSLTRSNGLVSDTRFANAMGFMKDEPA  144

Query  1231  ASCTQVVAQYHLNDD  1275
             + CTQ++ QY  +DD
Sbjct  145   SGCTQLLKQYQESDD  159



>gb|EPS69662.1| hypothetical protein M569_05103, partial [Genlisea aurea]
Length=156

 Score =   143 bits (361),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 65/132 (49%), Positives = 89/132 (67%), Gaps = 0/132 (0%)
 Frame = +1

Query  868   GKPFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSI  1047
             G P +++G VY DTC CGFET A+  +  + VR+ C +R T+ +TY+  AVT + G YS+
Sbjct  24    GVPLVLEGSVYCDTCRCGFETAASTKIAGATVRVECRDRKTSELTYTKEAVTGAAGRYSV  83

Query  1048  LVNGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQP  1227
             LV  DRGDD CD VL KSSDP    P +  DRARVIL+RNNG+ +  RFAN +GF    P
Sbjct  84    LVEDDRGDDYCDAVLAKSSDPECDTPGAESDRARVILTRNNGISSSARFANAMGFLKNTP  143

Query  1228  LASCTQVVAQYH  1263
             L++C +++ +Y 
Sbjct  144   LSNCPEILQKYQ  155



>ref|XP_010261236.1| PREDICTED: pollen-specific protein C13-like [Nelumbo nucifera]
Length=163

 Score =   144 bits (362),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 67/130 (52%), Positives = 90/130 (69%), Gaps = 0/130 (0%)
 Frame = +1

Query  874   PFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILV  1053
             PF V G+VY DTC  GFET AT Y+P + VR+ C +RD   + +S   VT++ G Y+I V
Sbjct  28    PFNVVGRVYCDTCRAGFETPATTYIPGARVRVECRDRDNLNLLFSVEGVTDATGTYNIQV  87

Query  1054  NGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  1233
               D GD LC+ VLV+SS    GK +SGR+RA V+L+RNNG+++D RFANN+GF   QPLA
Sbjct  88    AEDHGDQLCEAVLVRSSQEDCGKIESGRERANVVLTRNNGVLSDKRFANNMGFIKDQPLA  147

Query  1234  SCTQVVAQYH  1263
              C +++ QY 
Sbjct  148   GCAEILKQYQ  157



>ref|XP_002392460.1| hypothetical protein MPER_07958 [Moniliophthora perniciosa FA553]
 gb|EEB93390.1| hypothetical protein MPER_07958 [Moniliophthora perniciosa FA553]
Length=160

 Score =   142 bits (359),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 66/130 (51%), Positives = 86/130 (66%), Gaps = 0/130 (0%)
 Frame = +1

Query  874   PFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILV  1053
             P  V GKVY DTC  GFET A+ Y+  + V++ C +R +  + YS  A T+S G Y + V
Sbjct  27    PLTVTGKVYCDTCRAGFETPASTYIAGAKVKVECKDRTSMKLLYSQEATTDSTGTYKLFV  86

Query  1054  NGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  1233
             + D  D LCD +L+ S  P   KP +GRDRARVIL+R NG+V+D R+ANN+GF   QPLA
Sbjct  87    SEDHQDQLCDAMLLSSPQPNCQKPAAGRDRARVILTRYNGIVSDTRYANNMGFEMDQPLA  146

Query  1234  SCTQVVAQYH  1263
              CTQV+ QY 
Sbjct  147   GCTQVLQQYQ  156



>ref|XP_004150698.1| PREDICTED: protein DOWNSTREAM OF FLC [Cucumis sativus]
 gb|KGN62176.1| hypothetical protein Csa_2G309370 [Cucumis sativus]
Length=159

 Score =   140 bits (354),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 63/134 (47%), Positives = 91/134 (68%), Gaps = 0/134 (0%)
 Frame = +1

Query  874   PFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILV  1053
             PF+V+GKV+ DTC  GFET+AT Y+P + VR+ C +R++  + Y+  A T+S G Y++LV
Sbjct  26    PFVVRGKVFCDTCLAGFETSATTYIPGAKVRIECKDRNSMELQYTHEATTDSTGSYTLLV  85

Query  1054  NGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  1233
             N D GD+LCD VLV S          GRDRARVIL+R NG+ ++ R+ N +GF   +P++
Sbjct  86    NEDHGDELCDAVLVSSPQEKCSSVSEGRDRARVILTRYNGIASNERYVNAMGFAMDEPMS  145

Query  1234  SCTQVVAQYHLNDD  1275
              C QV++QY   +D
Sbjct  146   GCNQVMSQYQDIED  159



>emb|CDP01424.1| unnamed protein product [Coffea canephora]
Length=159

 Score =   140 bits (354),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 66/132 (50%), Positives = 91/132 (69%), Gaps = 1/132 (1%)
 Frame = +1

Query  871   KPFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRD-TNAVTYSANAVTNSQGEYSI  1047
             +PF V GKVY DTC  G+ET AT YLP   V+LVC  RD  + +T++  A T+S G+Y +
Sbjct  23    EPFTVTGKVYCDTCRVGYETPATTYLPGCIVKLVCKKRDNPDQITFTKEATTDSTGKYEM  82

Query  1048  LVNGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQP  1227
              V  D GDD+C++  VKSSDP    P++GRD AR+ L+RNNG+V++VR ANN+G+    P
Sbjct  83    QVAYDAGDDICEMEHVKSSDPTCATPNAGRDHARICLTRNNGMVSNVRHANNIGYFRDVP  142

Query  1228  LASCTQVVAQYH  1263
             LA C Q++ +Y 
Sbjct  143   LARCPQILQRYQ  154



>ref|XP_008445353.1| PREDICTED: protein DOWNSTREAM OF FLC [Cucumis melo]
Length=159

 Score =   139 bits (349),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 63/134 (47%), Positives = 91/134 (68%), Gaps = 0/134 (0%)
 Frame = +1

Query  874   PFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILV  1053
             PF+V+GKV+ DTC  GFET+AT Y+P + VR+ C +R++  V Y+  A T+S G Y++LV
Sbjct  26    PFVVRGKVFCDTCLAGFETSATTYIPGAKVRIECKDRNSMEVRYTHEATTDSTGSYTLLV  85

Query  1054  NGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  1233
             + D GD+LCD VLV S          GRDRARVIL+R NG+ ++ R+ N +GF   +P++
Sbjct  86    SEDHGDELCDAVLVSSPQEKCSSVAEGRDRARVILTRYNGIASNDRYVNAMGFAIDEPMS  145

Query  1234  SCTQVVAQYHLNDD  1275
              C QV++QY   +D
Sbjct  146   GCNQVMSQYQDIED  159



>ref|XP_010060161.1| PREDICTED: protein DOWNSTREAM OF FLC [Eucalyptus grandis]
 gb|KCW66732.1| hypothetical protein EUGRSUZ_F00490 [Eucalyptus grandis]
Length=160

 Score =   138 bits (348),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 65/130 (50%), Positives = 85/130 (65%), Gaps = 0/130 (0%)
 Frame = +1

Query  874   PFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILV  1053
             P  V GKVY DTC  GFET A+ Y+  + V++ C +R +  + YS  A T+S G Y + V
Sbjct  27    PLTVTGKVYCDTCRAGFETPASTYIAGAKVKVECKDRTSMKLLYSQEATTDSTGTYKLFV  86

Query  1054  NGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  1233
             + D  D LCD +L+ S      KP +GRDRARVIL+R NG+V+D R+ANN+GF   QPLA
Sbjct  87    SEDHQDQLCDAMLLSSPQLNCQKPAAGRDRARVILTRYNGIVSDTRYANNMGFEMDQPLA  146

Query  1234  SCTQVVAQYH  1263
              CTQV+ QY 
Sbjct  147   GCTQVLQQYQ  156



>ref|XP_010676978.1| PREDICTED: major pollen allergen Lol p 11-like [Beta vulgaris 
subsp. vulgaris]
Length=162

 Score =   138 bits (348),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 63/136 (46%), Positives = 90/136 (66%), Gaps = 0/136 (0%)
 Frame = +1

Query  871   KPFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSIL  1050
             KP+ V+GKVY DTC  GFET A+ YL    V+L C +R T  V YSA A T+  G Y I 
Sbjct  26    KPYCVRGKVYCDTCRAGFETPASTYLEGVKVKLECRHRQTQEVLYSAVATTDRTGSYKIF  85

Query  1051  VNGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPL  1230
             V  D+ +++CD +L+ S        D GRDR+RV+L+ NNG+V++ R+ANN+GFT ++P+
Sbjct  86    VENDQKENICDTMLLSSPHRRCKLADPGRDRSRVVLTSNNGVVSNDRYANNMGFTVEEPM  145

Query  1231  ASCTQVVAQYHLNDDN  1278
             + C Q++ QY L +D 
Sbjct  146   SYCAQLMQQYQLTEDE  161



>ref|XP_003634471.1| PREDICTED: pollen-specific protein C13 [Vitis vinifera]
 emb|CAN61642.1| hypothetical protein VITISV_029644 [Vitis vinifera]
 emb|CBI19132.3| unnamed protein product [Vitis vinifera]
Length=159

 Score =   138 bits (347),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/135 (47%), Positives = 90/135 (67%), Gaps = 0/135 (0%)
 Frame = +1

Query  871   KPFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSIL  1050
             +PF+++G+VY DTC  GFET+AT Y+  + VR+ C +R++  + YS   +T+S G Y I+
Sbjct  25    QPFVLQGRVYCDTCRAGFETSATTYIAGAKVRVECKDRNSMQLLYSIEGITDSTGTYKIM  84

Query  1051  VNGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPL  1230
             V  DR D LCD VLV S        D GRDRA VIL+R NG+V+D R+AN++GF    P+
Sbjct  85    VTEDREDQLCDAVLVSSPQSDCASVDPGRDRAAVILTRYNGIVSDNRYANSMGFLKDHPM  144

Query  1231  ASCTQVVAQYHLNDD  1275
             + CTQ++ QY   +D
Sbjct  145   SECTQLLQQYQEFED  159



>ref|XP_008348540.1| PREDICTED: protein DOWNSTREAM OF FLC-like [Malus domestica]
Length=162

 Score =   137 bits (346),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 64/131 (49%), Positives = 86/131 (66%), Gaps = 0/131 (0%)
 Frame = +1

Query  868   GKPFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSI  1047
             G PF V+G+VY DTC CGFETTAT Y+P + VR+ C +R+T  + YS    T+S G Y+I
Sbjct  25    GNPFHVQGRVYCDTCRCGFETTATNYIPGARVRIECKDRNTLQLAYSVEGETDSTGTYNI  84

Query  1048  LVNGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQP  1227
             LV  D  D +C+ VLV S        D GR RA V+++R NG+V D R+ANN+GF   +P
Sbjct  85    LVEEDHEDQICESVLVSSPISDCKSADPGRSRANVVVTRYNGVVKDKRYANNMGFFKNEP  144

Query  1228  LASCTQVVAQY  1260
             LA C +++ QY
Sbjct  145   LAGCEKILEQY  155



>gb|ABC86745.1| pollen-specific protein [Vitis pseudoreticulata]
Length=159

 Score =   136 bits (342),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 62/135 (46%), Positives = 89/135 (66%), Gaps = 0/135 (0%)
 Frame = +1

Query  871   KPFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSIL  1050
             +PF+++G+VY DTC  GFET+AT Y+  + VR+ C +R++  + YS   +T+S G Y I+
Sbjct  25    QPFVLQGRVYCDTCRAGFETSATTYIAGAKVRVECKDRNSMQLLYSIEGITDSTGTYKIM  84

Query  1051  VNGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPL  1230
             V  D  D LCD VLV S        D GRDRA VIL+R NG+V+D R+AN++GF    P+
Sbjct  85    VTEDHEDQLCDAVLVSSPQSDCASVDPGRDRAAVILTRYNGIVSDNRYANSMGFLKDHPM  144

Query  1231  ASCTQVVAQYHLNDD  1275
             + CTQ++ QY   +D
Sbjct  145   SECTQLLQQYQEFED  159



>ref|XP_010538956.1| PREDICTED: major pollen allergen Lol p 11 [Tarenaya hassleriana]
Length=159

 Score =   134 bits (336),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 61/134 (46%), Positives = 88/134 (66%), Gaps = 0/134 (0%)
 Frame = +1

Query  874   PFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILV  1053
             PF+V+G+VY DTC  GFET A+ Y+P + V+L C +R +  + YS  A T+S G Y I V
Sbjct  26    PFVVRGRVYCDTCRAGFETPASTYIPGAVVKLECKDRRSMELVYSHEARTDSTGAYKIWV  85

Query  1054  NGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  1233
             N D  D LCD++LVKS      K   GR+RARV L+R NG+ +D R+ NN+GF   + L+
Sbjct  86    NEDHEDQLCDIMLVKSPQLGCSKVSHGRERARVTLTRYNGIASDDRYVNNMGFERDEALS  145

Query  1234  SCTQVVAQYHLNDD  1275
              C++++ QY  N++
Sbjct  146   GCSEIMRQYQENEE  159



>ref|XP_009366359.1| PREDICTED: protein DOWNSTREAM OF FLC-like [Pyrus x bretschneideri]
Length=162

 Score =   133 bits (335),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 63/137 (46%), Positives = 87/137 (64%), Gaps = 0/137 (0%)
 Frame = +1

Query  868   GKPFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSI  1047
             G PF V+G+VY DTC CGFETTAT Y+  + VR+ C +R+T  + YS    T+S G Y+I
Sbjct  25    GNPFHVQGRVYCDTCRCGFETTATNYISGARVRIECKDRNTLQLAYSVEGETDSTGTYNI  84

Query  1048  LVNGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQP  1227
             L+  D  D +C  VLV S        D GR RA V+++R NG+V D R+ANN+GF   +P
Sbjct  85    LIEEDHEDQICKSVLVSSPISDCKSADPGRSRANVVVTRYNGVVKDKRYANNMGFFKDEP  144

Query  1228  LASCTQVVAQYHLNDDN  1278
             LA C +++ QY  +D +
Sbjct  145   LADCEKILEQYKNSDQH  161



>gb|AFK37732.1| unknown [Lotus japonicus]
Length=162

 Score =   133 bits (335),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 63/136 (46%), Positives = 90/136 (66%), Gaps = 1/136 (1%)
 Frame = +1

Query  874   PFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILV  1053
             PF+VKG VY D C  GFET+AT  +  + V L+C  +++N V Y+    TNS+GEY+I V
Sbjct  27    PFIVKGCVYCDPCRAGFETSATTRIAGTEVMLLCRQKNSNEVVYTKRGWTNSKGEYTISV  86

Query  1054  NGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  1233
             + D GD +CD  L+ S  P   +   GRD+ARVIL+R NG+ +D RFAN +GF ++   A
Sbjct  87    SEDHGDQICDAKLISSPHPTCKEATPGRDQARVILTRYNGIASDDRFANAMGFMSENVAA  146

Query  1234  SCTQVVAQY-HLNDDN  1278
              CTQ++ QY  L+++N
Sbjct  147   GCTQILKQYEELDNEN  162



>ref|XP_010455288.1| PREDICTED: protein DOWNSTREAM OF FLC-like [Camelina sativa]
Length=159

 Score =   132 bits (332),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 64/134 (48%), Positives = 82/134 (61%), Gaps = 0/134 (0%)
 Frame = +1

Query  874   PFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILV  1053
             PF+V+G+VY DTC  GFET+A+ Y+P + VRL C +R T  +TYS  A T+S G Y ILV
Sbjct  26    PFVVRGRVYCDTCLAGFETSASTYIPGAVVRLECKDRRTMELTYSHEARTDSTGSYKILV  85

Query  1054  NGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  1233
             N D  D  CD  LV SS         G DRARV L+R NG+ +D RFAN +GF    P+ 
Sbjct  86    NEDHDDQFCDATLVSSSQLRCSTRSPGHDRARVTLTRFNGIASDERFANTMGFLRDAPMP  145

Query  1234  SCTQVVAQYHLNDD  1275
              C +++  Y   DD
Sbjct  146   GCAEIMKLYQETDD  159



>ref|XP_002533139.1| Pollen-specific protein C13 precursor, putative [Ricinus communis]
 gb|EEF29251.1| Pollen-specific protein C13 precursor, putative [Ricinus communis]
Length=161

 Score =   132 bits (331),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 60/136 (44%), Positives = 85/136 (63%), Gaps = 0/136 (0%)
 Frame = +1

Query  868   GKPFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSI  1047
             G+PF +KG+VY DTC CGFET  T Y+P + VR+ C +R T  + YS    T+  G Y+I
Sbjct  26    GRPFHIKGRVYCDTCRCGFETKKTTYIPGARVRIECEDRTTLRLKYSVEGETDETGTYNI  85

Query  1048  LVNGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQP  1227
             LV  D  D +C   LV S  P     D GR RA V+++RNNG ++D+ FAN++GF   Q 
Sbjct  86    LVEDDHQDQICYAALVSSPWPSCNTADPGRSRAHVVVTRNNGAISDLHFANSMGFLRNQA  145

Query  1228  LASCTQVVAQYHLNDD  1275
             ++ CT++V Q   +D+
Sbjct  146   MSGCTELVKQLLQSDE  161



>ref|XP_008245042.1| PREDICTED: protein DOWNSTREAM OF FLC-like [Prunus mume]
Length=162

 Score =   132 bits (331),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 65/137 (47%), Positives = 88/137 (64%), Gaps = 1/137 (1%)
 Frame = +1

Query  868   GKPFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSI  1047
             G PF ++G+VY DTC CGFETTAT Y+P + VR+ C  R+T  + YS    T++ G Y+I
Sbjct  25    GNPFHIQGRVYCDTCRCGFETTATTYIPGATVRIECKYRNTLQLAYSVEGETDTTGTYNI  84

Query  1048  LVNGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQP  1227
             LV  D  D +C+ VLV S        D GR+RA V+++R NG+V D  +ANN+GF   QP
Sbjct  85    LVEDDHEDQICESVLVSSPVNDCKSADPGRNRANVVVTRYNGVVKDKHYANNMGFFKDQP  144

Query  1228  LASCTQVVAQYHLNDDN  1278
             LA C +++ QY LN D 
Sbjct  145   LAGCEELLKQY-LNYDQ  160



>ref|XP_007206364.1| hypothetical protein PRUPE_ppa017800mg [Prunus persica]
 gb|EMJ07563.1| hypothetical protein PRUPE_ppa017800mg [Prunus persica]
Length=160

 Score =   131 bits (329),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 65/137 (47%), Positives = 87/137 (64%), Gaps = 1/137 (1%)
 Frame = +1

Query  868   GKPFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSI  1047
             G PF ++G+VY DTC CGFETTAT Y+P + VR+ C  R+T  + YS    T++ G Y+I
Sbjct  23    GNPFHIQGRVYCDTCRCGFETTATTYIPGATVRIECKYRNTLQLAYSVEGETDATGTYNI  82

Query  1048  LVNGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQP  1227
             LV  D  D +C+ VLV S        D GR RA V+++R NG+V D  +ANN+GF   QP
Sbjct  83    LVEDDHEDQICESVLVSSPVNDCKSADPGRKRANVVVTRYNGVVKDKHYANNMGFFKDQP  142

Query  1228  LASCTQVVAQYHLNDDN  1278
             LA C +++ QY LN D 
Sbjct  143   LAGCEELLKQY-LNYDQ  158



>ref|XP_010436385.1| PREDICTED: protein DOWNSTREAM OF FLC-like [Camelina sativa]
Length=159

 Score =   130 bits (328),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 63/134 (47%), Positives = 82/134 (61%), Gaps = 0/134 (0%)
 Frame = +1

Query  874   PFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILV  1053
             PF+V+G+VY DTC  GFET+A+ Y+P + VRL C +R T  +TYS  A T+S G Y ILV
Sbjct  26    PFVVRGRVYCDTCLAGFETSASTYIPGAVVRLECKDRRTMELTYSHEARTDSTGSYKILV  85

Query  1054  NGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  1233
             N D  D  CD  LV SS         G DRARV L+R NG+ +D RFAN +GF    P+ 
Sbjct  86    NEDHDDQFCDATLVSSSQLRCSTLSPGHDRARVTLTRFNGIASDERFANTMGFLRDAPMP  145

Query  1234  SCTQVVAQYHLNDD  1275
              C +++  Y   +D
Sbjct  146   GCAEIMKLYQETED  159



>ref|XP_004289324.1| PREDICTED: protein DOWNSTREAM OF FLC-like [Fragaria vesca subsp. 
vesca]
Length=163

 Score =   130 bits (327),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 66/137 (48%), Positives = 87/137 (64%), Gaps = 1/137 (1%)
 Frame = +1

Query  868   GKPFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSI  1047
             GKPF V+G+VY DTC CGFET+AT Y+  + V + C NR++ ++ YS   VT+  G Y+I
Sbjct  26    GKPFHVQGRVYCDTCRCGFETSATIYIAGATVGIKCMNRNSMSLAYSVEGVTDETGTYNI  85

Query  1048  LVNGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQP  1227
             LV  D  D +C+ VLV S        D GR RA V+L+R NG+V   RFANN+GF   Q 
Sbjct  86    LVEDDHEDQICESVLVSSPISDCKSADPGRSRANVVLTRFNGVVKTKRFANNMGFFKDQA  145

Query  1228  LASCTQVVAQYHLNDDN  1278
             L  CT+++ QY LN D 
Sbjct  146   LPECTELLKQY-LNYDQ  161



>ref|XP_010269200.1| PREDICTED: pollen-specific protein C13-like [Nelumbo nucifera]
Length=159

 Score =   130 bits (327),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 63/130 (48%), Positives = 83/130 (64%), Gaps = 0/130 (0%)
 Frame = +1

Query  874   PFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILV  1053
             PF V GKVY D C  GFET+AT Y+P + VR+ C +RDT  + +S + VT+S G Y I V
Sbjct  26    PFTVFGKVYCDNCRAGFETSATTYIPGAKVRVECRDRDTLNLLFSVDGVTDSTGSYKIQV  85

Query  1054  NGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  1233
               D  D LC+ VLV S        + GR+RARVIL+R NG+ +D R+AN+LGF   QPL 
Sbjct  86    AEDHEDQLCESVLVSSPQNDCSAVEPGRERARVILTRGNGIASDNRYANSLGFIKDQPLP  145

Query  1234  SCTQVVAQYH  1263
              C +++ QY 
Sbjct  146   GCAEIMKQYQ  155



>ref|XP_010090546.1| hypothetical protein L484_016596 [Morus notabilis]
 gb|EXB39752.1| hypothetical protein L484_016596 [Morus notabilis]
Length=186

 Score =   131 bits (329),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 65/138 (47%), Positives = 89/138 (64%), Gaps = 1/138 (1%)
 Frame = +1

Query  868   GKPFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSI  1047
             G PF + G+VY DTC+ GFETTAT Y+P + VRL C +R+T  + YS++AVT+S G Y+I
Sbjct  46    GTPFHIIGRVYCDTCHAGFETTATYYIPGAKVRLDCLDRETLELRYSSHAVTDSTGTYNI  105

Query  1048  LVNGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRN-NGLVNDVRFANNLGFTTKQ  1224
              V  D  D +C+ VL  S       PD GR RA  +L+R  NG+VN+    NN+GF  ++
Sbjct  106   KVEDDHEDQICECVLESSPIAACEMPDPGRSRASALLTRYMNGVVNNKHIVNNMGFLLEK  165

Query  1225  PLASCTQVVAQYHLNDDN  1278
             PLA C QV+ +Y  +DD 
Sbjct  166   PLAECEQVLKRYFPDDDE  183



>gb|AFK47744.1| unknown [Lotus japonicus]
Length=162

 Score =   129 bits (325),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 62/136 (46%), Positives = 89/136 (65%), Gaps = 1/136 (1%)
 Frame = +1

Query  874   PFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILV  1053
             PF+VKG VY D C  GFET+AT  +  + V L+C  +++N V Y+    TNS+GEY+I V
Sbjct  27    PFIVKGCVYCDPCRAGFETSATTRIAGAEVMLLCRQKNSNEVVYTKRGWTNSKGEYTISV  86

Query  1054  NGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  1233
             + D GD +CD  L+ S  P   +   GRD+ARVIL+R NG+ +D RFAN +G  ++   A
Sbjct  87    SEDHGDQICDAKLISSPHPTCKEATPGRDQARVILTRYNGIASDDRFANAMGSMSENVAA  146

Query  1234  SCTQVVAQY-HLNDDN  1278
              CTQ++ QY  L+++N
Sbjct  147   GCTQILKQYEELDNEN  162



>ref|XP_011621414.1| PREDICTED: olee1-like protein [Amborella trichopoda]
Length=163

 Score =   129 bits (324),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/130 (45%), Positives = 85/130 (65%), Gaps = 0/130 (0%)
 Frame = +1

Query  877   FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  1056
             F V+GKVY D C  GFET  T+Y+PE+ VR+ C +R+   + YS   VT+  G Y I V 
Sbjct  27    FFVEGKVYCDNCRAGFETRVTEYVPEARVRVECKDREGGHLIYSIEGVTDRTGTYQIPVE  86

Query  1057  GDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLAS  1236
             GD  +++C+V+ + S+DP   +   GR+RAR++L+ NNG+++D RFAN L F  K PL  
Sbjct  87    GDHENEICEVMAINSTDPNCNEIFHGRNRARILLTTNNGIISDKRFANPLAFLKKDPLPV  146

Query  1237  CTQVVAQYHL  1266
             C +V+ +Y L
Sbjct  147   CAEVLKEYKL  156



>ref|XP_008234688.1| PREDICTED: protein DOWNSTREAM OF FLC-like [Prunus mume]
Length=162

 Score =   129 bits (324),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 64/137 (47%), Positives = 87/137 (64%), Gaps = 1/137 (1%)
 Frame = +1

Query  868   GKPFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSI  1047
             G PF ++G+VY DTC CGFETTAT Y+P + VR+ C  R+T  + YS    T++ G Y+I
Sbjct  25    GNPFHIQGRVYCDTCRCGFETTATTYIPGATVRIECKYRNTLQLAYSVEGETDATGTYNI  84

Query  1048  LVNGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQP  1227
             LV  D  D +C+ VLV S        D  R+RA V+++R NG+V D  +ANN+GF   QP
Sbjct  85    LVEDDHEDQICESVLVSSPVNDCKSADPRRNRANVVVTRYNGIVKDKHYANNMGFFKDQP  144

Query  1228  LASCTQVVAQYHLNDDN  1278
             LA C +++ QY LN D 
Sbjct  145   LAGCEELLKQY-LNYDQ  160



>ref|XP_002513885.1| Pollen-specific protein C13 precursor, putative [Ricinus communis]
 gb|EEF48468.1| Pollen-specific protein C13 precursor, putative [Ricinus communis]
Length=159

 Score =   129 bits (323),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/134 (46%), Positives = 86/134 (64%), Gaps = 0/134 (0%)
 Frame = +1

Query  874   PFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILV  1053
             PF V+G+VY DTC  GFET+ T Y+  + VR+ C +R T  + YS    T+S G Y I V
Sbjct  26    PFEVEGRVYCDTCRAGFETSKTTYVAGAKVRVECKDRKTMELVYSKEGTTDSTGTYRIHV  85

Query  1054  NGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  1233
             + D  D LCD +LV S      KP SGRDRARVIL+ NNG+V++ R+AN++GF  +  ++
Sbjct  86    DEDHQDQLCDAMLVSSPQHDCMKPSSGRDRARVILTNNNGIVSNKRYANSIGFMKEDAMS  145

Query  1234  SCTQVVAQYHLNDD  1275
              C +++ QY   +D
Sbjct  146   GCFELLRQYQEYED  159



>ref|XP_006289520.1| hypothetical protein CARUB_v10003061mg [Capsella rubella]
 gb|EOA22418.1| hypothetical protein CARUB_v10003061mg [Capsella rubella]
Length=160

 Score =   128 bits (322),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 62/134 (46%), Positives = 83/134 (62%), Gaps = 0/134 (0%)
 Frame = +1

Query  874   PFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILV  1053
             PF+V+G+VY DTC  GFET+A+ Y+P + VRL C +R T  +TYS  A T+S G Y ILV
Sbjct  27    PFVVRGRVYCDTCLAGFETSASTYIPGAVVRLECKDRRTMELTYSHEARTDSTGSYKILV  86

Query  1054  NGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  1233
             + D  D  CD  LV+SS         G DRARV L+R NG+ +D RFAN+LGF     + 
Sbjct  87    SEDHDDQFCDATLVRSSQLRCSNVSPGHDRARVTLTRFNGIASDERFANSLGFVRDAAMP  146

Query  1234  SCTQVVAQYHLNDD  1275
              C +++  Y   +D
Sbjct  147   GCAEIMKLYQETED  160



>emb|CDY12288.1| BnaA09g24880D [Brassica napus]
 emb|CDX90693.1| BnaA03g23730D [Brassica napus]
Length=159

 Score =   127 bits (319),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 62/134 (46%), Positives = 82/134 (61%), Gaps = 0/134 (0%)
 Frame = +1

Query  874   PFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILV  1053
             PF+V+G+VY DTC  GFET+A+ ++P + VRL C +R T  +TY   A T+S G Y ILV
Sbjct  26    PFVVRGRVYCDTCLAGFETSASTFIPGAVVRLECKDRRTMELTYRHEARTDSTGSYKILV  85

Query  1054  NGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  1233
             + D  D  CD +LV SS         G DRARV L+R NG+ +D RFANNLGF       
Sbjct  86    SEDHEDQFCDTMLVSSSQLRCSNVSPGHDRARVTLTRFNGIASDERFANNLGFLRDAASP  145

Query  1234  SCTQVVAQYHLNDD  1275
              C +++ QY   +D
Sbjct  146   GCAEIMKQYQETED  159



>ref|XP_009134109.1| PREDICTED: pollen-specific protein C13 [Brassica rapa]
Length=159

 Score =   127 bits (318),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 62/134 (46%), Positives = 82/134 (61%), Gaps = 0/134 (0%)
 Frame = +1

Query  874   PFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILV  1053
             PF+V+G+VY DTC  GFET+A+ ++P + VRL C +R T  +TY   A T+S G Y ILV
Sbjct  26    PFVVRGRVYCDTCLAGFETSASTFIPGAVVRLECKDRRTMELTYRHEARTDSTGSYRILV  85

Query  1054  NGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  1233
             + D  D  CD +LV SS         G DRARV L+R NG+ +D RFANNLGF       
Sbjct  86    SEDHEDQFCDTMLVSSSQLRCSNVSPGHDRARVTLTRFNGIASDERFANNLGFLRDAASP  145

Query  1234  SCTQVVAQYHLNDD  1275
              C +++ QY   +D
Sbjct  146   GCAEIMKQYQETED  159



>ref|XP_002307393.1| pollen Ole e 1 allergen and extensin family protein [Populus 
trichocarpa]
 gb|ABK95954.1| unknown [Populus trichocarpa]
 gb|EEE94389.1| pollen Ole e 1 allergen and extensin family protein [Populus 
trichocarpa]
Length=159

 Score =   126 bits (317),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 60/134 (45%), Positives = 85/134 (63%), Gaps = 0/134 (0%)
 Frame = +1

Query  874   PFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILV  1053
             PF+V+G VY DTC  GFET+ T  +  + VRL C +R T  + YS    T+S G+Y+I V
Sbjct  26    PFVVQGSVYCDTCLAGFETSKTTNIAGAKVRLECKDRKTQDLVYSKEGTTDSTGKYTITV  85

Query  1054  NGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  1233
             + D  D +CD +LV S       P +GRDRARVIL+ +NGLV+  R+AN +GF   QP++
Sbjct  86    DEDHEDQICDCMLVSSPRKDCRSPSAGRDRARVILTNDNGLVSTTRYANAMGFMAAQPMS  145

Query  1234  SCTQVVAQYHLNDD  1275
              CT+++  Y   +D
Sbjct  146   GCTELLRLYQEYED  159



>ref|XP_006857531.1| PREDICTED: pollen-specific protein C13 [Amborella trichopoda]
 gb|ERN18998.1| hypothetical protein AMTR_s00061p00032820 [Amborella trichopoda]
Length=159

 Score =   126 bits (316),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/133 (44%), Positives = 88/133 (66%), Gaps = 0/133 (0%)
 Frame = +1

Query  877   FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  1056
             F V+G+VY DTC  GFET+AT Y+  S VRL C +R T+ +TYS   VT++ G Y + V+
Sbjct  27    FEVEGRVYCDTCRAGFETSATTYIKGSTVRLECKDRATHQLTYSIEGVTDATGTYRLPVS  86

Query  1057  GDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLAS  1236
              DR  ++C+VV+V S +   GK   GR+RARV+L+ NNG+V++ R+AN L F   +PL  
Sbjct  87    DDRQHEICEVVVVSSPEAGCGKAMLGRERARVLLTHNNGIVSNTRYANALAFLKDEPLPR  146

Query  1237  CTQVVAQYHLNDD  1275
             C +++  Y   ++
Sbjct  147   CAELLKLYKEKEE  159



>ref|XP_002310579.1| hypothetical protein POPTR_0007s05750g [Populus trichocarpa]
 gb|EEE91029.1| hypothetical protein POPTR_0007s05750g [Populus trichocarpa]
Length=158

 Score =   126 bits (316),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 61/136 (45%), Positives = 85/136 (63%), Gaps = 0/136 (0%)
 Frame = +1

Query  868   GKPFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSI  1047
             G PF V+G+VY DTC CGFET  T Y+P++ VR+ C +R    + YS   VT+S G Y I
Sbjct  23    GNPFYVRGRVYCDTCQCGFETKKTTYVPDARVRIECRDRTDLQLRYSVEGVTDSTGTYKI  82

Query  1048  LVNGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQP  1227
              V GD+ D LC VVLV S        D+ R+ A VIL+R+NG ++D+ +AN+LGF   + 
Sbjct  83    KVEGDQADRLCHVVLVDSPLADCKTVDTARNGAEVILTRSNGAISDLHYANSLGFVKDKA  142

Query  1228  LASCTQVVAQYHLNDD  1275
             L  C ++V Q   +D+
Sbjct  143   LPGCAELVKQLLESDE  158



>ref|XP_002301038.1| pollen Ole e 1 allergen and extensin family protein [Populus 
trichocarpa]
 gb|ABK93129.1| unknown [Populus trichocarpa]
 gb|ABK94485.1| unknown [Populus trichocarpa]
 gb|ABK95752.1| unknown [Populus trichocarpa]
 gb|EEE80311.1| pollen Ole e 1 allergen and extensin family protein [Populus 
trichocarpa]
Length=159

 Score =   125 bits (314),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 60/134 (45%), Positives = 83/134 (62%), Gaps = 0/134 (0%)
 Frame = +1

Query  874   PFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILV  1053
             PF V+G VY DTC  GFET  T Y+  S V++ C +R T  + YS    T+S G+Y I V
Sbjct  26    PFSVQGLVYCDTCLAGFETPKTTYIAGSKVKVECRDRKTQDLVYSKEGTTDSTGKYIITV  85

Query  1054  NGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  1233
             + D  D +CD +LV S       P +GRDRARVIL+  NGLV+  R+AN++GF   QP++
Sbjct  86    DEDHKDQICDAMLVSSPRKDCSSPSAGRDRARVILTSYNGLVSTTRYANSMGFMAAQPMS  145

Query  1234  SCTQVVAQYHLNDD  1275
              CT+++  Y   D+
Sbjct  146   GCTELLRSYQEFDN  159



>gb|ABK94215.1| unknown [Populus trichocarpa]
Length=159

 Score =   125 bits (314),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 60/134 (45%), Positives = 83/134 (62%), Gaps = 0/134 (0%)
 Frame = +1

Query  874   PFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILV  1053
             PF V+G VY DTC  GFET  T Y+  S V++ C +R T  + YS    T+S G+Y I V
Sbjct  26    PFSVQGIVYCDTCLAGFETPKTTYIAGSKVKVECRDRKTQDLVYSKEGTTDSTGKYIITV  85

Query  1054  NGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  1233
             + D  D +CD +LV S       P +GRDRARVIL+  NGLV+  R+AN++GF   QP++
Sbjct  86    DEDHKDQICDAMLVSSPRKDCSSPSAGRDRARVILTSYNGLVSTTRYANSMGFMAAQPMS  145

Query  1234  SCTQVVAQYHLNDD  1275
              CT+++  Y   D+
Sbjct  146   GCTELLRSYQEFDN  159



>ref|XP_011016068.1| PREDICTED: pollen-specific protein C13-like [Populus euphratica]
 ref|XP_011027685.1| PREDICTED: pollen-specific protein C13 isoform X1 [Populus euphratica]
 ref|XP_011027686.1| PREDICTED: pollen-specific protein C13 isoform X2 [Populus euphratica]
Length=159

 Score =   124 bits (312),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 59/134 (44%), Positives = 84/134 (63%), Gaps = 0/134 (0%)
 Frame = +1

Query  874   PFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILV  1053
             PF V+G+VY DTC+ GFET  T Y+  S V++ C +R T  + YS    T+S G Y I V
Sbjct  26    PFSVQGRVYCDTCHAGFETPKTTYIAGSKVKVECRDRKTQDLVYSKEGTTDSTGTYIITV  85

Query  1054  NGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  1233
             + D  D +CD +LV S       P +GR+RARVIL+  NGLV+  R+AN++GF   QP++
Sbjct  86    DEDHKDQICDAMLVSSPRQDCSSPSAGRERARVILTNYNGLVSTTRYANSMGFMAAQPMS  145

Query  1234  SCTQVVAQYHLNDD  1275
              CT+++  Y   D+
Sbjct  146   GCTELLRLYQDYDN  159



>ref|XP_012078096.1| PREDICTED: pollen-specific protein C13 [Jatropha curcas]
 gb|KDP32694.1| hypothetical protein JCGZ_11986 [Jatropha curcas]
Length=159

 Score =   124 bits (312),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 61/134 (46%), Positives = 80/134 (60%), Gaps = 0/134 (0%)
 Frame = +1

Query  874   PFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILV  1053
             PF V+G+VY DTC  GFET  T Y+  + VRL C +R +  + YS    T+S G Y I V
Sbjct  26    PFEVEGRVYCDTCRAGFETPKTTYIAGAKVRLECKDRKSMELVYSKEGTTDSTGTYKIYV  85

Query  1054  NGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  1233
             + D  D LCD VLV S       P SGRDRARVIL+  NG+ ++ RFAN +GF      +
Sbjct  86    DDDHADQLCDAVLVSSPKKDCRSPSSGRDRARVILTSYNGIASNKRFANAIGFEKDDIES  145

Query  1234  SCTQVVAQYHLNDD  1275
              CT+++ QY   +D
Sbjct  146   GCTELLRQYQEYED  159



>ref|XP_011006159.1| PREDICTED: pollen-specific protein C13-like [Populus euphratica]
 ref|XP_011016058.1| PREDICTED: pollen-specific protein C13-like [Populus euphratica]
Length=159

 Score =   124 bits (312),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 59/134 (44%), Positives = 83/134 (62%), Gaps = 0/134 (0%)
 Frame = +1

Query  874   PFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILV  1053
             PF+V+G VY DTC  GFET+ T  +  + VRL C +R T  + YS    T+S G+Y+I V
Sbjct  26    PFVVQGSVYCDTCLAGFETSKTTNIAGAKVRLECKDRKTQDLVYSKEGTTDSTGKYTITV  85

Query  1054  NGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  1233
             + D  D +CD +LV S       P +GRDRARVIL+ NNGLV+  R+ N +GF    P++
Sbjct  86    DEDHKDQICDCMLVSSPRKDCRSPSAGRDRARVILTNNNGLVSTTRYVNAMGFMAAHPMS  145

Query  1234  SCTQVVAQYHLNDD  1275
              CT+++  Y   +D
Sbjct  146   GCTELLRLYQEYED  159



>gb|KJB59946.1| hypothetical protein B456_009G282200 [Gossypium raimondii]
Length=159

 Score =   124 bits (311),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 58/134 (43%), Positives = 83/134 (62%), Gaps = 0/134 (0%)
 Frame = +1

Query  874   PFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILV  1053
             P +V+G+VY D C  GFET  T+ +  + V++VC+NR T  V Y     T+S G+Y I V
Sbjct  26    PLVVQGQVYCDHCRAGFETPKTRNMAGAKVKVVCSNRKTGDVVYEKEGHTDSTGQYKIAV  85

Query  1054  NGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  1233
             + D  D++CD VLVKSS P   +   GR+RARV+L+  NG+ ++ RFAN +GF   +  A
Sbjct  86    SEDHLDEICDAVLVKSSQPECAEMSPGRERARVVLTNFNGISSNTRFANAMGFMANKAEA  145

Query  1234  SCTQVVAQYHLNDD  1275
              C +V+  Y   DD
Sbjct  146   GCAEVMKVYQEEDD  159



>emb|CDY05022.1| BnaC03g28200D [Brassica napus]
Length=159

 Score =   124 bits (311),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 61/134 (46%), Positives = 82/134 (61%), Gaps = 0/134 (0%)
 Frame = +1

Query  874   PFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILV  1053
             PF+V+G+VY DTC  GFET+A+ ++P + VRL C +R T  +TY   A T+S G Y ILV
Sbjct  26    PFVVRGRVYCDTCLAGFETSASTFIPGAVVRLECKDRRTMELTYRHEARTDSTGSYKILV  85

Query  1054  NGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  1233
             + D  D  CD +LV SS         G +RARV L+R NG+ +D RFANNLGF       
Sbjct  86    SEDHEDQFCDTMLVSSSQLRCSNVSPGHNRARVTLTRFNGIASDERFANNLGFLRDAASP  145

Query  1234  SCTQVVAQYHLNDD  1275
              C +++ QY   +D
Sbjct  146   GCAEIMKQYQEIED  159



>ref|NP_567338.1| protein SAH7 [Arabidopsis thaliana]
 emb|CAB40579.1| SAH7 protein [Arabidopsis thaliana]
 gb|AAL69502.1| unknown protein [Arabidopsis thaliana]
 gb|AAM45117.1| unknown protein [Arabidopsis thaliana]
 gb|AAM62935.1| allergen-like protein BRSn20 [Arabidopsis thaliana]
 dbj|BAF00475.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE82668.1| protein SAH7 [Arabidopsis thaliana]
Length=159

 Score =   124 bits (310),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 61/134 (46%), Positives = 81/134 (60%), Gaps = 0/134 (0%)
 Frame = +1

Query  874   PFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILV  1053
             PF+V+G+VY DTC  GFET A+ Y+  + VRL C +R T  +TYS  A T+S G Y ILV
Sbjct  26    PFVVRGRVYCDTCLAGFETPASTYISGAVVRLECKDRRTMELTYSHEARTDSTGSYKILV  85

Query  1054  NGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  1233
             N D  +  CD +LV+SS         G DRARV L+R NG+ +D RFANN+GF     + 
Sbjct  86    NEDHDEQFCDAMLVRSSQLRCSNVSPGHDRARVTLTRFNGIASDDRFANNMGFLRDAAMP  145

Query  1234  SCTQVVAQYHLNDD  1275
              C  ++  Y   +D
Sbjct  146   GCADIMKLYQETED  159



>ref|XP_008797140.1| PREDICTED: major pollen allergen Lol p 11-like [Phoenix dactylifera]
 ref|XP_008797142.1| PREDICTED: major pollen allergen Lol p 11-like [Phoenix dactylifera]
Length=174

 Score =   124 bits (310),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 61/134 (46%), Positives = 88/134 (66%), Gaps = 0/134 (0%)
 Frame = +1

Query  877   FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  1056
              +++G VY DTC  GFET  T Y+P + VRL CT   T+ VTY+A A T+  G Y I+V 
Sbjct  40    LVLEGHVYCDTCRAGFETDLTAYIPGAKVRLECTRYGTDEVTYAAEATTDLLGIYQIVVP  99

Query  1057  GDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLAS  1236
             GD  +D C VVL+KS+     +   GRDRARV+L+++ GL+++VR AN LGF   +PLA 
Sbjct  100   GDHSEDQCSVVLMKSAVDNCTEIKPGRDRARVVLAQDGGLLSNVRRANALGFLIAEPLAE  159

Query  1237  CTQVVAQYHLNDDN  1278
             C +++ +Y   +D+
Sbjct  160   CGKLLQKYGFANDD  173



>ref|XP_012093159.1| PREDICTED: protein DOWNSTREAM OF FLC [Jatropha curcas]
 gb|KDP46869.1| hypothetical protein JCGZ_24078 [Jatropha curcas]
Length=159

 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/135 (43%), Positives = 81/135 (60%), Gaps = 0/135 (0%)
 Frame = +1

Query  871   KPFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSIL  1050
             +PF V G+VY DTC CGFET  T Y+P + VR+ C +R  + + YS    T+S G Y I 
Sbjct  25    RPFFVHGRVYCDTCRCGFETNKTTYIPGAKVRIECLDRVNSQLKYSIEGKTDSTGTYRIK  84

Query  1051  VNGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPL  1230
             V  D  D  C  VLV S        D GR RA VIL+R+NG V+D+ FAN++G+   QP+
Sbjct  85    VKDDHQDQFCYAVLVSSPQANCKTADPGRSRAEVILTRSNGAVSDLHFANSMGYFRYQPM  144

Query  1231  ASCTQVVAQYHLNDD  1275
             + C ++V +   +D+
Sbjct  145   SGCAELVKELLHSDE  159



>gb|KFK32118.1| hypothetical protein AALP_AA6G200700 [Arabis alpina]
Length=160

 Score =   122 bits (307),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 60/134 (45%), Positives = 80/134 (60%), Gaps = 0/134 (0%)
 Frame = +1

Query  874   PFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILV  1053
             PF+V+G+V+ DTC  GFET A+ Y+P + VRL C +R T  + Y+ +A T+S G Y ILV
Sbjct  27    PFVVRGRVFCDTCLAGFETPASTYIPGAVVRLECKDRRTMELRYTHDAKTDSTGSYKILV  86

Query  1054  NGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  1233
             N D  D  CD +LV SS         G DRARV L+R NG+  D RFANN+ F     L 
Sbjct  87    NEDHEDQFCDTMLVSSSQLRCSNVSPGHDRARVTLTRFNGIATDDRFANNMAFLRDAALP  146

Query  1234  SCTQVVAQYHLNDD  1275
              C +++  Y   +D
Sbjct  147   GCAEIMKLYQETED  160



>ref|XP_010105888.1| hypothetical protein L484_021545 [Morus notabilis]
 gb|EXC06707.1| hypothetical protein L484_021545 [Morus notabilis]
Length=172

 Score =   122 bits (307),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 61/141 (43%), Positives = 86/141 (61%), Gaps = 11/141 (8%)
 Frame = +1

Query  874   PFLVKGKVYLDTCNCGFETTATKYLP----------ESHVRLVCTNRDT-NAVTYSANAV  1020
             PF+V+GKVY DTC  GFET+AT Y+P           + +R+ C +R+  + V +     
Sbjct  26    PFIVEGKVYCDTCRAGFETSATTYIPVYVNGGYYNISARIRIECVDRNAPSKVLFRKETT  85

Query  1021  TNSQGEYSILVNGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFAN  1200
             T+S+G YS+LV  D G+ +CD V+V S      K   GRDRARVIL+  NG+ ++ RF N
Sbjct  86    TDSEGCYSMLVAEDHGNQICDAVVVSSPQQNCAKAAPGRDRARVILTGYNGIASEKRFVN  145

Query  1201  NLGFTTKQPLASCTQVVAQYH  1263
             N+GF   +PLA C+ V+ QY 
Sbjct  146   NIGFEMDEPLALCSNVLKQYQ  166



>gb|ABK92993.1| unknown [Populus trichocarpa]
Length=159

 Score =   122 bits (306),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 59/133 (44%), Positives = 82/133 (62%), Gaps = 0/133 (0%)
 Frame = +1

Query  877   FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  1056
             F V+G VY DTC  GFET  T Y+  S V++ C +R T  + YS    T+S G+Y I V+
Sbjct  27    FSVQGLVYCDTCLAGFETPKTTYIAGSKVKVECRDRKTQDLVYSKEGTTDSTGKYIITVD  86

Query  1057  GDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLAS  1236
              D  D +CD +LV S       P +GRDRARVIL+  NGLV+  R+AN++GF   QP++ 
Sbjct  87    EDHKDQICDAMLVSSPRKDCSSPSAGRDRARVILTSYNGLVSTTRYANSMGFMAAQPMSG  146

Query  1237  CTQVVAQYHLNDD  1275
             CT+++  Y   D+
Sbjct  147   CTELLRSYQEFDN  159



>ref|XP_008234009.1| PREDICTED: pollen-specific protein C13 [Prunus mume]
Length=159

 Score =   122 bits (305),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 61/134 (46%), Positives = 78/134 (58%), Gaps = 0/134 (0%)
 Frame = +1

Query  874   PFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILV  1053
             PF V+GKVY DTC  GFET+AT Y+P + VRL C +R T  + Y+    T+S G Y I V
Sbjct  26    PFTVEGKVYCDTCRAGFETSATTYIPGATVRLECRDRKTMDIRYTKEGRTDSTGTYKIPV  85

Query  1054  NGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  1233
               D  D  CD VLV SS         GRDRARVIL+  NG+ +  RFAN +GF   + + 
Sbjct  86    TEDHEDQFCDAVLVSSSQKDCAAAAPGRDRARVILTGYNGIASYNRFANAMGFMKNEAVP  145

Query  1234  SCTQVVAQYHLNDD  1275
              C Q++ Q    D+
Sbjct  146   GCAQILKQLQEFDE  159



>gb|KDO80906.1| hypothetical protein CISIN_1g031458mg [Citrus sinensis]
Length=159

 Score =   122 bits (305),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 58/134 (43%), Positives = 82/134 (61%), Gaps = 0/134 (0%)
 Frame = +1

Query  871   KPFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSIL  1050
             KPF V+G+VY DTC  GFET AT Y+  + V++ C +R +  V YS    T+S G Y IL
Sbjct  25    KPFSVEGRVYCDTCQAGFETPATTYIAGAKVKVECKDRKSMQVVYSREGKTDSTGTYKIL  84

Query  1051  VNGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPL  1230
             V+ D  D LCD VLV S          GR+R+RVIL+  NG+ ++ R+AN++GF   +P+
Sbjct  85    VSEDHQDQLCDAVLVSSPQNDCKTVAPGRERSRVILTSYNGISSETRYANSMGFMKAEPM  144

Query  1231  ASCTQVVAQYHLND  1272
             + C +V+  Y   D
Sbjct  145   SGCAEVLRLYQEED  158



>ref|XP_006472638.1| PREDICTED: pollen-specific protein C13-like [Citrus sinensis]
Length=159

 Score =   122 bits (305),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 58/134 (43%), Positives = 82/134 (61%), Gaps = 0/134 (0%)
 Frame = +1

Query  871   KPFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSIL  1050
             KPF V+G+VY DTC  GFET AT Y+  + V++ C +R +  V YS    T+S G Y IL
Sbjct  25    KPFSVEGRVYCDTCQAGFETPATTYIAGAKVKVECKDRKSMQVVYSREGKTDSTGTYKIL  84

Query  1051  VNGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPL  1230
             V+ D  D LCD VLV S          GR+R+RVIL+  NG+ ++ R+AN++GF   +P+
Sbjct  85    VSEDHQDQLCDAVLVSSPQNDCKTVAPGRERSRVILTSYNGISSETRYANSMGFMKAEPM  144

Query  1231  ASCTQVVAQYHLND  1272
             + C +V+  Y   D
Sbjct  145   SGCAEVLRLYQEED  158



>ref|XP_006434027.1| hypothetical protein CICLE_v10002743mg [Citrus clementina]
 gb|ESR47267.1| hypothetical protein CICLE_v10002743mg [Citrus clementina]
Length=159

 Score =   121 bits (304),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 57/134 (43%), Positives = 82/134 (61%), Gaps = 0/134 (0%)
 Frame = +1

Query  871   KPFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSIL  1050
             KPF V+G+VY DTC  GFET AT Y+  + V++ C +R +  V YS    T+S G Y IL
Sbjct  25    KPFSVEGRVYCDTCQAGFETPATTYIAGAKVKVECKDRKSMQVVYSREGKTDSTGTYKIL  84

Query  1051  VNGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPL  1230
             V+ D  D LCD VL+ S          GR+R+RVIL+  NG+ ++ R+AN++GF   +P+
Sbjct  85    VSEDHQDQLCDAVLISSPQNDCKTVAPGRERSRVILTSYNGISSETRYANSMGFMKAEPM  144

Query  1231  ASCTQVVAQYHLND  1272
             + C +V+  Y   D
Sbjct  145   SGCAEVLRLYQEED  158



>ref|XP_006397273.1| hypothetical protein EUTSA_v10029031mg [Eutrema salsugineum]
 gb|ESQ38726.1| hypothetical protein EUTSA_v10029031mg [Eutrema salsugineum]
Length=161

 Score =   121 bits (303),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 60/130 (46%), Positives = 80/130 (62%), Gaps = 0/130 (0%)
 Frame = +1

Query  874   PFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILV  1053
             PF+V+G+VY DTC  GFET A+ Y+P + VRL C +R+T  +TY+  A T+S G Y ILV
Sbjct  26    PFVVRGRVYCDTCLAGFETPASTYIPGAVVRLECKDRNTMDLTYTHEARTDSTGSYKILV  85

Query  1054  NGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  1233
             + D  D  CD +L  SS         G DRARV L+R NG+ ++ RFANNLGF     L 
Sbjct  86    SEDHEDQFCDTMLGSSSQLRCSNVSPGHDRARVTLTRFNGIASNERFANNLGFLRDAELP  145

Query  1234  SCTQVVAQYH  1263
              C +++  Y 
Sbjct  146   GCAEIMKLYQ  155



>ref|XP_006464247.1| PREDICTED: protein DOWNSTREAM OF FLC-like [Citrus sinensis]
Length=161

 Score =   120 bits (302),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/131 (44%), Positives = 86/131 (66%), Gaps = 0/131 (0%)
 Frame = +1

Query  868   GKPFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSI  1047
             G PF ++G+VY DTC CGFET+AT Y+  +HVR+ C +R++  + YS +  T+S G Y+I
Sbjct  22    GDPFHIRGRVYCDTCRCGFETSATTYIQGAHVRIECKDRNSLNLKYSIDGETDSTGTYNI  81

Query  1048  LVNGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQP  1227
              V+GD  D +C   L+ S        D GR  ++VIL+R+NG V+++ FAN LGF   +P
Sbjct  82    HVDGDHQDQICYSKLISSPLADCKTADPGRACSQVILTRSNGAVSNLHFANALGFLKARP  141

Query  1228  LASCTQVVAQY  1260
             LA C +++ +Y
Sbjct  142   LAFCPELLKKY  152



>ref|XP_010424432.1| PREDICTED: protein DOWNSTREAM OF FLC-like [Camelina sativa]
Length=268

 Score =   123 bits (308),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 61/126 (48%), Positives = 76/126 (60%), Gaps = 0/126 (0%)
 Frame = +1

Query  874   PFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILV  1053
             PF+V+G+VY  TC  GFET+A+ Y+P + VRL C +R T  +TYS  A T+S G Y ILV
Sbjct  26    PFVVRGRVYCHTCLAGFETSASTYIPGAVVRLECKDRRTMELTYSHEARTDSTGSYKILV  85

Query  1054  NGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  1233
             N D  D  CD  LV SS         G DRARV L+R NG+ +D RFAN +GF    P+ 
Sbjct  86    NEDHDDQFCDATLVSSSQLRCSTLSPGHDRARVTLTRFNGIASDERFANTMGFLRDAPMP  145

Query  1234  SCTQVV  1251
              C  V 
Sbjct  146   DCADVA  151



>ref|XP_002872410.1| hypothetical protein ARALYDRAFT_489767 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48669.1| hypothetical protein ARALYDRAFT_489767 [Arabidopsis lyrata subsp. 
lyrata]
Length=162

 Score =   120 bits (300),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 62/137 (45%), Positives = 81/137 (59%), Gaps = 3/137 (2%)
 Frame = +1

Query  874   PFLVKGKVYLDTCNCGFETTATKYLPESH---VRLVCTNRDTNAVTYSANAVTNSQGEYS  1044
             PF+V+G+VY DTC  GFET A+ Y+  +    VRL C +R T  +TYS  A T+S G Y 
Sbjct  26    PFVVRGRVYCDTCLAGFETPASTYIHGTSGAVVRLECKDRRTMELTYSHEARTDSTGSYK  85

Query  1045  ILVNGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQ  1224
             ILVN D  D  CD +LV+SS         G DRARV L+R NG+ +D RFANN+GF    
Sbjct  86    ILVNEDHDDQFCDAMLVRSSQLRCSNVSPGHDRARVTLTRFNGIASDDRFANNMGFLRDA  145

Query  1225  PLASCTQVVAQYHLNDD  1275
              +  C  ++  Y   +D
Sbjct  146   AMPGCADIMKLYQETED  162



>ref|XP_007018845.1| Pollen-specific protein C13, putative [Theobroma cacao]
 gb|EOY16070.1| Pollen-specific protein C13, putative [Theobroma cacao]
Length=159

 Score =   120 bits (300),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 54/133 (41%), Positives = 81/133 (61%), Gaps = 0/133 (0%)
 Frame = +1

Query  874   PFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILV  1053
             P +V+G+VY D C  GFET  T+ +  + V++ C++R T  V Y     T+S G Y ++V
Sbjct  26    PLVVQGQVYCDRCRAGFETPKTRNMAGAKVKVECSDRKTGQVVYKKEGYTDSTGHYKVVV  85

Query  1054  NGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  1233
             + D  D++CD +LVKSS P   K   GR+RARVIL+  NG+ ++ RFAN +GF   +  A
Sbjct  86    SEDHLDEICDAILVKSSQPDCAKMSPGRERARVILTNFNGIASNTRFANAMGFMADEADA  145

Query  1234  SCTQVVAQYHLND  1272
              C +++  Y   D
Sbjct  146   GCAEIMKLYQEED  158



>ref|NP_001238723.1| uncharacterized protein LOC100499710 precursor [Glycine max]
 gb|ACU13342.1| unknown [Glycine max]
 gb|KHN09136.1| Pollen-specific protein C13 [Glycine soja]
Length=162

 Score =   119 bits (299),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 56/135 (41%), Positives = 81/135 (60%), Gaps = 0/135 (0%)
 Frame = +1

Query  874   PFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILV  1053
             PF VKG+VY D C  GFET+AT Y+  + + L C +R +N V Y+    T+S G Y++ V
Sbjct  27    PFCVKGRVYCDPCRAGFETSATTYIAGAEIMLQCKSRVSNEVVYTKKGYTDSTGAYTMYV  86

Query  1054  NGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  1233
             + D  D +C   LV S  P   +   GRD A VIL+R NG+ +D RFAN +GF +++  +
Sbjct  87    DEDHADQICSAKLVSSPHPQCKEVTPGRDEAVVILTRYNGIASDDRFANAMGFMSQEVAS  146

Query  1234  SCTQVVAQYHLNDDN  1278
              C +V+ QY   D+ 
Sbjct  147   GCAEVLRQYEEFDNE  161



>gb|KHN19737.1| Pollen-specific protein C13 [Glycine soja]
Length=162

 Score =   119 bits (298),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 55/135 (41%), Positives = 81/135 (60%), Gaps = 0/135 (0%)
 Frame = +1

Query  874   PFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILV  1053
             PF VKG+VY D C  GFET+AT Y+  + + L C +R +N V Y+    T+S G Y++ V
Sbjct  27    PFCVKGRVYCDPCRAGFETSATTYIAGAEIMLQCKSRVSNEVVYTKKGYTDSTGAYTMYV  86

Query  1054  NGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  1233
             + D  D +C   LV S  P   +   GRD A VIL+R NG+ +D RFAN +GF +++  +
Sbjct  87    DEDHADQICSAKLVSSPHPQCKEVTPGRDEAVVILTRYNGIASDDRFANAMGFMSQEVAS  146

Query  1234  SCTQVVAQYHLNDDN  1278
              C +++ QY   D+ 
Sbjct  147   GCAEILRQYQEFDNE  161



>ref|XP_007225977.1| hypothetical protein PRUPE_ppa012675mg [Prunus persica]
 gb|EMJ27176.1| hypothetical protein PRUPE_ppa012675mg [Prunus persica]
Length=159

 Score =   119 bits (298),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 59/134 (44%), Positives = 78/134 (58%), Gaps = 0/134 (0%)
 Frame = +1

Query  874   PFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILV  1053
             PF V+GKV+ D C  GFET+AT Y+P + VRL C +R T  + Y+    T+S G Y I V
Sbjct  26    PFTVEGKVFCDPCRAGFETSATTYIPGATVRLECRDRKTMDIRYTKEGRTDSTGTYKIPV  85

Query  1054  NGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  1233
               D  D  CD VLV SS         GRDRARVIL+  NG+ +  RFAN +GF   + ++
Sbjct  86    TEDHEDQFCDAVLVSSSQKDCAAAAPGRDRARVILTGYNGIASYNRFANAMGFMKNEAVS  145

Query  1234  SCTQVVAQYHLNDD  1275
              C Q++ Q    D+
Sbjct  146   GCAQILKQLQEFDE  159



>ref|XP_006302909.1| hypothetical protein CARUB_v10021044mg [Capsella rubella]
 gb|EOA35807.1| hypothetical protein CARUB_v10021044mg [Capsella rubella]
Length=171

 Score =   119 bits (298),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 56/135 (41%), Positives = 87/135 (64%), Gaps = 1/135 (1%)
 Frame = +1

Query  877   FLVKGKVYLDTCNCGFETTATKY-LPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILV  1053
              +V+G+ Y DTC  GFET  + Y +P + V+LVC +R T   TYS  AV++ QG Y  +V
Sbjct  30    MVVQGRTYCDTCKFGFETPESSYFIPGATVKLVCKHRQTMEETYSDEAVSDKQGYYKFIV  89

Query  1054  NGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  1233
             + D  D++CDV+LVKSSD   GK   GR+++RVIL+  +G+ + +R ANN+GF  +    
Sbjct  90    HEDHKDEMCDVMLVKSSDKTCGKISVGREQSRVILNHYSGIASQIRHANNMGFEKEVSDV  149

Query  1234  SCTQVVAQYHLNDDN  1278
              C+ +  +Y +++D 
Sbjct  150   FCSALFQKYMVDEDE  164



>gb|AAT08700.1| pollen-specific protein [Hyacinthus orientalis]
Length=174

 Score =   119 bits (298),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 60/131 (46%), Positives = 81/131 (62%), Gaps = 0/131 (0%)
 Frame = +1

Query  868   GKPFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSI  1047
             G PF+V+G+V+ DTC  GFET AT Y+  + VR+ C  R T A T S + VT+  G Y+I
Sbjct  39    GSPFIVQGRVFCDTCRAGFETPATTYIAGAKVRVECKARATGAETCSFDGVTDETGTYNI  98

Query  1048  LVNGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQP  1227
              V  +   + C+ VLV+S D    K    R+RA V L+RNNG+ +DVRFAN +GF    P
Sbjct  99    WVADEHEHENCESVLVESPDHECSKIIDDRERAPVFLTRNNGIASDVRFANAMGFKKDVP  158

Query  1228  LASCTQVVAQY  1260
             LA C  ++ QY
Sbjct  159   LAFCASLMKQY  169



>ref|XP_009421183.1| PREDICTED: pollen-specific protein C13-like [Musa acuminata subsp. 
malaccensis]
Length=160

 Score =   119 bits (297),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 56/134 (42%), Positives = 84/134 (63%), Gaps = 0/134 (0%)
 Frame = +1

Query  877   FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  1056
             F ++G+VY D C  GFET+AT Y+  + V+L C   DT  V  +A AVT++ G Y++ V 
Sbjct  27    FRIQGRVYCDKCRAGFETSATDYIEGAKVKLECRQYDTGVVEQTATAVTDASGTYTLEVE  86

Query  1057  GDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLAS  1236
              +  +++C+VVLV+S  P   +  +GRDRARV++S  +GL   VR+AN+LGF    PL  
Sbjct  87    DNHEEEICEVVLVESPRPGCSEIMTGRDRARVLISAESGLTTSVRYANSLGFLNAAPLPE  146

Query  1237  CTQVVAQYHLNDDN  1278
             C  ++ +Y L  D 
Sbjct  147   CGLLLQKYALGVDG  160



>ref|XP_007136225.1| hypothetical protein PHAVU_009G028900g [Phaseolus vulgaris]
 gb|ESW08219.1| hypothetical protein PHAVU_009G028900g [Phaseolus vulgaris]
Length=162

 Score =   118 bits (296),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 56/136 (41%), Positives = 83/136 (61%), Gaps = 0/136 (0%)
 Frame = +1

Query  871   KPFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSIL  1050
             + F VKG+VY D C  GFET+AT Y+  + V   C +R TN V ++ NA+T+S G Y++ 
Sbjct  26    REFSVKGRVYCDRCRAGFETSATTYIAGAEVMAQCKSRTTNEVVFTQNAITDSSGTYTLH  85

Query  1051  VNGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPL  1230
             V  D  D++C V ++ S  P       GRD A VIL+R NG+ +D R+AN +GF +++  
Sbjct  86    VKKDHNDEICSVKILSSPHPECTVVTPGRDEALVILTRYNGIASDDRYANAMGFMSREVA  145

Query  1231  ASCTQVVAQYHLNDDN  1278
             A C +V+ QY   D+ 
Sbjct  146   AGCAEVLKQYQEFDNE  161



>ref|XP_009403224.1| PREDICTED: pollen-specific protein C13-like [Musa acuminata subsp. 
malaccensis]
Length=160

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/134 (40%), Positives = 89/134 (66%), Gaps = 0/134 (0%)
 Frame = +1

Query  877   FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  1056
             F+++G+VY DTC  GFET  ++Y+P + V+L C + +T+++ ++A  VT+  G Y+I V 
Sbjct  27    FVIQGRVYCDTCRAGFETVVSQYIPGAKVKLQCRHYETDSIEHTAVGVTDGTGTYNIEVE  86

Query  1057  GDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLAS  1236
              +  +++C+V LV+S  P   +    R+RARV+++  NGL +DVR+AN+LGF   +PL  
Sbjct  87    DNHEEEICEVSLVQSPVPGCSEVSGTRNRARVLVTGRNGLASDVRYANSLGFLKDEPLKE  146

Query  1237  CTQVVAQYHLNDDN  1278
             C  ++ QY L  D+
Sbjct  147   CGLLLQQYALGVDD  160



>ref|XP_009408781.1| PREDICTED: pollen-specific protein C13-like [Musa acuminata subsp. 
malaccensis]
Length=163

 Score =   117 bits (293),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 60/134 (45%), Positives = 85/134 (63%), Gaps = 0/134 (0%)
 Frame = +1

Query  877   FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  1056
              +V+G+VY DTC  GFET AT+Y+  + V+L C N  T A T +A AVTN++G Y I V+
Sbjct  30    LVVEGRVYCDTCRAGFETKATEYIEGAKVKLECKNYTTGASTLTAVAVTNNKGTYQIPVS  89

Query  1057  GDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLAS  1236
              D  ++ C V+LV S      +   GR+ A V+L+ N G+ + VR+AN+LGF    PLAS
Sbjct  90    DDHQEESCAVMLVSSPRSDCSEISDGRNHAAVVLTHNVGITSSVRYANSLGFLKDVPLAS  149

Query  1237  CTQVVAQYHLNDDN  1278
             C Q++ QY L  D+
Sbjct  150   CGQMLMQYALGVDD  163



>ref|XP_006390031.1| hypothetical protein EUTSA_v10019236mg [Eutrema salsugineum]
 gb|ESQ27317.1| hypothetical protein EUTSA_v10019236mg [Eutrema salsugineum]
Length=166

 Score =   117 bits (292),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 54/135 (40%), Positives = 88/135 (65%), Gaps = 1/135 (1%)
 Frame = +1

Query  877   FLVKGKVYLDTCNCGFETTATKY-LPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILV  1053
              +V+G  Y DTC  GFET  + Y +P + V+LVC +R T    Y+  AV++ +G+Y  +V
Sbjct  31    MVVQGSTYCDTCKFGFETAESSYFIPGATVKLVCNDRKTMKPIYTDVAVSDKEGKYKFIV  90

Query  1054  NGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  1233
             + D  D++CDVVLVKSSD    K   GR+++RVIL+  NG+ + +R ANN+GF  +    
Sbjct  91    HEDHKDEMCDVVLVKSSDASCPKISPGREQSRVILNHYNGIASQIRHANNMGFEKEVSDV  150

Query  1234  SCTQVVAQYHLNDDN  1278
              C++++ +Y +++D+
Sbjct  151   FCSELIKKYQVDEDD  165



>gb|AAM08621.1|AC107314_12 Putative Pollen specific protein C13 precursor [Oryza sativa 
Japonica Group]
 gb|AAN31783.1| Putataive pollen specific protein C13 precursor [Oryza sativa 
Japonica Group]
 gb|AAP53386.1| Pollen proteins Ole e I family protein, expressed [Oryza sativa 
Japonica Group]
 gb|EAY78230.1| hypothetical protein OsI_33275 [Oryza sativa Indica Group]
 gb|EAZ15857.1| hypothetical protein OsJ_31276 [Oryza sativa Japonica Group]
Length=172

 Score =   116 bits (291),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 58/133 (44%), Positives = 83/133 (62%), Gaps = 0/133 (0%)
 Frame = +1

Query  877   FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  1056
             F+V+G+V+ DTC  GFET A+ Y+  + V++ C ++ T A T S    T+  G Y+I VN
Sbjct  38    FVVRGRVWCDTCLAGFETPASTYIAGAKVKVECRSKSTGAKTCSFEGQTDHTGTYNIPVN  97

Query  1057  GDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLAS  1236
              +   +LC+ VLV S D   GK  +GR+RA V L+ NNG+ ++VR AN LGF    PLA+
Sbjct  98    DEHEHELCESVLVSSPDAKCGKIVAGRERAPVFLTNNNGVTSNVRLANALGFQKDAPLAA  157

Query  1237  CTQVVAQYHLNDD  1275
             C Q++  Y   DD
Sbjct  158   CAQILKMYEEVDD  170



>ref|XP_006652233.1| PREDICTED: pollen-specific protein C13-like [Oryza brachyantha]
Length=166

 Score =   116 bits (291),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 56/134 (42%), Positives = 85/134 (63%), Gaps = 0/134 (0%)
 Frame = +1

Query  877   FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  1056
             +LV+G+VY DTC  GFET  T+Y+  + VRL C +  T  +  + + VT+  G Y I + 
Sbjct  31    YLVQGRVYCDTCRAGFETNVTEYIKGAKVRLECKHYGTGNIERAVDGVTDETGTYKIELK  90

Query  1057  GDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLAS  1236
                 +D+C+VVLVKS     G+  + RDRARV+L+RN G+ +++RFAN LG+    PL  
Sbjct  91    DSHEEDICEVVLVKSPLANCGEVQAERDRARVLLTRNVGICDNLRFANPLGYLKDIPLPV  150

Query  1237  CTQVVAQYHLNDDN  1278
             C +++ Q+ L DD+
Sbjct  151   CGELLKQFDLTDDD  164



>ref|XP_004500607.1| PREDICTED: pollen-specific protein C13-like [Cicer arietinum]
Length=162

 Score =   116 bits (290),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 57/136 (42%), Positives = 82/136 (60%), Gaps = 1/136 (1%)
 Frame = +1

Query  874   PFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILV  1053
             P  +KG+VY D C  GFETTA   +  + V L C  R +N V YS    T+S G Y++ V
Sbjct  27    PLCLKGRVYCDACRAGFETTAITNIAGAEVLLQCKERISNEVVYSKRGWTDSTGSYTMYV  86

Query  1054  NGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  1233
             + D  D +CDV LV S      +   GRD+ARVIL+R NG+ ++ R+AN +GF  ++  +
Sbjct  87    DEDHADQVCDVKLVSSHQHFCREATPGRDQARVILTRFNGIASNDRYANAMGFMAQEVAS  146

Query  1234  SCTQVVAQYH-LNDDN  1278
              C +V+ QY  L+D+N
Sbjct  147   GCAEVLKQYQDLDDEN  162



>ref|XP_011030966.1| PREDICTED: protein DOWNSTREAM OF FLC [Populus euphratica]
Length=157

 Score =   116 bits (290),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 58/136 (43%), Positives = 82/136 (60%), Gaps = 0/136 (0%)
 Frame = +1

Query  868   GKPFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSI  1047
             G PF V+G+VY DTC CGFET  T Y+P + VR+ C +R    + YS   VT+S G Y I
Sbjct  22    GNPFHVRGRVYCDTCQCGFETKKTTYIPGATVRIECKDRTDLQLRYSLEGVTDSTGAYKI  81

Query  1048  LVNGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQP  1227
              V GD+ D +C VVLV S            +RA VIL+R+NG ++D+ +AN+LGF   + 
Sbjct  82    KVVGDQADRICHVVLVDSPLADCKTVHPVLNRAEVILTRSNGAISDLHYANSLGFVKDEA  141

Query  1228  LASCTQVVAQYHLNDD  1275
             L  C ++V +   +D+
Sbjct  142   LPGCAELVKKLLESDE  157



>ref|XP_002307104.1| hypothetical protein POPTR_0005s08000g [Populus trichocarpa]
 gb|EEE94100.1| hypothetical protein POPTR_0005s08000g [Populus trichocarpa]
Length=157

 Score =   115 bits (289),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 58/136 (43%), Positives = 82/136 (60%), Gaps = 0/136 (0%)
 Frame = +1

Query  868   GKPFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSI  1047
             G PF V+G+VY DTC CGFET  T Y+  + VR+ C +R    + YS   VT+S G Y I
Sbjct  22    GNPFHVRGRVYCDTCQCGFETKKTTYISGATVRIECKDRTDLQLRYSMEGVTDSTGAYKI  81

Query  1048  LVNGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQP  1227
              V GD+ D +C VVLV S           R+RA VIL+R+NG ++D+ +AN+LGF   + 
Sbjct  82    KVVGDQADRICHVVLVDSPLADCKTVHPVRNRAEVILTRSNGAISDLHYANSLGFVKDEA  141

Query  1228  LASCTQVVAQYHLNDD  1275
             L  C ++V +   +D+
Sbjct  142   LPGCAELVKKLLESDE  157



>ref|XP_006428158.1| hypothetical protein CICLE_v10027141mg, partial [Citrus clementina]
 gb|ESR41398.1| hypothetical protein CICLE_v10027141mg, partial [Citrus clementina]
Length=250

 Score =   118 bits (295),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 56/130 (43%), Positives = 85/130 (65%), Gaps = 0/130 (0%)
 Frame = +1

Query  868   GKPFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSI  1047
             G PF ++G+VY DTC CGFET+AT Y+  +HVR+ C +R++  + YS +  T+S G Y+I
Sbjct  22    GDPFHIRGRVYCDTCRCGFETSATTYIQGAHVRIECKDRNSLNLKYSIDGETDSTGTYNI  81

Query  1048  LVNGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQP  1227
              V+GD  D +C   L+ S        D GR  ++VIL+R+NG V+++ FAN LGF   +P
Sbjct  82    HVDGDHQDQICYSKLISSPLADCKTADPGRACSQVILTRSNGAVSNLHFANALGFLKARP  141

Query  1228  LASCTQVVAQ  1257
             LA C +++ +
Sbjct  142   LAFCPELLKK  151



>dbj|BAJ86956.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=169

 Score =   115 bits (289),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 57/133 (43%), Positives = 82/133 (62%), Gaps = 0/133 (0%)
 Frame = +1

Query  877   FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  1056
             F+V+G+V+ DTC  GFET A+ ++  + VR+ C +R T A T S    T+  G Y+I V+
Sbjct  35    FVVRGRVWCDTCRAGFETPASTFIAGAKVRVECKSRSTGAQTCSFEGHTDHTGTYNIPVD  94

Query  1057  GDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLAS  1236
              +   +LC+ VLV S D    K  +GR+RA V L+ NNG+ ++VR AN LGF    PLA+
Sbjct  95    DEHEHELCESVLVSSPDTACAKAVAGRERAPVFLNNNNGVASNVRLANALGFEKDTPLAA  154

Query  1237  CTQVVAQYHLNDD  1275
             C Q++  Y   DD
Sbjct  155   CAQILKMYEEVDD  167



>ref|XP_011653120.1| PREDICTED: major pollen allergen Lol p 11-like [Cucumis sativus]
 gb|KGN53218.1| hypothetical protein Csa_4G028420 [Cucumis sativus]
Length=163

 Score =   115 bits (288),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 57/128 (45%), Positives = 80/128 (63%), Gaps = 0/128 (0%)
 Frame = +1

Query  877   FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  1056
             F+V G VY DTC CGFET  +  +  + VRL C +R T  + ++  A+T+S+G+Y I V 
Sbjct  29    FVVNGCVYCDTCRCGFETNVSTPISGAKVRLECRDRATWVLKFTKEAITDSKGKYKINVY  88

Query  1057  GDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLAS  1236
              D  D+ C VVLV S      +PD GR+ A VIL+ NNGL +  R+AN +GF  ++PLA 
Sbjct  89    EDHKDESCKVVLVSSPHLGCNRPDVGRNSATVILTNNNGLTSIFRYANAMGFLIRRPLAF  148

Query  1237  CTQVVAQY  1260
             C  ++ QY
Sbjct  149   CPTILKQY  156



>ref|NP_001064462.2| Os10g0371000 [Oryza sativa Japonica Group]
 dbj|BAF26376.2| Os10g0371000, partial [Oryza sativa Japonica Group]
Length=196

 Score =   116 bits (291),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 58/133 (44%), Positives = 83/133 (62%), Gaps = 0/133 (0%)
 Frame = +1

Query  877   FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  1056
             F+V+G+V+ DTC  GFET A+ Y+  + V++ C ++ T A T S    T+  G Y+I VN
Sbjct  62    FVVRGRVWCDTCLAGFETPASTYIAGAKVKVECRSKSTGAKTCSFEGQTDHTGTYNIPVN  121

Query  1057  GDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLAS  1236
              +   +LC+ VLV S D   GK  +GR+RA V L+ NNG+ ++VR AN LGF    PLA+
Sbjct  122   DEHEHELCESVLVSSPDAKCGKIVAGRERAPVFLTNNNGVTSNVRLANALGFQKDAPLAA  181

Query  1237  CTQVVAQYHLNDD  1275
             C Q++  Y   DD
Sbjct  182   CAQILKMYEEVDD  194



>ref|XP_010521200.1| PREDICTED: major pollen allergen Lol p 11 [Tarenaya hassleriana]
Length=164

 Score =   115 bits (288),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 55/137 (40%), Positives = 85/137 (62%), Gaps = 1/137 (1%)
 Frame = +1

Query  868   GKPFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSI  1047
             G   +V+G+ Y D C  GFET+A+ ++P + V+L C +R T  V ++    T++ G Y  
Sbjct  27    GNTMVVEGRTYCDPCLAGFETSASYFIPGATVKLECKDRKTMKVMHTEETTTDNGGSYKF  86

Query  1048  LVNGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQP  1227
              V+ D  D +CDV LVKS D    +   GR+++RVIL+ NNG+ +  R+ANN+GF  + P
Sbjct  87    FVHEDHKDQMCDVKLVKSPDTNCPRISPGREQSRVILNHNNGIASQNRYANNMGFEKEAP  146

Query  1228  LASCTQVVAQYH-LNDD  1275
              A C +++ QY  LN+D
Sbjct  147   DAFCAELLKQYQDLNED  163



>ref|XP_003566418.1| PREDICTED: major pollen allergen Lol p 11-like [Brachypodium 
distachyon]
Length=169

 Score =   115 bits (288),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 57/137 (42%), Positives = 88/137 (64%), Gaps = 2/137 (1%)
 Frame = +1

Query  871   KP-FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSI  1047
             KP FLV G+VY DTC  GFET A+  +P + V++ C + +TN + + A A T++QG Y +
Sbjct  28    KPGFLVTGRVYCDTCRAGFETNASHSIPGAVVQMECRHFETNELHHKAEATTDAQGWYKM  87

Query  1048  LVNGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVND-VRFANNLGFTTKQ  1224
              V  D  +++C+V L++S +    + +  RDR RV L+RNNG+    VR+AN + F  K+
Sbjct  88    EVGEDHQEEICEVALLRSPEKDCAEIEKSRDRCRVPLTRNNGIKQSGVRYANPIAFFRKE  147

Query  1225  PLASCTQVVAQYHLNDD  1275
             PLA+C  V+ +Y L D+
Sbjct  148   PLANCGDVLRKYDLYDE  164



>ref|XP_007025385.1| Olee1-like protein [Theobroma cacao]
 gb|EOY28007.1| Olee1-like protein [Theobroma cacao]
Length=170

 Score =   115 bits (288),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 56/138 (41%), Positives = 82/138 (59%), Gaps = 3/138 (2%)
 Frame = +1

Query  877   FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  1056
             F V+GKVY D C   F T  +KY+  + VRL C +R+   +TYS +  T+  G Y I V 
Sbjct  32    FFVEGKVYCDNCRAQFVTKISKYMAGAQVRLECRDREGGDITYSVDGETDESGTYHIKVE  91

Query  1057  GDRGDDLCDVVLVKSSDPLSGKPDSG---RDRARVILSRNNGLVNDVRFANNLGFTTKQP  1227
             GD  +++C+V LV+SSDP   + D     R  AR+ L++ +G+ +D R AN LGF  K+P
Sbjct  92    GDHEEEICEVSLVQSSDPECSEIDKENFLRKSARISLTKYSGITSDSRLANPLGFMVKKP  151

Query  1228  LASCTQVVAQYHLNDDNF  1281
             L  CT+V+ +  +  D F
Sbjct  152   LPECTEVLRELGITADGF  169



>ref|XP_010527375.1| PREDICTED: major pollen allergen Lol p 11-like [Tarenaya hassleriana]
Length=165

 Score =   115 bits (287),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/134 (39%), Positives = 83/134 (62%), Gaps = 0/134 (0%)
 Frame = +1

Query  877   FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  1056
              +V+G+ Y D C  GFET+A+ ++P + V+L C +R T  V YS  A+T+  G Y   V+
Sbjct  31    MVVEGRTYCDPCRAGFETSASYFIPGATVKLECKDRKTMDVMYSDEAITDKDGCYKFFVH  90

Query  1057  GDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLAS  1236
              D  D++CDV LVKS D    +   GR++++VIL+  NG+ +  R+ANN+GF  ++P   
Sbjct  91    EDHKDEMCDVKLVKSPDTNCPRISPGREQSQVILNHFNGIASQTRYANNMGFEKEEPDVF  150

Query  1237  CTQVVAQYHLNDDN  1278
             C +++ QY   D+ 
Sbjct  151   CAELMKQYQELDEE  164



>gb|KJB29302.1| hypothetical protein B456_005G093100 [Gossypium raimondii]
Length=161

 Score =   114 bits (286),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 54/134 (40%), Positives = 81/134 (60%), Gaps = 0/134 (0%)
 Frame = +1

Query  877   FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  1056
              +V+G VY DTC  GFET  T+ L ++ VRLVC++R +  V +     T+  G+Y I V+
Sbjct  27    LVVEGYVYCDTCRAGFETPKTRSLADAMVRLVCSDRKSGQVVFKKEGYTDKTGKYQIRVS  86

Query  1057  GDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLAS  1236
              D  D +CD VLVKSS         GR+RARVIL+  NG+ +  R+AN +GF   +P A 
Sbjct  87    EDHLDQICDAVLVKSSQLGCATMSPGRERARVILTNFNGISSTTRYANAMGFMVDEPEAG  146

Query  1237  CTQVVAQYHLNDDN  1278
             C +++  Y  ++++
Sbjct  147   CAEMMKMYQEDEED  160



>gb|EMS52933.1| hypothetical protein TRIUR3_31283 [Triticum urartu]
Length=169

 Score =   115 bits (287),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 57/133 (43%), Positives = 81/133 (61%), Gaps = 0/133 (0%)
 Frame = +1

Query  877   FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  1056
             F+V+G+V+ DTC  GFET A+ ++  + VR+ C +R T A T S    T+  G Y+I V 
Sbjct  35    FVVRGRVWCDTCRAGFETPASTFIAGAKVRVECKSRSTGAQTCSFEGHTDHTGTYNIPVA  94

Query  1057  GDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLAS  1236
              +   +LC+ VLV S D    K  +GR+RA V L+ NNG+ ++VR AN LGF    PLA+
Sbjct  95    DEHEHELCESVLVSSPDTACAKAVAGRERAPVFLNNNNGVASNVRLANALGFEKDTPLAA  154

Query  1237  CTQVVAQYHLNDD  1275
             C Q++  Y   DD
Sbjct  155   CAQILKMYEEVDD  167



>ref|XP_010535648.1| PREDICTED: major pollen allergen Lol p 11-like [Tarenaya hassleriana]
Length=166

 Score =   114 bits (286),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 52/134 (39%), Positives = 83/134 (62%), Gaps = 0/134 (0%)
 Frame = +1

Query  877   FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  1056
              +V+G+ Y D C  GFET+A+ ++P + V+L C +R T  V Y+  A T++ G Y   V+
Sbjct  32    MVVEGRTYCDPCRAGFETSASYFIPGATVKLECKDRKTMEVMYTDEATTDNNGCYKFFVH  91

Query  1057  GDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLAS  1236
              D  D++CDV LVKS D    +   GR+++RVIL+  NG+ +  R+ANN+GF  ++P   
Sbjct  92    DDHKDEMCDVKLVKSPDTNCPRISPGREQSRVILNHYNGIASQTRYANNMGFEKEEPDVF  151

Query  1237  CTQVVAQYHLNDDN  1278
             C +++ QY   D+ 
Sbjct  152   CAELLKQYQEFDEE  165



>ref|XP_010942359.1| PREDICTED: major pollen allergen Lol p 11-like [Elaeis guineensis]
Length=174

 Score =   114 bits (286),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 57/136 (42%), Positives = 83/136 (61%), Gaps = 0/136 (0%)
 Frame = +1

Query  871   KPFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSIL  1050
             K F++ G+VY DTC  GFET  T  +P + VRL C    T+ +TY A A T   G Y ++
Sbjct  38    KDFVLTGRVYCDTCRAGFETDITSSMPGAKVRLECKRYGTDELTYEAEATTQLSGMYQMI  97

Query  1051  VNGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPL  1230
             V  D  +D C VVLVKSS     + + GRDR R+ L+++ GL+++ R AN LGF   +PL
Sbjct  98    VPDDHSNDQCSVVLVKSSFNKCTEIEPGRDRVRITLAQDGGLLSNSRQANALGFLIDEPL  157

Query  1231  ASCTQVVAQYHLNDDN  1278
              SC +++ +Y   +D+
Sbjct  158   PSCGKLLQKYGFANDD  173



>gb|ACQ44229.1| putative pollen Ole e 1 allergen and extensin family protein 
[Arabis alpina]
 gb|KFK25306.1| hypothetical protein AALP_AA8G095400 [Arabis alpina]
Length=164

 Score =   114 bits (285),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 61/136 (45%), Positives = 76/136 (56%), Gaps = 0/136 (0%)
 Frame = +1

Query  868   GKPFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSI  1047
             G PF ++G VY DTC  GFET ATKY+  + VR+VC +R T        AVT  +G Y +
Sbjct  25    GTPFHIEGTVYCDTCRFGFETIATKYIIGAKVRVVCKDRVTLKSEVVGQAVTGRRGRYRV  84

Query  1048  LVNGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQP  1227
              V GDR D  C   LVKSS P     D GR  A VIL+R+NG  +   FAN +GF   QP
Sbjct  85    AVTGDRQDQQCLAELVKSSMPDCHVADPGRSTATVILTRSNGAASTRHFANAMGFFRDQP  144

Query  1228  LASCTQVVAQYHLNDD  1275
             L  C  +  +Y  + D
Sbjct  145   LRGCAALRKRYLADGD  160



>ref|XP_008453801.1| PREDICTED: major pollen allergen Lol p 11-like [Cucumis melo]
Length=163

 Score =   114 bits (285),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 58/128 (45%), Positives = 79/128 (62%), Gaps = 0/128 (0%)
 Frame = +1

Query  877   FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  1056
             F+V G VY DTC CGFET  +  +  + VRL C +R T  + ++  A TNS+G+Y I V 
Sbjct  29    FVVNGCVYCDTCRCGFETNVSTPVSGAKVRLECRDRATWVLKFTKEATTNSKGKYKIDVY  88

Query  1057  GDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLAS  1236
              D  D+ C VVLV S      +PD GR+ A VIL+ NNGL +  R+AN +GF  ++PLA 
Sbjct  89    EDHKDESCKVVLVSSPHRGCDRPDIGRNSATVILTNNNGLTSISRYANAMGFLIRRPLAF  148

Query  1237  CTQVVAQY  1260
             C  ++ QY
Sbjct  149   CPTILKQY  156



>ref|XP_004971474.1| PREDICTED: pollen allergen Phl p 11-like [Setaria italica]
Length=168

 Score =   114 bits (285),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 56/136 (41%), Positives = 80/136 (59%), Gaps = 1/136 (1%)
 Frame = +1

Query  868   GKPFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSI  1047
             G  F+V G+VY D C  GFET  +K +P + V +VC     +  T  A A T+  G Y +
Sbjct  28    GGGFVVTGRVYCDPCRAGFETNVSKSVPGATVEVVCRQFGASKETLKAEATTDEYGWYKL  87

Query  1048  LVNGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVND-VRFANNLGFTTKQ  1224
              ++ D  D++C+ VL KSSDP   + +  RDRARV L+ NNG+    VR+AN + F  K 
Sbjct  88    EIDQDHQDEICEAVLAKSSDPACAEVEEFRDRARVPLTSNNGIKQQGVRYANPIAFFRKD  147

Query  1225  PLASCTQVVAQYHLND  1272
             PL  C Q++++Y L D
Sbjct  148   PLKECGQILSKYDLKD  163



>ref|NP_001237189.1| uncharacterized protein LOC100305566 precursor [Glycine max]
 gb|ACU13310.1| unknown [Glycine max]
Length=162

 Score =   114 bits (285),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 53/135 (39%), Positives = 79/135 (59%), Gaps = 0/135 (0%)
 Frame = +1

Query  874   PFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILV  1053
             PF VKG+VY   C  GFET+AT Y+  + + L C +R +N V Y+    T+S G Y++ V
Sbjct  27    PFCVKGRVYCGPCRAGFETSATTYIAGAEIMLQCKSRVSNEVVYTKKGYTDSTGAYTMCV  86

Query  1054  NGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  1233
             + D  D +C   LV S  P   +   GRD A VI +R NG+ +D RFAN +GF +++  +
Sbjct  87    DEDHADQICSAKLVSSPHPQCKEVTPGRDEAVVIPTRYNGIASDDRFANAMGFMSQEVAS  146

Query  1234  SCTQVVAQYHLNDDN  1278
              C +++ QY   D+ 
Sbjct  147   GCAEILRQYQEFDNE  161



>gb|KFK42186.1| hypothetical protein AALP_AA2G222600 [Arabis alpina]
Length=168

 Score =   114 bits (285),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 52/135 (39%), Positives = 84/135 (62%), Gaps = 1/135 (1%)
 Frame = +1

Query  877   FLVKGKVYLDTCNCGFETTATKY-LPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILV  1053
              +V+G+ Y +TC  GFET  + Y +  + V+LVC NR T    Y+A  V+  +G+Y  +V
Sbjct  33    LVVQGRTYCETCKFGFETPESSYFISGATVKLVCKNRKTMEKVYTAETVSGKEGKYQFVV  92

Query  1054  NGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  1233
             + D  D++CDV+LVKSSD    K   GR+ +RVIL+  NG+ + +R ANN+GF       
Sbjct  93    HEDHKDEMCDVMLVKSSDASCSKITEGREMSRVILNHYNGIASQIRHANNMGFEKDVSDV  152

Query  1234  SCTQVVAQYHLNDDN  1278
              C++++ +Y +++D 
Sbjct  153   FCSELIKKYQVDEDE  167



>ref|XP_008782123.1| PREDICTED: pollen-specific protein C13-like [Phoenix dactylifera]
Length=175

 Score =   114 bits (284),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 58/131 (44%), Positives = 81/131 (62%), Gaps = 4/131 (3%)
 Frame = +1

Query  877   FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  1056
             F+V+G+V+ DTC  GFET  T Y+  + VR+ C +R T A T S +  T+  G Y+ILV 
Sbjct  41    FVVQGRVFCDTCRAGFETPKTTYIAGAKVRVECRSRTTGAKTCSFDGTTDGSGAYNILVA  100

Query  1057  GDRGDDLCDVVLVKSSDPLSG--KPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPL  1230
              +   + C+ +LV  S P+ G  K   GR+RARV L+ NNG+ +  RFAN+LGF    PL
Sbjct  101   DEHEHETCEAMLV--SSPVKGCDKMLEGRERARVFLTHNNGIASSKRFANSLGFQKDIPL  158

Query  1231  ASCTQVVAQYH  1263
             A C Q++  YH
Sbjct  159   AGCAQLLEMYH  169



>ref|XP_009383585.1| PREDICTED: pollen-specific protein C13-like [Musa acuminata subsp. 
malaccensis]
Length=169

 Score =   114 bits (284),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 58/132 (44%), Positives = 84/132 (64%), Gaps = 1/132 (1%)
 Frame = +1

Query  871   KPFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSIL  1050
             + F+V+G+V+ DTC  GFET A+ Y+  + V + C +R T A T S +  T+  G Y+IL
Sbjct  34    RGFVVQGRVFCDTCRAGFETPASTYIRGAKVSVECRSRITGAKTCSFDGTTDHTGTYNIL  93

Query  1051  VNGDRGD-DLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQP  1227
             +  +  D ++C+ VLV S +        GR+RARV LSRNNG+ +D RFAN+LGFT   P
Sbjct  94    IADEHDDHEICESVLVSSPESGCKTVLRGRERARVFLSRNNGIASDTRFANSLGFTKDTP  153

Query  1228  LASCTQVVAQYH  1263
             L+ CTQ++  Y 
Sbjct  154   LSICTQLLKTYE  165



>ref|XP_008376286.1| PREDICTED: pollen-specific protein C13-like [Malus domestica]
 ref|XP_008343323.1| PREDICTED: pollen-specific protein C13-like [Malus domestica]
 ref|XP_008353938.1| PREDICTED: pollen-specific protein C13-like [Malus domestica]
 ref|XP_009369651.1| PREDICTED: pollen-specific protein C13-like [Pyrus x bretschneideri]
Length=159

 Score =   113 bits (283),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 56/133 (42%), Positives = 76/133 (57%), Gaps = 0/133 (0%)
 Frame = +1

Query  874   PFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILV  1053
             PF V+GKVY DTC  G+ET A  Y+  + VRL C ++ + A+ Y+    T+S G Y I V
Sbjct  26    PFTVEGKVYCDTCRAGYETKAITYIAGAKVRLECRDKSSMALVYTKEGTTDSAGCYKIPV  85

Query  1054  NGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  1233
               D  D  CD VLV S          GR+RARVIL+  NG+ +  RFAN +GF   + L+
Sbjct  86    AEDHLDQFCDAVLVSSPQKDCATVSPGRERARVILTGYNGIASYTRFANAMGFMRTEALS  145

Query  1234  SCTQVVAQYHLND  1272
              CTQ++ +    D
Sbjct  146   GCTQILKELQELD  158



>ref|XP_008378536.1| PREDICTED: protein DOWNSTREAM OF FLC-like [Malus domestica]
Length=218

 Score =   115 bits (287),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 57/134 (43%), Positives = 78/134 (58%), Gaps = 0/134 (0%)
 Frame = +1

Query  874   PFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILV  1053
             PF V+GKVY DTC  G+ET A  Y+  + VRL C ++ + A+ Y+    T+S G Y I V
Sbjct  85    PFTVEGKVYCDTCRAGYETKAITYIAGAKVRLECRDKTSMALLYTKEGTTDSAGCYKIPV  144

Query  1054  NGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  1233
               D  D  CD VLV S          GR+RARVIL+ NNG+ +  RFAN +GF   + L+
Sbjct  145   AEDHLDQFCDAVLVSSPQKDCATVSPGRERARVILTANNGIASYNRFANAMGFMRTEALS  204

Query  1234  SCTQVVAQYHLNDD  1275
              CTQ++ +    D+
Sbjct  205   GCTQILKELQELDE  218



>ref|XP_010942360.1| PREDICTED: pollen allergen Phl p 11-like [Elaeis guineensis]
Length=174

 Score =   113 bits (283),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 56/136 (41%), Positives = 84/136 (62%), Gaps = 0/136 (0%)
 Frame = +1

Query  871   KPFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSIL  1050
             K F ++G+VY DTC  GFET  T Y+P + VRL C    T+ +TY A A T+  G Y + 
Sbjct  38    KDFTLEGRVYCDTCRTGFETDLTTYMPGAKVRLECMRYGTDELTYKAEATTDFLGIYQMT  97

Query  1051  VNGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPL  1230
             V  D  +D C VVLVKSS     + + GRDR R+ L+++ GL++++R AN LG+   +PL
Sbjct  98    VPDDHSNDQCSVVLVKSSLDNCTEIEPGRDRVRITLAQDGGLLSNIRQANALGYLIDKPL  157

Query  1231  ASCTQVVAQYHLNDDN  1278
               C +++ +Y   +D+
Sbjct  158   LECGKLLQKYGFANDD  173



>ref|XP_006661725.1| PREDICTED: pollen-specific protein C13-like [Oryza brachyantha]
Length=175

 Score =   112 bits (280),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 57/134 (43%), Positives = 83/134 (62%), Gaps = 1/134 (1%)
 Frame = +1

Query  877   FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  1056
             F+V+G+V+ DTC  GFET A+ Y+  + V++ C ++ T A T S    T+  G Y+I V+
Sbjct  40    FVVRGRVWCDTCLAGFETPASTYIAGAKVKVECRSKSTGAKTCSFEGETDHTGTYNIAVD  99

Query  1057  GDRGDDLCDVVLVKSSDPLS-GKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  1233
              +   +LC+ VLV S D    GK  +GR+RA V L+ NNG+ ++VR AN LGF    PLA
Sbjct  100   DEHEHELCESVLVSSPDAARCGKAVAGRERAPVFLTNNNGVTSNVRLANALGFQKDAPLA  159

Query  1234  SCTQVVAQYHLNDD  1275
             +C Q++  Y   DD
Sbjct  160   ACAQIMKMYEEVDD  173



>ref|XP_006399503.1| hypothetical protein EUTSA_v10014875mg [Eutrema salsugineum]
 gb|ESQ40956.1| hypothetical protein EUTSA_v10014875mg [Eutrema salsugineum]
Length=164

 Score =   112 bits (279),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 65/141 (46%), Positives = 79/141 (56%), Gaps = 1/141 (1%)
 Frame = +1

Query  868   GKPFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSI  1047
             G PFLV+G+VY DTC  GFET ATKY+  + VR+VC +  T        AVT   G YSI
Sbjct  25    GTPFLVEGRVYCDTCRFGFETIATKYIIGATVRIVCKDGVTLKQEVVGEAVTGGLGTYSI  84

Query  1048  LVNGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQP  1227
              V GDR D  C   LVKSS       D GR  A VIL+R+NG  +   FAN +G+   QP
Sbjct  85    AVTGDRHDQQCQAELVKSSMHDCHVADPGRSTATVILTRSNGAASTRHFANAMGYLRDQP  144

Query  1228  LASCTQVVAQYHLNDDNF*AI  1290
             L  C  +   Y L+D +  AI
Sbjct  145   LPGCAALRKLY-LSDGDARAI  164



>ref|XP_009106450.1| PREDICTED: protein DOWNSTREAM OF FLC [Brassica rapa]
Length=165

 Score =   112 bits (279),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 53/136 (39%), Positives = 84/136 (62%), Gaps = 1/136 (1%)
 Frame = +1

Query  877   FLVKGKVYLDTCNCGFETTATKY-LPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILV  1053
              +V+G  Y DTC  GFET  + Y +P + V+LVC +R T    Y+  A +N  G+Y  +V
Sbjct  30    LVVQGITYCDTCKFGFETAESSYTVPGATVKLVCRDRKTMKELYTDVATSNRHGKYMFVV  89

Query  1054  NGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  1233
             + D  D++CDV+LVKSSD    K   GR+++RVIL+  NG+ + +R ANN+GF       
Sbjct  90    HEDHKDEMCDVMLVKSSDKGCSKISKGREQSRVILNHYNGIASQIRHANNMGFEKDVSDV  149

Query  1234  SCTQVVAQYHLNDDNF  1281
              C++++ +Y +++D  
Sbjct  150   FCSELIKKYQVDEDEI  165



>emb|CDX87484.1| BnaA07g33890D [Brassica napus]
Length=165

 Score =   112 bits (279),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 53/136 (39%), Positives = 84/136 (62%), Gaps = 1/136 (1%)
 Frame = +1

Query  877   FLVKGKVYLDTCNCGFETTATKY-LPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILV  1053
              +V+G  Y DTC  GFET  + Y +P + V+LVC +R T    Y+  A +N  G+Y  +V
Sbjct  30    LVVQGITYCDTCKFGFETAESSYTVPGATVKLVCRDRKTMKELYTDVATSNRHGKYMFVV  89

Query  1054  NGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  1233
             + D  D++CDV+LVKSSD    K   GR+++RVIL+  NG+ + +R ANN+GF       
Sbjct  90    HEDHKDEMCDVMLVKSSDKGCSKISKGREQSRVILNHYNGIASQIRHANNMGFEKDVSDV  149

Query  1234  SCTQVVAQYHLNDDNF  1281
              C++++ +Y +++D  
Sbjct  150   FCSELIKKYQVDEDEI  165



>ref|XP_003638771.1| Pollen allergen Phl p [Medicago truncatula]
 gb|ACJ86158.1| unknown [Medicago truncatula]
 gb|AFK43522.1| unknown [Medicago truncatula]
 gb|KEH34886.1| pollen Ole e I family allergen [Medicago truncatula]
Length=162

 Score =   111 bits (278),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 54/136 (40%), Positives = 86/136 (63%), Gaps = 1/136 (1%)
 Frame = +1

Query  874   PFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILV  1053
             PF +KG+V  D C  G+ET+A  ++  + V LVC  R TN V ++    T++ GEY+I V
Sbjct  27    PFCLKGRVVCDPCRAGYETSAITHIAGADVMLVCKQRITNEVVFTKPGKTDATGEYTIYV  86

Query  1054  NGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  1233
             + DR DD+CDV L+ S +    +   GRD+ARVIL+R NG+ ++ RFAN + +  ++  +
Sbjct  87    DQDRADDVCDVQLINSPERSCSEKAPGRDQARVILTRYNGISSNDRFANAMLYMAEEVAS  146

Query  1234  SCTQVVAQYH-LNDDN  1278
              C +V+ Q   L+++N
Sbjct  147   GCAEVLKQMQELDEEN  162



>ref|XP_010472003.1| PREDICTED: major pollen allergen Lol p 11-like [Camelina sativa]
Length=171

 Score =   112 bits (279),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 54/135 (40%), Positives = 84/135 (62%), Gaps = 1/135 (1%)
 Frame = +1

Query  877   FLVKGKVYLDTCNCGFETTATKY-LPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILV  1053
              +V+G+ Y DTC  GFET  + Y +P + V+LVC +R T    YS  AV++ +G Y  +V
Sbjct  30    MVVEGRTYCDTCKFGFETPESSYFIPGATVKLVCKHRQTMEEVYSDVAVSDKKGNYKFVV  89

Query  1054  NGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  1233
             + D  D++CDV+LVKSSD    K   GR+++RVIL+  +G+ + +R ANN+GF       
Sbjct  90    HDDHKDEMCDVMLVKSSDKSCAKISVGREQSRVILNHYSGIASQIRHANNMGFEKDVSDI  149

Query  1234  SCTQVVAQYHLNDDN  1278
              C+ +  +Y +N+D 
Sbjct  150   FCSALFQKYMVNEDE  164



>emb|CDX88408.1| BnaC06g38520D [Brassica napus]
Length=165

 Score =   111 bits (278),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 53/135 (39%), Positives = 84/135 (62%), Gaps = 1/135 (1%)
 Frame = +1

Query  877   FLVKGKVYLDTCNCGFETTATKY-LPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILV  1053
              +V+G  Y DTC  GFET  + Y +P + V+LVC +R T    Y+  A +N  G+Y  +V
Sbjct  30    LVVQGVTYCDTCKFGFETAESSYTVPGATVKLVCRDRKTMKELYTNVATSNRHGKYMFVV  89

Query  1054  NGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  1233
             + D  D++CDV+LVKSSD    K   GR+++RVIL+  NG+ + +R ANN+GF       
Sbjct  90    HEDHKDEMCDVMLVKSSDKGCSKISKGREQSRVILNHYNGIASQIRHANNMGFEKDVSDV  149

Query  1234  SCTQVVAQYHLNDDN  1278
              C++++ +Y +++D 
Sbjct  150   FCSELIKKYQVDEDE  164



>ref|XP_009409254.1| PREDICTED: major pollen allergen Lol p 11-like [Musa acuminata 
subsp. malaccensis]
Length=168

 Score =   111 bits (278),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 52/128 (41%), Positives = 79/128 (62%), Gaps = 0/128 (0%)
 Frame = +1

Query  877   FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  1056
             F+V+G+V+ DTC  GFET  + Y   + VR+ C ++ T A T +    T+  G Y+ILV 
Sbjct  36    FVVQGRVFCDTCRAGFETPVSTYTKGAKVRIECRSKATGAKTCNFEGTTDHTGTYNILVA  95

Query  1057  GDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLAS  1236
              +   ++C+ +LV S +     P  GR+RARV LS NNG+ +D R+AN+LGF T  PL+ 
Sbjct  96    DEHEHEICESMLVSSPESRCKTPLQGRERARVFLSHNNGIASDTRYANSLGFQTDTPLSV  155

Query  1237  CTQVVAQY  1260
             C +++  Y
Sbjct  156   CAELLKTY  163



>ref|XP_006601773.1| PREDICTED: uncharacterized protein LOC100527053 isoform X1 [Glycine 
max]
 gb|KHN31359.1| Pollen-specific protein C13 [Glycine soja]
Length=157

 Score =   111 bits (277),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 55/135 (41%), Positives = 82/135 (61%), Gaps = 2/135 (1%)
 Frame = +1

Query  877   FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  1056
             F VKG VY DTC  GFET AT Y+  + V + C  R T  V + +  VT+S G Y I V 
Sbjct  23    FHVKGSVYCDTCRAGFETNATFYIRGARVGIQCKERKTMKVAFYSEGVTDSTGTYHIEVE  82

Query  1057  GDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSR-NNGLVNDVRFANNLGFTTKQPLA  1233
              D  D++C+ +LVKS       PDSGRD++ ++L+   NG+VN + +AN +G+   +PL 
Sbjct  83    NDHRDNICECLLVKSPIKWCSTPDSGRDKSSIVLTHYQNGIVNHLHYANAMGYLRDEPLP  142

Query  1234  SCTQVVAQYHLNDDN  1278
              C +++ +Y+L D +
Sbjct  143   ECHKLL-KYYLADSD  156



>gb|KHG30321.1| Anther-specific LAT52 [Gossypium arboreum]
Length=161

 Score =   111 bits (277),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 52/134 (39%), Positives = 81/134 (60%), Gaps = 0/134 (0%)
 Frame = +1

Query  877   FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  1056
              +V+G VY DTC  GFET  T+ L ++ V+LVC++R T  V +     T+  G+Y I V+
Sbjct  27    LVVEGYVYCDTCRAGFETPKTRRLADAMVKLVCSDRKTGGVVFEKEGYTDKTGKYQIRVS  86

Query  1057  GDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLAS  1236
              D  D +CD VLVKS          GR+RARVIL+ +NG+ +  R+AN++GF   +  A 
Sbjct  87    EDHLDQICDAVLVKSPQLGCATMSPGRERARVILTNSNGISSTTRYANSMGFMVDKAEAG  146

Query  1237  CTQVVAQYHLNDDN  1278
             C +++  Y  ++++
Sbjct  147   CAEMMKMYREDEED  160



>ref|XP_010428908.1| PREDICTED: major pollen allergen Lol p 11-like [Camelina sativa]
Length=171

 Score =   111 bits (278),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 53/135 (39%), Positives = 85/135 (63%), Gaps = 1/135 (1%)
 Frame = +1

Query  877   FLVKGKVYLDTCNCGFETTATKY-LPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILV  1053
              +V+G+ Y DTC  GFET  + Y +P + V+LVC +R T    Y+  AV++ +G Y  +V
Sbjct  30    MVVEGRTYCDTCKFGFETPESSYFIPGATVKLVCKHRQTMEEVYTDVAVSDKKGNYKFVV  89

Query  1054  NGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  1233
             + D  D++CDV+LVKSSD   GK   GR+++RVIL+  +G+ + +R ANN+GF       
Sbjct  90    HDDHKDEMCDVLLVKSSDKSCGKISVGREKSRVILNHYSGIASQIRHANNMGFEKDVSDI  149

Query  1234  SCTQVVAQYHLNDDN  1278
              C+ +  +Y +++D 
Sbjct  150   FCSALFQKYMVDEDE  164



>ref|XP_010911793.1| PREDICTED: pollen-specific protein C13-like [Elaeis guineensis]
Length=175

 Score =   111 bits (277),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 57/131 (44%), Positives = 78/131 (60%), Gaps = 0/131 (0%)
 Frame = +1

Query  871   KPFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSIL  1050
             K F+V+G+V+ DTC  GFET  + Y+  + VRL C +R T A T S + VT+  G Y+IL
Sbjct  39    KGFVVQGRVFCDTCRAGFETPKSTYIAGAKVRLECRSRTTGAKTCSFDGVTDRSGTYNIL  98

Query  1051  VNGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPL  1230
             V  +   + C+ VLV S      K   GR+RARV L+ NNG+ +  RFAN+LGF     L
Sbjct  99    VADEHEHETCEAVLVSSPVKGCAKTLEGRERARVFLTNNNGIASTKRFANSLGFQRDIAL  158

Query  1231  ASCTQVVAQYH  1263
             A C Q++  Y 
Sbjct  159   AGCAQLLKMYQ  169



>gb|AAN76546.1|AF393475_1 LLP-B3 protein [Lilium longiflorum]
Length=160

 Score =   110 bits (276),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 54/132 (41%), Positives = 82/132 (62%), Gaps = 0/132 (0%)
 Frame = +1

Query  877   FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  1056
             F+V+G+VY D+C  GFET  T Y+  + V+L C + D +++ ++   VTNS G YSI + 
Sbjct  28    FIVEGRVYCDSCRAGFETNITTYIEGAKVKLECRHFDNDSIAHTVEGVTNSTGTYSIQLE  87

Query  1057  GDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLAS  1236
              D   ++C+VVLV S      + D  RDRARV L+ NNG+ + +R+AN+LGF  +QP   
Sbjct  88    NDHESEICEVVLVSSPIFDCNEIDYDRDRARVTLTNNNGIDSPIRYANSLGFLQEQPDII  147

Query  1237  CTQVVAQYHLND  1272
             C  ++  Y + D
Sbjct  148   CGDLLKAYGIAD  159



>ref|NP_001057857.1| Os06g0556600 [Oryza sativa Japonica Group]
 dbj|BAD53560.1| putative pollen allergen Phl p 11 [Oryza sativa Japonica Group]
 dbj|BAD54134.1| putative pollen allergen Phl p 11 [Oryza sativa Japonica Group]
 dbj|BAF19771.1| Os06g0556600 [Oryza sativa Japonica Group]
 gb|EAZ01328.1| hypothetical protein OsI_23359 [Oryza sativa Indica Group]
 gb|EAZ37341.1| hypothetical protein OsJ_21682 [Oryza sativa Japonica Group]
 dbj|BAG93005.1| unnamed protein product [Oryza sativa Japonica Group]
Length=175

 Score =   111 bits (277),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 53/133 (40%), Positives = 81/133 (61%), Gaps = 1/133 (1%)
 Frame = +1

Query  877   FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  1056
             F+V G+VY D C  GFET  +K +P + V + C +      +  A A T+ +G Y + ++
Sbjct  38    FVVTGRVYCDPCRAGFETNVSKSIPGATVSVECRHYGAGRESLKAEATTDEKGWYKVEID  97

Query  1057  GDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGL-VNDVRFANNLGFTTKQPLA  1233
              D  +++C+VVL KSSDP   + +  RDR+RV L+ NNGL  N +R+AN + F  K+PLA
Sbjct  98    QDHQEEICEVVLDKSSDPACSETEKTRDRSRVPLTSNNGLKQNGIRYANPIAFFRKEPLA  157

Query  1234  SCTQVVAQYHLND  1272
              C  ++ +Y L D
Sbjct  158   DCGSILQKYDLKD  170



>gb|EAY93952.1| hypothetical protein OsI_15725 [Oryza sativa Indica Group]
Length=165

 Score =   110 bits (274),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 53/135 (39%), Positives = 84/135 (62%), Gaps = 0/135 (0%)
 Frame = +1

Query  877   FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  1056
             ++V+G+VY DTC  GFET  T+Y+  + VRL C +  T+ V  + + VT+  G Y I + 
Sbjct  30    YVVQGRVYCDTCRAGFETNVTEYIKGAKVRLECKHFGTDKVERAIDGVTDETGTYKIELK  89

Query  1057  GDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLAS  1236
                 +D+C+VVLV S      + ++ RDRARV+L+RN G+ +++R AN LG+    PL  
Sbjct  90    DSHEEDICEVVLVHSPLANCSEIEAERDRARVLLTRNVGICDNLRLANPLGYLKDIPLPV  149

Query  1237  CTQVVAQYHLNDDNF  1281
             C  ++ Q+ L DD++
Sbjct  150   CGALLKQFDLADDDY  164



>ref|XP_009396935.1| PREDICTED: pollen-specific protein C13-like [Musa acuminata subsp. 
malaccensis]
Length=163

 Score =   110 bits (274),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 52/133 (39%), Positives = 82/133 (62%), Gaps = 0/133 (0%)
 Frame = +1

Query  877   FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  1056
              +V+G+VY DTC  GFETTAT+Y+  + V+L C N  T  + ++  A T++ G+Y I V 
Sbjct  30    IVVEGRVYCDTCRAGFETTATEYIAGAKVKLECKNYTTGEIIHTNQATTDATGKYQITVV  89

Query  1057  GDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLAS  1236
              D  ++ C V L+ S      +   GR+ A V+++ N G+ + VR+AN+LGF  ++PL +
Sbjct  90    DDHQEETCQVTLISSPRSDCSEISEGRNSALVVVTHNVGITSGVRYANSLGFLKEKPLET  149

Query  1237  CTQVVAQYHLNDD  1275
             C Q++ QY L  D
Sbjct  150   CGQLLLQYALGVD  162



>ref|XP_007048005.1| Pollen-specific protein C13, putative [Theobroma cacao]
 gb|EOX92162.1| Pollen-specific protein C13, putative [Theobroma cacao]
Length=157

 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 55/135 (41%), Positives = 82/135 (61%), Gaps = 1/135 (1%)
 Frame = +1

Query  871   KPFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSIL  1050
             +PF + GKVY D C  GFET+   Y+P + V + C +R T ++ +S  AVT+S G Y IL
Sbjct  23    EPFRIVGKVYCDGCRAGFETSKCSYIPGATVEVKCYDRTTLSLKFSVGAVTDSTGTYDIL  82

Query  1051  VNGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPL  1230
             V  D  D +C   LV S  P     D  R++A VIL+R+NG+++++ +AN +GF   +P 
Sbjct  83    VEDDHQDQICYASLVSSPIPSCRNADPRRNKATVILTRSNGVISNLHYANAMGFLQDEPE  142

Query  1231  ASCTQVVAQYHLNDD  1275
             A C +++ Q  L DD
Sbjct  143   AGCQELL-QKLLEDD  156



>ref|XP_007141147.1| hypothetical protein PHAVU_008G171500g [Phaseolus vulgaris]
 gb|ESW13141.1| hypothetical protein PHAVU_008G171500g [Phaseolus vulgaris]
Length=160

 Score =   108 bits (271),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 52/135 (39%), Positives = 80/135 (59%), Gaps = 0/135 (0%)
 Frame = +1

Query  874   PFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILV  1053
             PF VKG+VY D C  GFET  T Y+  + V + C +R    + YS    T+S G Y+I V
Sbjct  24    PFYVKGRVYCDPCRAGFETPLTTYIAGAEVTMECRDRMRGNIVYSKKVKTDSSGSYTIFV  83

Query  1054  NGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  1233
             + ++ +  CD  LV S      +P  GRD +RV+L+R NG+  + RF NNLGF  ++  +
Sbjct  84    DANQANQNCDASLVTSPLRDCREPTPGRDHSRVVLNRFNGIATNDRFVNNLGFMKQKVAS  143

Query  1234  SCTQVVAQYHLNDDN  1278
             +C +++ +Y  +DD+
Sbjct  144   ACAKILRRYREHDDD  158



>ref|XP_009125327.1| PREDICTED: protein DOWNSTREAM OF FLC-like [Brassica rapa]
Length=166

 Score =   108 bits (271),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 60/141 (43%), Positives = 78/141 (55%), Gaps = 1/141 (1%)
 Frame = +1

Query  868   GKPFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSI  1047
             G PF ++G VY DTC  GFET ATKY+  + VR++C +R T        AVT  +G Y +
Sbjct  27    GTPFHIEGSVYCDTCRFGFETVATKYITGARVRILCKDRVTLKQDVVGEAVTGHRGIYKV  86

Query  1048  LVNGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQP  1227
              V GDR D  C   LV S       PD GR  A VIL+R+NG  +   FAN +GF   +P
Sbjct  87    AVKGDRQDQQCFAELVHSPLRKCQVPDPGRSTATVILTRSNGAASTRHFANAMGFFRDEP  146

Query  1228  LASCTQVVAQYHLNDDNF*AI  1290
             L  C   + +Y+L D +  AI
Sbjct  147   LRGCA-ALRRYYLADGDSRAI  166



>emb|CDY40079.1| BnaC02g00510D [Brassica napus]
Length=164

 Score =   108 bits (271),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 60/141 (43%), Positives = 78/141 (55%), Gaps = 1/141 (1%)
 Frame = +1

Query  868   GKPFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSI  1047
             G PF ++G VY DTC  GFET ATKY+  + VR++C +R T        AVT  +G Y +
Sbjct  25    GTPFHIEGSVYCDTCRFGFETVATKYITGARVRIMCKDRVTLKQDVVGEAVTGHRGIYKV  84

Query  1048  LVNGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQP  1227
              V GDR D  C   LV S       PD GR  A VIL+R+NG  +   FAN +GF   +P
Sbjct  85    AVKGDRQDQQCFAKLVHSPLRKCQVPDPGRSTATVILTRSNGAASTRHFANAMGFFRDEP  144

Query  1228  LASCTQVVAQYHLNDDNF*AI  1290
             L  C   + +Y+L D +  AI
Sbjct  145   LRGCA-ALRRYYLADGDSRAI  164



>emb|CDX85777.1| BnaA02g00360D [Brassica napus]
Length=164

 Score =   108 bits (270),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 60/141 (43%), Positives = 78/141 (55%), Gaps = 1/141 (1%)
 Frame = +1

Query  868   GKPFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSI  1047
             G PF ++G VY DTC  GFET ATKY+  + VR++C +R T        AVT  +G Y +
Sbjct  25    GTPFHIEGSVYCDTCRFGFETVATKYITGARVRILCKDRVTLKQDVVGEAVTGHRGIYKV  84

Query  1048  LVNGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQP  1227
              V GDR D  C   LV S       PD GR  A VIL+R+NG  +   FAN +GF   +P
Sbjct  85    AVKGDRQDQQCFAELVHSPLRKCQVPDPGRSTATVILTRSNGAASTRHFANAMGFFRDEP  144

Query  1228  LASCTQVVAQYHLNDDNF*AI  1290
             L  C   + +Y+L D +  AI
Sbjct  145   LRGCA-ALRRYYLADGDSRAI  164



>emb|CAH66537.1| H0209H04.4 [Oryza sativa Indica Group]
 gb|AFI71825.1| pollen specific protein [Oryza sativa]
Length=165

 Score =   108 bits (270),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 53/134 (40%), Positives = 83/134 (62%), Gaps = 0/134 (0%)
 Frame = +1

Query  877   FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  1056
             ++V+G+VY DTC  GFET  T+Y+  + VRL C +  T+ V  + + VT+  G Y I + 
Sbjct  30    YVVQGRVYCDTCRAGFETNVTEYIKGAKVRLECKHFGTDKVERAIDGVTDETGTYKIELK  89

Query  1057  GDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLAS  1236
                 +D+C+VVLV S      + ++ RDRARV+L+RN G+ +++R AN LG+    PL  
Sbjct  90    DSHEEDICEVVLVHSPLANCSEIEAERDRARVLLTRNVGICDNLRLANPLGYLKDIPLPV  149

Query  1237  CTQVVAQYHLNDDN  1278
             C  ++ Q+ L DD+
Sbjct  150   CGALLKQFDLADDD  163



>ref|XP_010416770.1| PREDICTED: major pollen allergen Lol p 11-like [Camelina sativa]
Length=171

 Score =   108 bits (271),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 53/135 (39%), Positives = 83/135 (61%), Gaps = 1/135 (1%)
 Frame = +1

Query  877   FLVKGKVYLDTCNCGFETTATKY-LPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILV  1053
              +V+G+ Y DTC  GFET  + Y +P + V+LVC +R T    YS  AV++ +G Y  +V
Sbjct  30    MVVEGRTYCDTCKFGFETPESSYFIPGATVKLVCKHRQTMEEVYSDVAVSDKKGNYKFVV  89

Query  1054  NGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  1233
             + D  D++CDV+LVKSSD    K   GR+++RVIL+  +G+ + +R ANN+GF       
Sbjct  90    HDDHKDEMCDVMLVKSSDKSCAKISVGREQSRVILNHYSGIASQIRHANNMGFEKDVSDI  149

Query  1234  SCTQVVAQYHLNDDN  1278
              C+ +  +Y ++ D 
Sbjct  150   FCSALFQKYMVDADE  164



>ref|NP_001052674.1| Os04g0398700 [Oryza sativa Japonica Group]
 emb|CAE05158.2| OSJNBa0039C07.14 [Oryza sativa Japonica Group]
 dbj|BAF14588.1| Os04g0398700 [Oryza sativa Japonica Group]
 gb|EAZ30594.1| hypothetical protein OsJ_14643 [Oryza sativa Japonica Group]
Length=165

 Score =   108 bits (270),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 53/134 (40%), Positives = 83/134 (62%), Gaps = 0/134 (0%)
 Frame = +1

Query  877   FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  1056
             ++V+G+VY DTC  GFET  T+Y+  + VRL C +  T+ V  + + VT+  G Y I + 
Sbjct  30    YVVQGRVYCDTCRAGFETNVTEYIKGAKVRLECKHFGTDKVERAIDGVTDETGTYKIELK  89

Query  1057  GDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLAS  1236
                 +D+C+VVLV S      + ++ RDRARV+L+RN G+ +++R AN LG+    PL  
Sbjct  90    DSHEEDICEVVLVHSPLANCSEIEAERDRARVLLTRNVGICDNLRLANPLGYLKDIPLPI  149

Query  1237  CTQVVAQYHLNDDN  1278
             C  ++ Q+ L DD+
Sbjct  150   CGALLKQFDLADDD  163



>ref|XP_008803750.1| PREDICTED: pollen-specific protein C13 [Phoenix dactylifera]
Length=176

 Score =   108 bits (269),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 56/130 (43%), Positives = 80/130 (62%), Gaps = 4/130 (3%)
 Frame = +1

Query  877   FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  1056
             F+V+G+++ DTC  GFET  T Y+  + VR+ C +R T A T S + VT+  G Y+ILV 
Sbjct  42    FVVEGRIFCDTCQAGFETPKTTYIAGAKVRVECQSRTTGAKTCSFDGVTDRSGTYNILVA  101

Query  1057  GDRGDDLCDVVLVKSSDPLSG--KPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPL  1230
              +   + C+ VLV  S P+ G  K   GR+R+ V L+ NNG+ +D RFAN+LGF    PL
Sbjct  102   DEHEHETCESVLV--SSPVKGCDKILKGRERSPVFLTHNNGIASDKRFANSLGFQNDIPL  159

Query  1231  ASCTQVVAQY  1260
               C Q++  Y
Sbjct  160   EGCAQLMEMY  169



>gb|KCW69946.1| hypothetical protein EUGRSUZ_F03264 [Eucalyptus grandis]
Length=167

 Score =   107 bits (268),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 56/126 (44%), Positives = 76/126 (60%), Gaps = 1/126 (1%)
 Frame = +1

Query  883   VKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVNGD  1062
             V GKV+ DTC   FET  +  L +S VRL C NR + A+T SA AVT+  GEY + V GD
Sbjct  32    VVGKVFCDTCRVDFETKVSYGLADSKVRLECHNRTSGALTLSAEAVTDKTGEYRLEVEGD  91

Query  1063  RGDDLCDVVLVKSSDP-LSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLASC  1239
               +++C+V L++SS+P  S   +     ARV L+  NG+    RFAN L F  K+ LA C
Sbjct  92    HEEEICEVQLIESSEPECSSLLEGAVHNARVALTNKNGVAQPARFANALAFAKKETLADC  151

Query  1240  TQVVAQ  1257
              QV+ +
Sbjct  152   AQVLLE  157



>ref|XP_004143635.1| PREDICTED: olee1-like protein [Cucumis sativus]
 gb|KGN50408.1| hypothetical protein Csa_5G172880 [Cucumis sativus]
Length=166

 Score =   107 bits (266),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 56/135 (41%), Positives = 81/135 (60%), Gaps = 2/135 (1%)
 Frame = +1

Query  877   FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  1056
             FLV+GKVY D C   F T A+K+L  + V+LVC   +  +VT S  AVT+  G YSI  +
Sbjct  28    FLVEGKVYCDACRVQFFTKASKFLEGATVKLVCKEIEGGSVTLSKEAVTDKTGSYSIEAD  87

Query  1057  GDRGDDLCDVVLVKSSDPLSGKP--DSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPL  1230
             GD  +DLC+V LVKS+DP   +   +     ARV ++ N+G+ N VR AN L F  K+ L
Sbjct  88    GDHEEDLCEVTLVKSNDPDCSEISLEKYEHMARVSITNNSGITNPVRHANPLAFMKKEKL  147

Query  1231  ASCTQVVAQYHLNDD  1275
               C +V+ +   +++
Sbjct  148   PECKEVLRELGFDEE  162



>gb|AAM78186.1| putative SAH7 protein [Gossypium raimondii]
Length=119

 Score =   105 bits (262),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 52/118 (44%), Positives = 71/118 (60%), Gaps = 0/118 (0%)
 Frame = +1

Query  886   KGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVNGDR  1065
             +G VY DTC  GFET  T+ L ++ VRLVC++R +  V +     T+  G+Y I V+ D 
Sbjct  1     EGYVYCDTCRAGFETPKTRSLADAMVRLVCSDRKSGQVVFKKEGYTDKTGKYQIRVSEDH  60

Query  1066  GDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLASC  1239
              D +CD VLVKSS         GR+RARVIL+  NG+ +  R+AN +GF   +P A C
Sbjct  61    LDQICDAVLVKSSQLGCATMSPGRERARVILTNFNGISSTTRYANAMGFMVDEPEAGC  118



>ref|XP_009122085.1| PREDICTED: protein DOWNSTREAM OF FLC-like [Brassica rapa]
 ref|XP_009122087.1| PREDICTED: protein DOWNSTREAM OF FLC-like [Brassica rapa]
Length=168

 Score =   107 bits (266),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 57/136 (42%), Positives = 74/136 (54%), Gaps = 0/136 (0%)
 Frame = +1

Query  868   GKPFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSI  1047
             G PF ++G VY DTC  GFET ATKY+  + +++VC +  T        AVT  +G Y +
Sbjct  29    GTPFHIEGCVYCDTCRFGFETIATKYITGAKLKIVCKDSVTLKSEVVGEAVTGRRGRYRV  88

Query  1048  LVNGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQP  1227
              V GDR D  C  VLV S       PD GR+ A VIL+R+NG  +   FAN +GF   +P
Sbjct  89    SVKGDRQDQQCLAVLVNSPISNCQFPDPGRNTATVILTRSNGAASTRHFANAMGFFRDEP  148

Query  1228  LASCTQVVAQYHLNDD  1275
             L  C  +  QY    D
Sbjct  149   LRGCATLRKQYLAEGD  164



>gb|AAZ67595.1| 80A08_10 [Brassica rapa subsp. pekinensis]
 emb|CDX69860.1| BnaA10g22090D [Brassica napus]
Length=164

 Score =   107 bits (266),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 57/136 (42%), Positives = 74/136 (54%), Gaps = 0/136 (0%)
 Frame = +1

Query  868   GKPFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSI  1047
             G PF ++G VY DTC  GFET ATKY+  + +++VC +  T        AVT  +G Y +
Sbjct  25    GTPFHIEGCVYCDTCRFGFETIATKYITGAKLKIVCKDSVTLKSEVVGEAVTGRRGRYRV  84

Query  1048  LVNGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQP  1227
              V GDR D  C  VLV S       PD GR+ A VIL+R+NG  +   FAN +GF   +P
Sbjct  85    SVKGDRQDQQCLAVLVNSPISNCQFPDPGRNTATVILTRSNGAASTRHFANAMGFFRDEP  144

Query  1228  LASCTQVVAQYHLNDD  1275
             L  C  +  QY    D
Sbjct  145   LRGCATLRKQYLAEGD  160



>ref|XP_010062811.1| PREDICTED: olee1-like protein [Eucalyptus grandis]
Length=196

 Score =   107 bits (268),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 56/126 (44%), Positives = 76/126 (60%), Gaps = 1/126 (1%)
 Frame = +1

Query  883   VKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVNGD  1062
             V GKV+ DTC   FET  +  L +S VRL C NR + A+T SA AVT+  GEY + V GD
Sbjct  61    VVGKVFCDTCRVDFETKVSYGLADSKVRLECHNRTSGALTLSAEAVTDKTGEYRLEVEGD  120

Query  1063  RGDDLCDVVLVKSSDP-LSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLASC  1239
               +++C+V L++SS+P  S   +     ARV L+  NG+    RFAN L F  K+ LA C
Sbjct  121   HEEEICEVQLIESSEPECSSLLEGAVHNARVALTNKNGVAQPARFANALAFAKKETLADC  180

Query  1240  TQVVAQ  1257
              QV+ +
Sbjct  181   AQVLLE  186



>ref|XP_006645671.1| PREDICTED: pollen allergen Phl p 11-like, partial [Oryza brachyantha]
Length=152

 Score =   106 bits (265),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 53/133 (40%), Positives = 78/133 (59%), Gaps = 1/133 (1%)
 Frame = +1

Query  877   FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  1056
             F+V G+VY D C  GFET  +  +P S V + C +         A A T+ +G Y + ++
Sbjct  15    FVVTGRVYCDPCRAGFETNVSSSIPGSTVSVECRHFGGGPERLKAEATTDERGWYKVEID  74

Query  1057  GDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGL-VNDVRFANNLGFTTKQPLA  1233
              D  +++C+ VLVKS DP   + +  RDR+RV L+ NNGL  N VR+AN + F  K+PLA
Sbjct  75    QDHQEEICEAVLVKSGDPKCSETEQFRDRSRVPLTSNNGLKQNGVRYANPIAFFRKEPLA  134

Query  1234  SCTQVVAQYHLND  1272
              C  ++ +Y L D
Sbjct  135   DCGFILQKYDLKD  147



>ref|NP_177927.1| pollen Ole e 1 allergen and extensin family protein [Arabidopsis 
thaliana]
 ref|NP_001077838.1| pollen Ole e 1 allergen and extensin family protein [Arabidopsis 
thaliana]
 gb|AAM64292.1| allergen, putative [Arabidopsis thaliana]
 gb|AAO42838.1| At1g78040 [Arabidopsis thaliana]
 dbj|BAE99504.1| phosphoglycerate mutase 1 like protein [Arabidopsis thaliana]
 gb|AEE36060.1| pollen Ole e 1 allergen and extensin family protein [Arabidopsis 
thaliana]
 gb|AEE36061.1| pollen Ole e 1 allergen and extensin family protein [Arabidopsis 
thaliana]
Length=171

 Score =   107 bits (266),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 82/135 (61%), Gaps = 1/135 (1%)
 Frame = +1

Query  877   FLVKGKVYLDTCNCGFETTATKY-LPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILV  1053
              +V+G  Y D C  GFET  + Y +P + V+L C +R T    Y+  AV++ +G+Y  +V
Sbjct  30    MVVQGSTYCDICKFGFETPESSYFIPGATVKLSCKDRKTMEEVYTDKAVSDKEGKYKFIV  89

Query  1054  NGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  1233
             + D  D +CDV+LVKSSD    K   GR+++RVIL+  +G+ + +R ANN+GF  +    
Sbjct  90    HDDHRDQMCDVLLVKSSDKTCSKISVGREKSRVILNHYSGIASQIRHANNMGFEKEVSDV  149

Query  1234  SCTQVVAQYHLNDDN  1278
              C+ +  +Y +++D 
Sbjct  150   FCSALFQKYMVDEDE  164



>ref|NP_196575.1| pollen_Ole_e_I-domain containing protein [Arabidopsis thaliana]
 sp|Q9LX15.1|DFC_ARATH RecName: Full=Protein DOWNSTREAM OF FLC; Short=AtDFC; AltName: 
Full=Pollen allergen-like protein; Flags: Precursor [Arabidopsis 
thaliana]
 emb|CAB92054.1| pollen allergen-like protein [Arabidopsis thaliana]
 gb|AAR24213.1| At5g10130 [Arabidopsis thaliana]
 gb|AAT06432.1| At5g10130 [Arabidopsis thaliana]
 gb|AED91497.1| pollen_Ole_e_I-domain containing protein [Arabidopsis thaliana]
Length=164

 Score =   106 bits (265),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 56/137 (41%), Positives = 75/137 (55%), Gaps = 0/137 (0%)
 Frame = +1

Query  868   GKPFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSI  1047
             G PF ++G VY DTC  GFET AT+Y+  + VR+VC +R T        AVT   G+Y +
Sbjct  25    GTPFHIEGSVYCDTCRFGFETIATQYIRGARVRIVCKDRVTLKSELVGVAVTGPDGKYKV  84

Query  1048  LVNGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQP  1227
              V GDR D  C   LV S      + D GR  A VIL+R+NG  +   +AN +GF   +P
Sbjct  85    AVRGDRQDQQCLAELVHSPLSRCQEADPGRSTATVILTRSNGAASTRHYANAMGFFRDEP  144

Query  1228  LASCTQVVAQYHLNDDN  1278
             L  C  +  +Y  + DN
Sbjct  145   LRGCAALRKRYLADGDN  161



>ref|XP_004975466.1| PREDICTED: pollen-specific protein C13-like [Setaria italica]
Length=163

 Score =   106 bits (265),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 49/134 (37%), Positives = 83/134 (62%), Gaps = 0/134 (0%)
 Frame = +1

Query  877   FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  1056
             F+++G+VY DTC  GF+T  T+Y+  + VRL C +  T AV  + + VT+  G Y+I + 
Sbjct  29    FVIQGRVYCDTCRAGFQTNVTEYIKGAKVRLECKHFGTGAVERAIDGVTDESGFYTIKLK  88

Query  1057  GDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLAS  1236
             G   +D+C+V+L++S      +  +  DRA V+L+++ G+ +D+RF N LG+    PL  
Sbjct  89    GGHEEDICEVILIESPRKDCAEVPAHSDRASVLLAKDAGISDDMRFPNPLGYFKDVPLPV  148

Query  1237  CTQVVAQYHLNDDN  1278
             C  V+ +Y L+D +
Sbjct  149   CGAVLKEYLLDDQD  162



>ref|XP_002873440.1| pollen ole e 1 allergen and extensin family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH49699.1| pollen ole e 1 allergen and extensin family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=164

 Score =   106 bits (264),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 57/136 (42%), Positives = 74/136 (54%), Gaps = 0/136 (0%)
 Frame = +1

Query  868   GKPFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSI  1047
             G PF ++G VY DTC  GFET ATKY+  + VR+VC +R T        AVT   G+Y +
Sbjct  25    GTPFHIEGCVYCDTCRFGFETIATKYIHGARVRIVCKDRVTLKSELVGVAVTGPNGKYKV  84

Query  1048  LVNGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQP  1227
              V GDR D  C   LV S      + D GR  A VIL+R+NG  +   FAN +GF   +P
Sbjct  85    AVRGDRQDQQCLAELVHSPLSRCQEADPGRSTATVILTRSNGAASTRHFANAMGFFRDEP  144

Query  1228  LASCTQVVAQYHLNDD  1275
             L  C  +  +Y  + D
Sbjct  145   LRGCAALRKRYLADGD  160



>ref|XP_009402012.1| PREDICTED: pollen-specific protein C13-like [Musa acuminata subsp. 
malaccensis]
Length=160

 Score =   105 bits (263),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 51/134 (38%), Positives = 86/134 (64%), Gaps = 0/134 (0%)
 Frame = +1

Query  877   FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  1056
             F+++G+VY DTC  GF+T  ++Y+  + V+L C N +T+AV +   AVT+S G Y I V 
Sbjct  27    FVIEGRVYCDTCRAGFQTAVSQYIAGAKVKLQCRNYETDAVEHLVEAVTDSTGTYHIEVE  86

Query  1057  GDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLAS  1236
                 +++C+V L++S  P   +    R+RAR++++  +GL +D+R+AN+LGF   +PL  
Sbjct  87    DSHEEEICEVSLLQSPQPGCTEVAQSRNRARILVTGRSGLASDIRYANSLGFLKDEPLQQ  146

Query  1237  CTQVVAQYHLNDDN  1278
             C  ++ QY L  D+
Sbjct  147   CGLLLQQYALGVDD  160



>ref|XP_010277041.1| PREDICTED: anther-specific protein LAT52 [Nelumbo nucifera]
Length=165

 Score =   105 bits (263),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 52/130 (40%), Positives = 77/130 (59%), Gaps = 0/130 (0%)
 Frame = +1

Query  877   FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  1056
             F V+GKVY DTC   FET  ++ +  + VRL C +R+ + V YS    T++ G Y + V 
Sbjct  30    FFVQGKVYCDTCRTQFETKLSEPISGAKVRLECRSRENDDVAYSVEGETDTTGIYKLPVE  89

Query  1057  GDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLAS  1236
             G   +D+C+V L+ S      +P  G D ARV+LS NNG+ +  RFAN+LGF   +P+  
Sbjct  90    GSHEEDICEVKLLSSPRKDCSEPAPGLDHARVLLSSNNGISSASRFANSLGFMVLKPIEG  149

Query  1237  CTQVVAQYHL  1266
             C+ V+ +  L
Sbjct  150   CSDVLKELGL  159



>ref|XP_008467237.1| PREDICTED: olee1-like protein [Cucumis melo]
Length=166

 Score =   105 bits (263),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 54/135 (40%), Positives = 81/135 (60%), Gaps = 2/135 (1%)
 Frame = +1

Query  877   FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  1056
             FLV+GKVY D C   F T A+K+L  + V+LVC   +  +VT S  AVT+  G YSI  +
Sbjct  28    FLVEGKVYCDACRVQFFTKASKFLEGATVKLVCKEIEGGSVTLSKEAVTDKTGSYSIEAD  87

Query  1057  GDRGDDLCDVVLVKSSDPLSGKP--DSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPL  1230
             GD  ++LC+V LVKS+DP   +   +     ARV ++ N+G+ N VR AN L F  K+ L
Sbjct  88    GDHEEELCEVTLVKSNDPDCSEISLEKYEHMARVSITNNSGITNPVRHANPLAFMKKEKL  147

Query  1231  ASCTQVVAQYHLNDD  1275
               C +++ +   +++
Sbjct  148   PECKEILRELGFDEE  162



>ref|XP_010491667.1| PREDICTED: protein DOWNSTREAM OF FLC [Camelina sativa]
Length=166

 Score =   105 bits (262),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 55/137 (40%), Positives = 73/137 (53%), Gaps = 0/137 (0%)
 Frame = +1

Query  868   GKPFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSI  1047
             G PF ++G VY DTC  GFET ATKY+  + V++VC +R T        AVT   G+Y +
Sbjct  27    GTPFHIEGCVYCDTCRFGFETIATKYISGARVKIVCKDRVTLKSEVVGKAVTGPDGKYKV  86

Query  1048  LVNGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQP  1227
              + GDR D  C   LV S      + D GR  A VIL+R+NG  +   +AN +GF   QP
Sbjct  87    AIKGDRQDQQCLAELVHSPMSRCHEADPGRSTATVILTRSNGAASTRHYANAMGFFRDQP  146

Query  1228  LASCTQVVAQYHLNDDN  1278
             L  C  +   Y  + D 
Sbjct  147   LRGCASLRKLYLADGDE  163



>ref|XP_010547621.1| PREDICTED: protein DOWNSTREAM OF FLC [Tarenaya hassleriana]
Length=166

 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 60/140 (43%), Positives = 82/140 (59%), Gaps = 5/140 (4%)
 Frame = +1

Query  877   FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  1056
             F ++G VY DTC  GFET A++Y+P + V++ C +R T      A AVT+  G Y + V 
Sbjct  30    FQIEGCVYCDTCRFGFETDASEYIPGATVKIECKDRVTLRSEEVAKAVTDKGGRYRVTVK  89

Query  1057  GDRGDDLCDVVLVKSSDPLSG--KPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPL  1230
             GDR D  C   LV S  P+SG  + D GR  A VIL+R+NG  ++  FAN +GF   QPL
Sbjct  90    GDRQDQQCLAKLVDS--PMSGCQEQDPGRSSATVILTRSNGAASNRHFANAMGFLRSQPL  147

Query  1231  ASCTQVVAQYHLNDDNF*AI  1290
               C  +  +Y L D +F +I
Sbjct  148   PGCAALRKRY-LADGDFKSI  166



>ref|XP_010453035.1| PREDICTED: protein DOWNSTREAM OF FLC-like [Camelina sativa]
Length=166

 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 55/137 (40%), Positives = 72/137 (53%), Gaps = 0/137 (0%)
 Frame = +1

Query  868   GKPFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSI  1047
             G PF ++G VY DTC  GFET ATKY+  + V++VC +R T        AVT   G Y +
Sbjct  27    GTPFHIEGCVYCDTCRFGFETVATKYISGARVKIVCKDRVTLKSEVVGKAVTGPDGRYKV  86

Query  1048  LVNGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQP  1227
              + GDR D  C   LV S      + D GR  A VIL+R+NG  +   +AN +GF   QP
Sbjct  87    AIKGDRQDQQCLAELVHSPMSRCHEADPGRSTATVILTRSNGAASTRHYANAMGFFRDQP  146

Query  1228  LASCTQVVAQYHLNDDN  1278
             L  C  +   Y  + D 
Sbjct  147   LRGCASLRKLYLADGDE  163



>sp|O49813.1|OLEE1_BETPN RecName: Full=Olee1-like protein; Flags: Precursor [Betula pendula]
 emb|CAA74365.1| putative Ole e 1 protein [Betula pendula]
Length=166

 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 53/138 (38%), Positives = 81/138 (59%), Gaps = 5/138 (4%)
 Frame = +1

Query  877   FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  1056
             F V+GKVY D C   F T  + Y+  + V L C NR+   + YS+++ T+  G Y I V+
Sbjct  27    FFVEGKVYCDNCRTQFVTKLSTYMKGAKVSLECRNREGGTLIYSSDSETDKSGTYRIPVD  86

Query  1057  GDRGDDLCDVVLVKSSDP----LSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQ  1224
             GD  +++C++ L KSSDP    +S  P   +  AR+ L++NNG+   VR AN LGF  K+
Sbjct  87    GDHEEEICEIALKKSSDPDCSEVSKDP-FLKKSARISLTKNNGISTPVRLANPLGFMKKK  145

Query  1225  PLASCTQVVAQYHLNDDN  1278
             PL  C + + +  +N D+
Sbjct  146   PLPECAKALRELGMNPDD  163



>gb|ACK44512.1| AT5G10130-like protein [Arabidopsis arenosa]
Length=184

 Score =   105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 56/136 (41%), Positives = 74/136 (54%), Gaps = 0/136 (0%)
 Frame = +1

Query  868   GKPFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSI  1047
             G PF ++G VY DTC  GFET ATKY+  + VR+VC +R T        AVT   G+Y +
Sbjct  25    GTPFHIEGCVYCDTCRFGFETIATKYIHGARVRIVCKDRVTLKSELVGEAVTGPNGKYKV  84

Query  1048  LVNGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQP  1227
              V GDR D  C   LV S      + D GR  A VIL+R+NG  +   +AN +GF   +P
Sbjct  85    AVRGDRQDQQCLAELVHSPLSHCQEADPGRSTATVILTRSNGAASTRHYANAMGFFRDEP  144

Query  1228  LASCTQVVAQYHLNDD  1275
             L  C  +  +Y  + D
Sbjct  145   LRGCAALRKRYLADGD  160



>ref|XP_010422886.1| PREDICTED: protein DOWNSTREAM OF FLC [Camelina sativa]
Length=166

 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 55/137 (40%), Positives = 72/137 (53%), Gaps = 0/137 (0%)
 Frame = +1

Query  868   GKPFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSI  1047
             G PF ++G VY DTC  GFET ATKY+  + V++VC +R T        AVT   G Y +
Sbjct  27    GTPFHIEGCVYCDTCRFGFETVATKYISGARVKIVCKDRVTLKSEVVGKAVTGPDGRYKV  86

Query  1048  LVNGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQP  1227
              + GDR D  C   LV S      + D GR  A VIL+R+NG  +   +AN +GF   QP
Sbjct  87    AIKGDRQDQQCLAELVHSPMSRCHEADPGRSTATVILTRSNGAASTRHYANAMGFFRDQP  146

Query  1228  LASCTQVVAQYHLNDDN  1278
             L  C  +   Y  + D 
Sbjct  147   LRGCASLRKLYLADGDE  163



>ref|XP_009386950.1| PREDICTED: pollen-specific protein C13-like [Musa acuminata subsp. 
malaccensis]
Length=166

 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 54/136 (40%), Positives = 80/136 (59%), Gaps = 1/136 (1%)
 Frame = +1

Query  871   KPFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSIL  1050
             + F+V+G+V+ DTC  GFET  + Y+  + VR+ C +  T A T S    T+  G Y+IL
Sbjct  31    RGFVVQGRVFCDTCRAGFETPVSTYIQGATVRVECRSEFTGAKTCSFEGTTDHTGTYNIL  90

Query  1051  VNGDRGD-DLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQP  1227
             V G+  D ++C+ +LV S +        GR+RA V LS NNG+ +D RFAN+LGF     
Sbjct  91    VEGEHDDHEICESLLVSSPESGCKTALQGRERAPVFLSHNNGIASDTRFANSLGFLKDTS  150

Query  1228  LASCTQVVAQYHLNDD  1275
             L  CT+++  Y   +D
Sbjct  151   LPVCTELLKSYEQYED  166



>ref|XP_010025486.1| PREDICTED: protein DOWNSTREAM OF FLC [Eucalyptus grandis]
 gb|KCW62152.1| hypothetical protein EUGRSUZ_H04813 [Eucalyptus grandis]
Length=164

 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 51/135 (38%), Positives = 77/135 (57%), Gaps = 0/135 (0%)
 Frame = +1

Query  871   KPFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSIL  1050
             + F ++G VY DTC  GFET A+ ++  + VR+ C +     + YS + VT+S G++ + 
Sbjct  29    RSFYIQGSVYCDTCRFGFETPASTHIEGAAVRVECKDSTGTQLDYSIDTVTDSNGKWEVT  88

Query  1051  VNGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPL  1230
             V  D  D LC  VLV S        D GR +A +IL+R+NG ++   +AN++G  T QPL
Sbjct  89    VEDDHDDQLCSAVLVSSPKAGCQTVDPGRSKATLILTRSNGAISSRHYANSMGCLTDQPL  148

Query  1231  ASCTQVVAQYHLNDD  1275
             A C  +   Y L+ D
Sbjct  149   AECANLRTYYQLDSD  163



>ref|XP_006288804.1| hypothetical protein CARUB_v10002136mg [Capsella rubella]
 gb|EOA21702.1| hypothetical protein CARUB_v10002136mg [Capsella rubella]
Length=164

 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 55/137 (40%), Positives = 72/137 (53%), Gaps = 0/137 (0%)
 Frame = +1

Query  868   GKPFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSI  1047
             G PF ++G VY DTC  GFET ATKY+  + V++VC +R T        AVT   G Y +
Sbjct  25    GTPFHIEGCVYCDTCRFGFETIATKYISGARVKIVCKDRVTLKSEVVGKAVTGPDGRYKV  84

Query  1048  LVNGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQP  1227
              + GDR D  C   LV S      + D GR  A VIL+R+NG  +   +AN +GF   QP
Sbjct  85    AIKGDRQDQQCLAELVHSPMSRCHEADPGRSTATVILTRSNGAASTRHYANAMGFFRDQP  144

Query  1228  LASCTQVVAQYHLNDDN  1278
             L  C  +   Y  + D 
Sbjct  145   LRGCASLRKLYLADGDE  161



>ref|XP_011006522.1| PREDICTED: olee1-like protein [Populus euphratica]
Length=161

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 48/125 (38%), Positives = 75/125 (60%), Gaps = 0/125 (0%)
 Frame = +1

Query  883   VKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVNGD  1062
             V+GKVY D C   F+T  ++ +P + V+LVC NRD    TY+    T+S G Y + V GD
Sbjct  29    VEGKVYCDPCRVEFQTKISEGIPAAKVKLVCNNRDNGTETYTVEGATDSSGTYRLSVAGD  88

Query  1063  RGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLASCT  1242
               DD+C++ LV+SS P   +P    D A+++L++N G+V+  R+ N LG+  K+    C 
Sbjct  89    HEDDICEIRLVESSRPDCNEPFRSIDSAKILLTKNAGVVDKTRYPNALGYMKKEAQPECA  148

Query  1243  QVVAQ  1257
              V+ +
Sbjct  149   NVLKE  153



>dbj|BAK06698.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=167

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 49/134 (37%), Positives = 82/134 (61%), Gaps = 0/134 (0%)
 Frame = +1

Query  877   FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  1056
             ++V+G+VY DTC  GFET  T+Y+  + VRL C    T+ +  S + VT+  G Y I + 
Sbjct  32    YIVQGRVYCDTCRAGFETNVTEYIKGAKVRLECRRFGTDKLERSIDGVTDESGTYKIELK  91

Query  1057  GDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLAS  1236
                 +D+C++VLV+S  P   +  + R+RA ++LSRN G+ +++R AN LG+   +PL  
Sbjct  92    DSHPEDICEMVLVQSPLPNCNEIQALRNRAEIVLSRNVGISDNIRLANPLGYLKDKPLPV  151

Query  1237  CTQVVAQYHLNDDN  1278
             C  ++  ++L  D+
Sbjct  152   CPDLLKMFNLTTDD  165



>ref|XP_010057097.1| PREDICTED: olee1-like protein [Eucalyptus grandis]
 gb|KCW74109.1| hypothetical protein EUGRSUZ_E02748 [Eucalyptus grandis]
Length=168

 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/134 (40%), Positives = 82/134 (61%), Gaps = 5/134 (4%)
 Frame = +1

Query  877   FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  1056
             F V+GKVY DTC   F T  +K +P++ VRL C +R+  +VTYS   VT++ G Y + V+
Sbjct  30    FFVEGKVYCDTCRTQFITKVSKDMPDAKVRLECKDREGGSVTYSIEGVTDNTGMYRLPVD  89

Query  1057  GDRGDDLCDVVLVKSSDP----LSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQ  1224
             G+  +++C++VLVKSS P    +S  P   R  AR+ L++NNG+   VR AN LG+   +
Sbjct  90    GEHEEEICEIVLVKSSQPGCEEVSNDPFL-RKTARISLTKNNGMATPVRQANPLGYMKNE  148

Query  1225  PLASCTQVVAQYHL  1266
              L  C  V+ +  +
Sbjct  149   SLPECADVLRELGM  162



>ref|XP_006370166.1| pollen Ole e 1 allergen and extensin family protein [Populus 
trichocarpa]
 gb|ERP66735.1| pollen Ole e 1 allergen and extensin family protein [Populus 
trichocarpa]
Length=161

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 49/125 (39%), Positives = 75/125 (60%), Gaps = 0/125 (0%)
 Frame = +1

Query  883   VKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVNGD  1062
             V+GKVY D C   F+T  ++ +P + V+LVC NRD    TY+    T++ G Y + V GD
Sbjct  29    VEGKVYCDPCRVEFQTKISEGIPAAKVKLVCNNRDNGTETYTVEGATDNSGTYRLPVAGD  88

Query  1063  RGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLASCT  1242
               DD+C+V LV+SS P   +P    D AR++L++N G+V+  R+ N LG+  K+    C 
Sbjct  89    HEDDICEVRLVESSRPDCNEPFRSIDSARILLTKNVGVVDKTRYPNALGYMKKEAQPECA  148

Query  1243  QVVAQ  1257
              V+ +
Sbjct  149   DVLKE  153



>ref|XP_010478273.1| PREDICTED: pollen-specific protein-like At4g18596 [Camelina sativa]
Length=171

 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 56/137 (41%), Positives = 81/137 (59%), Gaps = 4/137 (3%)
 Frame = +1

Query  877   FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  1056
             F +KG VY DTC   F T  +K+L  + V+L C  R+   VT +  AVT+S G Y + V 
Sbjct  32    FHIKGSVYCDTCRVQFMTRLSKFLEGAKVKLECKGRENQTVTLTKEAVTDSAGNYEMEVM  91

Query  1057  GDRGDDLCDVVLVKSSDPLSGKPDSG---RDRARVILSRNNGLV-NDVRFANNLGFTTKQ  1224
             GD  ++LC++VLV+S DP  G+ ++    R+ AR+ L+ N+G+V N+ R  N LGF  K 
Sbjct  92    GDHEEELCEIVLVQSPDPECGEVNNQEFLRNAARISLTANDGIVSNETRTINPLGFMRKT  151

Query  1225  PLASCTQVVAQYHLNDD  1275
             PLA C Q   +  +  D
Sbjct  152   PLADCPQAFKELGIVPD  168



>ref|XP_010460686.1| PREDICTED: pollen-specific protein-like At4g18596 [Camelina sativa]
Length=171

 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 56/137 (41%), Positives = 81/137 (59%), Gaps = 4/137 (3%)
 Frame = +1

Query  877   FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  1056
             F +KG VY DTC   F T  +K+L  + V+L C  R+   VT +  AVT+S G Y + V 
Sbjct  32    FHIKGSVYCDTCRVQFMTRLSKFLEGAKVKLECKGRENQTVTLTKEAVTDSAGNYQMEVM  91

Query  1057  GDRGDDLCDVVLVKSSDPLSGKPDSG---RDRARVILSRNNGLV-NDVRFANNLGFTTKQ  1224
             GD  ++LC++VLV+S DP  G+ ++    R+ AR+ L+ N+G+V N+ R  N LGF  K 
Sbjct  92    GDHEEELCEIVLVQSPDPECGEVNNQEFLRNAARISLTANDGIVSNETRTINPLGFMRKT  151

Query  1225  PLASCTQVVAQYHLNDD  1275
             PLA C Q   +  +  D
Sbjct  152   PLADCPQAFKELGIVPD  168



>ref|XP_004983223.1| PREDICTED: pollen-specific protein C13-like [Setaria italica]
Length=170

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 52/135 (39%), Positives = 77/135 (57%), Gaps = 0/135 (0%)
 Frame = +1

Query  877   FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  1056
             F+V+G+V+ DTC  GFET  + Y+  + VR+ C ++ T   + +    T+  G Y+ILV 
Sbjct  36    FVVRGRVWCDTCRAGFETPVSTYIAGAKVRVECRSKTTGLKSCTYEGHTDRTGTYNILVT  95

Query  1057  GDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLAS  1236
              +  D+LC+ VL+ S D        GR+RA V L+ NNG+ ++VR AN LGF     L  
Sbjct  96    DEHEDELCESVLISSPDMRCATTVPGRERAPVFLTSNNGVASNVRMANALGFQKDVALPR  155

Query  1237  CTQVVAQYHLNDDNF  1281
             C QV+  Y   DD+ 
Sbjct  156   CAQVLKMYEDEDDHL  170



>ref|XP_010499433.1| PREDICTED: pollen-specific protein-like At4g18596 [Camelina sativa]
Length=171

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 56/137 (41%), Positives = 81/137 (59%), Gaps = 4/137 (3%)
 Frame = +1

Query  877   FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  1056
             F +KG VY DTC   F T  +K+L  + V+L C  R+   VT +  AVT+S G Y + V 
Sbjct  32    FHIKGSVYCDTCRVQFMTRLSKFLEGAKVKLECKGRENQTVTLTKEAVTDSAGNYQMEVM  91

Query  1057  GDRGDDLCDVVLVKSSDPLSGKPDSG---RDRARVILSRNNGLV-NDVRFANNLGFTTKQ  1224
             GD  ++LC++VLV+S DP  G+ ++    R+ AR+ L+ N+G+V N+ R  N LGF  K 
Sbjct  92    GDHEEELCEIVLVQSPDPECGEVNNQEFLRNAARISLTANDGIVSNETRTINPLGFMRKT  151

Query  1225  PLASCTQVVAQYHLNDD  1275
             PLA C Q   +  +  D
Sbjct  152   PLADCPQAFKELGIVPD  168



>gb|AAM78187.1| putative SAH7 protein [Gossypium barbadense]
Length=119

 Score =   102 bits (255),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 50/118 (42%), Positives = 71/118 (60%), Gaps = 0/118 (0%)
 Frame = +1

Query  886   KGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVNGDR  1065
             +G VY DTC  GFET  T+ L ++ V+LVC++R T  V +     T+  G+Y I V+ D 
Sbjct  1     EGYVYCDTCRAGFETPKTRRLADAMVKLVCSDRKTGGVVFEKEGYTDKTGKYQIRVSEDH  60

Query  1066  GDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLASC  1239
              D +CD VLVKS          GR+RARVIL+ +NG+ +  R+AN++GF   +   SC
Sbjct  61    LDQICDAVLVKSPQLGCATMSPGRERARVILTNSNGISSTTRYANSMGFMVDKAAVSC  118



>ref|XP_003581152.1| PREDICTED: pollen-specific protein C13-like [Brachypodium distachyon]
Length=171

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 51/129 (40%), Positives = 77/129 (60%), Gaps = 0/129 (0%)
 Frame = +1

Query  877   FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  1056
             ++V+G+VY DTC  GFET  T Y+  + VRL C    T  V  + + VT+  G Y I + 
Sbjct  31    YIVQGRVYCDTCRAGFETNVTTYIKGAKVRLECKRFGTEKVERALDGVTDETGTYKIELK  90

Query  1057  GDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLAS  1236
                 +D+C+VVL++S      K  + RDRARV L+RN G+ +++R AN+LG+    PL  
Sbjct  91    DSHPEDICEVVLIQSPLADCNKIQALRDRARVELTRNIGISDNLRLANSLGYLKDVPLPV  150

Query  1237  CTQVVAQYH  1263
             C Q++ Q+ 
Sbjct  151   CAQLLKQFK  159



>ref|XP_004502439.1| PREDICTED: pollen-specific protein C13-like [Cicer arietinum]
Length=160

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 52/135 (39%), Positives = 81/135 (60%), Gaps = 2/135 (1%)
 Frame = +1

Query  877   FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  1056
             F VKG VY DTC  GFET AT Y+  + V + C +R++  V +    VT+S G Y+I+V 
Sbjct  26    FHVKGSVYCDTCRAGFETNATFYIQGARVGVRCQDRNSMDVVFYTEGVTDSTGTYNIIVE  85

Query  1057  GDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSR-NNGLVNDVRFANNLGFTTKQPLA  1233
              D  D +C  +LV S       PD GRDR+ ++L+   NG+VN + +AN +G+   +P  
Sbjct  86    KDHHDHICRCLLVSSPIAWCKTPDPGRDRSSIVLTHYKNGVVNHLHYANAMGYLKDKPSP  145

Query  1234  SCTQVVAQYHLNDDN  1278
              C +++ +Y+L+D +
Sbjct  146   QCHKLL-KYYLSDSD  159



>ref|XP_002523378.1| Anther-specific protein LAT52 precursor, putative [Ricinus communis]
 gb|EEF38957.1| Anther-specific protein LAT52 precursor, putative [Ricinus communis]
Length=166

 Score =   103 bits (258),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 49/123 (40%), Positives = 74/123 (60%), Gaps = 0/123 (0%)
 Frame = +1

Query  883   VKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVNGD  1062
             V+GKVY DTC   FET  ++ +P + V+L C NR+ N +TY+   VT++ G Y + V G+
Sbjct  32    VEGKVYCDTCRVEFETKLSEVIPGTRVKLECKNRENNTLTYAVEGVTDASGIYRLPVEGE  91

Query  1063  RGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLASCT  1242
               +DLC+V L+KS  P   +     D ARV+L+ N G+V   R+ N LGF  ++    C 
Sbjct  92    HEEDLCEVKLIKSGKPDCAEAFKSVDHARVLLTHNVGVVQPTRYTNPLGFMKQKASPECG  151

Query  1243  QVV  1251
             +V+
Sbjct  152   KVL  154



>ref|XP_010916905.1| PREDICTED: pollen-specific protein C13-like [Elaeis guineensis]
Length=175

 Score =   103 bits (258),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 55/130 (42%), Positives = 80/130 (62%), Gaps = 4/130 (3%)
 Frame = +1

Query  877   FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  1056
             F+V+G+V+ DTC  GFET  T Y+  + VR+ C +R T A   S + +T+  G Y+ILV 
Sbjct  41    FVVEGRVFCDTCRAGFETPKTTYIAGAKVRVECRSRMTGAKICSFDGMTDHTGTYNILVA  100

Query  1057  GDRGDDLCDVVLVKSSDPLSG--KPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPL  1230
              +   + C+ VLV  S P+ G  +   GR+RA V L+ NNG+ +D RFAN+LGF    P+
Sbjct  101   DEHEHENCESVLV--SSPVKGCDRILEGRERASVSLTHNNGITSDKRFANSLGFQKNIPV  158

Query  1231  ASCTQVVAQY  1260
             A C Q++  Y
Sbjct  159   AGCAQLLEMY  168



>gb|ACG32277.1| pollen-specific protein C13 precursor [Zea mays]
Length=172

 Score =   103 bits (257),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 54/133 (41%), Positives = 77/133 (58%), Gaps = 0/133 (0%)
 Frame = +1

Query  877   FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  1056
             F+V+G+V+ D C  GFET A+ Y+  + VR+ C ++ T A T S    T+  G Y+ILV 
Sbjct  38    FVVRGRVWCDNCRAGFETPASTYIAGAKVRVDCKSKTTGANTCSFEGHTDRTGTYNILVI  97

Query  1057  GDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLAS  1236
              +   +LC+ VLV S D       +GR+RA V L+ NNG+ ++VR AN LGF     L  
Sbjct  98    DEHEHELCESVLVSSPDKGCANVVAGRERAPVFLASNNGVASNVRLANALGFQKDVALPR  157

Query  1237  CTQVVAQYHLNDD  1275
             C Q++  Y   DD
Sbjct  158   CAQILKMYQDEDD  170



>ref|XP_003573867.1| PREDICTED: pollen-specific protein C13 [Brachypodium distachyon]
Length=169

 Score =   103 bits (257),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 53/133 (40%), Positives = 78/133 (59%), Gaps = 0/133 (0%)
 Frame = +1

Query  877   FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  1056
             F+V+G V+ DTC  GFET A+ Y+  + VR+ C ++ T   T S    T+  G Y+I V+
Sbjct  35    FVVRGSVWCDTCRAGFETPASTYIAGAKVRVECKSKSTGVKTCSFEGHTDHTGTYNISVD  94

Query  1057  GDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLAS  1236
              +   +LC+ VLV S D    K  +GR+RA V L+  NG+ ++VR AN LGF     LA+
Sbjct  95    DEHEHELCESVLVSSPDRGCAKLVAGRERAPVFLNNKNGVASNVRLANALGFQKDVALAA  154

Query  1237  CTQVVAQYHLNDD  1275
             C Q++  Y   +D
Sbjct  155   CAQILKMYQEVED  167



>ref|NP_001146979.1| LOC100280588 precursor [Zea mays]
 gb|ACG24873.1| pollen-specific protein C13 precursor [Zea mays]
 gb|ACN27364.1| unknown [Zea mays]
 tpg|DAA46881.1| TPA: pollen-specific protein C13 [Zea mays]
Length=172

 Score =   103 bits (257),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 54/133 (41%), Positives = 77/133 (58%), Gaps = 0/133 (0%)
 Frame = +1

Query  877   FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  1056
             F+V+G+V+ D C  GFET A+ Y+  + VR+ C ++ T A T S    T+  G Y+ILV 
Sbjct  38    FVVRGRVWCDNCRAGFETPASTYIAGAKVRVDCKSKTTGANTCSFEGHTDRTGTYNILVI  97

Query  1057  GDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLAS  1236
              +   +LC+ VLV S D       +GR+RA V L+ NNG+ ++VR AN LGF     L  
Sbjct  98    DEHEHELCESVLVSSPDKGCANVVAGRERAPVFLTSNNGVASNVRLANALGFQKDVALPR  157

Query  1237  CTQVVAQYHLNDD  1275
             C Q++  Y   DD
Sbjct  158   CAQILKMYQDEDD  170



>ref|XP_011029563.1| PREDICTED: olee1-like protein [Populus euphratica]
Length=166

 Score =   102 bits (255),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 49/125 (39%), Positives = 76/125 (61%), Gaps = 0/125 (0%)
 Frame = +1

Query  883   VKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVNGD  1062
             V+GKVY DTC   F+T  +  LP + V+L C NR+   +TY+    T+S+G Y + V GD
Sbjct  32    VEGKVYCDTCRVEFQTKISDALPGAKVKLACNNRENGTLTYTVEGSTDSRGTYRLPVAGD  91

Query  1063  RGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLASCT  1242
               +D+C+V LV+S      +P    D AR++L++N G+VN +R+AN LG+  K     C 
Sbjct  92    HEEDICEVRLVESPRADCNEPFKSVDSARILLTKNVGVVNSLRYANALGYMKKVAQPECA  151

Query  1243  QVVAQ  1257
             +V+ +
Sbjct  152   KVLEE  156



>emb|CDY43319.1| BnaC03g58910D [Brassica napus]
Length=171

 Score =   102 bits (255),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 54/137 (39%), Positives = 83/137 (61%), Gaps = 4/137 (3%)
 Frame = +1

Query  877   FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  1056
             F +KG VY DTC   F T  +K L  + V+L C  R+   VT +  AVT+ +G+Y ++V 
Sbjct  32    FHIKGSVYCDTCRVQFMTRLSKVLEGAKVKLECKGRENQTVTLTKEAVTDKEGKYEMVVM  91

Query  1057  GDRGDDLCDVVLVKSSDPLSGKPDSG---RDRARVILSRNNGLV-NDVRFANNLGFTTKQ  1224
             GD  +++C+++LV+S D   G+ ++    R+ AR+ L+ N+G+V N+VR  N LGF  K 
Sbjct  92    GDHEEEVCEIILVESPDAECGEVNNQEFLRNAARISLTANDGIVSNEVRTINPLGFMRKT  151

Query  1225  PLASCTQVVAQYHLNDD  1275
             PLA C QV  +  +  D
Sbjct  152   PLADCPQVFKELGIVPD  168



>dbj|BAK07321.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=167

 Score =   102 bits (255),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 53/133 (40%), Positives = 72/133 (54%), Gaps = 1/133 (1%)
 Frame = +1

Query  877   FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  1056
             FLV G+VY D C  GFET  +K +  + V + C           A A T+ QG Y I ++
Sbjct  30    FLVTGRVYCDPCRAGFETNISKNVEGATVAMDCRPFGGGESKLKAEATTDKQGWYKIEID  89

Query  1057  GDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVND-VRFANNLGFTTKQPLA  1233
              D  D++C+VVL KS DP   + +  RDRARV L+ NNG+     R+AN + F  KQP  
Sbjct  90    QDHQDEICEVVLTKSPDPACAEIEEFRDRARVPLTSNNGMKQQGTRYANPIAFFPKQPRP  149

Query  1234  SCTQVVAQYHLND  1272
              C  ++  Y L D
Sbjct  150   ECGGILQAYDLKD  162



>gb|AFO38383.1| putative pollen-specific protein C13 [Glycine max]
Length=193

 Score =   103 bits (256),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 69/113 (61%), Gaps = 1/113 (1%)
 Frame = +1

Query  877   FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  1056
             F VKG VY DTC  GFET AT Y+  + V + C  R T  V Y    VT+S G Y I V 
Sbjct  78    FHVKGSVYCDTCRAGFETNATFYIQGAKVGIQCKERKTMKVVYYTEGVTDSTGTYHIEVE  137

Query  1057  GDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRN-NGLVNDVRFANNLGF  1212
              D  D++C+ VLVKS       PDSGRD++ ++L+ + NG+VN + +AN +G+
Sbjct  138   NDHRDNICECVLVKSPIKWCNTPDSGRDKSSIVLTHHQNGVVNHLHYANAMGY  190



>gb|AAM78188.1| putative SAH7 protein [Gossypium barbadense]
Length=119

 Score =   101 bits (251),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 50/116 (43%), Positives = 69/116 (59%), Gaps = 0/116 (0%)
 Frame = +1

Query  886   KGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVNGDR  1065
             +G VY DTC  GFET  T+ L ++ VRLVC++R +  V +     T+  G+Y I V+ D 
Sbjct  1     EGYVYCDTCRAGFETPKTRSLADAMVRLVCSDRKSGQVVFKKEGYTDKTGKYQIRVSEDH  60

Query  1066  GDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  1233
              D +CD VLVK S         GR+RARVIL+  NG+ +  R+AN +GF   +P A
Sbjct  61    LDQICDAVLVKGSQLGCATMSPGRERARVILTNFNGISSTTRYANAMGFMVDEPEA  116



>ref|XP_002889170.1| pollen ole e 1 allergen and extensin family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH65429.1| pollen ole e 1 allergen and extensin family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=170

 Score =   102 bits (254),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 48/135 (36%), Positives = 82/135 (61%), Gaps = 1/135 (1%)
 Frame = +1

Query  877   FLVKGKVYLDTCNCGFETTATKY-LPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILV  1053
              +V+G+ Y D C  GFET  + Y +P + V+L C +R T    Y+  AV++ QG Y  +V
Sbjct  29    MVVQGRTYCDLCKFGFETPESSYFIPGATVKLSCRDRKTMEEVYTDEAVSDKQGNYKFIV  88

Query  1054  NGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  1233
             + +  D++CDV+LVKS+     K   GR+++RVIL+  +G+ + +R ANN+GF  +    
Sbjct  89    HDEHKDEMCDVLLVKSAVKGCSKISVGREKSRVILNHYSGIASQIRHANNMGFEKEVSDV  148

Query  1234  SCTQVVAQYHLNDDN  1278
              C+ +  +Y +++D 
Sbjct  149   FCSALFHKYMVDEDE  163



>ref|XP_002887714.1| pollen ole e 1 allergen and extensin family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH63973.1| pollen ole e 1 allergen and extensin family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=151

 Score =   101 bits (252),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 48/135 (36%), Positives = 82/135 (61%), Gaps = 1/135 (1%)
 Frame = +1

Query  877   FLVKGKVYLDTCNCGFETTATKY-LPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILV  1053
              +V+G+ Y D C  GFET  + Y +P + V+L C +R T    Y+  AV++ QG Y  +V
Sbjct  10    MVVQGRTYCDLCKFGFETPESSYFIPGATVKLSCRDRKTMEEVYTDEAVSDKQGNYKFIV  69

Query  1054  NGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  1233
             + +  D++CDV+LVKS+     K   GR+++RVIL+  +G+ + +R ANN+GF  +    
Sbjct  70    HDEHKDEMCDVLLVKSAVKGCSKISVGREKSRVILNHYSGIASQIRHANNMGFEKEVSDV  129

Query  1234  SCTQVVAQYHLNDDN  1278
              C+ +  +Y +++D 
Sbjct  130   FCSALYHKYMVDEDE  144



>gb|AAM78185.1| putative SAH7 protein [Gossypium herbaceum]
Length=119

 Score =   100 bits (250),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 49/118 (42%), Positives = 70/118 (59%), Gaps = 0/118 (0%)
 Frame = +1

Query  886   KGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVNGDR  1065
             +G VY DTC  GFET  T+ L ++ V+LVC++R T  V +     T+  G+Y I V+ D 
Sbjct  1     EGYVYCDTCRAGFETPKTRRLADAMVKLVCSDRKTGGVVFEKEGYTDKTGKYQIRVSEDH  60

Query  1066  GDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLASC  1239
              D +CD VLVKS          GR+RARVIL+ +NG+ +  R+AN++GF   +    C
Sbjct  61    LDQICDAVLVKSPQLGCATMSPGRERARVILTNSNGISSTTRYANSMGFMVDKAEVGC  118



>ref|XP_011070069.1| PREDICTED: anther-specific protein LAT52-like [Sesamum indicum]
Length=161

 Score =   101 bits (252),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 51/126 (40%), Positives = 73/126 (58%), Gaps = 0/126 (0%)
 Frame = +1

Query  877   FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  1056
             F V+G VY D C   FET  +  L  + VRL C + +T  VTYS   VT S G YS+ V 
Sbjct  26    FHVEGDVYCDPCRVQFETELSYNLAGATVRLECRDIETKTVTYSMEGVTGSDGHYSLTVK  85

Query  1057  GDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLAS  1236
             GD   D+C+V+ VKS      +P    +RA++  + N+GL N +R+AN +GF T + L +
Sbjct  86    GDHEKDICEVIPVKSPKAECSEPMGDYERAKIECTENSGLHNPIRYANPIGFMTPEILPA  145

Query  1237  CTQVVA  1254
             C  ++A
Sbjct  146   CGPILA  151



>ref|XP_002316866.1| pollen Ole e 1 allergen and extensin family protein [Populus 
trichocarpa]
 gb|EEE97478.1| pollen Ole e 1 allergen and extensin family protein [Populus 
trichocarpa]
Length=164

 Score =   101 bits (252),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/125 (38%), Positives = 77/125 (62%), Gaps = 0/125 (0%)
 Frame = +1

Query  883   VKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVNGD  1062
             V+GKVY DTC   F+T  +  +P + V+LVC NR+   +TY+    T+S G Y + V GD
Sbjct  32    VEGKVYCDTCRVEFQTKISDAIPGAKVKLVCNNRENGTLTYTVEGTTDSSGTYRLPVVGD  91

Query  1063  RGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLASCT  1242
               +D+C+V LV+S      +P    D AR++L++N G+V+++R+AN LG+  K     C 
Sbjct  92    HEEDICEVRLVESPRADCNEPFKSVDSARILLTKNVGVVDNLRYANALGYMKKVAQPECA  151

Query  1243  QVVAQ  1257
             +V+ +
Sbjct  152   KVLEE  156



>gb|AAN60344.1| unknown [Arabidopsis thaliana]
Length=148

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/113 (42%), Positives = 72/113 (64%), Gaps = 1/113 (1%)
 Frame = +1

Query  877   FLVKGKVYLDTCNCGFETTATKY-LPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILV  1053
              +V+G  Y D C  GFET  + Y +P + V+L C +R T    Y+  AV++ +G+Y  +V
Sbjct  30    MVVQGSTYCDICKFGFETPESSYFIPGATVKLSCKDRKTMEEVYTDKAVSDKEGKYKFIV  89

Query  1054  NGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGF  1212
             + D  D +CDV+LVKSSD    K   GR+++RVIL+  +G+ + +R ANN+GF
Sbjct  90    HDDHRDQMCDVLLVKSSDKTCSKISVGREKSRVILNHYSGIASQIRHANNMGF  142



>gb|ADI55168.1| AS1 [Gossypium hirsutum]
Length=182

 Score =   102 bits (253),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 53/128 (41%), Positives = 75/128 (59%), Gaps = 1/128 (1%)
 Frame = +1

Query  877   FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVT-NSQGEYSILV  1053
             F V G VY DTC   FET+ ++ +P + VRL C NR    +TY +  +T   +G Y I V
Sbjct  40    FEVLGHVYCDTCRVEFETSISEPIPGATVRLECRNRTDEKITYQSPEITAGDKGNYKIQV  99

Query  1054  NGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  1233
              GD  +  CDV+LVKS       P     +ARV+L+  +G+  ++RFANNLGF  K+ L 
Sbjct  100   TGDYEESDCDVMLVKSPRADCNDPTEEWRKARVVLTTLDGVSGEIRFANNLGFKKKEALP  159

Query  1234  SCTQVVAQ  1257
              CT+V+ +
Sbjct  160   ECTKVLTE  167



>ref|XP_008439743.1| PREDICTED: olee1-like protein isoform X2 [Cucumis melo]
Length=168

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 56/136 (41%), Positives = 83/136 (61%), Gaps = 5/136 (4%)
 Frame = +1

Query  877   FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNA--VTYSANAVTNSQGEYSIL  1050
             F ++GKVY DTC   F T  +KYLP + V+LVC   + NA   T++  AVT+  G Y I 
Sbjct  29    FFIEGKVYCDTCRIQFFTRVSKYLPGAKVKLVC-REEANAGNETFTGEAVTDKNGVYKIE  87

Query  1051  VNGDRGDDLCDVVLVKSSDPLSGK-PDSGRDR-ARVILSRNNGLVNDVRFANNLGFTTKQ  1224
             V+GD  +++C+V L++S D   G+ P  G    ARV ++ NNG+++ VR AN LGF  K+
Sbjct  88    VDGDHEEEICEVSLLESGDKGCGEIPTDGYGHFARVSITGNNGIIDPVRQANPLGFKKKE  147

Query  1225  PLASCTQVVAQYHLND  1272
              L  C +V+ +   +D
Sbjct  148   ALPQCKEVLRELGFDD  163



>ref|XP_002454899.1| hypothetical protein SORBIDRAFT_03g001020 [Sorghum bicolor]
 gb|EES00019.1| hypothetical protein SORBIDRAFT_03g001020 [Sorghum bicolor]
Length=166

 Score =   101 bits (251),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 50/133 (38%), Positives = 76/133 (57%), Gaps = 1/133 (1%)
 Frame = +1

Query  877   FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  1056
             F+V G+VY D C  GFET  +K +  + V +VC + + +  T  A A T+  G Y + ++
Sbjct  29    FVVTGRVYCDPCRAGFETNVSKSVAGATVEVVCRHFEASKETLKAEATTDDFGWYKLEID  88

Query  1057  GDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVND-VRFANNLGFTTKQPLA  1233
              D  +++C+VVL KS DP   + +  R RARV L+ NNG+     R+AN + F  K PL 
Sbjct  89    QDHQEEICEVVLKKSPDPACAEIEEQRARARVPLTSNNGIKQKGTRYANPIAFFRKDPLK  148

Query  1234  SCTQVVAQYHLND  1272
              C  ++ +Y L D
Sbjct  149   ECGAILQKYDLKD  161



>gb|KFK44745.1| hypothetical protein AALP_AA1G297400 [Arabis alpina]
Length=171

 Score =   101 bits (251),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 54/137 (39%), Positives = 81/137 (59%), Gaps = 4/137 (3%)
 Frame = +1

Query  877   FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  1056
             F +KG VY DTC   F T  +K+L  + V+L C  R+   VT +  AVT++ G Y + V 
Sbjct  32    FHIKGSVYCDTCRVQFVTRVSKFLEGAKVKLECKGRENQTVTLTKEAVTDNAGNYQMEVM  91

Query  1057  GDRGDDLCDVVLVKSSDPLSGKPDSG---RDRARVILSRNNGLV-NDVRFANNLGFTTKQ  1224
             GD  +++C++VLV+S DP  G  ++    R+ AR+ L+ N+G+V N+ R  N LGF  K 
Sbjct  92    GDHEEEVCEIVLVQSPDPECGDINNQEFLRNAARISLTANDGIVSNETRTINPLGFMRKN  151

Query  1225  PLASCTQVVAQYHLNDD  1275
             PL  C+QV  +  +  D
Sbjct  152   PLEDCSQVFKELGIVPD  168



>ref|XP_008439742.1| PREDICTED: olee1-like protein isoform X1 [Cucumis melo]
 ref|XP_008439744.1| PREDICTED: olee1-like protein isoform X3 [Cucumis melo]
Length=168

 Score =   101 bits (251),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 57/137 (42%), Positives = 83/137 (61%), Gaps = 5/137 (4%)
 Frame = +1

Query  877   FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNA--VTYSANAVTNSQGEYSIL  1050
             F ++GKVY DTC   F T  +KYLP + V+LVC   + NA   T++  AVT+  G Y I 
Sbjct  29    FFIEGKVYCDTCRIQFFTRVSKYLPGAKVKLVC-REEANAGNETFTGEAVTDKNGVYKIE  87

Query  1051  VNGDRGDDLCDVVLVKSSD-PLSGKPDSGRDR-ARVILSRNNGLVNDVRFANNLGFTTKQ  1224
             V+GD  +++C+V L++S+D   SG P  G    ARV ++ NNG+ N VR AN LGF  K 
Sbjct  88    VDGDHEEEICEVSLLESADKECSGIPTDGYGHFARVSITGNNGITNPVRQANPLGFLRKD  147

Query  1225  PLASCTQVVAQYHLNDD  1275
              L  C +V+ +   +++
Sbjct  148   ALPQCKEVLRELGFDEE  164



>ref|XP_003543768.1| PREDICTED: protein DOWNSTREAM OF FLC-like [Glycine max]
 gb|KHN26075.1| Pollen-specific protein C13 [Glycine soja]
Length=162

 Score =   100 bits (250),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 52/130 (40%), Positives = 72/130 (55%), Gaps = 0/130 (0%)
 Frame = +1

Query  874   PFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILV  1053
             PF VKG+V+ D C  GFET  T Y+  + V L C +R TN   YS    T+S G ++I V
Sbjct  27    PFYVKGRVFCDPCRAGFETPLTTYIAGAEVTLQCKDRITNNNVYSKQVKTDSTGSFTIFV  86

Query  1054  NGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  1233
             + ++ +  CD  LV S      +P  GRD  RV L+R NG+  + RF NNLGF  +   +
Sbjct  87    DANQANQNCDASLVTSPLRDCKEPTPGRDHTRVNLNRFNGIATNDRFVNNLGFMKEIVAS  146

Query  1234  SCTQVVAQYH  1263
             SC ++   Y 
Sbjct  147   SCAKIFKSYQ  156



>ref|NP_001148443.1| pollen allergen Phl p 11 precursor [Zea mays]
 gb|ACG31481.1| pollen allergen Phl p 11 [Zea mays]
 gb|ACN35276.1| unknown [Zea mays]
 gb|AFW80473.1| pollen allergen Phl p 11 [Zea mays]
Length=178

 Score =   101 bits (252),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 50/133 (38%), Positives = 77/133 (58%), Gaps = 1/133 (1%)
 Frame = +1

Query  877   FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  1056
             F+V G+VY D C  GFET  ++ +  + V +VC +   +  T  A A T+  G Y + ++
Sbjct  41    FVVTGRVYCDPCRAGFETNVSRSVAGATVEVVCRHFGASKETLKAEATTDDSGWYKLEID  100

Query  1057  GDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVND-VRFANNLGFTTKQPLA  1233
              D  +++C+VVL +S DP   + +  RDRARV L+ NNG+    VR+AN + F  K PL 
Sbjct  101   QDHQEEICEVVLARSPDPGCAEIEEFRDRARVPLTSNNGIKQQGVRYANPIAFFRKDPLK  160

Query  1234  SCTQVVAQYHLND  1272
              C  ++ +Y L D
Sbjct  161   ECGALLEKYDLKD  173



>ref|XP_009109686.1| PREDICTED: pollen-specific protein-like At4g18596 [Brassica rapa]
 emb|CDX90169.1| BnaA08g18150D [Brassica napus]
Length=171

 Score =   101 bits (251),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 54/137 (39%), Positives = 82/137 (60%), Gaps = 4/137 (3%)
 Frame = +1

Query  877   FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  1056
             F +KG VY DTC   F T  +K L  + V+L C  R+   VT +  AVT+  G+Y ++V 
Sbjct  32    FHIKGSVYCDTCRVQFMTRLSKVLEGAKVKLECKARENQTVTLTKEAVTDKDGKYEMVVM  91

Query  1057  GDRGDDLCDVVLVKSSDPLSGKPDSG---RDRARVILSRNNGLV-NDVRFANNLGFTTKQ  1224
             GD  +++C+++LV+S D   G+ ++    R+ AR+ L+ N+G+V N+VR  N LGF  K 
Sbjct  92    GDHEEEVCEIILVESPDAECGEVNNQEFLRNAARISLTANDGIVSNEVRTINPLGFMRKT  151

Query  1225  PLASCTQVVAQYHLNDD  1275
             PLA C QV  +  +  D
Sbjct  152   PLADCPQVFKELGIVPD  168



>ref|NP_174209.1| pollen Ole e 1 allergen and extensin family protein [Arabidopsis 
thaliana]
 gb|AAF88123.1|AC021043_16 Similar to major allergen OLE5c [Arabidopsis thaliana]
 gb|AEE31049.1| pollen Ole e 1 allergen and extensin family protein [Arabidopsis 
thaliana]
Length=171

 Score =   100 bits (250),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 54/137 (39%), Positives = 81/137 (59%), Gaps = 4/137 (3%)
 Frame = +1

Query  877   FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  1056
             F +KG VY DTC   F T  +K+L  + V+L C  R+   VT +  AVT++ G Y + V 
Sbjct  32    FHIKGSVYCDTCRVQFITRISKFLEGAKVKLECKGRENQTVTLTKEAVTDNAGNYQMEVM  91

Query  1057  GDRGDDLCDVVLVKSSDPLSGKPDSG---RDRARVILSRNNGLV-NDVRFANNLGFTTKQ  1224
             GD  +++C++VL++S DP  G  ++    R+ AR+ L+ N+G+V N+ R  N LGF  K 
Sbjct  92    GDHEEEVCEIVLLQSPDPECGDVNNQEFLRNAARISLTANDGIVSNETRTINPLGFMRKT  151

Query  1225  PLASCTQVVAQYHLNDD  1275
             PLA C QV  +  +  D
Sbjct  152   PLAECPQVFKELGIVPD  168



>ref|XP_004960638.1| PREDICTED: pollen allergen Phl p 11-like [Setaria italica]
Length=172

 Score =   100 bits (250),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 50/136 (37%), Positives = 84/136 (62%), Gaps = 1/136 (1%)
 Frame = +1

Query  871   KPFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSIL  1050
             K  +V G+VY D C  GFETTA+  +  + V++ C + +T  +   A A T++ G Y + 
Sbjct  32    KGLVVTGRVYCDNCRAGFETTASHNIAGATVQMECRHFETMQLHDKAEATTDAGGWYRMD  91

Query  1051  VNGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGL-VNDVRFANNLGFTTKQP  1227
             +  D  +++C+VVL+KS +    + +  RDR+R+ L+RNNG+  N VR+AN + F  K+P
Sbjct  92    IGDDHQEEICEVVLLKSPEADCAEIEQFRDRSRIALTRNNGMEQNAVRYANPIAFFRKEP  151

Query  1228  LASCTQVVAQYHLNDD  1275
             L +C +++  Y L +D
Sbjct  152   LQNCGEILRAYALYND  167



>ref|XP_006664913.1| PREDICTED: pollen allergen Phl p 11-like [Oryza brachyantha]
Length=175

 Score =   100 bits (250),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 51/139 (37%), Positives = 78/139 (56%), Gaps = 2/139 (1%)
 Frame = +1

Query  868   GKP-FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYS  1044
             G P F V G+VY D C  GFET  +  +  + V++ C + +T  V + A A  N  G Y 
Sbjct  32    GPPGFTVTGRVYCDNCRAGFETNVSHSIKGATVQMECRHFETQEVKHRAEAAANEWGWYK  91

Query  1045  ILVNGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVND-VRFANNLGFTTK  1221
             + V G+   ++C+V LV+S +    + +  RDR+RV L+RNNG+  D  R+AN + F  K
Sbjct  92    MEVGGEHEAEICEVALVRSPEAECAEIERFRDRSRVPLTRNNGIKQDGFRYANPIAFFRK  151

Query  1222  QPLASCTQVVAQYHLNDDN  1278
              P  +C  ++  Y L DD+
Sbjct  152   DPPPACGDILRSYDLYDDD  170



>ref|XP_004134927.1| PREDICTED: olee1-like protein [Cucumis sativus]
 gb|KGN49302.1| hypothetical protein Csa_6G519550 [Cucumis sativus]
Length=168

 Score =   100 bits (249),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 56/136 (41%), Positives = 82/136 (60%), Gaps = 5/136 (4%)
 Frame = +1

Query  877   FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNA--VTYSANAVTNSQGEYSIL  1050
             F ++GKVY DTC   F T  +KYLP + V+LVC   + NA   T++   VT+  G Y I 
Sbjct  29    FFIEGKVYCDTCRIQFFTRVSKYLPGAKVKLVC-REEANAGNETFTGEGVTDKNGVYKIE  87

Query  1051  VNGDRGDDLCDVVLVKSSDPLSGK-PDSGRDR-ARVILSRNNGLVNDVRFANNLGFTTKQ  1224
             V+GD  +++C+V L++S+D   G+ P  G    ARV ++ NNG++N VR AN LGF  K 
Sbjct  88    VDGDHEEEICEVSLLESADTGCGEIPTDGYGHFARVSITGNNGIINPVRQANPLGFMKKD  147

Query  1225  PLASCTQVVAQYHLND  1272
              L  C +V+ +   +D
Sbjct  148   ALPQCKEVLRELGFDD  163



>gb|KJB61584.1| hypothetical protein B456_009G368100 [Gossypium raimondii]
Length=180

 Score =   100 bits (249),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 52/137 (38%), Positives = 81/137 (59%), Gaps = 4/137 (3%)
 Frame = +1

Query  877   FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTN-RDTNAVTYSANAVTNSQGEYSILV  1053
             F+V+G+VY DTC   FET  +K +  + V+L C N  +   V++S + VT+  G Y I V
Sbjct  32    FIVEGRVYCDTCRVEFETKISKPIKGASVKLECRNITNEKIVSHSQDVVTDEAGGYKIEV  91

Query  1054  NGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  1233
              GD  D++C+V LVKS      +P     +ARV+L++ +G+    RFANNLG+  K+ L 
Sbjct  92    KGDHEDEICEVSLVKSPRADCSEPTEVWRKARVVLTKADGVSGIYRFANNLGYMKKEALP  151

Query  1234  SCTQVVAQ---YHLNDD  1275
              C +V+ +   + L D+
Sbjct  152   ECKKVLTEMGYFELQDE  168



>gb|AEW90946.1| pollen-specific protein F8-4 [Secale cereale x Triticum turgidum 
subsp. durum]
 gb|AEW90947.1| pollen-specific protein F8-5 [Secale cereale x Triticum turgidum 
subsp. durum]
Length=165

 Score =   100 bits (248),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 49/134 (37%), Positives = 78/134 (58%), Gaps = 0/134 (0%)
 Frame = +1

Query  877   FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  1056
             ++V+G+VY DTC  GFET  T+Y+  + VRL C    T  V  S + VT+  G Y I + 
Sbjct  30    YIVQGRVYCDTCRAGFETNVTEYIKGAKVRLECKRFGTEKVERSIDGVTDETGTYKIELK  89

Query  1057  GDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLAS  1236
                 +D+C++VLV+S      +    RDRA ++LSRN G+ +++R AN LG+   +PL  
Sbjct  90    DSHPEDICEMVLVQSPLANCNEIQDLRDRAEIVLSRNVGISDNIRMANPLGYLKDKPLPV  149

Query  1237  CTQVVAQYHLNDDN  1278
             C  ++  ++   D+
Sbjct  150   CPDLLKTFNPTTDD  163



>gb|AAM78189.1| putative SAH7 protein [Gossypioides kirkii]
Length=119

 Score = 99.0 bits (245),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 50/118 (42%), Positives = 69/118 (58%), Gaps = 0/118 (0%)
 Frame = +1

Query  886   KGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVNGDR  1065
             +G VY D C  GFET  T+ L ++ V++VCT+R T  V +     T+  G+Y I V+ D 
Sbjct  1     EGHVYCDRCRAGFETPKTRSLADALVKVVCTDRKTGQVVFEKEGHTDKTGKYQIRVSEDH  60

Query  1066  GDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLASC  1239
              D +CD VLVKSS         GR+RARVIL+  NG+ +  R+AN +GF   +  A C
Sbjct  61    LDQVCDAVLVKSSQLDCATMTPGRERARVILTNLNGISSTTRYANAMGFMVDEAEAGC  118



>emb|CDY21637.1| BnaC09g46550D [Brassica napus]
Length=180

 Score =   100 bits (249),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 52/115 (45%), Positives = 67/115 (58%), Gaps = 0/115 (0%)
 Frame = +1

Query  868   GKPFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSI  1047
             G PF ++G VY DTC  GFET ATKY+  + V++VC +  T        AVT  +G Y +
Sbjct  63    GTPFHIEGCVYYDTCRFGFETIATKYITGAKVKIVCKDSVTLKSEVVGEAVTGRRGRYRV  122

Query  1048  LVNGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGF  1212
              V GDR D  C  VLV S       PD GR+ A VIL+R+NG+ +   FAN +GF
Sbjct  123   AVEGDRQDQQCLAVLVNSPISNCQFPDPGRNTATVILTRSNGIASTRHFANAMGF  177



>gb|EMT13715.1| Pollen allergen Phl p 11 [Aegilops tauschii]
Length=167

 Score = 99.8 bits (247),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 51/133 (38%), Positives = 73/133 (55%), Gaps = 1/133 (1%)
 Frame = +1

Query  877   FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  1056
             F+V G+VY D C  GFET  +K +  + V + C           A A T+++G Y I ++
Sbjct  30    FIVTGRVYCDPCRAGFETNVSKNVEGATVAMDCRPFGGGESKLKAEATTDNKGWYKIEID  89

Query  1057  GDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVND-VRFANNLGFTTKQPLA  1233
              D  D++C+VVL KS DP   + +  RDRARV L+ NNG+     RFAN + F  K+P  
Sbjct  90    QDHQDEICEVVLTKSPDPSCAEIEEFRDRARVPLTSNNGMKQQGTRFANPIAFFPKEPRK  149

Query  1234  SCTQVVAQYHLND  1272
              C  ++  Y L D
Sbjct  150   ECGGILQAYDLKD  162



>ref|XP_003601984.1| Pollen-specific protein C13 [Medicago truncatula]
 gb|AES72235.1| pollen Ole e I family allergen [Medicago truncatula]
Length=160

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 77/135 (57%), Gaps = 1/135 (1%)
 Frame = +1

Query  877   FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  1056
             F +KG VY DTC  GFET AT Y+  + V + C +R T    +    VT+S G Y+I+V 
Sbjct  25    FHIKGCVYCDTCRAGFETNATFYIQGAKVGIRCQDRKTMDEVFYTEGVTDSTGTYNIMVE  84

Query  1057  GDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSR-NNGLVNDVRFANNLGFTTKQPLA  1233
              D  D++C  VLV S       PD GR+R+ ++L+   NG++N + +AN +G+    PL 
Sbjct  85    NDHHDNICKTVLVSSPISSCNTPDPGRNRSSIVLTHYKNGVLNHLHYANAMGYFKDDPLP  144

Query  1234  SCTQVVAQYHLNDDN  1278
                  + +Y+L+D +
Sbjct  145   QYCHQLLKYYLSDSD  159



>ref|XP_002489221.1| hypothetical protein SORBIDRAFT_0012s014630 [Sorghum bicolor]
 gb|EES20226.1| hypothetical protein SORBIDRAFT_0012s014630 [Sorghum bicolor]
Length=171

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 51/133 (38%), Positives = 76/133 (57%), Gaps = 0/133 (0%)
 Frame = +1

Query  877   FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  1056
             F+V+G+V+ D C  GFET A+ Y+  + VR+ C ++ T A T S    T+  G Y+ILV 
Sbjct  37    FVVRGRVWCDNCRTGFETPASTYIAGAKVRVDCKSKTTGANTCSFEGHTDRTGTYNILVA  96

Query  1057  GDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLAS  1236
              +   +LC+ +LV S D        GR+RA V L+ NNG+ +++R AN LGF     L  
Sbjct  97    DEHEHELCESILVSSPDKGCSNVVVGRERAPVFLTSNNGVASNIRLANALGFEKDVALPR  156

Query  1237  CTQVVAQYHLNDD  1275
             C Q++  Y   +D
Sbjct  157   CAQILKMYQDEND  169



>ref|XP_011098227.1| PREDICTED: anther-specific protein LAT52-like [Sesamum indicum]
Length=163

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 47/126 (37%), Positives = 73/126 (58%), Gaps = 0/126 (0%)
 Frame = +1

Query  877   FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  1056
             F V+G VY D C   FET  + ++  + VR+ C + +T  +T+S   VT S G YSI+V 
Sbjct  28    FYVEGDVYCDPCRVQFETELSYHIAGAMVRVECRDIETKKITFSMEGVTGSDGHYSIMVT  87

Query  1057  GDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLAS  1236
             GD   D+C+V+  +S      +P    +RA+V  + N+GL N +R+AN +GF T + L  
Sbjct  88    GDHEKDICEVIPTRSPKNECSEPMGDYERAKVECTENSGLHNTIRYANPVGFMTPKVLPE  147

Query  1237  CTQVVA  1254
             C  ++A
Sbjct  148   CAPILA  153



>sp|Q8LGR0.1|CHE1_CHEAL RecName: Full=Pollen allergen Che a 1; AltName: Allergen=Che 
a 1; Flags: Precursor [Chenopodium album]
 gb|AAL07319.1| Che a 1 allergen precursor [Chenopodium album]
Length=168

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 54/135 (40%), Positives = 76/135 (56%), Gaps = 3/135 (2%)
 Frame = +1

Query  877   FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  1056
             F V+G VY DTC   F T  +  +  + V+L C N      T+ A AVT+  G+YSI VN
Sbjct  30    FKVQGMVYCDTCRIQFMTRISTIMEGATVKLECRNITAGTQTFKAEAVTDKVGQYSIPVN  89

Query  1057  GDRGDDLCDVVLVKSSDPLSGKPDS---GRDRARVILSRNNGLVNDVRFANNLGFTTKQP  1227
             GD  DD+C++ LVKS +    +       +  A+V L+ NNG  +D+R AN LGF  K+P
Sbjct  90    GDFEDDICEIELVKSPNSECSEVSHDVYAKQSAKVSLTSNNGEASDIRSANALGFMRKEP  149

Query  1228  LASCTQVVAQYHLND  1272
             L  C +V+ +  L D
Sbjct  150   LKECPEVLKELDLYD  164



>ref|XP_007021723.1| Pollen Ole e 1 allergen and extensin family protein, putative 
[Theobroma cacao]
 gb|EOY13248.1| Pollen Ole e 1 allergen and extensin family protein, putative 
[Theobroma cacao]
Length=162

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 49/128 (38%), Positives = 78/128 (61%), Gaps = 1/128 (1%)
 Frame = +1

Query  877   FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTN-AVTYSANAVTNSQGEYSILV  1053
             F V+GKVY DTC   FET  ++ +  + V L C +R    ++TYS  +VT+  G+Y I V
Sbjct  28    FFVEGKVYCDTCRVEFETRLSQPIKGATVILECRDRTVGGSITYSQESVTDESGKYRIPV  87

Query  1054  NGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  1233
              GD  +++C+V +VKS      +      RARV+L++ NG+ + +R+ANNLGF  K+ + 
Sbjct  88    QGDHEEEICEVRVVKSPREDCNEFMEAWQRARVLLTKKNGVSDPIRYANNLGFLKKEAVP  147

Query  1234  SCTQVVAQ  1257
              C +V+ +
Sbjct  148   GCAEVLEE  155



>gb|KHG10520.1| Olee1-like protein [Gossypium arboreum]
Length=180

 Score = 99.4 bits (246),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 81/137 (59%), Gaps = 4/137 (3%)
 Frame = +1

Query  877   FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTN-RDTNAVTYSANAVTNSQGEYSILV  1053
             F+V+G+VY DTC   FET  ++ +  + V+L C N  +   V++S + VT+  G Y I V
Sbjct  32    FIVEGRVYCDTCRVEFETKISQPIKGASVKLECRNITNEKIVSHSQDVVTDEAGGYKIEV  91

Query  1054  NGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  1233
              GD  D++C+V LVKS      +P     +ARV+L++ +G+    RFANNLG+  K+ L 
Sbjct  92    KGDHEDEICEVSLVKSPRADCNEPTEVWRKARVVLTKADGVSGTYRFANNLGYMKKEALP  151

Query  1234  SCTQVVAQ---YHLNDD  1275
              C +V+ +   + L D+
Sbjct  152   ECKKVLTEMGYFELQDE  168



>gb|AAF17689.1|AC009243_16 F28K19.26 [Arabidopsis thaliana]
Length=677

 Score =   104 bits (260),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 50/128 (39%), Positives = 79/128 (62%), Gaps = 1/128 (1%)
 Frame = +1

Query  877   FLVKGKVYLDTCNCGFETTATKY-LPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILV  1053
              +V+G  Y D C  GFET  + Y +P + V+L C +R T    Y+  AV++ +G+Y  +V
Sbjct  228   MVVQGSTYCDICKFGFETPESSYFIPGATVKLSCKDRKTMEEVYTDKAVSDKEGKYKFIV  287

Query  1054  NGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  1233
             + D  D +CDV+LVKSSD    K   GR+++RVIL+  +G+ + +R ANN+GF  +  +A
Sbjct  288   HDDHRDQMCDVLLVKSSDKTCSKISVGREKSRVILNHYSGIASQIRHANNMGFEKEVRMA  347

Query  1234  SCTQVVAQ  1257
             + T +  Q
Sbjct  348   TSTTMSHQ  355



>ref|NP_001131377.1| uncharacterized protein LOC100192702 precursor [Zea mays]
 gb|ACF79764.1| unknown [Zea mays]
 gb|AFW82076.1| hypothetical protein ZEAMMB73_949741 [Zea mays]
Length=164

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 49/137 (36%), Positives = 79/137 (58%), Gaps = 1/137 (1%)
 Frame = +1

Query  868   GKPFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSI  1047
             G  F+V G++Y D C  GFET  +  +  + V + C + ++  V   A A T   G Y +
Sbjct  23    GVGFVVTGRIYCDNCRAGFETNVSHAIQGATVEMECRHFESQQVHDKAEATTGPGGWYRM  82

Query  1048  LVNGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVND-VRFANNLGFTTKQ  1224
              ++GD  D++CDV L+KS +    + D  RDR RV L+RN+G+    VR+AN + F  K+
Sbjct  83    EISGDHQDEICDVRLLKSPEADCAEIDHSRDRCRVPLTRNDGIKQSGVRYANPIAFLRKE  142

Query  1225  PLASCTQVVAQYHLNDD  1275
             PL +C +++  Y L ++
Sbjct  143   PLPNCGELLRAYDLYNE  159



>gb|EYU45018.1| hypothetical protein MIMGU_mgv1a015317mg [Erythranthe guttata]
Length=161

 Score = 98.2 bits (243),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 50/132 (38%), Positives = 74/132 (56%), Gaps = 0/132 (0%)
 Frame = +1

Query  877   FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  1056
             F ++G VY D C   F T  +K +P + VRL C N +T AVTYS   +TN+ G YS+ V+
Sbjct  30    FNIEGDVYCDPCRVQFHTELSKRIPGATVRLECQNEETKAVTYSVEGLTNADGHYSLRVD  89

Query  1057  GDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLAS  1236
             GD   D+C V  +KS      +P +    +R++ + N G+ + VRFAN +GF TK     
Sbjct  90    GDHEKDVCVVKAIKSPIAECSEPMTDVRESRIVCTNNIGMHSAVRFANPIGFMTKVGSPQ  149

Query  1237  CTQVVAQYHLND  1272
             C  V+  +  +D
Sbjct  150   CIPVLQDFFADD  161



>gb|KHG12773.1| Olee1-like protein [Gossypium arboreum]
Length=187

 Score = 99.0 bits (245),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 55/137 (40%), Positives = 79/137 (58%), Gaps = 4/137 (3%)
 Frame = +1

Query  877   FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTY-SANAVTNSQGEYSILV  1053
             ++V G VY DTC   FET  ++ +  + V+L C NR  N +T+ S   VT+  G+Y I V
Sbjct  31    YIVVGHVYCDTCRVEFETKLSEPIGGAVVKLECRNRTDNQLTFQSQEIVTDEHGDYHIAV  90

Query  1054  NGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  1233
              GD  +  CDV LV+S +P    P      +RV+L+  +G+  ++RFANNLGF  K  L 
Sbjct  91    EGDYEESDCDVALVRSPNPDCNDPSEIWRISRVVLTTLDGVSGELRFANNLGFKKKVALP  150

Query  1234  SCTQVVAQ---YHLNDD  1275
              CTQV+ +   Y LN +
Sbjct  151   QCTQVLQEIGYYELNQE  167



>ref|XP_004251892.1| PREDICTED: anther-specific protein LAT52-like [Solanum lycopersicum]
Length=161

 Score = 97.8 bits (242),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 50/132 (38%), Positives = 77/132 (58%), Gaps = 0/132 (0%)
 Frame = +1

Query  871   KPFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSIL  1050
             + F V+G VY DTC   F+T  ++Y+  + V+L C + +T  VTY+A A+T+  G+Y+I 
Sbjct  25    EAFKVEGTVYCDTCRVQFQTRISEYIEGAKVKLTCRDMETEKVTYTAEALTDKNGKYTIE  84

Query  1051  VNGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPL  1230
              +GD   +LCDV +V+S       P  G + +RV+ S N G+ N  R+AN L F  K+ L
Sbjct  85    ASGDHEKELCDVGVVQSPREDCKDPAIGFENSRVVCSNNVGMHNPTRYANPLFFMKKETL  144

Query  1231  ASCTQVVAQYHL  1266
               C  V+ +  L
Sbjct  145   PDCKDVLDELGL  156



>emb|CDY21640.1| BnaC09g46520D [Brassica napus]
Length=142

 Score = 97.4 bits (241),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 51/115 (44%), Positives = 66/115 (57%), Gaps = 0/115 (0%)
 Frame = +1

Query  868   GKPFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSI  1047
             G PF ++G VY DTC  GFET  TKY+  + V++VC +  T        AVT  +G Y +
Sbjct  25    GTPFHIEGCVYCDTCRFGFETILTKYITGAKVKIVCKDSVTLKSEVVGEAVTGRRGRYRV  84

Query  1048  LVNGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGF  1212
              V GDR D  C  VLV S       PD GR+ A VIL+R+NG+ +   FAN +GF
Sbjct  85    AVEGDRQDQQCLAVLVNSPISNCQFPDPGRNTATVILTRSNGIASTRHFANAMGF  139



>gb|AEW90940.1| group 11 grass pollen allergen F7-1 [Secale cereale x Triticum 
turgidum subsp. durum]
Length=167

 Score = 98.2 bits (243),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 51/133 (38%), Positives = 71/133 (53%), Gaps = 1/133 (1%)
 Frame = +1

Query  877   FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  1056
             FLV G+VY D C  GFET  +K +  + V + C           A A T+ QG Y I ++
Sbjct  30    FLVTGRVYCDPCRAGFETNVSKNVEGATVAMDCRPFGGGESKLKAEATTDKQGWYKIEID  89

Query  1057  GDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVND-VRFANNLGFTTKQPLA  1233
              D  D++C+VVL KS DP   + +  RDRARV L+ NN +     R+AN + F  K+P  
Sbjct  90    QDHQDEICEVVLTKSPDPSCAEIEEFRDRARVPLTSNNDMKQQGTRYANPIAFFPKEPRK  149

Query  1234  SCTQVVAQYHLND  1272
              C  ++  Y L D
Sbjct  150   ECGGILQAYDLKD  162



>gb|AAX93750.1| pollen allergen Cro s 1 [Crocus sativus]
Length=168

 Score = 97.8 bits (242),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 53/135 (39%), Positives = 76/135 (56%), Gaps = 3/135 (2%)
 Frame = +1

Query  877   FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  1056
             F V+G VY DTC   F T  +  +  + V+L C N      T+ A AVT+  G+YSI V+
Sbjct  30    FKVQGMVYCDTCRIQFMTRVSTIMEGATVKLECRNITAGTQTFKAEAVTDKVGQYSIPVH  89

Query  1057  GDRGDDLCDVVLVKSSDPLSGKPDS---GRDRARVILSRNNGLVNDVRFANNLGFTTKQP  1227
             GD  DD+C++ LVKS +    +       +  A+V L+ NNG  +D+R AN LGF  K+P
Sbjct  90    GDFQDDICEIELVKSPNSECSEVSHDVYAKQSAKVSLTSNNGEASDIRSANALGFMRKEP  149

Query  1228  LASCTQVVAQYHLND  1272
             L  C +V+ +  L D
Sbjct  150   LKECPEVLKELDLYD  164



>gb|AFW77548.1| pollen allergen Phl p 11 [Zea mays]
Length=165

 Score = 97.8 bits (242),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 46/131 (35%), Positives = 80/131 (61%), Gaps = 1/131 (1%)
 Frame = +1

Query  877   FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  1056
             F+V G+VY D C  GFET  +  +  + V + C + ++  V   A A T++ G Y + ++
Sbjct  27    FVVTGRVYCDNCRAGFETNVSHAIEGATVEMECRHFESQEVHDKAEATTDAGGWYRMEIS  86

Query  1057  GDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVND-VRFANNLGFTTKQPLA  1233
             GD  D++C+V+L+KS +    + +  RDR RV L+RN+G+    +R+AN + F  K+PL+
Sbjct  87    GDHQDEICEVLLLKSPEADCAEIERTRDRCRVPLTRNDGIRQSGIRYANPIAFFRKEPLS  146

Query  1234  SCTQVVAQYHL  1266
             +C +++  Y L
Sbjct  147   NCGELLRAYDL  157



>ref|XP_004959259.1| PREDICTED: pollen-specific protein C13-like [Setaria italica]
Length=168

 Score = 97.8 bits (242),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 55/134 (41%), Positives = 77/134 (57%), Gaps = 3/134 (2%)
 Frame = +1

Query  877   FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTN--RDTNAVTYSANAVTNSQGEYSIL  1050
             F V+G VY DTC  GFET AT  +  + VRL C +    + AV  SA   T++ G Y + 
Sbjct  30    FFVEGSVYCDTCRAGFETNATTPIAGARVRLECRHYMSRSGAVERSAEGATDAAGRYRVE  89

Query  1051  VNGDRG-DDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQP  1227
             +  +RG +++C V LV S  P   + ++GRDRA V    ++GL   VR AN LGF   QP
Sbjct  90    LVDNRGAEEVCVVALVSSPLPGCAEKEAGRDRAPVEPLADDGLATTVRRANPLGFLKDQP  149

Query  1228  LASCTQVVAQYHLN  1269
             L +C Q+++ Y L 
Sbjct  150   LPNCGQILSSYALR  163



>emb|CDX99789.1| BnaC05g22110D [Brassica napus]
Length=171

 Score = 97.8 bits (242),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 53/137 (39%), Positives = 81/137 (59%), Gaps = 4/137 (3%)
 Frame = +1

Query  877   FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  1056
             F + G VY DTC   F T  +K+L  + V+L C +R    VT +  AVT+  G+Y + V 
Sbjct  32    FNITGSVYCDTCRVQFVTRLSKFLEGAKVKLECKSRVNQTVTLTKEAVTDKDGKYQMEVM  91

Query  1057  GDRGDDLCDVVLVKSSDPLSGKPDSG---RDRARVILSRNNGLV-NDVRFANNLGFTTKQ  1224
             GD  ++LC+++LV+S D   G+ ++    R+ AR+ L+ N+G+V N++R  N LGF  K 
Sbjct  92    GDHEEELCEIILVQSPDAECGEVNNEEFLRNAARISLTANDGIVSNEIRTINPLGFMRKT  151

Query  1225  PLASCTQVVAQYHLNDD  1275
             PLA C QV  +  +  D
Sbjct  152   PLADCPQVFKELGIVPD  168



>gb|KHG13789.1| Anther-specific LAT52 [Gossypium arboreum]
Length=188

 Score = 98.2 bits (243),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 52/138 (38%), Positives = 80/138 (58%), Gaps = 4/138 (3%)
 Frame = +1

Query  877   FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTY-SANAVTNSQGEYSILV  1053
             ++V G VY DTC   FET  ++ +  + V+L C NR   A+T+ S+  V +S G+Y I+V
Sbjct  33    YMVVGHVYCDTCRVEFETKLSEPISGAVVKLECRNRTNEAITFQSSEIVADSHGDYHIIV  92

Query  1054  NGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  1233
              GD  +  CDV LV+S       P     ++RV+L+  +GL N +RFANNLGF     L 
Sbjct  93    EGDYEESDCDVALVRSPRADCSDPTEAWRKSRVVLTTFDGLSNKLRFANNLGFKKDIALP  152

Query  1234  SCTQVVAQ---YHLNDDN  1278
              CT+++ +   Y L+ ++
Sbjct  153   QCTRILKEMGYYELSQED  170



>ref|XP_008450951.1| PREDICTED: olee1-like protein [Cucumis melo]
Length=165

 Score = 97.4 bits (241),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 52/138 (38%), Positives = 79/138 (57%), Gaps = 4/138 (3%)
 Frame = +1

Query  877   FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  1056
             F V+GKVY DTC   F T  +K+L  + V+L C   +  +VT +  AVT+  G+YSI  +
Sbjct  27    FFVEGKVYCDTCRVQFFTKVSKFLKGATVKLECKEIEGGSVTLNKEAVTDKSGKYSIEAD  86

Query  1057  GDRGDDLCDVVLVKSSDP---LSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQP  1227
             GD  +++C+V LVKS DP      K   G   +RV ++ N+G+ N VR AN L F  K+ 
Sbjct  87    GDHEEEVCEVSLVKSVDPDCDEISKEGYGH-TSRVTITNNSGITNPVRLANPLAFLKKEK  145

Query  1228  LASCTQVVAQYHLNDDNF  1281
             L  C +V+ +   +++  
Sbjct  146   LPECKEVLRELGFDEEGL  163



>ref|XP_004134662.2| PREDICTED: olee1-like protein [Cucumis sativus]
 gb|KGN49303.1| hypothetical protein Csa_6G519560 [Cucumis sativus]
Length=168

 Score = 97.4 bits (241),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 55/136 (40%), Positives = 81/136 (60%), Gaps = 5/136 (4%)
 Frame = +1

Query  877   FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNA--VTYSANAVTNSQGEYSIL  1050
             F ++GKVY DTC   F T  +KYLP + V+LVC   + NA   T++   VT+  G Y I 
Sbjct  29    FFIEGKVYCDTCRIQFFTRVSKYLPGAKVKLVC-REEANAGNETFTGEGVTDKNGVYKIE  87

Query  1051  VNGDRGDDLCDVVLVKSSD-PLSGKPDSGRDR-ARVILSRNNGLVNDVRFANNLGFTTKQ  1224
             V+GD  +++C+V +++S+D   S  P  G    ARV ++ NNG++N VR AN LGF  K 
Sbjct  88    VDGDHEEEICEVSVLESADEECSDIPTDGYGHFARVSITGNNGIINPVRQANPLGFLKKD  147

Query  1225  PLASCTQVVAQYHLND  1272
              L  C +V+ +   +D
Sbjct  148   ALPQCKEVLRELGFDD  163



>gb|AFK46977.1| unknown [Lotus japonicus]
Length=168

 Score = 97.4 bits (241),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 52/137 (38%), Positives = 82/137 (60%), Gaps = 4/137 (3%)
 Frame = +1

Query  877   FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNA-VTYSANAVTNSQGEYSILV  1053
             F ++G VY DTC   F T  ++++  + V +VC  RD  A VT+S  AVT++ G YS+ V
Sbjct  27    FFIEGTVYCDTCRTQFLTRVSEFMSGATVGVVCRERDAGAKVTFSKEAVTDANGMYSVAV  86

Query  1054  NGDRGDDLCDVVLVKSSDPLSGKPDSG---RDRARVILSRNNGLVNDVRFANNLGFTTKQ  1224
             +GD  D++C+V L+KSS     + D+       +R+ ++ NNG+V+ VR AN LGF   +
Sbjct  87    DGDHEDEVCEVKLLKSSRADCSEVDTESHLEQASRISITNNNGIVSPVRTANPLGFLKTE  146

Query  1225  PLASCTQVVAQYHLNDD  1275
              L  C  ++ Q  L++D
Sbjct  147   RLPECGHILLQLGLHED  163



>gb|AEW90948.1| pollen-specific protein F8-6 [Secale cereale x Triticum turgidum 
subsp. durum]
Length=165

 Score = 97.1 bits (240),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 48/134 (36%), Positives = 77/134 (57%), Gaps = 0/134 (0%)
 Frame = +1

Query  877   FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  1056
             ++V+G+VY DTC  GFET  T+Y+  + VRL C    T  V  S + VT+  G Y I + 
Sbjct  30    YIVQGRVYCDTCRAGFETNVTEYIKGAKVRLECKRFGTEKVECSIDGVTDETGTYKIELK  89

Query  1057  GDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLAS  1236
                 +D+C++VLV+S      +    RDRA ++LSR  G+ +++R AN LG+   +PL  
Sbjct  90    DSHPEDICEMVLVQSPLANCNEIQDLRDRAEIVLSRYVGISDNIRMANPLGYLKDKPLPV  149

Query  1237  CTQVVAQYHLNDDN  1278
             C  ++  ++   D+
Sbjct  150   CPDLLKTFNPTTDD  163



>ref|XP_012078584.1| PREDICTED: olee1-like protein [Jatropha curcas]
 gb|KDP32532.1| hypothetical protein JCGZ_14735 [Jatropha curcas]
Length=165

 Score = 97.1 bits (240),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 50/128 (39%), Positives = 75/128 (59%), Gaps = 0/128 (0%)
 Frame = +1

Query  868   GKPFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSI  1047
             G    V+GKVY D C   FET  ++ +  + V+L C  R+ N +TY+    T+ QG Y +
Sbjct  27    GANMFVEGKVYCDVCRVEFETKLSEPIKGAVVKLECKIRENNTLTYAVEGETDPQGIYRL  86

Query  1048  LVNGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQP  1227
              V G+  +D+C+V LVKS      +P    DRAR++LS+N G+V   R+AN LG+  K+ 
Sbjct  87    PVEGEHEEDICEVRLVKSGMTDCIEPFKSTDRARILLSQNVGVVQASRYANPLGYMKKEA  146

Query  1228  LASCTQVV  1251
               +C QV+
Sbjct  147   NPNCGQVL  154



>ref|XP_004248244.1| PREDICTED: anther-specific protein LAT52 [Solanum lycopersicum]
 sp|P13447.1|LAT52_SOLLC RecName: Full=Anther-specific protein LAT52; Flags: Precursor 
[Solanum lycopersicum]
 emb|CAA33854.1| LAT52 [Solanum lycopersicum]
Length=161

 Score = 97.1 bits (240),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 52/130 (40%), Positives = 75/130 (58%), Gaps = 0/130 (0%)
 Frame = +1

Query  877   FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  1056
             F V+GKVY DTC   FET  ++ L  + V+L C N  T A T+S   VT+  G+Y + VN
Sbjct  27    FDVEGKVYCDTCRVQFETKLSENLEGATVKLQCRNISTEAETFSVEGVTDKDGKYKLTVN  86

Query  1057  GDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLAS  1236
             GD  +D+C+V +VKS      +  SG ++AR+  S N G+ N VRFAN L F   + +  
Sbjct  87    GDHENDICEVTVVKSPREDCKESVSGYEKARIECSDNVGIHNAVRFANPLFFMKAESVQG  146

Query  1237  CTQVVAQYHL  1266
             C + + +  L
Sbjct  147   CKEALDELGL  156



>gb|AFK47865.1| unknown [Lotus japonicus]
Length=168

 Score = 97.1 bits (240),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 52/136 (38%), Positives = 82/136 (60%), Gaps = 3/136 (2%)
 Frame = +1

Query  877   FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  1056
             F V+G VY DTC   F T  +++L  + VR+ C      +VT++   VT+++G Y + V+
Sbjct  28    FFVEGVVYCDTCRTQFITKLSEFLEGATVRVECKEEGNGSVTFTKEVVTDAKGSYKVEVD  87

Query  1057  GDRGDDLCDVVLVKS--SDPLSGKPDSGRDR-ARVILSRNNGLVNDVRFANNLGFTTKQP  1227
             GD  ++LC VVLVKS  SD      DS  ++ A++ +++NNG+V+ VR AN LGF  K+ 
Sbjct  88    GDHEEELCQVVLVKSPRSDCSEIDSDSHLEQAAKISITKNNGIVSPVRAANPLGFLKKER  147

Query  1228  LASCTQVVAQYHLNDD  1275
             L  C  V+ +  + +D
Sbjct  148   LPGCADVLKELGIKED  163



>ref|XP_010103032.1| hypothetical protein L484_005787 [Morus notabilis]
 gb|EXB94630.1| hypothetical protein L484_005787 [Morus notabilis]
Length=166

 Score = 96.7 bits (239),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 54/139 (39%), Positives = 79/139 (57%), Gaps = 5/139 (4%)
 Frame = +1

Query  877   FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  1056
              +V+G+VY DTC   F T  + Y+  + VRL C   +  +VTYS + VT+  G Y I V+
Sbjct  28    LIVEGRVYCDTCRAQFVTKVSNYIKGAKVRLECRESEGGSVTYSNDGVTDESGTYRIAVD  87

Query  1057  GDRGDDLCDVVLVKSSDP----LSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQ  1224
             GD  +++C+V LVKSS P    +S  P   +  ARV L+ NNG+ + VR AN LGF  K 
Sbjct  88    GDHEEEVCEVKLVKSSVPDCSEISNDP-YNKLNARVSLTSNNGITSPVRQANPLGFLKKN  146

Query  1225  PLASCTQVVAQYHLNDDNF  1281
              L  C +V+ +  +  +  
Sbjct  147   SLPECPEVLRELGITPEGL  165



>ref|XP_003565925.1| PREDICTED: pollen allergen Phl p 11 [Brachypodium distachyon]
Length=170

 Score = 97.1 bits (240),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 50/133 (38%), Positives = 74/133 (56%), Gaps = 1/133 (1%)
 Frame = +1

Query  877   FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  1056
             F+V G+VY D C  GFET  +K +  + V + C   +       A A T+  G Y I ++
Sbjct  33    FVVTGRVYCDPCRAGFETNVSKNIGGATVAVDCRPFNGGDSKLKAEATTDQYGWYKIDID  92

Query  1057  GDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVND-VRFANNLGFTTKQPLA  1233
              D  +++C+V+L +S DP   + +  RDRARV L+RNNGL     R+AN + F  K+PL 
Sbjct  93    QDHQEEICEVLLARSPDPACSEIEEFRDRARVPLTRNNGLKQQGTRYANPIAFFRKEPLK  152

Query  1234  SCTQVVAQYHLND  1272
              C  ++  Y L D
Sbjct  153   DCGGILQAYDLKD  165



>ref|XP_006304746.1| hypothetical protein CARUB_v10012122mg [Capsella rubella]
 gb|EOA37644.1| hypothetical protein CARUB_v10012122mg [Capsella rubella]
Length=171

 Score = 97.1 bits (240),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 52/137 (38%), Positives = 79/137 (58%), Gaps = 4/137 (3%)
 Frame = +1

Query  877   FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  1056
             F +KG VY DTC   F T  +K+L  + V+L C  R+   VT +  AVT+  G Y + V 
Sbjct  32    FHIKGSVYCDTCRVQFITRLSKFLEGAKVKLECKGRENQTVTLTKEAVTDKAGNYQMEVM  91

Query  1057  GDRGDDLCDVVLVKSSDPLSGKPDSG---RDRARVILSRNNGLV-NDVRFANNLGFTTKQ  1224
             GD  +++C++VL++S D   G+ ++    R+ AR+ L+ N+G+V N+ R  N LGF  K 
Sbjct  92    GDHEEEVCEIVLLQSPDAECGEVNNQEFLRNAARISLTANDGIVSNETRTINPLGFMRKT  151

Query  1225  PLASCTQVVAQYHLNDD  1275
             PLA C Q   +  +  D
Sbjct  152   PLAECPQAFKELGIVPD  168



>ref|XP_004144129.1| PREDICTED: olee1-like protein [Cucumis sativus]
 gb|KGN66323.1| hypothetical protein Csa_1G597700 [Cucumis sativus]
Length=165

 Score = 96.7 bits (239),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 51/138 (37%), Positives = 79/138 (57%), Gaps = 4/138 (3%)
 Frame = +1

Query  877   FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  1056
             F V+GKVY DTC   F T  +K+L  + V+L C   +  +VT    AVT+  G+YSI  +
Sbjct  27    FFVEGKVYCDTCRVQFFTKVSKFLEGATVKLECKEIEGGSVTLDKEAVTDKSGKYSIEAD  86

Query  1057  GDRGDDLCDVVLVKSSDP---LSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQP  1227
             GD  +++C+V L+KS DP      K   G   +RV ++ N+G+ N VR AN L F  K+ 
Sbjct  87    GDHEEEVCEVSLMKSVDPDCDEISKEGYGH-TSRVTITNNSGITNPVRLANPLAFLKKEK  145

Query  1228  LASCTQVVAQYHLNDDNF  1281
             L+ C +V+ +   +++  
Sbjct  146   LSECKEVLRELGFDEEGL  163



>ref|NP_001150330.1| pollen allergen Phl p 11 precursor [Zea mays]
 gb|ACG38668.1| pollen allergen Phl p 11 [Zea mays]
Length=165

 Score = 96.3 bits (238),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/131 (34%), Positives = 80/131 (61%), Gaps = 1/131 (1%)
 Frame = +1

Query  877   FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  1056
             F+V G+VY D C  GFET  +  +  + V + C + ++  V   A A T++ G Y + ++
Sbjct  27    FVVTGRVYCDNCRAGFETNVSHAIEGATVEMECRHFESQEVHDKAEATTDAGGWYRMEIS  86

Query  1057  GDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVND-VRFANNLGFTTKQPLA  1233
             GD  D++C+V+L+KS +    + +  R+R RV L+RN+G+    +R+AN + F  K+PL+
Sbjct  87    GDHQDEICEVLLLKSPEADCAEIERTRERCRVPLTRNDGIRQSGIRYANPIAFFRKEPLS  146

Query  1234  SCTQVVAQYHL  1266
             +C +++  Y L
Sbjct  147   NCGELLRAYDL  157



>ref|XP_008343344.1| PREDICTED: LOW QUALITY PROTEIN: olee1-like protein, partial [Malus 
domestica]
Length=125

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 49/123 (40%), Positives = 67/123 (54%), Gaps = 0/123 (0%)
 Frame = +1

Query  904   DTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVNGDRGDDLCD  1083
             DTC  G+ET A  Y+  + VRL C ++ + A+ Y+    T+S G Y I V  D  D  CD
Sbjct  2     DTCRAGYETKAITYIAGAKVRLECRDKSSMALVYTKEGTTDSAGCYKIPVAEDHLDQFCD  61

Query  1084  VVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLASCTQVVAQYH  1263
              VLV S          GR+RARVIL+  NG+ +  RFAN  GF   + L+ CTQ++ +  
Sbjct  62    AVLVSSPQKDCATVSPGRERARVILTGYNGIASYTRFANARGFMRTEALSGCTQILKELQ  121

Query  1264  LND  1272
               D
Sbjct  122   ELD  124



>gb|AEW90941.1| group 11 grass pollen allergen F7-4 [Secale cereale x Triticum 
turgidum subsp. durum]
Length=167

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 50/133 (38%), Positives = 72/133 (54%), Gaps = 1/133 (1%)
 Frame = +1

Query  877   FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  1056
             F+V G+VY D C  GFET  +K +  + V + C           A A T+++G Y I ++
Sbjct  30    FIVTGRVYCDPCRAGFETNVSKNVEGATVAMDCRPFGGGESKLKAEATTDNKGWYKIEID  89

Query  1057  GDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVND-VRFANNLGFTTKQPLA  1233
              D  D++C+VVL KS D    + +  RDRARV L+ NNG+     RFAN + F  K+P  
Sbjct  90    QDHQDEICEVVLTKSPDASCAEIEEFRDRARVPLTSNNGMKQQGTRFANPIAFLPKEPRK  149

Query  1234  SCTQVVAQYHLND  1272
              C  ++  Y L D
Sbjct  150   ECGGILQAYDLKD  162



>ref|XP_009115274.1| PREDICTED: pollen-specific protein-like At4g18596 [Brassica rapa]
Length=171

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 53/137 (39%), Positives = 80/137 (58%), Gaps = 4/137 (3%)
 Frame = +1

Query  877   FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  1056
             F + G VY DTC   F T  +K+L  + V+L C +R    VT +  AVT+  G+Y + V 
Sbjct  32    FNITGSVYCDTCRVQFVTRLSKFLEGAKVKLECKSRVNQTVTLTKEAVTDKDGKYQMEVM  91

Query  1057  GDRGDDLCDVVLVKSSDPLSGKPDSG---RDRARVILSRNNGLV-NDVRFANNLGFTTKQ  1224
             GD  ++LC+ +LV+S D   G+ ++    R+ AR+ L+ N+G+V N++R  N LGF  K 
Sbjct  92    GDHEEELCEFILVQSPDAECGEVNNEEFLRNAARISLTANDGIVSNEIRTINPLGFMRKT  151

Query  1225  PLASCTQVVAQYHLNDD  1275
             PLA C QV  +  +  D
Sbjct  152   PLADCPQVFKELGIVPD  168



>gb|AEW90942.1| group 11 grass pollen allergen F7-6 [Secale cereale x Triticum 
turgidum subsp. durum]
 gb|AEW90944.1| group 11 grass pollen allergen F8-9 [Secale cereale x Triticum 
turgidum subsp. durum]
Length=167

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 50/133 (38%), Positives = 72/133 (54%), Gaps = 1/133 (1%)
 Frame = +1

Query  877   FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  1056
             F+V G+VY D C  GFET  +K +  + V + C           A A T+++G Y I ++
Sbjct  30    FIVTGRVYCDPCRAGFETNVSKNVEGATVAMDCRPFGGGESKLKAEATTDNKGWYKIEID  89

Query  1057  GDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVND-VRFANNLGFTTKQPLA  1233
              D  D++C+VVL KS D    + +  RDRARV L+ NNG+     RFAN + F  K+P  
Sbjct  90    QDHQDEICEVVLTKSPDASCAEIEEFRDRARVPLTSNNGMKQQGTRFANPIAFFPKEPRK  149

Query  1234  SCTQVVAQYHLND  1272
              C  ++  Y L D
Sbjct  150   ECGGILQAYDLKD  162



>gb|AEW90943.1| group 11 grass pollen allergen F8-6 [Secale cereale x Triticum 
turgidum subsp. durum]
Length=167

 Score = 95.9 bits (237),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 50/133 (38%), Positives = 72/133 (54%), Gaps = 1/133 (1%)
 Frame = +1

Query  877   FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  1056
             F+V G+VY D C  GFET  +K +  + V + C           A A T+++G Y I ++
Sbjct  30    FIVTGRVYCDPCRAGFETNVSKNVEGATVAMDCRPFGGGESKLKAEATTDNKGWYKIEID  89

Query  1057  GDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVND-VRFANNLGFTTKQPLA  1233
              D  D++C+VVL KS D    + +  RDRARV L+ NNG+     RFAN + F  K+P  
Sbjct  90    RDHQDEICEVVLTKSPDASCAEIEEFRDRARVPLTSNNGMKQQGTRFANPIAFFPKEPRK  149

Query  1234  SCTQVVAQYHLND  1272
              C  ++  Y L D
Sbjct  150   ECGGILQAYDLKD  162



>ref|XP_003541705.1| PREDICTED: olee1-like protein-like [Glycine max]
 gb|KHN08444.1| Olee1-like protein [Glycine soja]
Length=169

 Score = 95.5 bits (236),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 81/137 (59%), Gaps = 4/137 (3%)
 Frame = +1

Query  877   FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRD-TNAVTYSANAVTNSQGEYSILV  1053
             F+V+G VY DTC   F T  +++L  + VR+VC+  D    VT+S  AVT++ G Y + V
Sbjct  28    FMVEGTVYCDTCRVQFLTKLSEFLEGATVRVVCSQVDNAKNVTFSKEAVTDASGSYKVEV  87

Query  1054  NGDRGDDLCDVVLVKSSDPLSGKPDSG---RDRARVILSRNNGLVNDVRFANNLGFTTKQ  1224
             +GD  +D C+V L+KS      + D     +  AR+ +++NNG+V+ +R AN LGF  K 
Sbjct  88    DGDHEEDTCEVTLLKSPRADCSEVDQESHLQQAARISITKNNGIVSPIRQANPLGFLKKD  147

Query  1225  PLASCTQVVAQYHLNDD  1275
              L  C  ++ +  +N+D
Sbjct  148   RLPGCLDLLKELGINED  164



>emb|CAA78897.1| pollen specific gene [Oryza sativa Indica Group]
Length=164

 Score = 95.5 bits (236),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 50/134 (37%), Positives = 80/134 (60%), Gaps = 1/134 (1%)
 Frame = +1

Query  877   FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  1056
             ++V+G+VY DTC   FET  T+Y+  + VRL C +  T+ V  + + VT+  G Y I + 
Sbjct  30    YVVQGRVYCDTCRAEFETNVTEYIKGAKVRLECKHFGTDKVERAIDGVTDETGTYKIELK  89

Query  1057  GDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLAS  1236
                 +D+C+VVLV S      + ++ RDRARV+L+RN G+ +++R AN LG+       S
Sbjct  90    DSHEEDICEVVLVHSPLANCSEIEAERDRARVLLTRNVGICDNLRLANPLGYLKDYHCPS  149

Query  1237  CTQVVAQYHLNDDN  1278
                ++ Q+ L DD+
Sbjct  150   -AALLKQFDLADDD  162



>ref|XP_009617824.1| PREDICTED: olee1-like protein [Nicotiana tomentosiformis]
Length=171

 Score = 95.5 bits (236),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 49/133 (37%), Positives = 76/133 (57%), Gaps = 3/133 (2%)
 Frame = +1

Query  877   FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  1056
             F V+GKVY D C   FE   +K +P + VRL C N   ++VT +    T+  G YS+LV 
Sbjct  31    FHVEGKVYCDFCRALFENRLSKPMPGAEVRLQCRNSTDDSVTLTVEGQTDKNGVYSLLVE  90

Query  1057  GDRGDDLCDVVLVKSS-DPLSGKPDSG--RDRARVILSRNNGLVNDVRFANNLGFTTKQP  1227
              D  D++C+++L+KSS +  S  P+ G  ++ AR+ ++ NNG+   +R AN L F  K+ 
Sbjct  91    RDHEDEICEMILMKSSKEDCSEIPNEGHAKESARITITSNNGMAETIRHANPLFFVKKEA  150

Query  1228  LASCTQVVAQYHL  1266
                C +V  +  L
Sbjct  151   APECAEVFKELEL  163



>ref|XP_009794171.1| PREDICTED: anther-specific protein LAT52 [Nicotiana sylvestris]
Length=161

 Score = 95.1 bits (235),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 50/130 (38%), Positives = 75/130 (58%), Gaps = 0/130 (0%)
 Frame = +1

Query  877   FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  1056
             F V+GKVY DTC   FET  ++ +  + VRL C N  T   T+S   VT+  G+Y + V 
Sbjct  27    FDVEGKVYCDTCRVQFETKLSENVEGATVRLQCRNISTEIETFSVEGVTDKDGKYKLTVE  86

Query  1057  GDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLAS  1236
             GD  DD+C+V +VKS      +  +G ++AR+  S N G+ N VR+AN L F   + ++ 
Sbjct  87    GDHQDDICEVTVVKSPREDCKEAVTGYEKARIECSDNVGIHNAVRYANALFFMKSEAVSG  146

Query  1237  CTQVVAQYHL  1266
             C +V+ +  L
Sbjct  147   CKEVLDELGL  156



>ref|XP_002522577.1| Pollen allergen Che a 1 precursor, putative [Ricinus communis]
 gb|EEF39877.1| Pollen allergen Che a 1 precursor, putative [Ricinus communis]
Length=171

 Score = 95.1 bits (235),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 48/131 (37%), Positives = 80/131 (61%), Gaps = 4/131 (3%)
 Frame = +1

Query  877   FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTN-AVTYSANAVTNSQGEYSILV  1053
             F V+GKVY DTC   F T AT Y+  + VRL C +R+   A+T+SA A T++ G Y I V
Sbjct  31    FTVEGKVYCDTCRVQFITKATSYIKGARVRLECKDREGGGAITFSAEAETDATGTYHIPV  90

Query  1054  NGDRGDDLCDVVLVKSSDPLSGKPDSG---RDRARVILSRNNGLVNDVRFANNLGFTTKQ  1224
             NG+  ++LC+++ +KS DP   + +     +  A++ L+ +NG+ +  R AN +GF  +Q
Sbjct  91    NGEHEEELCEIIPLKSPDPDCNEINQDPFVKKAAQITLTNHNGIASPTRSANPIGFLKQQ  150

Query  1225  PLASCTQVVAQ  1257
              +  C+ ++ +
Sbjct  151   AVPECSGILRE  161



>gb|EAZ45758.1| hypothetical protein OsJ_30442 [Oryza sativa Japonica Group]
Length=151

 Score = 94.7 bits (234),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 54/134 (40%), Positives = 75/134 (56%), Gaps = 3/134 (2%)
 Frame = +1

Query  877   FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTN--RDTNAVTYSANAVTNSQGEYSIL  1050
             F V+G VY DTC  GF+T AT  +  + VRL C +    + AV  SA   T++ G Y I 
Sbjct  13    FFVEGDVYCDTCRAGFQTNATTAIQGARVRLECRHFMSASGAVERSAEGTTDAAGHYRIE  72

Query  1051  VNGDRG-DDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQP  1227
             +  +RG +++C V L+ S DP   + + GRDRA V L ++ GL   VR AN LGF   +P
Sbjct  73    LVDNRGAEEVCAVALLSSPDPECHETEVGRDRAPVTLVQDAGLATMVRRANPLGFLKTRP  132

Query  1228  LASCTQVVAQYHLN  1269
             L  C  ++  Y L 
Sbjct  133   LPICGDLLKSYALG  146



>ref|XP_009604804.1| PREDICTED: anther-specific protein LAT52 [Nicotiana tomentosiformis]
Length=161

 Score = 94.7 bits (234),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 50/130 (38%), Positives = 75/130 (58%), Gaps = 0/130 (0%)
 Frame = +1

Query  877   FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  1056
             F V+GKVY DTC   FET  ++ +  + VRL C N  T   T+S   VT+  G+Y + V 
Sbjct  27    FDVEGKVYCDTCRVQFETKLSENVEGATVRLQCRNISTETETFSVEGVTDKDGKYKLTVE  86

Query  1057  GDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLAS  1236
             GD  DD+C+V +VKS      +  +G ++AR+  S N G+ N VR+AN L F   + ++ 
Sbjct  87    GDHQDDICEVTVVKSPREDCKESVTGYEKARIECSDNVGIHNAVRYANPLFFMKTEAVSG  146

Query  1237  CTQVVAQYHL  1266
             C +V+ +  L
Sbjct  147   CKEVLDELGL  156



>gb|KHN44330.1| Pollen-specific protein C13, partial [Glycine soja]
Length=127

 Score = 93.6 bits (231),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 50/113 (44%), Positives = 68/113 (60%), Gaps = 4/113 (4%)
 Frame = +1

Query  877   FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  1056
             F VKG VY DTC  GFET AT Y+  + V +    R T  V Y    VT+S G Y I V 
Sbjct  15    FHVKGSVYCDTCRAGFETNATFYIQGAKVGI---QRKTMKVVYYTEGVTDSTGTYHIEVE  71

Query  1057  GDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRN-NGLVNDVRFANNLGF  1212
              D  D++C+ VLVKS       PDSGRD++ ++L+ + NG+VN + +AN +G+
Sbjct  72    NDHRDNICECVLVKSPIKWCNTPDSGRDKSSIVLTHHQNGVVNHLHYANAMGY  124



>dbj|BAD46623.1| putative Pollen specific protein C13 precursor [Oryza sativa 
Japonica Group]
 dbj|BAD54680.1| putative Pollen specific protein C13 precursor [Oryza sativa 
Japonica Group]
Length=165

 Score = 94.4 bits (233),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 54/134 (40%), Positives = 75/134 (56%), Gaps = 3/134 (2%)
 Frame = +1

Query  877   FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTN--RDTNAVTYSANAVTNSQGEYSIL  1050
             F V+G VY DTC  GF+T AT  +  + VRL C +    + AV  SA   T++ G Y I 
Sbjct  27    FFVEGDVYCDTCRAGFQTNATTAIQGARVRLECRHFMSASGAVERSAEGTTDAAGHYRIE  86

Query  1051  VNGDRG-DDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQP  1227
             +  +RG +++C V L+ S DP   + + GRDRA V L ++ GL   VR AN LGF   +P
Sbjct  87    LVDNRGAEEVCAVALLSSPDPECHETEVGRDRAPVTLVQDAGLATMVRRANPLGFLKTRP  146

Query  1228  LASCTQVVAQYHLN  1269
             L  C  ++  Y L 
Sbjct  147   LPICGDLLKSYALG  160



>ref|XP_010941451.1| PREDICTED: pollen-specific protein C13-like [Elaeis guineensis]
Length=165

 Score = 94.4 bits (233),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 51/135 (38%), Positives = 78/135 (58%), Gaps = 1/135 (1%)
 Frame = +1

Query  877   FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  1056
             F V G+VY DTC  GF    T+YL  + VRL C +  +  V++S  A+T+  G Y+I ++
Sbjct  27    FSVTGRVYCDTCRAGFVHEFTEYLGGAKVRLECRDYVSGQVSHSGEALTDKYGYYTITMS  86

Query  1057  GDRGDDLCDVVLVKSSD-PLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  1233
              D  +++C+VVL+ S        P   RDRARV L+RNNG+ ++ R  N +G+    PL 
Sbjct  87    DDHQEEICEVVLLDSPRYDCKEIPADHRDRARVALTRNNGMSSEQRNVNAIGYLKDVPLP  146

Query  1234  SCTQVVAQYHLNDDN  1278
              C  ++ +Y L  D+
Sbjct  147   KCGPMLQRYALFTDD  161



>gb|EEC85106.1| hypothetical protein OsI_32490 [Oryza sativa Indica Group]
Length=167

 Score = 94.4 bits (233),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 54/134 (40%), Positives = 75/134 (56%), Gaps = 3/134 (2%)
 Frame = +1

Query  877   FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTN--RDTNAVTYSANAVTNSQGEYSIL  1050
             F V+G VY DTC  GF+T AT  +  + VRL C +    + AV  SA   T++ G Y I 
Sbjct  29    FFVEGDVYCDTCRAGFQTNATTAIQGARVRLECRHFMSASGAVERSAEGTTDAAGHYRIE  88

Query  1051  VNGDRG-DDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQP  1227
             +  +RG +++C V L+ S DP   + + GRDRA V L ++ GL   VR AN LGF   +P
Sbjct  89    LVDNRGAEEVCAVALLSSPDPECHETEVGRDRAPVTLVQDAGLATMVRRANPLGFLKTRP  148

Query  1228  LASCTQVVAQYHLN  1269
             L  C  ++  Y L 
Sbjct  149   LPICGDLLKSYALG  162



>ref|NP_001064001.1| Os09g0572800 [Oryza sativa Japonica Group]
 dbj|BAF25915.1| Os09g0572800 [Oryza sativa Japonica Group]
 dbj|BAH00168.1| unnamed protein product [Oryza sativa Japonica Group]
Length=167

 Score = 94.4 bits (233),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 54/134 (40%), Positives = 75/134 (56%), Gaps = 3/134 (2%)
 Frame = +1

Query  877   FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTN--RDTNAVTYSANAVTNSQGEYSIL  1050
             F V+G VY DTC  GF+T AT  +  + VRL C +    + AV  SA   T++ G Y I 
Sbjct  29    FFVEGDVYCDTCRAGFQTNATTAIQGARVRLECRHFMSASGAVERSAEGTTDAAGHYRIE  88

Query  1051  VNGDRG-DDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQP  1227
             +  +RG +++C V L+ S DP   + + GRDRA V L ++ GL   VR AN LGF   +P
Sbjct  89    LVDNRGAEEVCAVALLSSPDPECHETEVGRDRAPVTLVQDAGLATMVRRANPLGFLKTRP  148

Query  1228  LASCTQVVAQYHLN  1269
             L  C  ++  Y L 
Sbjct  149   LPICGDLLKSYALG  162



>ref|XP_003546028.1| PREDICTED: olee1-like protein-like [Glycine max]
 gb|KHN18912.1| Olee1-like protein [Glycine soja]
Length=169

 Score = 94.4 bits (233),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 79/137 (58%), Gaps = 4/137 (3%)
 Frame = +1

Query  877   FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRD-TNAVTYSANAVTNSQGEYSILV  1053
             F+V+G VY DTC   F T  ++ L  + VR+ C+  D    VT+S  AVT++ G Y + V
Sbjct  28    FMVEGTVYCDTCRVQFLTKLSEILEGATVRVTCSQVDNAKNVTFSKEAVTDASGSYKVEV  87

Query  1054  NGDRGDDLCDVVLVKSSDPLSGKPDSG---RDRARVILSRNNGLVNDVRFANNLGFTTKQ  1224
              GD  +D C+V L+KS  P   + D     +  AR+ +++NNG+V+ +R AN LGF  K 
Sbjct  88    EGDHEEDTCEVTLLKSPRPDCSEIDRESHLQQAARISITKNNGIVSPLRQANPLGFLKKD  147

Query  1225  PLASCTQVVAQYHLNDD  1275
              L  C  ++ +  +N+D
Sbjct  148   RLPGCADLLKELGINED  164



>gb|ADK22842.1| Sal k 5, partial [Salsola kali]
Length=151

 Score = 94.0 bits (232),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 55/135 (41%), Positives = 73/135 (54%), Gaps = 3/135 (2%)
 Frame = +1

Query  877   FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  1056
             + VKG VY DTC   F T  +  +  + V L C N      T+ A AVT+  G Y+I V+
Sbjct  9     YHVKGMVYCDTCRIQFITRVSTMMEGATVSLQCRNLTAGTETFKAEAVTDKLGMYTIKVD  68

Query  1057  GDRGDDLCDVVLVKS-SDPLSGKPDS--GRDRARVILSRNNGLVNDVRFANNLGFTTKQP  1227
             GD  DD+C +VLVKS     S  P+       A+V L+ NNG  +DVR AN LGF  K P
Sbjct  69    GDHEDDICQIVLVKSPGQECSEIPNDVYSEQAAKVTLTSNNGEASDVRNANALGFLKKAP  128

Query  1228  LASCTQVVAQYHLND  1272
             L  C +V+ +  + D
Sbjct  129   LPECPEVLKELDMYD  143



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4775625347306