BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig11341

Length=1073
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009591291.1|  PREDICTED: probable pyridoxal biosynthesis p...    531   0.0      Nicotiana tomentosiformis
ref|XP_009796117.1|  PREDICTED: probable pyridoxal biosynthesis p...    528   0.0      Nicotiana sylvestris
ref|XP_004235714.1|  PREDICTED: probable pyridoxal biosynthesis p...    518   0.0      Solanum lycopersicum
ref|XP_006341676.1|  PREDICTED: probable pyridoxal biosynthesis p...    516   0.0      Solanum tuberosum [potatoes]
ref|XP_011080804.1|  PREDICTED: probable pyridoxal biosynthesis p...    513   6e-180   Sesamum indicum [beniseed]
emb|CDO98042.1|  unnamed protein product                                503   8e-176   Coffea canephora [robusta coffee]
ref|XP_006465598.1|  PREDICTED: probable pyridoxal biosynthesis p...    492   2e-171   Citrus sinensis [apfelsine]
ref|XP_006426976.1|  hypothetical protein CICLE_v10026152mg             490   1e-170   Citrus clementina [clementine]
ref|XP_007024157.1|  Pyridoxine biosynthesis 1.2                        491   3e-170   
gb|EYU24698.1|  hypothetical protein MIMGU_mgv1a027113mg                489   4e-170   Erythranthe guttata [common monkey flower]
gb|KJB70474.1|  hypothetical protein B456_011G075300                    486   3e-169   Gossypium raimondii
ref|XP_010098060.1|  putative pyridoxal biosynthesis protein            484   2e-168   Morus notabilis
gb|KJB56744.1|  hypothetical protein B456_009G134000                    485   8e-168   Gossypium raimondii
ref|XP_008228527.1|  PREDICTED: probable pyridoxal biosynthesis p...    482   2e-167   Prunus mume [ume]
ref|XP_012073347.1|  PREDICTED: pyridoxal 5'-phosphate synthase-l...    481   2e-167   Jatropha curcas
ref|XP_007215728.1|  hypothetical protein PRUPE_ppa009060mg             480   8e-167   Prunus persica
ref|XP_002299701.2|  pyridoxin biosynthesis PDX1-like protein 2         479   2e-166   Populus trichocarpa [western balsam poplar]
ref|XP_011007588.1|  PREDICTED: probable pyridoxal biosynthesis p...    476   4e-165   Populus euphratica
ref|XP_002516058.1|  Pyridoxin biosynthesis protein PDX1, putative      471   5e-163   Ricinus communis
ref|XP_009346002.1|  PREDICTED: probable pyridoxal biosynthesis p...    465   7e-161   Pyrus x bretschneideri [bai li]
ref|XP_008342698.1|  PREDICTED: probable pyridoxal biosynthesis p...    462   1e-159   
ref|XP_002885122.1|  hypothetical protein ARALYDRAFT_479060             461   2e-159   
ref|XP_002862267.1|  hypothetical protein ARALYDRAFT_497537             461   3e-159   
ref|XP_008354742.1|  PREDICTED: probable pyridoxal biosynthesis p...    460   8e-159   
ref|XP_009353629.1|  PREDICTED: probable pyridoxal biosynthesis p...    459   2e-158   Pyrus x bretschneideri [bai li]
ref|XP_008371349.1|  PREDICTED: probable pyridoxal biosynthesis p...    459   3e-158   
ref|NP_188226.1|  putative pyridoxal biosynthesis protein PDX1.2        459   3e-158   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006299634.1|  hypothetical protein CARUB_v10015814mg             458   5e-158   Capsella rubella
ref|XP_010465605.1|  PREDICTED: probable pyridoxal biosynthesis p...    457   1e-157   Camelina sativa [gold-of-pleasure]
ref|XP_008344378.1|  PREDICTED: probable pyridoxal biosynthesis p...    456   3e-157   
ref|XP_010487448.1|  PREDICTED: probable pyridoxal biosynthesis p...    456   4e-157   Camelina sativa [gold-of-pleasure]
ref|XP_010503700.1|  PREDICTED: probable pyridoxal biosynthesis p...    456   5e-157   Camelina sativa [gold-of-pleasure]
emb|CDY50623.1|  BnaC01g44250D                                          454   5e-155   Brassica napus [oilseed rape]
ref|XP_009115047.1|  PREDICTED: probable pyridoxal biosynthesis p...    449   1e-154   Brassica rapa
ref|XP_010249746.1|  PREDICTED: probable pyridoxal biosynthesis p...    451   1e-154   Nelumbo nucifera [Indian lotus]
emb|CDY20176.1|  BnaA01g28260D                                          448   2e-154   Brassica napus [oilseed rape]
gb|KFK38958.1|  hypothetical protein AALP_AA3G182100                    449   3e-154   Arabis alpina [alpine rockcress]
ref|XP_006406887.1|  hypothetical protein EUTSA_v10021182mg             448   5e-154   Eutrema salsugineum [saltwater cress]
ref|XP_010062464.1|  PREDICTED: probable pyridoxal biosynthesis p...    451   8e-154   Eucalyptus grandis [rose gum]
ref|XP_004304508.1|  PREDICTED: pyridoxal 5'-phosphate synthase-l...    447   2e-153   Fragaria vesca subsp. vesca
ref|XP_010654664.1|  PREDICTED: probable pyridoxal biosynthesis p...    444   6e-153   Vitis vinifera
emb|CAN76358.1|  hypothetical protein VITISV_023953                     442   3e-152   Vitis vinifera
ref|XP_010535160.1|  PREDICTED: probable pyridoxal biosynthesis p...    440   5e-151   Tarenaya hassleriana [spider flower]
ref|XP_006847660.1|  PREDICTED: probable pyridoxal 5'-phosphate s...    417   4e-142   Amborella trichopoda
ref|XP_007205605.1|  hypothetical protein PRUPE_ppa009029mg             417   7e-142   Prunus persica
ref|XP_008370096.1|  PREDICTED: pyridoxal biosynthesis protein PD...    416   1e-141   Malus domestica [apple tree]
ref|XP_010691316.1|  PREDICTED: probable pyridoxal biosynthesis p...    415   4e-141   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009377760.1|  PREDICTED: pyridoxal biosynthesis protein PD...    415   4e-141   Pyrus x bretschneideri [bai li]
ref|XP_008390695.1|  PREDICTED: pyridoxal biosynthesis protein PD...    415   4e-141   Malus domestica [apple tree]
ref|XP_004485941.1|  PREDICTED: pyridoxal biosynthesis protein PD...    415   5e-141   Cicer arietinum [garbanzo]
gb|AAZ67141.1|  pyridoxine biosynthesis protein                         414   6e-141   Lotus japonicus
ref|XP_010253907.1|  PREDICTED: probable pyridoxal biosynthesis p...    414   1e-140   Nelumbo nucifera [Indian lotus]
ref|XP_010037698.1|  PREDICTED: pyridoxal biosynthesis protein PD...    414   1e-140   Eucalyptus grandis [rose gum]
ref|XP_002278391.1|  PREDICTED: probable pyridoxal biosynthesis p...    413   2e-140   Vitis vinifera
gb|KCW69605.1|  hypothetical protein EUGRSUZ_F03024                     412   3e-140   Eucalyptus grandis [rose gum]
ref|XP_010553115.1|  PREDICTED: pyridoxal biosynthesis protein PD...    412   6e-140   Tarenaya hassleriana [spider flower]
ref|XP_002308219.1|  pyridoxin biosynthesis PDX1-like protein 3         412   9e-140   Populus trichocarpa [western balsam poplar]
ref|XP_010062465.1|  PREDICTED: probable pyridoxal biosynthesis p...    413   1e-139   Eucalyptus grandis [rose gum]
ref|XP_011019114.1|  PREDICTED: probable pyridoxal biosynthesis p...    411   1e-139   Populus euphratica
gb|KJB36918.1|  hypothetical protein B456_006G182600                    411   2e-139   Gossypium raimondii
ref|XP_002525650.1|  Pyridoxin biosynthesis protein PDX1, putative      411   2e-139   Ricinus communis
ref|XP_004137720.1|  PREDICTED: probable pyridoxal 5'-phosphate s...    410   2e-139   Cucumis sativus [cucumbers]
ref|XP_010558377.1|  PREDICTED: pyridoxal biosynthesis protein PD...    410   3e-139   Tarenaya hassleriana [spider flower]
ref|XP_002322981.1|  pyridoxin biosynthesis PDX1-like protein 3         410   3e-139   Populus trichocarpa [western balsam poplar]
ref|XP_006398617.1|  hypothetical protein EUTSA_v10014179mg             410   4e-139   Eutrema salsugineum [saltwater cress]
ref|XP_009125418.1|  PREDICTED: pyridoxal biosynthesis protein PD...    409   6e-139   Brassica rapa
ref|XP_012087850.1|  PREDICTED: probable pyridoxal 5'-phosphate s...    409   7e-139   Jatropha curcas
ref|XP_010543207.1|  PREDICTED: pyridoxal biosynthesis protein PD...    409   1e-138   Tarenaya hassleriana [spider flower]
ref|XP_011006558.1|  PREDICTED: probable pyridoxal biosynthesis p...    408   3e-138   Populus euphratica
ref|XP_006288284.1|  hypothetical protein CARUB_v10001526mg             408   3e-138   Capsella rubella
ref|XP_007026699.1|  Aldolase-type TIM barrel family protein            407   4e-138   Theobroma cacao [chocolate]
emb|CDP17824.1|  unnamed protein product                                407   7e-138   Coffea canephora [robusta coffee]
ref|XP_003542985.1|  PREDICTED: pyridoxal biosynthesis protein PD...    407   8e-138   Glycine max [soybeans]
ref|NP_195761.1|  Pyridoxal biosynthesis protein PDX1.3                 407   8e-138   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010104626.1|  putative pyridoxal biosynthesis protein PDX1       406   2e-137   Morus notabilis
ref|XP_006429393.1|  hypothetical protein CICLE_v10012274mg             405   2e-137   Citrus clementina [clementine]
gb|KJB76949.1|  hypothetical protein B456_012G114100                    405   2e-137   Gossypium raimondii
emb|CDP09194.1|  unnamed protein product                                405   2e-137   Coffea canephora [robusta coffee]
ref|XP_010685547.1|  PREDICTED: probable pyridoxal biosynthesis p...    405   3e-137   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_012067529.1|  PREDICTED: probable pyridoxal 5'-phosphate s...    405   4e-137   Jatropha curcas
gb|KHG23987.1|  putative pyridoxal biosynthesis PDX1                    405   4e-137   Gossypium arboreum [tree cotton]
ref|XP_006350840.1|  PREDICTED: probable pyridoxal biosynthesis p...    404   6e-137   Solanum tuberosum [potatoes]
ref|XP_009347258.1|  PREDICTED: probable pyridoxal biosynthesis p...    404   9e-137   Pyrus x bretschneideri [bai li]
ref|XP_004242523.1|  PREDICTED: probable pyridoxal biosynthesis p...    404   1e-136   Solanum lycopersicum
ref|XP_006488530.1|  PREDICTED: probable pyridoxal biosynthesis p...    404   1e-136   Citrus sinensis [apfelsine]
gb|EYU45710.1|  hypothetical protein MIMGU_mgv1a010525mg                404   1e-136   Erythranthe guttata [common monkey flower]
ref|XP_009387957.1|  PREDICTED: probable pyridoxal biosynthesis p...    404   2e-136   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006425070.1|  hypothetical protein CICLE_v10028683mg             405   2e-136   
ref|NP_001238041.1|  pyridoxine biosynthesis protein                    403   2e-136   
gb|EPS62113.1|  hypothetical protein M569_12680                         403   2e-136   Genlisea aurea
emb|CDX80774.1|  BnaC03g00280D                                          403   2e-136   
gb|AAM66972.1|  pyridoxine biosynthesis protein-like                    403   2e-136   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009130656.1|  PREDICTED: pyridoxal biosynthesis protein PD...    403   2e-136   Brassica rapa
ref|XP_009417196.1|  PREDICTED: probable pyridoxal biosynthesis p...    403   3e-136   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007147987.1|  hypothetical protein PHAVU_006G171100g             402   3e-136   Phaseolus vulgaris [French bean]
gb|KDO66893.1|  hypothetical protein CISIN_1g037779mg                   402   5e-136   Citrus sinensis [apfelsine]
sp|Q39963.1|PDX1_HEVBR  RecName: Full=Probable pyridoxal 5'-phosp...    402   6e-136   Hevea brasiliensis [jebe]
ref|XP_009385390.1|  PREDICTED: probable pyridoxal biosynthesis p...    401   1e-135   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008384798.1|  PREDICTED: probable pyridoxal biosynthesis p...    401   1e-135   Malus domestica [apple tree]
gb|KHG25998.1|  putative pyridoxal biosynthesis PDX1                    407   1e-135   Gossypium arboreum [tree cotton]
ref|XP_008778106.1|  PREDICTED: probable pyridoxal biosynthesis p...    401   2e-135   Phoenix dactylifera
ref|XP_004302579.1|  PREDICTED: probable pyridoxal 5'-phosphate s...    400   2e-135   Fragaria vesca subsp. vesca
ref|XP_010043429.1|  PREDICTED: pyridoxal biosynthesis protein PD...    400   2e-135   Eucalyptus grandis [rose gum]
ref|XP_009598644.1|  PREDICTED: probable pyridoxal biosynthesis p...    400   2e-135   Nicotiana tomentosiformis
gb|ADE75952.1|  unknown                                                 399   6e-135   Picea sitchensis
ref|XP_010909911.1|  PREDICTED: probable pyridoxal biosynthesis p...    399   1e-134   Elaeis guineensis
ref|XP_009414696.1|  PREDICTED: probable pyridoxal biosynthesis p...    399   1e-134   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010909760.1|  PREDICTED: probable pyridoxal biosynthesis p...    398   2e-134   Elaeis guineensis
ref|XP_007205601.1|  hypothetical protein PRUPE_ppa008974mg             397   4e-134   Prunus persica
ref|XP_002879732.1|  ATPDX1.1                                           397   5e-134   Arabidopsis lyrata subsp. lyrata
ref|XP_006657377.1|  PREDICTED: probable pyridoxal biosynthesis p...    397   6e-134   Oryza brachyantha
ref|XP_010509206.1|  PREDICTED: pyridoxal biosynthesis protein PD...    397   6e-134   Camelina sativa [gold-of-pleasure]
ref|XP_010505440.1|  PREDICTED: pyridoxal biosynthesis protein PD...    397   7e-134   Camelina sativa [gold-of-pleasure]
ref|XP_006411025.1|  hypothetical protein EUTSA_v10017969mg             396   1e-133   Eutrema salsugineum [saltwater cress]
ref|XP_004294253.1|  PREDICTED: probable pyridoxal 5'-phosphate s...    395   2e-133   Fragaria vesca subsp. vesca
gb|KHG23612.1|  putative pyridoxal biosynthesis PDX1                    395   2e-133   Gossypium arboreum [tree cotton]
ref|XP_002459215.1|  hypothetical protein SORBIDRAFT_02g000720          396   2e-133   Sorghum bicolor [broomcorn]
ref|XP_003593782.1|  Pyridoxal biosynthesis protein PDX1.3              395   2e-133   Medicago truncatula
ref|XP_006294648.1|  hypothetical protein CARUB_v10023685mg             395   3e-133   Capsella rubella
ref|NP_001058669.1|  Os07g0100200                                       394   9e-133   
ref|XP_008777114.1|  PREDICTED: probable pyridoxal biosynthesis p...    394   1e-132   Phoenix dactylifera
ref|XP_004987289.1|  PREDICTED: probable pyridoxal biosynthesis p...    394   1e-132   Setaria italica
ref|NP_181358.1|  Pyridoxal biosynthesis protein PDX1.1                 393   2e-132   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003558759.1|  PREDICTED: probable pyridoxal biosynthesis p...    393   2e-132   Brachypodium distachyon [annual false brome]
ref|NP_001140657.1|  uncharacterized protein LOC100272732               395   2e-132   Zea mays [maize]
sp|Q9AT63.1|PDX1_GINBI  RecName: Full=Probable pyridoxal 5'-phosp...    392   3e-132   Ginkgo biloba [ginkgo]
tpg|DAA59354.1|  TPA: Pyridoxin biosynthesis protein ER1                395   7e-132   
ref|XP_008651055.1|  PREDICTED: uncharacterized protein LOC100272...    397   8e-132   
ref|XP_004506848.1|  PREDICTED: probable pyridoxal biosynthesis p...    391   1e-131   Cicer arietinum [garbanzo]
gb|ACF84885.1|  unknown                                                 391   2e-131   Zea mays [maize]
ref|XP_008464036.1|  PREDICTED: probable pyridoxal biosynthesis p...    390   2e-131   Cucumis melo [Oriental melon]
dbj|BAK01702.1|  predicted protein                                      390   3e-131   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AAZ94411.1|  pyridoxine biosynthesis protein                         389   8e-131   Triticum aestivum [Canadian hard winter wheat]
dbj|BAJ93273.1|  predicted protein                                      389   1e-130   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_012092513.1|  PREDICTED: pyridoxal 5'-phosphate synthase-l...    386   1e-130   
ref|XP_004143159.1|  PREDICTED: probable pyridoxal 5'-phosphate s...    387   7e-130   Cucumis sativus [cucumbers]
ref|NP_001064010.1|  Os10g0100700                                       386   1e-129   
ref|XP_002528091.1|  Pyridoxin biosynthesis protein PDX1, putative      384   2e-129   
gb|KDP20596.1|  hypothetical protein JCGZ_04218                         382   3e-129   Jatropha curcas
ref|XP_010228496.1|  PREDICTED: probable pyridoxal biosynthesis p...    384   4e-129   Brachypodium distachyon [annual false brome]
gb|AFN53699.1|  hypothetical protein                                    400   5e-129   Linum usitatissimum
ref|XP_008667891.1|  PREDICTED: pyridoxin biosynthesis protein ER...    384   7e-129   Zea mays [maize]
ref|NP_001147020.1|  pyridoxin biosynthesis protein ER1                 384   8e-129   Zea mays [maize]
ref|NP_001068563.1|  Os11g0708500                                       382   2e-127   
ref|XP_006661586.1|  PREDICTED: probable pyridoxal biosynthesis p...    377   5e-126   Oryza brachyantha
ref|XP_003604476.1|  Pyridoxal biosynthesis protein PDX1.3              371   3e-124   Medicago truncatula
ref|XP_002969265.1|  hypothetical protein SELMODRAFT_146305             371   7e-124   Selaginella moellendorffii
gb|EAZ02455.1|  hypothetical protein OsI_24560                          370   7e-123   Oryza sativa Indica Group [Indian rice]
ref|XP_011080788.1|  PREDICTED: probable pyridoxal biosynthesis p...    367   2e-122   Sesamum indicum [beniseed]
ref|XP_009141727.1|  PREDICTED: LOW QUALITY PROTEIN: pyridoxal bi...    368   4e-121   Brassica rapa
ref|XP_001778481.1|  predicted protein                                  360   2e-119   
ref|XP_001754823.1|  predicted protein                                  358   8e-119   
ref|XP_001762283.1|  predicted protein                                  357   2e-118   
gb|ACE97366.1|  vitamin B6 biosynthesis protein                         352   6e-118   Populus tremula [European aspen]
gb|ACE97329.1|  vitamin B6 biosynthesis protein                         351   1e-117   Populus tremula [European aspen]
ref|XP_001783042.1|  predicted protein                                  355   1e-117   
gb|ACE97338.1|  vitamin B6 biosynthesis protein                         350   3e-117   Populus tremula [European aspen]
gb|EAZ38383.1|  hypothetical protein OsJ_22760                          352   2e-116   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010468201.1|  PREDICTED: probable pyridoxal biosynthesis p...    349   2e-116   Camelina sativa [gold-of-pleasure]
ref|XP_005708062.1|  pyridoxine biosynthesis protein                    349   4e-115   Galdieria sulphuraria
emb|CDX93320.1|  BnaC04g45760D                                          347   1e-114   
ref|XP_002500451.1|  predicted protein                                  347   1e-114   Micromonas commoda
ref|XP_005537762.1|  stress-inducible pyridoxine biosynthesis pro...    345   1e-113   Cyanidioschyzon merolae strain 10D
ref|XP_007509329.1|  pyridoxine biosynthesis protein                    344   2e-113   Bathycoccus prasinos
gb|EMS65158.1|  putative pyridoxal biosynthesis protein PDX1.1          341   8e-113   Triticum urartu
ref|XP_005648541.1|  vitamin B6 biosynthesis protein                    340   7e-112   Coccomyxa subellipsoidea C-169
ref|XP_001416532.1|  predicted protein                                  339   2e-111   Ostreococcus lucimarinus CCE9901
dbj|BAL98702.1|  pyridoxal biosynthesis lyase PdxS                      339   3e-111   Caldilinea aerophila DSM 14535 = NBRC 104270
ref|XP_006960514.1|  vitamin B6 biosynthesis protein                    338   8e-111   Wallemia mellicola CBS 633.66
emb|CEF96954.1|  Ribulose-phosphate binding barrel                      337   1e-110   Ostreococcus tauri
gb|EJT98464.1|  vitamin B6 biosynthesis protein                         337   1e-110   Dacryopinax primogenitus
ref|WP_028457652.1|  pyridoxal biosynthesis protein                     337   1e-110   Chloroflexus sp. Y-396-1
gb|EIE86503.1|  pyridoxine biosynthesis protein pyroA                   337   2e-110   Rhizopus delemar RA 99-880
ref|XP_009269562.1|  Pyridoxine biosynthesis protein PDX1               337   2e-110   Wallemia ichthyophaga EXF-994
ref|WP_012258093.1|  MULTISPECIES: pyridoxal 5'-phosphate synthas...    336   3e-110   Chloroflexus aurantiacus
ref|WP_031457980.1|  pyridoxal biosynthesis protein                     335   6e-110   Chloroflexus sp. MS-G
ref|XP_007347746.1|  vitamin B6 biosynthesis protein                    335   2e-109   
ref|WP_015941652.1|  pyridoxal 5'-phosphate synthase subunit PdxS       333   2e-109   Chloroflexus aggregans
emb|CAQ34814.1|  vitamin B6 biosynthesis protein                        334   2e-109   Rhizophagus intraradices
emb|CEG64406.1|  Putative Pyridoxine biosynthesis protein PDX1          334   3e-109   Rhizopus microsporus
ref|XP_007863584.1|  vitamin B6 biosynthesis protein                    334   4e-109   Gloeophyllum trabeum ATCC 11539
gb|KIJ60651.1|  hypothetical protein HYDPIDRAFT_177350                  334   4e-109   Hydnomerulius pinastri MD-312
emb|CEI99339.1|  Putative Pyridoxine biosynthesis protein PDX1          333   4e-109   Rhizopus microsporus
dbj|GAN05769.1|  vitamin B6 biosynthesis protein                        333   5e-109   Mucor ambiguus
gb|KIK63634.1|  hypothetical protein GYMLUDRAFT_40702                   333   1e-108   Gymnopus luxurians FD-317 M1
ref|XP_007326724.1|  hypothetical protein AGABI1DRAFT_111385            333   1e-108   Agaricus bisporus var. burnettii JB137-S8
ref|XP_007263905.1|  vitamin B6 biosynthesis protein                    333   1e-108   Fomitiporia mediterranea MF3/22
ref|XP_006458263.1|  hypothetical protein AGABI2DRAFT_190607            333   2e-108   Agaricus bisporus var. bisporus H97
ref|XP_003026559.1|  hypothetical protein SCHCODRAFT_71165              333   2e-108   Schizophyllum commune H4-8
emb|CDH56625.1|  vitamin b6 biosynthesis protein                        331   3e-108   Lichtheimia corymbifera JMRC:FSU:9682
emb|CDS08813.1|  Putative Pyridoxine biosynthesis protein PDX1          331   4e-108   Lichtheimia ramosa
emb|CCO08517.1|  Pyridoxal biosynthesis lyase pdxS                      330   4e-108   Desulfotomaculum hydrothermale Lam5 = DSM 18033
gb|EPB86979.1|  pyridoxine biosynthesis protein PDX1                    331   5e-108   Mucor circinelloides f. circinelloides 1006PhL
ref|XP_001878289.1|  predicted protein                                  331   5e-108   Laccaria bicolor S238N-H82
ref|XP_001833418.1|  vitamin B6 biosynthesis protein                    331   6e-108   Coprinopsis cinerea okayama7#130
gb|KDQ60650.1|  hypothetical protein JAAARDRAFT_31620                   331   7e-108   Jaapia argillacea MUCL 33604
ref|WP_027364356.1|  pyridoxal biosynthesis protein                     329   9e-108   Desulfallas alcoholivorax
ref|XP_005767287.1|  pyridoxine biosynthesis protein                    330   9e-108   Emiliania huxleyi CCMP1516
ref|XP_007321372.1|  hypothetical protein SERLADRAFT_474134             330   1e-107   Serpula lacrymans var. lacrymans S7.9
gb|KIK06615.1|  hypothetical protein K443DRAFT_129881                   330   1e-107   Laccaria amethystina LaAM-08-1
gb|KIM87563.1|  hypothetical protein PILCRDRAFT_815117                  330   1e-107   Piloderma croceum F 1598
ref|WP_007290673.1|  pyridoxal biosynthesis protein                     329   1e-107   Sporomusaceae
emb|CCM06234.1|  predicted protein                                      332   2e-107   Fibroporia radiculosa
ref|WP_006520591.1|  pyridoxal biosynthesis protein                     328   2e-107   Desulfallas gibsoniae
ref|WP_011391558.1|  pyridoxal biosynthesis protein                     328   2e-107   Moorella thermoacetica
ref|XP_006657949.1|  PREDICTED: probable pyridoxal biosynthesis p...    328   3e-107   Oryza brachyantha
ref|XP_007395845.1|  hypothetical protein PHACADRAFT_256201             328   4e-107   Phanerochaete carnosa HHB-10118-sp
gb|EMD38488.1|  hypothetical protein CERSUDRAFT_48049                   328   5e-107   Gelatoporia subvermispora B
ref|WP_011876994.1|  pyridoxal biosynthesis protein                     328   5e-107   Desulfotomaculum reducens
gb|KIK45841.1|  hypothetical protein CY34DRAFT_801149                   328   6e-107   Suillus luteus UH-Slu-Lm8-n1
ref|XP_007764305.1|  vitamin B6 biosynthesis protein                    328   8e-107   Coniophora puteana RWD-64-598 SS2
emb|CCA68011.1|  probable Pyridoxine biosynthesis protein PDX1          328   8e-107   Serendipita indica DSM 11827
dbj|GAC74129.1|  stationary phase-induced protein                       328   9e-107   Moesziomyces antarcticus T-34
gb|EPT05956.1|  hypothetical protein FOMPIDRAFT_1021097                 328   9e-107   Fomitopsis pinicola FP-58527 SS1
ref|WP_013558597.1|  pyridoxal biosynthesis protein                     327   1e-106   Anaerolinea thermophila
gb|KIL00667.1|  hypothetical protein PAXRUDRAFT_129369                  328   1e-106   Paxillus rubicundulus Ve08.2h10
ref|XP_007879812.1|  hypothetical protein PFL1_04097                    327   1e-106   Anthracocystis flocculosa PF-1
ref|WP_006520847.1|  pyridoxal biosynthesis protein                     326   2e-106   Desulfallas gibsoniae
ref|XP_005852209.1|  hypothetical protein CHLNCDRAFT_55943              326   2e-106   Chlorella variabilis
ref|XP_003290234.1|  hypothetical protein DICPUDRAFT_95090              326   2e-106   Dictyostelium purpureum
gb|KIJ17199.1|  hypothetical protein PAXINDRAFT_112021                  328   2e-106   Paxillus involutus ATCC 200175
ref|XP_003055856.1|  predicted protein                                  326   2e-106   Micromonas pusilla CCMP1545
gb|KIO26141.1|  hypothetical protein M407DRAFT_243842                   327   2e-106   Tulasnella calospora MUT 4182
ref|XP_007847808.1|  pyridoxine biosynthesis protein                    327   3e-106   
ref|WP_029716204.1|  pyridoxal biosynthesis protein                     325   3e-106   
dbj|GAK66132.1|  vitamin B6 biosynthesis protein                        327   3e-106   Moesziomyces antarcticus
ref|WP_044200896.1|  pyridoxal biosynthesis protein                     325   4e-106   Oscillochloris trichoides
gb|KDR81800.1|  hypothetical protein GALMADRAFT_59193                   327   4e-106   Galerina marginata CBS 339.88
ref|WP_011876406.1|  pyridoxal biosynthesis protein                     325   4e-106   Desulfotomaculum reducens
gb|KIK24956.1|  hypothetical protein PISMIDRAFT_368620                  327   4e-106   Pisolithus microcarpus 441
ref|XP_008036802.1|  vitamin B6 biosynthesis protein                    327   5e-106   Trametes versicolor FP-101664 SS1
emb|CCF50585.1|  probable Pyridoxine biosynthesis protein PDX1          326   5e-106   Ustilago hordei
ref|WP_028308804.1|  pyridoxal biosynthesis protein                     325   5e-106   Desulfitibacter alkalitolerans
emb|CDI54544.1|  probable Pyridoxine biosynthesis protein PDX1          326   6e-106   Melanopsichium pennsylvanicum 4
ref|WP_007937919.1|  MULTISPECIES: pyridoxal biosynthesis protein       325   6e-106   Pelosinus
emb|CEP18624.1|  hypothetical protein                                   325   6e-106   Parasitella parasitica
ref|WP_026369791.1|  pyridoxal biosynthesis protein                     325   7e-106   bacterium JKG1
gb|KFH65130.1|  pyridoxine biosynthesis protein PDX1                    325   8e-106   Mortierella verticillata NRRL 6337
ref|WP_013821172.1|  pyridoxal biosynthesis protein                     325   8e-106   Desulfofundulus salinum
gb|EST08052.1|  putative Pyridoxine biosynthesis protein PDX1           325   9e-106   Kalmanozyma brasiliensis GHG001
gb|KIP09091.1|  hypothetical protein PHLGIDRAFT_68223                   326   9e-106   Phlebiopsis gigantea 11061_1 CR5-6
ref|WP_007953713.1|  pyridoxal biosynthesis protein                     324   1e-105   Pelosinus fermentans
ref|WP_044276923.1|  pyridoxal biosynthesis protein                     323   1e-105   
ref|XP_004340966.1|  thiazole biosynthesis protein ThiG, putative       323   1e-105   Acanthamoeba castellanii str. Neff
gb|KIL69605.1|  hypothetical protein M378DRAFT_7449                     325   2e-105   Amanita muscaria Koide BX008
ref|WP_012191338.1|  pyridoxal 5'-phosphate synthase subunit PdxS       323   2e-105   
ref|XP_002952566.1|  hypothetical protein VOLCADRAFT_109832             323   2e-105   Volvox carteri f. nagariensis
ref|XP_011390262.1|  putative pyridoxine biosynthesis protein SNZ1      325   2e-105   Ustilago maydis 521
gb|EKD04028.1|  hypothetical protein A1Q2_01702                         325   2e-105   Trichosporon asahii var. asahii CBS 8904
emb|CDO70776.1|  hypothetical protein BN946_scf184798.g91               325   2e-105   Trametes cinnabarina
ref|WP_014184905.1|  pyridoxal biosynthesis protein                     323   2e-105   Desulfosporosinus orientis
ref|XP_009542548.1|  hypothetical protein HETIRDRAFT_407635             324   3e-105   Heterobasidion irregulare TC 32-1
ref|XP_009529561.1|  hypothetical protein PHYSODRAFT_354828             323   3e-105   Phytophthora sojae
ref|XP_007301208.1|  vitamin B6 biosynthesis protein                    324   3e-105   Stereum hirsutum FP-91666 SS1
ref|XP_007000890.1|  hypothetical protein TREMEDRAFT_37289              324   3e-105   Tremella mesenterica DSM 1558
emb|CBQ68436.1|  probable Pyridoxine biosynthesis protein PDX1          324   3e-105   Sporisorium reilianum SRZ2
ref|WP_019224893.1|  MULTISPECIES: pyridoxal biosynthesis protein       323   3e-105   Dehalobacter
gb|KDQ16287.1|  hypothetical protein BOTBODRAFT_30991                   324   4e-105   Botryobasidium botryosum FD-172 SS1
emb|CEL55698.1|  pyridoxine biosynthesis protein                        324   4e-105   Rhizoctonia solani AG-1 IB
gb|KIM57605.1|  hypothetical protein SCLCIDRAFT_16920                   324   4e-105   Scleroderma citrinum Foug A
gb|EPX75331.1|  pyridoxine biosynthesis protein                         323   4e-105   Schizosaccharomyces octosporus yFS286
ref|XP_004141845.1|  PREDICTED: pyridoxal 5'-phosphate synthase-l...    322   5e-105   Cucumis sativus [cucumbers]
ref|WP_034376730.1|  pyridoxal 5'-phosphate synthase subunit PdxS       322   6e-105   Dehalococcoides mccartyi
gb|AGK99637.1|  pyridoxal 5''-phosphate synthase, synthase subuni...    322   9e-105   Desulfallas gibsoniae DSM 7213
gb|KIY45616.1|  vitamin B6 biosynthesis protein                         323   1e-104   Fistulina hepatica ATCC 64428
gb|KII88702.1|  hypothetical protein PLICRDRAFT_41913                   323   1e-104   Plicaturopsis crispa FD-325 SS-3
ref|XP_007361004.1|  vitamin B6 biosynthesis protein                    323   1e-104   Dichomitus squalens LYAD-421 SS1
gb|KFH65250.1|  pyridoxine biosynthesis protein PDX1                    322   1e-104   Mortierella verticillata NRRL 6337
ref|XP_006426977.1|  hypothetical protein CICLE_v10026215mg             321   1e-104   
ref|WP_015049188.1|  pyridoxal biosynthesis protein                     321   1e-104   
ref|XP_006465597.1|  PREDICTED: probable pyridoxal biosynthesis p...    322   1e-104   Citrus sinensis [apfelsine]
ref|WP_045646832.1|  pyridoxal biosynthesis protein                     321   1e-104   
gb|KGB78183.1|  pyridoxine biosynthesis protein PDX1                    323   1e-104   Cryptococcus gattii VGII R265
ref|XP_007384845.1|  vitamin B6 biosynthesis protein                    323   2e-104   Punctularia strigosozonata HHB-11173 SS5
ref|WP_027938267.1|  pyridoxal biosynthesis protein                     321   2e-104   Anaeroarcus burkinensis
ref|WP_011957941.1|  pyridoxal 5'-phosphate synthase subunit PdxS       321   2e-104   Roseiflexus sp. RS-1
ref|WP_031516359.1|  pyridoxal biosynthesis protein                     321   2e-104   Desulfohalotomaculum alkaliphilum
ref|WP_014808081.1|  pyridoxal biosynthesis protein                     321   2e-104   Desulfomonile tiedjei
ref|WP_041285055.1|  pyridoxal biosynthesis protein                     321   2e-104   Desulfallas gibsoniae
ref|WP_041424283.1|  hypothetical protein                               321   2e-104   
ref|WP_006717695.1|  pyridoxal biosynthesis protein                     321   2e-104   
ref|WP_038674267.1|  pyridoxal biosynthesis protein                     321   2e-104   
ref|WP_015042082.1|  MULTISPECIES: pyridoxal biosynthesis protein       321   3e-104   
ref|WP_018085993.1|  pyridoxal biosynthesis protein                     320   4e-104   
ref|XP_003077933.1|  Sor-like protein (ISS)                             322   4e-104   
gb|KIR57574.1|  pyridoxal biosynthesis lyase PdxS                       322   4e-104   
ref|WP_015407563.1|  pyridoxal 5'-phosphate synthase subunit PdxS       320   4e-104   
ref|XP_636800.1|  vitamin B6 biosynthesis family protein                320   4e-104   
ref|WP_015406930.1|  pyridoxal biosynthesis lyase PdxS                  320   4e-104   
ref|WP_015759680.1|  pyridoxal biosynthesis protein                     320   4e-104   
ref|NP_594982.1|  pyridoxine biosynthesis protein                       320   5e-104   
gb|KJA20263.1|  hypothetical protein HYPSUDRAFT_217155                  322   5e-104   
ref|XP_002171571.1|  pyridoxine biosynthesis protein                    320   6e-104   
ref|WP_011308905.1|  pyridoxal 5'-phosphate synthase subunit PdxS       320   6e-104   
ref|WP_011928089.1|  pyridoxal biosynthesis protein                     319   8e-104   
ref|WP_018704176.1|  pyridoxal biosynthesis protein                     319   8e-104   
ref|XP_002782052.1|  ethylene-inducible protein hever, putative         319   9e-104   
gb|EWM23151.1|  ethylene-inducible protein                              321   1e-103   
gb|KIR83189.1|  pyridoxal biosynthesis lyase PdxS                       320   1e-103   
gb|KIR44518.1|  pyridoxal biosynthesis lyase PdxS                       320   1e-103   
ref|WP_013623259.1|  pyridoxal biosynthesis protein                     319   1e-103   
gb|ACZ40959.1|  pyridoxine biosynthesis protein                         321   1e-103   
ref|XP_012048341.1|  pyridoxal biosynthesis lyase pdxS                  320   2e-103   
ref|XP_003196859.1|  pyridoxin biosynthesis protein PDX1 (Sor-lik...    320   2e-103   
gb|KIM32492.1|  hypothetical protein M408DRAFT_327038                   320   2e-103   
emb|CCU82976.1|  pyridoxine biosynthesis protein PDX1                   319   2e-103   
ref|XP_002775807.1|  ethylene-inducible protein hever, putative         319   2e-103   
ref|WP_013174219.1|  pyridoxal biosynthesis protein                     318   2e-103   
ref|XP_567591.1|  hypothetical protein                                  320   2e-103   
gb|EPQ62288.1|  hypothetical protein BGT96224_2533                      319   2e-103   
ref|WP_012301172.1|  pyridoxal biosynthesis protein                     318   3e-103   
emb|CCA21099.1|  pyridoxal biosynthesis lyase pdxS putative             318   3e-103   
ref|WP_040378943.1|  pyridoxal biosynthesis protein                     318   4e-103   
ref|WP_012122187.1|  pyridoxal 5'-phosphate synthase subunit PdxS       317   4e-103   
gb|EEG76900.1|  pyridoxine biosynthesis protein                         317   6e-103   
ref|XP_001731011.1|  hypothetical protein MGL_2010                      318   7e-103   
ref|WP_003545758.1|  MULTISPECIES: pyridoxal biosynthesis protein       317   7e-103   
ref|XP_008901515.1|  pyridoxal biosynthesis lyase pdxS                  317   8e-103   
ref|WP_027718876.1|  pyridoxal biosynthesis protein                     317   8e-103   
emb|CCU98387.1|  unnamed protein product                                318   8e-103   
ref|WP_014510110.1|  pyridoxal 5'-phosphate synthase subunit PdxS       317   8e-103   
ref|WP_013781849.1|  pyridoxal biosynthesis protein                     317   9e-103   
ref|XP_002837311.1|  hypothetical protein                               317   9e-103   
ref|WP_016329673.1|  pyridoxal 5''-phosphate synthase, synthase s...    317   9e-103   
ref|WP_034140715.1|  pyridoxal biosynthesis protein                     317   9e-103   
gb|KDQ33852.1|  hypothetical protein PLEOSDRAFT_1052656                 316   1e-102   
dbj|BAL57142.1|  pyridoxine biosynthesis protein                        317   1e-102   
emb|CBJ30310.1|  conserved unknown protein                              317   1e-102   
gb|KIY72906.1|  pyridoxine biosynthesis protein pyroA                   316   1e-102   
emb|CCX12030.1|  Similar to Pyridoxine biosynthesis protein PDX1;...    317   1e-102   
ref|WP_011345556.1|  MULTISPECIES: pyridoxal biosynthesis protein       316   2e-102   
ref|XP_002909070.1|  pyridoxal biosynthesis lyase pdxS                  316   2e-102   
gb|ETM52161.1|  pyridoxal biosynthesis lyase pdxS                       316   2e-102   
ref|WP_013840105.1|  pyridoxal biosynthesis protein                     315   3e-102   
gb|EUC57038.1|  pyridoxine biosynthesis protein PDX1                    317   4e-102   
ref|XP_007411133.1|  hypothetical protein MELLADRAFT_48766              317   5e-102   
gb|KDO35519.1|  pyridoxal biosynthesis lyase pdxS                       315   6e-102   
ref|WP_034103071.1|  pyridoxal biosynthesis protein                     315   8e-102   
ref|WP_003540497.1|  MULTISPECIES: pyridoxal biosynthesis protein       314   8e-102   
ref|XP_003333662.1|  pyridoxine biosynthesis protein                    317   8e-102   
ref|WP_038058981.1|  pyridoxal biosynthesis protein                     314   9e-102   
ref|WP_033161559.1|  pyridoxal biosynthesis lyase PdxS                  314   9e-102   
ref|WP_014453605.1|  pyridoxal biosynthesis protein                     314   9e-102   
ref|XP_009843044.1|  pyridoxal biosynthesis lyase pdxS                  315   9e-102   
ref|WP_014828828.1|  pyridoxal biosynthesis protein                     314   9e-102   
ref|WP_029144073.1|  pyridoxal biosynthesis protein                     314   1e-101   
ref|XP_004346964.2|  vitamin B6 biosynthesis family protein             315   1e-101   
ref|WP_027357443.1|  pyridoxal biosynthesis protein                     314   1e-101   
gb|EFO79454.1|  pyridoxine biosynthesis protein                         313   1e-101   
ref|XP_007586060.1|  putative pyridoxine biosynthesis protein           314   1e-101   
ref|XP_011122468.1|  hypothetical protein AOL_s00079g291                314   1e-101   
ref|WP_012818164.1|  pyridoxal biosynthesis protein                     313   1e-101   
ref|WP_027883046.1|  pyridoxal biosynthesis protein                     313   2e-101   
ref|WP_024119184.1|  pyridoxal 5'-phosphate synthase subunit PdxS       313   2e-101   
ref|WP_011172802.1|  pyridoxal 5'-phosphate synthase subunit PdxS       313   2e-101   
ref|WP_011228134.1|  pyridoxal biosynthesis protein                     313   2e-101   
ref|WP_039458922.1|  pyridoxal biosynthesis protein                     313   2e-101   
gb|EWC47828.1|  pyridoxine biosynthesis protein pyroA                   314   2e-101   
ref|WP_022797851.1|  pyridoxal biosynthesis protein                     313   2e-101   
ref|WP_013704015.1|  pyridoxal biosynthesis protein                     313   3e-101   
gb|EFA76251.1|  vitamin B6 biosynthesis family protein                  313   3e-101   
emb|CCI45834.1|  unnamed protein product                                313   3e-101   
ref|WP_013625825.1|  pyridoxal biosynthesis protein                     313   3e-101   
ref|WP_013118935.1|  pyridoxal biosynthesis protein                     313   3e-101   
ref|WP_012446502.1|  pyridoxal 5'-phosphate synthase subunit PdxS       312   6e-101   
ref|XP_002785179.1|  ethylene-inducible protein hever, putative         312   6e-101   
ref|WP_034124641.1|  pyridoxal biosynthesis protein                     312   6e-101   
ref|WP_022516580.1|  pyridoxal biosynthesis lyase PdxS                  312   8e-101   
ref|XP_008079220.1|  Ribulose-phosphate binding barrel                  312   9e-101   
ref|XP_008462450.1|  PREDICTED: probable pyridoxal biosynthesis p...    311   1e-100   
ref|XP_006677202.1|  hypothetical protein BATDEDRAFT_19038              312   1e-100   
ref|XP_003884703.1|  Ethylene-inducible protein hever, related          312   1e-100   
ref|XP_008868411.1|  pyridoxal biosynthesis lyase pdxS                  312   1e-100   
ref|WP_035165208.1|  pyridoxal biosynthesis protein                     311   1e-100   
gb|EPZ36570.1|  putative pyridoxine biosynthesis protein pdx1           311   1e-100   
ref|WP_012881658.1|  pyridoxal biosynthesis protein                     311   2e-100   
ref|WP_010936159.1|  pyridoxal 5'-phosphate synthase subunit PdxS       311   2e-100   
gb|KHJ32674.1|  putative pyridoxine biosynthesis protein                311   2e-100   
ref|WP_003044682.1|  pyridoxal biosynthesis protein                     311   2e-100   
gb|ADM95007.1|  pyridoxine biosynthesis enzyme                          311   2e-100   
ref|WP_014629859.1|  pyridoxal biosynthesis protein                     310   2e-100   
ref|WP_014515921.1|  pyridoxal biosynthesis protein                     310   2e-100   
ref|WP_028323474.1|  pyridoxal biosynthesis protein                     310   2e-100   
gb|AHB13088.1|  pyridoxine biosynthesis protein                         310   2e-100   
ref|WP_029717943.1|  pyridoxal biosynthesis protein                     310   2e-100   
ref|XP_008607385.1|  pyridoxal biosynthesis lyase pdxS                  311   2e-100   
ref|WP_026486074.1|  pyridoxal biosynthesis protein                     310   3e-100   
dbj|GAC93246.1|  hypothetical protein PHSY_000810                       310   3e-100   
ref|WP_019226003.1|  MULTISPECIES: pyridoxal biosynthesis protein       310   3e-100   
ref|WP_038261293.1|  pyridoxal biosynthesis protein [                   310   3e-100   
ref|WP_016483934.1|  pyridoxal phosphate synthase yaaD subunit          310   4e-100   
gb|KFY64519.1|  hypothetical protein V496_03208                         310   4e-100   
ref|XP_001390309.1|  pyridoxine biosynthesis protein pyroA              310   4e-100   
ref|XP_005836425.1|  hypothetical protein GUITHDRAFT_159450             310   5e-100   
ref|WP_022264507.1|  pyridoxal biosynthesis lyase PdxS                  310   5e-100   
gb|KJS14570.1|  pyridoxal biosynthesis protein                          309   5e-100   
ref|WP_013276926.1|  pyridoxal biosynthesis protein                     309   7e-100   
ref|WP_038065903.1|  pyridoxal biosynthesis protein                     309   7e-100   
ref|XP_007872144.1|  hypothetical protein PNEG_00272                    310   7e-100   
ref|WP_029955006.1|  pyridoxal biosynthesis protein                     309   9e-100   
ref|WP_038960612.1|  pyridoxal biosynthesis protein                     309   1e-99    
ref|WP_034419943.1|  pyridoxal biosynthesis protein                     309   1e-99    
ref|WP_026175176.1|  pyridoxal biosynthesis protein                     309   1e-99    
ref|WP_012282229.1|  pyridoxal 5'-phosphate synthase subunit PdxS       309   1e-99    
gb|ETR72978.1|  Pyridoxal biosynthesis lyase pdxS                       309   1e-99    
gb|KIM49428.1|  hypothetical protein M413DRAFT_438608                   308   1e-99    
ref|WP_028493967.1|  pyridoxal biosynthesis protein                     308   1e-99    
ref|WP_038046023.1|  pyridoxal biosynthesis protein                     308   2e-99    
ref|WP_026328982.1|  MULTISPECIES: pyridoxal biosynthesis protein       308   2e-99    
dbj|GAM23022.1|  hypothetical protein SAMD00019534_061970               309   2e-99    
ref|WP_027893120.1|  pyridoxal biosynthesis protein                     308   2e-99    
ref|XP_002565509.1|  Pc22g15930                                         308   2e-99    
gb|ELU40995.1|  vitamin B6 biosynthesis protein                         309   2e-99    
ref|WP_021937653.1|  pyridoxal biosynthesis lyase PdxS                  308   3e-99    
ref|WP_015717440.1|  MULTISPECIES: pyridoxal biosynthesis protein       308   3e-99    
ref|WP_026234234.1|  pyridoxal biosynthesis protein                     308   3e-99    
gb|KFZ15909.1|  hypothetical protein V502_05335                         308   3e-99    
ref|WP_015043798.1|  MULTISPECIES: pyridoxal biosynthesis protein       308   3e-99    
ref|WP_045575873.1|  pyridoxal biosynthesis protein                     308   3e-99    
ref|WP_038071717.1|  pyridoxal biosynthesis protein                     307   4e-99    
ref|WP_045574324.1|  pyridoxal biosynthesis protein                     307   4e-99    
gb|EKV12547.1|  Pyridoxine biosynthesis protein pyroA                   308   4e-99    
dbj|BAJ98399.1|  predicted protein                                      308   5e-99    
ref|WP_014186639.1|  pyridoxal biosynthesis protein                     307   6e-99    
ref|WP_027438784.1|  pyridoxal biosynthesis lyase PdxS                  307   6e-99    
gb|KIN06181.1|  hypothetical protein OIDMADRAFT_141797                  307   6e-99    
ref|WP_034141167.1|  pyridoxal biosynthesis protein                     307   7e-99    
dbj|GAA91301.1|  pyridoxine biosynthesis protein PDX1                   307   8e-99    
ref|WP_006930022.1|  pyridoxal biosynthesis protein                     306   9e-99    
ref|WP_014825145.1|  pyridoxal biosynthesis protein                     306   1e-98    
ref|WP_036946883.1|  pyridoxal biosynthesis protein                     306   1e-98    
ref|WP_021169502.1|  pyridoxal biosynthesis lyase PdxS                  306   1e-98    
ref|WP_012740712.1|  MULTISPECIES: pyridoxal biosynthesis lyase         306   1e-98    
gb|KIW09488.1|  pyridoxine biosynthesis protein pyroA                   306   2e-98    
ref|WP_008678539.1|  pyridoxal biosynthesis protein                     306   2e-98    
gb|KDN52762.1|  vitamin B6 biosynthesis protein                         308   2e-98    
ref|WP_022502089.1|  pyridoxal biosynthesis lyase PdxS                  305   2e-98    
gb|EPY53146.1|  pyridoxine biosynthesis protein                         305   2e-98    
gb|KFX87781.1|  hypothetical protein O988_09291                         306   2e-98    
gb|EDR98910.1|  pyridoxal 5'-phosphate synthase, synthase subunit...    305   2e-98    
ref|WP_039946240.1|  pyridoxal biosynthesis lyase PdxS                  305   2e-98    
gb|KJJ23465.1|  Vitamin B6 biosynthesis protein                         306   3e-98    
ref|XP_680994.1|  hypothetical protein AN7725.2                         306   3e-98    
ref|WP_021740360.1|  MULTISPECIES: pyridoxal 5'-phosphate synthas...    305   3e-98    
ref|WP_041702056.1|  pyridoxal biosynthesis protein                     305   3e-98    
ref|WP_031578048.1|  pyridoxal biosynthesis lyase PdxS                  305   3e-98    
ref|WP_028819307.1|  pyridoxal biosynthesis protein                     305   3e-98    
ref|WP_018204609.1|  pyridoxal biosynthesis protein                     305   3e-98    
ref|WP_004033648.1|  MULTISPECIES: pyridoxal biosynthesis protein       305   3e-98    
gb|KEQ96771.1|  hypothetical protein AUEXF2481DRAFT_63973               305   4e-98    
ref|WP_022428117.1|  pyridoxal biosynthesis lyase PdxS                  305   4e-98    
gb|EMS19547.1|  pyridoxine biosynthesis protein                         305   4e-98    
ref|WP_022118464.1|  pyridoxal biosynthesis lyase PdxS                  305   4e-98    
gb|AFS78785.1|  pyridoxal biosynthesis lyase PdxS [ [                   305   4e-98    
ref|WP_012861631.1|  pyridoxal biosynthesis lyase                       305   4e-98    
gb|EEG30152.1|  pyridoxal 5'-phosphate synthase, synthase subunit...    305   4e-98    
ref|XP_008885433.1|  ethylene inducible protein, putative               305   4e-98    
ref|XP_004355239.1|  vitamin B6 biosynthesis family protein             304   4e-98    
ref|XP_007690595.1|  hypothetical protein COCMIDRAFT_28574              305   4e-98    
gb|EPT26615.1|  ethylene inducible protein, putative                    305   4e-98    
ref|WP_014354927.1|  pyridoxal biosynthesis lyase                       305   5e-98    
ref|WP_027430124.1|  pyridoxal biosynthesis lyase PdxS                  305   5e-98    
ref|WP_013413443.1|  pyridoxal biosynthesis protein                     305   5e-98    
ref|WP_018466229.1|  pyridoxal biosynthesis protein                     305   5e-98    
ref|XP_007697322.1|  hypothetical protein COCSADRAFT_292879             305   5e-98    
gb|KGO36038.1|  Vitamin B6 biosynthesis protein                         305   5e-98    
ref|WP_011994875.1|  pyridoxal biosynthesis protein                     304   6e-98    
ref|WP_022207868.1|  pyridoxal biosynthesis lyase PdxS                  304   6e-98    
ref|WP_025436978.1|  pyridoxal biosynthesis protein                     304   7e-98    
gb|KFY23758.1|  hypothetical protein V493_05659                         306   7e-98    
gb|EPR60106.1|  putative ethylene inducible protein                     305   8e-98    
ref|WP_029720248.1|  pyridoxal biosynthesis lyase PdxS                  305   8e-98    
ref|WP_039635330.1|  pyridoxal biosynthesis lyase PdxS                  304   8e-98    
ref|XP_002183347.1|  predicted protein                                  305   9e-98    
ref|WP_005813582.1|  pyridoxal 5'-phosphate synthase subunit PdxS       304   9e-98    
ref|WP_036749371.1|  pyridoxal biosynthesis protein                     304   9e-98    
ref|WP_025561830.1|  MULTISPECIES: pyridoxal biosynthesis protein       304   1e-97    
gb|KEQ71109.1|  pyridoxine biosynthesis protein PDX1                    304   1e-97    
ref|XP_001823527.1|  pyridoxine biosynthesis protein pyroA              304   1e-97    
ref|XP_007707595.1|  hypothetical protein COCCADRAFT_32756              304   1e-97    
ref|WP_022750097.1|  pyridoxal biosynthesis lyase                       303   1e-97    
ref|WP_009288874.1|  MULTISPECIES: pyridoxal biosynthesis lyase         303   1e-97    
ref|WP_014182602.1|  pyridoxal biosynthesis protein                     303   1e-97    
ref|WP_027114483.1|  MULTISPECIES: pyridoxal biosynthesis lyase PdxS    303   1e-97    
ref|WP_033191603.1|  pyridoxal biosynthesis protein                     303   2e-97    
ref|WP_043883813.1|  pyridoxal 5'-phosphate synthase subunit PdxS       303   2e-97    
ref|WP_014452498.1|  pyridoxal biosynthesis protein                     303   2e-97    
ref|WP_035798974.1|  pyridoxal biosynthesis lyase PdxS                  303   2e-97    
ref|WP_012858975.1|  pyridoxal biosynthesis lyase                       303   2e-97    
dbj|GAA93993.1|  hypothetical protein E5Q_00640                         305   2e-97    
gb|KFY72913.1|  hypothetical protein V499_06955                         304   2e-97    
ref|WP_027876594.1|  pyridoxal biosynthesis protein                     303   2e-97    
ref|WP_018250232.1|  pyridoxal biosynthesis protein                     303   2e-97    
ref|WP_022204882.1|  pyridoxal biosynthesis lyase PdxS                  303   2e-97    
ref|WP_028263022.1|  pyridoxal biosynthesis protein                     303   2e-97    
ref|WP_011991020.1|  pyridoxal biosynthesis protein                     303   2e-97    
emb|CDM36033.1|  Pyridoxine biosynthesis protein pyroA                  303   2e-97    
ref|WP_024728193.1|  pyridoxal biosynthesis lyase PdxS                  303   2e-97    
ref|WP_014094687.1|  pyridoxal biosynthesis lyase                       303   2e-97    
ref|WP_022399050.1|  pyridoxal biosynthesis lyase PdxS                  303   2e-97    



>ref|XP_009591291.1| PREDICTED: probable pyridoxal biosynthesis protein PDX1.2 [Nicotiana 
tomentosiformis]
Length=306

 Score =   531 bits (1369),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/291 (86%), Positives = 273/291 (94%), Gaps = 0/291 (0%)
 Frame = -1

Query  980  MAEDGAVTVYSGSAITDAKKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIV  801
            M EDGAVTVYSGSAITD KKNPFSIKVG+AQMLRGGAI EVTTVDQAKIAESAGACC++V
Sbjct  1    MEEDGAVTVYSGSAITDTKKNPFSIKVGLAQMLRGGAIAEVTTVDQAKIAESAGACCLVV  60

Query  800  SEPDSRGISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLAIA  621
            SEP   GISRM DP+LIKEIK+AVSIPVMAK+RVGHFVEAQILE +G DY+DESE+LA+A
Sbjct  61   SEPIGPGISRMADPSLIKEIKQAVSIPVMAKARVGHFVEAQILEAIGADYVDESEVLALA  120

Query  620  DEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKVMG  441
            DEDHFINKHNFR PFVCG RDLGEALRRVREGAAMIRTQGDL G+GNIVDTVR+VRKVMG
Sbjct  121  DEDHFINKHNFRAPFVCGCRDLGEALRRVREGAAMIRTQGDLLGTGNIVDTVRNVRKVMG  180

Query  440  DIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQLGC  261
            D+RVL+NMDEDEVF FSKKI+APYDIV QTKQM RLPVVHFA+GGIVTPADAA+MMQLGC
Sbjct  181  DVRVLSNMDEDEVFTFSKKISAPYDIVAQTKQMGRLPVVHFAAGGIVTPADAALMMQLGC  240

Query  260  DGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            DG+FLGP++FNCSDPYKKV AIVQAVRNYNDPH+LA ASSGLE+AM GLNL
Sbjct  241  DGVFLGPDIFNCSDPYKKVRAIVQAVRNYNDPHILAAASSGLEEAMGGLNL  291



>ref|XP_009796117.1| PREDICTED: probable pyridoxal biosynthesis protein PDX1.2 [Nicotiana 
sylvestris]
Length=306

 Score =   528 bits (1360),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/291 (86%), Positives = 272/291 (93%), Gaps = 0/291 (0%)
 Frame = -1

Query  980  MAEDGAVTVYSGSAITDAKKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIV  801
            M EDGAVTVYSGSAITD KKNPFSIKVG+AQMLRGGAI EVTTVDQAKIAESAGACC++V
Sbjct  1    MEEDGAVTVYSGSAITDTKKNPFSIKVGLAQMLRGGAIAEVTTVDQAKIAESAGACCLVV  60

Query  800  SEPDSRGISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLAIA  621
            SEP   GISRM DP+LIKEIK+AVSIPVMAK+RVGHFVEAQILE +G DY+DESE+LA+A
Sbjct  61   SEPKGPGISRMADPSLIKEIKQAVSIPVMAKARVGHFVEAQILEAIGADYVDESEVLALA  120

Query  620  DEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKVMG  441
            DEDHFINKHNFR PFVCG  DLGEALRRVREGAAMIRTQGDL G+GNIV+TVR+VRKVMG
Sbjct  121  DEDHFINKHNFRAPFVCGCCDLGEALRRVREGAAMIRTQGDLLGTGNIVETVRNVRKVMG  180

Query  440  DIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQLGC  261
            DIRVL+NMDEDEVF FSKKI+APYDIV QTKQM RLPVVHFA+GGIVTPADAA+MMQLGC
Sbjct  181  DIRVLSNMDEDEVFTFSKKISAPYDIVAQTKQMGRLPVVHFAAGGIVTPADAALMMQLGC  240

Query  260  DGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            DG+FLGP++FNCSDPYKKV AIVQAVRNYNDPH+LA ASSGLE+AM GLNL
Sbjct  241  DGVFLGPDIFNCSDPYKKVRAIVQAVRNYNDPHILAAASSGLEEAMGGLNL  291



>ref|XP_004235714.1| PREDICTED: probable pyridoxal biosynthesis protein PDX1.2 [Solanum 
lycopersicum]
Length=305

 Score =   518 bits (1333),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 243/291 (84%), Positives = 270/291 (93%), Gaps = 0/291 (0%)
 Frame = -1

Query  980  MAEDGAVTVYSGSAITDAKKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIV  801
            M EDGAVTVYSGSAITD KKN FSIKVGIAQMLRGGAI EVTTV+QAKIAESAG CC++V
Sbjct  1    MEEDGAVTVYSGSAITDTKKNSFSIKVGIAQMLRGGAIAEVTTVNQAKIAESAGVCCLVV  60

Query  800  SEPDSRGISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLAIA  621
            SEP   GISRMPDP+LIKEIK+AV++PVMAK+RVGHFVEAQILE +GVDYIDESE+LA+A
Sbjct  61   SEPKGPGISRMPDPSLIKEIKQAVALPVMAKARVGHFVEAQILEAIGVDYIDESEILALA  120

Query  620  DEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKVMG  441
            DEDHF+NKHNFR PFVCG RDLGEALRRVREGAAM+RTQGDL G+G+IVDTV +VRKVMG
Sbjct  121  DEDHFVNKHNFRAPFVCGCRDLGEALRRVREGAAMVRTQGDLAGTGSIVDTVHNVRKVMG  180

Query  440  DIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQLGC  261
            DIR+L+NMD+DEVF FSKKI APYDIV QTKQM RLPVVHFA+GGIVTPADAA+MMQLGC
Sbjct  181  DIRILSNMDDDEVFTFSKKIGAPYDIVAQTKQMGRLPVVHFAAGGIVTPADAALMMQLGC  240

Query  260  DGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            DG+F+G ++FNCSDPYKKV AIVQAVRNYNDPH+LA ASSGLE+AM GLNL
Sbjct  241  DGVFVGSDIFNCSDPYKKVRAIVQAVRNYNDPHILAAASSGLEEAMGGLNL  291



>ref|XP_006341676.1| PREDICTED: probable pyridoxal biosynthesis protein PDX1.2-like 
[Solanum tuberosum]
Length=305

 Score =   516 bits (1328),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 242/291 (83%), Positives = 268/291 (92%), Gaps = 0/291 (0%)
 Frame = -1

Query  980  MAEDGAVTVYSGSAITDAKKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIV  801
            M EDGAVTVYSGSAITD KKN FSIKVGIAQMLRGGAI EVTTV+QAKIAESAG CC++V
Sbjct  1    MEEDGAVTVYSGSAITDTKKNTFSIKVGIAQMLRGGAIAEVTTVNQAKIAESAGVCCLVV  60

Query  800  SEPDSRGISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLAIA  621
            SEP   GISRMPDP+LIKEIK+AV++PVMAK+RVGHFVEAQILE +GVDYIDESE LA+A
Sbjct  61   SEPKGPGISRMPDPSLIKEIKQAVALPVMAKARVGHFVEAQILEAIGVDYIDESETLALA  120

Query  620  DEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKVMG  441
            DEDHF+NKHNFR PFVCG RDLGEALRRVREGAAM+RTQGDL G+G+IVDTV +VRKVMG
Sbjct  121  DEDHFVNKHNFRAPFVCGCRDLGEALRRVREGAAMVRTQGDLAGTGSIVDTVHNVRKVMG  180

Query  440  DIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQLGC  261
            DIR+L+NMD+DEVF FSKKI APYDIV QTKQM RLPVVHFA+GGIVTPADAA MMQLGC
Sbjct  181  DIRILSNMDDDEVFTFSKKIGAPYDIVAQTKQMGRLPVVHFAAGGIVTPADAAFMMQLGC  240

Query  260  DGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            DG+F+G ++FNCS+PYKKV AIVQAVRNYNDPH+LA ASSGLE+AM GLNL
Sbjct  241  DGVFIGSDIFNCSNPYKKVRAIVQAVRNYNDPHILAAASSGLEEAMGGLNL  291



>ref|XP_011080804.1| PREDICTED: probable pyridoxal biosynthesis protein PDX1.2 [Sesamum 
indicum]
Length=305

 Score =   513 bits (1322),  Expect = 6e-180, Method: Compositional matrix adjust.
 Identities = 247/291 (85%), Positives = 271/291 (93%), Gaps = 0/291 (0%)
 Frame = -1

Query  980  MAEDGAVTVYSGSAITDAKKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIV  801
            MA+D AVT+YS +AITDAKKNPFSIKV +AQMLRGGAIVEVT++DQAKIAESAGACCVIV
Sbjct  1    MADDNAVTLYSSAAITDAKKNPFSIKVAMAQMLRGGAIVEVTSLDQAKIAESAGACCVIV  60

Query  800  SEPDSRGISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLAIA  621
            S+P   GISRMPDP+LIKEIK+A+SIPVMAK+RVGHFVEAQILE++GVDYIDESE LAIA
Sbjct  61   SDPRRAGISRMPDPSLIKEIKQALSIPVMAKARVGHFVEAQILESIGVDYIDESEALAIA  120

Query  620  DEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKVMG  441
            DEDHFINKHNFRV FVCG  DLGEALRRVREGAA+IRTQGDL GSGN+++ VR VRKVMG
Sbjct  121  DEDHFINKHNFRVTFVCGCHDLGEALRRVREGAALIRTQGDLKGSGNVMEAVRYVRKVMG  180

Query  440  DIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQLGC  261
            +IRVLNNMDEDEVFAFSK+I APYDIV QTKQM RLPVVHFA+GGIVTPADAA+MMQLGC
Sbjct  181  EIRVLNNMDEDEVFAFSKRIQAPYDIVAQTKQMGRLPVVHFAAGGIVTPADAALMMQLGC  240

Query  260  DGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            DG+FLGPEVF+C DPYKKV AIVQAVRNYNDP  LA+ASSGLEDAMAGLNL
Sbjct  241  DGVFLGPEVFDCLDPYKKVRAIVQAVRNYNDPMELAEASSGLEDAMAGLNL  291



>emb|CDO98042.1| unnamed protein product [Coffea canephora]
Length=309

 Score =   503 bits (1295),  Expect = 8e-176, Method: Compositional matrix adjust.
 Identities = 241/294 (82%), Positives = 271/294 (92%), Gaps = 3/294 (1%)
 Frame = -1

Query  980  MAEDGAVTVYSGSAITDA---KKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACC  810
            MA+DGAVTVY GSAITDA   KKNPFSIKVG+ QMLRGGAIVEV+++DQAKIAESAGACC
Sbjct  1    MADDGAVTVYGGSAITDATAAKKNPFSIKVGMVQMLRGGAIVEVSSMDQAKIAESAGACC  60

Query  809  VIVSEPDSRGISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELL  630
            V+VSEP++ GISRMPDP+LIKEIK +++IP++A++RVGHFVEAQILE VGVDYIDESE+L
Sbjct  61   VLVSEPNTSGISRMPDPSLIKEIKGSIAIPIVARARVGHFVEAQILEAVGVDYIDESEVL  120

Query  629  AIADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRK  450
            AIADEDHFINKHNFR PFVCG RDLGEALRRVREGAA+IRTQGDL GSGNIV+TV +VRK
Sbjct  121  AIADEDHFINKHNFRAPFVCGCRDLGEALRRVREGAALIRTQGDLRGSGNIVETVGNVRK  180

Query  449  VMGDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQ  270
            VMGDIRVLNNMD+DEVF FSKKI APYDIV Q KQM RLPVVHFA+GGIVTPADAA+MMQ
Sbjct  181  VMGDIRVLNNMDDDEVFTFSKKIQAPYDIVAQAKQMGRLPVVHFAAGGIVTPADAALMMQ  240

Query  269  LGCDGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            LGCDG+FLG +VF+C DPYK+V AIVQAVRNYNDP +LA+ASS LED +AGLNL
Sbjct  241  LGCDGVFLGSDVFDCPDPYKRVRAIVQAVRNYNDPVILAEASSALEDTLAGLNL  294



>ref|XP_006465598.1| PREDICTED: probable pyridoxal biosynthesis protein PDX1.2-like 
[Citrus sinensis]
Length=304

 Score =   492 bits (1266),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 228/291 (78%), Positives = 265/291 (91%), Gaps = 0/291 (0%)
 Frame = -1

Query  980  MAEDGAVTVYSGSAITDAKKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIV  801
            MAEDGAVTVYSGSAITDAKKNPFSIK G+AQMLRGGAIVEV++V+QAKIAE+AGAC ++V
Sbjct  1    MAEDGAVTVYSGSAITDAKKNPFSIKAGLAQMLRGGAIVEVSSVEQAKIAEAAGACSIMV  60

Query  800  SEPDSRGISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLAIA  621
            SEP   GI RMPDP+L+K +KRAVS+PVM++ RVGHFVEAQILE++G+DYIDESE+L +A
Sbjct  61   SEPSRPGIKRMPDPSLVKSVKRAVSVPVMSRVRVGHFVEAQILESIGLDYIDESEVLGLA  120

Query  620  DEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKVMG  441
            DE +FINKHNFR PFVCG R+LGEALRR+REGAAMIR QGDL  SGNIV+TV++VR +MG
Sbjct  121  DEYNFINKHNFRFPFVCGCRNLGEALRRIREGAAMIRIQGDLLNSGNIVETVKNVRSLMG  180

Query  440  DIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQLGC  261
            DIR+LNNMDEDEVF F+KKIAAPYD+V QTKQM RLPVV FA+GG+VTPADAA+MMQLGC
Sbjct  181  DIRILNNMDEDEVFTFAKKIAAPYDLVAQTKQMGRLPVVQFAAGGVVTPADAALMMQLGC  240

Query  260  DGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            DG+F+G EVF CSDPYKKV  IVQAVR+YNDPHVL ++S GLEDAMAG+NL
Sbjct  241  DGVFVGSEVFECSDPYKKVRGIVQAVRHYNDPHVLVESSCGLEDAMAGINL  291



>ref|XP_006426976.1| hypothetical protein CICLE_v10026152mg [Citrus clementina]
 gb|ESR40216.1| hypothetical protein CICLE_v10026152mg [Citrus clementina]
Length=304

 Score =   490 bits (1261),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 227/291 (78%), Positives = 264/291 (91%), Gaps = 0/291 (0%)
 Frame = -1

Query  980  MAEDGAVTVYSGSAITDAKKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIV  801
            MAEDGAVTVY GSAITDAKKNPFSIK G+AQMLRGGAIVEV++V+QAKIAE+AGAC ++V
Sbjct  1    MAEDGAVTVYGGSAITDAKKNPFSIKAGLAQMLRGGAIVEVSSVEQAKIAEAAGACSIMV  60

Query  800  SEPDSRGISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLAIA  621
            SEP   GI RMPDP+L+K +KRAVS+PVM++ RVGHFVEAQILE++G+DYIDESE+L +A
Sbjct  61   SEPSRPGIKRMPDPSLVKSVKRAVSVPVMSRVRVGHFVEAQILESIGLDYIDESEVLGLA  120

Query  620  DEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKVMG  441
            DE +FINKHNFR PFVCG R+LGEALRR+REGAAMIR QGDL  SGNIV+TV++VR +MG
Sbjct  121  DEYNFINKHNFRFPFVCGCRNLGEALRRIREGAAMIRIQGDLLNSGNIVETVKNVRSLMG  180

Query  440  DIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQLGC  261
            DIR+LNNMDEDEVF F+KKIAAPYD+V QTKQM RLPVV FA+GG+VTPADAA+MMQLGC
Sbjct  181  DIRILNNMDEDEVFTFAKKIAAPYDLVAQTKQMGRLPVVQFAAGGVVTPADAALMMQLGC  240

Query  260  DGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            DG+F+G EVF CSDPYKKV  IVQAVR+YNDPHVL ++S GLEDAMAG+NL
Sbjct  241  DGVFVGSEVFECSDPYKKVRGIVQAVRHYNDPHVLVESSCGLEDAMAGINL  291



>ref|XP_007024157.1| Pyridoxine biosynthesis 1.2 [Theobroma cacao]
 gb|EOY26779.1| Pyridoxine biosynthesis 1.2 [Theobroma cacao]
Length=356

 Score =   491 bits (1264),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 229/292 (78%), Positives = 269/292 (92%), Gaps = 1/292 (0%)
 Frame = -1

Query  980  MAEDGAVTVYSGSAITDAKKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIV  801
            MAEDGAVT+Y+ +AITDAKKN FSIKVG+AQMLRGGAI++V+T+ QAKIAE AGACC+++
Sbjct  1    MAEDGAVTLYNNTAITDAKKNSFSIKVGMAQMLRGGAILQVSTLSQAKIAEEAGACCLVL  60

Query  800  SEPDSRGISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLAIA  621
            +EP+ +GISRMPDP+LIK+IKR VS+PVMA+SR+GHFVEAQILE VGVDYIDESE+LAIA
Sbjct  61   TEPNCQGISRMPDPSLIKQIKRTVSVPVMARSRIGHFVEAQILERVGVDYIDESEVLAIA  120

Query  620  DEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKVMG  441
            DED+FINKHNF  PFVCG ++LGEALRRVREGAAMIRTQGDL G+GNI +TV++VR VMG
Sbjct  121  DEDNFINKHNFICPFVCGCKNLGEALRRVREGAAMIRTQGDLLGTGNIAETVKNVRSVMG  180

Query  440  DIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQLGC  261
            +IRVLNNMDEDEVFAFSKKIAAPYD+V QTKQM RLPVVHFA+GGI+TPADAA+MMQLGC
Sbjct  181  EIRVLNNMDEDEVFAFSKKIAAPYDLVAQTKQMGRLPVVHFAAGGILTPADAALMMQLGC  240

Query  260  DGIFLGPEVF-NCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            DG+F+G EVF NCSDPYK+V  IV+AVR+YNDPHVL + S GLE+ MAGLN+
Sbjct  241  DGVFVGSEVFDNCSDPYKRVRGIVEAVRHYNDPHVLVENSCGLEEEMAGLNV  292



>gb|EYU24698.1| hypothetical protein MIMGU_mgv1a027113mg [Erythranthe guttata]
Length=305

 Score =   489 bits (1258),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 242/293 (83%), Positives = 266/293 (91%), Gaps = 2/293 (1%)
 Frame = -1

Query  980  MAEDGAVTVY-SGSAITDA-KKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCV  807
            MA+D AVT+Y S  AITDA KKNPFSIKV +AQMLRGGAIVEVTT+DQA+IAESAGACCV
Sbjct  1    MADDNAVTLYNSNPAITDAAKKNPFSIKVAMAQMLRGGAIVEVTTLDQARIAESAGACCV  60

Query  806  IVSEPDSRGISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLA  627
            +VS+P   GISRMPDP+LIKEIKRAV+IPVMAKSRVGHFVEAQILE++GVDYIDESE LA
Sbjct  61   VVSDPRKPGISRMPDPSLIKEIKRAVTIPVMAKSRVGHFVEAQILESIGVDYIDESEALA  120

Query  626  IADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKV  447
             ADEDHFINKHNF V FVCG RDLGEAL RVREGAA+IRTQGDL+ SG+IV TVRSVRKV
Sbjct  121  FADEDHFINKHNFGVAFVCGCRDLGEALIRVREGAALIRTQGDLSRSGDIVQTVRSVRKV  180

Query  446  MGDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQL  267
            MG+IRVLNNMD+DEVFAFSK+I APYDIV QTKQM RLPVVHFA+GGI TPADAA+MMQL
Sbjct  181  MGEIRVLNNMDDDEVFAFSKRIRAPYDIVAQTKQMGRLPVVHFAAGGISTPADAALMMQL  240

Query  266  GCDGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            GCDG+FL  EVF+C DPYKKV AIVQAVRNYNDP  LA+ASSGLE+AMAGLN+
Sbjct  241  GCDGVFLESEVFDCLDPYKKVRAIVQAVRNYNDPLELAQASSGLEEAMAGLNV  293



>gb|KJB70474.1| hypothetical protein B456_011G075300 [Gossypium raimondii]
Length=302

 Score =   486 bits (1252),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 227/292 (78%), Positives = 266/292 (91%), Gaps = 1/292 (0%)
 Frame = -1

Query  980  MAEDGAVTVYSGSAITDAKKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIV  801
            MAEDG VT+Y+ +AITD KKNP SIKVG+ QMLRGGAI+EV+  +QAKIAE AGACC+++
Sbjct  1    MAEDGVVTLYNNTAITDTKKNPVSIKVGLTQMLRGGAILEVSNTNQAKIAEEAGACCLVI  60

Query  800  SEPDSRGISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLAIA  621
            +EP+ +GISRMPDPALIK+IKRAVSIP+M++SR+GHFVEAQILE VGVDYIDE+E+LAIA
Sbjct  61   TEPNRQGISRMPDPALIKQIKRAVSIPIMSRSRIGHFVEAQILERVGVDYIDENEVLAIA  120

Query  620  DEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKVMG  441
            DE +FINKHNFR PFVCG R+LGEALRRVREGAAMIRTQGDL+G+GNIV+TV++VR VMG
Sbjct  121  DEFNFINKHNFRCPFVCGCRNLGEALRRVREGAAMIRTQGDLSGTGNIVETVKNVRCVMG  180

Query  440  DIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQLGC  261
            +IR+LNNMDEDEVFAFSKKIAAPYD+V QTKQM RLPVVHFA+GGIVTPADAA+MMQLGC
Sbjct  181  EIRILNNMDEDEVFAFSKKIAAPYDLVAQTKQMGRLPVVHFAAGGIVTPADAALMMQLGC  240

Query  260  DGIFLGPEVF-NCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            DG+F+G EVF NCSD YK+V  IV+AVR+YNDPHVL + S GLE  MAGLN+
Sbjct  241  DGVFVGSEVFDNCSDSYKRVRGIVEAVRHYNDPHVLVENSCGLEGEMAGLNV  292



>ref|XP_010098060.1| putative pyridoxal biosynthesis protein [Morus notabilis]
 gb|EXB74497.1| putative pyridoxal biosynthesis protein [Morus notabilis]
Length=307

 Score =   484 bits (1246),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 230/294 (78%), Positives = 263/294 (89%), Gaps = 3/294 (1%)
 Frame = -1

Query  980  MAEDGAVTVYSGSAITDAKKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIV  801
            MAEDGAVT+Y+ SAITDAKKNPFSIKVG+AQMLRGGAI+EVT VDQAK+AE AGAC ++V
Sbjct  1    MAEDGAVTLYNSSAITDAKKNPFSIKVGMAQMLRGGAILEVTNVDQAKLAEEAGACAILV  60

Query  800  SEPDSR---GISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELL  630
            SEP +R   GISRM DP+LIKEIKR+VSIPV+A+SRVGHFVEAQILE + VDYIDESE L
Sbjct  61   SEPANRRRGGISRMSDPSLIKEIKRSVSIPVVARSRVGHFVEAQILEAINVDYIDESEAL  120

Query  629  AIADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRK  450
            A+ADE++FINKHNFR PF+CG R+LGEAL RVREGAAM+RTQGDL+GSGN+ +TV+SVR 
Sbjct  121  ALADEENFINKHNFRAPFICGCRNLGEALTRVREGAAMVRTQGDLSGSGNVAETVKSVRS  180

Query  449  VMGDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQ  270
            VMG+IRVLNNMDEDEVFAFSKKI+APYD+V QTKQM RLPVV FA GGIVTPADAA+MMQ
Sbjct  181  VMGEIRVLNNMDEDEVFAFSKKISAPYDLVAQTKQMGRLPVVQFAGGGIVTPADAALMMQ  240

Query  269  LGCDGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            LGCDG+F+G E FN  DPYK+V  IVQAVR+YNDPHVL + S GL DAMAGL+L
Sbjct  241  LGCDGVFVGSETFNSPDPYKRVRGIVQAVRHYNDPHVLVETSCGLADAMAGLSL  294



>gb|KJB56744.1| hypothetical protein B456_009G134000 [Gossypium raimondii]
Length=362

 Score =   485 bits (1248),  Expect = 8e-168, Method: Compositional matrix adjust.
 Identities = 229/305 (75%), Positives = 271/305 (89%), Gaps = 1/305 (0%)
 Frame = -1

Query  1019  VVSLAHCTEHFAEMAEDGAVTVYSGSAITDAKKNPFSIKVGIAQMLRGGAIVEVTTVDQA  840
             ++ L H  +H A MAEDGAVT+Y  ++ITDAKKN FSIK G+AQMLRGGAIVEV+T+ QA
Sbjct  45    LLPLKHFHKHLAAMAEDGAVTLYKATSITDAKKNSFSIKAGLAQMLRGGAIVEVSTLSQA  104

Query  839   KIAESAGACCVIVSEPDSRGISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVG  660
             KIAE AGACC++++EP+ +GISRMPDP++IK+IKR V IPVMA+SRVGHFVEAQILE VG
Sbjct  105   KIAEEAGACCLVITEPNRQGISRMPDPSIIKQIKRCVLIPVMARSRVGHFVEAQILERVG  164

Query  659   VDYIDESELLAIADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGN  480
             VDYIDESE+LAIADED+FINKHNF  PFVCG ++LG+ALRRVREGAAMIRTQGDL G+GN
Sbjct  165   VDYIDESEVLAIADEDNFINKHNFGCPFVCGCKNLGDALRRVREGAAMIRTQGDLLGTGN  224

Query  479   IVDTVRSVRKVMGDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIV  300
             I +TV++VR VMG+IR+LNNMDEDEVFAFSK+IAAPYD+V QTKQM RLPVVHFA+GGIV
Sbjct  225   IAETVKNVRSVMGEIRILNNMDEDEVFAFSKEIAAPYDLVAQTKQMGRLPVVHFAAGGIV  284

Query  299   TPADAAIMMQLGCDGIFLGPEVF-NCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAM  123
             TPADAA+MMQLGCDG+F+G EVF N SD YK+V  IV+AVR+YNDPHVL + S GLE+ M
Sbjct  285   TPADAALMMQLGCDGVFVGSEVFDNGSDLYKRVRGIVEAVRHYNDPHVLVENSCGLEEEM  344

Query  122   AGLNL  108
             AGLN+
Sbjct  345   AGLNV  349



>ref|XP_008228527.1| PREDICTED: probable pyridoxal biosynthesis protein PDX1.2 [Prunus 
mume]
Length=308

 Score =   482 bits (1241),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 228/291 (78%), Positives = 262/291 (90%), Gaps = 1/291 (0%)
 Frame = -1

Query  977  AEDGAVTVYSGSAITDAKKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIVS  798
            AEDGAVT+YSGSAITDAKKNP+S+KVG+ QMLRGGAI EVTT DQAK+AE AGAC VIVS
Sbjct  3    AEDGAVTIYSGSAITDAKKNPYSLKVGLGQMLRGGAIFEVTTADQAKLAEDAGACSVIVS  62

Query  797  EP-DSRGISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLAIA  621
            +P  ++GISRM DPAL+K+IKRAVSIPVMA+SRVGHFVEAQ+LE +GVDYIDESE LAIA
Sbjct  63   DPPRAQGISRMSDPALVKDIKRAVSIPVMARSRVGHFVEAQVLEAIGVDYIDESEYLAIA  122

Query  620  DEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKVMG  441
            DEDHFINKHNF+ PFVCGA+ LG+ALRRVREGAA++RTQGDL+GSGN+   V++VR VMG
Sbjct  123  DEDHFINKHNFQTPFVCGAQTLGDALRRVREGAAIVRTQGDLSGSGNVAMAVKNVRSVMG  182

Query  440  DIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQLGC  261
             IR+LNNMD+DEVFAFSK+I APYD+V QTKQM RLPVV FASGGIVTPADAA+MMQLGC
Sbjct  183  QIRLLNNMDDDEVFAFSKEIQAPYDLVAQTKQMGRLPVVQFASGGIVTPADAALMMQLGC  242

Query  260  DGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            DG+F+G +VFNCSDPYK+V  IV+AVRNYNDPHVL + SSGL   MAGL+L
Sbjct  243  DGVFVGSDVFNCSDPYKRVRGIVEAVRNYNDPHVLVETSSGLSGLMAGLDL  293



>ref|XP_012073347.1| PREDICTED: pyridoxal 5'-phosphate synthase-like subunit PDX1.2 
[Jatropha curcas]
 gb|KDP37227.1| hypothetical protein JCGZ_06283 [Jatropha curcas]
Length=299

 Score =   481 bits (1239),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 226/291 (78%), Positives = 264/291 (91%), Gaps = 0/291 (0%)
 Frame = -1

Query  980  MAEDGAVTVYSGSAITDAKKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIV  801
            M EDGAVT+Y+ SAITDAKKNPFS+KVG+AQMLRGGAI+EVT + QAKIAE AGAC +++
Sbjct  1    MEEDGAVTLYNSSAITDAKKNPFSLKVGLAQMLRGGAILEVTNLQQAKIAEQAGACSIML  60

Query  800  SEPDSRGISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLAIA  621
            +EP  +GI RMPDP+LIKEIKRAVSIPV+A++RVGHFVEAQILE +GVDYIDESELLA+A
Sbjct  61   AEPMRQGIKRMPDPSLIKEIKRAVSIPVIARARVGHFVEAQILEAIGVDYIDESELLALA  120

Query  620  DEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKVMG  441
            DED+FINKHNFR PF+CG +DLGEALRRVREGAAMIRTQG++ G GNI  TV++VR VM 
Sbjct  121  DEDNFINKHNFRCPFICGCQDLGEALRRVREGAAMIRTQGEVLGHGNIALTVKNVRNVMK  180

Query  440  DIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQLGC  261
            +IRVLNNMDEDEVFAF+KKIAAPYD+V QTKQM RLPVV FA+GGI++PADAA+MMQLGC
Sbjct  181  EIRVLNNMDEDEVFAFAKKIAAPYDLVAQTKQMGRLPVVQFAAGGIMSPADAALMMQLGC  240

Query  260  DGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            DGIF+G EVF+C+DPYK+V AIVQAVR+YNDPHVL ++S  LEDAMA LNL
Sbjct  241  DGIFVGNEVFDCADPYKRVRAIVQAVRHYNDPHVLVESSCELEDAMAELNL  291



>ref|XP_007215728.1| hypothetical protein PRUPE_ppa009060mg [Prunus persica]
 gb|EMJ16927.1| hypothetical protein PRUPE_ppa009060mg [Prunus persica]
Length=308

 Score =   480 bits (1236),  Expect = 8e-167, Method: Compositional matrix adjust.
 Identities = 226/291 (78%), Positives = 261/291 (90%), Gaps = 1/291 (0%)
 Frame = -1

Query  977  AEDGAVTVYSGSAITDAKKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIVS  798
            AEDGAVT+YSGSAITDAKKNP+S+KVG+ QMLRGGAI EVTT DQAK+AE AGAC +IVS
Sbjct  3    AEDGAVTIYSGSAITDAKKNPYSLKVGLGQMLRGGAIFEVTTADQAKLAEDAGACSIIVS  62

Query  797  EP-DSRGISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLAIA  621
            +P  ++GISRM DPAL+K+IKRAVS+PVMA+SRVGHFVEAQ+LE +GVDYIDESE LAIA
Sbjct  63   DPPRAQGISRMSDPALVKDIKRAVSLPVMARSRVGHFVEAQVLEAIGVDYIDESEYLAIA  122

Query  620  DEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKVMG  441
            DEDHFINKHNF+ PFVCGA+ LG+ALRRVREGAA++RTQGDL+GSGN+   V++VR VMG
Sbjct  123  DEDHFINKHNFQTPFVCGAQTLGDALRRVREGAAIVRTQGDLSGSGNVAMAVKNVRSVMG  182

Query  440  DIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQLGC  261
             IR+LNNMD+DEVFAFSK+I APYD+V QTKQM RLPVV FASGGIVTPADAA+MMQLGC
Sbjct  183  QIRLLNNMDDDEVFAFSKEIQAPYDLVAQTKQMGRLPVVQFASGGIVTPADAALMMQLGC  242

Query  260  DGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            DG+F+G  VFNCSDPYK+V  IV+AVRNYNDPHVL + SSGL   MAGL+L
Sbjct  243  DGVFVGSNVFNCSDPYKRVRGIVEAVRNYNDPHVLVETSSGLSGLMAGLDL  293



>ref|XP_002299701.2| pyridoxin biosynthesis PDX1-like protein 2 [Populus trichocarpa]
 gb|EEE84506.2| pyridoxin biosynthesis PDX1-like protein 2 [Populus trichocarpa]
Length=305

 Score =   479 bits (1233),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 226/292 (77%), Positives = 264/292 (90%), Gaps = 1/292 (0%)
 Frame = -1

Query  980  MAEDGAVTVYSGSAITDAKKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIV  801
            MA+DGAVT+Y+ SAITDAKKNPFSIK G+AQMLRGGAI+EV++V QAKIAE AGAC ++V
Sbjct  1    MADDGAVTLYNNSAITDAKKNPFSIKAGLAQMLRGGAILEVSSVQQAKIAEEAGACSIMV  60

Query  800  SEPDSR-GISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLAI  624
            SEP  R GI RMPDP+LIKEIKRAVSIP+MA++RVGHFVEAQILE +GVDYIDESELLA+
Sbjct  61   SEPGLRQGIRRMPDPSLIKEIKRAVSIPLMARARVGHFVEAQILEAIGVDYIDESELLAL  120

Query  623  ADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKVM  444
            ADED+FINKHNFR PF+CG R+LGEALRRVREGAAMIRTQG++ G GN+ +TV++VR VM
Sbjct  121  ADEDNFINKHNFRCPFICGCRNLGEALRRVREGAAMIRTQGEILGQGNVAETVKNVRNVM  180

Query  443  GDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQLG  264
             ++RVLNNMDEDEVFAF+KKIAAPYD+V Q KQM RLPVV FA+GGIVTPADAA+MMQLG
Sbjct  181  KEVRVLNNMDEDEVFAFAKKIAAPYDLVAQIKQMGRLPVVQFAAGGIVTPADAALMMQLG  240

Query  263  CDGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            CDGIF+G EVF+ +DPYK+V  IVQAVR+YNDPHVL ++S GLED+MA LNL
Sbjct  241  CDGIFVGSEVFDSADPYKRVRGIVQAVRHYNDPHVLVESSCGLEDSMAELNL  292



>ref|XP_011007588.1| PREDICTED: probable pyridoxal biosynthesis protein PDX1.2 [Populus 
euphratica]
 ref|XP_011011428.1| PREDICTED: probable pyridoxal biosynthesis protein PDX1.2 [Populus 
euphratica]
Length=305

 Score =   476 bits (1225),  Expect = 4e-165, Method: Compositional matrix adjust.
 Identities = 224/292 (77%), Positives = 263/292 (90%), Gaps = 1/292 (0%)
 Frame = -1

Query  980  MAEDGAVTVYSGSAITDAKKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIV  801
            MA+DGAVT+Y+ SAITDAKKNPFSIK G+AQMLRGGAI+EV++V QAKIAE AGAC ++V
Sbjct  1    MADDGAVTLYNNSAITDAKKNPFSIKAGLAQMLRGGAILEVSSVQQAKIAEEAGACSIMV  60

Query  800  SEPD-SRGISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLAI  624
            SEP   +GI RMPDP+LIKEIKRAVSIP+MA++RVGHFVEAQILE +GVDYIDESELLA+
Sbjct  61   SEPGLHQGIRRMPDPSLIKEIKRAVSIPLMARARVGHFVEAQILEAIGVDYIDESELLAL  120

Query  623  ADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKVM  444
            ADED+F NKHNFR PF+CG R+LGEALRRVREGAAMIRTQG++ G GN+ +TV++VR VM
Sbjct  121  ADEDNFTNKHNFRCPFICGCRNLGEALRRVREGAAMIRTQGEILGQGNVAETVKNVRNVM  180

Query  443  GDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQLG  264
             ++RVLNNMDEDEVFAF+KKIAAPYD+V Q KQM RLPVV FA+GGIVTPADAA+MMQLG
Sbjct  181  KEVRVLNNMDEDEVFAFAKKIAAPYDLVAQIKQMGRLPVVQFAAGGIVTPADAALMMQLG  240

Query  263  CDGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            CDGIF+G EVF+ +DPYK+V  IVQAVR+YNDPHVL ++S GLED+MA LNL
Sbjct  241  CDGIFVGSEVFDSADPYKRVRGIVQAVRHYNDPHVLVESSCGLEDSMAELNL  292



>ref|XP_002516058.1| Pyridoxin biosynthesis protein PDX1, putative [Ricinus communis]
 gb|EEF46478.1| Pyridoxin biosynthesis protein PDX1, putative [Ricinus communis]
Length=305

 Score =   471 bits (1211),  Expect = 5e-163, Method: Compositional matrix adjust.
 Identities = 224/292 (77%), Positives = 259/292 (89%), Gaps = 1/292 (0%)
 Frame = -1

Query  980  MAEDGAVTVYSGSAITDAKKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIV  801
            M E GAVTVY+ SAITDAKKNP+SIKVG+AQMLRGGAI+EV    QAK+AE AGAC V+V
Sbjct  1    MEEGGAVTVYNNSAITDAKKNPYSIKVGLAQMLRGGAILEVINPQQAKLAEEAGACSVMV  60

Query  800  SE-PDSRGISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLAI  624
            +E P  +GI RMPDP+LIKEIKRAVSIPV+ ++RVGHFVEAQILE + VDYIDESELLA+
Sbjct  61   TELPIRQGIQRMPDPSLIKEIKRAVSIPVITRARVGHFVEAQILEAINVDYIDESELLAL  120

Query  623  ADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKVM  444
            ADED+FINKHNFR PF+CG RDLGEALRRVREGAAMIRTQG+L G GN+ +TVR+VR VM
Sbjct  121  ADEDNFINKHNFRTPFICGCRDLGEALRRVREGAAMIRTQGELRGYGNVGETVRNVRNVM  180

Query  443  GDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQLG  264
             +IR+LNNMDEDE+FAF+KKI APYD+V QTKQM RLPVV FA+GGI TPADAA+MMQLG
Sbjct  181  KEIRILNNMDEDEMFAFAKKINAPYDLVAQTKQMGRLPVVQFAAGGIATPADAALMMQLG  240

Query  263  CDGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            CDGIF+G EVF+C+DPYK++ AIVQAVR+YNDPHVL ++S GLEDAMA LNL
Sbjct  241  CDGIFVGNEVFHCADPYKRMRAIVQAVRHYNDPHVLVESSCGLEDAMADLNL  292



>ref|XP_009346002.1| PREDICTED: probable pyridoxal biosynthesis protein PDX1.2 [Pyrus 
x bretschneideri]
Length=310

 Score =   465 bits (1197),  Expect = 7e-161, Method: Compositional matrix adjust.
 Identities = 224/293 (76%), Positives = 259/293 (88%), Gaps = 3/293 (1%)
 Frame = -1

Query  977  AEDGAVTVYSGSAITDA--KKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVI  804
            AEDGAVT+Y+ SAITDA  KKNP+SIKVG+AQMLRGGAIVEV T +QA++AE AGAC VI
Sbjct  3    AEDGAVTIYNSSAITDANNKKNPYSIKVGLAQMLRGGAIVEVNTPEQARLAEDAGACSVI  62

Query  803  VSEPD-SRGISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLA  627
            VS+P  +RGISRM DP LIK+IKRAVSIPV+A+SR+GHFVEAQILE++GVDYIDESE LA
Sbjct  63   VSDPPRNRGISRMSDPCLIKDIKRAVSIPVVARSRIGHFVEAQILESIGVDYIDESEYLA  122

Query  626  IADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKV  447
            +ADE+HFINKHNF+ PF+CGA+ LG+ALRRVREGAA+IR QGDLTGSGN+  TV++VR V
Sbjct  123  MADEEHFINKHNFQTPFICGAQTLGDALRRVREGAAIIRIQGDLTGSGNVAMTVKNVRSV  182

Query  446  MGDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQL  267
            MG IR+LNNMD+DEVFAFSK I APYD+V Q+KQM RLPVV FASGGIVTPAD A+MMQL
Sbjct  183  MGQIRLLNNMDDDEVFAFSKTIQAPYDLVAQSKQMGRLPVVLFASGGIVTPADVALMMQL  242

Query  266  GCDGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            GCDG+F+G +VFNCSDPYK+V  IVQAVRNYNDPHVL + SSGL D MAGL  
Sbjct  243  GCDGVFIGSDVFNCSDPYKRVIDIVQAVRNYNDPHVLVEVSSGLSDLMAGLGF  295



>ref|XP_008342698.1| PREDICTED: probable pyridoxal biosynthesis protein PDX1.2 [Malus 
domestica]
Length=310

 Score =   462 bits (1190),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 221/293 (75%), Positives = 257/293 (88%), Gaps = 3/293 (1%)
 Frame = -1

Query  977  AEDGAVTVYSGSAITDA--KKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVI  804
            AEDGAVT+Y+ SAITDA  KKNP+SIKVG+AQMLRGG IVEV T +QA++ E AGAC VI
Sbjct  3    AEDGAVTIYNSSAITDANNKKNPYSIKVGLAQMLRGGTIVEVNTPEQARLXEDAGACSVI  62

Query  803  VSEPD-SRGISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLA  627
            +S+P  +RGISRM DP LIK+IKRAVSIPV+A+SR+GHFVEAQILE++GVDYIDESE LA
Sbjct  63   ISDPXXNRGISRMSDPCLIKDIKRAVSIPVVARSRIGHFVEAQILESIGVDYIDESEYLA  122

Query  626  IADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKV  447
            +ADE+HFINKHNF+ PF+CGA+ LG+ALRRVREGAA+IR QGDLTGSGN+  TV++VR V
Sbjct  123  MADEEHFINKHNFQTPFICGAQTLGDALRRVREGAAIIRIQGDLTGSGNVAMTVKNVRSV  182

Query  446  MGDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQL  267
            MG IR+LNNMD+DEVFAFSK I APYD+V Q+KQM RLPVV FASGGIVTPAD A+MMQL
Sbjct  183  MGQIRLLNNMDDDEVFAFSKTIQAPYDLVAQSKQMGRLPVVLFASGGIVTPADVALMMQL  242

Query  266  GCDGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            GCDG+F+G +VFNCSDPYK+V  IVQAVRNYNDPHVL + SSGL D MAGL  
Sbjct  243  GCDGVFIGSDVFNCSDPYKRVIDIVQAVRNYNDPHVLVEVSSGLSDLMAGLGF  295



>ref|XP_002885122.1| hypothetical protein ARALYDRAFT_479060 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61381.1| hypothetical protein ARALYDRAFT_479060 [Arabidopsis lyrata subsp. 
lyrata]
Length=309

 Score =   461 bits (1187),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 217/292 (74%), Positives = 263/292 (90%), Gaps = 3/292 (1%)
 Frame = -1

Query  974  EDGAVTVYSGSAITDAKKN-PFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIVS  798
            E GAVT+YSG+AITDAKKN PFS+KVG+AQ+LRGGAIVEV++V+QAKIAESAGAC VIVS
Sbjct  5    EQGAVTLYSGAAITDAKKNHPFSVKVGLAQVLRGGAIVEVSSVNQAKIAESAGACSVIVS  64

Query  797  EP-DSRG-ISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLAI  624
            +P  SRG + RMPDP LIKE+KRAVS+PVM ++RVGHFVEAQILE++ VDYIDESE++++
Sbjct  65   DPVRSRGGVRRMPDPVLIKEVKRAVSVPVMGRARVGHFVEAQILESLAVDYIDESEIISV  124

Query  623  ADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKVM  444
            ADEDHFINKHNFR PF+CG RD GEALRR+REGAAMIR QGDLT +GNI +TV++VR +M
Sbjct  125  ADEDHFINKHNFRSPFICGCRDTGEALRRIREGAAMIRIQGDLTATGNIAETVKNVRSLM  184

Query  443  GDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQLG  264
            G++RVLNNMD+DEVF F+KKI+APYD+V QTKQM R+PVV FASGGI TPADAA+MMQLG
Sbjct  185  GEVRVLNNMDDDEVFTFAKKISAPYDLVAQTKQMGRVPVVQFASGGITTPADAALMMQLG  244

Query  263  CDGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            CDG+F+G EVF+  DP+KK+ +IVQAV++YNDPHVLA+ SSGLE+AM  LN+
Sbjct  245  CDGVFVGSEVFDGPDPFKKLRSIVQAVQHYNDPHVLAEMSSGLENAMESLNV  296



>ref|XP_002862267.1| hypothetical protein ARALYDRAFT_497537 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH38525.1| hypothetical protein ARALYDRAFT_497537 [Arabidopsis lyrata subsp. 
lyrata]
Length=314

 Score =   461 bits (1186),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 217/292 (74%), Positives = 263/292 (90%), Gaps = 3/292 (1%)
 Frame = -1

Query  974  EDGAVTVYSGSAITDAKKN-PFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIVS  798
            E GAVT+YSG+AITDAKKN PFS+KVG+AQ+LRGGAIVEV++V+QAKIAESAGAC VIVS
Sbjct  10   EQGAVTLYSGAAITDAKKNHPFSVKVGLAQVLRGGAIVEVSSVNQAKIAESAGACSVIVS  69

Query  797  EP-DSRG-ISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLAI  624
            +P  SRG + RMPDP LIKE+KRAVS+PVM ++RVGHFVEAQILE++ VDYIDESE++++
Sbjct  70   DPVRSRGGVRRMPDPVLIKEVKRAVSVPVMGRARVGHFVEAQILESLAVDYIDESEIISV  129

Query  623  ADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKVM  444
            ADEDHFINKHNFR PF+CG RD GEALRR+REGAAMIR QGDLT +GNI +TV++VR +M
Sbjct  130  ADEDHFINKHNFRSPFICGCRDTGEALRRIREGAAMIRIQGDLTATGNIAETVKNVRSLM  189

Query  443  GDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQLG  264
            G++RVLNNMD+DEVF F+KKI+APYD+V QTKQM R+PVV FASGGI TPADAA+MMQLG
Sbjct  190  GEVRVLNNMDDDEVFTFAKKISAPYDLVAQTKQMGRVPVVQFASGGITTPADAALMMQLG  249

Query  263  CDGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            CDG+F+G EVF+  DP+KK+ +IVQAV++YNDPHVLA+ SSGLE+AM  LN+
Sbjct  250  CDGVFVGSEVFDGPDPFKKLRSIVQAVQHYNDPHVLAEMSSGLENAMESLNV  301



>ref|XP_008354742.1| PREDICTED: probable pyridoxal biosynthesis protein PDX1.2 [Malus 
domestica]
Length=308

 Score =   460 bits (1183),  Expect = 8e-159, Method: Compositional matrix adjust.
 Identities = 220/291 (76%), Positives = 261/291 (90%), Gaps = 3/291 (1%)
 Frame = -1

Query  977  AEDGAVTVYSGSAITDAK--KNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVI  804
            AEDGAVT+Y+ SAITDAK  +NP+S+KVG+AQMLRGGAIVEV T++QAK+AE AGAC VI
Sbjct  3    AEDGAVTIYNSSAITDAKNKQNPYSMKVGLAQMLRGGAIVEVNTLEQAKLAEDAGACSVI  62

Query  803  VSEPD-SRGISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLA  627
            VS+P  +RGISRM DP+LIK+IKRAVSIPV+A+SR+GHFVEAQILE++GVDYIDESE LA
Sbjct  63   VSDPPRTRGISRMSDPSLIKDIKRAVSIPVVARSRIGHFVEAQILESIGVDYIDESEYLA  122

Query  626  IADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKV  447
            +ADE+HFINKHNF++PFVCGA+ LG+AL RVREGAA+IR QGDL+GSGN+  TV++VR V
Sbjct  123  MADEEHFINKHNFQIPFVCGAQTLGDALWRVREGAAVIRIQGDLSGSGNVSXTVKNVRCV  182

Query  446  MGDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQL  267
            MG IR+LNNMD+DEVFAFSK I APYD+V Q+KQM RLPV+ FA+GGIVTPADAA+MMQL
Sbjct  183  MGQIRLLNNMDDDEVFAFSKTIQAPYDLVAQSKQMGRLPVMLFAAGGIVTPADAALMMQL  242

Query  266  GCDGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGL  114
            GCDG+F+G +VFNCSDPYK+V  IVQAVRNYNDPHVL + SSGL   MAGL
Sbjct  243  GCDGVFIGSDVFNCSDPYKRVMGIVQAVRNYNDPHVLVEVSSGLSGLMAGL  293



>ref|XP_009353629.1| PREDICTED: probable pyridoxal biosynthesis protein PDX1.2 [Pyrus 
x bretschneideri]
Length=308

 Score =   459 bits (1182),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 221/291 (76%), Positives = 259/291 (89%), Gaps = 3/291 (1%)
 Frame = -1

Query  977  AEDGAVTVYSGSAITDAK--KNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVI  804
            AEDGAVT+Y+ SAITDAK  +NP+S+KVG+AQMLRGGAIVEV T++QAK+AE AGAC VI
Sbjct  3    AEDGAVTIYNSSAITDAKNKQNPYSMKVGLAQMLRGGAIVEVNTLEQAKLAEEAGACSVI  62

Query  803  VSEPD-SRGISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLA  627
            VS+P  +RGISRM  P+LIK+IKRAVSIPV+A+SR+GHFVEAQILE++GVDYIDESE LA
Sbjct  63   VSDPPRTRGISRMSAPSLIKDIKRAVSIPVVARSRIGHFVEAQILESIGVDYIDESEYLA  122

Query  626  IADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKV  447
             ADE+HFINKHNF +PFVCGA+ LG+ALRRVREGAA+IR QGDL+GSGN+  TV++VR V
Sbjct  123  TADEEHFINKHNFEIPFVCGAQTLGDALRRVREGAAVIRIQGDLSGSGNVSMTVKNVRCV  182

Query  446  MGDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQL  267
            MG IR+LNNMD+DEVFAFSK I APYD+V Q+KQM RLPVV FA+GGIVTPADAA+MMQL
Sbjct  183  MGQIRLLNNMDDDEVFAFSKTIQAPYDLVAQSKQMGRLPVVLFAAGGIVTPADAALMMQL  242

Query  266  GCDGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGL  114
            GCDG+F+G +VFNCSDPYK+V  IVQAVRNYNDPHVL + SSGL   MAGL
Sbjct  243  GCDGVFIGSDVFNCSDPYKRVIGIVQAVRNYNDPHVLLEVSSGLSGLMAGL  293



>ref|XP_008371349.1| PREDICTED: probable pyridoxal biosynthesis protein PDX1.2 [Malus 
domestica]
Length=308

 Score =   459 bits (1180),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 219/291 (75%), Positives = 260/291 (89%), Gaps = 3/291 (1%)
 Frame = -1

Query  977  AEDGAVTVYSGSAITDAK--KNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVI  804
            AEDGAVT+Y+ SAITDAK  +NP+S+KVG+AQMLRGGAIVEV T++QAK+AE AGAC VI
Sbjct  3    AEDGAVTIYNSSAITDAKNKQNPYSMKVGLAQMLRGGAIVEVNTLEQAKLAEDAGACSVI  62

Query  803  VSEPD-SRGISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLA  627
            VS+P  +RGISRM DP+LIK+IKRAVSIPV+ +SR+GHFVEAQILE++GVDYIDESE LA
Sbjct  63   VSDPPRTRGISRMSDPSLIKDIKRAVSIPVVTRSRIGHFVEAQILESIGVDYIDESEYLA  122

Query  626  IADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKV  447
            +ADE+HFINKHNF++PFVCGA+ LG+AL RVREGAA+IR QGDL+GSGN+  TV++VR V
Sbjct  123  MADEEHFINKHNFQIPFVCGAQTLGDALWRVREGAAVIRIQGDLSGSGNVSXTVKNVRCV  182

Query  446  MGDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQL  267
            MG IR+LNNMD+DEVFAFSK I APYD+V Q+KQM RLPV+ FA+GGIVTPADAA+MMQL
Sbjct  183  MGQIRLLNNMDDDEVFAFSKTIQAPYDLVAQSKQMGRLPVMLFAAGGIVTPADAALMMQL  242

Query  266  GCDGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGL  114
            GCDG+F+G +VFNCSDPYK+V  IVQAVRNYNDPHVL + SSGL   MAGL
Sbjct  243  GCDGVFIGSDVFNCSDPYKRVMGIVQAVRNYNDPHVLVEVSSGLSGLMAGL  293



>ref|NP_188226.1| putative pyridoxal biosynthesis protein PDX1.2 [Arabidopsis thaliana]
 sp|Q9ZNR6.1|PDX12_ARATH RecName: Full=Pyridoxal 5'-phosphate synthase-like subunit PDX1.2; 
Short=AtPDX1.2; Short=AtPDX1;3 [Arabidopsis thaliana]
 gb|AAD01897.1| A37 [Arabidopsis thaliana]
 gb|AAD01898.1| A37 [Arabidopsis thaliana]
 dbj|BAB02670.1| A37 protein; ethylene-inducible protein-like [Arabidopsis thaliana]
 gb|AAO24568.1| At3g16050 [Arabidopsis thaliana]
 dbj|BAF00051.1| putative ethylene-inducible protein [Arabidopsis thaliana]
 gb|AEE75766.1| putative pyridoxal biosynthesis protein PDX1.2 [Arabidopsis thaliana]
Length=314

 Score =   459 bits (1180),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 215/292 (74%), Positives = 264/292 (90%), Gaps = 3/292 (1%)
 Frame = -1

Query  974  EDGAVTVYSGSAITDAKKN-PFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIVS  798
            + GAVT+YSG+AITDAKKN PFS+KVG+AQ+LRGGAIVEV++V+QAK+AESAGAC VIVS
Sbjct  10   DQGAVTLYSGTAITDAKKNHPFSVKVGLAQVLRGGAIVEVSSVNQAKLAESAGACSVIVS  69

Query  797  EP-DSRG-ISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLAI  624
            +P  SRG + RMPDP LIKE+KRAVS+PVMA++RVGHFVEAQILE++ VDYIDESE++++
Sbjct  70   DPVRSRGGVRRMPDPVLIKEVKRAVSVPVMARARVGHFVEAQILESLAVDYIDESEIISV  129

Query  623  ADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKVM  444
            AD+DHFINKHNFR PF+CG RD GEALRR+REGAAMIR QGDLT +GNI +TV++VR +M
Sbjct  130  ADDDHFINKHNFRSPFICGCRDTGEALRRIREGAAMIRIQGDLTATGNIAETVKNVRSLM  189

Query  443  GDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQLG  264
            G++RVLNNMD+DEVF F+KKI+APYD+V QTKQM R+PVV FASGGI TPADAA+MMQLG
Sbjct  190  GEVRVLNNMDDDEVFTFAKKISAPYDLVAQTKQMGRVPVVQFASGGITTPADAALMMQLG  249

Query  263  CDGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            CDG+F+G EVF+  DP+KK+ +IVQAV++YNDPHVLA+ SSGLE+AM  LN+
Sbjct  250  CDGVFVGSEVFDGPDPFKKLRSIVQAVQHYNDPHVLAEMSSGLENAMESLNV  301



>ref|XP_006299634.1| hypothetical protein CARUB_v10015814mg [Capsella rubella]
 gb|EOA32532.1| hypothetical protein CARUB_v10015814mg [Capsella rubella]
Length=315

 Score =   458 bits (1179),  Expect = 5e-158, Method: Compositional matrix adjust.
 Identities = 212/292 (73%), Positives = 262/292 (90%), Gaps = 3/292 (1%)
 Frame = -1

Query  974  EDGAVTVYSGSAITDAKKN-PFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIVS  798
            + GAVT+YSG+AITDAKKN PFS+KVG+AQ+LRGGAIVEV++V+QAKIAESAGAC V+VS
Sbjct  11   QGGAVTLYSGTAITDAKKNHPFSVKVGLAQVLRGGAIVEVSSVNQAKIAESAGACSVLVS  70

Query  797  EP--DSRGISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLAI  624
            +P     G+ RMPDP L+KE+KRAVS+PVM ++RVGHFVEAQILE++ VDYIDESE++++
Sbjct  71   DPVRSCSGVRRMPDPVLVKEVKRAVSVPVMGRARVGHFVEAQILESLAVDYIDESEVISV  130

Query  623  ADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKVM  444
            AD+DHFINKHNFR PF+CG RD GEALRR+REGAAMIR QGDLTG+GNI +TV++VR +M
Sbjct  131  ADDDHFINKHNFRSPFICGCRDTGEALRRIREGAAMIRIQGDLTGTGNIAETVKNVRSLM  190

Query  443  GDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQLG  264
            GD+RVLNNMD+DEVF F+KKI+APYD+V QTKQM R+PVV FASGGI TPADAA+MMQLG
Sbjct  191  GDVRVLNNMDDDEVFTFAKKISAPYDLVAQTKQMGRVPVVQFASGGITTPADAALMMQLG  250

Query  263  CDGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            CDG+F+G EVF+  DP+KK+ +IVQAV++YNDPHVLA+ SSGLE+AM  L++
Sbjct  251  CDGVFVGSEVFDGPDPFKKLRSIVQAVQHYNDPHVLAEMSSGLENAMENLSV  302



>ref|XP_010465605.1| PREDICTED: probable pyridoxal biosynthesis protein PDX1.2 [Camelina 
sativa]
 ref|XP_010465606.1| PREDICTED: probable pyridoxal biosynthesis protein PDX1.2 [Camelina 
sativa]
 ref|XP_010465607.1| PREDICTED: probable pyridoxal biosynthesis protein PDX1.2 [Camelina 
sativa]
 ref|XP_010465608.1| PREDICTED: probable pyridoxal biosynthesis protein PDX1.2 [Camelina 
sativa]
Length=315

 Score =   457 bits (1176),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 211/292 (72%), Positives = 262/292 (90%), Gaps = 3/292 (1%)
 Frame = -1

Query  974  EDGAVTVYSGSAITDAKK-NPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIVS  798
            + GAVT+YSG+AITDAKK +PFS+KVG+AQ+LRGGAIVEV++V+QAKIAESAGAC V+VS
Sbjct  11   QQGAVTLYSGTAITDAKKTHPFSVKVGLAQVLRGGAIVEVSSVNQAKIAESAGACSVLVS  70

Query  797  EP--DSRGISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLAI  624
            +P     G+ RMPDP L+KE+KRAVS+PVMA++RVGHFVEAQILE++ VDYIDESE++++
Sbjct  71   DPVRSLSGVRRMPDPVLVKEVKRAVSVPVMARARVGHFVEAQILESLAVDYIDESEIISV  130

Query  623  ADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKVM  444
            AD+DHFINKHNFR PF+CG RD GEALRR+REGAAMIR QGDLTG+GN+  TV++VR +M
Sbjct  131  ADDDHFINKHNFRSPFICGCRDTGEALRRIREGAAMIRIQGDLTGTGNVSKTVKNVRSLM  190

Query  443  GDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQLG  264
            G++RVLNNMD+DEVF F+KKI+APYD+V QTKQM R+PVV FASGGI TPADAA+MMQLG
Sbjct  191  GEVRVLNNMDDDEVFTFAKKISAPYDLVAQTKQMGRVPVVQFASGGITTPADAALMMQLG  250

Query  263  CDGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            CDG+F+G EVF+  DP+KK+ +IVQAV++YNDPHVLA+ SSGLE+AM  LN+
Sbjct  251  CDGVFVGSEVFDGPDPFKKLRSIVQAVQHYNDPHVLAEMSSGLENAMENLNV  302



>ref|XP_008344378.1| PREDICTED: probable pyridoxal biosynthesis protein PDX1.2 [Malus 
domestica]
Length=309

 Score =   456 bits (1173),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 218/290 (75%), Positives = 260/290 (90%), Gaps = 3/290 (1%)
 Frame = -1

Query  974  EDGAVTVYSGSAITDAK--KNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIV  801
            +DGAVT+Y+ SAITDAK  +NP+S+KVG+AQMLRGGAIVEV T++QAK+AE AGAC VIV
Sbjct  5    KDGAVTIYNSSAITDAKNKQNPYSMKVGLAQMLRGGAIVEVNTLEQAKLAEDAGACSVIV  64

Query  800  SEPD-SRGISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLAI  624
            S+P  +RGISRM DP+LIK+IKRAVSIPV+A+SR+GHFVEAQILE++GVDYIDESE LA+
Sbjct  65   SDPPRTRGISRMSDPSLIKDIKRAVSIPVVARSRIGHFVEAQILESIGVDYIDESEYLAM  124

Query  623  ADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKVM  444
            ADE+HFINKHNF++PFVCGA+ LG+AL RVREGAA+IR QGDL+GSGN+  TV++VR VM
Sbjct  125  ADEEHFINKHNFQIPFVCGAQTLGDALWRVREGAAVIRIQGDLSGSGNVSXTVKNVRCVM  184

Query  443  GDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQLG  264
            G IR+LNNMD+DEVFAFSK I APYD+V Q+KQM RLPV+ FA+GGIVTPADAA+MMQLG
Sbjct  185  GQIRLLNNMDDDEVFAFSKTIQAPYDLVAQSKQMGRLPVMLFAAGGIVTPADAALMMQLG  244

Query  263  CDGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGL  114
            CDG+F+G +VFNCSDPYK+V  IVQAVRNYNDPHVL + SSGL   MAGL
Sbjct  245  CDGVFIGSDVFNCSDPYKRVMGIVQAVRNYNDPHVLVEVSSGLSGLMAGL  294



>ref|XP_010487448.1| PREDICTED: probable pyridoxal biosynthesis protein PDX1.2 [Camelina 
sativa]
Length=314

 Score =   456 bits (1173),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 214/292 (73%), Positives = 263/292 (90%), Gaps = 3/292 (1%)
 Frame = -1

Query  974  EDGAVTVYSGSAITDAKKN-PFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIVS  798
            + GAVT+YSG+AITDAKKN PFS+KVG+AQ+LRGGAIVEV++V+QAKIAESAGAC VIVS
Sbjct  10   DQGAVTLYSGTAITDAKKNHPFSVKVGLAQVLRGGAIVEVSSVNQAKIAESAGACSVIVS  69

Query  797  EP-DSR-GISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLAI  624
            +P  SR G+ RMPDP L+KE+KRAVS+PVMA++RVGHFVEAQILE++ VDYIDESE++++
Sbjct  70   DPVRSRAGVRRMPDPVLVKEVKRAVSVPVMARARVGHFVEAQILESLAVDYIDESEVISV  129

Query  623  ADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKVM  444
            AD+DHFINKHNFR PF+CG RD GEALRR+REGAAMIR QGDL G+GNI  TV++VR +M
Sbjct  130  ADDDHFINKHNFRSPFICGCRDTGEALRRIREGAAMIRIQGDLNGTGNISRTVKNVRSLM  189

Query  443  GDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQLG  264
            G++RVLNNMD+DEVF F+KKI+APYD+V QTKQM R+PVV FASGGI TPADAA+MMQLG
Sbjct  190  GEVRVLNNMDDDEVFTFAKKISAPYDLVAQTKQMGRVPVVQFASGGITTPADAALMMQLG  249

Query  263  CDGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            CDG+F+G EVF+  DP+KK+ +IVQAV++YNDPHVLA+ SSGLE+AM  L++
Sbjct  250  CDGVFVGSEVFDGPDPFKKLRSIVQAVQHYNDPHVLAEMSSGLENAMENLSV  301



>ref|XP_010503700.1| PREDICTED: probable pyridoxal biosynthesis protein PDX1.2 [Camelina 
sativa]
Length=315

 Score =   456 bits (1173),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 212/292 (73%), Positives = 261/292 (89%), Gaps = 3/292 (1%)
 Frame = -1

Query  974  EDGAVTVYSGSAITDAKKN-PFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIVS  798
            + GAVT+YSG+AITDAKKN PFS+KVG+AQ+LRGGAIVEV++V+QAKIAESAGAC VIVS
Sbjct  11   QQGAVTLYSGTAITDAKKNHPFSVKVGLAQVLRGGAIVEVSSVNQAKIAESAGACSVIVS  70

Query  797  EP--DSRGISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLAI  624
            +P     G+ RMPDP L+KE+KRAVS+PVMA++RVGHFVEAQILE++ VDYIDESE++++
Sbjct  71   DPVRSLSGVRRMPDPVLVKEVKRAVSVPVMARARVGHFVEAQILESLAVDYIDESEVISV  130

Query  623  ADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKVM  444
            AD+DHFINKHNFR PF+CG RD GEALRR+REGAAMIR QGDL G+GNI  TV++VR +M
Sbjct  131  ADDDHFINKHNFRSPFICGCRDTGEALRRIREGAAMIRIQGDLNGTGNISRTVKNVRSLM  190

Query  443  GDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQLG  264
            G++RVLNNMD+DEVF F+KKI+APYD+V QTKQM R+PVV FASGGI TPADAA+MMQLG
Sbjct  191  GEVRVLNNMDDDEVFTFAKKISAPYDLVAQTKQMGRVPVVQFASGGITTPADAALMMQLG  250

Query  263  CDGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            CDG+F+G EVF+  DP+KK+ +IVQAV++YNDPHVLA+ SSGLE+AM  L++
Sbjct  251  CDGVFVGSEVFDGPDPFKKLRSIVQAVQHYNDPHVLAEMSSGLENAMENLSV  302



>emb|CDY50623.1| BnaC01g44250D [Brassica napus]
Length=403

 Score =   454 bits (1168),  Expect = 5e-155, Method: Compositional matrix adjust.
 Identities = 214/319 (67%), Positives = 275/319 (86%), Gaps = 6/319 (2%)
 Frame = -1

Query  974  EDGAVTVYSGSAITDA--KKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIV  801
            + GAVT+YSG+AITDA  K +PFS+KVG+AQ+LRGGA+VEV++V+QAKIAESAGAC V++
Sbjct  5    DQGAVTLYSGTAITDAAKKNHPFSVKVGLAQVLRGGAVVEVSSVNQAKIAESAGACAVLI  64

Query  800  SEPD----SRGISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESEL  633
            S+P     + G+ RMPDPAL+KE+KRAVS+PVMA++RVGHFVEAQILE + VDYIDESE+
Sbjct  65   SDPPRSPATAGVQRMPDPALVKEVKRAVSVPVMARARVGHFVEAQILEHLAVDYIDESEI  124

Query  632  LAIADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVR  453
            +++ADE +FINKHNFR PF+CG RD GEALRR+REGAAMIR QGD+T +GN+ +TVR+VR
Sbjct  125  ISVADEGNFINKHNFRSPFICGCRDTGEALRRIREGAAMIRIQGDVTRTGNVAETVRNVR  184

Query  452  KVMGDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMM  273
            +VMGD+RVLNNMD+DEVFAF+KK++APYD+V QTKQM R+PVV FASGGI TPADAA+MM
Sbjct  185  RVMGDVRVLNNMDDDEVFAFAKKLSAPYDLVAQTKQMGRVPVVQFASGGITTPADAALMM  244

Query  272  QLGCDGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNLVRAGS  93
            QLGCDG+F+G EVF  +DP+K+V +IVQAV++YNDPHVLA+ SSGLE AM  L+L+   +
Sbjct  245  QLGCDGVFVGCEVFEGTDPFKRVRSIVQAVQHYNDPHVLAEMSSGLESAMESLSLLFYYT  304

Query  92   GN*VLAVLMKSLEIDVISF  36
             N +LA ++ +  I +I +
Sbjct  305  PNLILAAIILTAVIGLIDY  323



>ref|XP_009115047.1| PREDICTED: probable pyridoxal biosynthesis protein PDX1.2 [Brassica 
rapa]
Length=304

 Score =   449 bits (1155),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 205/291 (70%), Positives = 259/291 (89%), Gaps = 2/291 (1%)
 Frame = -1

Query  974  EDGAVTVYSGSAITDA--KKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIV  801
            + GAVT+YSG+AITDA  K + FS+KVG+AQ+LRGGA+VEV++V+QAKIAESAGAC V++
Sbjct  5    DQGAVTLYSGAAITDAAKKNHSFSVKVGLAQVLRGGAVVEVSSVNQAKIAESAGACAVLI  64

Query  800  SEPDSRGISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLAIA  621
            S+P   G+ RMPDPAL+KE+KRAVS+P MA++RVGHFVEAQILE + VDYIDESE++++A
Sbjct  65   SDPPRSGVQRMPDPALVKEVKRAVSVPAMARARVGHFVEAQILEHLAVDYIDESEIISVA  124

Query  620  DEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKVMG  441
            DE +FINKHNFR PF+CG RD GEALRR+REGAAMIR QGD+T +GN+ +TVR+VR+VMG
Sbjct  125  DEGNFINKHNFRSPFICGCRDTGEALRRIREGAAMIRIQGDVTRTGNVAETVRNVRRVMG  184

Query  440  DIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQLGC  261
            D+RVLNNMD+DEVFAF+KK++APYD+V QTKQM R+PVV FASGG+ TPADAA+MMQLGC
Sbjct  185  DVRVLNNMDDDEVFAFAKKLSAPYDLVAQTKQMGRVPVVQFASGGVTTPADAALMMQLGC  244

Query  260  DGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            DG+F+G EVF  +DP+K+V +IVQAV++YNDPHVLA+ SSGLE AM  L++
Sbjct  245  DGVFVGSEVFEGADPFKRVRSIVQAVQHYNDPHVLAEMSSGLESAMESLSV  295



>ref|XP_010249746.1| PREDICTED: probable pyridoxal biosynthesis protein PDX1 [Nelumbo 
nucifera]
Length=341

 Score =   451 bits (1159),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 213/294 (72%), Positives = 258/294 (88%), Gaps = 1/294 (0%)
 Frame = -1

Query  986  AEMAEDGAVTVYSGSAITDAKK-NPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACC  810
            ++MA+DG V VY+ SAITDAKK NPFSIKVG+AQMLRGG I+EVT V+QAKIAE AGAC 
Sbjct  34   SKMADDGVVAVYNNSAITDAKKKNPFSIKVGLAQMLRGGVILEVTNVEQAKIAEEAGACA  93

Query  809  VIVSEPDSRGISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELL  630
            ++V E   RG+ RM DP+LIKEIKR +SIPVMAK+RVGHFVEAQILET+GVDYIDESE+L
Sbjct  94   IVVIEQLQRGVRRMADPSLIKEIKRVISIPVMAKARVGHFVEAQILETIGVDYIDESEVL  153

Query  629  AIADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRK  450
              AD+++ INKHNFRVPFVCG+R LG AL+RVREGAAM+ T+GD + SGNIV+TVR+VR 
Sbjct  154  TPADDENHINKHNFRVPFVCGSRSLGVALQRVREGAAMVSTEGDASESGNIVETVRNVRS  213

Query  449  VMGDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQ  270
            VMG+IR+LNNMD+DEVF+F+ KI+APYD+V QTKQ+ RLPVVHFA+GGI+TPADAA+MMQ
Sbjct  214  VMGEIRILNNMDDDEVFSFANKISAPYDLVAQTKQLGRLPVVHFAAGGIITPADAALMMQ  273

Query  269  LGCDGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            LGCDG+F+G EVFN  DPYK+  AI++AV +YNDPHVLA+ S GL DA+AGL+L
Sbjct  274  LGCDGVFVGSEVFNTPDPYKRARAIIRAVSHYNDPHVLAEISCGLADALAGLSL  327



>emb|CDY20176.1| BnaA01g28260D [Brassica napus]
Length=304

 Score =   448 bits (1153),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 206/291 (71%), Positives = 258/291 (89%), Gaps = 2/291 (1%)
 Frame = -1

Query  974  EDGAVTVYSGSAITDA--KKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIV  801
            + GAVT+YSG+AITDA  K + FS+KVG+AQ+LRGGA+VEV++V+QAKIAESAGAC V++
Sbjct  5    DQGAVTLYSGAAITDAAKKNHSFSVKVGLAQVLRGGAVVEVSSVNQAKIAESAGACAVLI  64

Query  800  SEPDSRGISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLAIA  621
            S+P   G+ RMPDPAL+KE+KRAVS+P MA++RVGHFVEAQILE + VDYIDESE++++A
Sbjct  65   SDPPRSGVQRMPDPALVKEVKRAVSVPAMARARVGHFVEAQILEHLAVDYIDESEIISVA  124

Query  620  DEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKVMG  441
            DE +FINKHNFR PF+CG RD GEALRR+REGAAMIR QGD+T +GN+ +TVR+VR VMG
Sbjct  125  DEGNFINKHNFRSPFICGCRDTGEALRRIREGAAMIRIQGDVTRTGNVAETVRNVRTVMG  184

Query  440  DIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQLGC  261
            D+RVLNNMD+DEVFAF+KK++APYD+V QTKQM R+PVV FASGGI TPADAA+MMQLGC
Sbjct  185  DVRVLNNMDDDEVFAFAKKLSAPYDLVAQTKQMGRVPVVQFASGGITTPADAALMMQLGC  244

Query  260  DGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            DG+F+G EVF  +DP+K+V +IVQAV++YNDPHVLA+ SSGLE AM  L++
Sbjct  245  DGVFVGSEVFEGADPFKRVRSIVQAVQHYNDPHVLAEMSSGLESAMESLSV  295



>gb|KFK38958.1| hypothetical protein AALP_AA3G182100 [Arabis alpina]
Length=319

 Score =   449 bits (1154),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 214/298 (72%), Positives = 265/298 (89%), Gaps = 6/298 (2%)
 Frame = -1

Query  974  EDGAVTVYSGSAITDA--KKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIV  801
            + GAVT+YSG+AITDA  K +PFS+KVG+AQ+LRGGAIVEV++V+QAKIAESAGAC VIV
Sbjct  5    DQGAVTLYSGTAITDAGKKNHPFSVKVGLAQVLRGGAIVEVSSVNQAKIAESAGACSVIV  64

Query  800  SEP--DSRGISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLA  627
            S+P     G+ RMPDP LIKE+KRAVS+PVMA++RVGHFVEAQILE++ VDYIDESE+++
Sbjct  65   SDPVRSRTGVRRMPDPVLIKEVKRAVSVPVMARARVGHFVEAQILESLAVDYIDESEIIS  124

Query  626  IADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKV  447
            +ADED+FINKHNFR PF+CG RD+GEALRR+REGAAMIR QGDL G+GNI +TV++VR +
Sbjct  125  VADEDNFINKHNFRAPFICGCRDIGEALRRIREGAAMIRIQGDLNGTGNISETVKNVRSL  184

Query  446  MGDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQL  267
            MG++RVLNNMD+DEVF+F+KK+ APYD+V QTKQM R+PVV FASGGI+TPADAA+MMQL
Sbjct  185  MGEVRVLNNMDDDEVFSFAKKLKAPYDLVAQTKQMGRVPVVQFASGGIMTPADAALMMQL  244

Query  266  GCDGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKAS-SGLEDAMAGLNLVRAG  96
            GCDG+F+G EVF+  DP+KKV +IVQAV++YNDPHVLA+ S SGLE +M GL+ VR G
Sbjct  245  GCDGVFVGSEVFDGLDPFKKVRSIVQAVQHYNDPHVLAEMSCSGLESSMEGLS-VRGG  301



>ref|XP_006406887.1| hypothetical protein EUTSA_v10021182mg [Eutrema salsugineum]
 gb|ESQ48340.1| hypothetical protein EUTSA_v10021182mg [Eutrema salsugineum]
Length=312

 Score =   448 bits (1152),  Expect = 5e-154, Method: Compositional matrix adjust.
 Identities = 211/285 (74%), Positives = 255/285 (89%), Gaps = 4/285 (1%)
 Frame = -1

Query  974  EDGAVTVYSGSAITDA--KKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIV  801
            + GAVTVYSGSAITDA  K +PFS+KVG+AQ+LRGGAIVEVT+V+QAKIAESAGAC VIV
Sbjct  5    DQGAVTVYSGSAITDAAKKNHPFSVKVGLAQVLRGGAIVEVTSVNQAKIAESAGACSVIV  64

Query  800  SEP--DSRGISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLA  627
            S+P     G+ RMPDP L+KE+KRAVS+PVMA++RVGHFVEAQILE++ VDYIDESE+++
Sbjct  65   SDPVRSLAGVRRMPDPVLVKEVKRAVSVPVMARARVGHFVEAQILESLAVDYIDESEVIS  124

Query  626  IADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKV  447
            +ADE++FINKHNFR PF+CG RD GEALRR+REGAAMIR QG+LTG GNI++TVR+VR +
Sbjct  125  VADEENFINKHNFRSPFICGCRDTGEALRRIREGAAMIRIQGELTGKGNILETVRNVRSL  184

Query  446  MGDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQL  267
            MGD+RVL+NMD+DEVF F+KKI+APYD+V QTKQM R+PVV FASGGI TPADAA+MMQL
Sbjct  185  MGDVRVLSNMDDDEVFTFAKKISAPYDLVAQTKQMGRVPVVQFASGGITTPADAALMMQL  244

Query  266  GCDGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLE  132
            GCDG+F+G EVF+  DP+KKV  IVQAV++YNDPHVLA+ SSGLE
Sbjct  245  GCDGVFVGAEVFDGPDPFKKVRGIVQAVQHYNDPHVLAEMSSGLE  289



>ref|XP_010062464.1| PREDICTED: probable pyridoxal biosynthesis protein PDX1.2 [Eucalyptus 
grandis]
Length=391

 Score =   451 bits (1159),  Expect = 8e-154, Method: Compositional matrix adjust.
 Identities = 215/305 (70%), Positives = 260/305 (85%), Gaps = 6/305 (2%)
 Frame = -1

Query  1016  VSLAHCTEHFAEMAEDGAVTVYSGSAITDAKKNPFSIKVGIAQMLRGGAIVEVTTVDQAK  837
             +S+A   +    MAE+G VTVY+ + + D KKNPFS+KVG+AQMLRGGAI E T+V+QAK
Sbjct  80    LSIAAFRQGIWAMAEEGVVTVYNSNVVADTKKNPFSLKVGMAQMLRGGAIFEATSVEQAK  139

Query  836   IAESAGACCVIVSEPD--SRGISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETV  663
             IAE AGAC V+VS P   + GISRMPDP+LIK++KRAVSIP++A++RVGHFVEAQILE V
Sbjct  140   IAEEAGACSVVVSHPSGAATGISRMPDPSLIKDVKRAVSIPIVARARVGHFVEAQILEAV  199

Query  662   GVDYIDESELLAIADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSG  483
             GVDYIDESE +AIADED++INKHNFR PFVCG R LGEALRR+REGAAMIR QGDL  SG
Sbjct  200   GVDYIDESEAIAIADEDNYINKHNFRSPFVCGCRSLGEALRRMREGAAMIRIQGDLDRSG  259

Query  482   NIVDTVRSVRKVMGDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGI  303
             ++V+TV++VR VMG++RVLNNMD+DEVFAF+KKI APYD+V Q+KQM RLPVVHFA+GGI
Sbjct  260   DVVETVKNVRSVMGEMRVLNNMDDDEVFAFAKKIEAPYDLVAQSKQMGRLPVVHFAAGGI  319

Query  302   VTPADAAIMMQLGCDGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAM  123
             VTPADAA+MMQLGCDG+F+G EVF+CSDPYK+V  IV+ VR+Y DPHVL +  SGL    
Sbjct  320   VTPADAALMMQLGCDGVFVGSEVFDCSDPYKRVQGIVRGVRHYTDPHVLVETCSGL----  375

Query  122   AGLNL  108
             AGL+L
Sbjct  376   AGLHL  380



>ref|XP_004304508.1| PREDICTED: pyridoxal 5'-phosphate synthase-like subunit PDX1.2 
[Fragaria vesca subsp. vesca]
Length=309

 Score =   447 bits (1149),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 212/294 (72%), Positives = 250/294 (85%), Gaps = 4/294 (1%)
 Frame = -1

Query  977  AEDGAVTVYSGSAITDA--KKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVI  804
            ++DGAVT+Y+  A+ DA  KKNP+S+KVG+AQMLRGGAIVEVT  DQAK+AE AGAC VI
Sbjct  3    SQDGAVTIYTSGAVADASKKKNPYSLKVGLAQMLRGGAIVEVTNPDQAKLAEDAGACSVI  62

Query  803  VSEPD--SRGISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELL  630
            VS P   + GI RMPDP+L+K IKRAVSIPVMA+SRVGHFVEAQILE +GVDY+DESE L
Sbjct  63   VSSPRGAAAGILRMPDPSLVKAIKRAVSIPVMARSRVGHFVEAQILEAIGVDYVDESEYL  122

Query  629  AIADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRK  450
            A+ADEDH++NKHNFR PFVCGA  LG+ALRR+REGAA+IRTQGDL+GSGN+  TVR+VR 
Sbjct  123  AVADEDHYVNKHNFRCPFVCGAETLGDALRRIREGAALIRTQGDLSGSGNVARTVRNVRA  182

Query  449  VMGDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQ  270
            +M  IR+LNNMD+DEVFAFSK IAAPYD+V QTKQM RLPVV FASGGIVTPAD  ++MQ
Sbjct  183  IMSQIRMLNNMDDDEVFAFSKSIAAPYDLVAQTKQMGRLPVVQFASGGIVTPADVGLVMQ  242

Query  269  LGCDGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            LGCDG+F+G +VF  +DPYK+V  IV AVRNYNDP VL + SSGL   MAG++L
Sbjct  243  LGCDGVFIGSDVFGVADPYKRVRGIVDAVRNYNDPDVLVETSSGLAGLMAGMSL  296



>ref|XP_010654664.1| PREDICTED: probable pyridoxal biosynthesis protein PDX1.2 [Vitis 
vinifera]
Length=293

 Score =   444 bits (1143),  Expect = 6e-153, Method: Compositional matrix adjust.
 Identities = 215/292 (74%), Positives = 251/292 (86%), Gaps = 1/292 (0%)
 Frame = -1

Query  980  MAEDGAVTVYSGSAITDAKKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIV  801
            MAE+G VTVY   AITD  K  FSIK G+AQMLRGGAI EV  +DQAKIAE AGAC VIV
Sbjct  1    MAEEGVVTVYGSGAITDPAKTSFSIKAGMAQMLRGGAIFEVMNLDQAKIAEEAGACAVIV  60

Query  800  SEPDSRGISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLAIA  621
            SE  S+GISR+ DPA+IKEIKR V+IPV+A++RVGHFVEAQILE +GVDYIDESEL ++A
Sbjct  61   SESVSKGISRLIDPAVIKEIKRRVAIPVIARARVGHFVEAQILEAIGVDYIDESEL-SVA  119

Query  620  DEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKVMG  441
            DED+FINKHNFR PFVCG RDLGEALRRVREGA MIR QGDL+GSGN+ +TVR+VRKVMG
Sbjct  120  DEDNFINKHNFRTPFVCGCRDLGEALRRVREGAVMIRIQGDLSGSGNVAETVRNVRKVMG  179

Query  440  DIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQLGC  261
            DIRVL NMD+DEVFAFSKKI A YD+V QTK+MARLPV+HFA+GGIVTPADAA+MMQLGC
Sbjct  180  DIRVLTNMDDDEVFAFSKKIGAAYDVVAQTKEMARLPVLHFAAGGIVTPADAALMMQLGC  239

Query  260  DGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNLV  105
            DG+ +G ++F  +DPYK+V AIVQAVR+YND  VLA++ S L+ A+A L +V
Sbjct  240  DGVLVGSKIFGSADPYKRVRAIVQAVRHYNDAQVLAESCSELDVAVADLRIV  291



>emb|CAN76358.1| hypothetical protein VITISV_023953 [Vitis vinifera]
Length=293

 Score =   442 bits (1138),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 215/292 (74%), Positives = 249/292 (85%), Gaps = 1/292 (0%)
 Frame = -1

Query  980  MAEDGAVTVYSGSAITDAKKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIV  801
            MAE+G VTVY   AI D  K  FSIK G+AQMLRGGAI EV  +DQAKIAE AGAC VIV
Sbjct  1    MAEEGVVTVYGSGAIXDPAKTSFSIKAGMAQMLRGGAIFEVMNLDQAKIAEEAGACAVIV  60

Query  800  SEPDSRGISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLAIA  621
            SE  S+GISR+ DPA+IKEIKR VSIPV+A++RVGHFVEAQILE  GVDYIDESEL ++A
Sbjct  61   SESXSKGISRLIDPAVIKEIKRRVSIPVIARARVGHFVEAQILEAXGVDYIDESEL-SVA  119

Query  620  DEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKVMG  441
            DED+FINKHNFR PFVCG RDLGEALRRVREGA MIR QGDL+GSGN+ +TVR+VRKVMG
Sbjct  120  DEDNFINKHNFRTPFVCGCRDLGEALRRVREGAVMIRIQGDLSGSGNVAETVRNVRKVMG  179

Query  440  DIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQLGC  261
            DIRVL NMD+DEVFAFSKKI A YD+V QTK+MARLPV+HFA+GGIVTPADAA+MMQLGC
Sbjct  180  DIRVLTNMDDDEVFAFSKKIGAAYDVVAQTKEMARLPVLHFAAGGIVTPADAALMMQLGC  239

Query  260  DGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNLV  105
            DG+ +G ++F  +DPYK+V AIVQAVR+YND  VLA++ S L+ A+A L +V
Sbjct  240  DGVLVGSKIFGSADPYKRVRAIVQAVRHYNDAQVLAESCSELDVAVADLRIV  291



>ref|XP_010535160.1| PREDICTED: probable pyridoxal biosynthesis protein PDX1.2 [Tarenaya 
hassleriana]
Length=300

 Score =   440 bits (1131),  Expect = 5e-151, Method: Compositional matrix adjust.
 Identities = 209/293 (71%), Positives = 254/293 (87%), Gaps = 4/293 (1%)
 Frame = -1

Query  974  EDGAVTVYSGSAITDAKKN--PFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIV  801
            +  A+T+Y GSAITDAK +   FS+K+GIAQMLRGGAIVEV++VDQAKIAESAGAC V+V
Sbjct  5    DQSAMTLYGGSAITDAKNHHHSFSVKIGIAQMLRGGAIVEVSSVDQAKIAESAGACAVVV  64

Query  800  --SEPDSRGISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLA  627
              S P +  I RMPDP L+KE+KRAVS+PVM ++RVGHFVEAQILE++ VDYIDESE+LA
Sbjct  65   VPSGPGAAAIRRMPDPGLVKEVKRAVSVPVMGRARVGHFVEAQILESLAVDYIDESEILA  124

Query  626  IADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKV  447
            IADED+FINKHNFR PF+CG R+LGEALRR+REGAAMIR QG++T +GNI +TVR+VR +
Sbjct  125  IADEDNFINKHNFRSPFICGCRNLGEALRRIREGAAMIRVQGEVTPAGNISETVRNVRTL  184

Query  446  MGDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQL  267
            MGD+R+LNNMDEDEVF F+K I+APYD+VVQTKQM RLPVV FASGGI  PADAA+MMQL
Sbjct  185  MGDVRMLNNMDEDEVFTFAKNISAPYDLVVQTKQMGRLPVVQFASGGITIPADAAMMMQL  244

Query  266  GCDGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            GCDGIF+G E+F+  DP+KK+ +IVQAVR+YNDPHVL + SSGL+ AM  L++
Sbjct  245  GCDGIFVGSEIFDGPDPFKKLRSIVQAVRHYNDPHVLVEMSSGLDTAMGELSI  297



>ref|XP_006847660.1| PREDICTED: probable pyridoxal 5'-phosphate synthase subunit PDX1 
[Amborella trichopoda]
 ref|XP_011624553.1| PREDICTED: probable pyridoxal 5'-phosphate synthase subunit PDX1 
[Amborella trichopoda]
 gb|ERN09241.1| hypothetical protein AMTR_s00149p00021030 [Amborella trichopoda]
Length=309

 Score =   417 bits (1073),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 200/297 (67%), Positives = 245/297 (82%), Gaps = 7/297 (2%)
 Frame = -1

Query  980  MAEDGAVTVYSGSAITDAKKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIV  801
            MA  G VTVY    +T+AKK+ FS+KVG+AQMLRGG I++V   +QA+IAE AGAC V+ 
Sbjct  1    MAGSGVVTVYGNGTLTEAKKSHFSVKVGLAQMLRGGVIMDVVNAEQARIAEEAGACAVMA  60

Query  800  SE---PDSR---GISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDES  639
             E    D R   G++RM DP LIKEIK++V+IPVMAK+R+GHFVEAQILE +G+DY+DES
Sbjct  61   LERVPADIRAEGGVARMSDPGLIKEIKQSVTIPVMAKARIGHFVEAQILEALGIDYVDES  120

Query  638  ELLAIADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRS  459
            E+L  ADEDH INKHNFR+PFVCG R+LGEALRRVREGAAMIRT+G+  G+GNIV+ VR 
Sbjct  121  EVLTPADEDHHINKHNFRIPFVCGCRNLGEALRRVREGAAMIRTKGE-AGTGNIVEAVRH  179

Query  458  VRKVMGDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAI  279
            VR VMGDIR+L NMD+DEVFAF+KKI+APYD+VVQTKQ+ RLPVVHFA+GG+ TPADAA+
Sbjct  180  VRSVMGDIRLLQNMDDDEVFAFAKKISAPYDLVVQTKQLGRLPVVHFAAGGVATPADAAL  239

Query  278  MMQLGCDGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            MMQLGCDG+F+G  +F   DP K+  AIVQAV +Y+DP +LA+ SSGL +AM GLNL
Sbjct  240  MMQLGCDGVFVGSGIFKSGDPAKRARAIVQAVTHYSDPEILAEVSSGLGEAMVGLNL  296



>ref|XP_007205605.1| hypothetical protein PRUPE_ppa009029mg [Prunus persica]
 ref|XP_008243681.1| PREDICTED: pyridoxal biosynthesis protein PDX1.3 [Prunus mume]
 gb|EMJ06804.1| hypothetical protein PRUPE_ppa009029mg [Prunus persica]
Length=309

 Score =   417 bits (1072),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 202/297 (68%), Positives = 244/297 (82%), Gaps = 7/297 (2%)
 Frame = -1

Query  980  MAEDGAVTVYSGSAITDAKKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIV  801
            MA  G V VY   AIT++K++PFS+KVG+AQMLRGG I++V   +QA+IAE AGAC V+ 
Sbjct  1    MAGSGVVAVYGNGAITESKQSPFSVKVGLAQMLRGGVIMDVVNAEQARIAEEAGACAVMA  60

Query  800  SE---PDSR---GISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDES  639
             E    D R   G++RM DP LIKEIK+AV+IPVMAK+R+GHFVEAQILE +GVDY+DES
Sbjct  61   LERVPADIRAQGGVARMSDPQLIKEIKQAVTIPVMAKARIGHFVEAQILEAIGVDYVDES  120

Query  638  ELLAIADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRS  459
            E+L +ADE+H INKHNFRVPFVCG R+LGEALRRVREGAAMIRT+G+  G+GNI++ VR 
Sbjct  121  EVLTLADEEHHINKHNFRVPFVCGCRNLGEALRRVREGAAMIRTKGE-AGTGNIIEAVRH  179

Query  458  VRKVMGDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAI  279
            VR VMGDIRVL NMD+DEVF F+KKIAAPYD+V+QTKQ+ RLPVVHFA+GG+ TPADAA+
Sbjct  180  VRSVMGDIRVLRNMDDDEVFTFAKKIAAPYDLVMQTKQLGRLPVVHFAAGGVATPADAAL  239

Query  278  MMQLGCDGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            MMQLGCDG+F+G  VF   DP K+  AIVQAV +Y DP VLA+ S GL +AM GLNL
Sbjct  240  MMQLGCDGVFVGSGVFKSGDPVKRGRAIVQAVTHYRDPDVLAEVSCGLGEAMVGLNL  296



>ref|XP_008370096.1| PREDICTED: pyridoxal biosynthesis protein PDX1.3 [Malus domestica]
Length=309

 Score =   416 bits (1070),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 200/297 (67%), Positives = 244/297 (82%), Gaps = 7/297 (2%)
 Frame = -1

Query  980  MAEDGAVTVYSGSAITDAKKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIV  801
            MA  G V VY   AI+++K++PFS+KVG+AQMLRGG I++V   +QA++AE AGAC V+ 
Sbjct  1    MAGSGVVAVYGNGAISESKQSPFSVKVGLAQMLRGGVIMDVVNAEQARVAEEAGACAVMA  60

Query  800  SE---PDSR---GISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDES  639
             E    D R   G++RM DP LIKEIK+AV+IPVMAK+R+GHFVEAQILE +GVDY+DES
Sbjct  61   LERVPADIRAQGGVARMSDPQLIKEIKQAVTIPVMAKARIGHFVEAQILEAIGVDYVDES  120

Query  638  ELLAIADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRS  459
            E+L +ADE+H INKHNFRVPFVCG R+LGEALRRVREGAAMIRT+G+  G+GNI++ VR 
Sbjct  121  EVLTLADEEHHINKHNFRVPFVCGCRNLGEALRRVREGAAMIRTKGE-AGTGNIIEAVRH  179

Query  458  VRKVMGDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAI  279
            VR VMGDIRVL NMD+DEVF F+KKIAAPYD+V+QTKQ+ RLPVVHFA+GG+ TPADAA+
Sbjct  180  VRSVMGDIRVLRNMDDDEVFTFAKKIAAPYDLVMQTKQLGRLPVVHFAAGGVATPADAAL  239

Query  278  MMQLGCDGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            MMQLGCDG+F+G  VF   DP K+  AIVQAV +Y DP VLA+ S GL +AM GLNL
Sbjct  240  MMQLGCDGVFVGSGVFKSGDPAKRARAIVQAVTHYRDPDVLAEVSCGLGEAMVGLNL  296



>ref|XP_010691316.1| PREDICTED: probable pyridoxal biosynthesis protein PDX1.2 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010691317.1| PREDICTED: probable pyridoxal biosynthesis protein PDX1.2 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010691318.1| PREDICTED: probable pyridoxal biosynthesis protein PDX1.2 [Beta 
vulgaris subsp. vulgaris]
Length=302

 Score =   415 bits (1066),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 203/298 (68%), Positives = 245/298 (82%), Gaps = 12/298 (4%)
 Frame = -1

Query  980  MAEDGAVTVYSGSAIT-----DAKKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGA  816
            MA+DG V +Y G+ IT     +   NP+SIKVG+ Q+LRGGAIVE++   QAKIAE+AGA
Sbjct  1    MADDGVVVLYDGTIITTDQPTNPNPNPYSIKVGLTQILRGGAIVEISDPTQAKIAENAGA  60

Query  815  CCV-IVSEPDSRGISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDES  639
            CC+ IV +       RM +P+LIK+IKR VSIPV+ KSRVGHFVEAQI+E+ G DYIDE+
Sbjct  61   CCISIVGDH-----GRMSNPSLIKQIKRTVSIPVIGKSRVGHFVEAQIIESSGSDYIDEN  115

Query  638  ELLAIADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRS  459
            E+L IADED+FINKHNFRVPF+CG R+LG ALRR+REGAAMIRTQGDL+GSGNI +TV +
Sbjct  116  EVLLIADEDNFINKHNFRVPFICGTRNLGGALRRIREGAAMIRTQGDLSGSGNIAETVGN  175

Query  458  VRKVMGDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAI  279
            VRK+MG +R+LNNMD+DEVF F+K I APYD+V QTKQM RLPVVHFASGGIVTPADAA+
Sbjct  176  VRKIMGHVRMLNNMDDDEVFTFAKNIGAPYDLVAQTKQMGRLPVVHFASGGIVTPADAAL  235

Query  278  MMQLGCDGIFLGPEVFN-CSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            MMQLGCDG+F+G EVF+  SDP+K+V AIV+AVRNYNDP VL    +G  DAMA LN+
Sbjct  236  MMQLGCDGVFIGVEVFDGVSDPFKRVRAIVEAVRNYNDPAVLVDVCTGFSDAMARLNV  293



>ref|XP_009377760.1| PREDICTED: pyridoxal biosynthesis protein PDX1.3 [Pyrus x bretschneideri]
Length=309

 Score =   415 bits (1067),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 199/297 (67%), Positives = 244/297 (82%), Gaps = 7/297 (2%)
 Frame = -1

Query  980  MAEDGAVTVYSGSAITDAKKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIV  801
            MA  G V VY   AI+++K++PFS+KVG+AQMLRGG I++V   +QA++AE AGAC V+ 
Sbjct  1    MAGSGVVAVYGNGAISESKQSPFSVKVGLAQMLRGGVIMDVVNAEQARVAEEAGACAVMA  60

Query  800  SE---PDSR---GISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDES  639
             E    D R   G++RM DP LIKEIK+AV+IPVMAK+R+GHFVEAQILE +GVDY+DES
Sbjct  61   LERVPADIRAQGGVARMSDPQLIKEIKQAVTIPVMAKARIGHFVEAQILEAIGVDYVDES  120

Query  638  ELLAIADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRS  459
            E+L +ADE+H INKHNFRVPFVCG R+LGEALRRVREGAAMIRT+G+  G+GNI++ VR 
Sbjct  121  EVLTLADEEHHINKHNFRVPFVCGCRNLGEALRRVREGAAMIRTKGE-AGTGNIIEAVRH  179

Query  458  VRKVMGDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAI  279
            VR VMG+IRVL NMD+DEVF F+KKIAAPYD+V+QTKQ+ RLPVVHFA+GG+ TPADAA+
Sbjct  180  VRSVMGNIRVLRNMDDDEVFTFAKKIAAPYDLVMQTKQLGRLPVVHFAAGGVATPADAAL  239

Query  278  MMQLGCDGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            MMQLGCDG+F+G  VF   DP K+  AIVQAV +Y DP VLA+ S GL +AM GLNL
Sbjct  240  MMQLGCDGVFVGSGVFKSGDPAKRARAIVQAVTHYQDPDVLAEVSCGLGEAMVGLNL  296



>ref|XP_008390695.1| PREDICTED: pyridoxal biosynthesis protein PDX1.3-like [Malus 
domestica]
Length=309

 Score =   415 bits (1067),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 200/297 (67%), Positives = 242/297 (81%), Gaps = 7/297 (2%)
 Frame = -1

Query  980  MAEDGAVTVYSGSAITDAKKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIV  801
            MA  G V VY   AI ++K++PFS+KVG+AQMLRGG I++V   DQA++AE AGAC V+ 
Sbjct  1    MAGSGVVAVYGNGAIAESKQSPFSVKVGLAQMLRGGVIMDVVNADQARVAEEAGACAVMA  60

Query  800  SE---PDSR---GISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDES  639
             E    D R   G++RM DP LIKEIK+AV+IPVMAK+R+GHFVEAQILE +GVDY+DES
Sbjct  61   LERVPADIRAQGGVARMSDPQLIKEIKQAVTIPVMAKARIGHFVEAQILEAIGVDYVDES  120

Query  638  ELLAIADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRS  459
            E+L +ADE+H INKHNFRVPFVCG R+LGEALRRVREGAAMIRT+G+  G+GNI++ VR 
Sbjct  121  EVLTLADEEHHINKHNFRVPFVCGCRNLGEALRRVREGAAMIRTKGE-AGTGNIIEAVRH  179

Query  458  VRKVMGDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAI  279
            VR VMGDIRVL NMD+DEVF F+KKIAAPYD+V+QTKQ+ RLPVVHFA+GG+ TPADAA+
Sbjct  180  VRSVMGDIRVLRNMDDDEVFTFAKKIAAPYDLVMQTKQLGRLPVVHFAAGGVATPADAAL  239

Query  278  MMQLGCDGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            MMQLGCDG+F+G  VF   DP K+  AIVQAV +Y DP VL + S GL +AM GLNL
Sbjct  240  MMQLGCDGVFVGSGVFKSGDPAKRARAIVQAVTHYRDPDVLVEVSCGLGEAMVGLNL  296



>ref|XP_004485941.1| PREDICTED: pyridoxal biosynthesis protein PDX1.3-like [Cicer 
arietinum]
Length=309

 Score =   415 bits (1066),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 199/297 (67%), Positives = 244/297 (82%), Gaps = 7/297 (2%)
 Frame = -1

Query  980  MAEDGAVTVYSGSAITDAKKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIV  801
            M   G VTVY   AIT+ KK+PFS+KVG+AQMLRGG I++V   +QA+IAE AGAC V+ 
Sbjct  1    MEGSGVVTVYGNGAITETKKSPFSVKVGLAQMLRGGVIMDVVNAEQARIAEEAGACAVMA  60

Query  800  SE---PDSR---GISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDES  639
             E    D R   G++RM DP LIKEIK+AV+IPVMAK+R+GHFVEAQILE +G+DY+DES
Sbjct  61   LERVPADIRAQGGVARMSDPQLIKEIKQAVTIPVMAKARIGHFVEAQILEHLGIDYVDES  120

Query  638  ELLAIADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRS  459
            E+L +ADED+ INKHNFR+PFVCG R+LGEALRR+REGAAMIRT+G+  G+GNI++ VR 
Sbjct  121  EVLTLADEDNHINKHNFRIPFVCGCRNLGEALRRIREGAAMIRTKGE-AGTGNIIEAVRH  179

Query  458  VRKVMGDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAI  279
            VR VMGDIRVL NMD+DEVF F+KKIAAPYD+V+QTKQ+ RLPVVHFA+GG+ TPADAA+
Sbjct  180  VRSVMGDIRVLRNMDDDEVFTFAKKIAAPYDLVMQTKQLGRLPVVHFAAGGVATPADAAL  239

Query  278  MMQLGCDGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            MMQLGCDG+F+G  VF   DP K+  AIVQAV +Y+DP VLA+ S GL +AM G+NL
Sbjct  240  MMQLGCDGVFVGSGVFKSGDPAKRARAIVQAVTHYSDPEVLAEVSCGLGEAMVGINL  296



>gb|AAZ67141.1| pyridoxine biosynthesis protein [Lotus japonicus]
Length=310

 Score =   414 bits (1065),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 203/298 (68%), Positives = 246/298 (83%), Gaps = 8/298 (3%)
 Frame = -1

Query  980  MAEDGAVTVY-SGSAITDAKKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVI  804
            M   G VTVY +G+AIT+ KK+PFS+KVG+AQMLRGG I++V    QA+IAE AGAC V+
Sbjct  1    MEGSGVVTVYGNGAAITETKKSPFSVKVGLAQMLRGGVIMDVVNAQQARIAEEAGACAVM  60

Query  803  VSE---PDSR---GISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDE  642
              E    D R   G++RM DP LIKEIK+AV+IPVMAK+R+GHFVEAQILE +GVDY+DE
Sbjct  61   ALERVPADIRAQGGVARMSDPQLIKEIKQAVTIPVMAKARIGHFVEAQILEAIGVDYVDE  120

Query  641  SELLAIADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVR  462
            SE+L +ADED+ INKHNFR+PFVCG R+LGEALRRVREGAAMIRT+G+  G+GNIV+ VR
Sbjct  121  SEVLTLADEDNHINKHNFRIPFVCGCRNLGEALRRVREGAAMIRTKGE-AGTGNIVEAVR  179

Query  461  SVRKVMGDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAA  282
             VR VMGDIRVL NMD+DEVF F+KKIAAPYD+V+QTKQ+ RLPVVHFA+GG+ TPADAA
Sbjct  180  HVRSVMGDIRVLRNMDDDEVFTFAKKIAAPYDLVMQTKQLGRLPVVHFAAGGVATPADAA  239

Query  281  IMMQLGCDGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            +MMQLGCDG+F+G  VF   DP K+  AIVQAV +Y+DP +LA+ S GL +AM GLNL
Sbjct  240  LMMQLGCDGVFVGSGVFKSGDPAKRARAIVQAVTHYSDPGLLAEISCGLGEAMVGLNL  297



>ref|XP_010253907.1| PREDICTED: probable pyridoxal biosynthesis protein PDX1 [Nelumbo 
nucifera]
Length=309

 Score =   414 bits (1064),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 197/297 (66%), Positives = 246/297 (83%), Gaps = 7/297 (2%)
 Frame = -1

Query  980  MAEDGAVTVYSGSAITDAKKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIV  801
            MA  G VTVY   A+T+AK +PFS+KVG+AQMLRGG I++V   +QA+IAE AGAC V+ 
Sbjct  1    MAGTGVVTVYGNGALTEAKTSPFSVKVGLAQMLRGGVIMDVVNAEQARIAEEAGACAVMA  60

Query  800  SE---PDSR---GISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDES  639
             E    D R   G++RM DP LIKEIK+AV+IPVMAK+R+GHFVEAQILE +GVDY+DES
Sbjct  61   LERVPADIRAQGGVARMSDPGLIKEIKQAVTIPVMAKARIGHFVEAQILEAIGVDYVDES  120

Query  638  ELLAIADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRS  459
            E+L +AD+++ INKHNFR+PFVCG R+LGEALRR+REGAAMIRT+G+  G+GNI++ VR 
Sbjct  121  EVLTVADDENHINKHNFRIPFVCGCRNLGEALRRIREGAAMIRTKGE-AGTGNIIEAVRH  179

Query  458  VRKVMGDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAI  279
            VR VMGDIRVL NMD+DEVFAF+KKI+APYD+V+QTKQ+ RLPVVHFA+GG+ TPADAA+
Sbjct  180  VRSVMGDIRVLRNMDDDEVFAFAKKISAPYDLVMQTKQLGRLPVVHFAAGGVATPADAAL  239

Query  278  MMQLGCDGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            MMQLGCDG+F+G  VF   DP ++  AIVQAV +Y+DP +LA+ S GL +AM GLNL
Sbjct  240  MMQLGCDGVFVGSGVFKSGDPARRARAIVQAVTHYSDPEILAEVSCGLGEAMVGLNL  296



>ref|XP_010037698.1| PREDICTED: pyridoxal biosynthesis protein PDX1.3 [Eucalyptus 
grandis]
 gb|KCW49454.1| hypothetical protein EUGRSUZ_K02981 [Eucalyptus grandis]
Length=309

 Score =   414 bits (1063),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 201/300 (67%), Positives = 244/300 (81%), Gaps = 7/300 (2%)
 Frame = -1

Query  980  MAEDGAVTVYSGSAITDAKKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIV  801
            MA  G V VY   A+T+AKK+ FS+KVG+AQMLRGG I++V   DQA++AE AGAC V+ 
Sbjct  1    MAGTGVVAVYGNGALTEAKKSTFSVKVGLAQMLRGGVIMDVVNADQARVAEEAGACAVMA  60

Query  800  SE---PDSR---GISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDES  639
             E    D R   G++RM DP LIKEIK+AV+IPVMAK+R+GHFVEAQILE +GVDY+DES
Sbjct  61   LERVPADIRAQGGVARMSDPQLIKEIKQAVTIPVMAKARIGHFVEAQILEAIGVDYVDES  120

Query  638  ELLAIADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRS  459
            E+L +ADED+ INKHNFRVPFVCG R+LGEALRRVREGAAMIRT+G+  G+GN+V+ VR 
Sbjct  121  EVLTLADEDNHINKHNFRVPFVCGCRNLGEALRRVREGAAMIRTKGE-AGTGNVVEAVRH  179

Query  458  VRKVMGDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAI  279
            VR VMGDIRVL NMD+DEVF F+KKIAAPYD+V+QTKQ+ RLPVV FA+GG+ TPADAA+
Sbjct  180  VRSVMGDIRVLRNMDDDEVFTFAKKIAAPYDLVMQTKQLGRLPVVQFAAGGVATPADAAL  239

Query  278  MMQLGCDGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNLVRA  99
            MMQLGCDG+F+G  VF   DP K+  AIVQAV +Y+DP +LA+ S GL +AM GLNL  A
Sbjct  240  MMQLGCDGVFVGSGVFKSGDPAKRARAIVQAVTHYSDPEMLAEVSCGLGEAMVGLNLTDA  299



>ref|XP_002278391.1| PREDICTED: probable pyridoxal biosynthesis protein PDX1 [Vitis 
vinifera]
Length=309

 Score =   413 bits (1061),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 196/297 (66%), Positives = 246/297 (83%), Gaps = 7/297 (2%)
 Frame = -1

Query  980  MAEDGAVTVYSGSAITDAKKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIV  801
            MA  G VTVY   AIT+ KK+PFS+KVG+AQMLRGG I++V   +QA+IAE AGAC V+ 
Sbjct  1    MAGSGVVTVYGNGAITETKKSPFSVKVGLAQMLRGGVIMDVVNAEQARIAEEAGACAVMA  60

Query  800  SE---PDSR---GISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDES  639
             E    D R   G++RM DP+LIKEIK+AV+IPVMAK+R+GHFVEAQILE +G+DY+DES
Sbjct  61   LERVPADIRAQGGVARMSDPSLIKEIKQAVTIPVMAKARIGHFVEAQILEAIGIDYVDES  120

Query  638  ELLAIADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRS  459
            E+L +ADED+ INKHNFR+PFVCG R+LGEALRR+REGAAMIRT+G+  G+GNIV+ VR 
Sbjct  121  EVLTVADEDNHINKHNFRIPFVCGCRNLGEALRRIREGAAMIRTKGE-AGTGNIVEAVRH  179

Query  458  VRKVMGDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAI  279
            VR VMG+IRVL NMD+DEVF ++KK++APYD+V+QTKQ+ RLPVVHFA+GG+ TPADAA+
Sbjct  180  VRSVMGEIRVLRNMDDDEVFTYAKKLSAPYDLVMQTKQLGRLPVVHFAAGGVATPADAAL  239

Query  278  MMQLGCDGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            MMQLGCDG+F+G  VF   DP ++  AIVQAV +Y+DP VLA+ S GL +AM G+NL
Sbjct  240  MMQLGCDGVFVGSGVFKSGDPARRARAIVQAVTHYSDPDVLAEVSCGLGEAMVGINL  296



>gb|KCW69605.1| hypothetical protein EUGRSUZ_F03024 [Eucalyptus grandis]
Length=293

 Score =   412 bits (1059),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 199/293 (68%), Positives = 243/293 (83%), Gaps = 1/293 (0%)
 Frame = -1

Query  980  MAEDGAVTVYSGSAITDAKKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIV  801
            MAE+G VTVY+ + + D KKNPFS+KVG+AQMLRGGAI +VT+V+QAKIAE AGAC V+V
Sbjct  1    MAEEGVVTVYNSNVVADTKKNPFSLKVGMAQMLRGGAIFKVTSVEQAKIAEKAGACSVVV  60

Query  800  SEPDSRGISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLAIA  621
            SEP S  + RMPDP+LIK++KRAVSIP++A++R+GHFVEAQILE +GVDYIDESE L IA
Sbjct  61   SEP-SWDVRRMPDPSLIKDVKRAVSIPIVAQARIGHFVEAQILEAIGVDYIDESEALDIA  119

Query  620  DEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKVMG  441
            DED++INKHNFR PFVC  R+LGEALRRV EGAAMIRT     G G++ +TV++VR VMG
Sbjct  120  DEDNYINKHNFRSPFVCEGRNLGEALRRVSEGAAMIRTTVFSYGYGDLAETVKNVRSVMG  179

Query  440  DIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQLGC  261
            + RVLNNMD+DEVFAF+K+I AP D+V QTKQM RLPVVHFA+G  VTPADAA+MMQLGC
Sbjct  180  ETRVLNNMDDDEVFAFAKEIEAPNDLVAQTKQMGRLPVVHFAAGRFVTPADAALMMQLGC  239

Query  260  DGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNLVR  102
            D +F+  ++ N SDP K+V  IV+ VR+Y DPHVLA+  SGL+D MAG   VR
Sbjct  240  DCVFVDSDIVNFSDPCKRVQGIVRGVRHYTDPHVLAETCSGLKDIMAGSITVR  292



>ref|XP_010553115.1| PREDICTED: pyridoxal biosynthesis protein PDX1.3-like [Tarenaya 
hassleriana]
Length=309

 Score =   412 bits (1059),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 197/297 (66%), Positives = 243/297 (82%), Gaps = 7/297 (2%)
 Frame = -1

Query  980  MAEDGAVTVYSGSAITDAKKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIV  801
            M   G V VY   AIT+ KK+PFS+KVG+AQMLRGG I++V T +QA+IAE AGAC V+ 
Sbjct  1    MEGTGVVAVYGNGAITETKKSPFSVKVGLAQMLRGGVIMDVVTPEQARIAEEAGACAVMA  60

Query  800  SE---PDSR---GISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDES  639
             E    D R   G++RM DP LIKEIK+AV+IPVMAK+R+GHFVEAQILE +G+DY+DES
Sbjct  61   LERVPADIRAQGGVARMSDPQLIKEIKQAVTIPVMAKARIGHFVEAQILEAIGIDYVDES  120

Query  638  ELLAIADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRS  459
            E+L +ADEDH INKHNFR+PFVCG R+LGEALRR+REGAAMIRT+G+  G+GNIV+ VR 
Sbjct  121  EVLTLADEDHHINKHNFRIPFVCGCRNLGEALRRIREGAAMIRTKGE-AGTGNIVEAVRH  179

Query  458  VRKVMGDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAI  279
            VR V GDIRVL NMD+DEVF F+KKIAAPYD+V+QTKQ+ RLPVV FA+GG+ TPADAA+
Sbjct  180  VRSVTGDIRVLRNMDDDEVFTFAKKIAAPYDLVMQTKQLGRLPVVQFAAGGVATPADAAL  239

Query  278  MMQLGCDGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            MMQLGCDG+F+G  +F   DP ++  AIVQAV +Y+DP +LA+ SSGL +AM G+NL
Sbjct  240  MMQLGCDGVFVGSGIFKSGDPARRARAIVQAVTHYSDPEMLAEVSSGLGEAMVGINL  296



>ref|XP_002308219.1| pyridoxin biosynthesis PDX1-like protein 3 [Populus trichocarpa]
 gb|EEE91742.1| pyridoxin biosynthesis PDX1-like protein 3 [Populus trichocarpa]
Length=309

 Score =   412 bits (1058),  Expect = 9e-140, Method: Compositional matrix adjust.
 Identities = 197/297 (66%), Positives = 243/297 (82%), Gaps = 7/297 (2%)
 Frame = -1

Query  980  MAEDGAVTVYSGSAITDAKKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIV  801
            MA  G V VY    IT+ KK+PFS+KVG+AQMLRGG I++V T +QA+IAE AGAC V+ 
Sbjct  1    MAGTGVVAVYGNGTITETKKSPFSVKVGLAQMLRGGVIMDVVTAEQARIAEEAGACAVMA  60

Query  800  SE---PDSR---GISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDES  639
             E    D R   G++RM DP LIKEIK+AV+IPVMAK+R+GHFVEAQILE +GVDY+DES
Sbjct  61   LERVPADIRAQGGVARMSDPQLIKEIKQAVTIPVMAKARIGHFVEAQILEAIGVDYVDES  120

Query  638  ELLAIADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRS  459
            E+L +ADED+ INKHNFR+PFVCG R+LGEALRR+REGAAMIRT+G+  G+GN+++ VR 
Sbjct  121  EVLTLADEDNHINKHNFRIPFVCGCRNLGEALRRIREGAAMIRTKGE-AGTGNVIEAVRH  179

Query  458  VRKVMGDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAI  279
            VR VMGDIR+L NMD+DEVF F+KKIAAPYD+V+QTKQ+ RLPVV FA+GG+ TPADAA+
Sbjct  180  VRSVMGDIRMLRNMDDDEVFTFAKKIAAPYDLVMQTKQLGRLPVVQFAAGGVATPADAAL  239

Query  278  MMQLGCDGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            MMQLGCDG+F+G  VF   DP K+  AIVQAV +Y+DP +LA+ S GL +AM GLNL
Sbjct  240  MMQLGCDGVFVGSGVFKSGDPVKRGRAIVQAVTHYSDPELLAEVSCGLGEAMVGLNL  296



>ref|XP_010062465.1| PREDICTED: probable pyridoxal biosynthesis protein PDX1.2 [Eucalyptus 
grandis]
Length=368

 Score =   413 bits (1062),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 200/301 (66%), Positives = 245/301 (81%), Gaps = 1/301 (0%)
 Frame = -1

Query  1004  HCTEHFAEMAEDGAVTVYSGSAITDAKKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAES  825
             H      +MAE+G VTVY+ + + D KKNPFS+KVG+AQMLRGGAI +VT+V+QAKIAE 
Sbjct  68    HSCRTSGQMAEEGVVTVYNSNVVADTKKNPFSLKVGMAQMLRGGAIFKVTSVEQAKIAEK  127

Query  824   AGACCVIVSEPDSRGISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYID  645
             AGAC V+VSEP S  + RMPDP+LIK++KRAVSIP++A++R+GHFVEAQILE +GVDYID
Sbjct  128   AGACSVVVSEP-SWDVRRMPDPSLIKDVKRAVSIPIVAQARIGHFVEAQILEAIGVDYID  186

Query  644   ESELLAIADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTV  465
             ESE L IADED++INKHNFR PFVC  R+LGEALRRV EGAAMIRT     G G++ +TV
Sbjct  187   ESEALDIADEDNYINKHNFRSPFVCEGRNLGEALRRVSEGAAMIRTTVFSYGYGDLAETV  246

Query  464   RSVRKVMGDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADA  285
             ++VR VMG+ RVLNNMD+DEVFAF+K+I AP D+V QTKQM RLPVVHFA+G  VTPADA
Sbjct  247   KNVRSVMGETRVLNNMDDDEVFAFAKEIEAPNDLVAQTKQMGRLPVVHFAAGRFVTPADA  306

Query  284   AIMMQLGCDGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNLV  105
             A+MMQLGCD +F+  ++ N SDP K+V  IV+ VR+Y DPHVLA+  SGL+D MAG   V
Sbjct  307   ALMMQLGCDCVFVDSDIVNFSDPCKRVQGIVRGVRHYTDPHVLAETCSGLKDIMAGSITV  366

Query  104   R  102
             R
Sbjct  367   R  367



>ref|XP_011019114.1| PREDICTED: probable pyridoxal biosynthesis protein PDX1 [Populus 
euphratica]
 ref|XP_011019115.1| PREDICTED: probable pyridoxal biosynthesis protein PDX1 [Populus 
euphratica]
Length=309

 Score =   411 bits (1056),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 197/297 (66%), Positives = 243/297 (82%), Gaps = 7/297 (2%)
 Frame = -1

Query  980  MAEDGAVTVYSGSAITDAKKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIV  801
            MA  G V VY    IT+ KK+PFS+KVG+AQMLRGG I++V T +QA+IAE AGAC V+ 
Sbjct  1    MAGTGVVAVYGNGTITETKKSPFSVKVGLAQMLRGGVIMDVVTAEQARIAEEAGACAVMA  60

Query  800  SE---PDSR---GISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDES  639
             E    D R   G++RM DP LIKEIK+AV+IPVMAK+R+GHFVEAQILE +GVDY+DES
Sbjct  61   LERVPADIRAQGGVARMSDPQLIKEIKQAVTIPVMAKARIGHFVEAQILEAIGVDYVDES  120

Query  638  ELLAIADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRS  459
            E+L +ADE++ INKHNFR+PFVCG R+LGEALRR+REGAAMIRT+G+  G+GN+++ VR 
Sbjct  121  EVLTLADEENHINKHNFRIPFVCGCRNLGEALRRIREGAAMIRTKGE-AGTGNVIEAVRH  179

Query  458  VRKVMGDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAI  279
            VR VMGDIR+L NMD+DEVF F+KKIAAPYD+V+QTKQ+ RLPVV FA+GG+ TPADAA+
Sbjct  180  VRSVMGDIRMLRNMDDDEVFTFAKKIAAPYDLVMQTKQLGRLPVVQFAAGGVATPADAAL  239

Query  278  MMQLGCDGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            MMQLGCDG+F+G  VF   DP K+  AIVQAV +Y+DP VLA+ S GL +AM GLNL
Sbjct  240  MMQLGCDGVFVGSGVFKSGDPVKRGRAIVQAVTHYSDPEVLAEVSCGLGEAMVGLNL  296



>gb|KJB36918.1| hypothetical protein B456_006G182600 [Gossypium raimondii]
 gb|KJB36919.1| hypothetical protein B456_006G182600 [Gossypium raimondii]
 gb|KJB36920.1| hypothetical protein B456_006G182600 [Gossypium raimondii]
Length=309

 Score =   411 bits (1056),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 196/297 (66%), Positives = 244/297 (82%), Gaps = 7/297 (2%)
 Frame = -1

Query  980  MAEDGAVTVYSGSAITDAKKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIV  801
            MA  G V VY   AIT+  K+PFS+KVG+AQMLRGG I++V T DQA+IAE AGAC V+ 
Sbjct  1    MAGTGVVAVYGNGAITETHKSPFSVKVGLAQMLRGGVIMDVVTPDQARIAEEAGACAVMA  60

Query  800  SE---PDSR---GISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDES  639
             E    D R   G++RM DP LIKEIK++V+IPVMAK+R+GHFVEAQILE +G+DY+DES
Sbjct  61   LERVPADIRAQGGVARMSDPQLIKEIKQSVTIPVMAKARIGHFVEAQILEAIGIDYVDES  120

Query  638  ELLAIADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRS  459
            E+L +ADE++ INKHNFR+PFVCG R+LGEALRR+REGAAMIRT+G+  G+GNI++ VR 
Sbjct  121  EVLTLADEENHINKHNFRIPFVCGCRNLGEALRRIREGAAMIRTKGE-AGTGNIIEAVRH  179

Query  458  VRKVMGDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAI  279
            VR VMGDIR+L NMD+DEVF+F+KKI +PYD+VVQTKQ+ RLPVVHFA+GG+ TPADAA+
Sbjct  180  VRSVMGDIRILRNMDDDEVFSFAKKIQSPYDLVVQTKQLGRLPVVHFAAGGVATPADAAL  239

Query  278  MMQLGCDGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            MMQLGCDG+F+G  VF   DP ++  AIVQAV +Y+DP VLA+ S GL +AM GLNL
Sbjct  240  MMQLGCDGVFVGSGVFKSGDPARRARAIVQAVTHYSDPAVLAEVSCGLGEAMVGLNL  296



>ref|XP_002525650.1| Pyridoxin biosynthesis protein PDX1, putative [Ricinus communis]
 gb|EEF36768.1| Pyridoxin biosynthesis protein PDX1, putative [Ricinus communis]
Length=327

 Score =   411 bits (1057),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 199/298 (67%), Positives = 244/298 (82%), Gaps = 8/298 (3%)
 Frame = -1

Query  980  MAEDGAVTVYSGSAITDA-KKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVI  804
            MA+ G VTVY   A+ +  KK+PFS+KVG+AQMLRGG I++V   +QA+IAE AGAC V+
Sbjct  1    MADTGVVTVYGNGALYETTKKSPFSVKVGLAQMLRGGVIMDVVNAEQARIAEEAGACAVM  60

Query  803  VSE---PDSR---GISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDE  642
              E    D R   G++RM DP LIKEIK+AV+IPVMAK+R+GHFVEAQILE VG+DYIDE
Sbjct  61   ALERVPADIRAQGGVARMSDPQLIKEIKQAVTIPVMAKARIGHFVEAQILEAVGIDYIDE  120

Query  641  SELLAIADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVR  462
            SE+L +ADED+ INKHNFR+PFVCG R+LGEALRR+REGAAMIRT+G+  G+GNI++ VR
Sbjct  121  SEVLTVADEDNHINKHNFRIPFVCGCRNLGEALRRIREGAAMIRTKGE-AGTGNIIEAVR  179

Query  461  SVRKVMGDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAA  282
             VR VMGDIRVL NMD+DEVF F+KKIAAPYD+V+QTKQ+ RLPVV FA+GG+ TPADAA
Sbjct  180  HVRSVMGDIRVLRNMDDDEVFTFAKKIAAPYDLVMQTKQLGRLPVVQFAAGGVATPADAA  239

Query  281  IMMQLGCDGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            +MMQLGCDG+F+G  VF   DP ++  AIVQAV +Y DPHVLA+ S GL +AM G+NL
Sbjct  240  LMMQLGCDGVFVGSGVFKSGDPARRARAIVQAVTHYTDPHVLAEVSCGLGEAMVGINL  297



>ref|XP_004137720.1| PREDICTED: probable pyridoxal 5'-phosphate synthase subunit PDX1 
[Cucumis sativus]
 ref|XP_008442417.1| PREDICTED: probable pyridoxal biosynthesis protein PDX1 [Cucumis 
melo]
 gb|ADN33796.1| pyridoxal biosynthesis protein [Cucumis melo subsp. melo]
 gb|KGN58759.1| hypothetical protein Csa_3G731210 [Cucumis sativus]
Length=308

 Score =   410 bits (1055),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 194/297 (65%), Positives = 243/297 (82%), Gaps = 7/297 (2%)
 Frame = -1

Query  980  MAEDGAVTVYSGSAITDAKKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIV  801
            MA  G V VY   A+T+ K++PFS+KVG+AQMLRGG I++V   +QA++AE AGAC V+ 
Sbjct  1    MAGSGVVAVYGNGALTETKQSPFSVKVGLAQMLRGGVIMDVVNAEQARVAEEAGACAVMA  60

Query  800  SE---PDSR---GISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDES  639
             E    D R   G++RM DP LIKEIK+AV+IPVMAK+R+GHFVEAQILE +G+DY+DES
Sbjct  61   LERVPADIRAQGGVARMSDPQLIKEIKQAVTIPVMAKARIGHFVEAQILEAIGIDYVDES  120

Query  638  ELLAIADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRS  459
            E+L +ADE++ INKHNFR+PFVCG R+LGEALRR+REGAAMIRT+G+  G+GNI++ VR 
Sbjct  121  EVLTLADEENHINKHNFRIPFVCGCRNLGEALRRIREGAAMIRTKGE-AGTGNIIEAVRH  179

Query  458  VRKVMGDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAI  279
            VR VMGDIR+L NMD+DEVF F+KKIAAPYD+V+QTKQ+ RLPVV FA+GG+ TPADAA+
Sbjct  180  VRSVMGDIRLLRNMDDDEVFTFAKKIAAPYDLVLQTKQLGRLPVVQFAAGGVATPADAAL  239

Query  278  MMQLGCDGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            MMQLGCDG+F+G  VF   DP ++  AIVQAV +YNDP VLA+ S GL +AM GLNL
Sbjct  240  MMQLGCDGVFVGSGVFKSGDPARRARAIVQAVTHYNDPEVLAEVSCGLGEAMVGLNL  296



>ref|XP_010558377.1| PREDICTED: pyridoxal biosynthesis protein PDX1.3 [Tarenaya hassleriana]
Length=309

 Score =   410 bits (1055),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 197/297 (66%), Positives = 244/297 (82%), Gaps = 7/297 (2%)
 Frame = -1

Query  980  MAEDGAVTVYSGSAITDAKKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIV  801
            M   G V VY   AIT+AKK+PFS+KVG+AQMLRGG I++V T +QA+IAE AGAC V+ 
Sbjct  1    MEGTGVVAVYGNGAITEAKKSPFSVKVGLAQMLRGGVIMDVVTPEQARIAEEAGACAVMA  60

Query  800  SE---PDSR---GISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDES  639
             E    D R   G++RM DP LIKEIK+AV+IPVMAK+R+GHFVEAQILE +G+DY+DES
Sbjct  61   LERVPADIRAQGGVARMSDPQLIKEIKQAVTIPVMAKARIGHFVEAQILEAIGIDYVDES  120

Query  638  ELLAIADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRS  459
            E+L +ADED+ INKHNFR+PFVCG R+LGEALRR+REGAAMIRT+G+  G+GNIV+ VR 
Sbjct  121  EVLTLADEDNHINKHNFRIPFVCGCRNLGEALRRIREGAAMIRTKGE-AGTGNIVEAVRH  179

Query  458  VRKVMGDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAI  279
            VR VMGDIRVL NMD+DEVF F+KKIAAPYD+V+QTKQ+ RLPVV FA+GG+ TPADAA+
Sbjct  180  VRSVMGDIRVLRNMDDDEVFTFAKKIAAPYDLVMQTKQLGRLPVVQFAAGGVATPADAAL  239

Query  278  MMQLGCDGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            MMQLGCDG+F+G  +F   DP ++  AIVQAV +Y+DP +LA+ S GL +AM G+NL
Sbjct  240  MMQLGCDGVFVGSGIFKSGDPARRARAIVQAVTHYSDPEMLAEVSCGLGEAMVGINL  296



>ref|XP_002322981.1| pyridoxin biosynthesis PDX1-like protein 3 [Populus trichocarpa]
 gb|EEF04742.1| pyridoxin biosynthesis PDX1-like protein 3 [Populus trichocarpa]
Length=309

 Score =   410 bits (1054),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 199/297 (67%), Positives = 243/297 (82%), Gaps = 7/297 (2%)
 Frame = -1

Query  980  MAEDGAVTVYSGSAITDAKKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIV  801
            MA  G V VY   AIT+ KK+PFS+KVG+AQMLRGG I++V T +QA+IAE AGAC V+ 
Sbjct  1    MAGTGVVAVYGNGAITETKKSPFSVKVGLAQMLRGGVIMDVVTPEQARIAEEAGACAVMA  60

Query  800  SE---PDSR---GISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDES  639
             E    D R   G++RM DP LIKEIK+AV+IPVMAK+R+GHFVEAQILE +G+DYIDES
Sbjct  61   LERVPADIRAQGGVARMSDPQLIKEIKQAVTIPVMAKARIGHFVEAQILEAIGIDYIDES  120

Query  638  ELLAIADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRS  459
            E+L  ADE++ INKHNFR+PFVCG R+LGEALRR+REGAAMIRT+G+  G+GN+++ VR 
Sbjct  121  EVLTPADEENHINKHNFRIPFVCGCRNLGEALRRIREGAAMIRTKGE-AGTGNVIEAVRH  179

Query  458  VRKVMGDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAI  279
            VR VMGDIRVL NMD+DEVF F+KKIAAPYD+V+QTKQ+ RLPVV FA+GG+ TPADAA+
Sbjct  180  VRSVMGDIRVLRNMDDDEVFTFAKKIAAPYDLVMQTKQLGRLPVVQFAAGGVATPADAAL  239

Query  278  MMQLGCDGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            MMQLGCDG+F+G  VF   DP K+  AIVQAV +Y+DP VLA+ S GL +AM GLNL
Sbjct  240  MMQLGCDGVFVGSGVFKSGDPVKRGRAIVQAVTHYSDPQVLAEVSCGLGEAMVGLNL  296



>ref|XP_006398617.1| hypothetical protein EUTSA_v10014179mg [Eutrema salsugineum]
 gb|ESQ40070.1| hypothetical protein EUTSA_v10014179mg [Eutrema salsugineum]
Length=309

 Score =   410 bits (1054),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 195/297 (66%), Positives = 242/297 (81%), Gaps = 7/297 (2%)
 Frame = -1

Query  980  MAEDGAVTVYSGSAITDAKKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIV  801
            M   G V VY   AIT+AKK+PFS+KVG+AQMLRGG I++V   +QA+IAE AGAC V+ 
Sbjct  1    MEGTGVVAVYGNGAITEAKKSPFSVKVGLAQMLRGGVIMDVVNAEQARIAEEAGACAVMA  60

Query  800  SE---PDSR---GISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDES  639
             E    D R   G++RM DP +IKEIK+AV+IPVMAK+R+GHFVEAQILE +G+DYIDES
Sbjct  61   LERVPADIRAQGGVARMSDPQMIKEIKQAVTIPVMAKARIGHFVEAQILEAIGIDYIDES  120

Query  638  ELLAIADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRS  459
            E+L +ADEDH INKHNFR+PFVCG R+LGEALRR+REGAAMIRT+G+  G+GNIV+ VR 
Sbjct  121  EVLTLADEDHHINKHNFRIPFVCGCRNLGEALRRIREGAAMIRTKGE-AGTGNIVEAVRH  179

Query  458  VRKVMGDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAI  279
            VR VMGDIRVL NMD+DEVF F+KK+AAPYD+V+QTKQ+ RLPVV FA+GG+ TPADAA+
Sbjct  180  VRSVMGDIRVLRNMDDDEVFTFAKKLAAPYDLVMQTKQLGRLPVVQFAAGGVATPADAAL  239

Query  278  MMQLGCDGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            MMQLGCDG+F+G  +F   DP ++  AIVQAV +Y+DP +L + S GL +AM G+NL
Sbjct  240  MMQLGCDGVFVGSGIFKSGDPARRARAIVQAVTHYSDPEMLVEVSCGLGEAMVGINL  296



>ref|XP_009125418.1| PREDICTED: pyridoxal biosynthesis protein PDX1.3 [Brassica rapa]
 emb|CDY04839.1| BnaAnng00210D [Brassica napus]
Length=309

 Score =   409 bits (1052),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 195/297 (66%), Positives = 242/297 (81%), Gaps = 7/297 (2%)
 Frame = -1

Query  980  MAEDGAVTVYSGSAITDAKKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIV  801
            M   G V VY   AIT+AKK+PFS+KVG+AQMLRGG I++V   DQA+IAE AGAC V+ 
Sbjct  1    MEGTGVVAVYGNGAITEAKKSPFSVKVGLAQMLRGGVIMDVVNADQARIAEEAGACAVMA  60

Query  800  SE---PDSR---GISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDES  639
             E    D R   G++RM DP +IK+IK+AV+IPVMAK+R+GHFVEAQILE +G+DYIDES
Sbjct  61   LERVPADIRAQGGVARMSDPQMIKDIKQAVTIPVMAKARIGHFVEAQILEAIGIDYIDES  120

Query  638  ELLAIADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRS  459
            E+L +ADEDH INKHNFR+PFVCG R+LGEALRR+REGAAMIRT+G+  G+GNIV+ VR 
Sbjct  121  EVLTLADEDHHINKHNFRIPFVCGCRNLGEALRRIREGAAMIRTKGE-AGTGNIVEAVRH  179

Query  458  VRKVMGDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAI  279
            VR VMGDIRVL NMD+DEVF F+KK+AAPYD+V+QTKQ+ RLPVV FA+GG+ TPADAA+
Sbjct  180  VRSVMGDIRVLRNMDDDEVFTFAKKLAAPYDLVMQTKQLGRLPVVQFAAGGVATPADAAL  239

Query  278  MMQLGCDGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            MMQLGCDG+F+G  +F   DP ++  AIVQAV +Y+DP +L + S GL +AM G+NL
Sbjct  240  MMQLGCDGVFVGSGIFKSGDPARRARAIVQAVTHYSDPEMLVEVSCGLGEAMVGINL  296



>ref|XP_012087850.1| PREDICTED: probable pyridoxal 5'-phosphate synthase subunit PDX1 
[Jatropha curcas]
 gb|KDP24448.1| hypothetical protein JCGZ_25012 [Jatropha curcas]
Length=309

 Score =   409 bits (1052),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 195/297 (66%), Positives = 243/297 (82%), Gaps = 7/297 (2%)
 Frame = -1

Query  980  MAEDGAVTVYSGSAITDAKKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIV  801
            MA  G V VY   AIT+ KK+PFS+KVG+AQMLRGG I++V   +QA+IAE AGAC V+ 
Sbjct  1    MAGTGVVAVYGNGAITETKKSPFSVKVGLAQMLRGGVIMDVVNAEQARIAEEAGACAVMA  60

Query  800  SE---PDSR---GISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDES  639
             E    D R   G++RM DP LIKEIK+AV+IPVMAK+R+GHFVEAQILE +G+DY+DES
Sbjct  61   LERVPADIRAQGGVARMSDPQLIKEIKQAVTIPVMAKARIGHFVEAQILEAIGIDYVDES  120

Query  638  ELLAIADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRS  459
            E+L +ADE++ INKHNFR+PFVCG R+LGEALRR+REGAAMIRT+G+  G+GN+++ VR 
Sbjct  121  EVLTLADEENHINKHNFRIPFVCGCRNLGEALRRIREGAAMIRTKGE-AGTGNVIEAVRH  179

Query  458  VRKVMGDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAI  279
            VR VMGDIRVL NMD+DEVF+F+KKIAAPYD+V+QTKQ+ RLPVV FA+GG+ TPADAA+
Sbjct  180  VRSVMGDIRVLRNMDDDEVFSFAKKIAAPYDLVMQTKQLGRLPVVQFAAGGVATPADAAL  239

Query  278  MMQLGCDGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            MMQLGCDG+F+G  VF   DP ++  AIVQAV +Y DP VLA+ S GL +AM G+NL
Sbjct  240  MMQLGCDGVFVGSGVFKSGDPARRARAIVQAVTHYTDPDVLAEVSCGLGEAMVGINL  296



>ref|XP_010543207.1| PREDICTED: pyridoxal biosynthesis protein PDX1.3 [Tarenaya hassleriana]
Length=309

 Score =   409 bits (1051),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 196/297 (66%), Positives = 244/297 (82%), Gaps = 7/297 (2%)
 Frame = -1

Query  980  MAEDGAVTVYSGSAITDAKKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIV  801
            M   G V VY   AIT+AKK+PFS+KVG+AQMLRGG I++V T +QA+IAE AGAC V+ 
Sbjct  1    MEGTGVVAVYGNGAITEAKKSPFSVKVGLAQMLRGGVIMDVVTPEQARIAEEAGACAVMA  60

Query  800  SE---PDSR---GISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDES  639
             E    D R   G++RM DP LIKEIK+AV+IPVMAK+R+GHFVEAQILE +G+DY+DES
Sbjct  61   LERVPADIRAQGGVARMSDPQLIKEIKQAVTIPVMAKARIGHFVEAQILEAIGIDYVDES  120

Query  638  ELLAIADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRS  459
            E+L +ADED+ INKHNFR+PFVCG R+LGEALRR+REGAAMIRT+G+  G+GNIV+ VR 
Sbjct  121  EVLTLADEDNHINKHNFRIPFVCGCRNLGEALRRIREGAAMIRTKGE-AGTGNIVEAVRH  179

Query  458  VRKVMGDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAI  279
            VR VMGDIRVL NMD+DEVF F+KK+AAPYD+V+Q KQ+ARLPVV FA+GG+ TPADAA+
Sbjct  180  VRSVMGDIRVLRNMDDDEVFTFAKKMAAPYDLVMQVKQLARLPVVQFAAGGVATPADAAL  239

Query  278  MMQLGCDGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            MMQLGCDG+F+G  +F   DP ++  AIVQAV +Y+DP +LA+ S GL +AM G+NL
Sbjct  240  MMQLGCDGVFVGSGIFKSGDPARRARAIVQAVTHYSDPEMLAEVSCGLGEAMVGINL  296



>ref|XP_011006558.1| PREDICTED: probable pyridoxal biosynthesis protein PDX1 [Populus 
euphratica]
Length=309

 Score =   408 bits (1048),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 198/297 (67%), Positives = 242/297 (81%), Gaps = 7/297 (2%)
 Frame = -1

Query  980  MAEDGAVTVYSGSAITDAKKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIV  801
            MA  G V VY   AIT+ K +PFS+KVG+AQMLRGG I++V T +QA+IAE AGAC V+ 
Sbjct  1    MAGTGVVAVYGNGAITETKNSPFSVKVGLAQMLRGGVIMDVVTPEQARIAEEAGACAVMA  60

Query  800  SE---PDSR---GISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDES  639
             E    D R   G++RM DP LIKEIK+AV+IPVMAK+R+GHFVEAQILE +G+DYIDES
Sbjct  61   LERVPADIRAQGGVARMSDPQLIKEIKQAVTIPVMAKARIGHFVEAQILEAIGIDYIDES  120

Query  638  ELLAIADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRS  459
            E+L  ADE++ INKHNFR+PFVCG R+LGEALRR+REGAAMIRT+G+  G+GN+++ VR 
Sbjct  121  EVLTPADEENHINKHNFRIPFVCGCRNLGEALRRIREGAAMIRTKGE-AGTGNVIEAVRH  179

Query  458  VRKVMGDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAI  279
            VR VMGDIRVL NMD+DEVF F+KKIAAPYD+V+QTKQ+ RLPVV FA+GG+ TPADAA+
Sbjct  180  VRSVMGDIRVLRNMDDDEVFTFAKKIAAPYDLVMQTKQLGRLPVVQFAAGGVATPADAAL  239

Query  278  MMQLGCDGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            MMQLGCDG+F+G  VF   DP K+  AIVQAV +Y+DP VLA+ S GL +AM GLNL
Sbjct  240  MMQLGCDGVFVGSGVFKSGDPVKRGRAIVQAVTHYSDPEVLAEVSCGLGEAMVGLNL  296



>ref|XP_006288284.1| hypothetical protein CARUB_v10001526mg [Capsella rubella]
 ref|XP_010423952.1| PREDICTED: pyridoxal biosynthesis protein PDX1.3 [Camelina sativa]
 ref|XP_010451988.1| PREDICTED: pyridoxal biosynthesis protein PDX1.3 isoform X1 [Camelina 
sativa]
 ref|XP_010451989.1| PREDICTED: pyridoxal biosynthesis protein PDX1.3 isoform X2 [Camelina 
sativa]
 ref|XP_010451990.1| PREDICTED: pyridoxal biosynthesis protein PDX1.3 isoform X3 [Camelina 
sativa]
 ref|XP_010490569.1| PREDICTED: pyridoxal biosynthesis protein PDX1.3 [Camelina sativa]
 gb|EOA21182.1| hypothetical protein CARUB_v10001526mg [Capsella rubella]
Length=309

 Score =   408 bits (1048),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 193/297 (65%), Positives = 242/297 (81%), Gaps = 7/297 (2%)
 Frame = -1

Query  980  MAEDGAVTVYSGSAITDAKKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIV  801
            M   G V VY   AIT+AKK+PFS+KVG+AQMLRGG I++V   +QA+IAE AGAC V+ 
Sbjct  1    MEGTGVVAVYGNGAITEAKKSPFSVKVGLAQMLRGGVIMDVVNAEQARIAEEAGACAVMA  60

Query  800  SE---PDSR---GISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDES  639
             E    D R   G++RM DP +IK+IK+AV+IPVMAK+R+GHFVEAQILE +G+DYIDES
Sbjct  61   LERVPADIRAQGGVARMSDPQMIKDIKQAVTIPVMAKARIGHFVEAQILEAIGIDYIDES  120

Query  638  ELLAIADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRS  459
            E+L +ADEDH INKHNFR+PFVCG R+LGEALRR+REGAAMIRT+G+  G+GNI++ VR 
Sbjct  121  EVLTLADEDHHINKHNFRIPFVCGCRNLGEALRRIREGAAMIRTKGE-AGTGNIIEAVRH  179

Query  458  VRKVMGDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAI  279
            VR VMGDIRVL NMD+DEVF F+KK+AAPYD+V+QTKQ+ RLPVV FA+GG+ TPADAA+
Sbjct  180  VRSVMGDIRVLRNMDDDEVFTFAKKLAAPYDLVMQTKQLGRLPVVQFAAGGVATPADAAL  239

Query  278  MMQLGCDGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            MMQLGCDG+F+G  +F   DP ++  AIVQAV +Y+DP +L + S GL +AM G+NL
Sbjct  240  MMQLGCDGVFVGSGIFKSGDPARRARAIVQAVTHYSDPEMLVEVSCGLGEAMVGINL  296



>ref|XP_007026699.1| Aldolase-type TIM barrel family protein [Theobroma cacao]
 gb|EOY07201.1| Aldolase-type TIM barrel family protein [Theobroma cacao]
Length=309

 Score =   407 bits (1047),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 196/297 (66%), Positives = 243/297 (82%), Gaps = 7/297 (2%)
 Frame = -1

Query  980  MAEDGAVTVYSGSAITDAKKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIV  801
            MA  G V VY   AIT+  K+PFS+KVG+AQMLRGG I++V T +QA+IAE AGAC V+ 
Sbjct  1    MAGTGVVAVYGNGAITETHKSPFSVKVGLAQMLRGGVIMDVVTPEQARIAEEAGACAVMA  60

Query  800  SE---PDSR---GISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDES  639
             E    D R   G++RM DP LIKEIK+AV+IPVMAK+R+GHFVEAQILE +G+DY+DES
Sbjct  61   LERVPADIRAQGGVARMSDPQLIKEIKQAVTIPVMAKARIGHFVEAQILEAIGIDYVDES  120

Query  638  ELLAIADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRS  459
            E+L  ADE++ INKHNFR+PFVCG R+LGEALRR+REGAAMIRT+G+  G+GNI++ VR 
Sbjct  121  EVLTPADEENHINKHNFRIPFVCGCRNLGEALRRIREGAAMIRTKGE-AGTGNIIEAVRH  179

Query  458  VRKVMGDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAI  279
            VR VMGDIRVL NMD+DEVF+F+KKI +PYD+V+QTKQ+ RLPVVHFA+GG+ TPADAA+
Sbjct  180  VRSVMGDIRVLRNMDDDEVFSFAKKIQSPYDLVMQTKQLGRLPVVHFAAGGVATPADAAL  239

Query  278  MMQLGCDGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            MMQLGCDG+F+G  VF   DP ++  AIVQAV +Y+DP VLA+ S GL +AM GLNL
Sbjct  240  MMQLGCDGVFVGSGVFKSGDPARRARAIVQAVTHYSDPDVLAEVSCGLGEAMVGLNL  296



>emb|CDP17824.1| unnamed protein product [Coffea canephora]
Length=310

 Score =   407 bits (1045),  Expect = 7e-138, Method: Compositional matrix adjust.
 Identities = 198/298 (66%), Positives = 245/298 (82%), Gaps = 8/298 (3%)
 Frame = -1

Query  980  MAEDGAVTVYSGSAITD-AKKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVI  804
            MA  G VTVY   AIT+ AKK+PFS+KVG+AQMLRGG I++V T +QA+IAE AGAC V+
Sbjct  1    MAGSGVVTVYGNGAITETAKKSPFSVKVGLAQMLRGGVIMDVVTPEQARIAEEAGACAVM  60

Query  803  VSE---PDSR---GISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDE  642
              E    D R   G++RM DP LIKEIK+AV+IPVMAK+R+GHFVEAQILE +G+DY+DE
Sbjct  61   ALERVPADIRAQGGVARMSDPQLIKEIKQAVTIPVMAKARIGHFVEAQILEAIGIDYVDE  120

Query  641  SELLAIADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVR  462
            SE+L  AD+++ INKHNFR+PFVCG R+LGEALRR+REGAAMIRT+G+  G+GNI++ VR
Sbjct  121  SEVLTPADDENHINKHNFRIPFVCGCRNLGEALRRIREGAAMIRTKGE-AGTGNIIEAVR  179

Query  461  SVRKVMGDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAA  282
             VR VMGDIRVL NMD+DEVFAF+KKI +PYD+V+QTKQ+ RLPVVHFA+GG+ TPADAA
Sbjct  180  HVRSVMGDIRVLRNMDDDEVFAFAKKIQSPYDLVMQTKQLGRLPVVHFAAGGVATPADAA  239

Query  281  IMMQLGCDGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            +MMQLGCDG+F+G  VF   DP ++  AIVQAV +Y+DP VLA  S GL +AM G+NL
Sbjct  240  LMMQLGCDGVFVGSGVFKSGDPARRARAIVQAVTHYSDPEVLADVSCGLGEAMVGINL  297



>ref|XP_003542985.1| PREDICTED: pyridoxal biosynthesis protein PDX1-like [Glycine 
max]
Length=311

 Score =   407 bits (1045),  Expect = 8e-138, Method: Compositional matrix adjust.
 Identities = 195/298 (65%), Positives = 242/298 (81%), Gaps = 7/298 (2%)
 Frame = -1

Query  983  EMAEDGAVTVYSGSAITDAKKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVI  804
            E +  G VTVY   AIT+ KK+PFS+KVG+AQMLRGG I++V   +QA+IAE AGAC V+
Sbjct  2    EGSGSGVVTVYGNGAITETKKSPFSVKVGLAQMLRGGVIMDVVNAEQARIAEEAGACAVM  61

Query  803  VSE---PDSR---GISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDE  642
              E    D R   G++RM DP LIK+IKRAV+IPVMAK+R+GHFVEAQILE +G+DY+DE
Sbjct  62   ALERVPADIRAQGGVARMSDPQLIKDIKRAVTIPVMAKARIGHFVEAQILEAIGIDYVDE  121

Query  641  SELLAIADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVR  462
            SE+L +AD+ + INKHNFR+PFVCG R+LGEALRR+REGAAMIRT+G+  G+GNI++ VR
Sbjct  122  SEVLTLADDANHINKHNFRIPFVCGCRNLGEALRRIREGAAMIRTKGE-AGTGNIIEAVR  180

Query  461  SVRKVMGDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAA  282
             VR VM DIRVL NMD+DEVF F+K IAAPYD+V+QTKQ+ RLPVVHFA+GG+ TPADAA
Sbjct  181  HVRSVMSDIRVLRNMDDDEVFTFAKSIAAPYDLVMQTKQLGRLPVVHFAAGGVATPADAA  240

Query  281  IMMQLGCDGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            +MMQLGCDG+F+G  VF   DP K+  AIVQAV +Y+DP VLA+ S GL +AM G+NL
Sbjct  241  LMMQLGCDGVFVGSGVFKSGDPAKRARAIVQAVTHYSDPEVLAEVSCGLGEAMVGINL  298



>ref|NP_195761.1| Pyridoxal biosynthesis protein PDX1.3 [Arabidopsis thaliana]
 ref|XP_002870922.1| hypothetical protein ARALYDRAFT_908014 [Arabidopsis lyrata subsp. 
lyrata]
 sp|Q8L940.2|PDX13_ARATH RecName: Full=Pyridoxal 5'-phosphate synthase subunit PDX1.3; 
Short=AtPDX1.3; Short=AtPDX1;1; Short=PLP synthase subunit 
PDX1.3 [Arabidopsis thaliana]
 gb|AAL16130.1|AF428298_1 AT5g01410/T10O8_120 [Arabidopsis thaliana]
 gb|AAL48227.1|AF446352_1 AT5g01410/T10O8_120 [Arabidopsis thaliana]
 emb|CAB81924.1| pyridoxine biosynthesis protein-like [Arabidopsis thaliana]
 gb|AAM19944.1| AT5g01410/T10O8_120 [Arabidopsis thaliana]
 gb|AAY42123.1| pyridoxine biosynthesis protein [Arabidopsis thaliana]
 dbj|BAE99236.1| pyridoxine biosynthesis protein - like [Arabidopsis thaliana]
 gb|EFH47181.1| hypothetical protein ARALYDRAFT_908014 [Arabidopsis lyrata subsp. 
lyrata]
 gb|AED90340.1| Pyridoxal biosynthesis protein PDX1.3 [Arabidopsis thaliana]
 gb|AEF15886.1| pyridoxine biosynthesis protein [Arabidopsis thaliana]
Length=309

 Score =   407 bits (1045),  Expect = 8e-138, Method: Compositional matrix adjust.
 Identities = 193/297 (65%), Positives = 241/297 (81%), Gaps = 7/297 (2%)
 Frame = -1

Query  980  MAEDGAVTVYSGSAITDAKKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIV  801
            M   G V VY   AIT+AKK+PFS+KVG+AQMLRGG I++V   +QA+IAE AGAC V+ 
Sbjct  1    MEGTGVVAVYGNGAITEAKKSPFSVKVGLAQMLRGGVIMDVVNAEQARIAEEAGACAVMA  60

Query  800  SE---PDSR---GISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDES  639
             E    D R   G++RM DP +IKEIK+AV+IPVMAK+R+GHFVEAQILE +G+DYIDES
Sbjct  61   LERVPADIRAQGGVARMSDPQMIKEIKQAVTIPVMAKARIGHFVEAQILEAIGIDYIDES  120

Query  638  ELLAIADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRS  459
            E+L +ADEDH INKHNFR+PFVCG R+LGEALRR+REGAAMIRT+G+  G+GNI++ VR 
Sbjct  121  EVLTLADEDHHINKHNFRIPFVCGCRNLGEALRRIREGAAMIRTKGE-AGTGNIIEAVRH  179

Query  458  VRKVMGDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAI  279
            VR V GDIRVL NMD+DEVF F+KK+AAPYD+V+QTKQ+ RLPVV FA+GG+ TPADAA+
Sbjct  180  VRSVNGDIRVLRNMDDDEVFTFAKKLAAPYDLVMQTKQLGRLPVVQFAAGGVATPADAAL  239

Query  278  MMQLGCDGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            MMQLGCDG+F+G  +F   DP ++  AIVQAV +Y+DP +L + S GL +AM G+NL
Sbjct  240  MMQLGCDGVFVGSGIFKSGDPARRARAIVQAVTHYSDPEMLVEVSCGLGEAMVGINL  296



>ref|XP_010104626.1| putative pyridoxal biosynthesis protein PDX1 [Morus notabilis]
 gb|EXC01432.1| putative pyridoxal biosynthesis protein PDX1 [Morus notabilis]
Length=310

 Score =   406 bits (1043),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 195/298 (65%), Positives = 245/298 (82%), Gaps = 8/298 (3%)
 Frame = -1

Query  980  MAEDGAVTVYSGSAITD-AKKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVI  804
            MA+ G VTVY   AI + AKK+PFS+KVG+AQMLRGG I++V   +QA++AE AGAC V+
Sbjct  1    MADTGVVTVYGNGAIYETAKKSPFSVKVGLAQMLRGGVIMDVVNAEQARVAEEAGACAVM  60

Query  803  VSE---PDSR---GISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDE  642
              E    D R   G++RM DP LIKEIK+AV+IPVMAK+R+GHFVEAQILE +G+DY+DE
Sbjct  61   ALERVPADIRAQGGVARMSDPQLIKEIKQAVTIPVMAKARIGHFVEAQILEAIGIDYVDE  120

Query  641  SELLAIADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVR  462
            SE+L +ADE++ INKHNFR+PFVCG R+LGEALRR+REGAAMIRT+G+  G+GN+++ VR
Sbjct  121  SEVLTVADEENHINKHNFRIPFVCGCRNLGEALRRIREGAAMIRTKGE-AGTGNVIEAVR  179

Query  461  SVRKVMGDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAA  282
             VR VMGDIRVL NMD+DEVF+F+KKIAAPYD+V+QTKQ+ RLPVV FA+GG+ TPADAA
Sbjct  180  HVRSVMGDIRVLRNMDDDEVFSFAKKIAAPYDLVMQTKQLGRLPVVQFAAGGVATPADAA  239

Query  281  IMMQLGCDGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            +MMQLGCDG+F+G  VF   DP ++  AIVQAV +Y+DP VLA  S GL +AM G+NL
Sbjct  240  LMMQLGCDGVFVGSGVFKSGDPARRARAIVQAVTHYSDPDVLADVSCGLGEAMVGINL  297



>ref|XP_006429393.1| hypothetical protein CICLE_v10012274mg [Citrus clementina]
 ref|XP_006481040.1| PREDICTED: probable pyridoxal biosynthesis protein PDX1-like 
[Citrus sinensis]
 gb|ESR42633.1| hypothetical protein CICLE_v10012274mg [Citrus clementina]
 gb|KDO56641.1| hypothetical protein CISIN_1g021578mg [Citrus sinensis]
 gb|KDO56642.1| hypothetical protein CISIN_1g021578mg [Citrus sinensis]
 gb|KDO56643.1| hypothetical protein CISIN_1g021578mg [Citrus sinensis]
Length=310

 Score =   405 bits (1042),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 197/298 (66%), Positives = 244/298 (82%), Gaps = 8/298 (3%)
 Frame = -1

Query  980  MAEDGAVTVYSG-SAITDAKKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVI  804
            MA  G V VY    AIT+ KK+PFS+KVG+AQMLRGG I++V T +QA++AE AGAC V+
Sbjct  1    MAGTGVVAVYGNDGAITETKKSPFSVKVGLAQMLRGGVIMDVVTPEQARVAEEAGACAVM  60

Query  803  VSE---PDSR---GISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDE  642
              E    D R   G++RM DP LIKEIK++V+IPVMAK+R+GHFVEAQILE +G+DY+DE
Sbjct  61   ALERVPADIRSQGGVARMSDPQLIKEIKQSVTIPVMAKARIGHFVEAQILEAIGIDYVDE  120

Query  641  SELLAIADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVR  462
            SE+L  ADE++ INKHNFR+PFVCG R+LGEALRR+REGAAMIRT+G+  G+GNI++ VR
Sbjct  121  SEVLTPADEENHINKHNFRIPFVCGCRNLGEALRRIREGAAMIRTKGE-AGTGNIIEAVR  179

Query  461  SVRKVMGDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAA  282
             VR VMGDIRVL NMD+DEVF F+KKIAAPYD+V+QTKQ+ RLPVVHFA+GG+ TPADAA
Sbjct  180  HVRSVMGDIRVLRNMDDDEVFTFAKKIAAPYDLVMQTKQLGRLPVVHFAAGGVATPADAA  239

Query  281  IMMQLGCDGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            +MMQLGCDG+F+G  VF   DP K+  AIV+AV +Y+DP VLA+ S GL +AM GLNL
Sbjct  240  MMMQLGCDGVFVGSGVFKSGDPVKRAQAIVRAVTHYSDPEVLAEVSCGLGEAMVGLNL  297



>gb|KJB76949.1| hypothetical protein B456_012G114100 [Gossypium raimondii]
 gb|KJB76950.1| hypothetical protein B456_012G114100 [Gossypium raimondii]
Length=309

 Score =   405 bits (1042),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 193/297 (65%), Positives = 242/297 (81%), Gaps = 7/297 (2%)
 Frame = -1

Query  980  MAEDGAVTVYSGSAITDAKKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIV  801
            MA  G V VY   AI +  K+PFS+KVG+AQMLRGG I++V T DQA+IAE AGAC V+ 
Sbjct  1    MAGTGVVAVYGNGAIAETHKSPFSVKVGLAQMLRGGVIMDVVTPDQARIAEEAGACAVMA  60

Query  800  SE---PDSR---GISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDES  639
             E    D R   G++RM DP LIKEIK+AV+IPVMAK+R+GHFVEAQILE +G+DY+DES
Sbjct  61   LERVPADIRAQGGVARMSDPQLIKEIKQAVTIPVMAKARIGHFVEAQILEAIGIDYVDES  120

Query  638  ELLAIADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRS  459
            E+L +ADE++ INKHNFR+PFVCG R+LGEALRR+REGAAMIRT+G+  G+GN+++ VR 
Sbjct  121  EVLTLADEENHINKHNFRIPFVCGCRNLGEALRRIREGAAMIRTKGE-AGTGNVIEAVRH  179

Query  458  VRKVMGDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAI  279
            VR VMGDIR L NMD+DEVF+F+KKI +PYD+V+QTKQ+ RLPVV FA+GG+ TPADAA+
Sbjct  180  VRSVMGDIRALRNMDDDEVFSFAKKIQSPYDLVMQTKQLGRLPVVQFAAGGVATPADAAL  239

Query  278  MMQLGCDGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            MMQLGCDG+F+G  VF   DP K+  AIVQAV +Y+DP++LA+ S GL +AM GLNL
Sbjct  240  MMQLGCDGVFVGSGVFKSGDPAKRARAIVQAVTHYSDPNILAEVSCGLGEAMVGLNL  296



>emb|CDP09194.1| unnamed protein product [Coffea canephora]
Length=310

 Score =   405 bits (1042),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 197/298 (66%), Positives = 245/298 (82%), Gaps = 8/298 (3%)
 Frame = -1

Query  980  MAEDGAVTVYSGSAITD-AKKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVI  804
            MA  G VTVY   AIT+ AKK+PFS+KVG+AQMLRGG I++V T +QA+IAE AGAC V+
Sbjct  1    MAGSGVVTVYGNGAITETAKKSPFSVKVGLAQMLRGGVIMDVVTPEQARIAEEAGACAVM  60

Query  803  VSE---PDSR---GISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDE  642
              E    D R   G++RM DP LIKEIK+AV+IPVMAK+R+GHFVEAQILE +G+DY+DE
Sbjct  61   ALERVPADIRAQGGVARMSDPQLIKEIKQAVTIPVMAKARIGHFVEAQILEAIGIDYVDE  120

Query  641  SELLAIADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVR  462
            SE+L  AD+++ INKHNFR+PFVCG R+LGEALRR+REGAAMIRT+G+  G+GNI++ VR
Sbjct  121  SEVLTPADDENHINKHNFRIPFVCGCRNLGEALRRIREGAAMIRTKGE-AGTGNIIEAVR  179

Query  461  SVRKVMGDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAA  282
             VR VMGDIRVL NMD+DEVF+F+KKI +PYD+V+QTKQ+ RLPVVHFA+GG+ TPADAA
Sbjct  180  HVRSVMGDIRVLRNMDDDEVFSFAKKIQSPYDLVMQTKQLGRLPVVHFAAGGVATPADAA  239

Query  281  IMMQLGCDGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            +MMQLGCDG+F+G  VF   DP ++  AIVQAV +Y+DP VLA  S GL +AM G+NL
Sbjct  240  LMMQLGCDGVFVGSGVFKSGDPARRARAIVQAVTHYSDPEVLADVSCGLGEAMVGINL  297



>ref|XP_010685547.1| PREDICTED: probable pyridoxal biosynthesis protein PDX1 [Beta 
vulgaris subsp. vulgaris]
Length=312

 Score =   405 bits (1042),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 197/300 (66%), Positives = 246/300 (82%), Gaps = 10/300 (3%)
 Frame = -1

Query  980  MAEDGAVTVYSGSAITDA---KKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACC  810
            M+  G VT+Y   AIT+    KK+PFS+KVG+AQMLRGG I++V T +QA+IAE AGAC 
Sbjct  1    MSGSGVVTLYGNGAITETTSNKKSPFSVKVGLAQMLRGGVIMDVVTPEQARIAEEAGACA  60

Query  809  VIVSE---PDSR---GISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYI  648
            V+  E    D R   G++RM DP LIK+IKRAV+IPVMAK+R+GHFVEAQILE++GVDY+
Sbjct  61   VMALERVPADIRAQGGVARMSDPQLIKDIKRAVTIPVMAKARIGHFVEAQILESIGVDYV  120

Query  647  DESELLAIADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDT  468
            DESE+L +ADED+ INKHNF++PFVCG R+LGEALRR+REGAAMIRT+G+  G+GNIV+ 
Sbjct  121  DESEVLTLADEDNHINKHNFQIPFVCGCRNLGEALRRIREGAAMIRTKGE-AGTGNIVEA  179

Query  467  VRSVRKVMGDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPAD  288
            VR VR VMGDIRVL NMD+DEVF F+KKIAAPYD+V+QTKQ+ RLPVV FA+GG+ TPAD
Sbjct  180  VRHVRSVMGDIRVLRNMDDDEVFTFAKKIAAPYDLVMQTKQLGRLPVVQFAAGGVATPAD  239

Query  287  AAIMMQLGCDGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            AA+MMQLGCDG+F+G  VF   DP ++  AIVQAV +Y+DP +LA+ S GL +AM G+NL
Sbjct  240  AALMMQLGCDGVFVGSGVFKSGDPARRARAIVQAVTHYSDPGMLAEVSCGLGEAMVGINL  299



>ref|XP_012067529.1| PREDICTED: probable pyridoxal 5'-phosphate synthase subunit PDX1 
[Jatropha curcas]
 gb|KDP46491.1| hypothetical protein JCGZ_08463 [Jatropha curcas]
Length=310

 Score =   405 bits (1041),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 198/298 (66%), Positives = 243/298 (82%), Gaps = 8/298 (3%)
 Frame = -1

Query  980  MAEDGAVTVYSGSAITDA-KKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVI  804
            MA+ G VTVY   AI +  KK+PFS+KVG+AQMLRGG I++V   +QA+IAE AGAC V+
Sbjct  1    MADTGVVTVYGNGAIYETTKKSPFSVKVGLAQMLRGGVIMDVVNAEQARIAEEAGACAVM  60

Query  803  VSE---PDSR---GISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDE  642
              E    D R   G++RM DP LIKEIK++V+IPVMAK+R+GHFVEAQILE +G+DYIDE
Sbjct  61   ALERVPADIRAQGGVARMSDPQLIKEIKQSVTIPVMAKARIGHFVEAQILEAIGIDYIDE  120

Query  641  SELLAIADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVR  462
            SE+L  ADE++ INKHNFR+PFVCG R+LGEALRR+REGAAMIRT+G+  G+GNIV+ VR
Sbjct  121  SEVLTPADEENHINKHNFRIPFVCGCRNLGEALRRIREGAAMIRTKGE-AGTGNIVEAVR  179

Query  461  SVRKVMGDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAA  282
             VR VMGDIRVL NMD+DEVF F+KKIAAPYD+V+QTKQ+ RLPVVHFA+GG+ TPADAA
Sbjct  180  HVRSVMGDIRVLRNMDDDEVFTFAKKIAAPYDLVMQTKQLGRLPVVHFAAGGVATPADAA  239

Query  281  IMMQLGCDGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            +MMQLGCDG+F+G  VF   DP ++  AIVQAV +Y+DP VLA  S GL +AM G+NL
Sbjct  240  LMMQLGCDGVFVGSGVFKSGDPARRARAIVQAVTHYSDPDVLADVSCGLGEAMVGINL  297



>gb|KHG23987.1| putative pyridoxal biosynthesis PDX1 [Gossypium arboreum]
Length=309

 Score =   405 bits (1040),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 193/297 (65%), Positives = 243/297 (82%), Gaps = 7/297 (2%)
 Frame = -1

Query  980  MAEDGAVTVYSGSAITDAKKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIV  801
            MA  G V VY   AI +  K+PFS+KVG+AQMLRGG I++V T +QA+IAE AGAC V+ 
Sbjct  1    MAGTGVVAVYGNGAIAETHKSPFSVKVGLAQMLRGGVIMDVVTPEQARIAEEAGACAVMA  60

Query  800  SE---PDSR---GISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDES  639
             E    D R   G++RM DP LIKEIK+AV+IPVMAK+R+GHFVEAQILE +G+DY+DES
Sbjct  61   LERVPADIRAQGGVARMSDPQLIKEIKQAVTIPVMAKARIGHFVEAQILEAIGIDYVDES  120

Query  638  ELLAIADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRS  459
            E+L +ADE++ INKHNFR+PFVCG R+LGEALRR+REGAAMIRT+G+  G+GN+++ VR 
Sbjct  121  EVLTLADEENHINKHNFRIPFVCGCRNLGEALRRIREGAAMIRTKGE-AGTGNVIEAVRH  179

Query  458  VRKVMGDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAI  279
            VR VMGDIRVL NMD+DEVF+F+KKI +PYD+V+QTKQ+ RLPVV FA+GG+ TPADAA+
Sbjct  180  VRSVMGDIRVLRNMDDDEVFSFAKKIQSPYDLVMQTKQLGRLPVVQFAAGGVATPADAAL  239

Query  278  MMQLGCDGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            MMQLGCDG+F+G  VF   DP K+  AIVQAV +Y+DP++LA+ S GL +AM GLNL
Sbjct  240  MMQLGCDGVFVGSGVFKSGDPAKRARAIVQAVTHYSDPNMLAEVSCGLGEAMVGLNL  296



>ref|XP_006350840.1| PREDICTED: probable pyridoxal biosynthesis protein PDX1-like 
[Solanum tuberosum]
Length=309

 Score =   404 bits (1039),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 194/298 (65%), Positives = 244/298 (82%), Gaps = 8/298 (3%)
 Frame = -1

Query  980  MAEDGAVTVYSGSAITDA-KKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVI  804
            MA  G VTVY   A+T+  K++PFS+KVG+AQMLRGG I++V   +QA+IAE AGAC V+
Sbjct  1    MAGSGVVTVYGNGALTETTKQSPFSVKVGLAQMLRGGVIMDVVNAEQARIAEEAGACAVM  60

Query  803  VSE---PDSR---GISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDE  642
              E    D R   G++RM DP LIKEIK+AV+IPVMAK+R+GHFVEAQILE +GVDY+DE
Sbjct  61   ALERVPADIRAQGGVARMSDPQLIKEIKQAVTIPVMAKARIGHFVEAQILEAIGVDYVDE  120

Query  641  SELLAIADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVR  462
            SE+L +AD+++ INKHNFR+PFVCG R+LGEALRR+REGAAMIRT+G+  G+GNI++ VR
Sbjct  121  SEVLTLADDENHINKHNFRIPFVCGCRNLGEALRRIREGAAMIRTKGE-AGTGNIIEAVR  179

Query  461  SVRKVMGDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAA  282
             VR VMGDIRVL NMD+DEVF F+KKI APYD+V+QTKQ+ RLPVVHFA+GG+ TPADAA
Sbjct  180  HVRSVMGDIRVLRNMDDDEVFTFAKKIQAPYDLVMQTKQLGRLPVVHFAAGGVATPADAA  239

Query  281  IMMQLGCDGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            +MMQLGCDG+F+G  +F   DP K+  AIVQAV +Y+DP +LA+ S GL +AM G+NL
Sbjct  240  LMMQLGCDGVFVGSGIFKSGDPAKRGRAIVQAVTHYSDPQLLAEISCGLGEAMVGINL  297



>ref|XP_009347258.1| PREDICTED: probable pyridoxal biosynthesis protein PDX1 [Pyrus 
x bretschneideri]
Length=312

 Score =   404 bits (1038),  Expect = 9e-137, Method: Compositional matrix adjust.
 Identities = 197/295 (67%), Positives = 241/295 (82%), Gaps = 9/295 (3%)
 Frame = -1

Query  968  GAVTVYSGSAI--TDAKKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIVSE  795
            G VTVY   AI  T  K +PFS+KVG+AQMLRGG I++V    QA+IAE AGAC V+  E
Sbjct  6    GVVTVYGKGAIYETTTKSSPFSVKVGLAQMLRGGVIMDVVNPAQARIAEEAGACAVMALE  65

Query  794  ---PDSR---GISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESEL  633
                D R   G++RM DP LIKEIKR+V+IPVMAK+R+GHFVEAQILE +GVDY+DESE+
Sbjct  66   RVPADIRSQGGVARMSDPQLIKEIKRSVTIPVMAKARIGHFVEAQILEAIGVDYVDESEV  125

Query  632  LAIADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVR  453
            L +ADE+H INKHNFRVPFVCG R+LGEALRR+REGAAMIRT+G+  G+GNIV+ VR VR
Sbjct  126  LTLADEEHHINKHNFRVPFVCGCRNLGEALRRIREGAAMIRTKGE-AGTGNIVEAVRHVR  184

Query  452  KVMGDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMM  273
             VMGDIRVL NMD+DEVFA++KKI+APYD+++QTKQ+ RLPVVHFA+GG+ TPADAA+MM
Sbjct  185  HVMGDIRVLRNMDDDEVFAYAKKISAPYDLMMQTKQLGRLPVVHFAAGGVATPADAALMM  244

Query  272  QLGCDGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            QLGCDG+F+G  VF  SDP ++  AIVQA  +Y+DP VLA+ S GL +AM G+NL
Sbjct  245  QLGCDGVFIGSGVFKSSDPARRARAIVQASTHYSDPDVLAEISCGLGEAMTGMNL  299



>ref|XP_004242523.1| PREDICTED: probable pyridoxal biosynthesis protein PDX1 [Solanum 
lycopersicum]
Length=309

 Score =   404 bits (1038),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 193/298 (65%), Positives = 244/298 (82%), Gaps = 8/298 (3%)
 Frame = -1

Query  980  MAEDGAVTVYSGSAITDA-KKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVI  804
            MA  G VTVY   A+T+  K++PFS+KVG+AQMLRGG I++V   +QA+IAE AGAC V+
Sbjct  1    MAGSGVVTVYGNGALTETTKQSPFSVKVGLAQMLRGGVIMDVVNAEQARIAEEAGACAVM  60

Query  803  VSE---PDSR---GISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDE  642
              E    D R   G++RM DP LIKEIK+AV+IPVMAK+R+GHFVEAQILE +G+DY+DE
Sbjct  61   ALERVPADIRAQGGVARMSDPQLIKEIKQAVTIPVMAKARIGHFVEAQILEAIGIDYVDE  120

Query  641  SELLAIADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVR  462
            SE+L +AD+++ INKHNFR+PFVCG R+LGEALRR+REGAAMIRT+G+  G+GNI++ VR
Sbjct  121  SEVLTLADDENHINKHNFRIPFVCGCRNLGEALRRIREGAAMIRTKGE-AGTGNIIEAVR  179

Query  461  SVRKVMGDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAA  282
             VR VMGDIRVL NMD+DEVF F+KKI APYD+V+QTKQ+ RLPVVHFA+GG+ TPADAA
Sbjct  180  HVRSVMGDIRVLRNMDDDEVFTFAKKIQAPYDLVMQTKQLGRLPVVHFAAGGVATPADAA  239

Query  281  IMMQLGCDGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            +MMQLGCDG+F+G  +F   DP K+  AIVQAV +Y+DP +LA+ S GL +AM G+NL
Sbjct  240  LMMQLGCDGVFVGSGIFKSGDPAKRGRAIVQAVTHYSDPQLLAEISCGLGEAMVGINL  297



>ref|XP_006488530.1| PREDICTED: probable pyridoxal biosynthesis protein PDX1-like 
[Citrus sinensis]
Length=310

 Score =   404 bits (1038),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 198/298 (66%), Positives = 243/298 (82%), Gaps = 8/298 (3%)
 Frame = -1

Query  980  MAEDGAVTVYSGSAITDA-KKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVI  804
            MA+ G VTVY   AI +  KK+PFS+KVG+AQMLRGG I++V T +QA+IAE AGAC V+
Sbjct  1    MADTGVVTVYGNGAIYETTKKSPFSVKVGLAQMLRGGVIMDVVTPEQARIAEEAGACAVM  60

Query  803  VSE---PDSR---GISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDE  642
              E    D R   G++RM DP LIK+IK +V+IPVMAK+R+GHFVEAQILE +GVDY+DE
Sbjct  61   ALERVPADIRAQGGVARMSDPQLIKQIKSSVTIPVMAKARIGHFVEAQILEAIGVDYVDE  120

Query  641  SELLAIADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVR  462
            SE+L  ADE++ INKHNFRVPFVCG R+LGE+LRR+REGAAMIRT+G+  G+GNIV+ VR
Sbjct  121  SEVLTPADEENHINKHNFRVPFVCGCRNLGESLRRIREGAAMIRTKGE-AGTGNIVEAVR  179

Query  461  SVRKVMGDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAA  282
             VR VMGDIRVL NMD+DEVF F+K IAAPYD+V+QTKQ+ RLPVVHFA+GG+ TPADAA
Sbjct  180  HVRSVMGDIRVLRNMDDDEVFTFAKNIAAPYDLVMQTKQLGRLPVVHFAAGGVATPADAA  239

Query  281  IMMQLGCDGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            +MMQLGCDG+F+G  VF   DP ++  AIVQAV NY+DP VLA+ S GL +AM G+NL
Sbjct  240  MMMQLGCDGVFVGSGVFKSGDPVRRARAIVQAVTNYSDPDVLAEVSCGLGEAMVGINL  297



>gb|EYU45710.1| hypothetical protein MIMGU_mgv1a010525mg [Erythranthe guttata]
Length=310

 Score =   404 bits (1037),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 194/298 (65%), Positives = 242/298 (81%), Gaps = 8/298 (3%)
 Frame = -1

Query  980  MAEDGAVTVYSGSAITDA-KKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVI  804
            MA  G VTVY   AIT+  K++PFS+KVG+AQMLRGG I++V   +QA+IAE AGAC V+
Sbjct  1    MAGSGVVTVYGNGAITETTKQSPFSVKVGLAQMLRGGVIMDVVNAEQARIAEEAGACAVM  60

Query  803  VSE---PDSR---GISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDE  642
              E    D R   G++RM DP LIKEIK+AV+IPVMAK+R+GHFVEAQILE +G+DY+DE
Sbjct  61   ALERVPADIRAQGGVARMSDPQLIKEIKQAVTIPVMAKARIGHFVEAQILEAIGIDYVDE  120

Query  641  SELLAIADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVR  462
            SE+L +AD+++ INKHNFR+PFVCG R+LGEALRR+REGAAMIRT+G+  G+GNI++ VR
Sbjct  121  SEVLTLADDENHINKHNFRIPFVCGCRNLGEALRRIREGAAMIRTKGE-AGTGNIIEAVR  179

Query  461  SVRKVMGDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAA  282
             VR VMGDIRVL NMD+DEVF F+KKI APYD+V+QTKQ+ RLPVVHFA+GG+ TPADAA
Sbjct  180  HVRSVMGDIRVLRNMDDDEVFTFAKKIQAPYDLVMQTKQLGRLPVVHFAAGGVATPADAA  239

Query  281  IMMQLGCDGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            +MMQLGCDG+F+G  VF   DP ++  AIVQAV +Y+DP VL   S GL +AM G+NL
Sbjct  240  LMMQLGCDGVFVGSGVFKSGDPARRARAIVQAVTHYSDPQVLVDVSCGLGEAMVGINL  297



>ref|XP_009387957.1| PREDICTED: probable pyridoxal biosynthesis protein PDX1.1 [Musa 
acuminata subsp. malaccensis]
Length=311

 Score =   404 bits (1037),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 197/299 (66%), Positives = 245/299 (82%), Gaps = 9/299 (3%)
 Frame = -1

Query  980  MAEDGAVTVY-SGSAITDAKKNP-FSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCV  807
            M++ G VTVY +G+A+T+ KK+  FS+KVG+AQMLRGG I++V T +QA++AE AGAC V
Sbjct  1    MSDSGVVTVYGNGAALTEPKKSSTFSVKVGLAQMLRGGVIMDVVTPEQARVAEEAGACAV  60

Query  806  IVSE---PDSR---GISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYID  645
            +  E    D R   G++RM DP LIKEIKRAV+IPVMAK+R+GHFVEAQILE +GVDY+D
Sbjct  61   MALERVPADIRAQGGVARMSDPGLIKEIKRAVTIPVMAKARIGHFVEAQILEAIGVDYVD  120

Query  644  ESELLAIADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTV  465
            ESE+L  AD+ H INKHNFRVPFVCG R+LGEALRR+REGAAMIRT+G+  G+GNIV+ V
Sbjct  121  ESEVLTPADDQHHINKHNFRVPFVCGCRNLGEALRRIREGAAMIRTKGE-AGTGNIVEAV  179

Query  464  RSVRKVMGDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADA  285
            R VR VMGDIR L NMD+DEVFAF+K+IAAPYD+V+QTKQ+ RLPVVHFA+GG+ TPADA
Sbjct  180  RHVRSVMGDIRALRNMDDDEVFAFAKRIAAPYDLVMQTKQLGRLPVVHFAAGGVATPADA  239

Query  284  AIMMQLGCDGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            A+MMQLGCDG+F+G  +F   DP ++  AIVQAV +Y DP +LA+ S GL +AM G NL
Sbjct  240  ALMMQLGCDGVFVGSGIFKSGDPARRARAIVQAVTHYTDPEILAEVSCGLGEAMVGSNL  298



>ref|XP_006425070.1| hypothetical protein CICLE_v10028683mg [Citrus clementina]
 gb|ESR38310.1| hypothetical protein CICLE_v10028683mg [Citrus clementina]
Length=371

 Score =   405 bits (1042),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 205/341 (60%), Positives = 262/341 (77%), Gaps = 26/341 (8%)
 Frame = -1

Query  1055  IKSSPHE-------ARY*SVVSLAHCTE--------HF---AEMAEDGAVTVYSGSAITD  930
             +++SPH        +++ S ++L+H           HF   ++MA+ G VTVY   AI +
Sbjct  19    VQASPHRHLLLKSVSQFLSHLTLSHLNIYKTNKQRIHFFFPSKMADTGVVTVYGNGAIYE  78

Query  929   A-KKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIVSE---PDSR---GISR  771
               KK+PFS+KVG+AQMLRGG I++V T +QA+IAE AGAC V+  E    D R   G++R
Sbjct  79    TTKKSPFSVKVGLAQMLRGGVIMDVVTPEQARIAEEAGACAVMALERVPADIRAQGGVAR  138

Query  770   MPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLAIADEDHFINKHN  591
             M DP LIK+IK +V+IPVMAK+R+GHFVEAQILE +GVDY+DESE+L  ADE++ INKHN
Sbjct  139   MSDPQLIKQIKSSVTIPVMAKARIGHFVEAQILEAIGVDYVDESEVLTPADEENHINKHN  198

Query  590   FRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKVMGDIRVLNNMDE  411
             FRVPFVCG R+LGE+LRR+REGAAMIRT+G+  G+GNIV+ VR VR VMGDIRVL NMD+
Sbjct  199   FRVPFVCGCRNLGESLRRIREGAAMIRTKGE-AGTGNIVEAVRHVRSVMGDIRVLRNMDD  257

Query  410   DEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQLGCDGIFLGPEVF  231
             DEVF F+K IAAPYD+V+QTKQ+ RLPVVHFA+GG+ TPADAA+MMQLGCDG+F+G  VF
Sbjct  258   DEVFTFAKNIAAPYDLVMQTKQLGRLPVVHFAAGGVATPADAAMMMQLGCDGVFVGSGVF  317

Query  230   NCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
                DP ++  AIVQAV NY+DP VLA+ S GL +AM G++L
Sbjct  318   KSGDPVRRARAIVQAVTNYSDPDVLAEVSCGLGEAMVGIDL  358



>ref|NP_001238041.1| pyridoxine biosynthesis protein [Glycine max]
 gb|AAZ67142.1| pyridoxine biosynthesis protein [Glycine max]
Length=311

 Score =   403 bits (1036),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 193/298 (65%), Positives = 241/298 (81%), Gaps = 7/298 (2%)
 Frame = -1

Query  983  EMAEDGAVTVYSGSAITDAKKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVI  804
            E +  G VTVY   AIT+ KK+PFS+KVG+AQMLRGG I++V   +QA+IAE AGAC V+
Sbjct  2    EGSGSGVVTVYGNGAITETKKSPFSVKVGLAQMLRGGVIMDVVDAEQARIAEEAGACAVM  61

Query  803  VSE---PDSR---GISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDE  642
              E    D R   G++RM DP LI +IKRAV+IPVMAK+R+GHFVEAQILE +G+DY+DE
Sbjct  62   ALERVPADIRAQGGVARMSDPQLINDIKRAVTIPVMAKARIGHFVEAQILEAIGIDYVDE  121

Query  641  SELLAIADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVR  462
            SE+L +AD+ + INKHNFR+PFVCG R+LGEALRR+REGAAMIRT+G+  G+GNI++ VR
Sbjct  122  SEVLTLADDANHINKHNFRIPFVCGCRNLGEALRRIREGAAMIRTKGE-AGTGNIIEAVR  180

Query  461  SVRKVMGDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAA  282
             VR VM DIRVL NMD+DEVF F+K IAAPYD+V+QTKQ+ RLPVVHFA+GG+ TPADAA
Sbjct  181  HVRSVMSDIRVLRNMDDDEVFTFAKNIAAPYDLVMQTKQLGRLPVVHFAAGGVATPADAA  240

Query  281  IMMQLGCDGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            +MMQLGCDG+F+G  VF   DP K+  AIVQAV +Y+DP +LA+ S GL +AM G+NL
Sbjct  241  LMMQLGCDGVFVGSGVFKSGDPAKRARAIVQAVTHYSDPEILAEVSCGLGEAMVGINL  298



>gb|EPS62113.1| hypothetical protein M569_12680 [Genlisea aurea]
Length=310

 Score =   403 bits (1036),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 194/298 (65%), Positives = 245/298 (82%), Gaps = 8/298 (3%)
 Frame = -1

Query  980  MAEDGAVTVYSGSAITD-AKKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVI  804
            MA  G VTVY   AIT+ AK++PFS+KVG+AQMLRGG I++V T +QA++AE AGAC V+
Sbjct  1    MAGSGVVTVYGNGAITETAKQSPFSVKVGLAQMLRGGVIMDVVTPEQARVAEEAGACAVM  60

Query  803  VSE---PDSR---GISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDE  642
              E    D R   G++RM DP +IKEIK+AV+IPVMAK+R+GHFVEAQILE +G+DY+DE
Sbjct  61   ALERVPADIRAQGGVARMSDPQMIKEIKQAVTIPVMAKARIGHFVEAQILEAIGIDYVDE  120

Query  641  SELLAIADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVR  462
            SE+L  AD+++ INKHNFR+PFVCG R+LGEALRR+REGAAMIRT+G+  G+GNI++ VR
Sbjct  121  SEVLTPADDNNHINKHNFRIPFVCGCRNLGEALRRIREGAAMIRTKGE-AGTGNIIEAVR  179

Query  461  SVRKVMGDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAA  282
             VR VMGDIR+L NMD+DEVF F+KKI APYD+V+QTKQ+ RLPVVHFA+GG+ TPADAA
Sbjct  180  HVRSVMGDIRLLRNMDDDEVFTFAKKIQAPYDLVMQTKQLGRLPVVHFAAGGVATPADAA  239

Query  281  IMMQLGCDGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            +MMQLGCDG+F+G  VF   DP ++  AIVQAV +Y+DP VLA+ S GL +AM G+NL
Sbjct  240  LMMQLGCDGVFVGSGVFKSGDPARRARAIVQAVTHYSDPEVLAEVSCGLGEAMVGINL  297



>emb|CDX80774.1| BnaC03g00280D [Brassica napus]
Length=309

 Score =   403 bits (1036),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 191/291 (66%), Positives = 240/291 (82%), Gaps = 7/291 (2%)
 Frame = -1

Query  962  VTVYSGSAITDAKKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIVSE---P  792
            V VY   AIT+AKK+PFS+KVG+AQMLRGG I++V   +QA+IAE AGAC V+  E    
Sbjct  7    VAVYGNGAITEAKKSPFSVKVGLAQMLRGGVIMDVVNAEQARIAEEAGACAVMALERVPA  66

Query  791  DSR---GISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLAIA  621
            D R   G++RM DP +IK+IK+AV+IPVMAK+R+GHFVEAQILE +G+DYIDESE+L +A
Sbjct  67   DIRAQGGVARMSDPQMIKDIKQAVTIPVMAKARIGHFVEAQILEAIGIDYIDESEVLTLA  126

Query  620  DEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKVMG  441
            DED+ INKHNFR+PFVCG R+LGEALRR+REGAAMIRT+G+  G+GNIV+ VR VR VMG
Sbjct  127  DEDNHINKHNFRIPFVCGCRNLGEALRRIREGAAMIRTKGE-AGTGNIVEAVRHVRSVMG  185

Query  440  DIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQLGC  261
            DIRVL NMD+DEVF F+KK+AAPYD+V+QTKQ+ RLPVV FA+GG+ TPADAA+MMQLGC
Sbjct  186  DIRVLRNMDDDEVFTFAKKLAAPYDLVMQTKQLGRLPVVQFAAGGVATPADAALMMQLGC  245

Query  260  DGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            DG+F+G  +F   DP ++  AIVQAV +Y+DP +L + S GL +AM G+NL
Sbjct  246  DGVFVGSGIFKSGDPARRARAIVQAVTHYSDPEMLVEVSCGLGEAMVGINL  296



>gb|AAM66972.1| pyridoxine biosynthesis protein-like [Arabidopsis thaliana]
Length=309

 Score =   403 bits (1036),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 192/297 (65%), Positives = 240/297 (81%), Gaps = 7/297 (2%)
 Frame = -1

Query  980  MAEDGAVTVYSGSAITDAKKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIV  801
            M   G V VY   AIT+AKK+PFS+KVG+AQMLRGG I++V   +QA+IAE AGAC V+ 
Sbjct  1    MEGTGVVAVYGNGAITEAKKSPFSVKVGLAQMLRGGVIMDVVNAEQARIAEEAGACAVMA  60

Query  800  SE---PDSR---GISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDES  639
             E    D R   G++RM DP +IKEIK+AV+IPVMAK+R+GHFVEAQILE +G+DYIDES
Sbjct  61   LERVPADIRAQGGVARMSDPQMIKEIKQAVTIPVMAKARIGHFVEAQILEAIGIDYIDES  120

Query  638  ELLAIADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRS  459
            E+L +ADEDH INKHNFR+PFVCG R+LGEALRR+REGAAMIRT+G+  G+GNI++ VR 
Sbjct  121  EVLTLADEDHHINKHNFRIPFVCGCRNLGEALRRIREGAAMIRTKGE-AGTGNIIEAVRH  179

Query  458  VRKVMGDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAI  279
            VR V GDIRVL NMD+DEVF F+KK+AAPYD+V+QTKQ+ RLPVV  A+GG+ TPADAA+
Sbjct  180  VRSVNGDIRVLRNMDDDEVFTFAKKLAAPYDLVMQTKQLGRLPVVQSAAGGVATPADAAL  239

Query  278  MMQLGCDGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            MMQLGCDG+F+G  +F   DP ++  AIVQAV +Y+DP +L + S GL +AM G+NL
Sbjct  240  MMQLGCDGVFVGSGIFKSGDPARRARAIVQAVTHYSDPEMLVEVSCGLGEAMVGINL  296



>ref|XP_009130656.1| PREDICTED: pyridoxal biosynthesis protein PDX1.3-like [Brassica 
rapa]
 emb|CDY11202.1| BnaA03g00380D [Brassica napus]
Length=309

 Score =   403 bits (1036),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 191/291 (66%), Positives = 240/291 (82%), Gaps = 7/291 (2%)
 Frame = -1

Query  962  VTVYSGSAITDAKKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIVSE---P  792
            V VY   AIT+AKK+PFS+KVG+AQMLRGG I++V   +QA+IAE AGAC V+  E    
Sbjct  7    VAVYGNGAITEAKKSPFSVKVGLAQMLRGGVIMDVVNAEQARIAEEAGACAVMALERVPA  66

Query  791  DSR---GISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLAIA  621
            D R   G++RM DP +IK+IK+AV+IPVMAK+R+GHFVEAQILE +G+DYIDESE+L +A
Sbjct  67   DIRAQGGVARMSDPQMIKDIKQAVTIPVMAKARIGHFVEAQILEAIGIDYIDESEVLTLA  126

Query  620  DEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKVMG  441
            DED+ INKHNFR+PFVCG R+LGEALRR+REGAAMIRT+G+  G+GNIV+ VR VR VMG
Sbjct  127  DEDNHINKHNFRIPFVCGCRNLGEALRRIREGAAMIRTKGE-AGTGNIVEAVRHVRSVMG  185

Query  440  DIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQLGC  261
            DIRVL NMD+DEVF F+KK+AAPYD+V+QTKQ+ RLPVV FA+GG+ TPADAA+MMQLGC
Sbjct  186  DIRVLRNMDDDEVFTFAKKLAAPYDLVMQTKQLGRLPVVQFAAGGVATPADAALMMQLGC  245

Query  260  DGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            DG+F+G  +F   DP ++  AIVQAV +Y+DP +L + S GL +AM G+NL
Sbjct  246  DGVFVGSGIFKSGDPARRARAIVQAVTHYSDPEMLVEVSCGLGEAMVGINL  296



>ref|XP_009417196.1| PREDICTED: probable pyridoxal biosynthesis protein PDX1.1 [Musa 
acuminata subsp. malaccensis]
Length=311

 Score =   403 bits (1035),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 195/299 (65%), Positives = 245/299 (82%), Gaps = 9/299 (3%)
 Frame = -1

Query  980  MAEDGAVTVY-SGSAITDAKKNP-FSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCV  807
            M++ G VTVY +G+A+ + KK+  FS+KVG+AQMLRGG I++V T +QA++AE AGAC V
Sbjct  1    MSDSGVVTVYGNGAALLEPKKSSTFSVKVGLAQMLRGGVIMDVVTPEQARVAEEAGACAV  60

Query  806  IVSE---PDSR---GISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYID  645
            +  E    D R   G++RM DP LIKEIKRAV+IPVMAK+R+GHFVEAQILE +GVDY+D
Sbjct  61   MALERVPADIRAQGGVARMSDPGLIKEIKRAVTIPVMAKARIGHFVEAQILEAIGVDYVD  120

Query  644  ESELLAIADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTV  465
            ESE+L  AD+ H INKHNFRVPFVCG RDLGEALRR+REGAAMIRT+G+  G+GNI++ V
Sbjct  121  ESEVLTPADDQHHINKHNFRVPFVCGCRDLGEALRRIREGAAMIRTKGE-AGTGNIIEAV  179

Query  464  RSVRKVMGDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADA  285
            R VR VMGDIR L NMD+DEVF F+K+IAAPYD+V+QTKQ+ RLPVVHFA+GG+ TPADA
Sbjct  180  RHVRSVMGDIRALRNMDDDEVFTFAKRIAAPYDLVMQTKQLGRLPVVHFAAGGVATPADA  239

Query  284  AIMMQLGCDGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            A+MMQLGCDG+F+G  +F   DP ++  AIVQAV +Y+DP +LA+ S GL +AM G+NL
Sbjct  240  ALMMQLGCDGVFVGSGIFKSGDPARRARAIVQAVTHYSDPEILAEVSCGLGEAMVGINL  298



>ref|XP_007147987.1| hypothetical protein PHAVU_006G171100g [Phaseolus vulgaris]
 sp|Q9FT25.1|PDX1_PHAVU RecName: Full=Pyridoxal 5'-phosphate synthase subunit PDX1; Short=PLP 
synthase subunit PDX1; AltName: Full=pvPDX1 [Phaseolus 
vulgaris]
 gb|AAG17942.1| putative pyridoxine biosynthetic enzyme [Phaseolus vulgaris]
 gb|AGV54409.1| pyridoxal biosynthesis protein PDX1-like protein [Phaseolus vulgaris]
 gb|ESW19981.1| hypothetical protein PHAVU_006G171100g [Phaseolus vulgaris]
Length=312

 Score =   402 bits (1034),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 193/292 (66%), Positives = 240/292 (82%), Gaps = 8/292 (3%)
 Frame = -1

Query  962  VTVYSGS-AITDAKKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIVSE---  795
            V +Y G+ AIT+ KK+PFS+KVG+AQMLRGG I++V   DQA+IAE AGAC V+  E   
Sbjct  9    VALYDGNGAITETKKSPFSVKVGLAQMLRGGVIMDVVNADQARIAEEAGACAVMALERVP  68

Query  794  PDSR---GISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLAI  624
             D R   G++RM DP LIKEIKRAV+IPVMAK+R+GHFVEAQILE +G+DY+DESE+L +
Sbjct  69   ADIRAQGGVARMSDPQLIKEIKRAVTIPVMAKARIGHFVEAQILEAIGIDYVDESEVLTL  128

Query  623  ADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKVM  444
            AD+ + INKHNFR+PFVCG R+LGEALRR+REGAAMIRT+G+  G+GNI++ VR VR VM
Sbjct  129  ADDANHINKHNFRIPFVCGCRNLGEALRRIREGAAMIRTKGE-AGTGNIIEAVRHVRSVM  187

Query  443  GDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQLG  264
             DIRVL NMD+DEVF F+K IAAPYD+V+QTKQ+ RLPVVHFA+GG+ TPADAA+MMQLG
Sbjct  188  SDIRVLRNMDDDEVFTFAKSIAAPYDLVMQTKQLGRLPVVHFAAGGVATPADAALMMQLG  247

Query  263  CDGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            CDG+F+G  VF   DP K+  AIVQAV +Y+DP +LA+ S GL +AM G+NL
Sbjct  248  CDGVFVGSGVFKSGDPAKRARAIVQAVTHYSDPEILAEVSCGLGEAMVGINL  299



>gb|KDO66893.1| hypothetical protein CISIN_1g037779mg [Citrus sinensis]
Length=310

 Score =   402 bits (1033),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 197/298 (66%), Positives = 243/298 (82%), Gaps = 8/298 (3%)
 Frame = -1

Query  980  MAEDGAVTVYSGSAITDA-KKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVI  804
            MA+ G VTVY   AI +  KK+PFS+KVG+AQMLRGG I++V T +QA+IAE AGAC V+
Sbjct  1    MADTGVVTVYGNGAIYETTKKSPFSVKVGLAQMLRGGVIMDVVTPEQARIAEEAGACAVM  60

Query  803  VSE---PDSR---GISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDE  642
              E    D R   G++RM DP LIK+IK +V+IPVMAK+R+GHFVEAQILE +GVDY+DE
Sbjct  61   ALERVPADIRAQGGVARMSDPQLIKQIKSSVTIPVMAKARIGHFVEAQILEAIGVDYVDE  120

Query  641  SELLAIADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVR  462
            SE+L  ADE++ INKHNFRVPFVCG R+LGE+LRR+REGAAMIRT+G+  G+GNIV+ VR
Sbjct  121  SEVLTPADEENHINKHNFRVPFVCGCRNLGESLRRIREGAAMIRTKGE-AGTGNIVEAVR  179

Query  461  SVRKVMGDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAA  282
             VR VMGDIRVL NMD+DEVF F+K IAAPYD+V+QTKQ+ RLPVVHFA+GG+ TPADAA
Sbjct  180  HVRSVMGDIRVLRNMDDDEVFTFAKNIAAPYDLVMQTKQLGRLPVVHFAAGGVATPADAA  239

Query  281  IMMQLGCDGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            +MMQLGCDG+F+G  VF   DP ++  AIVQAV NY+DP VLA+ S GL +AM G++L
Sbjct  240  MMMQLGCDGVFVGSGVFKSGDPVRRARAIVQAVTNYSDPDVLAEVSCGLGEAMVGIDL  297



>sp|Q39963.1|PDX1_HEVBR RecName: Full=Probable pyridoxal 5'-phosphate synthase subunit 
PDX1; Short=PLP synthase subunit PDX1; AltName: Full=Ethylene-inducible 
protein HEVER [Hevea brasiliensis]
 gb|AAA91063.1| ethylene-inducible protein [Hevea brasiliensis]
Length=309

 Score =   402 bits (1032),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 192/297 (65%), Positives = 242/297 (81%), Gaps = 7/297 (2%)
 Frame = -1

Query  980  MAEDGAVTVYSGSAITDAKKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIV  801
            MA  G V VY   AIT+ KK+PFS+KVG+AQMLRGG I++V   +QA+IAE AGAC V+ 
Sbjct  1    MAGTGVVAVYGNGAITETKKSPFSVKVGLAQMLRGGVIMDVVNPEQARIAEEAGACAVMA  60

Query  800  SE---PDSR---GISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDES  639
             E    D R   G++RM DP LIKEIK++V+IPVMAK+R+GHFVEAQILE +G+DY+DES
Sbjct  61   LERVPADIRAQGGVARMSDPQLIKEIKQSVTIPVMAKARIGHFVEAQILEAIGIDYVDES  120

Query  638  ELLAIADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRS  459
            E+L  ADE++ INKHNFR+PFVCG R+LGEALRR+REGAAMIRT+G+  G+GN+++ VR 
Sbjct  121  EVLTPADEENHINKHNFRIPFVCGCRNLGEALRRIREGAAMIRTKGE-AGTGNVIEAVRH  179

Query  458  VRKVMGDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAI  279
            VR VMGDIR+L NMD+DEVF F+KKIAAPYD+V+QTKQ+ RLPVV FA+GG+ TPADAA+
Sbjct  180  VRSVMGDIRLLRNMDDDEVFTFAKKIAAPYDLVMQTKQLGRLPVVQFAAGGVATPADAAL  239

Query  278  MMQLGCDGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            MMQLGCDG+F+G  VF   DP ++  AIVQAV +Y+DP +LA+ S GL +AM G+NL
Sbjct  240  MMQLGCDGVFVGSGVFKSGDPARRARAIVQAVTHYSDPDMLAEVSCGLGEAMVGINL  296



>ref|XP_009385390.1| PREDICTED: probable pyridoxal biosynthesis protein PDX1 [Musa 
acuminata subsp. malaccensis]
Length=311

 Score =   401 bits (1031),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 195/299 (65%), Positives = 245/299 (82%), Gaps = 9/299 (3%)
 Frame = -1

Query  980  MAEDGAVTVY-SGSAITDAKKNP-FSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCV  807
            M++ G V VY +G+A+T+ KK+  FS+KVG+AQMLRGG I++V T +QA++AE AGAC V
Sbjct  1    MSDSGVVMVYGNGAALTEPKKSSTFSVKVGLAQMLRGGVIMDVVTPEQARVAEEAGACAV  60

Query  806  IVSE---PDSR---GISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYID  645
            +  E    D R   G++RM DP LIKEIKRAV+IPVMAK+R+GHFVEAQILE +GVDY+D
Sbjct  61   MALERVPADIRAQGGVARMSDPGLIKEIKRAVTIPVMAKARIGHFVEAQILEAIGVDYVD  120

Query  644  ESELLAIADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTV  465
            ESE+L  ADE + INKHNFRVPFVCG RDLGEALRR+REGAAMIRT+G+  G+GNI++ V
Sbjct  121  ESEVLTPADEQNHINKHNFRVPFVCGCRDLGEALRRIREGAAMIRTKGE-AGTGNIIEAV  179

Query  464  RSVRKVMGDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADA  285
            R VR VMGDIR L NMD+DEVF F+K+IAAPYD+V+QTKQ+ RLPVVHFA+GG+ TPADA
Sbjct  180  RHVRSVMGDIRALRNMDDDEVFTFAKRIAAPYDLVMQTKQLGRLPVVHFAAGGVATPADA  239

Query  284  AIMMQLGCDGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            A+MMQLGCDG+F+G  +F   DP ++  AIVQAV +Y+DP +LA+ S GL +AM G+NL
Sbjct  240  ALMMQLGCDGVFVGSGIFKSGDPARRARAIVQAVTHYSDPEILAEVSCGLGEAMVGINL  298



>ref|XP_008384798.1| PREDICTED: probable pyridoxal biosynthesis protein PDX1 [Malus 
domestica]
Length=312

 Score =   401 bits (1031),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 196/295 (66%), Positives = 242/295 (82%), Gaps = 9/295 (3%)
 Frame = -1

Query  968  GAVTVYSGSAI--TDAKKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIVSE  795
            G VTVY   AI  T +K +PFS+KVG+AQMLRGG I++V    QA+IAE +GAC V+  E
Sbjct  6    GVVTVYGKGAIYETTSKSSPFSVKVGLAQMLRGGVIMDVVNPAQARIAEESGACAVMALE  65

Query  794  ---PDSR---GISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESEL  633
                D R   G++RM DP LIKEIKR+V+IPVMAK+R+GHFVEAQILE +GVDY+DESE+
Sbjct  66   RVPSDIRSQGGVARMSDPQLIKEIKRSVTIPVMAKARIGHFVEAQILEAIGVDYVDESEV  125

Query  632  LAIADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVR  453
            L +AD++H INKHNFRVPFVCG RDLGEALRR+REGAAMIRT+G+  G+GNIV+ VR VR
Sbjct  126  LTLADDEHHINKHNFRVPFVCGCRDLGEALRRIREGAAMIRTKGE-AGTGNIVEAVRHVR  184

Query  452  KVMGDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMM  273
             VMGDIRVL NMD+DEVFA++K+I+APYD+++QTKQ+ RLPVVHFA+GG+ TPADAA+MM
Sbjct  185  HVMGDIRVLRNMDDDEVFAYAKRISAPYDLMMQTKQVGRLPVVHFAAGGVATPADAALMM  244

Query  272  QLGCDGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            QLGCDG+F+G  VF  SDP ++  AIVQA  +Y+DP VLA  S GL +AMAG+NL
Sbjct  245  QLGCDGVFVGSGVFKSSDPARRARAIVQASTHYSDPDVLADISCGLGEAMAGINL  299



>gb|KHG25998.1| putative pyridoxal biosynthesis PDX1 [Gossypium arboreum]
Length=471

 Score =   407 bits (1045),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 195/298 (65%), Positives = 243/298 (82%), Gaps = 7/298 (2%)
 Frame = -1

Query  983  EMAEDGAVTVYSGSAITDAKKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVI  804
            +MA  G V VY   AIT+  K+PFS+KVG+AQMLRGG I++V T DQA IAE AGAC V+
Sbjct  75   DMAGTGVVAVYGNGAITETHKSPFSVKVGLAQMLRGGVIMDVVTPDQACIAEEAGACAVM  134

Query  803  VSE---PDSR---GISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDE  642
              E    D R   G++RM DP LIKEIK++V+IPVMAK+R+GHFVEAQILE +G+DY+DE
Sbjct  135  ALERVPADIRAQGGVARMSDPQLIKEIKQSVTIPVMAKARIGHFVEAQILEAIGIDYVDE  194

Query  641  SELLAIADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVR  462
            SE+L +ADE++ INKHNFR+PFVCG R+LGEALRR+REGAAMIRT+G+  G+GNI++ VR
Sbjct  195  SEVLTLADEENHINKHNFRIPFVCGCRNLGEALRRIREGAAMIRTKGE-AGTGNIIEAVR  253

Query  461  SVRKVMGDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAA  282
             VR VMGDIR+L NMD+DEVF+F+KKI +PYD+VVQTKQ+ RLPVVHFA+GG+ TPADAA
Sbjct  254  HVRSVMGDIRILRNMDDDEVFSFAKKIRSPYDLVVQTKQLGRLPVVHFAAGGVATPADAA  313

Query  281  IMMQLGCDGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            +MMQLGCDG+F+G  VF   DP ++  AIVQAV +Y+DP VLA+ S GL + M GLNL
Sbjct  314  LMMQLGCDGVFVGSGVFKSGDPARRARAIVQAVTHYSDPAVLAEVSCGLGETMVGLNL  371



>ref|XP_008778106.1| PREDICTED: probable pyridoxal biosynthesis protein PDX1.1 [Phoenix 
dactylifera]
Length=318

 Score =   401 bits (1030),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 198/303 (65%), Positives = 245/303 (81%), Gaps = 14/303 (5%)
 Frame = -1

Query  977  AEDGAVTVYSG----SAITD---AKKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAG  819
            ++ G VTVY G    +A+T+    K + FS+KVG+AQMLRGG I++V + DQA++AE AG
Sbjct  3    SDSGVVTVYGGNNGGAALTEPGVKKTSTFSVKVGLAQMLRGGVIMDVVSPDQARVAEEAG  62

Query  818  ACCVIVSE---PDSR---GISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGV  657
            AC V+  E    D R   G++RM DP LIKEIKRAV+IPVMAK+R+GHFVEAQILE +GV
Sbjct  63   ACAVMALERVPADIRAGGGVARMSDPGLIKEIKRAVTIPVMAKARIGHFVEAQILEAIGV  122

Query  656  DYIDESELLAIADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNI  477
            DY+DESE+L  AD+ H INKHNFRVPFVCG RDLGEALRR+REGAAMIRT+G+  G+GNI
Sbjct  123  DYVDESEVLTPADDVHHINKHNFRVPFVCGCRDLGEALRRIREGAAMIRTKGE-AGTGNI  181

Query  476  VDTVRSVRKVMGDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVT  297
            V+ VR VR VMGDIR L NMD+DEVFAF+K+IAAPYD+V+QTKQ+ RLPVVHFA+GG+ T
Sbjct  182  VEAVRHVRSVMGDIRFLRNMDDDEVFAFAKRIAAPYDLVMQTKQLGRLPVVHFAAGGVAT  241

Query  296  PADAAIMMQLGCDGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAG  117
            PADAA+MMQLGCDG+F+G  +F   DP ++  AIVQAV +Y+DP VLA+ SSGL +AM G
Sbjct  242  PADAALMMQLGCDGVFVGSGIFKSGDPARRARAIVQAVTHYSDPDVLAEVSSGLGEAMVG  301

Query  116  LNL  108
            +NL
Sbjct  302  INL  304



>ref|XP_004302579.1| PREDICTED: probable pyridoxal 5'-phosphate synthase subunit PDX1 
[Fragaria vesca subsp. vesca]
Length=311

 Score =   400 bits (1029),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 195/299 (65%), Positives = 241/299 (81%), Gaps = 9/299 (3%)
 Frame = -1

Query  980  MAEDGAVTVYSGSAITDAKKNP--FSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCV  807
            MA  G V VY   AIT++  N   F++KVG+AQMLRGG I++V   +QA+IAE AGAC V
Sbjct  1    MAGSGVVAVYGNGAITESSSNKSAFAVKVGLAQMLRGGVIMDVVNAEQARIAEEAGACAV  60

Query  806  IVSE---PDSR---GISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYID  645
            +  E    D R   G++RM DP LIKEIK+AV+IPVMAK+R+GHFVEAQILE +GVDY+D
Sbjct  61   MALERVPADIRAQGGVARMSDPQLIKEIKQAVTIPVMAKARIGHFVEAQILEAIGVDYVD  120

Query  644  ESELLAIADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTV  465
            ESE+L +ADED+ INKHNF++PFVCG R+LGEALRR+REGAAMIRT+G+  G+GN+++ V
Sbjct  121  ESEVLTLADEDNHINKHNFQIPFVCGCRNLGEALRRIREGAAMIRTKGE-AGTGNVIEAV  179

Query  464  RSVRKVMGDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADA  285
            R VR VMGDIRVL NMD+DEVF F+KKIAAPYD+V+QTKQ+ RLPVVHFA+GG+ TPADA
Sbjct  180  RHVRSVMGDIRVLRNMDDDEVFTFAKKIAAPYDLVMQTKQLGRLPVVHFAAGGVATPADA  239

Query  284  AIMMQLGCDGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            A+MMQLG DG+F+G  VF   DP K+  AIVQAV +YNDP++LA  S GL +AM GLNL
Sbjct  240  ALMMQLGMDGVFVGSGVFKSGDPVKRGRAIVQAVTHYNDPNILADVSCGLGEAMVGLNL  298



>ref|XP_010043429.1| PREDICTED: pyridoxal biosynthesis protein PDX1.3-like [Eucalyptus 
grandis]
 gb|KCW85437.1| hypothetical protein EUGRSUZ_B02251 [Eucalyptus grandis]
Length=311

 Score =   400 bits (1029),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 195/295 (66%), Positives = 238/295 (81%), Gaps = 9/295 (3%)
 Frame = -1

Query  968  GAVTVYSGSAI--TDAKKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIVSE  795
            G VTVY   AI  T  K + FS+KVG+AQMLRGG I++V   +QA+IAE AGAC V+  E
Sbjct  5    GVVTVYGNGAIAETTKKSSTFSVKVGLAQMLRGGVIMDVVNAEQARIAEEAGACAVMALE  64

Query  794  ---PDSR---GISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESEL  633
                D R   G++RM DP LIKEIK AV+IPVMAK+R+GHFVEAQILE +G+DY+DESE+
Sbjct  65   RVPADIRAQGGVARMSDPQLIKEIKNAVTIPVMAKARIGHFVEAQILEALGIDYVDESEV  124

Query  632  LAIADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVR  453
            L +ADED+ INKHNFR+PFVCG R+LGEALRR+REGAAMIRT+G+  G+GN+V+ VR VR
Sbjct  125  LTLADEDNHINKHNFRIPFVCGCRNLGEALRRIREGAAMIRTKGE-AGTGNVVEAVRHVR  183

Query  452  KVMGDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMM  273
             VMGDIRVL NMD+DEVFAF+KKIAAPYD+V+QTKQ+ RLPVV FA+GG+ TPADAA+MM
Sbjct  184  SVMGDIRVLRNMDDDEVFAFAKKIAAPYDLVMQTKQLGRLPVVQFAAGGVATPADAALMM  243

Query  272  QLGCDGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            QLGCDG+F+G  VF   DP K+  AIVQAV +Y DP +LA+ S GL +AM G+NL
Sbjct  244  QLGCDGVFVGSGVFKSGDPAKRAKAIVQAVTHYTDPELLAEVSCGLGEAMVGINL  298



>ref|XP_009598644.1| PREDICTED: probable pyridoxal biosynthesis protein PDX1 [Nicotiana 
tomentosiformis]
 ref|XP_009800129.1| PREDICTED: probable pyridoxal biosynthesis protein PDX1 [Nicotiana 
sylvestris]
 gb|AAS92255.1| putative pyridoxine biosynthesis protein isoform A [Nicotiana 
tabacum]
 gb|AAS92256.1| putative pyridoxine biosynthesis protein isoform B [Nicotiana 
tabacum]
Length=309

 Score =   400 bits (1029),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 191/298 (64%), Positives = 244/298 (82%), Gaps = 8/298 (3%)
 Frame = -1

Query  980  MAEDGAVTVYSGSAITDA-KKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVI  804
            MA  G VT+Y   A+T+  K++PFS+KVG+AQMLRGG I++V   +QA+IAE AGAC V+
Sbjct  1    MAGSGVVTLYGNGALTETTKQSPFSVKVGLAQMLRGGVIMDVVNAEQARIAEEAGACAVM  60

Query  803  VSE---PDSR---GISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDE  642
              E    D R   G++RM DP LIKEIK+AV+IPVMAK+R+GHFVEAQILE +G+DY+DE
Sbjct  61   ALERVPADIRAQGGVARMSDPQLIKEIKQAVTIPVMAKARIGHFVEAQILEAIGIDYVDE  120

Query  641  SELLAIADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVR  462
            SE+L +AD+++ INKHNFR+PFVCG R+LGEALRR+REGAAMIRT+G+  G+GNI++ VR
Sbjct  121  SEVLTLADDENHINKHNFRIPFVCGCRNLGEALRRIREGAAMIRTKGE-AGTGNIIEAVR  179

Query  461  SVRKVMGDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAA  282
             VR VMGDIRVL NMD+DEVF F+KK+ APYD+V+QTKQ+ RLPVVHFA+GG+ TPADAA
Sbjct  180  HVRSVMGDIRVLRNMDDDEVFTFAKKLQAPYDLVMQTKQLGRLPVVHFAAGGVATPADAA  239

Query  281  IMMQLGCDGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            +MMQLGCDG+F+G  +F   DP K+  AIVQAV +Y+DP +LA+ S GL +AM G+NL
Sbjct  240  LMMQLGCDGVFVGSGIFKSGDPAKRGRAIVQAVTHYSDPGLLAEISCGLGEAMVGINL  297



>gb|ADE75952.1| unknown [Picea sitchensis]
Length=309

 Score =   399 bits (1026),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 192/297 (65%), Positives = 241/297 (81%), Gaps = 7/297 (2%)
 Frame = -1

Query  980  MAEDGAVTVYSGSAITDAKKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIV  801
            MA DG VTVY   AITD KK+ +++KVG+AQMLRGG I++V  V+QAKIAE AGA  V+ 
Sbjct  1    MASDGVVTVYGNGAITDPKKSSYAVKVGLAQMLRGGVIMDVVNVEQAKIAEEAGATAVMA  60

Query  800  SE---PDSR---GISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDES  639
             E    D R   G++RM DP LIKEIKRAV+IPVMAK+R+GHFVEAQILE +G+DYIDES
Sbjct  61   LERVPADIRAQGGVARMSDPGLIKEIKRAVTIPVMAKARIGHFVEAQILEAIGIDYIDES  120

Query  638  ELLAIADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRS  459
            E+L +AD+ H INKHNFR+PFVCG R+LGEALRR+ EGAAMIRT+G+  G+GN+++ VR 
Sbjct  121  EVLTVADDMHHINKHNFRMPFVCGCRNLGEALRRIAEGAAMIRTKGE-AGTGNVIEAVRH  179

Query  458  VRKVMGDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAI  279
            VR V+GDIR L ++D+DEVF F+K+IAAPY++V QTKQ+ RLPVV+FA+GG+ TPADAA+
Sbjct  180  VRSVLGDIRKLQSLDDDEVFTFAKQIAAPYELVRQTKQLGRLPVVNFAAGGVATPADAAL  239

Query  278  MMQLGCDGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            MMQLGCDG+F+G  VF   DP ++  AIVQAV +YNDPHVLA+ S  L +AM G+NL
Sbjct  240  MMQLGCDGVFVGSGVFKSGDPARRARAIVQAVTHYNDPHVLAEVSCDLGEAMVGINL  296



>ref|XP_010909911.1| PREDICTED: probable pyridoxal biosynthesis protein PDX1.1 [Elaeis 
guineensis]
Length=318

 Score =   399 bits (1025),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 196/303 (65%), Positives = 245/303 (81%), Gaps = 14/303 (5%)
 Frame = -1

Query  977  AEDGAVTVYSG----SAITD---AKKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAG  819
            ++ G VTVY G    +A+T+    K + FS+KVG+AQMLRGG I++V + DQA++AE AG
Sbjct  3    SDSGVVTVYGGNNGGAALTEPGVKKTSTFSVKVGLAQMLRGGVIMDVVSPDQARVAEEAG  62

Query  818  ACCVIVSE---PDSR---GISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGV  657
            AC V+  E    D R   G++RM DP LIKEIKRAV+IPVMAK+R+GHFVEAQILE +GV
Sbjct  63   ACAVMALERVPADIRAGGGVARMSDPGLIKEIKRAVTIPVMAKARIGHFVEAQILEAIGV  122

Query  656  DYIDESELLAIADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNI  477
            DY+DESE+L  AD+ H INKHNFRVPFVCG RDLGEALRR+REGAAMIRT+G+  G+GNI
Sbjct  123  DYVDESEVLTPADDIHHINKHNFRVPFVCGCRDLGEALRRIREGAAMIRTKGE-AGTGNI  181

Query  476  VDTVRSVRKVMGDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVT  297
            V+ VR VR VMG+IR L NMD+DEVFAF+K+IAAPYD+V+QTKQ+ RLPVVHFA+GG+ T
Sbjct  182  VEAVRHVRSVMGNIRSLRNMDDDEVFAFAKRIAAPYDLVMQTKQLGRLPVVHFAAGGVAT  241

Query  296  PADAAIMMQLGCDGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAG  117
            PADAA+MMQLGCDG+F+G  +F   DP ++  AIVQAV +Y+DP +LA+ SSGL +AM G
Sbjct  242  PADAALMMQLGCDGVFVGSGIFKSGDPARRARAIVQAVTHYSDPDILAEVSSGLGEAMVG  301

Query  116  LNL  108
            +NL
Sbjct  302  INL  304



>ref|XP_009414696.1| PREDICTED: probable pyridoxal biosynthesis protein PDX1 [Musa 
acuminata subsp. malaccensis]
Length=311

 Score =   399 bits (1024),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 195/299 (65%), Positives = 244/299 (82%), Gaps = 9/299 (3%)
 Frame = -1

Query  980  MAEDGAVTVY-SGSAITDAKKNP-FSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCV  807
            M++ G V VY  G+A+++ KK+  FS+KVG+AQMLRGG I++V T +QA+IAE AGAC V
Sbjct  1    MSDSGVVMVYGKGAALSEPKKSSTFSVKVGLAQMLRGGVIMDVVTPEQARIAEEAGACAV  60

Query  806  IVSE---PDSR---GISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYID  645
            +  E    D R   G++RM DP LIKEIKRAV+IPVMAK+R+GHFVEAQILE VGVDY+D
Sbjct  61   MALERVPADIRAQGGVARMSDPGLIKEIKRAVTIPVMAKARIGHFVEAQILEAVGVDYVD  120

Query  644  ESELLAIADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTV  465
            ESE+L  AD+ + INKHNFRVPFVCG RDLGEALRR+REGAAMIRT+G+  G+GNI++ V
Sbjct  121  ESEVLTPADDQNHINKHNFRVPFVCGCRDLGEALRRIREGAAMIRTKGE-AGTGNIIEAV  179

Query  464  RSVRKVMGDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADA  285
            R VR VMGDIR L NMD+DEVF F+K+IAAPYD+V+QTKQ+ RLPVVHFA+GG+ TPADA
Sbjct  180  RHVRSVMGDIRALRNMDDDEVFTFAKRIAAPYDLVMQTKQLGRLPVVHFAAGGVATPADA  239

Query  284  AIMMQLGCDGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            A+MMQLGCDG+F+G  +F   DP ++  AIVQAV +Y+DP +LA+ S GL +AM G+NL
Sbjct  240  ALMMQLGCDGVFVGSGIFKSGDPARRARAIVQAVTHYSDPAILAEVSCGLGEAMVGINL  298



>ref|XP_010909760.1| PREDICTED: probable pyridoxal biosynthesis protein PDX1.1 [Elaeis 
guineensis]
Length=318

 Score =   398 bits (1023),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 197/303 (65%), Positives = 243/303 (80%), Gaps = 14/303 (5%)
 Frame = -1

Query  977  AEDGAVTVYS----GSAITD---AKKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAG  819
            ++ G VTVY     GSA+T+    K + FS+KVG+AQMLRGG I++V   DQA++AE AG
Sbjct  3    SDSGVVTVYGETNGGSALTELGVKKTSTFSVKVGLAQMLRGGVIMDVVNPDQARVAEEAG  62

Query  818  ACCVIVSE---PDSR---GISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGV  657
            AC V+  E    D R   G++RM DP LIKEIKRAV+IPVMAK+R+GHFVEAQILE +GV
Sbjct  63   ACAVMALERVPADIRAGGGVARMSDPGLIKEIKRAVTIPVMAKARIGHFVEAQILEAIGV  122

Query  656  DYIDESELLAIADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNI  477
            DY+DESE+L  AD+ H INKHNFRVPFVCG RDLGEALRR+REGAAMIRT+G+  G+GNI
Sbjct  123  DYVDESEVLTPADDAHHINKHNFRVPFVCGCRDLGEALRRIREGAAMIRTKGE-AGTGNI  181

Query  476  VDTVRSVRKVMGDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVT  297
            V+ VR VR VMGDIR L+NMD+DEVFAF+K IAAPYD+V+QTKQ+ RLPVVHFA+GG+ T
Sbjct  182  VEAVRHVRSVMGDIRSLHNMDDDEVFAFAKCIAAPYDLVMQTKQLGRLPVVHFAAGGVAT  241

Query  296  PADAAIMMQLGCDGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAG  117
            PADAA+MMQLGCDG+F+G  +F   DP ++  AIVQAV +Y+DP +LA+ S GL +AM G
Sbjct  242  PADAALMMQLGCDGVFVGSGIFKSGDPARRARAIVQAVTHYSDPDILAEVSCGLGEAMVG  301

Query  116  LNL  108
            +NL
Sbjct  302  INL  304



>ref|XP_007205601.1| hypothetical protein PRUPE_ppa008974mg [Prunus persica]
 ref|XP_008220846.1| PREDICTED: probable pyridoxal biosynthesis protein PDX1 [Prunus 
mume]
 gb|EMJ06800.1| hypothetical protein PRUPE_ppa008974mg [Prunus persica]
Length=312

 Score =   397 bits (1021),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 194/295 (66%), Positives = 240/295 (81%), Gaps = 9/295 (3%)
 Frame = -1

Query  968  GAVTVYSGSAI--TDAKKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIVSE  795
            G VTVY   AI  T  K +PFS+KVG+AQMLRGG I++V    QA+IAE AGAC V+  E
Sbjct  6    GVVTVYGKGAIYETTTKSSPFSVKVGLAQMLRGGVIMDVVNPAQARIAEEAGACAVMALE  65

Query  794  ---PDSR---GISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESEL  633
                D R   G++RM DP LIKEIKR+V+IPVMAK+R+GHFVEAQILE +GVDY+DESE+
Sbjct  66   RVPADIRSQGGVARMSDPQLIKEIKRSVTIPVMAKARIGHFVEAQILEAIGVDYVDESEV  125

Query  632  LAIADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVR  453
            L +AD++H INKHNFRVPFVCG R+LGEALRR+REGAAMIRT+G+  G+GNIV+ VR VR
Sbjct  126  LTLADDEHHINKHNFRVPFVCGCRNLGEALRRIREGAAMIRTKGE-AGTGNIVEAVRHVR  184

Query  452  KVMGDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMM  273
            +VMGDIRVL NMD+DEVFA++K+IAAPYD+++QTKQ+ RLPVV FA+GG+ TPADAA+MM
Sbjct  185  QVMGDIRVLRNMDDDEVFAYAKRIAAPYDLMMQTKQLGRLPVVQFAAGGVATPADAALMM  244

Query  272  QLGCDGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            QLGCDG+F+G  VF   DP ++  AIVQA  +Y+DP VLA+ S GL +AM G+NL
Sbjct  245  QLGCDGVFVGSGVFKSGDPARRARAIVQASTHYSDPDVLAEISCGLGEAMVGINL  299



>ref|XP_002879732.1| ATPDX1.1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH55991.1| ATPDX1.1 [Arabidopsis lyrata subsp. lyrata]
Length=309

 Score =   397 bits (1020),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 194/298 (65%), Positives = 238/298 (80%), Gaps = 8/298 (3%)
 Frame = -1

Query  980  MAEDGAVTVYSGSAITDAK-KNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVI  804
            MA  G V VY   A+T+ K K+PFS+KVG+AQMLRGG I++V   +QA+IAE AGAC V+
Sbjct  1    MAATGVVAVYGEGAMTETKQKSPFSVKVGLAQMLRGGVIMDVVNAEQARIAEEAGACAVM  60

Query  803  VSE---PDSR---GISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDE  642
              E    D R   G++RM DP +IKEIK AV+IPVMAK+R+GHFVEAQILE +GVDY+DE
Sbjct  61   ALERVPADIRAQGGVARMSDPEMIKEIKNAVTIPVMAKARIGHFVEAQILEAIGVDYVDE  120

Query  641  SELLAIADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVR  462
            SE+L +ADED+ INKHNF++PFVCG R+LGEALRR+REGAAMIRT+G+  G+GN+V+ VR
Sbjct  121  SEVLTLADEDNHINKHNFKIPFVCGCRNLGEALRRIREGAAMIRTKGE-AGTGNVVEAVR  179

Query  461  SVRKVMGDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAA  282
             VR V G IR+L NMD+DEVF F+KKIAAPYD+VVQTK++ RLPVV FA+GG+ TPADAA
Sbjct  180  HVRSVNGAIRLLRNMDDDEVFTFAKKIAAPYDLVVQTKELGRLPVVQFAAGGVATPADAA  239

Query  281  IMMQLGCDGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            +MMQLGCDG+F+G  VF   DP K+  AIVQAV NY D  VLA+ S GL +AM GLNL
Sbjct  240  LMMQLGCDGVFVGSGVFKSGDPVKRAKAIVQAVTNYRDAAVLAEVSCGLGEAMVGLNL  297



>ref|XP_006657377.1| PREDICTED: probable pyridoxal biosynthesis protein PDX1.1-like 
[Oryza brachyantha]
Length=318

 Score =   397 bits (1020),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 195/306 (64%), Positives = 247/306 (81%), Gaps = 16/306 (5%)
 Frame = -1

Query  980  MAEDGA--VTVY----SGSAI---TDAKKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAE  828
            MA DG+  VTVY    +G+A+   ++ K   FS+KVG+AQMLRGG I++V T DQA+IAE
Sbjct  1    MATDGSGVVTVYGSGTNGAALLEPSNHKSATFSVKVGLAQMLRGGVIMDVVTPDQARIAE  60

Query  827  SAGACCVIVSE---PDSR---GISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILET  666
             AGAC V+  E    D R   G++RM DP LI++IKRAV+IPVMAK+R+GHFVEAQILE 
Sbjct  61   EAGACAVMALERVPADIRAQGGVARMSDPGLIRDIKRAVTIPVMAKARIGHFVEAQILEA  120

Query  665  VGVDYIDESELLAIADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGS  486
            +GVDY+DESE+L +AD+ H INKHNFRVPFVCG RDLGEALRR+REGAAMIRT+G+  G+
Sbjct  121  IGVDYVDESEVLTLADDSHHINKHNFRVPFVCGCRDLGEALRRIREGAAMIRTKGE-AGT  179

Query  485  GNIVDTVRSVRKVMGDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGG  306
            GN+V+ VR VR VMGDIR L NMD+DEVF+++K+IAAPYD+V+QTKQ+ RLPVV FA+GG
Sbjct  180  GNVVEAVRHVRSVMGDIRALRNMDDDEVFSYAKRIAAPYDLVMQTKQLGRLPVVQFAAGG  239

Query  305  IVTPADAAIMMQLGCDGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDA  126
            + TPADAA+MMQLGCDG+F+G  +F   DP ++  AIVQAV +Y+DP +LA+ SSGL +A
Sbjct  240  VATPADAALMMQLGCDGVFVGSGIFKSGDPARRARAIVQAVTHYSDPKILAEVSSGLGEA  299

Query  125  MAGLNL  108
            M G+NL
Sbjct  300  MVGINL  305



>ref|XP_010509206.1| PREDICTED: pyridoxal biosynthesis protein PDX1.1-like [Camelina 
sativa]
 ref|XP_010517111.1| PREDICTED: pyridoxal biosynthesis protein PDX1.1-like [Camelina 
sativa]
Length=310

 Score =   397 bits (1019),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 194/299 (65%), Positives = 239/299 (80%), Gaps = 9/299 (3%)
 Frame = -1

Query  980  MAEDGAVTVYSGSAITDA--KKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCV  807
            MAE G V VY   A+T+   +K+PFS+KVG+AQMLRGG I++V   +QA+IAE AGAC V
Sbjct  1    MAETGVVAVYGELAMTETTKQKSPFSVKVGLAQMLRGGVIMDVVNAEQARIAEEAGACAV  60

Query  806  IVSE---PDSR---GISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYID  645
            +  E    D R   G++RM DP +IKEIK AV+IPVMAK+R+GHFVEAQILE +GVDY+D
Sbjct  61   MALERVPADIRAQGGVARMSDPEMIKEIKNAVTIPVMAKARIGHFVEAQILEAIGVDYVD  120

Query  644  ESELLAIADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTV  465
            ESE+L +ADED+ INKHNF++PFVCG R+LGEALRR+REGAAMIRT+G+  G+GN+V+ V
Sbjct  121  ESEVLTLADEDNHINKHNFKIPFVCGCRNLGEALRRIREGAAMIRTKGE-AGTGNVVEAV  179

Query  464  RSVRKVMGDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADA  285
            R VR V G IR+L NMD+DEVF F+KKIAAPYD+VVQTK++ RLPVV FA+GG+ TPADA
Sbjct  180  RHVRSVNGAIRLLRNMDDDEVFTFAKKIAAPYDLVVQTKELGRLPVVQFAAGGVATPADA  239

Query  284  AIMMQLGCDGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            A+MMQLGCDG+F+G  VF   DP K+  AIVQAV NY D  VLA+ S GL +AM GLNL
Sbjct  240  ALMMQLGCDGVFVGSGVFKSGDPVKRAKAIVQAVTNYRDAAVLAEVSCGLGEAMVGLNL  298



>ref|XP_010505440.1| PREDICTED: pyridoxal biosynthesis protein PDX1.1 [Camelina sativa]
Length=310

 Score =   397 bits (1019),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 194/299 (65%), Positives = 239/299 (80%), Gaps = 9/299 (3%)
 Frame = -1

Query  980  MAEDGAVTVYSGSAITDA--KKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCV  807
            MAE G V VY   A+T+   +K+PFS+KVG+AQMLRGG I++V   +QA+IAE AGAC V
Sbjct  1    MAETGVVAVYGEVAMTETTKQKSPFSVKVGLAQMLRGGVIMDVVNAEQARIAEEAGACAV  60

Query  806  IVSE---PDSR---GISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYID  645
            +  E    D R   G++RM DP +IKEIK AV+IPVMAK+R+GHFVEAQILE +GVDY+D
Sbjct  61   MALERVPADIRAQGGVARMSDPEMIKEIKNAVTIPVMAKARIGHFVEAQILEAIGVDYVD  120

Query  644  ESELLAIADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTV  465
            ESE+L +ADED+ INKHNF++PFVCG R+LGEALRR+REGAAMIRT+G+  G+GN+V+ V
Sbjct  121  ESEVLTLADEDNHINKHNFKIPFVCGCRNLGEALRRIREGAAMIRTKGE-AGTGNVVEAV  179

Query  464  RSVRKVMGDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADA  285
            R VR V G IR+L NMD+DEVF F+KKIAAPYD+VVQTK++ RLPVV FA+GG+ TPADA
Sbjct  180  RHVRSVNGAIRLLRNMDDDEVFTFAKKIAAPYDLVVQTKELGRLPVVQFAAGGVATPADA  239

Query  284  AIMMQLGCDGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            A+MMQLGCDG+F+G  VF   DP K+  AIVQAV NY D  VLA+ S GL +AM GLNL
Sbjct  240  ALMMQLGCDGVFVGSGVFKSGDPVKRAKAIVQAVTNYRDAAVLAEVSCGLGEAMVGLNL  298



>ref|XP_006411025.1| hypothetical protein EUTSA_v10017969mg [Eutrema salsugineum]
 gb|ESQ52478.1| hypothetical protein EUTSA_v10017969mg [Eutrema salsugineum]
Length=310

 Score =   396 bits (1018),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 193/299 (65%), Positives = 243/299 (81%), Gaps = 9/299 (3%)
 Frame = -1

Query  980  MAE-DGAVTVYSGSAITDAKK-NPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCV  807
            MAE  G V VY   ++T+ K+ +PFS+KVG+AQMLRGG I++V   +QA+IAE AGAC V
Sbjct  1    MAEGTGVVAVYGEGSMTETKQQSPFSVKVGLAQMLRGGVIMDVINAEQARIAEEAGACAV  60

Query  806  IVSE---PDSR---GISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYID  645
            +  E    D R   G++RM DP +IKEIK++V+IPVMAK+R+GHFVEAQILE++GVDY+D
Sbjct  61   MALERVPADIRAQGGVARMSDPEMIKEIKKSVTIPVMAKARIGHFVEAQILESIGVDYVD  120

Query  644  ESELLAIADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTV  465
            ESE+L +ADED+ INKHNF++PFVCG R+LGEALRR+REGAAMIRT+G+  G+GN+V+ V
Sbjct  121  ESEVLTLADEDNHINKHNFKIPFVCGCRNLGEALRRIREGAAMIRTKGE-AGTGNVVEAV  179

Query  464  RSVRKVMGDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADA  285
            R VR VMG IR+L NMD+DEVFAF+KKIAAPY++V+QTKQ+ RLPVV FA+GGI TPADA
Sbjct  180  RHVRSVMGAIRLLRNMDDDEVFAFAKKIAAPYELVMQTKQLGRLPVVQFAAGGIATPADA  239

Query  284  AIMMQLGCDGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            A+MMQLGCDG+F+G  +F   DP K+  AIVQAV NY D  VLA+ S GL +AM GLNL
Sbjct  240  ALMMQLGCDGVFVGSGIFKSGDPAKRAKAIVQAVTNYRDAAVLAEVSCGLGEAMVGLNL  298



>ref|XP_004294253.1| PREDICTED: probable pyridoxal 5'-phosphate synthase subunit PDX1 
[Fragaria vesca subsp. vesca]
Length=312

 Score =   395 bits (1016),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 194/300 (65%), Positives = 240/300 (80%), Gaps = 10/300 (3%)
 Frame = -1

Query  980  MAEDGAVTVYSGSAI---TDAKKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACC  810
            MA+ G VTVY   AI   +  KK+ + +KVG+AQMLRGG I++V T  QA+IAE AGAC 
Sbjct  1    MADSGVVTVYGKGAICETSSTKKSSYPVKVGLAQMLRGGVIMDVVTPAQARIAEEAGACA  60

Query  809  VIVSE---PDSR---GISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYI  648
            V+  E    D R   G++RM DP LIKEIKRAV+IPVMAK R+GHF EAQILE +GVDY+
Sbjct  61   VMALERVPADIRAHGGVARMSDPQLIKEIKRAVTIPVMAKCRIGHFAEAQILEAIGVDYV  120

Query  647  DESELLAIADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDT  468
            DESE+L +AD+D+ INKHNF+VPFVCG R+LGEALRR+REGAAMIRT+G+  G+GNIV+ 
Sbjct  121  DESEVLTVADDDNHINKHNFQVPFVCGCRNLGEALRRIREGAAMIRTKGE-AGTGNIVEA  179

Query  467  VRSVRKVMGDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPAD  288
            VR VR VMG++RVL NMD+DEVF F+KKIAAPYD+V+QTKQM RLPVVHFA+GG+ TPAD
Sbjct  180  VRHVRSVMGEVRVLRNMDDDEVFGFAKKIAAPYDMVMQTKQMGRLPVVHFAAGGVATPAD  239

Query  287  AAIMMQLGCDGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            AA+MMQLGCDG+F+G  VF   +P ++  AIVQA  +Y+DP VLA+ S GL +AM G+NL
Sbjct  240  AAMMMQLGCDGVFVGSGVFKSGEPARRARAIVQAATHYSDPEVLAEVSCGLGEAMVGINL  299



>gb|KHG23612.1| putative pyridoxal biosynthesis PDX1 [Gossypium arboreum]
 gb|KJB17072.1| hypothetical protein B456_002G263400 [Gossypium raimondii]
Length=310

 Score =   395 bits (1016),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 191/294 (65%), Positives = 240/294 (82%), Gaps = 8/294 (3%)
 Frame = -1

Query  968  GAVTVYSGSAITDA-KKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIVSE-  795
            G V VY   A+T+   K+ FS+KVG+AQMLRGG I++V T +QA+IAE AGAC V+  E 
Sbjct  5    GVVAVYGNGAMTETHNKSTFSVKVGLAQMLRGGVIMDVVTPEQARIAEEAGACAVMALER  64

Query  794  --PDSR---GISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELL  630
               D R   G++RM DP LIKEIK+AV+IPVMAK+R+GHFVEAQILE +G+DY+DESE+L
Sbjct  65   VPADIRAQGGVARMSDPQLIKEIKQAVTIPVMAKARIGHFVEAQILEAIGIDYVDESEVL  124

Query  629  AIADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRK  450
              ADE++ INKHNFR+PFVCG R+LGEALRR+REGAAMIRT+G+  G+GNI++ VR VR 
Sbjct  125  TPADEENHINKHNFRIPFVCGCRNLGEALRRIREGAAMIRTKGE-AGTGNIIEAVRHVRS  183

Query  449  VMGDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQ  270
            VMGDIRVL NMD+DEVF+F+KKI +PYD+V+QTKQ+ RLPVVHFA+GG+ TPADAA+MMQ
Sbjct  184  VMGDIRVLRNMDDDEVFSFAKKIQSPYDLVMQTKQLGRLPVVHFAAGGVATPADAALMMQ  243

Query  269  LGCDGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            LGCDG+F+G  VF   DP ++  AIVQAV +Y+DP VLA+ S GL +AM G+NL
Sbjct  244  LGCDGVFVGSGVFKSGDPARRARAIVQAVTHYSDPEVLAEVSCGLGEAMVGINL  297



>ref|XP_002459215.1| hypothetical protein SORBIDRAFT_02g000720 [Sorghum bicolor]
 gb|EER95736.1| hypothetical protein SORBIDRAFT_02g000720 [Sorghum bicolor]
Length=317

 Score =   396 bits (1017),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 197/305 (65%), Positives = 245/305 (80%), Gaps = 15/305 (5%)
 Frame = -1

Query  980  MAEDGA--VTVY--SGSAITDAKKNP----FSIKVGIAQMLRGGAIVEVTTVDQAKIAES  825
            MA DG+  VTVY  +G+A+ +  K P    FS+KVG+AQMLRGG I++V T +QA+IAE 
Sbjct  1    MASDGSGVVTVYGNNGAALLEPSKQPKSATFSVKVGLAQMLRGGVIMDVVTPEQARIAEE  60

Query  824  AGACCVIVSE---PDSR---GISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETV  663
            AGAC V+  E    D R   G++RM DP LI++IKRAV+IPVMAK+R+GHFVEAQILE V
Sbjct  61   AGACAVMALERVPADIRSQGGVARMSDPGLIRDIKRAVTIPVMAKARIGHFVEAQILEAV  120

Query  662  GVDYIDESELLAIADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSG  483
            GVDY+DESE+L  AD+ H INKHNFRVPFVCG RDLGEALRRVREGAAMIRT+G+  G+G
Sbjct  121  GVDYVDESEVLTPADDAHHINKHNFRVPFVCGCRDLGEALRRVREGAAMIRTKGE-AGTG  179

Query  482  NIVDTVRSVRKVMGDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGI  303
            NIV+ VR VR VMGD+R L NMD+DEVFA++K+IAAPYD+V+QTKQ+ RLPVV FA+GG+
Sbjct  180  NIVEAVRHVRSVMGDVRALRNMDDDEVFAYAKRIAAPYDLVMQTKQLGRLPVVQFAAGGV  239

Query  302  VTPADAAIMMQLGCDGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAM  123
             TPADAA+MMQLGCDG+F+G  +F   DP ++  AIVQAV +Y+DP +LA  S+GL +AM
Sbjct  240  ATPADAALMMQLGCDGVFVGSGIFKSGDPARRARAIVQAVTHYSDPTILADVSAGLGEAM  299

Query  122  AGLNL  108
             G+NL
Sbjct  300  VGINL  304



>ref|XP_003593782.1| Pyridoxal biosynthesis protein PDX1.3 [Medicago truncatula]
 gb|AAZ67140.1| pyridoxine biosynthesis protein [Medicago truncatula]
 gb|AES64033.1| pyridoxal biosynthesis protein PDX1, putative [Medicago truncatula]
Length=314

 Score =   395 bits (1016),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 194/302 (64%), Positives = 239/302 (79%), Gaps = 12/302 (4%)
 Frame = -1

Query  980  MAEDGAVTVYSGSAITDAKKN-----PFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGA  816
            M   G VTVY   A+T+         PFS+KVG+AQMLRGG I++V   +QA+IAE AGA
Sbjct  1    MEGSGVVTVYGNGALTETTSTTTKSSPFSVKVGLAQMLRGGVIMDVVNAEQARIAEEAGA  60

Query  815  CCVIVSE---PDSR---GISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVD  654
            C V+  E    D R   G++RM DP LIKEIK AV+IPVMAK+R+GHFVEAQILE++G+D
Sbjct  61   CAVMALERVPADIRAQGGVARMSDPQLIKEIKAAVTIPVMAKARIGHFVEAQILESLGID  120

Query  653  YIDESELLAIADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIV  474
            Y+DESE+L +ADED+ INKHNFR+PFVCG R+LGEALRR+REGAAMIRT+G+  G+GNI+
Sbjct  121  YVDESEVLTLADEDNHINKHNFRIPFVCGCRNLGEALRRIREGAAMIRTKGE-AGTGNII  179

Query  473  DTVRSVRKVMGDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTP  294
            + VR VR V+GDIRVL NMDEDEVF F+KKI APYD+V+QTKQ+ RLPVV FA+GG+ TP
Sbjct  180  EAVRHVRSVLGDIRVLRNMDEDEVFTFAKKIGAPYDLVMQTKQLGRLPVVQFAAGGVATP  239

Query  293  ADAAIMMQLGCDGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGL  114
            ADAA+MMQLGCDG+F+G  VF   DP K+  AIVQAV +Y+DP +LA+ S GL +AM GL
Sbjct  240  ADAALMMQLGCDGVFVGSGVFKSGDPAKRARAIVQAVTHYSDPEILAEVSCGLGEAMVGL  299

Query  113  NL  108
            NL
Sbjct  300  NL  301



>ref|XP_006294648.1| hypothetical protein CARUB_v10023685mg [Capsella rubella]
 gb|EOA27546.1| hypothetical protein CARUB_v10023685mg [Capsella rubella]
Length=310

 Score =   395 bits (1015),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 192/299 (64%), Positives = 239/299 (80%), Gaps = 9/299 (3%)
 Frame = -1

Query  980  MAEDGAVTVYSGSAITDA--KKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCV  807
            MA  G V VY   A+T+   K +PFS+KVG+AQMLRGG I++V   DQA+IAE AGAC V
Sbjct  1    MAGTGVVAVYGEGAMTETAKKTSPFSVKVGLAQMLRGGVIMDVVNADQARIAEEAGACAV  60

Query  806  IVSE---PDSR---GISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYID  645
            +  E    D R   G++RM DP +IKEIK+AV+IPVMAK+R+GHFVEAQILE +GVDY+D
Sbjct  61   MALERVPADIRAQGGVARMSDPEMIKEIKKAVTIPVMAKARIGHFVEAQILEAIGVDYVD  120

Query  644  ESELLAIADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTV  465
            ESE+L +ADED+ INKHNF++PFVCG R+LGEALRR+REGAAMIRT+G+  G+GN+++ V
Sbjct  121  ESEVLTLADEDNHINKHNFKIPFVCGCRNLGEALRRIREGAAMIRTKGE-AGTGNVIEAV  179

Query  464  RSVRKVMGDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADA  285
            R VR V G IR+L +MD+DEVF F+KKIAAPYD+V+QTKQ+ RLPVV FA+GG+ TPADA
Sbjct  180  RHVRSVNGAIRLLRSMDDDEVFTFAKKIAAPYDLVMQTKQLGRLPVVQFAAGGVATPADA  239

Query  284  AIMMQLGCDGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            A+MMQLGCDG+F+G  VF   DP K+  AIVQAV NY+D  VLA+ S GL +AM GLNL
Sbjct  240  ALMMQLGCDGVFVGSGVFKSGDPVKRAKAIVQAVTNYSDAAVLAEVSCGLGEAMVGLNL  298



>ref|NP_001058669.1| Os07g0100200 [Oryza sativa Japonica Group]
 sp|Q69LA6.1|PDX11_ORYSJ RecName: Full=Probable pyridoxal 5'-phosphate synthase subunit 
PDX1.1; Short=PLP synthase subunit PDX1.1 [Oryza sativa Japonica 
Group]
 dbj|BAD31816.1| putative ethylene-inducible protein [Oryza sativa Japonica Group]
 dbj|BAE79758.1| putative ethylene-inducible protein [Oryza sativa Japonica Group]
 dbj|BAF20583.1| Os07g0100200 [Oryza sativa Japonica Group]
 dbj|BAG87659.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG93387.1| unnamed protein product [Oryza sativa Japonica Group]
Length=318

 Score =   394 bits (1012),  Expect = 9e-133, Method: Compositional matrix adjust.
 Identities = 194/306 (63%), Positives = 246/306 (80%), Gaps = 16/306 (5%)
 Frame = -1

Query  980  MAEDGA--VTVY----SGSAI---TDAKKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAE  828
            MA DG   VTVY    +G+A+   ++ K   FS+KVG+AQMLRGG I++V T +QA+IAE
Sbjct  1    MATDGTGVVTVYGSGTNGAALLEPSNHKSATFSVKVGLAQMLRGGVIMDVVTPEQARIAE  60

Query  827  SAGACCVIVSE---PDSR---GISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILET  666
             AGAC V+  E    D R   G++RM DP LI++IKRAV+IPVMAK+R+GHFVEAQILE 
Sbjct  61   EAGACAVMALERVPADIRAQGGVARMSDPGLIRDIKRAVTIPVMAKARIGHFVEAQILEA  120

Query  665  VGVDYIDESELLAIADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGS  486
            +GVDY+DESE+L +AD+ H INKHNFRVPFVCG RDLGEALRR+REGAAMIRT+G+  G+
Sbjct  121  IGVDYVDESEVLTLADDAHHINKHNFRVPFVCGCRDLGEALRRIREGAAMIRTKGE-AGT  179

Query  485  GNIVDTVRSVRKVMGDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGG  306
            GN+V+ VR VR VMGDIR L NMD+DEVF+++K+IAAPYD+V+QTKQ+ RLPVV FA+GG
Sbjct  180  GNVVEAVRHVRSVMGDIRALRNMDDDEVFSYAKRIAAPYDLVMQTKQLGRLPVVQFAAGG  239

Query  305  IVTPADAAIMMQLGCDGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDA  126
            + TPADAA+MMQLGCDG+F+G  +F   DP ++  AIVQAV +Y+DP +LA+ SSGL +A
Sbjct  240  VATPADAALMMQLGCDGVFVGSGIFKSGDPARRARAIVQAVTHYSDPKILAEVSSGLGEA  299

Query  125  MAGLNL  108
            M G+NL
Sbjct  300  MVGINL  305



>ref|XP_008777114.1| PREDICTED: probable pyridoxal biosynthesis protein PDX1.1 [Phoenix 
dactylifera]
Length=319

 Score =   394 bits (1012),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 194/303 (64%), Positives = 242/303 (80%), Gaps = 14/303 (5%)
 Frame = -1

Query  977  AEDGAVTVYSG----SAITD---AKKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAG  819
            ++ G VTVY G    SA+T+    K + FS+KVG+AQMLRGG I++V + +QA++AE AG
Sbjct  4    SDSGVVTVYGGNDGGSALTEPGVKKTSTFSVKVGLAQMLRGGVIMDVVSPEQARVAEEAG  63

Query  818  ACCVIVSE---PDSR---GISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGV  657
            AC V+  E    D R   G++RM DP LIKEIKRAV+IPVMAK+R+GHFVEAQILE +GV
Sbjct  64   ACAVMALERVPADIRAGAGVARMSDPGLIKEIKRAVTIPVMAKARIGHFVEAQILEAIGV  123

Query  656  DYIDESELLAIADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNI  477
            DY+DESE+L  AD+ H INKHNFRVPFVCG RDLGEALRR+REGAAMIRT+G+  G+GNI
Sbjct  124  DYVDESEVLTPADDAHHINKHNFRVPFVCGCRDLGEALRRIREGAAMIRTKGE-AGTGNI  182

Query  476  VDTVRSVRKVMGDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVT  297
            V+ VR VR VMGDIR L NMD+DEVF F+K+ AAPYD+V+QTKQ+ RLPVVHFA+GGI T
Sbjct  183  VEAVRHVRSVMGDIRSLRNMDDDEVFTFAKRTAAPYDLVMQTKQLGRLPVVHFAAGGIAT  242

Query  296  PADAAIMMQLGCDGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAG  117
            PADAA+MMQLGCDG+F+G  +F   DP ++  AIVQA+ +Y+DP +LA+ S GL +AM G
Sbjct  243  PADAALMMQLGCDGVFIGSGIFKSGDPPRRARAIVQAITHYSDPDILAEVSCGLGEAMVG  302

Query  116  LNL  108
            +NL
Sbjct  303  INL  305



>ref|XP_004987289.1| PREDICTED: probable pyridoxal biosynthesis protein PDX1.1-like 
[Setaria italica]
Length=318

 Score =   394 bits (1012),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 191/298 (64%), Positives = 244/298 (82%), Gaps = 12/298 (4%)
 Frame = -1

Query  968  GAVTVY--SGSAI---TDAKKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVI  804
            G VTVY  +G+A+   +   K+ FS+KVG+AQMLRGG I++V T +QA++AE AGAC V+
Sbjct  9    GVVTVYGNNGAALLEPSKQSKSTFSVKVGLAQMLRGGVIMDVVTPEQARLAEEAGACAVM  68

Query  803  VSE---PDSR---GISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDE  642
              E    D R   G++RM DP LI++IKRAV+IPVMAK+R+GHFVEAQILE +GVDY+DE
Sbjct  69   ALERVPADIRAQGGVARMSDPGLIRDIKRAVTIPVMAKARIGHFVEAQILEAIGVDYVDE  128

Query  641  SELLAIADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVR  462
            SE+L +AD+ H INKHNFRVPFVCG RDLGEALRRVREGAAMIRT+G+  G+GN+V+ VR
Sbjct  129  SEVLTLADDAHHINKHNFRVPFVCGCRDLGEALRRVREGAAMIRTKGE-AGTGNVVEAVR  187

Query  461  SVRKVMGDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAA  282
             VR VMGDIR L NMD+DEVFA++K+IAAPYD+V+QTKQ+ RLPVV FA+GG+ TPADAA
Sbjct  188  HVRSVMGDIRALRNMDDDEVFAYAKRIAAPYDLVMQTKQLGRLPVVQFAAGGVATPADAA  247

Query  281  IMMQLGCDGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            +MMQLGCDG+F+G  +F   DP ++  AIVQAV +Y+DP++LA+ S+GL +AM G+NL
Sbjct  248  LMMQLGCDGVFVGSGIFKSGDPARRARAIVQAVTHYSDPNILAEVSAGLGEAMVGINL  305



>ref|NP_181358.1| Pyridoxal biosynthesis protein PDX1.1 [Arabidopsis thaliana]
 sp|O80448.1|PDX11_ARATH RecName: Full=Pyridoxal 5'-phosphate synthase subunit PDX1.1; 
Short=AtPDX1.1; Short=AtPDX1;2; Short=PLP synthase subunit 
PDX1.1; AltName: Full=HEVER-like protein [Arabidopsis thaliana]
 gb|AAK44111.1|AF370296_1 putative SOR1 from the fungus Cercospora nicotianae protein [Arabidopsis 
thaliana]
 gb|AAK60287.1|AF385694_1 At2g38230/F16M14.16 [Arabidopsis thaliana]
 gb|AAC27172.1| similar to SOR1 from the fungus Cercospora nicotianae [Arabidopsis 
thaliana]
 gb|AAL34217.1| putative SOR1 from the fungus Cercospora nicotianae protein [Arabidopsis 
thaliana]
 gb|AEC09511.1| Pyridoxal biosynthesis protein PDX1.1 [Arabidopsis thaliana]
Length=309

 Score =   393 bits (1009),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 192/298 (64%), Positives = 238/298 (80%), Gaps = 8/298 (3%)
 Frame = -1

Query  980  MAEDGAVTVYSGSAITDAK-KNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVI  804
            MA  G V VY   A+T+ K K+PFS+KVG+AQMLRGG I++V   +QA+IAE AGAC V+
Sbjct  1    MAGTGVVAVYGEGAMTETKQKSPFSVKVGLAQMLRGGVIMDVVNAEQARIAEEAGACAVM  60

Query  803  VSE---PDSR---GISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDE  642
              E    D R   G++RM DP +IKEIK AV+IPVMAK+R+GHFVEAQILE +GVDY+DE
Sbjct  61   ALERVPADIRAQGGVARMSDPEMIKEIKNAVTIPVMAKARIGHFVEAQILEAIGVDYVDE  120

Query  641  SELLAIADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVR  462
            SE+L +ADED+ INKHNF++PFVCG R+LGEALRR+REGAAMIRT+G+  G+GN+V+ VR
Sbjct  121  SEVLTLADEDNHINKHNFKIPFVCGCRNLGEALRRIREGAAMIRTKGE-AGTGNVVEAVR  179

Query  461  SVRKVMGDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAA  282
             VR V G IR+L +MD+DEVF ++KKIAAPYD+VVQTK++ RLPVV FA+GG+ TPADAA
Sbjct  180  HVRSVNGAIRLLRSMDDDEVFTYAKKIAAPYDLVVQTKELGRLPVVQFAAGGVATPADAA  239

Query  281  IMMQLGCDGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            +MMQLGCDG+F+G  VF   DP K+  AIVQAV NY D  VLA+ S GL +AM GLNL
Sbjct  240  LMMQLGCDGVFVGSGVFKSGDPVKRAKAIVQAVTNYRDAAVLAEVSCGLGEAMVGLNL  297



>ref|XP_003558759.1| PREDICTED: probable pyridoxal biosynthesis protein PDX1.1 [Brachypodium 
distachyon]
Length=316

 Score =   393 bits (1010),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 189/304 (62%), Positives = 241/304 (79%), Gaps = 14/304 (5%)
 Frame = -1

Query  980  MAEDGAVTVY--SGSAITDAKKNP-----FSIKVGIAQMLRGGAIVEVTTVDQAKIAESA  822
            MA DG VT+Y  +   + +    P     FS+KVG+AQMLRGG I++V T +QA++AE A
Sbjct  1    MASDGVVTLYGNNNKVVVEPSSKPASAATFSVKVGLAQMLRGGVIMDVVTAEQARLAEEA  60

Query  821  GACCVIVSE---PDSR---GISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVG  660
            GAC V+  E    D R   G++RM DPALI++IKRAV+IPVMAK+R+GHFVEAQILE VG
Sbjct  61   GACAVMALERVPADIRAQGGVARMSDPALIRDIKRAVTIPVMAKARIGHFVEAQILEAVG  120

Query  659  VDYIDESELLAIADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGN  480
            VDY+DESE+L +ADE H INKHNFRVPFVCG RDLGEALRR+REGAAM+RT+G+  G+GN
Sbjct  121  VDYVDESEVLTVADEAHHINKHNFRVPFVCGCRDLGEALRRIREGAAMVRTKGE-AGTGN  179

Query  479  IVDTVRSVRKVMGDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIV  300
            +V+ VR VR VMGD+R L +MD+DEVFA++K IAAPYD+V+QTKQ+ RLPVV FA+GG+ 
Sbjct  180  VVEAVRHVRSVMGDVRALRSMDDDEVFAYAKSIAAPYDLVMQTKQLGRLPVVQFAAGGVA  239

Query  299  TPADAAIMMQLGCDGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMA  120
            TPADAA+MMQLGCDG+F+G  +F   DP ++  AIV+AV +Y+DP +LA  S+GL +AM 
Sbjct  240  TPADAALMMQLGCDGVFVGSGIFKSGDPARRARAIVEAVTHYSDPEILANVSAGLGEAMV  299

Query  119  GLNL  108
            G+NL
Sbjct  300  GINL  303



>ref|NP_001140657.1| uncharacterized protein LOC100272732 [Zea mays]
 gb|ACF84295.1| unknown [Zea mays]
Length=380

 Score =   395 bits (1016),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 200/333 (60%), Positives = 254/333 (76%), Gaps = 25/333 (8%)
 Frame = -1

Query  1064  RN*IKSSPHEARY*SVVSLAHCTEHFAEMAEDGA--VTVY--SGSAITDAKKNP----FS  909
             R  I S PH+AR+          +    MA DG+  VTVY  +G+ + +  K P    FS
Sbjct  46    RKPIHSIPHKARH----------KRTKPMASDGSGVVTVYGSNGAELLEPSKQPKSATFS  95

Query  908   IKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIVSE---PDSR---GISRMPDPALIK  747
             +KVG+AQMLRGG I++V T +QA++AE AGAC V+  E    D R   G++RM DP LI+
Sbjct  96    VKVGLAQMLRGGVIMDVVTPEQARLAEEAGACAVMALERVPADIRAQGGVARMSDPGLIR  155

Query  746   EIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLAIADEDHFINKHNFRVPFVCG  567
             +IKRAV+IPVMAK+R+GHFVEAQILE VGVDY+DESE+L  AD+ H INKHNFRVPFVCG
Sbjct  156   DIKRAVTIPVMAKARIGHFVEAQILEAVGVDYVDESEVLTPADDAHHINKHNFRVPFVCG  215

Query  566   ARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKVMGDIRVLNNMDEDEVFAFSK  387
              RDLGEALRRVREGAAMIRT+G+  G+GN+V+ VR VR VMGD+R L +MD+DEVFA++K
Sbjct  216   CRDLGEALRRVREGAAMIRTKGE-AGTGNVVEAVRHVRSVMGDVRALRSMDDDEVFAYAK  274

Query  386   KIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQLGCDGIFLGPEVFNCSDPYKK  207
             +IAAPYD+V+QTKQ+ RLPVV FA+GG+ TPADAA+MMQLGCDG+F+G  +F   DP ++
Sbjct  275   RIAAPYDLVMQTKQLGRLPVVQFAAGGVATPADAALMMQLGCDGVFVGSGIFKSGDPARR  334

Query  206   VWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
               AIVQAV +Y+DP +LA  S+GL +AM G+NL
Sbjct  335   ARAIVQAVTHYSDPTILADVSTGLGEAMVGINL  367



>sp|Q9AT63.1|PDX1_GINBI RecName: Full=Probable pyridoxal 5'-phosphate synthase subunit 
PDX1; Short=PLP synthase subunit PDX1; AltName: Full=Sor-like 
protein [Ginkgo biloba]
 gb|AAK18310.1|AF344827_1 Sor-like protein [Ginkgo biloba]
Length=309

 Score =   392 bits (1008),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 188/297 (63%), Positives = 238/297 (80%), Gaps = 7/297 (2%)
 Frame = -1

Query  980  MAEDGAVTVYSGSAITDAKKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIV  801
            MA DG VTVY   AITD K + +++KVG+AQMLRGG I++V   +QA+IAE AGA  V+ 
Sbjct  1    MASDGVVTVYGDGAITDTKVSSYAVKVGLAQMLRGGVIMDVVNAEQARIAEEAGATAVMA  60

Query  800  SE---PDSR---GISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDES  639
             E    D R   G++RM DP LIKEIK AV+IPVMAK+R+GHFVEAQILE +G+DYIDES
Sbjct  61   LERVPADIRAQGGVARMSDPGLIKEIKSAVTIPVMAKARIGHFVEAQILEAIGIDYIDES  120

Query  638  ELLAIADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRS  459
            E+L  AD+ H INKHNFR+PFVCG R+LGEALRR+ EGAAMIRT+G+  G+GN+++ VR 
Sbjct  121  EVLTPADDXHHINKHNFRIPFVCGCRNLGEALRRIAEGAAMIRTKGE-AGTGNVIEAVRH  179

Query  458  VRKVMGDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAI  279
            VR V+GDIR L ++D+DEVFAF+K+IAAPY++V QTKQ+ RLPVV+FA+GG+ TPADAA+
Sbjct  180  VRSVLGDIRKLQSLDDDEVFAFAKQIAAPYELVRQTKQLGRLPVVNFAAGGVATPADAAL  239

Query  278  MMQLGCDGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            MMQLGCDG+F+G  VF   DP ++  AIVQAV +YNDPH+LA+ S  L +AM G+NL
Sbjct  240  MMQLGCDGVFVGSGVFKSGDPARRARAIVQAVTHYNDPHILAEVSCSLGEAMVGINL  296



>tpg|DAA59354.1| TPA: Pyridoxin biosynthesis protein ER1 [Zea mays]
Length=413

 Score =   395 bits (1016),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 200/333 (60%), Positives = 254/333 (76%), Gaps = 25/333 (8%)
 Frame = -1

Query  1064  RN*IKSSPHEARY*SVVSLAHCTEHFAEMAEDGA--VTVY--SGSAITDAKKNP----FS  909
             R  I S PH+AR+          +    MA DG+  VTVY  +G+ + +  K P    FS
Sbjct  79    RKPIHSIPHKARH----------KRTKPMASDGSGVVTVYGSNGAELLEPSKQPKSATFS  128

Query  908   IKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIVSE---PDSR---GISRMPDPALIK  747
             +KVG+AQMLRGG I++V T +QA++AE AGAC V+  E    D R   G++RM DP LI+
Sbjct  129   VKVGLAQMLRGGVIMDVVTPEQARLAEEAGACAVMALERVPADIRAQGGVARMSDPGLIR  188

Query  746   EIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLAIADEDHFINKHNFRVPFVCG  567
             +IKRAV+IPVMAK+R+GHFVEAQILE VGVDY+DESE+L  AD+ H INKHNFRVPFVCG
Sbjct  189   DIKRAVTIPVMAKARIGHFVEAQILEAVGVDYVDESEVLTPADDAHHINKHNFRVPFVCG  248

Query  566   ARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKVMGDIRVLNNMDEDEVFAFSK  387
              RDLGEALRRVREGAAMIRT+G+  G+GN+V+ VR VR VMGD+R L +MD+DEVFA++K
Sbjct  249   CRDLGEALRRVREGAAMIRTKGE-AGTGNVVEAVRHVRSVMGDVRALRSMDDDEVFAYAK  307

Query  386   KIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQLGCDGIFLGPEVFNCSDPYKK  207
             +IAAPYD+V+QTKQ+ RLPVV FA+GG+ TPADAA+MMQLGCDG+F+G  +F   DP ++
Sbjct  308   RIAAPYDLVMQTKQLGRLPVVQFAAGGVATPADAALMMQLGCDGVFVGSGIFKSGDPARR  367

Query  206   VWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
               AIVQAV +Y+DP +LA  S+GL +AM G+NL
Sbjct  368   ARAIVQAVTHYSDPTILADVSTGLGEAMVGINL  400



>ref|XP_008651055.1| PREDICTED: uncharacterized protein LOC100272732 isoform X1 [Zea 
mays]
Length=457

 Score =   397 bits (1019),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 200/333 (60%), Positives = 254/333 (76%), Gaps = 25/333 (8%)
 Frame = -1

Query  1064  RN*IKSSPHEARY*SVVSLAHCTEHFAEMAEDGA--VTVY--SGSAITDAKKNP----FS  909
             R  I S PH+AR+          +    MA DG+  VTVY  +G+ + +  K P    FS
Sbjct  123   RKPIHSIPHKARH----------KRTKPMASDGSGVVTVYGSNGAELLEPSKQPKSATFS  172

Query  908   IKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIVSE---PDSR---GISRMPDPALIK  747
             +KVG+AQMLRGG I++V T +QA++AE AGAC V+  E    D R   G++RM DP LI+
Sbjct  173   VKVGLAQMLRGGVIMDVVTPEQARLAEEAGACAVMALERVPADIRAQGGVARMSDPGLIR  232

Query  746   EIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLAIADEDHFINKHNFRVPFVCG  567
             +IKRAV+IPVMAK+R+GHFVEAQILE VGVDY+DESE+L  AD+ H INKHNFRVPFVCG
Sbjct  233   DIKRAVTIPVMAKARIGHFVEAQILEAVGVDYVDESEVLTPADDAHHINKHNFRVPFVCG  292

Query  566   ARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKVMGDIRVLNNMDEDEVFAFSK  387
              RDLGEALRRVREGAAMIRT+G+  G+GN+V+ VR VR VMGD+R L +MD+DEVFA++K
Sbjct  293   CRDLGEALRRVREGAAMIRTKGE-AGTGNVVEAVRHVRSVMGDVRALRSMDDDEVFAYAK  351

Query  386   KIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQLGCDGIFLGPEVFNCSDPYKK  207
             +IAAPYD+V+QTKQ+ RLPVV FA+GG+ TPADAA+MMQLGCDG+F+G  +F   DP ++
Sbjct  352   RIAAPYDLVMQTKQLGRLPVVQFAAGGVATPADAALMMQLGCDGVFVGSGIFKSGDPARR  411

Query  206   VWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
               AIVQAV +Y+DP +LA  S+GL +AM G+NL
Sbjct  412   ARAIVQAVTHYSDPTILADVSTGLGEAMVGINL  444



>ref|XP_004506848.1| PREDICTED: probable pyridoxal biosynthesis protein PDX1.2-like 
[Cicer arietinum]
Length=305

 Score =   391 bits (1004),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 190/293 (65%), Positives = 236/293 (81%), Gaps = 13/293 (4%)
 Frame = -1

Query  980  MAEDGAVTVYSGSAITDAKKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIV  801
            MA+D AVTVY+ + ITD  +N +S K+     LRGGAI +VT + QAK+AE AGAC VIV
Sbjct  1    MAQDTAVTVYNTTVITDPLQNQYSFKL----TLRGGAIFQVTNLHQAKLAEQAGACAVIV  56

Query  800  SEPDSRG--ISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLA  627
            S+  +    ISRM DP+LIK+IKR VSIPV++++R+GHFVEAQILE  GVDYIDESE L+
Sbjct  57   SDQINSNSVISRMTDPSLIKQIKRVVSIPVISRARIGHFVEAQILEATGVDYIDESESLS  116

Query  626  IADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKV  447
            IAD+ + INK NFR+PF+ GAR+LGEALRR+REGAAMIR QG+L+ SGN+ +TV++VR +
Sbjct  117  IADDQNHINKQNFRIPFISGARNLGEALRRIREGAAMIRIQGELSNSGNVSETVKNVRCL  176

Query  446  MGDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQL  267
            M ++RVL+NMD+DEVFAF+KKI APYD+V QTKQM RLPVVHFA+GGIVTPADAA+MMQL
Sbjct  177  MKELRVLSNMDDDEVFAFAKKIEAPYDLVAQTKQMGRLPVVHFAAGGIVTPADAALMMQL  236

Query  266  GCDGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            GC G+F+GPEVF   + +K+V  IVQAVRNYNDPHVL        + M GLNL
Sbjct  237  GCHGVFVGPEVFGYGNGFKRVRGIVQAVRNYNDPHVLV-------ETMMGLNL  282



>gb|ACF84885.1| unknown [Zea mays]
 gb|ACF85878.1| unknown [Zea mays]
 gb|ACF87886.1| unknown [Zea mays]
 gb|ACG24464.1| pyridoxin biosynthesis protein ER1 [Zea mays]
Length=317

 Score =   391 bits (1004),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 193/305 (63%), Positives = 244/305 (80%), Gaps = 15/305 (5%)
 Frame = -1

Query  980  MAEDGA--VTVY--SGSAITDAKKNP----FSIKVGIAQMLRGGAIVEVTTVDQAKIAES  825
            MA DG+  VTVY  +G+ + +  K P    FS+KVG+AQMLRGG I++V T +QA++AE 
Sbjct  1    MASDGSGVVTVYGSNGAELLEPSKQPKSATFSVKVGLAQMLRGGVIMDVVTPEQARLAEE  60

Query  824  AGACCVIVSE---PDSR---GISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETV  663
            AGAC V+  E    D R   G++RM DP LI++IKRAV+IPVMAK+R+GHFVEAQILE V
Sbjct  61   AGACAVMALERVPADIRAQGGVARMSDPGLIRDIKRAVTIPVMAKARIGHFVEAQILEAV  120

Query  662  GVDYIDESELLAIADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSG  483
            GVDY+DESE+L  AD+ H INKHNFRVPFVCG RDLGEALRRVREGAAMIRT+G+  G+G
Sbjct  121  GVDYVDESEVLTPADDAHHINKHNFRVPFVCGCRDLGEALRRVREGAAMIRTKGE-AGTG  179

Query  482  NIVDTVRSVRKVMGDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGI  303
            N+V+ VR VR VMGD+R L +MD+DEVFA++K+IAAPYD+V+QTKQ+ RLPVV FA+GG+
Sbjct  180  NVVEAVRHVRSVMGDVRALRSMDDDEVFAYAKRIAAPYDLVMQTKQLGRLPVVQFAAGGV  239

Query  302  VTPADAAIMMQLGCDGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAM  123
             TPADAA+MMQLGCDG+F+G  +F   DP ++  AIVQAV +Y+DP +LA  S+GL +AM
Sbjct  240  ATPADAALMMQLGCDGVFVGSGIFKSGDPARRARAIVQAVTHYSDPTILADVSTGLGEAM  299

Query  122  AGLNL  108
             G+NL
Sbjct  300  VGINL  304



>ref|XP_008464036.1| PREDICTED: probable pyridoxal biosynthesis protein PDX1 [Cucumis 
melo]
Length=312

 Score =   390 bits (1003),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 192/298 (64%), Positives = 237/298 (80%), Gaps = 8/298 (3%)
 Frame = -1

Query  980  MAEDGAVTVYSGSAITDA-KKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVI  804
            MA+ G VTVY    I +A KK+PFS+K  +AQMLRGG I++V    QA+IAE AGAC V+
Sbjct  1    MADTGVVTVYGNGVICEATKKSPFSVKASLAQMLRGGVIMDVVNAQQARIAEEAGACAVM  60

Query  803  VSEP---DSR---GISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDE  642
              E    D R   G++RM DP LIKEIK+AV+IPVMA  R+GHFVEAQILE +G+DYIDE
Sbjct  61   ALEKVPADIRAQGGVARMSDPQLIKEIKQAVTIPVMANVRIGHFVEAQILEAIGIDYIDE  120

Query  641  SELLAIADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVR  462
            SE+L  AD+ + INKHNFR+PFVCG R+LGEALRR+REGAAMIRT+G+  G+GNIV+ VR
Sbjct  121  SEVLTPADDKNHINKHNFRIPFVCGCRNLGEALRRIREGAAMIRTKGE-AGTGNIVEAVR  179

Query  461  SVRKVMGDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAA  282
             VR VMGDIR+L NMD+DEVF ++K+I APYD+V+QTKQ+ RLPVVHFA+GGI TPADAA
Sbjct  180  HVRSVMGDIRMLRNMDDDEVFCYAKQIGAPYDLVMQTKQLGRLPVVHFAAGGIATPADAA  239

Query  281  IMMQLGCDGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            +MMQLGCDG+F+G  VF  SDP ++  AIVQA  +Y+DP VLA+ S GL + MAG+NL
Sbjct  240  MMMQLGCDGVFVGSGVFKSSDPARRARAIVQAATHYSDPDVLAEVSFGLGEPMAGINL  297



>dbj|BAK01702.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ98828.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=314

 Score =   390 bits (1002),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 187/302 (62%), Positives = 241/302 (80%), Gaps = 12/302 (4%)
 Frame = -1

Query  980  MAEDGAVTVY-SGSAITDAKKNP----FSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGA  816
            MA DG V +Y +  A+ +    P    FS+KVG+AQMLRGG I++V T +QA++AE AGA
Sbjct  1    MASDGVVALYGNNKAVVEPTAKPAAATFSVKVGLAQMLRGGVIMDVVTAEQARLAEEAGA  60

Query  815  CCVIVSE---PDSR---GISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVD  654
            C V+  E    D R   G++RM DPALI++IKRAV+IPVMAK+R+GHFVEAQILE +GVD
Sbjct  61   CAVMALERVPADIRAQGGVARMSDPALIRDIKRAVTIPVMAKARIGHFVEAQILEAIGVD  120

Query  653  YIDESELLAIADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIV  474
            Y+DESE+L +AD+ H INKHNFRVPFVCG R+LGEALRR+REGAAMIRT+G+  G+GN+V
Sbjct  121  YVDESEVLTLADDAHHINKHNFRVPFVCGCRNLGEALRRIREGAAMIRTKGE-AGTGNVV  179

Query  473  DTVRSVRKVMGDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTP  294
            + VR VR VMG +R L NMD+DEVF+++K+IAAPYD+V+QTKQ+ RLPVV FA+GG+ TP
Sbjct  180  EAVRHVRSVMGAVRALRNMDDDEVFSYAKQIAAPYDLVMQTKQLGRLPVVQFAAGGVATP  239

Query  293  ADAAIMMQLGCDGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGL  114
            ADAA+MMQLGCDG+F+G  +F   DP ++  AIVQAV +Y+DP +LA  S+GL +AM G+
Sbjct  240  ADAALMMQLGCDGVFVGSGIFKSGDPSRRARAIVQAVTHYSDPEILANVSAGLGEAMVGI  299

Query  113  NL  108
            NL
Sbjct  300  NL  301



>gb|AAZ94411.1| pyridoxine biosynthesis protein [Triticum aestivum]
Length=314

 Score =   389 bits (999),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 187/302 (62%), Positives = 239/302 (79%), Gaps = 12/302 (4%)
 Frame = -1

Query  980  MAEDGAVTVY-SGSAITDAKKNP----FSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGA  816
            M  DG V +Y +  A+ +    P    FS+KVG+AQMLRGG I++V T +QA++AE AGA
Sbjct  1    MRSDGVVALYGNNKAVVEPSAKPAAATFSVKVGLAQMLRGGVIMDVVTAEQARLAEEAGA  60

Query  815  CCVIVSE---PDSR---GISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVD  654
            C V+  E    D R   G++RM DPALI++IKRAV+IPVMAK+R+GHFVEAQILE +GVD
Sbjct  61   CAVMALERVPADIRAQGGVARMSDPALIRDIKRAVTIPVMAKARIGHFVEAQILEAIGVD  120

Query  653  YIDESELLAIADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIV  474
            Y+DESE+L +AD+ H INKHNFRVPFVCG RDLGEALRR+REGAAMI T+G+  G+GN+V
Sbjct  121  YVDESEVLTLADDAHHINKHNFRVPFVCGCRDLGEALRRIREGAAMIHTKGE-AGTGNVV  179

Query  473  DTVRSVRKVMGDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTP  294
            + VR VR VMG +R L NMDEDEVF+++K+IAAPYD+V+QTKQ+ RLPVV FA+GG+ TP
Sbjct  180  EAVRHVRSVMGAVRALRNMDEDEVFSYAKQIAAPYDLVMQTKQLGRLPVVQFAAGGVATP  239

Query  293  ADAAIMMQLGCDGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGL  114
            ADAA+MMQLGCDG+F+G  +F   DP ++  AIVQAV +Y+DP +LA  S+GL +AM G+
Sbjct  240  ADAALMMQLGCDGVFVGSGIFKSGDPARRARAIVQAVTHYSDPEILANVSAGLGEAMVGI  299

Query  113  NL  108
            NL
Sbjct  300  NL  301



>dbj|BAJ93273.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=316

 Score =   389 bits (998),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 192/305 (63%), Positives = 243/305 (80%), Gaps = 16/305 (5%)
 Frame = -1

Query  980  MAEDGA--VTVYSGSAITDA------KKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAES  825
            MA DG+  VTVY GS    A      K +PFS+KVG+AQMLRGG I++V   +QA+IAE 
Sbjct  1    MASDGSGVVTVY-GSGNNGAGTQLEPKSSPFSVKVGLAQMLRGGVIMDVVNAEQARIAEE  59

Query  824  AGACCVIVSE---PDSR---GISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETV  663
            AGAC V+  E    D R   G++RM DP LI+EIKRAV+IPVMAK+R+GHFVEAQILE++
Sbjct  60   AGACAVMALERVPADIRAQGGVARMSDPGLIREIKRAVTIPVMAKARIGHFVEAQILESI  119

Query  662  GVDYIDESELLAIADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSG  483
            GVDY+DESE+L +AD+ H INKHNFRVPFVCG R+LGEALRR+REGAAMIRT+G+  G+G
Sbjct  120  GVDYVDESEVLTLADDAHHINKHNFRVPFVCGCRNLGEALRRIREGAAMIRTKGE-AGTG  178

Query  482  NIVDTVRSVRKVMGDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGI  303
            N+V+ VR VR VMGD+R L +MD+DEVF+++K IAAPYD+V+QTKQ+ RLPVV FA+GG+
Sbjct  179  NVVEAVRHVRSVMGDVRALRSMDDDEVFSYAKSIAAPYDLVMQTKQLGRLPVVQFAAGGV  238

Query  302  VTPADAAIMMQLGCDGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAM  123
             TPADAA+MMQLGCDG+F+G  +F   DP ++  AIVQAV +Y+DP+VLA+ S  L +AM
Sbjct  239  ATPADAALMMQLGCDGVFVGSGIFKSGDPARRARAIVQAVTHYSDPNVLAEVSCDLGEAM  298

Query  122  AGLNL  108
             G+NL
Sbjct  299  VGINL  303



>ref|XP_012092513.1| PREDICTED: pyridoxal 5'-phosphate synthase-like subunit PDX1.2, 
partial [Jatropha curcas]
Length=242

 Score =   386 bits (991),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 181/230 (79%), Positives = 209/230 (91%), Gaps = 0/230 (0%)
 Frame = -1

Query  797  EPDSRGISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLAIAD  618
            EP  +GI RMPDP+LIKEIKRAVSIPV+A++RVGHFVEAQILE +GVDYIDESELLA+AD
Sbjct  5    EPMRQGIKRMPDPSLIKEIKRAVSIPVIARARVGHFVEAQILEAIGVDYIDESELLALAD  64

Query  617  EDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKVMGD  438
            ED+FINKHNFR PF+CG +DLGEALRRVREGAAMIRTQG++ G GNI  TV++VR VM +
Sbjct  65   EDNFINKHNFRCPFICGCQDLGEALRRVREGAAMIRTQGEVLGHGNIALTVKNVRNVMKE  124

Query  437  IRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQLGCD  258
            IRVLNNMDEDEVFAF+KKIAAPYD+V QTKQM RLPVV FA+GGI++PADAA+MMQLGCD
Sbjct  125  IRVLNNMDEDEVFAFAKKIAAPYDLVAQTKQMGRLPVVQFAAGGIMSPADAALMMQLGCD  184

Query  257  GIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            GIF+G EVF+C+DPYK+V AIVQAVR+YNDPHVL ++S  LEDAMA LNL
Sbjct  185  GIFVGNEVFDCADPYKRVRAIVQAVRHYNDPHVLVESSCELEDAMAELNL  234



>ref|XP_004143159.1| PREDICTED: probable pyridoxal 5'-phosphate synthase subunit PDX1 
[Cucumis sativus]
 gb|KGN47080.1| hypothetical protein Csa_6G185290 [Cucumis sativus]
Length=312

 Score =   387 bits (993),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 190/298 (64%), Positives = 237/298 (80%), Gaps = 8/298 (3%)
 Frame = -1

Query  980  MAEDGAVTVYSGSAITDA-KKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVI  804
            MA+ G VTVY    I +A KK+PFS+K G+AQMLRGG I++V    QA+IAE AGAC V+
Sbjct  1    MADTGVVTVYGNGVICEATKKSPFSVKAGLAQMLRGGVIMDVVNAQQARIAEEAGACAVM  60

Query  803  VSE---PDSR---GISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDE  642
              +    D R   G++RM DP LIKEIK+AV+IPVMA  R+GHFVEAQILE + +DYIDE
Sbjct  61   ALQRVPADIRAQGGVARMSDPQLIKEIKQAVTIPVMANVRIGHFVEAQILEAIDIDYIDE  120

Query  641  SELLAIADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVR  462
            SE+L  AD+ + INKHNFR+PFVCG R+LGEALRR+REGAAMIRT+G+  G+G+IV+ VR
Sbjct  121  SEVLTPADDKNHINKHNFRIPFVCGCRNLGEALRRIREGAAMIRTKGE-AGTGDIVEAVR  179

Query  461  SVRKVMGDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAA  282
             VR VMGDIR+L NMD+DEVF ++K+I APYD+V+QTKQ+ RLPVVHFA+GGI TPADAA
Sbjct  180  HVRSVMGDIRMLRNMDDDEVFCYAKQIGAPYDLVMQTKQLGRLPVVHFAAGGIATPADAA  239

Query  281  IMMQLGCDGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            +MMQLGCDG+F+G  VF  SDP ++  AIVQA  +Y+DP VLA+ S GL + MAG+NL
Sbjct  240  MMMQLGCDGVFVGSGVFKSSDPARRARAIVQAATHYSDPDVLAEVSFGLGEPMAGINL  297



>ref|NP_001064010.1| Os10g0100700 [Oryza sativa Japonica Group]
 sp|Q8W3D0.1|PDX12_ORYSJ RecName: Full=Probable pyridoxal 5'-phosphate synthase subunit 
PDX1.2; Short=PLP synthase subunit PDX1.2 [Oryza sativa Japonica 
Group]
 gb|AAL73561.1|AC079632_5 Putative ethylene-inducible protein [Oryza sativa Japonica Group]
 gb|AAM08638.1|AC108883_11 Putative pyridoxine/pyridoxal 5-phosphate biosynthesis protein 
[Oryza sativa Japonica Group]
 gb|AAP51743.1| pyridoxin biosynthesis protein ER1, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF25924.1| Os10g0100700 [Oryza sativa Japonica Group]
 dbj|BAG87405.1| unnamed protein product [Oryza sativa Japonica Group]
Length=313

 Score =   386 bits (991),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 187/299 (63%), Positives = 238/299 (80%), Gaps = 9/299 (3%)
 Frame = -1

Query  980  MAEDGA--VTVYSGSAITDAKKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCV  807
            MA DG   V +Y G+     K   FS+KVG+AQMLRGG I++V T +QA+IAE AGAC V
Sbjct  1    MASDGTDVVALYGGANGLSHKSGSFSVKVGLAQMLRGGVIMDVVTPEQARIAEEAGACAV  60

Query  806  IVSE---PDSR---GISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYID  645
            +  E    D R   G++RM DP LI++IKR+V+IPVMAK+R+GH VEAQILE +GVDY+D
Sbjct  61   MALERVPADIRAQGGVARMSDPGLIRDIKRSVTIPVMAKARIGHLVEAQILEAIGVDYVD  120

Query  644  ESELLAIADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTV  465
            ESE+L +AD+ H INK+NFRVPFVCG RDLGEALRR+REGAAMIRT+G+  G+GN+V+ V
Sbjct  121  ESEVLTLADDAHHINKNNFRVPFVCGCRDLGEALRRIREGAAMIRTKGE-AGTGNVVEAV  179

Query  464  RSVRKVMGDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADA  285
            R VR VMGDIR L +MD+DEVF+++K+IAAPYD+V+QTKQ+ RLPVV FA+GG+ TPADA
Sbjct  180  RHVRSVMGDIRALRSMDDDEVFSYAKRIAAPYDLVMQTKQLGRLPVVQFAAGGVATPADA  239

Query  284  AIMMQLGCDGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            A+MMQLGCDG+F+G  +F   DP  +  AIVQAV +Y+DP +LA+ SSGL +AM G+NL
Sbjct  240  ALMMQLGCDGVFVGSGIFKSGDPALRARAIVQAVTHYSDPKILAEVSSGLGEAMVGINL  298



>ref|XP_002528091.1| Pyridoxin biosynthesis protein PDX1, putative [Ricinus communis]
 gb|EEF34270.1| Pyridoxin biosynthesis protein PDX1, putative [Ricinus communis]
Length=281

 Score =   384 bits (987),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 184/274 (67%), Positives = 226/274 (82%), Gaps = 7/274 (3%)
 Frame = -1

Query  980  MAEDGAVTVYSGSAITDAKKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIV  801
            MA  G V VY   AIT+AKK+PFS+KVG+AQMLRGG I++V   +QA++AE AGAC V+ 
Sbjct  1    MAGTGVVAVYGNGAITEAKKSPFSVKVGLAQMLRGGVIMDVINAEQARVAEEAGACAVMA  60

Query  800  SE---PDSR---GISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDES  639
             E    D R   G++RM DP LIKEIK+AV+IPVMAK+R+GHFVEAQILE +G+DY+DES
Sbjct  61   LERVPADIRAQGGVARMSDPQLIKEIKQAVTIPVMAKARIGHFVEAQILEALGIDYVDES  120

Query  638  ELLAIADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRS  459
            E+L +ADED+ INKHNFR+PFVCG R+LGEALRR+REGAAMIRT+G+  G+GN+V+ VR 
Sbjct  121  EVLTLADEDNHINKHNFRIPFVCGCRNLGEALRRIREGAAMIRTKGE-AGTGNVVEAVRH  179

Query  458  VRKVMGDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAI  279
            VR VMGDIRVL NMD+DEVF+F+KKIAAPYD+V+QTKQ+ RLPVV FA+GG+ TPADAA+
Sbjct  180  VRSVMGDIRVLRNMDDDEVFSFAKKIAAPYDLVMQTKQLGRLPVVQFAAGGVATPADAAL  239

Query  278  MMQLGCDGIFLGPEVFNCSDPYKKVWAIVQAVRN  177
            MMQLGCDG+F+G  VF   DP K+  AIVQA  N
Sbjct  240  MMQLGCDGVFVGSGVFKSGDPAKRARAIVQANTN  273



>gb|KDP20596.1| hypothetical protein JCGZ_04218 [Jatropha curcas]
Length=236

 Score =   382 bits (981),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 179/226 (79%), Positives = 207/226 (92%), Gaps = 0/226 (0%)
 Frame = -1

Query  785  RGISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLAIADEDHF  606
            +GI RMPDP+LIKEIKRAVSIPV+A++RVGHFVEAQILE +GVDYIDESELLA+ADED+F
Sbjct  3    QGIKRMPDPSLIKEIKRAVSIPVIARARVGHFVEAQILEAIGVDYIDESELLALADEDNF  62

Query  605  INKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKVMGDIRVL  426
            INKHNFR PF+CG +DLGEALRRVREGAAMIRTQG++ G GNI  TV++VR VM +IRVL
Sbjct  63   INKHNFRCPFICGCQDLGEALRRVREGAAMIRTQGEVLGHGNIALTVKNVRNVMKEIRVL  122

Query  425  NNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQLGCDGIFL  246
            NNMDEDEVFAF+KKIAAPYD+V QTKQM RLPVV FA+GGI++PADAA+MMQLGCDGIF+
Sbjct  123  NNMDEDEVFAFAKKIAAPYDLVAQTKQMGRLPVVQFAAGGIMSPADAALMMQLGCDGIFV  182

Query  245  GPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            G EVF+C+DPYK+V AIVQAVR+YNDPHVL ++S  LEDAMA LNL
Sbjct  183  GNEVFDCADPYKRVRAIVQAVRHYNDPHVLVESSCELEDAMAELNL  228



>ref|XP_010228496.1| PREDICTED: probable pyridoxal biosynthesis protein PDX1.1 [Brachypodium 
distachyon]
Length=313

 Score =   384 bits (987),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 189/302 (63%), Positives = 242/302 (80%), Gaps = 13/302 (4%)
 Frame = -1

Query  980  MAEDGA--VTVYSGS---AITDAKKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGA  816
            MA DG+  V +Y G+   +I D+K +PF++K G+AQMLRGG I++V T DQA+IAE AGA
Sbjct  1    MASDGSGVVALYGGNNNNSILDSK-SPFAVKAGLAQMLRGGVIMDVVTADQARIAEEAGA  59

Query  815  CCVIVSE---PDSR---GISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVD  654
            C V+  E    D R   G++RM DP LI++IKRAV+IPVMAK+R+GHFVEAQILE +GVD
Sbjct  60   CAVMALERVPADIRAQGGVARMSDPGLIRDIKRAVTIPVMAKARIGHFVEAQILEHIGVD  119

Query  653  YIDESELLAIADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIV  474
            Y+DESE+L +AD+ H INKHNFRVPFVCG R+LGEALRRVREGAAMIRT+G+  G+GN+V
Sbjct  120  YVDESEVLTLADDAHHINKHNFRVPFVCGCRNLGEALRRVREGAAMIRTKGE-AGTGNVV  178

Query  473  DTVRSVRKVMGDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTP  294
            + VR VR VMGD+R L  MD+DEVF+++K IAAPYD+V+QTKQ+ RLPVV FA+GG+ TP
Sbjct  179  EAVRHVRSVMGDVRALRAMDDDEVFSYAKSIAAPYDLVLQTKQLGRLPVVQFAAGGVATP  238

Query  293  ADAAIMMQLGCDGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGL  114
            ADAA+M+QLGCDG+F+G  +F   DP ++  AIVQAV +Y+DP VLA+ S  L +AM G+
Sbjct  239  ADAALMIQLGCDGVFVGSGIFKSGDPARRARAIVQAVTHYSDPAVLAEVSCDLGEAMVGI  298

Query  113  NL  108
            NL
Sbjct  299  NL  300



>gb|AFN53699.1| hypothetical protein [Linum usitatissimum]
Length=801

 Score =   400 bits (1029),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 195/299 (65%), Positives = 243/299 (81%), Gaps = 9/299 (3%)
 Frame = -1

Query  980  MAEDGAVTVYSGSAITD--AKKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCV  807
            MA+ G VTVY  +A+ +   KK+ FS+KVG+AQMLRGG I++V   DQA+IAE AGAC V
Sbjct  1    MADSGVVTVYGNAALYEPTTKKSTFSVKVGLAQMLRGGVIMDVVNADQARIAEEAGACAV  60

Query  806  IVSE---PDSR---GISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYID  645
            +  E    D R   G++RM DP LIKEIK++V+IPVMAK+R+GHFVEAQILE +G+DYID
Sbjct  61   MALERVPADIRSQGGVARMSDPQLIKEIKQSVTIPVMAKARIGHFVEAQILEALGIDYID  120

Query  644  ESELLAIADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTV  465
            ESE+L +ADED+ INKHNFR+PFVCG R+LGEALRR+REGAAMIRT+G+  G+GN+++ V
Sbjct  121  ESEVLTLADEDNHINKHNFRIPFVCGCRNLGEALRRIREGAAMIRTKGE-AGTGNVIEAV  179

Query  464  RSVRKVMGDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADA  285
            R VR VMGDIRVL NMD+DEVF F+KKIAAPYD+V+QTKQ+ RLPVV FA+GG+ TPADA
Sbjct  180  RHVRSVMGDIRVLRNMDDDEVFTFAKKIAAPYDLVMQTKQLGRLPVVQFAAGGVATPADA  239

Query  284  AIMMQLGCDGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            A+MMQLGCDG+F+G  VF   DP ++  AIVQAV +Y DP VLA+ S GL +AM G+NL
Sbjct  240  AMMMQLGCDGVFVGSGVFKSGDPARRARAIVQAVTHYTDPEVLAEVSCGLGEAMVGINL  298



>ref|XP_008667891.1| PREDICTED: pyridoxin biosynthesis protein ER1 isoform X1 [Zea 
mays]
Length=310

 Score =   384 bits (986),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 191/305 (63%), Positives = 241/305 (79%), Gaps = 15/305 (5%)
 Frame = -1

Query  980  MAEDGA--VTVY--SGSAITDAKKNP----FSIKVGIAQMLRGGAIVEVTTVDQAKIAES  825
            MA DG+  VTVY  +G+A+ +  K P    FS+KVG+AQMLRGG I++V T +QA++AE 
Sbjct  1    MASDGSGVVTVYGNNGAALLEPPKQPKSSTFSVKVGLAQMLRGGVIMDVVTPEQARLAEE  60

Query  824  AGACCVIVSE---PDSR---GISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETV  663
            AGAC V+  E    D R   G++RM DP LI++IKRAV+IPVMAK+R+GHFVEAQILE V
Sbjct  61   AGACAVMALERVPADIRAQGGVARMSDPGLIRDIKRAVTIPVMAKARIGHFVEAQILEAV  120

Query  662  GVDYIDESELLAIADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSG  483
            GVDY+DESE+L  AD+ H INKHNFRVPFVCG RDLGEALRRVREGAAMIRT+G+  G+G
Sbjct  121  GVDYVDESEVLTPADDAHHINKHNFRVPFVCGCRDLGEALRRVREGAAMIRTKGE-AGTG  179

Query  482  NIVDTVRSVRKVMGDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGI  303
            N+V+ VR VR V G +R L  MD+DEVFA++K+IAAPYD+V+QTKQ+ RLPVV FA+GG+
Sbjct  180  NVVEAVRHVRSVAGAVRALRGMDDDEVFAYAKRIAAPYDLVMQTKQLGRLPVVQFAAGGV  239

Query  302  VTPADAAIMMQLGCDGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAM  123
             TPADAA+MMQLGCDG+F+G  +F   DP ++  AIVQAV +Y+DP +L   S+GL +AM
Sbjct  240  ATPADAALMMQLGCDGVFVGSGIFKSGDPARRARAIVQAVTHYSDPTILTDVSAGLGEAM  299

Query  122  AGLNL  108
             G+NL
Sbjct  300  VGINL  304



>ref|NP_001147020.1| pyridoxin biosynthesis protein ER1 [Zea mays]
 gb|ACG25086.1| pyridoxin biosynthesis protein ER1 [Zea mays]
 gb|ACL52468.1| unknown [Zea mays]
 tpg|DAA42655.1| TPA: Pyridoxin biosynthesis protein ER1 [Zea mays]
Length=317

 Score =   384 bits (986),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 191/305 (63%), Positives = 241/305 (79%), Gaps = 15/305 (5%)
 Frame = -1

Query  980  MAEDGA--VTVY--SGSAITDAKKNP----FSIKVGIAQMLRGGAIVEVTTVDQAKIAES  825
            MA DG+  VTVY  +G+A+ +  K P    FS+KVG+AQMLRGG I++V T +QA++AE 
Sbjct  1    MASDGSGVVTVYGNNGAALLEPPKQPKSSTFSVKVGLAQMLRGGVIMDVVTPEQARLAEE  60

Query  824  AGACCVIVSE---PDSR---GISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETV  663
            AGAC V+  E    D R   G++RM DP LI++IKRAV+IPVMAK+R+GHFVEAQILE V
Sbjct  61   AGACAVMALERVPADIRAQGGVARMSDPGLIRDIKRAVTIPVMAKARIGHFVEAQILEAV  120

Query  662  GVDYIDESELLAIADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSG  483
            GVDY+DESE+L  AD+ H INKHNFRVPFVCG RDLGEALRRVREGAAMIRT+G+  G+G
Sbjct  121  GVDYVDESEVLTPADDAHHINKHNFRVPFVCGCRDLGEALRRVREGAAMIRTKGE-AGTG  179

Query  482  NIVDTVRSVRKVMGDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGI  303
            N+V+ VR VR V G +R L  MD+DEVFA++K+IAAPYD+V+QTKQ+ RLPVV FA+GG+
Sbjct  180  NVVEAVRHVRSVAGAVRALRGMDDDEVFAYAKRIAAPYDLVMQTKQLGRLPVVQFAAGGV  239

Query  302  VTPADAAIMMQLGCDGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAM  123
             TPADAA+MMQLGCDG+F+G  +F   DP ++  AIVQAV +Y+DP +L   S+GL +AM
Sbjct  240  ATPADAALMMQLGCDGVFVGSGIFKSGDPARRARAIVQAVTHYSDPTILTDVSAGLGEAM  299

Query  122  AGLNL  108
             G+NL
Sbjct  300  VGINL  304



>ref|NP_001068563.1| Os11g0708500 [Oryza sativa Japonica Group]
 gb|AAX95426.1| pyridoxine biosynthesis protein, putative [Oryza sativa Japonica 
Group]
 gb|ABA95534.1| pyridoxin biosynthesis protein ER1, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF28926.1| Os11g0708500 [Oryza sativa Japonica Group]
 dbj|BAG88686.1| unnamed protein product [Oryza sativa Japonica Group]
Length=363

 Score =   382 bits (981),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 186/295 (63%), Positives = 238/295 (81%), Gaps = 12/295 (4%)
 Frame = -1

Query  977  AEDGAVTVYSGSAITDAKKNP---FSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCV  807
            ++DG V +Y G  ++   K P   FS+KVG+AQMLRGG I++V T +QA++AE AGAC V
Sbjct  4    SDDGVVALYGGGKVS--CKPPAATFSVKVGLAQMLRGGVIMDVVTPEQARLAEEAGACAV  61

Query  806  IVSE---PDSR---GISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYID  645
            +  E    D R   G++RM DPALI++IKRAV+IPVMAK+R+GHFVEAQILE +GVDY+D
Sbjct  62   MALERVPADIRAQGGVARMSDPALIRDIKRAVTIPVMAKARIGHFVEAQILEAIGVDYVD  121

Query  644  ESELLAIADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTV  465
            ESE+L  AD+ H INKHNFRVPFVCG RDLGEALRR+REGAAMIRT+G+  G+GN+V+ V
Sbjct  122  ESEVLTPADDAHHINKHNFRVPFVCGCRDLGEALRRIREGAAMIRTKGE-AGTGNVVEAV  180

Query  464  RSVRKVMGDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADA  285
            R VR VMG+IR L NMD+DEVF+++K+IAAPYD+V+QTKQ+ RLPVV FA+GG+ TPADA
Sbjct  181  RHVRSVMGEIRALRNMDDDEVFSYAKRIAAPYDLVMQTKQLGRLPVVQFAAGGVATPADA  240

Query  284  AIMMQLGCDGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMA  120
            A+MMQLGCDG+F+G  +F   DP ++  AIVQAV +Y+DP +LA  S+GL DAM+
Sbjct  241  ALMMQLGCDGVFVGSGIFKSGDPARRARAIVQAVTHYSDPEILADVSAGLGDAMS  295



>ref|XP_006661586.1| PREDICTED: probable pyridoxal biosynthesis protein PDX1.1-like 
[Oryza brachyantha]
Length=316

 Score =   377 bits (968),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 179/288 (62%), Positives = 232/288 (81%), Gaps = 8/288 (3%)
 Frame = -1

Query  950  SGSAITDAKKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIVSE---PDSR-  783
            + +A+ + K   FS+KVG+AQMLRGG I++V T +QA++AE AGAC V+  E    D R 
Sbjct  17   TAAALQEYKSATFSVKVGLAQMLRGGVIMDVVTPEQARVAEEAGACAVMALERVPADIRA  76

Query  782  ---GISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLAIADED  612
               G++RM DP LI++IKRAV+IPVMAK+R+GHFVEAQILE +GVDY+DESE+L +AD+ 
Sbjct  77   QGGGVARMSDPGLIRDIKRAVTIPVMAKARIGHFVEAQILEAIGVDYVDESEVLTLADDA  136

Query  611  HFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKVMGDIR  432
            H INK+NFRV FVCG RDL EALRR+REGAAMIRT+G+  G+ N+V+ VR VR VMGD+R
Sbjct  137  HHINKNNFRVHFVCGCRDLAEALRRIREGAAMIRTKGE-AGTCNVVEAVRHVRSVMGDLR  195

Query  431  VLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQLGCDGI  252
             L NMD+DEVF+++K+IAAPYD+V+QTKQ+ RLPVV FA+GG+ TPADAA+MMQLGCDG+
Sbjct  196  ALCNMDDDEVFSYAKRIAAPYDLVMQTKQLGRLPVVQFAAGGVATPADAALMMQLGCDGV  255

Query  251  FLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            F+G  +    DP ++  AIVQAV +YNDP +LA+ SSGL +AM G+NL
Sbjct  256  FVGSGILKSGDPARRARAIVQAVTHYNDPKILAEVSSGLGEAMVGINL  303



>ref|XP_003604476.1| Pyridoxal biosynthesis protein PDX1.3 [Medicago truncatula]
 gb|AES86673.1| pyridoxal biosynthesis protein PDX1, putative [Medicago truncatula]
Length=295

 Score =   371 bits (953),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 185/292 (63%), Positives = 222/292 (76%), Gaps = 13/292 (4%)
 Frame = -1

Query  980  MAEDGAVTVYSGSAIT-DAKKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVI  804
            MA+D  VTVY+ +AIT D  + P+S K+ + Q LRGGAI +VT + QAKIAE AGAC V 
Sbjct  1    MAQDTTVTVYNTTAITTDPLQTPYSFKLSLTQTLRGGAIFQVTNLHQAKIAEQAGACAVT  60

Query  803  VSEPDSRGISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLAI  624
            VS+       RM DP+LIK IKR+VSIPV++  R+GHFVEAQILE  GVDYIDE+E L I
Sbjct  61   VSDQ-----QRMTDPSLIKSIKRSVSIPVISPVRIGHFVEAQILEATGVDYIDENESLTI  115

Query  623  ADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKVM  444
            AD+ + INKHNFR PF+  A +LGEAL R+REGAAMIR QG++  SGNI  TV  VR +M
Sbjct  116  ADDQNHINKHNFRTPFISSASNLGEALCRIREGAAMIRIQGEVKNSGNIAKTVMHVRCLM  175

Query  443  GDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQLG  264
             ++RVL+NMD+DEVF FSK+I APYDIV QTKQM RLPVVHFA+GGIVTPADAA+MMQLG
Sbjct  176  KELRVLSNMDDDEVFTFSKRIQAPYDIVAQTKQMGRLPVVHFAAGGIVTPADAALMMQLG  235

Query  263  CDGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            C G+F+G EVF   D +K+V  IVQAVRNYNDP+VL        + M GLNL
Sbjct  236  CHGVFVGAEVFGYEDCFKRVKGIVQAVRNYNDPNVLV-------EIMMGLNL  280



>ref|XP_002969265.1| hypothetical protein SELMODRAFT_146305 [Selaginella moellendorffii]
 ref|XP_002986846.1| hypothetical protein SELMODRAFT_182665 [Selaginella moellendorffii]
 gb|EFJ12176.1| hypothetical protein SELMODRAFT_182665 [Selaginella moellendorffii]
 gb|EFJ29353.1| hypothetical protein SELMODRAFT_146305 [Selaginella moellendorffii]
Length=309

 Score =   371 bits (953),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 177/297 (60%), Positives = 233/297 (78%), Gaps = 7/297 (2%)
 Frame = -1

Query  980  MAEDGAVTVYSGSAITDAKKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIV  801
            M  +G V VY   AI + KK  +++KVG+AQMLRGG I++V   +QA+IAE AGA  V+ 
Sbjct  1    MDANGVVAVYGNGAIAEPKKASYAVKVGLAQMLRGGVIMDVVNAEQARIAEEAGAVAVMA  60

Query  800  SE---PDSR---GISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDES  639
             E    D R   G++RM DP +IKEIK+AV+IPVMAK+R+GHFVE Q+LE++GVD++DES
Sbjct  61   LERVPADIRAEGGVARMSDPGMIKEIKKAVTIPVMAKARIGHFVEGQVLESIGVDFVDES  120

Query  638  ELLAIADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRS  459
            E+L  AD+ + INKHNF VPFVCG R+LGEALRR+ EGAAMIRT+G+  G+GNI++ VR 
Sbjct  121  EVLTPADDANHINKHNFHVPFVCGCRNLGEALRRITEGAAMIRTKGE-AGTGNIIEAVRH  179

Query  458  VRKVMGDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAI  279
            VR +MGDIR L ++DEDEVF+F+K+I APY++V QTKQ+ RLPVV+FA+GG+ TPADAA+
Sbjct  180  VRSLMGDIRRLRSLDEDEVFSFAKEIGAPYELVRQTKQLGRLPVVNFAAGGVATPADAAL  239

Query  278  MMQLGCDGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            MMQLGCDG+F+G  +F   +P  +  AIV AV +YNDPHV+A+ S GL +AM G+NL
Sbjct  240  MMQLGCDGVFVGSGIFKSGNPAARARAIVTAVTHYNDPHVVAEVSCGLGEAMVGINL  296



>gb|EAZ02455.1| hypothetical protein OsI_24560 [Oryza sativa Indica Group]
Length=366

 Score =   370 bits (951),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 183/287 (64%), Positives = 231/287 (80%), Gaps = 16/287 (6%)
 Frame = -1

Query  980  MAEDGA--VTVY----SGSAI---TDAKKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAE  828
            MA DG   VTVY    +G+A+   ++ K   FS+KVG+AQMLRGG I++V T +QA+IAE
Sbjct  1    MATDGTGVVTVYGSGTNGAALLEPSNHKSATFSVKVGLAQMLRGGVIMDVVTPEQARIAE  60

Query  827  SAGACCVIVSE---PDSR---GISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILET  666
             AGAC V+  E    D R   G++RM DP LI++IKRAV+IPVMAK+R+GHFVEAQILE 
Sbjct  61   EAGACAVMALERVPADIRAQGGVARMSDPGLIRDIKRAVTIPVMAKARIGHFVEAQILEA  120

Query  665  VGVDYIDESELLAIADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGS  486
            +GVDY+DESE+L +AD+ H INKHNFRVPFVCG RDLGEALRR+REGAAMIRT+G+  G+
Sbjct  121  IGVDYVDESEVLTLADDAHHINKHNFRVPFVCGCRDLGEALRRIREGAAMIRTKGE-AGT  179

Query  485  GNIVDTVRSVRKVMGDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGG  306
            GN+V+ VR VR VMGDIR L NMD+DEVF+++K+IAAPYD+V+QTKQ+ RLPVV FA+GG
Sbjct  180  GNVVEAVRHVRSVMGDIRALRNMDDDEVFSYAKRIAAPYDLVMQTKQLGRLPVVQFAAGG  239

Query  305  IVTPADAAIMMQLGCDGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDP  165
            + TPADAA+MMQLGCDG+F+G  +F   DP ++  AIVQAV +Y+DP
Sbjct  240  VATPADAALMMQLGCDGVFVGSGIFKSGDPARRARAIVQAVTHYSDP  286



>ref|XP_011080788.1| PREDICTED: probable pyridoxal biosynthesis protein PDX1 [Sesamum 
indicum]
Length=301

 Score =   367 bits (942),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 182/298 (61%), Positives = 229/298 (77%), Gaps = 17/298 (6%)
 Frame = -1

Query  980  MAEDGAVTVYSGSAITDA-KKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVI  804
            MA  G VTVY   AIT+  K++PFS+KVG+AQMLRGG I++V T +QA++AE AGAC V+
Sbjct  1    MAGSGVVTVYGNGAITETTKQSPFSVKVGLAQMLRGGVIMDVVTPEQARVAEEAGACAVM  60

Query  803  VSE---PDSR---GISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDE  642
              E    D R   G++RM DP LIKEIK+AV+IPVMAK+R+GHFVEAQILE +G+DY+DE
Sbjct  61   ALERVPADIRAQGGVARMSDPQLIKEIKQAVTIPVMAKARIGHFVEAQILEAIGIDYVDE  120

Query  641  SELLAIADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVR  462
            SE+L +AD+++ INKHNFR+PFVCG R L  A  R +  A          G+GNI++ VR
Sbjct  121  SEVLTLADDENHINKHNFRIPFVCGCRHLRGAPHRPKGEA----------GTGNIIEAVR  170

Query  461  SVRKVMGDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAA  282
             VR VMGDIRVL NMD+DEVF F+KKI APYD+V+QTKQ+ RLPVVHFA+GG+ TPADAA
Sbjct  171  HVRSVMGDIRVLRNMDDDEVFTFAKKIQAPYDLVMQTKQLGRLPVVHFAAGGVATPADAA  230

Query  281  IMMQLGCDGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            +MMQLGCDG+F+G  VF   DP ++  AIVQAV +Y+DP VLA+ S GL +AM G+NL
Sbjct  231  LMMQLGCDGVFVGSGVFKSGDPARRARAIVQAVTHYSDPEVLAEVSCGLGEAMVGINL  288



>ref|XP_009141727.1| PREDICTED: LOW QUALITY PROTEIN: pyridoxal biosynthesis protein 
PDX1.1 [Brassica rapa]
Length=418

 Score =   368 bits (945),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 189/322 (59%), Positives = 245/322 (76%), Gaps = 17/322 (5%)
 Frame = -1

Query  1055  IKSSPHEARY*SVVSLAHCTEHF--AEMAED-GAVTVYSGSAITDAKK-NPFSIKVGIAQ  888
             I++S H  +Y S++ L   T      +MAE  G V VY   ++T+ K+ +PFS+KVG+AQ
Sbjct  80    IRASLH--KYKSLIFLLSSTLSLNPRKMAESTGVVAVYGEGSMTETKQQSPFSVKVGLAQ  137

Query  887   MLRGGAIVEVTTVDQAKIAESAGACCVIVSE---PDSR---GISRMPDPALIKEIKRAVS  726
             MLRGG I++V   +QA+IAE AGAC V+  E    D R   G++RM D   IKEIK AV+
Sbjct  138   MLRGGVIMDVVNAEQARIAEEAGACAVMALERVPADIRAQGGVARMSD--XIKEIKHAVT  195

Query  725   IPVMAKSRVGHFVEAQILETVGVDYIDESELLAIADEDHFINKHNFRVPFVCGARDLGEA  546
             IPVMAK+R+GHFVE QILE++GVDY+DESE+L +ADED+ INKHNF++PFVCG ++LGEA
Sbjct  196   IPVMAKARIGHFVEVQILESIGVDYVDESEVLTLADEDNHINKHNFKIPFVCGCKNLGEA  255

Query  545   LRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKVMGDIRVLNNMD--EDEVFAFSKKIAAP  372
             LRR+REGAAMIRT+G+  G+GN+V+ VR VR VMG IR+L  MD  +DEVFA++KKI AP
Sbjct  256   LRRIREGAAMIRTKGE-AGTGNVVEAVRHVRSVMGTIRLLRGMDXVDDEVFAYAKKIVAP  314

Query  371   YDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQLGCDGIFLGPEVFNCSDPYKKVWAIV  192
             Y++V+QTKQ+ RLPVV FA+GG+ TPADAA+MMQLGCDG+F+G  +F   DP K+  AIV
Sbjct  315   YELVMQTKQLGRLPVVQFAAGGVATPADAALMMQLGCDGVFVGSRIFKSGDPAKRAKAIV  374

Query  191   QAVRNYNDPHVLAKASSGLEDA  126
             QAV NY D  VLA+ S GL +A
Sbjct  375   QAVTNYRDAAVLAEVSCGLGEA  396



>ref|XP_001778481.1| predicted protein [Physcomitrella patens]
 gb|EDQ56654.1| predicted protein [Physcomitrella patens]
Length=315

 Score =   360 bits (924),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 172/279 (62%), Positives = 225/279 (81%), Gaps = 7/279 (3%)
 Frame = -1

Query  926  KKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIVSE---PDSR---GISRMP  765
            K   +++KVG+AQMLRGG I++V   +QA+IAE AGA  V+  E    D R   G++RM 
Sbjct  25   KSVSYAVKVGLAQMLRGGVIMDVVDANQARIAEEAGAVAVMALERVPADIRAEGGVARMS  84

Query  764  DPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLAIADEDHFINKHNFR  585
            DPA+IKEIK+AV+IPVMAK+R+GHFVEAQILE +GVDYIDESE+L  AD+ + INKHN+R
Sbjct  85   DPAMIKEIKKAVTIPVMAKARIGHFVEAQILEAIGVDYIDESEVLTPADDVNHINKHNYR  144

Query  584  VPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKVMGDIRVLNNMDEDE  405
            +PFVCG R+LGEALRR+ EGAAMIRT+G+  G+GN+V+ VR  R V+G+IR L ++D+DE
Sbjct  145  IPFVCGCRNLGEALRRIAEGAAMIRTKGE-AGTGNVVEAVRHTRSVLGEIRRLQSLDDDE  203

Query  404  VFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQLGCDGIFLGPEVFNC  225
            VF+F+K+IAAPY++V QTKQ+ RLPVV+FA+GG+ TPADAA+MMQLGCDG+F+G  +F  
Sbjct  204  VFSFAKEIAAPYELVRQTKQLGRLPVVNFAAGGVATPADAALMMQLGCDGVFVGSGIFKS  263

Query  224  SDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
             DP K+  AIV+AV +YND HVLA+ S  L +AM G+NL
Sbjct  264  GDPAKRARAIVEAVTHYNDAHVLAEVSENLGEAMVGINL  302



>ref|XP_001754823.1| predicted protein [Physcomitrella patens]
 gb|EDQ80277.1| predicted protein [Physcomitrella patens]
Length=313

 Score =   358 bits (919),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 177/301 (59%), Positives = 233/301 (77%), Gaps = 11/301 (4%)
 Frame = -1

Query  980  MAEDGAVTVYS-GSAITD---AKKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGAC  813
            M E+  V V + GS +++    K   +++KVG+AQMLRGG I++V  V QA+IAE AGA 
Sbjct  1    MEENRVVAVLNNGSGLSENQNKKTVSYAVKVGLAQMLRGGVIMDVVDVAQARIAEEAGAV  60

Query  812  CVIVSE---PDSR---GISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDY  651
             V+  E    D R   G++RM DP++IKEIK+AV+IPVMAK+R+GHFVEAQILE +GVDY
Sbjct  61   AVMALERVPADIRAEGGVARMSDPSMIKEIKKAVTIPVMAKARIGHFVEAQILEAIGVDY  120

Query  650  IDESELLAIADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVD  471
            IDESE+L  AD+ H INKHN+R+PFVCG R+LGEALRR+ EGAAMIRT+G+  G+GN+V+
Sbjct  121  IDESEVLTPADDVHHINKHNYRIPFVCGCRNLGEALRRIAEGAAMIRTKGE-AGTGNVVE  179

Query  470  TVRSVRKVMGDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPA  291
             VR  R V+GDIR L ++D+DEVF ++K+I APY++V QTKQ+ RLPVV+FA+GG+ TPA
Sbjct  180  AVRHTRSVLGDIRRLQSLDDDEVFTYAKEIQAPYELVRQTKQLGRLPVVNFAAGGVATPA  239

Query  290  DAAIMMQLGCDGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLN  111
            DAA+MMQLGCDG+F+G  +F   DP K+  AIV+AV +YND  VLA+ S  L +AM G+N
Sbjct  240  DAALMMQLGCDGVFVGSGIFKSGDPAKRARAIVEAVTHYNDARVLAEVSENLGEAMVGIN  299

Query  110  L  108
            L
Sbjct  300  L  300



>ref|XP_001762283.1| predicted protein [Physcomitrella patens]
 gb|EDQ72750.1| predicted protein [Physcomitrella patens]
Length=314

 Score =   357 bits (917),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 177/302 (59%), Positives = 232/302 (77%), Gaps = 12/302 (4%)
 Frame = -1

Query  980  MAEDGAVTVY--SGSAITD---AKKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGA  816
            M  +G V VY  +GS +++    K   +++KVG+AQMLRGG I++V    QA+IAE AGA
Sbjct  1    MEGNGVVAVYHNNGSGLSENQNKKTVSYAVKVGLAQMLRGGVIMDVVDAAQARIAEEAGA  60

Query  815  CCVIVSE---PDSR---GISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVD  654
              V+  E    D R   G++RM DP++IKEIK+AV+IPVMAK+R+GHFVEAQILE +GVD
Sbjct  61   VAVMALERVPADIRAEGGVARMSDPSMIKEIKKAVTIPVMAKARIGHFVEAQILEAIGVD  120

Query  653  YIDESELLAIADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIV  474
            YIDESE+L  AD+ + INKHN+R+PFVCG R+LGEALRR+ EGAAMIRT+G+  G+GN+V
Sbjct  121  YIDESEVLTPADDVNHINKHNYRIPFVCGCRNLGEALRRIAEGAAMIRTKGE-AGTGNVV  179

Query  473  DTVRSVRKVMGDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTP  294
            + VR  R V+GDIR L ++D+DEVF F+K+I APY++V QTKQ+ RLPVV+FA+GG+ TP
Sbjct  180  EAVRHTRSVLGDIRRLQSLDDDEVFTFAKEIQAPYELVRQTKQLGRLPVVNFAAGGVATP  239

Query  293  ADAAIMMQLGCDGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGL  114
            ADAA+MMQLGCDG+F+G  +F   DP K+  AIV+AV +Y D HVLA  S  L +AM G+
Sbjct  240  ADAALMMQLGCDGVFVGSGIFKSGDPAKRARAIVEAVTHYRDAHVLADVSENLGEAMVGI  299

Query  113  NL  108
            NL
Sbjct  300  NL  301



>gb|ACE97366.1| vitamin B6 biosynthesis protein, partial [Populus tremula]
Length=211

 Score =   352 bits (904),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 166/211 (79%), Positives = 192/211 (91%), Gaps = 1/211 (0%)
 Frame = -1

Query  875  GAIVEVTTVDQAKIAESAGACCVIVSEPDSR-GISRMPDPALIKEIKRAVSIPVMAKSRV  699
            GAI+EV++V QAKIAE AGAC ++VSEP  R GI RMPDP+LIKEIKRAVSIP+MA++RV
Sbjct  1    GAILEVSSVQQAKIAEEAGACSIMVSEPGLRQGIRRMPDPSLIKEIKRAVSIPLMARARV  60

Query  698  GHFVEAQILETVGVDYIDESELLAIADEDHFINKHNFRVPFVCGARDLGEALRRVREGAA  519
            GHFVEAQILE +GVDYIDESELLA+ADED+FINKHNFR PF+CG R+LGEALRRVREGAA
Sbjct  61   GHFVEAQILEAIGVDYIDESELLALADEDNFINKHNFRCPFICGCRNLGEALRRVREGAA  120

Query  518  MIRTQGDLTGSGNIVDTVRSVRKVMGDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMA  339
            MIRTQG++ G GN+ +TV++VR VM ++RVLNNMDEDEVFAF+KKIAAPYD+V Q KQM 
Sbjct  121  MIRTQGEILGQGNVAETVKNVRNVMKEVRVLNNMDEDEVFAFAKKIAAPYDLVAQIKQMG  180

Query  338  RLPVVHFASGGIVTPADAAIMMQLGCDGIFL  246
            RLPVV FA+GGIVTPADAAIMMQLGCDGIF+
Sbjct  181  RLPVVQFAAGGIVTPADAAIMMQLGCDGIFV  211



>gb|ACE97329.1| vitamin B6 biosynthesis protein, partial [Populus tremula]
 gb|ACE97330.1| vitamin B6 biosynthesis protein, partial [Populus tremula]
 gb|ACE97331.1| vitamin B6 biosynthesis protein, partial [Populus tremula]
 gb|ACE97332.1| vitamin B6 biosynthesis protein, partial [Populus tremula]
 gb|ACE97333.1| vitamin B6 biosynthesis protein, partial [Populus tremula]
 gb|ACE97334.1| vitamin B6 biosynthesis protein, partial [Populus tremula]
 gb|ACE97335.1| vitamin B6 biosynthesis protein, partial [Populus tremula]
 gb|ACE97336.1| vitamin B6 biosynthesis protein, partial [Populus tremula]
 gb|ACE97337.1| vitamin B6 biosynthesis protein, partial [Populus tremula]
 gb|ACE97339.1| vitamin B6 biosynthesis protein, partial [Populus tremula]
 gb|ACE97340.1| vitamin B6 biosynthesis protein, partial [Populus tremula]
 gb|ACE97341.1| vitamin B6 biosynthesis protein, partial [Populus tremula]
 gb|ACE97342.1| vitamin B6 biosynthesis protein, partial [Populus tremula]
 gb|ACE97343.1| vitamin B6 biosynthesis protein, partial [Populus tremula]
 gb|ACE97344.1| vitamin B6 biosynthesis protein, partial [Populus tremula]
 gb|ACE97345.1| vitamin B6 biosynthesis protein, partial [Populus tremula]
 gb|ACE97346.1| vitamin B6 biosynthesis protein, partial [Populus tremula]
 gb|ACE97348.1| vitamin B6 biosynthesis protein, partial [Populus tremula]
 gb|ACE97349.1| vitamin B6 biosynthesis protein, partial [Populus tremula]
 gb|ACE97350.1| vitamin B6 biosynthesis protein, partial [Populus tremula]
 gb|ACE97351.1| vitamin B6 biosynthesis protein, partial [Populus tremula]
 gb|ACE97352.1| vitamin B6 biosynthesis protein, partial [Populus tremula]
 gb|ACE97353.1| vitamin B6 biosynthesis protein, partial [Populus tremula]
 gb|ACE97354.1| vitamin B6 biosynthesis protein, partial [Populus tremula]
 gb|ACE97355.1| vitamin B6 biosynthesis protein, partial [Populus tremula]
 gb|ACE97356.1| vitamin B6 biosynthesis protein, partial [Populus tremula]
 gb|ACE97357.1| vitamin B6 biosynthesis protein, partial [Populus tremula]
 gb|ACE97359.1| vitamin B6 biosynthesis protein, partial [Populus tremula]
 gb|ACE97360.1| vitamin B6 biosynthesis protein, partial [Populus tremula]
 gb|ACE97361.1| vitamin B6 biosynthesis protein, partial [Populus tremula]
 gb|ACE97362.1| vitamin B6 biosynthesis protein, partial [Populus tremula]
 gb|ACE97363.1| vitamin B6 biosynthesis protein, partial [Populus tremula]
 gb|ACE97364.1| vitamin B6 biosynthesis protein, partial [Populus tremula]
 gb|ACE97365.1| vitamin B6 biosynthesis protein, partial [Populus tremula]
Length=211

 Score =   351 bits (901),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 165/211 (78%), Positives = 192/211 (91%), Gaps = 1/211 (0%)
 Frame = -1

Query  875  GAIVEVTTVDQAKIAESAGACCVIVSEPDSR-GISRMPDPALIKEIKRAVSIPVMAKSRV  699
            GAI+EV++V QAKIAE AGAC ++VSEP  R GI RMPDP+LIKEIKRAVSIP+MA++RV
Sbjct  1    GAILEVSSVQQAKIAEEAGACSIMVSEPGLRQGIRRMPDPSLIKEIKRAVSIPLMARARV  60

Query  698  GHFVEAQILETVGVDYIDESELLAIADEDHFINKHNFRVPFVCGARDLGEALRRVREGAA  519
            GHFVEAQILE +GVDYIDESELLA+ADED+FINKHNFR PF+CG R+LGEALRRVREGAA
Sbjct  61   GHFVEAQILEAIGVDYIDESELLALADEDNFINKHNFRCPFICGCRNLGEALRRVREGAA  120

Query  518  MIRTQGDLTGSGNIVDTVRSVRKVMGDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMA  339
            MIRTQG++ G GN+ +TV++VR VM ++RVLNNMDEDEVFAF+KKIAAPYD+V Q KQM 
Sbjct  121  MIRTQGEILGQGNVAETVKNVRNVMKEVRVLNNMDEDEVFAFAKKIAAPYDLVAQIKQMG  180

Query  338  RLPVVHFASGGIVTPADAAIMMQLGCDGIFL  246
            RLPVV FA+GGIVTPADAA+MMQLGCDGIF+
Sbjct  181  RLPVVQFAAGGIVTPADAALMMQLGCDGIFV  211



>ref|XP_001783042.1| predicted protein [Physcomitrella patens]
 gb|EDQ52166.1| predicted protein [Physcomitrella patens]
Length=315

 Score =   355 bits (912),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 177/303 (58%), Positives = 235/303 (78%), Gaps = 13/303 (4%)
 Frame = -1

Query  980  MAEDGAVTVY--SGSAITD---AKKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGA  816
            M  DG V VY  +G  +++    K   +++KVG+AQMLRGG I++V   +QA+IAE AGA
Sbjct  1    MEGDGVVAVYCDNGKGLSENNNKKTVSYAVKVGLAQMLRGGVIMDVVDANQARIAEEAGA  60

Query  815  CCVIVSE---PDSR---GISRMPDPALIKEIKRAVSIPVMAKSRV-GHFVEAQILETVGV  657
              V+  E    D R   G++RM DP++IKEIK+AV+IPVMAK+R+ GHFVEAQILE +GV
Sbjct  61   VAVMALERVPADIRAEGGVARMSDPSMIKEIKKAVTIPVMAKARIAGHFVEAQILEAIGV  120

Query  656  DYIDESELLAIADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNI  477
            DYIDESE+L  AD+ + INKHN+R+PFVCG R+LGEALRR+ EGAAMIRT+G+  G+GN+
Sbjct  121  DYIDESEVLTPADDVNHINKHNYRIPFVCGCRNLGEALRRIAEGAAMIRTKGE-AGTGNV  179

Query  476  VDTVRSVRKVMGDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVT  297
            V+ VR  R V+G+IR L ++D+DEVF F+K+IAAPY++V QTKQ+ RLPVV+FA+GG+ T
Sbjct  180  VEAVRHTRSVLGEIRRLQSLDDDEVFTFAKQIAAPYELVRQTKQLGRLPVVNFAAGGVAT  239

Query  296  PADAAIMMQLGCDGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAG  117
            PADAA+MMQLGCDG+F+G  +F   DP K+  AIV+AV +YND H+LA+ S  L +AM G
Sbjct  240  PADAALMMQLGCDGVFVGSGIFKSGDPVKRGRAIVEAVTHYNDAHMLAEMSENLGEAMVG  299

Query  116  LNL  108
            +NL
Sbjct  300  INL  302



>gb|ACE97338.1| vitamin B6 biosynthesis protein, partial [Populus tremula]
 gb|ACE97347.1| vitamin B6 biosynthesis protein, partial [Populus tremula]
 gb|ACE97358.1| vitamin B6 biosynthesis protein, partial [Populus tremula]
Length=211

 Score =   350 bits (899),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 165/211 (78%), Positives = 192/211 (91%), Gaps = 1/211 (0%)
 Frame = -1

Query  875  GAIVEVTTVDQAKIAESAGACCVIVSEPDSR-GISRMPDPALIKEIKRAVSIPVMAKSRV  699
            GAI+EV++V QAKIAE AGAC ++VSEP  R GI RMPDP+LIKEIKRAVSIP+MA++RV
Sbjct  1    GAILEVSSVQQAKIAEEAGACSIMVSEPGLRQGIRRMPDPSLIKEIKRAVSIPLMARARV  60

Query  698  GHFVEAQILETVGVDYIDESELLAIADEDHFINKHNFRVPFVCGARDLGEALRRVREGAA  519
            GHFVEAQILE +GVDYIDESELLA+ADED+FINKHNFR PF+CG R+LGEALRRVREGAA
Sbjct  61   GHFVEAQILEAIGVDYIDESELLALADEDNFINKHNFRCPFICGCRNLGEALRRVREGAA  120

Query  518  MIRTQGDLTGSGNIVDTVRSVRKVMGDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMA  339
            MIRTQG++ G GN+ +TV++VR VM ++RVLNNMDEDEVFAF+KKIAAPYD+V Q KQM 
Sbjct  121  MIRTQGEILGQGNVAETVKNVRYVMKEVRVLNNMDEDEVFAFAKKIAAPYDLVAQIKQMG  180

Query  338  RLPVVHFASGGIVTPADAAIMMQLGCDGIFL  246
            RLPVV FA+GGIVTPADAA+MMQLGCDGIF+
Sbjct  181  RLPVVQFAAGGIVTPADAALMMQLGCDGIFV  211



>gb|EAZ38383.1| hypothetical protein OsJ_22760 [Oryza sativa Japonica Group]
Length=298

 Score =   352 bits (903),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 177/300 (59%), Positives = 227/300 (76%), Gaps = 24/300 (8%)
 Frame = -1

Query  980  MAEDGA--VTVY----SGSAI---TDAKKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAE  828
            MA DG   VTVY    +G+A+   ++ K   FS+KVG+AQMLRGG I++V T +QA+IAE
Sbjct  1    MATDGTGVVTVYGSGTNGAALLEPSNHKSATFSVKVGLAQMLRGGVIMDVVTPEQARIAE  60

Query  827  SAGACCVIVSEPDSRGISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYI  648
             AGAC V+  E       R+P     +  +R         +R+GHFVEAQILE +GVDY+
Sbjct  61   EAGACAVMALE-------RVPADIRAQGRRRP-------HARIGHFVEAQILEAIGVDYV  106

Query  647  DESELLAIADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDT  468
            DESE+L +AD+ H INKHNFRVPFVCG RDLGEALRR+REGAAMIRT+G+  G+GN+V+ 
Sbjct  107  DESEVLTLADDAHHINKHNFRVPFVCGCRDLGEALRRIREGAAMIRTKGE-AGTGNVVEA  165

Query  467  VRSVRKVMGDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPAD  288
            VR VR VMGDIR L NMD+DEVF+++K+IAAPYD+V+QTKQ+ RLPVV FA+GG+ TPAD
Sbjct  166  VRHVRSVMGDIRALRNMDDDEVFSYAKRIAAPYDLVMQTKQLGRLPVVQFAAGGVATPAD  225

Query  287  AAIMMQLGCDGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            AA+MMQLGCDG+F+G  +F   DP ++  AIVQAV +Y+DP +LA+ SSGL +AM G+NL
Sbjct  226  AALMMQLGCDGVFVGSGIFKSGDPARRARAIVQAVTHYSDPKILAEVSSGLGEAMVGINL  285



>ref|XP_010468201.1| PREDICTED: probable pyridoxal biosynthesis protein PDX1.2 [Camelina 
sativa]
Length=234

 Score =   349 bits (895),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 161/222 (73%), Positives = 200/222 (90%), Gaps = 3/222 (1%)
 Frame = -1

Query  974  EDGAVTVYSGSAITDAKK-NPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIVS  798
            + GAVT+YSG+AITDAKK +PFS+KVG+AQ+LRGGAIVEV++V+QAKIAESAGAC V+VS
Sbjct  11   QQGAVTLYSGTAITDAKKTHPFSVKVGLAQVLRGGAIVEVSSVNQAKIAESAGACSVLVS  70

Query  797  EP--DSRGISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLAI  624
            +P     G+ RMPDP L+KE+KRAVS+PVMA++RVGHFVEAQILE++ VDYIDESE++++
Sbjct  71   DPVRSLSGVRRMPDPVLVKEVKRAVSVPVMARARVGHFVEAQILESLAVDYIDESEIISV  130

Query  623  ADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKVM  444
            AD+DHFINKHNFR PF+CG RD GEALRR+REGAAMIR QGDLTG+GN+  TV++VR +M
Sbjct  131  ADDDHFINKHNFRSPFICGCRDTGEALRRIREGAAMIRIQGDLTGTGNVSKTVKNVRSLM  190

Query  443  GDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHF  318
            G++RVLNNMD+DEVF F+KKI+APYD+V QTKQM R+PVV F
Sbjct  191  GEVRVLNNMDDDEVFTFAKKISAPYDLVAQTKQMGRVPVVQF  232



>ref|XP_005708062.1| pyridoxine biosynthesis protein [Galdieria sulphuraria]
 gb|EME31542.1| pyridoxine biosynthesis protein [Galdieria sulphuraria]
Length=319

 Score =   349 bits (896),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 172/300 (57%), Positives = 224/300 (75%), Gaps = 12/300 (4%)
 Frame = -1

Query  989  FAEMAEDGAVTVYSGSAITDAKKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACC  810
            FA+ AE     V  G    DAK   F++KVG+AQML+GG I++V T +QAKIAE AGAC 
Sbjct  10   FAQTAE----AVNEGFIAGDAK-GTFAVKVGLAQMLKGGVIMDVVTPEQAKIAEEAGACA  64

Query  809  VIVSEP------DSRGISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYI  648
            V+  E        S G++RM DP +IK IK+AVSIPVMAK R+GHFVEAQILE +G+DYI
Sbjct  65   VMALEKIPADIRKSNGVARMSDPKIIKAIKQAVSIPVMAKCRIGHFVEAQILEAIGIDYI  124

Query  647  DESELLAIADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDT  468
            DESE+L  AD+ H +NKH F+VPFVCG R+LGEALRR+ EGAAMIRT+G+  G+GN+V+ 
Sbjct  125  DESEVLTPADDSHHVNKHKFQVPFVCGCRNLGEALRRISEGAAMIRTKGE-AGTGNVVEA  183

Query  467  VRSVRKVMGDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPAD  288
            V+  R+V GDIR L NMDEDE++ F+K+I AP+ +V +TK++ RLPVV FA+GG+ TPAD
Sbjct  184  VKHARQVNGDIRRLRNMDEDELYTFAKEIGAPFALVKRTKELGRLPVVQFAAGGVATPAD  243

Query  287  AAIMMQLGCDGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            AA+MMQLG DG+F+G  +F    P K+  AIV+AV NYN+P +LA+ S  L +AM G+ +
Sbjct  244  AALMMQLGVDGVFVGSGIFKSETPKKRAEAIVKAVTNYNNPKILAQVSEDLGEAMVGIEM  303



>emb|CDX93320.1| BnaC04g45760D [Brassica napus]
Length=289

 Score =   347 bits (889),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 175/299 (59%), Positives = 223/299 (75%), Gaps = 30/299 (10%)
 Frame = -1

Query  980  MAED-GAVTVYSGSAITDAKK-NPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCV  807
            MAE  G V VY   ++T+ K+ +PFS+KVG+AQMLRGG I++V   +QA+IAE AGAC V
Sbjct  1    MAESAGVVAVYGEGSMTETKQQSPFSVKVGLAQMLRGGVIMDVVNAEQARIAEEAGACAV  60

Query  806  IVSE---PDSR---GISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYID  645
            +  E    D R   G++RM DP +IKEIK+AV+IPVMAK+R+GHFVEAQILE++G     
Sbjct  61   MALERVPADIRAQGGVARMSDPEMIKEIKQAVTIPVMAKARIGHFVEAQILESIG-----  115

Query  644  ESELLAIADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTV  465
                            HNF++PFVCG R+LGEALRR+REGAAMIRT+G+  G+GN+V+ V
Sbjct  116  ----------------HNFKIPFVCGCRNLGEALRRIREGAAMIRTKGE-AGTGNVVEAV  158

Query  464  RSVRKVMGDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADA  285
            R VR VMG IR+L  MD+DEVFA++KKIAAPY++V+QTKQ+ RLPVV FA+GG+ TPADA
Sbjct  159  RHVRSVMGAIRLLRGMDDDEVFAYAKKIAAPYELVMQTKQLGRLPVVQFAAGGVATPADA  218

Query  284  AIMMQLGCDGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            A+MMQLGCDG+F+G  +F   DP K+  AIVQAV NY D  VLA+ S GL +AM G+NL
Sbjct  219  ALMMQLGCDGVFVGSGIFKSGDPAKRAKAIVQAVTNYRDAAVLAEVSCGLGEAMVGINL  277



>ref|XP_002500451.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO61709.1| predicted protein [Micromonas sp. RCC299]
Length=296

 Score =   347 bits (890),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 165/281 (59%), Positives = 222/281 (79%), Gaps = 7/281 (2%)
 Frame = -1

Query  935  TDAKKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIVSE---PDSR---GIS  774
            T+A+K  F++KVG+AQML+GG I++V  V+QA+IAE AGA  V+  E    D R   G++
Sbjct  3    TEAQKGTFAVKVGLAQMLKGGVIMDVVNVEQARIAEEAGAVAVMALERVPADIRKDGGVA  62

Query  773  RMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLAIADEDHFINKH  594
            RM DP +IK IK AV+IPVMAK+R+GHFVEAQ+LE++G+DYIDESE+L  ADE + INKH
Sbjct  63   RMSDPTMIKAIKEAVTIPVMAKARIGHFVEAQVLESIGIDYIDESEVLTPADEINHINKH  122

Query  593  NFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKVMGDIRVLNNMD  414
            NF+VP +CG RDLGEALRR+ EG++MIRT+G+  G+GN+V+ VR  R VMGDIR L +MD
Sbjct  123  NFKVPVLCGCRDLGEALRRIAEGSSMIRTKGE-AGTGNVVEAVRHCRAVMGDIRRLQSMD  181

Query  413  EDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQLGCDGIFLGPEV  234
            +DE+F ++K+I AP ++V QTK + RLPVV+FA+GG+ TPADAA+MMQLG DG+F+G  +
Sbjct  182  DDEIFVYAKEIRAPLELVKQTKTLGRLPVVNFAAGGVATPADAALMMQLGMDGVFVGSGI  241

Query  233  FNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLN  111
            F   DP K+  AIVQAV +YNDP ++A+ S GL +AM G++
Sbjct  242  FKSGDPAKRARAIVQAVTHYNDPKIIAEVSQGLGEAMVGID  282



>ref|XP_005537762.1| stress-inducible pyridoxine biosynthesis protein SOR [Cyanidioschyzon 
merolae strain 10D]
 dbj|BAM81726.1| stress-inducible pyridoxine biosynthesis protein SOR [Cyanidioschyzon 
merolae strain 10D]
Length=324

 Score =   345 bits (886),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 168/281 (60%), Positives = 218/281 (78%), Gaps = 7/281 (2%)
 Frame = -1

Query  932  DAKKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIVSE---PDSRG---ISR  771
            D   + F++KVG+AQML+GG I++V T +QA+IAE+AGAC V+  E    D R    ++R
Sbjct  29   DVHASTFAVKVGLAQMLKGGVIMDVVTPEQARIAENAGACAVMALERIPADIRAQGQVAR  88

Query  770  MPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLAIADEDHFINKHN  591
            M DP LIK IK AVSIPVMAK+R+GHFVEAQILE +GVDYIDESE+L  AD+ H INKH 
Sbjct  89   MSDPGLIKRIKAAVSIPVMAKARIGHFVEAQILEALGVDYIDESEVLTPADDLHHINKHK  148

Query  590  FRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKVMGDIRVLNNMDE  411
            FRVPFVCG R+LGEALRR++EGAA IRT+G+  G+GN+V+ VR  R+V+G+IR L  MD+
Sbjct  149  FRVPFVCGCRNLGEALRRIQEGAAFIRTKGE-AGTGNVVEAVRHARQVVGEIRRLQTMDD  207

Query  410  DEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQLGCDGIFLGPEVF  231
            DE+F ++K+I A Y +V +TK+M RLPVV FA+GG+ TPADAA+MMQLG DG+F+G  +F
Sbjct  208  DELFTYAKEIGASYALVKRTKEMGRLPVVQFAAGGVATPADAALMMQLGMDGVFVGSGIF  267

Query  230  NCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
              +DP K+  AIV+AV NYNDP +LA+ S  L DAM G+ +
Sbjct  268  KSADPEKRARAIVKAVANYNDPKILAEVSEDLGDAMVGIEM  308



>ref|XP_007509329.1| pyridoxine biosynthesis protein [Bathycoccus prasinos]
 emb|CCO19786.1| pyridoxine biosynthesis protein [Bathycoccus prasinos]
Length=298

 Score =   344 bits (882),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 166/284 (58%), Positives = 219/284 (77%), Gaps = 7/284 (2%)
 Frame = -1

Query  944  SAITDAKKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIVSE---PDSR---  783
            S  TD +K  F++K G+AQML+GG I++V  V+QA+IAE AGA  V+  E    D R   
Sbjct  2    SGNTDVEKGNFAVKAGLAQMLKGGVIMDVVNVEQARIAEEAGAVAVMALERVPADIRKDG  61

Query  782  GISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLAIADEDHFI  603
            G++RM DP +IK IK AV+IPVMAK+R+GHFVEAQ+LE++G+DYIDESE+L  ADE + I
Sbjct  62   GVARMSDPTMIKLIKEAVTIPVMAKARIGHFVEAQVLESIGIDYIDESEVLTPADEINHI  121

Query  602  NKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKVMGDIRVLN  423
            NKH F+VP +CG RDLGEALRR+ EG +MIRT+G+  G+GN+V+ VR  R VMGDIR L 
Sbjct  122  NKHKFKVPVLCGCRDLGEALRRIAEGCSMIRTKGE-AGTGNVVEAVRHCRAVMGDIRRLQ  180

Query  422  NMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQLGCDGIFLG  243
             MDEDEVF ++K+I APY++V QTK++ RLP V+FA+GG+ TPADAA+MMQLG DG+F+G
Sbjct  181  AMDEDEVFVYAKEIRAPYELVAQTKKLGRLPTVNFAAGGVATPADAALMMQLGMDGVFVG  240

Query  242  PEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLN  111
              +F   DP K+  AIVQAV +YNDP ++A+ S GL +AM G++
Sbjct  241  SGIFKSGDPAKRARAIVQAVTHYNDPKIIAEVSCGLGEAMVGID  284



>gb|EMS65158.1| putative pyridoxal biosynthesis protein PDX1.1 [Triticum urartu]
Length=251

 Score =   341 bits (874),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 154/225 (68%), Positives = 194/225 (86%), Gaps = 1/225 (0%)
 Frame = -1

Query  782  GISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLAIADEDHFI  603
            G++RM DPALI++IKRAV+IPVMAK+R+GHFVEAQILE +GVDY+DESE+L +AD+ H I
Sbjct  15   GVARMSDPALIRDIKRAVTIPVMAKARIGHFVEAQILEAIGVDYVDESEVLTLADDAHHI  74

Query  602  NKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKVMGDIRVLN  423
            NKHNFRVPFVCG RDLGEALRR+REGAAMIRT+G+  G+GN+V+ VR VR VMG +R L 
Sbjct  75   NKHNFRVPFVCGCRDLGEALRRIREGAAMIRTKGE-AGTGNVVEAVRHVRSVMGAVRALR  133

Query  422  NMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQLGCDGIFLG  243
            NMDEDEVF+++K+IAAPYD+V+QTKQ+ RLPVV FA+GG+ TPADAA+MMQLGCDG+F+G
Sbjct  134  NMDEDEVFSYAKQIAAPYDLVMQTKQLGRLPVVQFAAGGVATPADAALMMQLGCDGVFVG  193

Query  242  PEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
              +F   DP ++  AIVQAV +Y+DP +LA  S+GL +AM G+NL
Sbjct  194  SGIFKSGDPARRARAIVQAVTHYSDPEILANVSAGLGEAMVGINL  238



>ref|XP_005648541.1| vitamin B6 biosynthesis protein [Coccomyxa subellipsoidea C-169]
 gb|EIE23997.1| vitamin B6 biosynthesis protein [Coccomyxa subellipsoidea C-169]
Length=295

 Score =   340 bits (872),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 165/282 (59%), Positives = 219/282 (78%), Gaps = 7/282 (2%)
 Frame = -1

Query  938  ITDAKKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIVSE---PDSR---GI  777
            +T+A+K  F++KVG+AQML+GG I++VTT ++A+IAE AGA  V+  E    D R   G+
Sbjct  1    MTEAQKGTFAVKVGLAQMLKGGVIMDVTTPEEARIAEEAGAVAVMALERVPADIRKEGGV  60

Query  776  SRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLAIADEDHFINK  597
            +RM D  +IK IK AV+IPVMAK+R+GHFVEAQILE + VDY+DESE+L  AD+ H INK
Sbjct  61   ARMSDAEVIKAIKAAVTIPVMAKARIGHFVEAQILEALEVDYLDESEVLTPADDQHHINK  120

Query  596  HNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKVMGDIRVLNNM  417
            HNF+VPFVCG RDLGEALRR+ EGAAMIRT+G+  G+GN+V+ VR  R VMG IR L  M
Sbjct  121  HNFKVPFVCGCRDLGEALRRISEGAAMIRTKGE-AGTGNVVEAVRHCRSVMGAIRALQTM  179

Query  416  DEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQLGCDGIFLGPE  237
            D+DE++ ++K++ AP ++V QTK + RLPVV+FA+GG+ TPADAA+MMQ+G DG+F+G  
Sbjct  180  DDDELYVYAKELRAPIELVRQTKHLGRLPVVNFAAGGVATPADAALMMQMGMDGVFVGSG  239

Query  236  VFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLN  111
            +F   DP K+  AIVQAV +YND  VLA+ S+GL  AM G++
Sbjct  240  IFKAGDPAKRARAIVQAVTHYNDAKVLAEMSTGLGPAMVGID  281



>ref|XP_001416532.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO94825.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=296

 Score =   339 bits (869),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 162/281 (58%), Positives = 219/281 (78%), Gaps = 7/281 (2%)
 Frame = -1

Query  935  TDAKKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIVSE---PDSR---GIS  774
            T+ +++ F++K G+AQML+GG I++V  V+QA+IAE AGA  V+  E    D R   G++
Sbjct  3    TETERSSFAVKAGLAQMLKGGVIMDVVNVEQARIAEEAGAVAVMALERVPADIRKDGGVA  62

Query  773  RMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLAIADEDHFINKH  594
            RM DP +IK IK AV+IPVMAK+R+GHFVEAQ+LE VG+DYIDESE+L  ADE + +NKH
Sbjct  63   RMSDPTMIKAIKEAVTIPVMAKARIGHFVEAQVLEAVGIDYIDESEVLTPADEINHLNKH  122

Query  593  NFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKVMGDIRVLNNMD  414
             F+VP +CG RDLGEALRR+ EG++MIRT+G+  G+GN+V+ VR  R VMGDIR L  MD
Sbjct  123  KFKVPVLCGCRDLGEALRRIAEGSSMIRTKGE-AGTGNVVEAVRHCRAVMGDIRRLCAMD  181

Query  413  EDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQLGCDGIFLGPEV  234
            EDEVF ++K+I AP ++V QT+++ RLPVV+FA+GG+ TPADAA+MMQLG DG+F+G  +
Sbjct  182  EDEVFVYAKEIRAPLELVQQTRKLGRLPVVNFAAGGVATPADAALMMQLGMDGVFVGSGI  241

Query  233  FNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLN  111
            F   DP K+  AIVQAV +YNDP ++A+ S GL +AM G++
Sbjct  242  FKSGDPAKRARAIVQAVTHYNDPKIIAEVSQGLGEAMVGID  282



>dbj|BAL98702.1| pyridoxal biosynthesis lyase PdxS [Caldilinea aerophila DSM 14535 
= NBRC 104270]
Length=310

 Score =   339 bits (869),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 168/282 (60%), Positives = 212/282 (75%), Gaps = 7/282 (2%)
 Frame = -1

Query  935  TDAKKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIVSE---PDSR---GIS  774
             D     F++KVG+AQML+GG I++V T +QA+IAE AGAC V+  E    D R   G++
Sbjct  16   NDVITGSFAVKVGLAQMLKGGVIMDVVTAEQARIAEEAGACAVMALERVPADIRRDGGVA  75

Query  773  RMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLAIADEDHFINKH  594
            RM DP  IKEI  AV+IPVMAK R+GHFVEAQIL+ +GVDYIDESE+L  ADE+H INKH
Sbjct  76   RMSDPRKIKEIIEAVTIPVMAKVRIGHFVEAQILQALGVDYIDESEVLTPADEEHHINKH  135

Query  593  NFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKVMGDIRVLNNMD  414
             F  PFVCGARDLGEALRR+ EGAAMIRT+G+  G+GNIV+ VR  R V G IR L +MD
Sbjct  136  KFTTPFVCGARDLGEALRRIAEGAAMIRTKGE-AGTGNIVEAVRHARAVNGAIRRLRSMD  194

Query  413  EDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQLGCDGIFLGPEV  234
            EDE+FA++K+I APY +V  T ++ RLPVV+FA+GG+ TPADAA+MMQLG DG+F+G  +
Sbjct  195  EDELFAYAKEIRAPYSLVKLTAELGRLPVVNFAAGGVATPADAALMMQLGMDGVFVGSGI  254

Query  233  FNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            F   +P K+  AIV AV +YNDP +LA+ S  L + M G+NL
Sbjct  255  FKSGNPEKRARAIVMAVTHYNDPQILAEVSEDLGEPMVGINL  296



>ref|XP_006960514.1| vitamin B6 biosynthesis protein [Wallemia sebi CBS 633.66]
 gb|EIM19482.1| vitamin B6 biosynthesis protein [Wallemia sebi CBS 633.66]
Length=318

 Score =   338 bits (867),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 162/281 (58%), Positives = 214/281 (76%), Gaps = 7/281 (2%)
 Frame = -1

Query  932  DAKKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIVSE---PDSR---GISR  771
            D     FS+K G+AQML+GG I++V   +QA+IAE AGAC V+  E    D R   G+SR
Sbjct  25   DGSIGTFSVKSGLAQMLKGGVIMDVVNAEQARIAEEAGACAVMALERVPADIRQEGGVSR  84

Query  770  MPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLAIADEDHFINKHN  591
            M DP LIKEI  AV+IPVMAK+R+GHFVE+QIL+  GVDYIDESE+L  ADE H INKH 
Sbjct  85   MSDPVLIKEIIDAVTIPVMAKARIGHFVESQILQECGVDYIDESEVLTPADEQHHINKHQ  144

Query  590  FRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKVMGDIRVLNNMDE  411
            F+VPFVCG ++LGEALRR+ EGAAMIRT+G+  G+GN+V+ VR  R++M DIR   +M+E
Sbjct  145  FKVPFVCGCKNLGEALRRISEGAAMIRTKGE-AGTGNVVEAVRHERQLMADIRKAASMEE  203

Query  410  DEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQLGCDGIFLGPEVF  231
            +E++AF+K + APY ++ +T ++ RLPVV+FA+GG+ TPADAA+MMQLGCDG+F+G  +F
Sbjct  204  EELYAFAKDLQAPYHLLKETARLKRLPVVNFAAGGLATPADAAMMMQLGCDGVFVGSGIF  263

Query  230  NCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
               DP K+  AIVQA  +Y +P +LA+ S GL +AM GLN+
Sbjct  264  KSGDPLKRAKAIVQATTHYQNPKILAQVSEGLGEAMVGLNV  304



>emb|CEF96954.1| Ribulose-phosphate binding barrel [Ostreococcus tauri]
Length=296

 Score =   337 bits (864),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 161/281 (57%), Positives = 218/281 (78%), Gaps = 7/281 (2%)
 Frame = -1

Query  935  TDAKKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIVSE---PDSR---GIS  774
            T+A++  F++K G+AQML+GG I++V  V+QA+IAE AGA  V+  E    D R   G++
Sbjct  3    TEAERTTFAVKAGLAQMLKGGVIMDVVNVEQARIAEEAGAVAVMALERVPADIRKDGGVA  62

Query  773  RMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLAIADEDHFINKH  594
            RM DP +I+ IK AV+IPVMAK+R+GHFVEAQ+LE +G+DYIDESE+L  ADE + +NKH
Sbjct  63   RMSDPTMIRAIKEAVTIPVMAKARIGHFVEAQVLEAIGIDYIDESEVLTPADEINHLNKH  122

Query  593  NFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKVMGDIRVLNNMD  414
             F+VP +CG RDLGEALRR+ EG++MIRT+G+  G+GN+V+ VR  R VMGDIR L  MD
Sbjct  123  KFKVPVLCGCRDLGEALRRIAEGSSMIRTKGE-AGTGNVVEAVRHCRAVMGDIRRLCAMD  181

Query  413  EDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQLGCDGIFLGPEV  234
            EDEVF ++K+I AP ++V QT+++ RLPVV+FA+GG+ TPADAA+MMQLG DG+F+G  +
Sbjct  182  EDEVFVYAKEIRAPLELVQQTRKLGRLPVVNFAAGGVATPADAALMMQLGMDGVFVGSGI  241

Query  233  FNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLN  111
            F   DP K+  AIVQAV +YNDP ++A+ S  L DAM G++
Sbjct  242  FKSGDPAKRARAIVQAVTHYNDPKIIAEVSQDLGDAMVGID  282



>gb|EJT98464.1| vitamin B6 biosynthesis protein [Dacryopinax sp. DJM-731 SS1]
Length=291

 Score =   337 bits (863),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 160/275 (58%), Positives = 216/275 (79%), Gaps = 7/275 (3%)
 Frame = -1

Query  914  FSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIVSE---PDSR---GISRMPDPAL  753
            F +K G+AQML+GG I++V T +QA+IAE AGAC V+  E    D R   G++RM DP +
Sbjct  4    FGVKSGLAQMLKGGVIMDVVTAEQARIAEEAGACAVMALERVPADIRAQGGVARMSDPKM  63

Query  752  IKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLAIADEDHFINKHNFRVPFV  573
            IK+I+ AV+IPVMAK R+GHFVEAQIL+ +G+DYIDESE+L  ADE H INKH F+VPFV
Sbjct  64   IKDIQAAVTIPVMAKVRIGHFVEAQILQAIGIDYIDESEVLTPADEQHHINKHAFKVPFV  123

Query  572  CGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKVMGDIRVLNNMDEDEVFAF  393
            CG RDLGEALRR+ EGAAMIRT+G+  G+GN+V+ VR +R+VM DI+  + M E+E++AF
Sbjct  124  CGCRDLGEALRRISEGAAMIRTKGE-AGTGNVVEAVRHMRQVMSDIKRASAMAEEELYAF  182

Query  392  SKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQLGCDGIFLGPEVFNCSDPY  213
            +K++ AP+ ++ +T ++ RLP V+FA+GGI TPADAA+MMQLGCDG+F+G  +F+  DP 
Sbjct  183  AKELGAPFHLLKETARLKRLPCVNFAAGGIATPADAALMMQLGCDGVFVGSGIFHSGDPV  242

Query  212  KKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            K+  AIVQAV +YN+P +LA+ SS L +AM GL +
Sbjct  243  KRARAIVQAVTHYNNPKILAEISSDLGEAMVGLTI  277



>ref|WP_028457652.1| pyridoxal biosynthesis protein [Chloroflexus sp. Y-396-1]
Length=293

 Score =   337 bits (863),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 163/279 (58%), Positives = 213/279 (76%), Gaps = 7/279 (3%)
 Frame = -1

Query  926  KKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIVSE---PDSR---GISRMP  765
            +K  ++ KVG+AQML+GG I++V T +QA+IAE AGA  V+  E    D R   G++RM 
Sbjct  2    EKATWTTKVGLAQMLKGGVIMDVVTPEQARIAEEAGAVAVMALERVPADIRAQGGVARMS  61

Query  764  DPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLAIADEDHFINKHNFR  585
            DP LI  IK AV+IPVMAK+R+GHFVEAQ+LE +GVDYIDESE+L  ADE+H INKH FR
Sbjct  62   DPELILAIKEAVTIPVMAKARIGHFVEAQVLEAIGVDYIDESEVLTPADEEHHINKHKFR  121

Query  584  VPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKVMGDIRVLNNMDEDE  405
            VPFVCG RDLGEALRR+ EGAAM+RT+G+  G+GN+V+ VR  R V  +IR L +M+EDE
Sbjct  122  VPFVCGCRDLGEALRRIAEGAAMLRTKGE-AGTGNVVEAVRHARAVYSEIRRLQSMNEDE  180

Query  404  VFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQLGCDGIFLGPEVFNC  225
            +F ++KKI APY++V Q     +LPVV+FA+GGI TPADAA++MQLG DGIF+G  +F  
Sbjct  181  LFTYAKKIQAPYELVKQVAAEGKLPVVNFAAGGIATPADAALLMQLGVDGIFVGSGIFKS  240

Query  224  SDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
             DP K+  AIV+A  +YNDP ++A+ S GL +AM G+N+
Sbjct  241  GDPVKRARAIVEATTHYNDPKIIAEVSKGLGEAMVGINI  279



>gb|EIE86503.1| pyridoxine biosynthesis protein pyroA [Rhizopus delemar RA 99-880]
Length=310

 Score =   337 bits (863),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 159/281 (57%), Positives = 219/281 (78%), Gaps = 7/281 (2%)
 Frame = -1

Query  932  DAKKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIVSE---PDSR---GISR  771
            D K++ FSIK G+AQML+GG I++V   +QA+IAE AGAC V+  E    D R   G++R
Sbjct  17   DNKEDSFSIKAGLAQMLKGGVIMDVVNAEQARIAEEAGACAVMALERVPADIRKNGGVAR  76

Query  770  MPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLAIADEDHFINKHN  591
            M DP +IKEI  AV+IPVMAK R+GHFVEAQI+E++GVDYIDESE+L  ADE + I KHN
Sbjct  77   MSDPKMIKEIIEAVTIPVMAKVRIGHFVEAQIIESIGVDYIDESEVLTPADESNHITKHN  136

Query  590  FRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKVMGDIRVLNNMDE  411
            F++P+VCGA++LGEALRR+ EGAAMIRT+G+  G+GN+V+ VR +R V  +IR  + M +
Sbjct  137  FKIPYVCGAKNLGEALRRINEGAAMIRTKGE-AGTGNVVEAVRHIRTVNAEIRRASTMTD  195

Query  410  DEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQLGCDGIFLGPEVF  231
            +E++A++K + APY+++ +T ++ RLPVV+FA+GG+ TPADAA+MMQLGCDG+F+G  +F
Sbjct  196  EELYAYAKDLQAPYNLLKETAKLGRLPVVNFAAGGVATPADAALMMQLGCDGVFVGSGIF  255

Query  230  NCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
               +P K+  AIVQAV +YNDP VLA+ S  L +A+ G+NL
Sbjct  256  KSGNPAKRAKAIVQAVTHYNDPKVLAEVSEDLGEAIVGINL  296



>ref|XP_009269562.1| Pyridoxine biosynthesis protein PDX1 [Wallemia ichthyophaga EXF-994]
 gb|EOQ99574.1| Pyridoxine biosynthesis protein PDX1 [Wallemia ichthyophaga EXF-994]
Length=318

 Score =   337 bits (864),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 161/283 (57%), Positives = 217/283 (77%), Gaps = 7/283 (2%)
 Frame = -1

Query  932  DAKKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIVSE---PDSR---GISR  771
            D     FS+K G+AQML+GG I++V   +QA+IAE AGAC V+  E    D R   G++R
Sbjct  25   DTSIGTFSVKSGLAQMLKGGVIMDVVNAEQARIAEEAGACAVMALERVPADIRQEGGVAR  84

Query  770  MPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLAIADEDHFINKHN  591
            M DPALIKEI  AV+IPVMAKSR+GHFVE+QIL+  GVDYIDESE+L  ADE H INKH 
Sbjct  85   MSDPALIKEIIDAVTIPVMAKSRIGHFVESQILQECGVDYIDESEVLTPADEQHHINKHQ  144

Query  590  FRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKVMGDIRVLNNMDE  411
            F+VPFVCG ++LGEALRR+ EGAAMIRT+G+  G+GN+V+ VR  R++M DIR  ++M+E
Sbjct  145  FKVPFVCGCKNLGEALRRISEGAAMIRTKGE-AGTGNVVEAVRHERQLMSDIRKASSMEE  203

Query  410  DEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQLGCDGIFLGPEVF  231
            +E++AF+K++ APY ++ +T ++ +LPVV+FA+GG+ TPADAA++MQLGCDG+F+G  +F
Sbjct  204  EELYAFAKELQAPYHLLKETARLKKLPVVNFAAGGLATPADAAMLMQLGCDGVFVGSGIF  263

Query  230  NCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNLVR  102
               +P  +  AIVQA  +Y +P VLA+ S GL +AM GLN+ R
Sbjct  264  KSGNPLMRAKAIVQATTHYQNPKVLAQVSEGLGEAMVGLNVDR  306



>ref|WP_012258093.1| MULTISPECIES: pyridoxal 5'-phosphate synthase subunit PdxS [Chloroflexus]
 ref|YP_001635828.1| pyridoxal biosynthesis lyase PdxS [Chloroflexus aurantiacus J-10-fl]
 sp|A9WFT9.1|PDXS_CHLAA RecName: Full=Pyridoxal 5'-phosphate synthase subunit PdxS; Short=PLP 
synthase subunit PdxS; AltName: Full=Pdx1 [Chloroflexus 
aurantiacus J-10-fl]
 sp|B9LIK3.1|PDXS_CHLSY RecName: Full=Pyridoxal 5'-phosphate synthase subunit PdxS; Short=PLP 
synthase subunit PdxS; AltName: Full=Pdx1 [Chloroflexus 
sp. Y-400-fl]
 gb|ABY35439.1| pyridoxine biosynthesis protein [Chloroflexus aurantiacus J-10-fl]
 gb|ACM53797.1| pyridoxine biosynthesis protein [Chloroflexus sp. Y-400-fl]
Length=293

 Score =   336 bits (861),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 162/279 (58%), Positives = 215/279 (77%), Gaps = 7/279 (3%)
 Frame = -1

Query  926  KKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIVSE---PDSR---GISRMP  765
            +K+ ++ KVG+AQML+GG I++V T +QA+IAE AGA  V+  E    D R   G++RM 
Sbjct  2    EKSTWTTKVGLAQMLKGGVIMDVVTPEQARIAEEAGAVAVMALERVPADIRAQGGVARMS  61

Query  764  DPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLAIADEDHFINKHNFR  585
            DP LI  IK+AV+IPVMAK+R+GHFVEAQ+LE +GVDYIDESE+L  ADE+H INKH FR
Sbjct  62   DPELILAIKQAVTIPVMAKARIGHFVEAQVLEAIGVDYIDESEVLTPADEEHHINKHKFR  121

Query  584  VPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKVMGDIRVLNNMDEDE  405
            VPFVCG R+LGEALRRV EGAAM+RT+G+  G+GN+V+ VR  R V  +IR L +M+EDE
Sbjct  122  VPFVCGCRNLGEALRRVAEGAAMLRTKGE-AGTGNVVEAVRHARAVYSEIRRLQSMNEDE  180

Query  404  VFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQLGCDGIFLGPEVFNC  225
            +F ++K+I APY++V Q     +LPVV+FA+GGI TPADAA++MQLG DGIF+G  +F  
Sbjct  181  LFTYAKQIQAPYELVKQVATEGKLPVVNFAAGGIATPADAALLMQLGVDGIFVGSGIFKS  240

Query  224  SDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
             DP K+  AIV+A  +YNDP ++A+ S GL +AM G+N+
Sbjct  241  GDPVKRARAIVEATTHYNDPEIIAEVSKGLGEAMVGINI  279



>ref|WP_031457980.1| pyridoxal biosynthesis protein [Chloroflexus sp. MS-G]
Length=293

 Score =   335 bits (859),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 162/279 (58%), Positives = 214/279 (77%), Gaps = 7/279 (3%)
 Frame = -1

Query  926  KKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIVSE---PDSR---GISRMP  765
            +K  ++ KVG+AQML+GG I++V T +QA+IAE AGA  V+  E    D R   G++RM 
Sbjct  2    EKATWTTKVGLAQMLKGGVIMDVVTPEQARIAEEAGAVAVMALERVPADIRAQGGVARMS  61

Query  764  DPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLAIADEDHFINKHNFR  585
            DP LI  IK+AV+IPVMAK+R+GHFVEAQ+LE +GVDYIDESE+L  ADE+H INKH FR
Sbjct  62   DPELILAIKQAVTIPVMAKARIGHFVEAQVLEAIGVDYIDESEVLTPADEEHHINKHKFR  121

Query  584  VPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKVMGDIRVLNNMDEDE  405
            VPFVCG RDLGEALRR+ EGAAM+RT+G+  G+GN+V+ VR  R V  +IR L +M+EDE
Sbjct  122  VPFVCGCRDLGEALRRIAEGAAMLRTKGE-AGTGNVVEAVRHARAVYREIRRLQSMNEDE  180

Query  404  VFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQLGCDGIFLGPEVFNC  225
            +F ++K+I APY++V Q     +LPVV+FA+GGI TPADAA++MQLG DGIF+G  +F  
Sbjct  181  LFTYAKQIQAPYELVKQVAAEGKLPVVNFAAGGIATPADAALLMQLGVDGIFVGSGIFKS  240

Query  224  SDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
             DP K+  AIV+A  +YNDP ++A+ S GL +AM G+N+
Sbjct  241  GDPVKRARAIVEATTHYNDPEIIAEVSKGLGEAMVGINI  279



>ref|XP_007347746.1| vitamin B6 biosynthesis protein [Auricularia delicata TFB-10046 
SS5]
 gb|EJD44063.1| vitamin B6 biosynthesis protein [Auricularia delicata TFB-10046 
SS5]
Length=346

 Score =   335 bits (860),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 161/280 (58%), Positives = 215/280 (77%), Gaps = 7/280 (3%)
 Frame = -1

Query  929  AKKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIVSE---PDSR---GISRM  768
            A  + F +K G+AQML+GG I++V   +QA+IAE AGAC V+  E    D R   G++RM
Sbjct  54   AANSSFGVKSGLAQMLKGGVIMDVINAEQARIAEEAGACAVMALERVPADIRANGGVARM  113

Query  767  PDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLAIADEDHFINKHNF  588
             DP +IKEI  AV+IPVMAK R+GHFVEAQIL+ +GVDYIDESE+L  AD+ H INKHNF
Sbjct  114  SDPKMIKEIIEAVTIPVMAKVRIGHFVEAQILQAIGVDYIDESEVLTPADDQHHINKHNF  173

Query  587  RVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKVMGDIRVLNNMDED  408
            +VPFVCGARDLGEALRR+ EGAA IRT+G+  G+GN+V+ VR  R VM DIR  + M ++
Sbjct  174  KVPFVCGARDLGEALRRIAEGAAFIRTKGE-AGTGNVVEAVRHERAVMADIRRASAMSDE  232

Query  407  EVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQLGCDGIFLGPEVFN  228
            E++AF+K++ AP+ ++ +T ++ RLPVV+FA+GGI TPADAA+MMQLGCDG+F+G  +F 
Sbjct  233  ELYAFAKELQAPFHLLKETARLKRLPVVNFAAGGIATPADAALMMQLGCDGVFVGSGIFK  292

Query  227  CSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
              +P K+  AIVQ+V +YN+P +LA+ S  L +AM GLN+
Sbjct  293  SGNPAKRARAIVQSVTHYNNPKLLAEISEDLGEAMVGLNI  332



>ref|WP_015941652.1| pyridoxal 5'-phosphate synthase subunit PdxS [Chloroflexus aggregans]
 sp|B8G663.1|PDXS_CHLAD RecName: Full=Pyridoxal 5'-phosphate synthase subunit PdxS; Short=PLP 
synthase subunit PdxS; AltName: Full=Pdx1 [Chloroflexus 
aggregans DSM 9485]
 gb|ACL25796.1| pyridoxine biosynthesis protein [Chloroflexus aggregans DSM 9485]
Length=293

 Score =   333 bits (855),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 160/279 (57%), Positives = 215/279 (77%), Gaps = 7/279 (3%)
 Frame = -1

Query  926  KKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIVSE---PDSR---GISRMP  765
            +K+ ++ KVG+AQML+GG I++V T +QA+IAE AGA  V+  E    D R   G++RM 
Sbjct  2    EKSTWTTKVGLAQMLKGGVIMDVVTPEQARIAEEAGAVAVMALERVPADIRAQGGVARMS  61

Query  764  DPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLAIADEDHFINKHNFR  585
            DP LI  IK+AV+IPVMAK+R+GHFVEAQ+LE +GVDYIDESE+L  ADE+H INKH FR
Sbjct  62   DPELILAIKQAVTIPVMAKARIGHFVEAQVLEAIGVDYIDESEVLTPADEEHHINKHKFR  121

Query  584  VPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKVMGDIRVLNNMDEDE  405
            VPFVCG R+LGEALRR+ EGAAM+RT+G+  G+GN+V+ VR  R V  +IR L +M+EDE
Sbjct  122  VPFVCGCRNLGEALRRIAEGAAMLRTKGE-AGTGNVVEAVRHARAVYSEIRRLQSMNEDE  180

Query  404  VFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQLGCDGIFLGPEVFNC  225
            +F ++K+I APY++V Q     +LPVV+FA+GGI TPADAA++MQLG DGIF+G  +F  
Sbjct  181  LFTYAKQIQAPYELVKQVATEGKLPVVNFAAGGIATPADAALLMQLGVDGIFVGSGIFKS  240

Query  224  SDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
             +P K+  AIV+A  +YNDP ++A+ S GL +AM G+N+
Sbjct  241  GNPIKRARAIVEATTHYNDPEIIAEVSKGLGEAMVGINI  279



>emb|CAQ34814.1| vitamin B6 biosynthesis protein [Rhizophagus intraradices]
 gb|ESA01670.1| hypothetical protein GLOINDRAFT_258073 [Rhizophagus irregularis 
DAOM 181602]
 gb|EXX75943.1| Snz3p [Rhizophagus irregularis DAOM 197198w]
Length=317

 Score =   334 bits (857),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 155/275 (56%), Positives = 218/275 (79%), Gaps = 7/275 (3%)
 Frame = -1

Query  914  FSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIVSE---PDSR---GISRMPDPAL  753
            F++K G+AQ L+GG I++V   +QA+IAE AGAC V+  E    D R   G++RM DP +
Sbjct  30   FTVKTGLAQNLKGGVIMDVVNAEQARIAEEAGACAVMALERVPADIRIQGGVARMSDPKM  89

Query  752  IKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLAIADEDHFINKHNFRVPFV  573
            IKEIK AV+IPVMAK R+GHFVEAQILE++G+DYIDESE+L  ADE++ INKHN++VPFV
Sbjct  90   IKEIKEAVTIPVMAKVRIGHFVEAQILESIGIDYIDESEVLTPADEENHINKHNYKVPFV  149

Query  572  CGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKVMGDIRVLNNMDEDEVFAF  393
            CGA++LGEALRR+ EGAAMIRT+G+  G+GN+V+ VR +R +  +IR  + M E+E+F++
Sbjct  150  CGAKNLGEALRRINEGAAMIRTKGE-AGTGNVVEAVRHMRTITREIRKASLMSEEELFSY  208

Query  392  SKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQLGCDGIFLGPEVFNCSDPY  213
            +K++ APY+++ +T ++ RLPVV+F++GG+ TPADAA+MMQLGCDG+F+G  +F   DP 
Sbjct  209  AKELQAPYNLLKETAKLRRLPVVNFSAGGLATPADAAMMMQLGCDGVFVGSGIFKSGDPA  268

Query  212  KKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            K+  AIVQAV +++DP +LA+ S  L DAM G+N+
Sbjct  269  KRAKAIVQAVTHFDDPKILAEVSEDLGDAMVGINI  303



>emb|CEG64406.1| Putative Pyridoxine biosynthesis protein PDX1 [Rhizopus microsporus]
Length=312

 Score =   334 bits (856),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 161/290 (56%), Positives = 221/290 (76%), Gaps = 7/290 (2%)
 Frame = -1

Query  959  TVYSGSAITDAKKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIVSE---PD  789
             ++S     + +++ F+IK G+AQML+GG I++V   +QA+IAE AGAC V+  E    D
Sbjct  10   NLHSDKPNGNEEQDSFAIKAGLAQMLKGGVIMDVINAEQARIAEEAGACAVMALERVPAD  69

Query  788  SR---GISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLAIAD  618
             R   G++RM DP +IKEI  AV+IPVMAK R+GHFVEAQI++ VGVDYIDESE+L  AD
Sbjct  70   IRKNGGVARMSDPKMIKEIIEAVTIPVMAKVRIGHFVEAQIIQAVGVDYIDESEVLTPAD  129

Query  617  EDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKVMGD  438
            E + INKHNF+VP+VCGA++LGEALRR+ EGAAMIRT+G+  G+GN+V+ VR +R V  +
Sbjct  130  EANHINKHNFKVPYVCGAKNLGEALRRINEGAAMIRTKGE-AGTGNVVEAVRHIRTVNAE  188

Query  437  IRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQLGCD  258
            IR   +M ++E++A++K + APY ++ +T ++ RLPVV+FA+GG+ TPADAA+MMQLGCD
Sbjct  189  IRRAASMTDEELYAYAKDLQAPYSLLKETARLGRLPVVNFAAGGVATPADAALMMQLGCD  248

Query  257  GIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            G+F+G  +F   DP K+  AIVQAV +YNDP VLA+ S  L +AM G+NL
Sbjct  249  GVFVGSGIFKSGDPAKRAKAIVQAVTHYNDPKVLAEISEDLGEAMVGINL  298



>ref|XP_007863584.1| vitamin B6 biosynthesis protein [Gloeophyllum trabeum ATCC 11539]
 gb|EPQ58396.1| vitamin B6 biosynthesis protein [Gloeophyllum trabeum ATCC 11539]
Length=333

 Score =   334 bits (857),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 164/275 (60%), Positives = 213/275 (77%), Gaps = 7/275 (3%)
 Frame = -1

Query  914  FSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIVSE---PDSR---GISRMPDPAL  753
            F +K G+AQML+GG I++V + +QA+IAE AGAC V+  E    D R   G++RM DPAL
Sbjct  46   FGVKSGLAQMLKGGVIMDVVSPEQARIAEEAGACAVMALERVPADIRAEGGVARMSDPAL  105

Query  752  IKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLAIADEDHFINKHNFRVPFV  573
            IK+I  AV+IPVMAK R+GHFVEAQIL+ VGVDYIDESE+L  ADE+H INKH F+VPFV
Sbjct  106  IKQIIDAVTIPVMAKVRIGHFVEAQILQAVGVDYIDESEVLTPADEEHHINKHAFKVPFV  165

Query  572  CGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKVMGDIRVLNNMDEDEVFAF  393
            CGAR+LGEALRR+ EGAA IRT+G+  G+GN+V+ VR  R V   IR  + M+E+E++ F
Sbjct  166  CGARNLGEALRRISEGAAFIRTKGE-AGTGNVVEAVRHTRAVQTAIRQSSVMNEEELYVF  224

Query  392  SKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQLGCDGIFLGPEVFNCSDPY  213
            +K+I APY ++ +T ++ RLPVV+FA+GGI TPADAA+MMQLGCDG+F+G  +F   DP 
Sbjct  225  AKEIGAPYHLLKETSRLKRLPVVNFAAGGIATPADAALMMQLGCDGVFVGSGIFKSGDPA  284

Query  212  KKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            K+  AIVQAV +YN+P VLA+ S  L +AM GLN+
Sbjct  285  KRAKAIVQAVTHYNNPKVLAEISGDLGEAMVGLNI  319



>gb|KIJ60651.1| hypothetical protein HYDPIDRAFT_177350 [Hydnomerulius pinastri 
MD-312]
Length=335

 Score =   334 bits (857),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 161/275 (59%), Positives = 213/275 (77%), Gaps = 7/275 (3%)
 Frame = -1

Query  914  FSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIVSE---PDSR---GISRMPDPAL  753
            F +K G+AQML+GG I++V   DQA+IAE AGAC V+  E    D R   G+SRM DPA+
Sbjct  48   FGVKSGLAQMLKGGVIMDVVNADQARIAEEAGACAVMALERVPADIRAEGGVSRMSDPAM  107

Query  752  IKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLAIADEDHFINKHNFRVPFV  573
            IK I  AV+IPVMAK R+GHFVEAQIL+ +G+DYIDESE+L  ADE+H INKHNF+VPFV
Sbjct  108  IKSIVDAVTIPVMAKVRIGHFVEAQILQAIGIDYIDESEVLTPADEEHHINKHNFKVPFV  167

Query  572  CGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKVMGDIRVLNNMDEDEVFAF  393
            CGAR+LGEALRR+ EGAA IRT+G+  G+GN+V+ VR  R VM +IR  + M+E+E++A+
Sbjct  168  CGARNLGEALRRISEGAAFIRTKGE-AGTGNVVEAVRHQRSVMSEIRKASVMNEEELYAY  226

Query  392  SKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQLGCDGIFLGPEVFNCSDPY  213
            +K+I AP+ ++ +T ++ RLPVV+FA+GG+ TPADAA+MMQLGCDG+F+G  +F+  DP 
Sbjct  227  AKEIQAPFHLLKETARLKRLPVVNFAAGGLATPADAALMMQLGCDGVFVGSGIFHSGDPA  286

Query  212  KKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            K+  AIVQAV +YN+P VLA+ S  L   M GL +
Sbjct  287  KRARAIVQAVTHYNNPKVLAEISEDLGAPMVGLTI  321



>emb|CEI99339.1| Putative Pyridoxine biosynthesis protein PDX1 [Rhizopus microsporus]
Length=312

 Score =   333 bits (855),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 160/290 (55%), Positives = 221/290 (76%), Gaps = 7/290 (2%)
 Frame = -1

Query  959  TVYSGSAITDAKKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIVSE---PD  789
             ++S     + +++ F+IK G+AQML+GG I++V   +QA+IAE AGAC V+  E    D
Sbjct  10   NLHSDKPNGNEEQDSFAIKAGLAQMLKGGVIMDVINAEQARIAEEAGACAVMALERVPAD  69

Query  788  SR---GISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLAIAD  618
             R   G++RM DP +IKEI  AV+IPVMAK R+GHFVEAQI++ +GVDYIDESE+L  AD
Sbjct  70   IRKNGGVARMSDPKMIKEIIEAVTIPVMAKVRIGHFVEAQIIQAIGVDYIDESEVLTPAD  129

Query  617  EDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKVMGD  438
            E + INKHNF+VP+VCGA++LGEALRR+ EGAAMIRT+G+  G+GN+V+ VR +R V  +
Sbjct  130  EANHINKHNFKVPYVCGAKNLGEALRRINEGAAMIRTKGE-AGTGNVVEAVRHIRTVNAE  188

Query  437  IRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQLGCD  258
            IR   +M ++E++A++K + APY ++ +T ++ RLPVV+FA+GG+ TPADAA+MMQLGCD
Sbjct  189  IRRAASMTDEELYAYAKDLQAPYSLLKETARLGRLPVVNFAAGGVATPADAALMMQLGCD  248

Query  257  GIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            G+F+G  +F   DP K+  AIVQAV +YNDP VLA+ S  L +AM G+NL
Sbjct  249  GVFVGSGIFKSGDPAKRAKAIVQAVTHYNDPKVLAEISEDLGEAMVGINL  298



>dbj|GAN05769.1| vitamin B6 biosynthesis protein [Mucor ambiguus]
Length=313

 Score =   333 bits (855),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 158/275 (57%), Positives = 215/275 (78%), Gaps = 7/275 (3%)
 Frame = -1

Query  914  FSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIVSE---PDSR---GISRMPDPAL  753
            +SIK G+AQML+GG I++V   +QA+IAE AGAC V+  E    D R   G++RM DP +
Sbjct  26   YSIKAGLAQMLKGGVIMDVINAEQARIAEEAGACAVMALERVPADIRKNGGVARMSDPQM  85

Query  752  IKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLAIADEDHFINKHNFRVPFV  573
            IKEI  AV+IPVMAK R+GHFVEAQI+E++GVDYIDESE+L  ADE + INKHNF++P+V
Sbjct  86   IKEIIEAVTIPVMAKVRIGHFVEAQIIESIGVDYIDESEVLTPADESNHINKHNFKIPYV  145

Query  572  CGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKVMGDIRVLNNMDEDEVFAF  393
            CGA++LGEALRR+ EGAAMIRT+G+  G+GN+V+ VR +R V  +IR  + M ++E++A+
Sbjct  146  CGAKNLGEALRRINEGAAMIRTKGE-AGTGNVVEAVRHIRTVTTEIRRASVMSDEELYAY  204

Query  392  SKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQLGCDGIFLGPEVFNCSDPY  213
            +K I APY+++ +T ++ RLPVV+FA+GG+ TPADAA+MMQLGCDG+F+G  +F   DP 
Sbjct  205  AKDIQAPYNLLKETAKLGRLPVVNFAAGGVATPADAALMMQLGCDGVFVGSGIFKSGDPA  264

Query  212  KKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            K+  AIVQAV ++ND  VLA+ S  L +AM G+NL
Sbjct  265  KRAKAIVQAVTHFNDAKVLAEVSENLGEAMVGINL  299



>gb|KIK63634.1| hypothetical protein GYMLUDRAFT_40702 [Gymnopus luxurians FD-317 
M1]
Length=328

 Score =   333 bits (854),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 162/275 (59%), Positives = 212/275 (77%), Gaps = 7/275 (3%)
 Frame = -1

Query  914  FSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIVSE---PDSR---GISRMPDPAL  753
            F +K G+AQML+GG I++V T +QA+IAE AGAC V+  E    D R   G++RM DP +
Sbjct  41   FGVKSGLAQMLKGGVIMDVVTPEQARIAEEAGACAVMALERVPADIRAQGGVARMSDPKM  100

Query  752  IKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLAIADEDHFINKHNFRVPFV  573
            IKEI  AV+IPVMAK R+GHFVEAQIL+ +GVDYIDESE+L  ADE+H INKHNF+VPFV
Sbjct  101  IKEIVDAVTIPVMAKCRIGHFVEAQILQAIGVDYIDESEVLTPADEEHHINKHNFKVPFV  160

Query  572  CGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKVMGDIRVLNNMDEDEVFAF  393
            CGAR+LGEALRR+ EGAA IRT+G+  G+GN+V+ VR  R V  +IR  + M E+E++A+
Sbjct  161  CGARNLGEALRRISEGAAFIRTKGE-AGTGNVVEAVRHERAVNSEIRKASAMSEEELYAY  219

Query  392  SKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQLGCDGIFLGPEVFNCSDPY  213
            +K+I AP+ ++ +T ++ RLPVV+FA+GGI TPADAA+MMQLGCDG+F+G  +F   D  
Sbjct  220  AKEIQAPFHLLKETARLKRLPVVNFAAGGIATPADAALMMQLGCDGVFVGSGIFKSGDAA  279

Query  212  KKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            K+  AIVQAV +YN+P VLA+ S  L DAM GL +
Sbjct  280  KRARAIVQAVTHYNNPKVLAEVSENLGDAMVGLTI  314



>ref|XP_007326724.1| hypothetical protein AGABI1DRAFT_111385 [Agaricus bisporus var. 
burnettii JB137-S8]
 gb|EKM82817.1| hypothetical protein AGABI1DRAFT_111385 [Agaricus bisporus var. 
burnettii JB137-S8]
Length=332

 Score =   333 bits (854),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 159/275 (58%), Positives = 212/275 (77%), Gaps = 7/275 (3%)
 Frame = -1

Query  914  FSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIVSE---PDSR---GISRMPDPAL  753
            F +K G+AQML+GG I++V   +QA+IAE AGAC V+  E    D R   G++RM DP +
Sbjct  45   FGVKSGLAQMLKGGVIMDVVNAEQARIAEEAGACAVMALERVPADIRKEGGVARMSDPQM  104

Query  752  IKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLAIADEDHFINKHNFRVPFV  573
            IKEI  AV+IPVMAK R+GHFVEAQIL+ +GVDYIDESE+L  ADE+H INKHNF+VPFV
Sbjct  105  IKEIVNAVTIPVMAKVRIGHFVEAQILQVIGVDYIDESEVLTPADEEHHINKHNFKVPFV  164

Query  572  CGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKVMGDIRVLNNMDEDEVFAF  393
            CGAR+LGEALRR+ EGAAMIRT+G+  G+GN+V+ VR  R VM +IR  ++M+E+E++ F
Sbjct  165  CGARNLGEALRRISEGAAMIRTKGE-AGTGNVVEAVRHERTVMAEIRRASSMNEEELYTF  223

Query  392  SKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQLGCDGIFLGPEVFNCSDPY  213
            +K I AP+ ++ +T ++  LPVV+FA+GGI TPADAA+MM LGCDG+F+G  +F+  DP 
Sbjct  224  AKDIQAPFHLLKETARLKHLPVVNFAAGGITTPADAALMMHLGCDGVFVGSGIFHSGDPA  283

Query  212  KKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            K+  AIVQAV +YN+P +LA+ S  L  AM G+ +
Sbjct  284  KRARAIVQAVTHYNNPKILAEVSENLGAAMVGVTI  318



>ref|XP_007263905.1| vitamin B6 biosynthesis protein [Fomitiporia mediterranea MF3/22]
 gb|EJD05759.1| vitamin B6 biosynthesis protein [Fomitiporia mediterranea MF3/22]
Length=334

 Score =   333 bits (853),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 160/275 (58%), Positives = 211/275 (77%), Gaps = 7/275 (3%)
 Frame = -1

Query  914  FSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIVSE---PDSR---GISRMPDPAL  753
            F +K G+AQML+GG I++VT  +QA+IAE AGAC V+  E    D R   G++RM DP +
Sbjct  47   FGVKSGLAQMLKGGVIMDVTNAEQARIAEEAGACAVMALERVPADIRKEGGVARMSDPKM  106

Query  752  IKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLAIADEDHFINKHNFRVPFV  573
            IKEI  AV+IPVMAK R+GHFVEAQI++ VG DYIDESE+L  ADE H INKH F+VPFV
Sbjct  107  IKEIIDAVTIPVMAKVRIGHFVEAQIIQAVGADYIDESEVLTPADEQHHINKHTFKVPFV  166

Query  572  CGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKVMGDIRVLNNMDEDEVFAF  393
            CGA++LGEALRR+ EGAA IRT+G+  G+GN+V+ VR  R VM DIR  + M+++E++AF
Sbjct  167  CGAKNLGEALRRISEGAAFIRTKGE-AGTGNVVEAVRHQRAVMADIRRASAMNDEELYAF  225

Query  392  SKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQLGCDGIFLGPEVFNCSDPY  213
            +K++ AP+ ++ +  ++ RLPVV FA+GGI TPADAA+MMQLGCDG+F+G  +FN  DP 
Sbjct  226  AKELTAPFHLLKEVARLKRLPVVSFAAGGIATPADAALMMQLGCDGVFVGSGIFNSGDPA  285

Query  212  KKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            K+  AIVQAV +YN+P VLA+ S  L +AM GL +
Sbjct  286  KRARAIVQAVTHYNNPKVLAEVSEDLGEAMVGLTI  320



>ref|XP_006458263.1| hypothetical protein AGABI2DRAFT_190607 [Agaricus bisporus var. 
bisporus H97]
 gb|EKV50217.1| hypothetical protein AGABI2DRAFT_190607 [Agaricus bisporus var. 
bisporus H97]
Length=332

 Score =   333 bits (853),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 159/275 (58%), Positives = 212/275 (77%), Gaps = 7/275 (3%)
 Frame = -1

Query  914  FSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIVSE---PDSR---GISRMPDPAL  753
            F +K G+AQML+GG I++V   +QA+IAE AGAC V+  E    D R   G++RM DP +
Sbjct  45   FGVKSGLAQMLKGGVIMDVVNAEQARIAEEAGACAVMALERVPADIRKEGGVARMSDPQM  104

Query  752  IKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLAIADEDHFINKHNFRVPFV  573
            IKEI  AV+IPVMAK R+GHFVEAQIL+ +GVDYIDESE+L  ADE+H INKHNF+VPFV
Sbjct  105  IKEIVNAVTIPVMAKVRIGHFVEAQILQVIGVDYIDESEVLTPADEEHHINKHNFKVPFV  164

Query  572  CGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKVMGDIRVLNNMDEDEVFAF  393
            CGAR+LGEALRR+ EGAAMIRT+G+  G+GN+V+ VR  R VM +IR  ++M+E+E++ F
Sbjct  165  CGARNLGEALRRISEGAAMIRTKGE-AGTGNVVEAVRHERTVMAEIRRASSMNEEELYTF  223

Query  392  SKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQLGCDGIFLGPEVFNCSDPY  213
            +K I AP+ ++ +T ++  LPVV+FA+GGI TPADAA+MM LGCDG+F+G  +F+  DP 
Sbjct  224  AKDIQAPFHLLKETARLKHLPVVNFAAGGIATPADAALMMHLGCDGVFVGSGIFHSGDPA  283

Query  212  KKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            K+  AIVQAV +YN+P +LA+ S  L  AM G+ +
Sbjct  284  KRARAIVQAVTHYNNPKILAEVSENLGAAMVGVTI  318



>ref|XP_003026559.1| hypothetical protein SCHCODRAFT_71165 [Schizophyllum commune 
H4-8]
 gb|EFI91656.1| hypothetical protein SCHCODRAFT_71165 [Schizophyllum commune 
H4-8]
Length=333

 Score =   333 bits (853),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 163/275 (59%), Positives = 210/275 (76%), Gaps = 7/275 (3%)
 Frame = -1

Query  914  FSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIVSE---PDSR---GISRMPDPAL  753
            F +K G+AQML+GG I++V   +QA+IAE AGAC V+  E    D R   G++RM DP +
Sbjct  46   FGVKSGLAQMLKGGVIMDVVNAEQARIAEEAGACAVMALERVPADIRAEGGVARMSDPQM  105

Query  752  IKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLAIADEDHFINKHNFRVPFV  573
            IK I  AV+IPVMAK R+GHFVEAQIL+ VGVDYIDESE+L  ADE+H INKHNF+VPFV
Sbjct  106  IKSIIDAVTIPVMAKVRIGHFVEAQILQAVGVDYIDESEVLTPADEEHHINKHNFKVPFV  165

Query  572  CGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKVMGDIRVLNNMDEDEVFAF  393
            CG R+LGEALRR+ EGAA IRT+G+  G+GN+V+ VR  R VM DIR  + M EDE++AF
Sbjct  166  CGCRNLGEALRRISEGAAFIRTKGE-AGTGNVVEAVRHERAVMSDIRRASAMSEDELYAF  224

Query  392  SKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQLGCDGIFLGPEVFNCSDPY  213
            +K+I AP+ ++ +T ++ RLPVV+FA+GGI TPADAA+MMQLGCDG+F+G  +F+  DP 
Sbjct  225  AKEIGAPFHLLKETARLKRLPVVNFAAGGIATPADAALMMQLGCDGVFVGSGIFHSGDPA  284

Query  212  KKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            K+  AIVQAV +YN+P  LA+ S  L  AM GL +
Sbjct  285  KRARAIVQAVTHYNNPKKLAEVSQDLGPAMVGLTI  319



>emb|CDH56625.1| vitamin b6 biosynthesis protein [Lichtheimia corymbifera JMRC:FSU:9682]
Length=311

 Score =   331 bits (849),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 159/291 (55%), Positives = 220/291 (76%), Gaps = 7/291 (2%)
 Frame = -1

Query  962  VTVYSGSAITDAKKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIVSE---P  792
            V +++   + + + + FSI  G+AQML+GG I++V   DQA+IAE AGAC V+  E    
Sbjct  8    VNLHNDKTVQNGETSQFSINAGLAQMLKGGVIMDVIDADQARIAEEAGACAVMALERVPA  67

Query  791  DSR---GISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLAIA  621
            D R   G++RM DP +IK I+ AV+IPVMAK R+GHFVEAQI+E++G+DYIDESE+L  A
Sbjct  68   DIRKNGGVARMSDPKMIKGIQEAVTIPVMAKVRIGHFVEAQIIESIGIDYIDESEVLTPA  127

Query  620  DEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKVMG  441
            DE + INK NF+VPFVCGA++LGEALRR+ EGA+MIRT+G+  G+GN+V+ VR +R V  
Sbjct  128  DEANHINKKNFKVPFVCGAKNLGEALRRINEGASMIRTKGE-AGTGNVVEAVRHMRTVNA  186

Query  440  DIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQLGC  261
            +IR    M ++E++A++K I APYD++ +T ++ RLPVV+FA+GG+ TPADAA+MMQLGC
Sbjct  187  EIRRAAAMTDEELYAYAKDIQAPYDLLKETARLGRLPVVNFAAGGVATPADAALMMQLGC  246

Query  260  DGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            DG+F+G  +F   DP K+  AIVQAV ++ DP VLA+ S  L +AM G+NL
Sbjct  247  DGVFVGSGIFKSGDPAKRAKAIVQAVTHFKDPKVLAEVSEDLGEAMVGINL  297



>emb|CDS08813.1| Putative Pyridoxine biosynthesis protein PDX1 [Absidia idahoensis 
var. thermophila]
Length=311

 Score =   331 bits (849),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 159/291 (55%), Positives = 222/291 (76%), Gaps = 7/291 (2%)
 Frame = -1

Query  962  VTVYSGSAITDAKKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIVSE---P  792
            V +++  +  + + + FSI  G+AQML+GG I++V   DQA+IAE AGAC V+  E    
Sbjct  8    VNLHNDKSAQNGETSQFSINAGLAQMLKGGVIMDVIDADQARIAEEAGACAVMALERVPA  67

Query  791  DSR---GISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLAIA  621
            D R   G++RM DP +IK I+ AV+IPVMAK R+GHFVEAQI++++GVDYIDESE+L  A
Sbjct  68   DIRKNGGVARMSDPKMIKGIQEAVTIPVMAKVRIGHFVEAQIIQSIGVDYIDESEVLTPA  127

Query  620  DEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKVMG  441
            DE + INK +F+VPFVCGA++LGEALRR+ EGA+MIRT+G+  G+GN+V+ VR +R V  
Sbjct  128  DEANHINKKSFKVPFVCGAKNLGEALRRINEGASMIRTKGE-AGTGNVVEAVRHMRTVNA  186

Query  440  DIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQLGC  261
            +IR   +M ++E++A++K I APYD++ +T ++ RLPVV+FA+GG+ TPADAA+MMQLGC
Sbjct  187  EIRRAASMTDEELYAYAKDIQAPYDLLKETARLGRLPVVNFAAGGVATPADAALMMQLGC  246

Query  260  DGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            DG+F+G  +F   DP K+  AIVQAV ++NDP VLA+ S  L +AM G+NL
Sbjct  247  DGVFVGSGIFKSGDPAKRAKAIVQAVTHFNDPKVLAEVSEDLGEAMVGINL  297



>emb|CCO08517.1| Pyridoxal biosynthesis lyase pdxS [Desulfotomaculum hydrothermale 
Lam5 = DSM 18033]
Length=294

 Score =   330 bits (847),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 163/280 (58%), Positives = 216/280 (77%), Gaps = 7/280 (3%)
 Frame = -1

Query  929  AKKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIVSE---PDSR---GISRM  768
            A+K  +++K G+A+ML+GG I++VTT +QAKIAE AGAC V+  E    D R   G++RM
Sbjct  2    AEKGTWTVKKGLAEMLKGGVIMDVTTPEQAKIAEEAGACAVMALERVPADIRAAGGVARM  61

Query  767  PDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLAIADEDHFINKHNF  588
             DP +I  I  AV+IPVMAK+R+GHFVEAQILE +GVDYIDESE+L  ADE   INKH+F
Sbjct  62   ADPNVILRIMDAVTIPVMAKARIGHFVEAQILEALGVDYIDESEVLTPADEVFHINKHDF  121

Query  587  RVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKVMGDIRVLNNMDED  408
            +VPFVCGAR+LGEALRR+ EGAAMIRT+G+  G+GN+V+ VR +R+VM +IR++ +M +D
Sbjct  122  KVPFVCGARNLGEALRRIGEGAAMIRTKGE-PGTGNVVEAVRHMRQVMSEIRMVQHMPKD  180

Query  407  EVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQLGCDGIFLGPEVFN  228
            E+   +K++ APYD+VVQ  ++ RLPVV+FA+GGI TPADAA+MMQLGCDGIF+G  +F 
Sbjct  181  ELMTAAKEMGAPYDLVVQVHELGRLPVVNFAAGGIATPADAALMMQLGCDGIFVGSGIFK  240

Query  227  CSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
              DP  +  AIV A  +YNDP VLA+ S  L +AM G+ +
Sbjct  241  SKDPVARAKAIVAATTHYNDPQVLAEISKDLGEAMPGIEI  280



>gb|EPB86979.1| pyridoxine biosynthesis protein PDX1 [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=313

 Score =   331 bits (848),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 157/275 (57%), Positives = 215/275 (78%), Gaps = 7/275 (3%)
 Frame = -1

Query  914  FSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIVSE---PDSR---GISRMPDPAL  753
            +SIK G+AQML+GG I++V   +QA+IAE AGAC V+  E    D R   G++RM DP +
Sbjct  26   YSIKAGLAQMLKGGVIMDVINAEQARIAEEAGACAVMALERVPADIRKNGGVARMSDPQM  85

Query  752  IKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLAIADEDHFINKHNFRVPFV  573
            IKEI  AV+IPVMAK R+GHFVEAQI+E++GVDYIDESE+L  ADE + INKHNF++P+V
Sbjct  86   IKEIIEAVTIPVMAKVRIGHFVEAQIIESIGVDYIDESEVLTPADEANHINKHNFKIPYV  145

Query  572  CGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKVMGDIRVLNNMDEDEVFAF  393
            CGA++LGEALRR+ EGAAMIRT+G+  G+GN+V+ VR +R V  +IR  + M ++E++A+
Sbjct  146  CGAKNLGEALRRINEGAAMIRTKGE-AGTGNVVEAVRHMRTVTSEIRRASVMSDEELYAY  204

Query  392  SKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQLGCDGIFLGPEVFNCSDPY  213
            +K I AP++++ +T ++ RLPVV+FA+GG+ TPADAA+MMQLGCDG+F+G  +F   DP 
Sbjct  205  AKDIQAPFNLLKETAKLGRLPVVNFAAGGVATPADAALMMQLGCDGVFVGSGIFKSGDPA  264

Query  212  KKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            K+  AIVQAV ++ND  VLA+ S  L +AM G+NL
Sbjct  265  KRAKAIVQAVTHFNDAKVLAEVSENLGEAMVGINL  299



>ref|XP_001878289.1| predicted protein [Laccaria bicolor S238N-H82]
 gb|EDR10988.1| predicted protein [Laccaria bicolor S238N-H82]
Length=331

 Score =   331 bits (849),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 160/275 (58%), Positives = 212/275 (77%), Gaps = 7/275 (3%)
 Frame = -1

Query  914  FSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIVSE---PDSR---GISRMPDPAL  753
            F +K G+AQML+GG I++V   +QA+IAE AGAC V+  E    D R   G++RM DP +
Sbjct  44   FGVKSGLAQMLKGGVIMDVVNAEQARIAEEAGACAVMALERVPADIRAEGGVARMSDPQM  103

Query  752  IKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLAIADEDHFINKHNFRVPFV  573
            IKEI  AV+IPVMAK R+GHFVEAQIL+ +GVDYIDESE+L  AD++H INKH F+VPFV
Sbjct  104  IKEIVDAVTIPVMAKVRIGHFVEAQILQVIGVDYIDESEVLTPADDEHHINKHGFKVPFV  163

Query  572  CGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKVMGDIRVLNNMDEDEVFAF  393
            CGARDLGEALRR+ EGAAMIRT+G+  G+GN+V+ VR  R VM  IR  + M+E+E++ F
Sbjct  164  CGARDLGEALRRISEGAAMIRTKGE-AGTGNVVEAVRHQRAVMSQIRRASVMNEEELYVF  222

Query  392  SKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQLGCDGIFLGPEVFNCSDPY  213
            +K+I AP+ ++ +T ++ RLPVV+FA+GG+ TPADAA+MMQLGCDG+F+G  +F+  DP 
Sbjct  223  AKEIQAPFHLLKETARLKRLPVVNFAAGGLATPADAALMMQLGCDGVFVGSGIFHSGDPA  282

Query  212  KKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            K+  AIVQAV +YN+P +LA+ S  L  AM GL +
Sbjct  283  KRARAIVQAVTHYNNPKILAEVSENLGAAMVGLTI  317



>ref|XP_001833418.1| vitamin B6 biosynthesis protein [Coprinopsis cinerea okayama7#130]
 gb|EAU88352.1| vitamin B6 biosynthesis protein [Coprinopsis cinerea okayama7#130]
Length=331

 Score =   331 bits (849),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 160/275 (58%), Positives = 212/275 (77%), Gaps = 7/275 (3%)
 Frame = -1

Query  914  FSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIVSE---PDSR---GISRMPDPAL  753
            F +K G+AQML+GG I++V   +QA+IAE AGAC V+  E    D R   G++RM DP +
Sbjct  44   FGVKSGLAQMLKGGVIMDVVNAEQARIAEEAGACAVMALERVPADIRKEGGVARMSDPKM  103

Query  752  IKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLAIADEDHFINKHNFRVPFV  573
            IKEI  AV+IPVMAK R+GHFVEAQIL+ +GVDYIDESE+L  ADE+H INKHNF+VPFV
Sbjct  104  IKEIVDAVTIPVMAKVRIGHFVEAQILQAIGVDYIDESEVLTPADEEHHINKHNFKVPFV  163

Query  572  CGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKVMGDIRVLNNMDEDEVFAF  393
            CG R+LGEALRR+ EGAA IRT+G+  G+GNIV+ VR  R VM DI+  + M ++E++ F
Sbjct  164  CGCRNLGEALRRISEGAAFIRTKGE-AGTGNIVEAVRHERAVMSDIKKASVMSDEELYVF  222

Query  392  SKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQLGCDGIFLGPEVFNCSDPY  213
            +K+I AP+ ++ +T ++ RLPVV+FA+GGI TPADAA+MMQLGCDG+F+G  +F+  DP 
Sbjct  223  AKEIQAPFHLLKETARLKRLPVVNFAAGGIATPADAALMMQLGCDGVFVGSGIFHSGDPA  282

Query  212  KKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            K+  AIVQAV +YN+P +LA+ S  L +AM GL +
Sbjct  283  KRARAIVQAVTHYNNPKILAEVSEDLGEAMVGLTI  317



>gb|KDQ60650.1| hypothetical protein JAAARDRAFT_31620 [Jaapia argillacea MUCL 
33604]
Length=334

 Score =   331 bits (849),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 162/275 (59%), Positives = 210/275 (76%), Gaps = 7/275 (3%)
 Frame = -1

Query  914  FSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIVSE---PDSR---GISRMPDPAL  753
            F +K G+AQML+GG I++V   +QA+IAE AGAC V+  E    D R   G++RM DPA+
Sbjct  47   FGVKSGLAQMLKGGVIMDVINAEQARIAEEAGACAVMALERVPADIRADGGVARMSDPAM  106

Query  752  IKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLAIADEDHFINKHNFRVPFV  573
            IK+I  AV+IPVMAK R+GHFVEAQIL+ VGVDYIDESE+L  ADE H INKH F+VPFV
Sbjct  107  IKKIVHAVTIPVMAKVRIGHFVEAQILQAVGVDYIDESEVLTPADEQHHINKHAFKVPFV  166

Query  572  CGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKVMGDIRVLNNMDEDEVFAF  393
            CG R+LGEALRR+ EGAA IRT+G+  G+GN+V+ VR  R VM DIR  + M+E+E++AF
Sbjct  167  CGCRNLGEALRRISEGAAFIRTKGE-AGTGNVVEAVRHERAVMSDIRKASAMNEEELYAF  225

Query  392  SKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQLGCDGIFLGPEVFNCSDPY  213
            +K I AP+ ++ +T ++ RLPVV+FA+GGI TPADAA+MMQLGCDG+F+G  +F   DP 
Sbjct  226  AKDIGAPFHLLKETARLKRLPVVNFAAGGIATPADAALMMQLGCDGVFVGSGIFKSGDPA  285

Query  212  KKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            K+  AIVQAV +YN+P +LA  S  L +AM GL +
Sbjct  286  KRARAIVQAVTHYNNPKILADISCDLGEAMVGLTI  320



>ref|WP_027364356.1| pyridoxal biosynthesis protein [Desulfotomaculum alcoholivorax]
Length=294

 Score =   329 bits (844),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 159/280 (57%), Positives = 213/280 (76%), Gaps = 7/280 (3%)
 Frame = -1

Query  929  AKKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIVSE---PDSR---GISRM  768
            A+K  +++K G+A+ML+GG I++VTT +QAKIAE AGAC V+  E    D R   G++RM
Sbjct  2    AEKGTWTVKKGLAEMLKGGVIMDVTTPEQAKIAEEAGACAVMALERVPADIRAAGGVARM  61

Query  767  PDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLAIADEDHFINKHNF  588
             DP +I  I  AV+IPVMAK+R+GHFVEAQILE +GVDYIDESE+L  ADE H INKH F
Sbjct  62   ADPTVILRIMEAVTIPVMAKARIGHFVEAQILEALGVDYIDESEVLTPADEQHHINKHEF  121

Query  587  RVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKVMGDIRVLNNMDED  408
            +VPFVCGAR+LGEALRR+ EGAAMIRT+G+  G+GN+V+ VR +R VMG+IR + NM ++
Sbjct  122  KVPFVCGARNLGEALRRIAEGAAMIRTKGE-PGTGNVVEAVRHMRMVMGEIRRIQNMPKE  180

Query  407  EVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQLGCDGIFLGPEVFN  228
            E+ + +K++ APY ++++  +  +LPVV+FA+GGI TPADAA+MMQLGCDGIF+G  +F 
Sbjct  181  ELMSVAKELGAPYHLLLEVAETGKLPVVNFAAGGIATPADAALMMQLGCDGIFVGSGIFK  240

Query  227  CSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
              DP  +  AIV A  +Y DP +LA+ S  L +AM GL +
Sbjct  241  SKDPQARAKAIVAATTHYQDPQILAEISRNLGEAMPGLEI  280



>ref|XP_005767287.1| pyridoxine biosynthesis protein [Emiliania huxleyi CCMP1516]
 gb|EOD14858.1| pyridoxine biosynthesis protein [Emiliania huxleyi CCMP1516]
Length=312

 Score =   330 bits (846),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 159/279 (57%), Positives = 212/279 (76%), Gaps = 7/279 (3%)
 Frame = -1

Query  929  AKKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIVSE---PDSR---GISRM  768
            A    F++K G+AQML+GG I++V  V+QA+IAE AGAC V+  E    D R   G++RM
Sbjct  3    ASTGTFAVKAGMAQMLKGGVIMDVVNVEQARIAEEAGACAVMALERVPADIRKDGGVARM  62

Query  767  PDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLAIADEDHFINKHNF  588
             DP +IKEIK AV+IPVMAKSR+GHFVE QIL+ +G DYIDESE+L +ADED+  NKH F
Sbjct  63   SDPKMIKEIKAAVTIPVMAKSRIGHFVECQILQEIGADYIDESEVLTMADEDNHTNKHKF  122

Query  587  RVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKVMGDIRVLNNMDED  408
             VPFVCG R+LGEALRRV EGAAMIRT+G+  G+GN+V+ VR  R ++ +I+ + +MDED
Sbjct  123  TVPFVCGCRNLGEALRRVAEGAAMIRTKGE-AGTGNVVEAVRHARTLLREIKKVQSMDED  181

Query  407  EVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQLGCDGIFLGPEVFN  228
            E++ ++K+I AP+ ++ QT ++ RLPVV+FA+GG+ TPADAA+MMQLG DG+F+G  +F 
Sbjct  182  ELYTYAKEIGAPHHLLKQTAEVGRLPVVNFAAGGVATPADAALMMQLGMDGVFVGSGIFK  241

Query  227  CSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLN  111
              +P K+  AIV+AV NYNDP VLA+ S  L   M G+N
Sbjct  242  SDNPAKRARAIVEAVANYNDPKVLARVSEDLGAPMVGIN  280



>ref|XP_007321372.1| hypothetical protein SERLADRAFT_474134 [Serpula lacrymans var. 
lacrymans S7.9]
 gb|EGN96063.1| hypothetical protein SERLA73DRAFT_185580 [Serpula lacrymans var. 
lacrymans S7.3]
 gb|EGO21586.1| hypothetical protein SERLADRAFT_474134 [Serpula lacrymans var. 
lacrymans S7.9]
Length=333

 Score =   330 bits (847),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 158/275 (57%), Positives = 214/275 (78%), Gaps = 7/275 (3%)
 Frame = -1

Query  914  FSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIVSE---PDSR---GISRMPDPAL  753
            F +K G+AQML+GG I++V   +QA+IAE AGAC V+  E    D R   G++RM DPA+
Sbjct  46   FGVKSGLAQMLKGGVIMDVVNAEQARIAEEAGACAVMALERVPADIRKEGGVARMSDPAM  105

Query  752  IKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLAIADEDHFINKHNFRVPFV  573
            IKEI  AV+IPVMAK R+GHFVEAQIL+ +G+DYIDESE+L  ADE++ INKHN++VPFV
Sbjct  106  IKEIVDAVTIPVMAKVRIGHFVEAQILQAIGIDYIDESEVLTPADEEYHINKHNYKVPFV  165

Query  572  CGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKVMGDIRVLNNMDEDEVFAF  393
            CGAR+LGEALRR+ EGAA IRT+G+  G+GN+V+ VR  R VM +IR  + M E+E++A+
Sbjct  166  CGARNLGEALRRISEGAAFIRTKGE-AGTGNVVEAVRHQRSVMSEIRKASVMSEEELYAY  224

Query  392  SKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQLGCDGIFLGPEVFNCSDPY  213
            +K+I AP+ ++ +T ++ RLPVV+FA+GGI TPADAA+MMQLGCDG+F+G  +F+  DP 
Sbjct  225  AKEIQAPFHLLKETARLKRLPVVNFAAGGIATPADAALMMQLGCDGVFVGSGIFHSGDPA  284

Query  212  KKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            K+  AIVQ+V +YN+P +LA+ S  L  AM GL +
Sbjct  285  KRARAIVQSVTHYNNPKILAEISDNLGAAMVGLTI  319



>gb|KIK06615.1| hypothetical protein K443DRAFT_129881 [Laccaria amethystina LaAM-08-1]
Length=331

 Score =   330 bits (847),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 160/275 (58%), Positives = 212/275 (77%), Gaps = 7/275 (3%)
 Frame = -1

Query  914  FSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIVSE---PDSR---GISRMPDPAL  753
            F +K G+AQML+GG I++V   +QA+IAE AGAC V+  E    D R   G++RM DP +
Sbjct  44   FGVKSGLAQMLKGGVIMDVVNAEQARIAEEAGACAVMALERVPADIRSEGGVARMSDPQM  103

Query  752  IKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLAIADEDHFINKHNFRVPFV  573
            IKEI  AV+IPVMAK R+GHFVEAQIL+ +GVDYIDESE+L  AD++H INKH F+VPFV
Sbjct  104  IKEIVDAVTIPVMAKVRIGHFVEAQILQVIGVDYIDESEVLTPADDEHHINKHGFKVPFV  163

Query  572  CGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKVMGDIRVLNNMDEDEVFAF  393
            CGARDLGEALRR+ EGAAMIRT+G+  G+GN+V+ VR  R VM  IR  + M+E+E++ F
Sbjct  164  CGARDLGEALRRISEGAAMIRTKGE-AGTGNVVEAVRHQRAVMSQIRRASVMNEEELYVF  222

Query  392  SKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQLGCDGIFLGPEVFNCSDPY  213
            +K+I AP+ ++ +T ++ RLPVV+FA+GGI TPADAA+MMQLGCDG+F+G  +F+  DP 
Sbjct  223  AKEIQAPFHLLKETARLKRLPVVNFAAGGIATPADAALMMQLGCDGVFVGSGIFHSGDPA  282

Query  212  KKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            K+  AIVQAV ++N+P +LA+ S  L  AM GL +
Sbjct  283  KRARAIVQAVTHHNNPKILAEVSENLGAAMVGLTI  317



>gb|KIM87563.1| hypothetical protein PILCRDRAFT_815117 [Piloderma croceum F 1598]
Length=334

 Score =   330 bits (847),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 159/275 (58%), Positives = 213/275 (77%), Gaps = 7/275 (3%)
 Frame = -1

Query  914  FSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIVSE---PDSR---GISRMPDPAL  753
            F +K G+AQML+GG I++V    QA+IAE AGAC V+  E    D R   G++RM DP +
Sbjct  47   FGVKSGLAQMLKGGVIMDVVNAQQARIAEEAGACAVMALERVPADIRKEGGVARMSDPRM  106

Query  752  IKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLAIADEDHFINKHNFRVPFV  573
            IKEI  AV+IPVMAK R+GHFVEAQIL+++G+DYIDESE+L  ADE++ INKH+F+VPFV
Sbjct  107  IKEIVEAVTIPVMAKVRIGHFVEAQILQSIGIDYIDESEVLTPADEEYHINKHSFKVPFV  166

Query  572  CGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKVMGDIRVLNNMDEDEVFAF  393
            CGAR+LGEALRR+ EGAA IRT+G+  G+GN+V+ VR  R V  +IR  + M+E+E++AF
Sbjct  167  CGARNLGEALRRISEGAAFIRTKGE-AGTGNVVEAVRHERAVNSEIRKASVMNEEELYAF  225

Query  392  SKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQLGCDGIFLGPEVFNCSDPY  213
            +K I AP+ +V +T ++ RLPVV+FA+GGI TPADAA+MMQLGCDG+F+G  +F+  DP 
Sbjct  226  AKDIQAPFHLVKETARLKRLPVVNFAAGGIATPADAALMMQLGCDGVFVGSGIFHSGDPA  285

Query  212  KKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            K+  AIVQAV +YN+P +LA+ S  L +AM GL +
Sbjct  286  KRARAIVQAVTHYNNPKILAEVSEDLGEAMVGLTI  320



>ref|WP_007290673.1| pyridoxal biosynthesis protein [Thermosinus carboxydivorans]
 gb|EAX46324.1| pyridoxine biosynthesis protein [Thermosinus carboxydivorans 
Nor1]
Length=293

 Score =   329 bits (843),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 162/279 (58%), Positives = 213/279 (76%), Gaps = 7/279 (3%)
 Frame = -1

Query  926  KKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIVSE---PDSR---GISRMP  765
            ++  F +K G+A+ML+GG I++VTT +QAKIAE AGAC V+  E    D R   G++RM 
Sbjct  2    EQGTFRVKAGLAEMLKGGVIMDVTTPEQAKIAEQAGACAVMALERVPADIRAAGGVARMA  61

Query  764  DPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLAIADEDHFINKHNFR  585
            DP +I  I  AV+IPVMAK+R+GHFVEAQILE +GVDYIDESE+L  AD+   INKH F+
Sbjct  62   DPTVILRIMDAVTIPVMAKARIGHFVEAQILEALGVDYIDESEVLTPADDKFHINKHQFK  121

Query  584  VPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKVMGDIRVLNNMDEDE  405
            VPFVCGA++LGEALRR+ EGAAMIRT+G+  G+GN+V+ V+ +R+VM +IR L N+ +DE
Sbjct  122  VPFVCGAKNLGEALRRIGEGAAMIRTKGE-PGTGNVVEAVKHMRQVMSEIRTLVNLPDDE  180

Query  404  VFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQLGCDGIFLGPEVFNC  225
            V AF+K I AP ++V++TK++ RLPVV+FA+GGI TPADAA+MMQLGCDGIF+G  +F  
Sbjct  181  VPAFAKNIGAPLELVLETKKLGRLPVVNFAAGGIATPADAALMMQLGCDGIFVGSGIFKS  240

Query  224  SDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
             DP K+  AIV A   YNDP VLA+ S  L + M G+ +
Sbjct  241  GDPVKRAKAIVAATTYYNDPQVLAEVSKDLGEPMVGIEI  279



>emb|CCM06234.1| predicted protein [Fibroporia radiculosa]
Length=397

 Score =   332 bits (852),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 160/282 (57%), Positives = 215/282 (76%), Gaps = 7/282 (2%)
 Frame = -1

Query  914  FSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIVSE---PDSR---GISRMPDPAL  753
            F +K G+AQML+GG I++V   DQA+IAE AGAC V+  E    D R   G++RM DP +
Sbjct  49   FGVKSGLAQMLKGGVIMDVINADQARIAEEAGACAVMALERVPADIRANGGVARMSDPKM  108

Query  752  IKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLAIADEDHFINKHNFRVPFV  573
            IKEI  AV+IPVMAK R+GHFVEAQIL+ +G+DYIDESE+L  ADE+H INKH F++PFV
Sbjct  109  IKEIVDAVTIPVMAKVRIGHFVEAQILQAIGIDYIDESEVLTPADEEHHINKHAFKIPFV  168

Query  572  CGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKVMGDIRVLNNMDEDEVFAF  393
            CGAR+LGEALRR+ EGAA IRT+G+  G+GN+V+ VR  R VM +IR  + M E+E++A+
Sbjct  169  CGARNLGEALRRISEGAAFIRTKGE-AGTGNVVEAVRHQRAVMSEIRKASVMSEEELYAY  227

Query  392  SKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQLGCDGIFLGPEVFNCSDPY  213
            +K I AP+ ++ +T ++ RLPVV+FA+GG+ TPADAA+MMQLGCDG+F+G  +F+  DP 
Sbjct  228  AKDIQAPFHLLKETARLKRLPVVNFAAGGLATPADAALMMQLGCDGVFVGSGIFHSGDPA  287

Query  212  KKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNLVRAGSGN  87
            K+  AIVQAV +YN+P +L++ S  L DAM GL +V +   N
Sbjct  288  KRARAIVQAVTHYNNPKILSEISEDLGDAMVGLTIVNSDRKN  329



>ref|WP_006520591.1| pyridoxal biosynthesis protein [Desulfotomaculum gibsoniae]
 gb|AGL03188.1| pyridoxal 5''-phosphate synthase, synthase subunit Pdx1 [Desulfotomaculum 
gibsoniae DSM 7213]
Length=294

 Score =   328 bits (842),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 158/279 (57%), Positives = 214/279 (77%), Gaps = 7/279 (3%)
 Frame = -1

Query  926  KKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIVSE---PDSR---GISRMP  765
            +K  +++K G+A+ML+GG I++VTT +QAKIAE AGAC V+  E    D R   G++RM 
Sbjct  3    EKGTWTVKKGMAEMLKGGVIMDVTTPEQAKIAEDAGACAVMALERVPADIRAAGGVARMA  62

Query  764  DPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLAIADEDHFINKHNFR  585
            DP +I+ I  AV+IPVMAK+R+GHFVEAQILE++GVDYIDESE+L  ADE H INKH +R
Sbjct  63   DPTIIQRIMGAVTIPVMAKARIGHFVEAQILESLGVDYIDESEVLTPADETHHINKHAYR  122

Query  584  VPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKVMGDIRVLNNMDEDE  405
            VPFVCGAR+LGEALRR+ EGAAMIRT+G+  G+GN+V+  R +R VMG+IR + ++ ++E
Sbjct  123  VPFVCGARNLGEALRRISEGAAMIRTKGE-PGTGNVVEAARHMRMVMGEIRRVQHLPKEE  181

Query  404  VFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQLGCDGIFLGPEVFNC  225
            + + +K++ APYD++ Q  +M RLPVV+FA+GGI TPADAA MMQLGCDGIF+G  +F  
Sbjct  182  LMSAAKEMGAPYDLLAQVAEMGRLPVVNFAAGGIATPADAAFMMQLGCDGIFVGSGIFKS  241

Query  224  SDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            ++P  +  AIV A  +YNDP +L + S  L +AM GL +
Sbjct  242  NNPTARAKAIVAATTHYNDPQILTEVSKDLGEAMPGLEI  280



>ref|WP_011391558.1| pyridoxal biosynthesis protein [Moorella thermoacetica]
 ref|YP_428892.1| pyridoxal biosynthesis lyase PdxS [Moorella thermoacetica ATCC 
39073]
 gb|ABC18349.1| pyridoxal phosphate synthase yaaD subunit [Moorella thermoacetica 
ATCC 39073]
 dbj|GAF25771.1| pyridoxine biosynthesis enzyme [Moorella thermoacetica Y72]
Length=296

 Score =   328 bits (842),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 162/280 (58%), Positives = 215/280 (77%), Gaps = 7/280 (3%)
 Frame = -1

Query  929  AKKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIVSE---PDSR---GISRM  768
            A+   +++K G+A+ML+GG I++VTT +QAKIAE AGAC V+  E    D R   G++RM
Sbjct  4    AEVGTWTVKKGLAEMLKGGVIMDVTTPEQAKIAEEAGACAVMALERVPADIRAAGGVARM  63

Query  767  PDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLAIADEDHFINKHNF  588
             DP +I  I  AV+IPVMAK+R+GHFVEAQILE +GVDYIDESE+L  ADED  INKH F
Sbjct  64   ADPTVILRIMDAVTIPVMAKARIGHFVEAQILEALGVDYIDESEVLTPADEDFHINKHEF  123

Query  587  RVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKVMGDIRVLNNMDED  408
            +VPFVCGAR+LGEALRR+ EGAAMIRT+G+  G+GN+V+ VR +R+VM +IR L N+ ++
Sbjct  124  KVPFVCGARNLGEALRRIGEGAAMIRTKGE-PGTGNVVEAVRHMRRVMSEIRRLQNLPDE  182

Query  407  EVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQLGCDGIFLGPEVFN  228
            E+  F+K+I APY++V Q K++ RLPVV+FA+GGI TPADAA+MMQLG DGIF+G  +F 
Sbjct  183  ELMTFAKEIQAPYELVKQVKELGRLPVVNFAAGGIATPADAALMMQLGADGIFVGSGIFK  242

Query  227  CSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
             SDP K+  AIV A  ++ +P VLA+ S  L +AM G+ +
Sbjct  243  SSDPRKRARAIVAATTHFREPEVLAEVSRDLGEAMPGIEI  282



>ref|XP_006657949.1| PREDICTED: probable pyridoxal biosynthesis protein PDX1.1-like 
[Oryza brachyantha]
Length=289

 Score =   328 bits (841),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 162/287 (56%), Positives = 209/287 (73%), Gaps = 33/287 (11%)
 Frame = -1

Query  950  SGSAITDAKKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIVSE---PDSR-  783
            + +A+   K   FS+KVG+AQMLRGG I++V T +QA++AE AGAC V+  E    D R 
Sbjct  17   AAAALQKHKSATFSVKVGLAQMLRGGVIMDVVTPEQARVAEEAGACAVMALERVPADIRA  76

Query  782  --GISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLAIADEDH  609
              G++RM DP LI++IKRAV+IPVMAK+R+GHFVEAQILE +GVDY+DESE+L +AD+ H
Sbjct  77   QGGVARMSDPGLIRDIKRAVTIPVMAKARIGHFVEAQILEAIGVDYVDESEVLTLADDSH  136

Query  608  FINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKVMGDIRV  429
             INKHNFR                 R GA          G+GN+V+ VR VR VMGD+R 
Sbjct  137  HINKHNFR-----------------RGGA----------GTGNVVEAVRHVRSVMGDLRA  169

Query  428  LNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQLGCDGIF  249
            L NMD+DEVF+++K+IAAPYD+V+QTKQ+ RLPVV FA+GG+ TPADAA+MMQLGCD +F
Sbjct  170  LRNMDDDEVFSYAKRIAAPYDLVMQTKQLGRLPVVQFAAGGVATPADAALMMQLGCDSVF  229

Query  248  LGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            +G  VF   DP ++  AIVQAV +YNDP +LA+ SSGL +AM G+NL
Sbjct  230  VGSGVFKSGDPARRARAIVQAVTHYNDPKILAEVSSGLGEAMVGINL  276



>ref|XP_007395845.1| hypothetical protein PHACADRAFT_256201 [Phanerochaete carnosa 
HHB-10118-sp]
 gb|EKM55521.1| hypothetical protein PHACADRAFT_256201 [Phanerochaete carnosa 
HHB-10118-sp]
Length=308

 Score =   328 bits (841),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 159/282 (56%), Positives = 213/282 (76%), Gaps = 7/282 (2%)
 Frame = -1

Query  935  TDAKKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIVSE---PDSR---GIS  774
            T++    F +K G+AQML+GG I++V   +QA+IAE AGAC V+  E    D R   G++
Sbjct  14   TNSSLGTFGVKSGLAQMLKGGVIMDVINAEQARIAEEAGACAVMALERVPADIRADGGVA  73

Query  773  RMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLAIADEDHFINKH  594
            RM DP +IKEI  AV+IPVMAK R+GHFVEAQIL+ +G+DYIDESE+L  ADE+H INKH
Sbjct  74   RMSDPKMIKEIVEAVTIPVMAKVRIGHFVEAQILQAIGIDYIDESEVLTPADEEHHINKH  133

Query  593  NFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKVMGDIRVLNNMD  414
             F+VPFVCGAR+LGEALRR+ EGAA IRT+G+  G+GN+V+ VR  R VMG+IR    M 
Sbjct  134  AFKVPFVCGARNLGEALRRISEGAAFIRTKGE-AGTGNVVEAVRHQRAVMGEIRKCGVMS  192

Query  413  EDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQLGCDGIFLGPEV  234
            E+E++AF+K I AP+ ++ +T ++ RLPVV+FA+GGI TPADAA+MMQLGCDG+F+G  +
Sbjct  193  EEELYAFAKDIQAPFHLLKETARLKRLPVVNFAAGGIATPADAALMMQLGCDGVFVGSGI  252

Query  233  FNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            F   D  K+  AIVQAV ++N+P +LA+ S  + +AM GL +
Sbjct  253  FKSGDAAKRARAIVQAVTHFNNPKILAEVSEDIGEAMVGLTI  294



>gb|EMD38488.1| hypothetical protein CERSUDRAFT_48049 [Ceriporiopsis subvermispora 
B]
Length=307

 Score =   328 bits (841),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 158/275 (57%), Positives = 211/275 (77%), Gaps = 7/275 (3%)
 Frame = -1

Query  914  FSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIVSE---PDSR---GISRMPDPAL  753
            F +K G+AQML+GG I++V   +QA+IAE AGAC V+  E    D R   G++RM DP +
Sbjct  20   FGVKSGLAQMLKGGVIMDVVNAEQARIAEEAGACAVMALERVPADIRAEGGVARMSDPRM  79

Query  752  IKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLAIADEDHFINKHNFRVPFV  573
            IKEI  AV+IPVMAK R+GHFVEAQIL+ +G+DYIDESE+L  ADE+H INKH F+VPFV
Sbjct  80   IKEIVDAVTIPVMAKVRIGHFVEAQILQAIGIDYIDESEVLTPADEEHHINKHAFKVPFV  139

Query  572  CGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKVMGDIRVLNNMDEDEVFAF  393
            CGAR+LGEALRR+ EGAA IRT+G+  G+GN+V+ VR  R VM +IR  + M E+E++A+
Sbjct  140  CGARNLGEALRRISEGAAFIRTKGE-AGTGNVVEAVRHQRSVMSEIRKASVMSEEELYAY  198

Query  392  SKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQLGCDGIFLGPEVFNCSDPY  213
            +K I AP+ ++ +T ++ RLPVV+FA+GG+ TPADAA+MMQLGCDG+F+G  +F+  DP 
Sbjct  199  AKDIQAPFHLLKETARLKRLPVVNFAAGGLATPADAALMMQLGCDGVFVGSGIFHSGDPV  258

Query  212  KKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            K+  AIVQAV +YN+P +LA+ S  L  AM GL +
Sbjct  259  KRARAIVQAVTHYNNPKILAEISEDLGAAMVGLTI  293



>ref|WP_011876994.1| pyridoxal biosynthesis protein [Desulfotomaculum reducens]
 gb|ABO49157.1| pyridoxal phosphate synthase yaaD subunit [Desulfotomaculum reducens 
MI-1]
Length=294

 Score =   328 bits (840),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 159/280 (57%), Positives = 217/280 (78%), Gaps = 7/280 (3%)
 Frame = -1

Query  929  AKKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIVSE---PDSR---GISRM  768
            A+K  +++K G+A+ML+GG I++VTT +QAKIAE AGAC V+  E    D R   G++RM
Sbjct  2    AEKGTWTVKKGLAEMLKGGVIMDVTTPEQAKIAEEAGACAVMALERVPADIRAAGGVARM  61

Query  767  PDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLAIADEDHFINKHNF  588
             DP +I  I  AV+IPVMAK+R+GHFVEAQILE +GVDYIDESE+L  ADE   I+KH F
Sbjct  62   ADPNIILRIMEAVTIPVMAKARIGHFVEAQILEALGVDYIDESEVLTPADEVFHIDKHQF  121

Query  587  RVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKVMGDIRVLNNMDED  408
            +VP+VCGAR+LGEALRR+ EGAAMIRT+G+  G+GN+V+ VR +R+VM +IR+++NM +D
Sbjct  122  KVPYVCGARNLGEALRRIGEGAAMIRTKGE-PGTGNVVEAVRHMRQVMSEIRMVHNMPKD  180

Query  407  EVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQLGCDGIFLGPEVFN  228
            E+   +K++ APYD+V+Q  ++ +LPVV+FA+GGI TPADAA+MMQLGCDGIF+G  +F 
Sbjct  181  ELMTAAKEMGAPYDLVLQVHELGKLPVVNFAAGGIATPADAALMMQLGCDGIFVGSGIFK  240

Query  227  CSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
             +DP  +  AIV A  +YNDP +LA+ S  L +AM G+ +
Sbjct  241  SNDPASRAKAIVAATTHYNDPKILAEISKDLGEAMPGMEI  280



>gb|KIK45841.1| hypothetical protein CY34DRAFT_801149 [Suillus luteus UH-Slu-Lm8-n1]
Length=321

 Score =   328 bits (842),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 159/281 (57%), Positives = 217/281 (77%), Gaps = 7/281 (2%)
 Frame = -1

Query  932  DAKKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIVSE---PDSR---GISR  771
            ++K   F +K G+AQML+GG I++V   +QA+IAE AGAC V+  E    D R   G+SR
Sbjct  28   NSKLGTFGVKSGLAQMLKGGVIMDVINPEQARIAEEAGACAVMALERVPADIRKEGGVSR  87

Query  770  MPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLAIADEDHFINKHN  591
            M DPA+IK I  AV+IPVMAK R+GHFVEAQIL+ +G+DYIDESE+L  AD++H INKHN
Sbjct  88   MSDPAMIKSIVDAVTIPVMAKVRIGHFVEAQILQAIGIDYIDESEVLTPADDEHHINKHN  147

Query  590  FRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKVMGDIRVLNNMDE  411
            F+VPFVCGAR+LGEALRR+ EGAA IRT+G+  G+GN+V+ VR  R VM +IR  + M+E
Sbjct  148  FKVPFVCGARNLGEALRRISEGAAFIRTKGE-AGTGNVVEAVRHQRSVMSEIRKASVMNE  206

Query  410  DEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQLGCDGIFLGPEVF  231
            +E++A++K+I AP+ ++ +T ++ RLPVV+FA+GGI TPADAA+MMQLGCDGIF+G  +F
Sbjct  207  EELYAYAKEIQAPFHLLKETARLKRLPVVNFAAGGIATPADAALMMQLGCDGIFVGSGIF  266

Query  230  NCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            +  DP K+  AIVQAV ++N+P++LA+ S  +   M GL +
Sbjct  267  HSGDPAKRARAIVQAVTHHNNPNMLAEVSEDIGAPMVGLTI  307



>ref|XP_007764305.1| vitamin B6 biosynthesis protein [Coniophora puteana RWD-64-598 
SS2]
 gb|EIW85405.1| vitamin B6 biosynthesis protein [Coniophora puteana RWD-64-598 
SS2]
Length=333

 Score =   328 bits (842),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 156/275 (57%), Positives = 215/275 (78%), Gaps = 7/275 (3%)
 Frame = -1

Query  914  FSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIVSE---PDSR---GISRMPDPAL  753
            F +K G+AQML+GG I++V  V+QA+IAE AGAC V+  E    D R   G++RM DPA+
Sbjct  46   FGVKSGLAQMLKGGVIMDVVNVEQARIAEEAGACAVMALERVPADIRAEGGVARMSDPAM  105

Query  752  IKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLAIADEDHFINKHNFRVPFV  573
            IK I  AV+IPVMAK R+GHFVEAQIL+++G+DYIDESE+L  AD++H INKH+F+VPFV
Sbjct  106  IKAIVDAVTIPVMAKVRIGHFVEAQILQSIGIDYIDESEVLTPADDEHHINKHSFKVPFV  165

Query  572  CGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKVMGDIRVLNNMDEDEVFAF  393
            CGAR+LGEALRR+ EGAA +RT+G+  G+GN+V+ VR  R +   IR  ++M+E+E++AF
Sbjct  166  CGARNLGEALRRISEGAAFVRTKGE-AGTGNVVEAVRHSRAMSAAIRRASSMNEEELYAF  224

Query  392  SKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQLGCDGIFLGPEVFNCSDPY  213
            +K++ AP+ ++ +T ++ RLPVV+FA+GGI TPADAA+MMQLGCDG+F+G  +F+  DP 
Sbjct  225  AKEMQAPFHLLKETARLKRLPVVNFAAGGIATPADAALMMQLGCDGVFVGSGIFHSGDPA  284

Query  212  KKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            K+  AIVQAV +YN+P +LA+ S  L  AM GL +
Sbjct  285  KRARAIVQAVTHYNNPKLLAEVSEDLGAAMVGLTI  319



>emb|CCA68011.1| probable Pyridoxine biosynthesis protein PDX1 [Piriformospora 
indica DSM 11827]
Length=327

 Score =   328 bits (841),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 163/303 (54%), Positives = 215/303 (71%), Gaps = 7/303 (2%)
 Frame = -1

Query  980  MAEDGAVTVYSGSAITDAKKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIV  801
            +A   +  V  G          F++K G+AQML+GG I++V   +QA+IAE AGAC V+ 
Sbjct  18   LASSRSAQVARGDGAAGPNAGTFAVKSGLAQMLKGGVIMDVINAEQARIAEEAGACAVMA  77

Query  800  SE---PDSR---GISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDES  639
             E    D R   G++RM DP++IKEI  AV+IPVMAK R+GHFVEAQIL+ VGVDYIDES
Sbjct  78   LERVPADIRKEGGVARMSDPSMIKEIIDAVTIPVMAKCRIGHFVEAQILQAVGVDYIDES  137

Query  638  ELLAIADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRS  459
            E+L  ADE H INK  F+VPFVCGA++LGEALRR+ EGAA IRT+G+  G+GN+++ VR 
Sbjct  138  EVLTPADEQHHINKQGFKVPFVCGAKNLGEALRRISEGAAFIRTKGE-AGTGNVIEAVRH  196

Query  458  VRKVMGDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAI  279
             R V  +IR    M E+E+FA++K+I APY ++ +T ++ RLPVV+FA+GG+ TPADAA+
Sbjct  197  CRTVNAEIRKAAAMGEEELFAYAKEIGAPYHLLKETARLKRLPVVNFAAGGVATPADAAL  256

Query  278  MMQLGCDGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNLVRA  99
            MMQLGCDG+F+G  +F   DP K+  AIVQAV +YNDP  LA+ S  L  AM GL + + 
Sbjct  257  MMQLGCDGVFVGSGIFLSGDPAKRARAIVQAVTHYNDPQKLAEVSQNLGPAMVGLTITKG  316

Query  98   GSG  90
              G
Sbjct  317  MQG  319



>dbj|GAC74129.1| stationary phase-induced protein [Pseudozyma antarctica T-34]
 gb|ETS64109.1| hypothetical protein PaG_01344 [Pseudozyma aphidis DSM 70725]
Length=324

 Score =   328 bits (841),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 160/299 (54%), Positives = 222/299 (74%), Gaps = 8/299 (3%)
 Frame = -1

Query  977  AEDGAVTVYSGSA-ITDAKKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIV  801
            A +GA    +GSA  +DA    F +K G+AQML+GG I++V   +QA+IAE AGAC V+ 
Sbjct  15   ATNGAPARVNGSAPKSDANLGTFGVKSGLAQMLKGGVIMDVVNAEQARIAEDAGACAVMA  74

Query  800  SEP---DSR---GISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDES  639
             E    D R   G++RM DPA+IKEI+   ++P MAK R+GH VEAQIL+ +GVDYIDES
Sbjct  75   LEKIPADIRVEGGVARMSDPAMIKEIQETTTVPCMAKVRIGHIVEAQILQAIGVDYIDES  134

Query  638  ELLAIADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRS  459
            E+L  ADE H INKHNF+VPFVCGA++LGEALRR+ EGAAMIRT+G+  G+GN+V+ VR 
Sbjct  135  EVLTPADEQHHINKHNFKVPFVCGAKNLGEALRRISEGAAMIRTKGE-AGTGNVVEAVRH  193

Query  458  VRKVMGDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAI  279
             R + G+I+ +++M ++E++A++K I AP+ ++ +T ++ RLPVV+FA+GGI TPADAA+
Sbjct  194  QRTIQGEIKRVSSMSDEELYAYAKDIQAPFHLLKETARLKRLPVVNFAAGGIATPADAAL  253

Query  278  MMQLGCDGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNLVR  102
            MMQLG DG+F+G  +F  ++P ++  AIV AV +YNDP  LA  S  L +AM GLN+ +
Sbjct  254  MMQLGSDGVFVGSGIFKGNNPEQRARAIVAAVTHYNDPAKLAAVSENLGEAMVGLNITK  312



>gb|EPT05956.1| hypothetical protein FOMPIDRAFT_1021097 [Fomitopsis pinicola 
FP-58527 SS1]
Length=333

 Score =   328 bits (841),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 158/288 (55%), Positives = 216/288 (75%), Gaps = 7/288 (2%)
 Frame = -1

Query  950  SGSAITDAKKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIVSE---PDSR-  783
            +G   T +    F +K G+AQML+GG I++V   +QA+IAE AGAC V+  E    D R 
Sbjct  34   TGKDGTSSNLGTFGVKSGLAQMLKGGVIMDVVNAEQARIAEEAGACAVMALERVPADIRA  93

Query  782  --GISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLAIADEDH  609
              G++RM DP +IKEI  AV+IPVMAK R+GHFVEAQIL+ +G+DYIDESE+L  ADE+H
Sbjct  94   NGGVARMSDPKMIKEIVDAVTIPVMAKVRIGHFVEAQILQAIGIDYIDESEVLTPADEEH  153

Query  608  FINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKVMGDIRV  429
             INKH ++VPFVCGAR+LGEALRR+ EGAA IRT+G+  G+GN+V+ VR  R V  +IR 
Sbjct  154  HINKHGYKVPFVCGARNLGEALRRISEGAAFIRTKGE-AGTGNVVEAVRHTRAVQSEIRK  212

Query  428  LNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQLGCDGIF  249
             + M+E+E++A++K I AP+ ++ +T ++ RLPVV+FA+GG+ TPADAA+MMQLGCDG+F
Sbjct  213  ASVMNEEELYAYAKDIQAPFHLLKETARLKRLPVVNFAAGGVATPADAALMMQLGCDGVF  272

Query  248  LGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNLV  105
            +G  +F+  DP K+  AIVQAV +YN+P +LA+ S  L +AM GL + 
Sbjct  273  VGSGIFHSGDPAKRARAIVQAVTHYNNPKILAEISEDLGEAMVGLTIT  320



>ref|WP_013558597.1| pyridoxal biosynthesis protein [Anaerolinea thermophila]
 dbj|BAJ62199.1| pyridoxal biosynthesis lyase PdxS [Anaerolinea thermophila UNI-1]
Length=296

 Score =   327 bits (837),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 161/275 (59%), Positives = 212/275 (77%), Gaps = 7/275 (3%)
 Frame = -1

Query  914  FSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIVSE---PDSR---GISRMPDPAL  753
            F++K G+AQML+GG I++V T + A+IAE AGA  V+  E    D R   G++RM DP L
Sbjct  9    FAVKKGLAQMLKGGVIMDVVTPEHARIAEDAGAVAVMALERVPADIRAHGGVARMSDPEL  68

Query  752  IKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLAIADEDHFINKHNFRVPFV  573
            I +I  AVSIPVMAK R+GHFVEAQILE +GVDYIDESE+L  ADE+H I KH F+VPFV
Sbjct  69   ILKIMDAVSIPVMAKCRIGHFVEAQILEAIGVDYIDESEVLTPADEEHHIYKHAFKVPFV  128

Query  572  CGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKVMGDIRVLNNMDEDEVFAF  393
            CGAR+LGEALRR+ EGAAMIRT+G+  G+G++V+ VR  R VMG+IR L N+ ++EV AF
Sbjct  129  CGARNLGEALRRIGEGAAMIRTKGE-AGTGDVVEAVRHARAVMGEIRRLQNLPDEEVMAF  187

Query  392  SKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQLGCDGIFLGPEVFNCSDPY  213
            +K+I APY++V++T+++ RLPVV+FA+GGI TPADAA+MMQLG DG+F+G  +F   DP 
Sbjct  188  AKEIGAPYELVLETRKLGRLPVVNFAAGGIATPADAALMMQLGMDGVFVGSGIFKSGDPA  247

Query  212  KKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            K+  AIV+AV +YNDP +LA+ S  L + M G  +
Sbjct  248  KRAAAIVKAVTHYNDPKILAEVSRNLGEPMVGRQI  282



>gb|KIL00667.1| hypothetical protein PAXRUDRAFT_129369 [Paxillus rubicundulus 
Ve08.2h10]
Length=330

 Score =   328 bits (840),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 159/275 (58%), Positives = 211/275 (77%), Gaps = 7/275 (3%)
 Frame = -1

Query  914  FSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIVSE---PDSR---GISRMPDPAL  753
            F +K G+AQML+GG I++V   +QA+IAE AGAC V+  E    D R   G+SRM DPA+
Sbjct  43   FGVKSGLAQMLKGGVIMDVVNAEQARIAEEAGACAVMALERVPADIRAEGGVSRMSDPAM  102

Query  752  IKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLAIADEDHFINKHNFRVPFV  573
            IK I  AV+IPVMAK R+GHFVEAQIL+ +G+DYIDESE+L  ADE+H INKH+F+VPFV
Sbjct  103  IKSIVDAVTIPVMAKVRIGHFVEAQILQAIGIDYIDESEVLTPADEEHHINKHSFKVPFV  162

Query  572  CGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKVMGDIRVLNNMDEDEVFAF  393
            CGAR+LGEALRR+ EGAA IRT+G+  G+GN+V+ VR  R VM +IR  + M+E+E++A+
Sbjct  163  CGARNLGEALRRISEGAAFIRTKGE-AGTGNVVEAVRHQRSVMSEIRKASVMNEEELYAY  221

Query  392  SKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQLGCDGIFLGPEVFNCSDPY  213
            +K I AP+ ++ +T ++ RLPVV FA+GGI TPADAA+MMQLGCDG+F+G  +F+  DP 
Sbjct  222  AKDIQAPFHLLKETARLKRLPVVDFAAGGIATPADAAMMMQLGCDGVFVGSGIFHSGDPV  281

Query  212  KKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            K+  AIVQAV ++N+P VLA+ S  L   M GL +
Sbjct  282  KRARAIVQAVTHFNNPKVLAEVSEDLGAPMVGLTI  316



>ref|XP_007879812.1| hypothetical protein PFL1_04097 [Pseudozyma flocculosa PF-1]
 gb|EPQ28270.1| hypothetical protein PFL1_04097 [Pseudozyma flocculosa PF-1]
Length=323

 Score =   327 bits (839),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 154/284 (54%), Positives = 216/284 (76%), Gaps = 7/284 (2%)
 Frame = -1

Query  935  TDAKKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIVSEP---DSR---GIS  774
            TDA    F +K G+AQML+GG I++V   +QA+IAE AGAC V+  E    D R   G++
Sbjct  29   TDANLGTFGVKSGLAQMLKGGVIMDVVNAEQARIAEDAGACAVMALEKIPADIRVEGGVA  88

Query  773  RMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLAIADEDHFINKH  594
            RM DPA+IKEI+   ++P MAK R+GHFVEAQ+L+++GVDYIDESE+L  AD+ H INKH
Sbjct  89   RMSDPAMIKEIQETTTVPCMAKVRIGHFVEAQVLQSIGVDYIDESEVLTPADDQHHINKH  148

Query  593  NFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKVMGDIRVLNNMD  414
            NF+VPFVCGA++LGEALRR+ EGAAMIRT+G+  G+GN+V+ VR  R + G+I+ + +M 
Sbjct  149  NFKVPFVCGAKNLGEALRRISEGAAMIRTKGE-AGTGNVVEAVRHQRTIQGEIKRVASMS  207

Query  413  EDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQLGCDGIFLGPEV  234
            ++E++A++K I AP+ ++ +T +M RLPVV+FA+GGI TPADAA+MMQLG DG+F+G  +
Sbjct  208  DEELYAYAKDIQAPFHLLKETARMKRLPVVNFAAGGIATPADAALMMQLGSDGVFVGSGI  267

Query  233  FNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNLVR  102
            F  ++P ++  AIV+AV +YNDP  +A  S  L +AM GLN+ +
Sbjct  268  FKGNNPAERARAIVEAVTHYNDPAKIAAVSENLGEAMVGLNITK  311



>ref|WP_006520847.1| pyridoxal biosynthesis protein [Desulfotomaculum gibsoniae]
 gb|AGL02302.1| pyridoxal 5''-phosphate synthase, synthase subunit Pdx1 [Desulfotomaculum 
gibsoniae DSM 7213]
Length=294

 Score =   326 bits (836),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 159/279 (57%), Positives = 216/279 (77%), Gaps = 7/279 (3%)
 Frame = -1

Query  926  KKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIVSE---PDSR---GISRMP  765
            +K  +++K G+A+ML+GG I++VTT +QAKIAE AGAC V+  E    D R   G++RM 
Sbjct  3    EKGTWAVKKGLAEMLKGGVIMDVTTPEQAKIAEDAGACAVMALERVPADIRAAGGVARMA  62

Query  764  DPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLAIADEDHFINKHNFR  585
            DP +I+ I  AV+IPVMAK+R+GHFVEAQILE++GVDYIDESE+L   D+ H INKH F+
Sbjct  63   DPTIIQRIMDAVTIPVMAKARIGHFVEAQILESLGVDYIDESEVLTPTDDTHHINKHVFK  122

Query  584  VPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKVMGDIRVLNNMDEDE  405
            VPFVCGAR+LGEALRR+ EGAAMIRT+G+  G+GN+V+ VR +R VMG+IR + N+ ++E
Sbjct  123  VPFVCGARNLGEALRRIGEGAAMIRTKGE-PGTGNVVEAVRHMRMVMGEIRRVQNLPKEE  181

Query  404  VFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQLGCDGIFLGPEVFNC  225
            + + +K++ APYD++VQ   + RLPVV+FA+GGI TPADAA+MMQLGCDGIF+G  +F  
Sbjct  182  LMSAAKEMGAPYDLMVQVAGLGRLPVVNFAAGGIATPADAALMMQLGCDGIFVGSGIFKS  241

Query  224  SDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            ++P  +  AIV A  +YNDP +LA+ S  L +AM GL +
Sbjct  242  NNPAVRAKAIVAATTHYNDPQILAEVSRDLGEAMPGLEI  280



>ref|XP_005852209.1| hypothetical protein CHLNCDRAFT_55943 [Chlorella variabilis]
 gb|EFN60107.1| hypothetical protein CHLNCDRAFT_55943 [Chlorella variabilis]
Length=295

 Score =   326 bits (836),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 160/287 (56%), Positives = 216/287 (75%), Gaps = 7/287 (2%)
 Frame = -1

Query  938  ITDAKKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIVSE---PDSR---GI  777
            + + ++   ++KVG+AQML+GG I++V T ++A+IAE AGA  V+  E    D R   G+
Sbjct  1    MAEQQRGTQAVKVGLAQMLKGGVIMDVVTPEEARIAEEAGAVAVMALERVPADIRRNGGV  60

Query  776  SRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLAIADEDHFINK  597
            +RM DP +IK IK AV+IPVMAK+R+GHFVEAQILE VG+DYIDESE+L  AD+ H INK
Sbjct  61   ARMSDPQMIKAIKAAVTIPVMAKARIGHFVEAQILEAVGIDYIDESEVLTPADDVHHINK  120

Query  596  HNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKVMGDIRVLNNM  417
            H F+VPFVCG RDLGEALRR+ EGAAMIRT+G+  G+GN+V+ VR  R V G IR L  M
Sbjct  121  HAFKVPFVCGCRDLGEALRRIAEGAAMIRTKGE-AGTGNVVEAVRHARAVQGAIRQLQTM  179

Query  416  DEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQLGCDGIFLGPE  237
            D+DE++ ++K++ AP ++V QTK + RLPVV+FA+GG+ TPADAA+MMQLG DG+F+G  
Sbjct  180  DDDELYVYAKELRAPVELVRQTKALGRLPVVNFAAGGVATPADAALMMQLGMDGVFVGSG  239

Query  236  VFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNLVRAG  96
            +F   DP K+  AIVQAV +YNDP ++A+ S  L + M G+++   G
Sbjct  240  IFKSGDPAKRARAIVQAVTHYNDPAIVAEVSCDLGEPMVGIDVREKG  286



>ref|XP_003290234.1| hypothetical protein DICPUDRAFT_95090 [Dictyostelium purpureum]
 gb|EGC33241.1| hypothetical protein DICPUDRAFT_95090 [Dictyostelium purpureum]
Length=291

 Score =   326 bits (836),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 158/277 (57%), Positives = 212/277 (77%), Gaps = 7/277 (3%)
 Frame = -1

Query  920  NPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIVSEP---DSR---GISRMPDP  759
            N F +K  +AQML+GG I++V T +QA+IAE AGAC V+  E    D R   G++RM DP
Sbjct  4    NTFRVKASLAQMLKGGVIMDVVTPEQARIAEEAGACAVMALEKIPADIRHFGGVARMSDP  63

Query  758  ALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLAIADEDHFINKHNFRVP  579
             +IKEI  AV+IPVMAK R+GHFVEAQILE +GVDYIDESE+L IAD ++ I+KH F+VP
Sbjct  64   GMIKEIMAAVTIPVMAKVRIGHFVEAQILEQIGVDYIDESEVLTIADNENHIDKHEFKVP  123

Query  578  FVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKVMGDIRVLNNMDEDEVF  399
            FVCG R+LGEALRR+ EGAAMIRT+G+  G+G++V+ VR  R V  +I+ + NMD  E++
Sbjct  124  FVCGCRNLGEALRRIAEGAAMIRTKGE-AGTGDVVEAVRHARAVNKEIKKVQNMDPHELY  182

Query  398  AFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQLGCDGIFLGPEVFNCSD  219
            +++K+I AP ++V + K++ RLPVV+FA+GG+ TPADAA+MMQLG DG+F+G  +F   D
Sbjct  183  SYAKEIQAPLELVKEVKRLGRLPVVNFAAGGVATPADAAMMMQLGMDGVFVGSGIFKSGD  242

Query  218  PYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            P K+  AIVQAV +YN+P VLAK S  L +AM G+N+
Sbjct  243  PAKRAKAIVQAVTHYNNPEVLAKISENLGEAMVGINV  279



>gb|KIJ17199.1| hypothetical protein PAXINDRAFT_112021 [Paxillus involutus ATCC 
200175]
Length=335

 Score =   328 bits (840),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 159/275 (58%), Positives = 211/275 (77%), Gaps = 7/275 (3%)
 Frame = -1

Query  914  FSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIVSE---PDSR---GISRMPDPAL  753
            F +K G+AQML+GG I++V   +QA+IAE AGAC V+  E    D R   G+SRM DPA+
Sbjct  48   FGVKSGLAQMLKGGVIMDVVNAEQARIAEEAGACAVMALERVPADIRAEGGVSRMSDPAM  107

Query  752  IKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLAIADEDHFINKHNFRVPFV  573
            IK I  AV+IPVMAK R+GHFVEAQIL+ +G+DYIDESE+L  ADE+H INKH+F+VPFV
Sbjct  108  IKSIVDAVTIPVMAKVRIGHFVEAQILQAIGIDYIDESEVLTPADEEHHINKHSFKVPFV  167

Query  572  CGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKVMGDIRVLNNMDEDEVFAF  393
            CGAR+LGEALRR+ EGAA IRT+G+  G+GN+V+ VR  R VM +IR  + M+E+E++A+
Sbjct  168  CGARNLGEALRRISEGAAFIRTKGE-AGTGNVVEAVRHQRSVMSEIRKASVMNEEELYAY  226

Query  392  SKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQLGCDGIFLGPEVFNCSDPY  213
            +K I AP+ ++ +T ++ RLPVV FA+GGI TPADAA+MMQLGCDG+F+G  +F+  DP 
Sbjct  227  AKDIQAPFHLLKETARLKRLPVVDFAAGGIATPADAAMMMQLGCDGVFVGSGIFHSGDPA  286

Query  212  KKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            K+  AIVQAV ++N+P VLA+ S  L   M GL +
Sbjct  287  KRARAIVQAVTHFNNPKVLAEVSEDLGAPMVGLTI  321



>ref|XP_003055856.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH59232.1| predicted protein [Micromonas pusilla CCMP1545]
Length=293

 Score =   326 bits (835),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 163/280 (58%), Positives = 211/280 (75%), Gaps = 10/280 (4%)
 Frame = -1

Query  926  KKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIVSE---PDSR---GISRMP  765
            +K  F++KVG+AQML+GG I++V  V+QA+IAE AGA  V+  E    D R   G++RM 
Sbjct  2    QKGTFAVKVGLAQMLKGGVIMDVVNVEQARIAEEAGAVAVMALERVPADIRKDGGVARMS  61

Query  764  DPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLAIADEDHFINKHNFR  585
            DP +IK IK AV+IPVMAK+R+GHFVEAQ    VG+DYIDESE+L  ADE + INKHNF+
Sbjct  62   DPTMIKAIKEAVTIPVMAKARIGHFVEAQ--APVGIDYIDESEVLTPADEINHINKHNFK  119

Query  584  VPFVCGARDLGEALRRVREGAAMIRTQG--DLTGSGNIVDTVRSVRKVMGDIRVLNNMDE  411
            VP +CG RDLGEALRRV EG +MIRT+G     G+GN+V+ VR  R VMGDIR L  M E
Sbjct  120  VPVLCGCRDLGEALRRVAEGCSMIRTKGASREAGTGNVVEAVRHCRAVMGDIRRLQAMSE  179

Query  410  DEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQLGCDGIFLGPEVF  231
            DE+F ++K+I AP ++V QTK + RLPVV+FA+GG+ TPADAA+MMQLG DG+F+G  +F
Sbjct  180  DEIFVYAKEIRAPLELVRQTKTLGRLPVVNFAAGGVATPADAALMMQLGMDGVFVGSGIF  239

Query  230  NCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLN  111
               +P K+  AIVQAV +YNDP +LA+ S GL +AM G++
Sbjct  240  KSGEPAKRARAIVQAVTHYNDPKILAEVSQGLGEAMVGID  279



>gb|KIO26141.1| hypothetical protein M407DRAFT_243842 [Tulasnella calospora MUT 
4182]
Length=334

 Score =   327 bits (839),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 158/275 (57%), Positives = 209/275 (76%), Gaps = 7/275 (3%)
 Frame = -1

Query  914  FSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIVSE---PDSR---GISRMPDPAL  753
            F +K G+AQML+ G I++V   +QA+IAE AGAC V+  E    D R   G++RM DP +
Sbjct  47   FGVKSGLAQMLKSGVIMDVINAEQARIAEEAGACAVMALERVPADIRAQGGVARMSDPKM  106

Query  752  IKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLAIADEDHFINKHNFRVPFV  573
            IKEI  AV+IPVMAK R+GHFVEAQIL+ +G+DYIDESE+L  ADE H I KHNFRVPFV
Sbjct  107  IKEIVDAVTIPVMAKVRIGHFVEAQILQAIGIDYIDESEVLTPADEAHHIMKHNFRVPFV  166

Query  572  CGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKVMGDIRVLNNMDEDEVFAF  393
            CGA  LGEALRR+ EGAAMIRT+G+  G+GNIV+ VR  R V  +I+ ++NM E+E++A+
Sbjct  167  CGATSLGEALRRISEGAAMIRTKGE-AGTGNIVEAVRHARAVNTEIKRISNMSEEELYAY  225

Query  392  SKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQLGCDGIFLGPEVFNCSDPY  213
            +K+I AP+ ++ +T ++ RLPVV FA+GGI TPADAA+MMQLGCDG+F+G  +F+  DP 
Sbjct  226  AKEIQAPFHLLKETARLKRLPVVSFAAGGIATPADAALMMQLGCDGVFVGSGIFHSGDPA  285

Query  212  KKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            ++  AIVQAV +Y +P +LA+ S  L DAM GL +
Sbjct  286  RRARAIVQAVTHYQNPKILAEVSEDLGDAMVGLTI  320



>ref|XP_007847808.1| pyridoxine biosynthesis protein [Moniliophthora roreri MCA 2997]
 gb|ESK92870.1| pyridoxine biosynthesis protein [Moniliophthora roreri MCA 2997]
Length=327

 Score =   327 bits (837),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 157/272 (58%), Positives = 210/272 (77%), Gaps = 7/272 (3%)
 Frame = -1

Query  905  KVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIVSE---PDSR---GISRMPDPALIKE  744
            K G+AQML+GG I++V   +QA+IAE AGAC V+  E    D R   G++RM DP LIKE
Sbjct  43   KSGLAQMLKGGVIMDVVNAEQARIAEEAGACAVMALERVPADIRAQGGVARMSDPKLIKE  102

Query  743  IKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLAIADEDHFINKHNFRVPFVCGA  564
            I  AV+IPVMAK R+GHFVEAQIL+++G+DYIDESE+L  ADE+H INKHNF+VPFVCG+
Sbjct  103  IVDAVTIPVMAKVRIGHFVEAQILQSLGIDYIDESEVLTPADEEHHINKHNFKVPFVCGS  162

Query  563  RDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKVMGDIRVLNNMDEDEVFAFSKK  384
            R+LGEALRR+ EGAAMIRT+G+  G+GN+V+ VR  R +  +IR  + M E+E++ ++K+
Sbjct  163  RNLGEALRRISEGAAMIRTKGE-AGTGNVVEAVRHSRAIASEIRKASAMSEEELYTYAKE  221

Query  383  IAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQLGCDGIFLGPEVFNCSDPYKKV  204
            I AP+ ++ +T ++ RLPVV+FA+GGI TPADAA+MMQLGCDG+F+G  +F   D  K+ 
Sbjct  222  IQAPFHLLKETARLKRLPVVNFAAGGIATPADAALMMQLGCDGVFVGSGIFKSGDAAKRA  281

Query  203  WAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
             AIVQAV +YN+P VLA+ S  L +AM GL +
Sbjct  282  RAIVQAVTHYNNPKVLAEVSEDLGEAMVGLTI  313



>ref|WP_029716204.1| pyridoxal biosynthesis protein [Atribacteria bacterium JGI 0000079-L04]
Length=294

 Score =   325 bits (834),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 159/281 (57%), Positives = 214/281 (76%), Gaps = 7/281 (2%)
 Frame = -1

Query  926  KKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIVSE---PDSR---GISRMP  765
            +K  + +K G+A+ML+GG I++V TV+QAKIAE AGA  V+  E    D R   G++RM 
Sbjct  3    EKGTYKVKKGLAEMLKGGVIMDVVTVEQAKIAEEAGAVAVMALERVPADIRAAGGVARMA  62

Query  764  DPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLAIADEDHFINKHNFR  585
            DP  IKEI  AVSIPVMAK R+GHFVEAQILE +GVDYIDESE+L  ADE + INKHNF+
Sbjct  63   DPKNIKEIMSAVSIPVMAKVRIGHFVEAQILEALGVDYIDESEVLTPADEKYHINKHNFK  122

Query  584  VPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKVMGDIRVLNNMDEDE  405
            VPFVCGAR+LGEALRR+ EGAAMIRT+G+  G+GNIV+ VR +R+VM +IR L N+ ++E
Sbjct  123  VPFVCGARNLGEALRRIGEGAAMIRTKGE-PGTGNIVEAVRHMRQVMDEIRRLKNIPKEE  181

Query  404  VFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQLGCDGIFLGPEVFNC  225
            +   +K++ AP++++ +  +  +LPVV+FA+GGI TPADAA+MMQLG DGIF+G  +F  
Sbjct  182  LMNMAKELGAPFELLQEVAESGKLPVVNFAAGGIATPADAALMMQLGADGIFVGSGIFKS  241

Query  224  SDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNLVR  102
             DP K+  AIV+A  +YN+P +LA+ S GL +AM G+ + +
Sbjct  242  KDPVKRARAIVEATTHYNNPEILARVSEGLGEAMKGIEISK  282



>dbj|GAK66132.1| vitamin B6 biosynthesis protein [Pseudozyma antarctica]
Length=324

 Score =   327 bits (837),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 159/299 (53%), Positives = 221/299 (74%), Gaps = 8/299 (3%)
 Frame = -1

Query  977  AEDGAVTVYSGSA-ITDAKKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIV  801
            A +GA    +GS   +DA    F +K G+AQML+GG I++V   +QA+IAE AGAC V+ 
Sbjct  15   ATNGAPARVNGSTPKSDANLGTFGVKSGLAQMLKGGVIMDVVNAEQARIAEDAGACAVMA  74

Query  800  SEP---DSR---GISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDES  639
             E    D R   G++RM DPA+IKEI+   ++P MAK R+GH VEAQIL+ +GVDYIDES
Sbjct  75   LEKIPADIRVEGGVARMSDPAMIKEIQETTTVPCMAKVRIGHIVEAQILQAIGVDYIDES  134

Query  638  ELLAIADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRS  459
            E+L  ADE H INKHNF+VPFVCGA++LGEALRR+ EGAAMIRT+G+  G+GN+V+ VR 
Sbjct  135  EVLTPADEQHHINKHNFKVPFVCGAKNLGEALRRISEGAAMIRTKGE-AGTGNVVEAVRH  193

Query  458  VRKVMGDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAI  279
             R + G+I+ +++M ++E++A++K I AP+ ++ +T ++ RLPVV+FA+GGI TPADAA+
Sbjct  194  QRTIQGEIKRVSSMSDEELYAYAKDIQAPFHLLKETARLKRLPVVNFAAGGIATPADAAL  253

Query  278  MMQLGCDGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNLVR  102
            MMQLG DG+F+G  +F  ++P ++  AIV AV +YNDP  LA  S  L +AM GLN+ +
Sbjct  254  MMQLGSDGVFVGSGIFKGNNPEQRARAIVAAVTHYNDPAKLAAVSENLGEAMVGLNITK  312



>ref|WP_044200896.1| pyridoxal biosynthesis protein [Oscillochloris trichoides]
Length=293

 Score =   325 bits (834),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 155/275 (56%), Positives = 208/275 (76%), Gaps = 7/275 (3%)
 Frame = -1

Query  914  FSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIVSE---PDSR---GISRMPDPAL  753
            ++ KVG+AQML+GG I++V T +QA+IAE AGA  V+  E    D R   G++RM DP L
Sbjct  6    WTTKVGLAQMLKGGVIMDVVTPEQARIAEEAGAVAVMALERVPADIRAQGGVARMSDPEL  65

Query  752  IKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLAIADEDHFINKHNFRVPFV  573
            I  IK AV+IPVMAK+R+GHFVEAQ++E +G+DYIDESE+L  ADE+H INKH F++PFV
Sbjct  66   ISAIKAAVTIPVMAKARIGHFVEAQVIEALGIDYIDESEVLTPADEEHHINKHKFKIPFV  125

Query  572  CGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKVMGDIRVLNNMDEDEVFAF  393
            CG R+LGEALRRV EGAAM+RT+G+  G+GN+V+ VR  R V GDIR L +MD DE+F  
Sbjct  126  CGCRNLGEALRRVAEGAAMLRTKGE-AGTGNVVEAVRHFRTVQGDIRRLQSMDADELFTA  184

Query  392  SKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQLGCDGIFLGPEVFNCSDPY  213
            +K + APY++V Q  +  +LPVV+FA+GGI TPADAA+MMQLG +G+F+G  +F   DP 
Sbjct  185  AKNLQAPYELVKQVAETGKLPVVNFAAGGIATPADAALMMQLGVEGVFVGSGIFKSGDPV  244

Query  212  KKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            ++  AIV+A  +Y DP ++AK S GL + M G+N+
Sbjct  245  RRARAIVEATTHYKDPEIIAKVSRGLGEPMVGINI  279



>gb|KDR81800.1| hypothetical protein GALMADRAFT_59193 [Galerina marginata CBS 
339.88]
Length=334

 Score =   327 bits (837),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 158/275 (57%), Positives = 210/275 (76%), Gaps = 7/275 (3%)
 Frame = -1

Query  914  FSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIVSE---PDSR---GISRMPDPAL  753
            F +K G+AQML+GG I++V   + A+IAE AGAC V+  E    D R   G++RM DP +
Sbjct  47   FGVKSGLAQMLKGGVIMDVVNAEHARIAEEAGACAVMALERVPADIRAEGGVARMSDPEM  106

Query  752  IKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLAIADEDHFINKHNFRVPFV  573
            IK I  AV+IPVMAK R+GHFVEAQIL+ +GVDYIDESE+L  AD+++ INKH F+VPFV
Sbjct  107  IKSIVDAVTIPVMAKVRIGHFVEAQILQVIGVDYIDESEVLTPADDEYHINKHGFKVPFV  166

Query  572  CGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKVMGDIRVLNNMDEDEVFAF  393
            CGARDLGEALRR+ EGAAMIRT+G+  G+GN+V+ VR  R VMG IR  + M E+E++ F
Sbjct  167  CGARDLGEALRRISEGAAMIRTKGE-AGTGNVVEAVRHQRAVMGQIRKASVMTEEELYVF  225

Query  392  SKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQLGCDGIFLGPEVFNCSDPY  213
            +K+I AP+ ++ +T ++ RLPVV+FA+GGI TPADAA+MMQLGCDG+F+G  +F+  DP 
Sbjct  226  AKEIQAPFHLLKETARLKRLPVVNFAAGGIATPADAALMMQLGCDGVFVGSGIFHSGDPA  285

Query  212  KKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            K+  AIVQAV ++N+P +LA+ S  L  AM GL +
Sbjct  286  KRARAIVQAVTHFNNPKILAEVSESLGPAMVGLTI  320



>ref|WP_011876406.1| pyridoxal biosynthesis protein [Desulfotomaculum reducens]
 gb|ABO48562.1| pyridoxal phosphate synthase yaaD subunit [Desulfotomaculum reducens 
MI-1]
Length=294

 Score =   325 bits (833),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 158/280 (56%), Positives = 216/280 (77%), Gaps = 7/280 (3%)
 Frame = -1

Query  929  AKKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIVSE---PDSR---GISRM  768
            A+K  +++K G+A+ML+GG I++VTT +QAKIAE AGAC V+  E    D R   G++RM
Sbjct  2    AEKGTWTVKKGLAEMLKGGVIMDVTTPEQAKIAEEAGACAVMALERVPADIRAAGGVARM  61

Query  767  PDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLAIADEDHFINKHNF  588
             DP +I  I  AV+IPVMAK+R+GHFVEAQILE +G DYIDESE+L  ADE   I+KH F
Sbjct  62   ADPNIILRIMDAVTIPVMAKARIGHFVEAQILEALGADYIDESEVLTPADEVFHIDKHQF  121

Query  587  RVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKVMGDIRVLNNMDED  408
            +VP+VCGAR+LGEALRR+ EGAAMIRT+G+  G+GN+V+ VR +R+VM +IR+++NM +D
Sbjct  122  KVPYVCGARNLGEALRRIGEGAAMIRTKGE-PGTGNVVEAVRHMRQVMSEIRMVHNMPKD  180

Query  407  EVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQLGCDGIFLGPEVFN  228
            E+   +K++ APYD+V+Q  ++ +LPVV+FA+GGI TPADAA+MMQLGCDGIF+G  +F 
Sbjct  181  ELMTAAKEMGAPYDLVLQVHELGKLPVVNFAAGGIATPADAALMMQLGCDGIFVGSGIFK  240

Query  227  CSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
             +DP  +  AIV A  +YNDP +LA+ S  L +AM G+ +
Sbjct  241  SNDPVSRAKAIVAATTHYNDPKILAEISKDLGEAMPGMEI  280



>gb|KIK24956.1| hypothetical protein PISMIDRAFT_368620 [Pisolithus microcarpus 
441]
Length=330

 Score =   327 bits (837),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 164/300 (55%), Positives = 220/300 (73%), Gaps = 14/300 (5%)
 Frame = -1

Query  968  GAVTVYSGSAITDAKKN-------PFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACC  810
            GA    SG+A    K++        F +K G+AQML+GG I++V   +QA+IAE AGAC 
Sbjct  18   GAGGTSSGAAAHAPKRDGGNTSLGTFGVKSGLAQMLKGGVIMDVVNPEQARIAEEAGACA  77

Query  809  VIVSE---PDSR---GISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYI  648
            V+  E    D R   G++RM DPA+IK I  AV+IPVMAK R+GHFVEAQIL+ +GVDYI
Sbjct  78   VMALERVPADIRAEGGVARMSDPAMIKAIVDAVTIPVMAKVRIGHFVEAQILQAIGVDYI  137

Query  647  DESELLAIADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDT  468
            DESE+L  ADE+H INKHNF+VPFVCGAR+LGEALRR+ EGAA IRT+G+  G+GN+V+ 
Sbjct  138  DESEVLTPADEEHHINKHNFKVPFVCGARNLGEALRRISEGAAFIRTKGE-AGTGNVVEA  196

Query  467  VRSVRKVMGDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPAD  288
            VR  R VM +IR  + M E+E++A++K+I AP+ ++ +T ++ RLPVV+FA+GGI +PAD
Sbjct  197  VRHQRAVMAEIRQASVMSEEELYAYAKEIQAPFHLLKETARLKRLPVVNFAAGGIASPAD  256

Query  287  AAIMMQLGCDGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            AA+MMQL CDG+F+G  +F+  +P K+  AIVQAV +YN+P VLA+ S  L   M GL +
Sbjct  257  AALMMQLSCDGVFVGSGIFHSGNPAKRARAIVQAVTHYNNPKVLAEVSEDLGAPMVGLTI  316



>ref|XP_008036802.1| vitamin B6 biosynthesis protein [Trametes versicolor FP-101664 
SS1]
 gb|EIW60507.1| vitamin B6 biosynthesis protein [Trametes versicolor FP-101664 
SS1]
Length=341

 Score =   327 bits (838),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 156/276 (57%), Positives = 214/276 (78%), Gaps = 7/276 (3%)
 Frame = -1

Query  914  FSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIVSE---PDSR---GISRMPDPAL  753
            F +K G+AQML+GG I++V   +QA+IAE AGAC V+  E    D R   G++RM DP +
Sbjct  54   FGVKSGLAQMLKGGVIMDVVNAEQARIAEEAGACAVMALERVPADIRAQGGVARMSDPKM  113

Query  752  IKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLAIADEDHFINKHNFRVPFV  573
            IKEI  AV+IPVMAK R+GHFVEAQIL+ +G+DYIDESE+L+ AD++H INKH F+VPFV
Sbjct  114  IKEIVDAVTIPVMAKVRIGHFVEAQILQAIGIDYIDESEVLSPADDEHHINKHPFKVPFV  173

Query  572  CGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKVMGDIRVLNNMDEDEVFAF  393
            CGAR+LGEALRR+ EGAA IRT+G+  G+GN+V+ VR  R VMG+IR  + M E+E++A+
Sbjct  174  CGARNLGEALRRISEGAAFIRTKGE-AGTGNVVEAVRHQRSVMGEIRKASVMSEEELYAY  232

Query  392  SKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQLGCDGIFLGPEVFNCSDPY  213
            ++ I AP+ ++ +T ++ RLPVV+FA+GGI TPADAA+MMQLGCDG+F+G  +F+  DP 
Sbjct  233  ARDIQAPFHLLKETARLKRLPVVNFAAGGIATPADAALMMQLGCDGVFVGSGIFHSGDPA  292

Query  212  KKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNLV  105
            K+  AIVQAV ++N+P +LA+ S  + +AM GL + 
Sbjct  293  KRARAIVQAVTHFNNPKLLAEISEDIGEAMVGLTIT  328



>emb|CCF50585.1| probable Pyridoxine biosynthesis protein PDX1 [Ustilago hordei]
Length=328

 Score =   326 bits (836),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 155/291 (53%), Positives = 218/291 (75%), Gaps = 7/291 (2%)
 Frame = -1

Query  956  VYSGSAITDAKKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIVSEP---DS  786
            V S +  +DA    F +K G+AQML+GG I++V   +QA+IAE AGAC V+  E    D 
Sbjct  27   VNSSAPKSDANLGTFGVKSGLAQMLKGGVIMDVVNAEQARIAEDAGACAVMALEKIPADI  86

Query  785  R---GISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLAIADE  615
            R   G++RM DPA+IKEI+   ++P MAK R+GHFVEAQIL+ +GVDYIDESE+L  ADE
Sbjct  87   RVEGGVARMSDPAMIKEIQETTTVPCMAKVRIGHFVEAQILQAIGVDYIDESEVLTPADE  146

Query  614  DHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKVMGDI  435
             H INKHNF++PFVCGA++LGEALRR+ EGAAMIRT+G+  G+GN+V+ VR  R + G+I
Sbjct  147  AHHINKHNFKIPFVCGAKNLGEALRRISEGAAMIRTKGE-AGTGNVVEAVRHQRTIQGEI  205

Query  434  RVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQLGCDG  255
            + +++M ++E++ ++K I AP+ ++ +T ++ RLPVV+FA+GGI TPADAA+MMQLG DG
Sbjct  206  KRVSSMSDEELYVYAKDIQAPFHLLKETARLKRLPVVNFAAGGIATPADAALMMQLGSDG  265

Query  254  IFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNLVR  102
            +F+G  +F  ++P ++  AIV+AV +YNDP  LA  S  L +AM GLN+ +
Sbjct  266  VFVGSGIFKGNNPEQRARAIVEAVTHYNDPAKLAAVSENLGEAMVGLNITK  316



>ref|WP_028308804.1| pyridoxal biosynthesis protein [Desulfitibacter alkalitolerans]
Length=294

 Score =   325 bits (833),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 160/279 (57%), Positives = 211/279 (76%), Gaps = 7/279 (3%)
 Frame = -1

Query  926  KKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIVSE---PDSR---GISRMP  765
            KK  + +K G+A+ML+GG I++VTT +QAKIAE AGAC V+  E    D R   G++RM 
Sbjct  3    KKGTWKVKSGLAEMLKGGVIMDVTTPEQAKIAEEAGACAVMALERVPADIRAAGGVARMA  62

Query  764  DPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLAIADEDHFINKHNFR  585
            DP +IK I   VSIPVMAK+R+GHFVEAQILE +G DYIDESE+L  ADE + I+K+ F+
Sbjct  63   DPTIIKNIMEVVSIPVMAKARIGHFVEAQILEALGADYIDESEVLTPADEQYHIDKNLFK  122

Query  584  VPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKVMGDIRVLNNMDEDE  405
            VPFVCGAR+LGEALRR+ EGAAMIRT+G+  G+GN+V+ VR +R +M +IR L +M EDE
Sbjct  123  VPFVCGARNLGEALRRINEGAAMIRTKGE-PGTGNVVEAVRHMRMMMSEIRRLTSMREDE  181

Query  404  VFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQLGCDGIFLGPEVFNC  225
            ++ F+K I APYD+V    +  +LPVV+FA+GGI TPADAA+MMQLGCDGIF+G  +F  
Sbjct  182  LYTFAKDIQAPYDLVHYVAENGKLPVVNFAAGGIATPADAALMMQLGCDGIFVGSGIFKS  241

Query  224  SDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            ++P K+  AIV A  ++NDP +LA+ S  L +AM GL +
Sbjct  242  NEPAKRAKAIVTATTHFNDPQILAQISRDLGEAMPGLEI  280



>emb|CDI54544.1| probable Pyridoxine biosynthesis protein PDX1 [Melanopsichium 
pennsylvanicum 4]
Length=325

 Score =   326 bits (835),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 156/291 (54%), Positives = 221/291 (76%), Gaps = 9/291 (3%)
 Frame = -1

Query  950  SGSAI--TDAKKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIVSE---PDS  786
            +GS++  +DA    F +K G+AQML+GG I++V   +QA+IAE AGAC V+  E    D 
Sbjct  24   NGSSVPKSDANLGTFGVKSGLAQMLKGGVIMDVVNPEQARIAEDAGACAVMALERIPADI  83

Query  785  R---GISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLAIADE  615
            R   G++RM DPA+IKEI+   ++P MAK R+GH VEAQIL+++GVDYIDESE+L  ADE
Sbjct  84   RVEGGVARMSDPAMIKEIQETTTVPCMAKVRIGHMVEAQILQSIGVDYIDESEVLTPADE  143

Query  614  DHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKVMGDI  435
             H INKHNF+VPFVCGA++LGEALRR+ EGAAMIRT+G+  G+GN+V+ VR  R + G+I
Sbjct  144  QHHINKHNFKVPFVCGAKNLGEALRRISEGAAMIRTKGE-AGTGNVVEAVRHQRTIQGEI  202

Query  434  RVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQLGCDG  255
            + +++M ++E++A++K I AP+ ++ +T ++ RLPVV+FA+GGI TPADAA+MMQLG DG
Sbjct  203  KRVSSMSDEELYAYAKDIQAPFHLLKETARLKRLPVVNFAAGGIATPADAALMMQLGSDG  262

Query  254  IFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNLVR  102
            +F+G  +F  ++P ++  AIV+AV +YNDP  LA  S  L +AM GLN+ +
Sbjct  263  VFVGSGIFKGNNPEQRARAIVEAVTHYNDPAKLAAVSENLGEAMVGLNISK  313



>ref|WP_007937919.1| MULTISPECIES: pyridoxal biosynthesis protein [Pelosinus]
 gb|EIW15432.1| pyridoxine biosynthesis protein [Pelosinus fermentans B4]
 gb|EIW26877.1| Pyridoxal biosynthesis lyase pdxS [Pelosinus fermentans A11]
 gb|EIW28487.1| Pyridoxal biosynthesis lyase pdxS [Pelosinus fermentans DSM 17108]
Length=293

 Score =   325 bits (832),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 159/279 (57%), Positives = 212/279 (76%), Gaps = 7/279 (3%)
 Frame = -1

Query  926  KKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIVSE---PDSR---GISRMP  765
            ++  F +K G+A+ML+GG I++VTT +QAKIAE AGAC V+  E    D R   G++RM 
Sbjct  2    QQGTFRVKAGLAEMLKGGVIMDVTTPEQAKIAEEAGACAVMALERVPADIRAAGGVARMA  61

Query  764  DPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLAIADEDHFINKHNFR  585
            DP +I  I  AV+IPVMAK R+GHFVEAQI+E++GVDYIDESE+L  AD+ + I+KH F+
Sbjct  62   DPTIILNIMEAVTIPVMAKGRIGHFVEAQIIESLGVDYIDESEVLTPADDKYHIDKHQFK  121

Query  584  VPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKVMGDIRVLNNMDEDE  405
            VPFVCGA++LGEALRR+ EGAAMIRT+G+  G+GN+V+ V+ +R VM +IR L N+  +E
Sbjct  122  VPFVCGAKNLGEALRRIGEGAAMIRTKGE-PGTGNVVEAVKHIRMVMSEIRQLQNLPNEE  180

Query  404  VFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQLGCDGIFLGPEVFNC  225
            V AF+K IAAP ++V++ K++ RLPVV+FA+GGI TPADAA+MM LGCDGIF+G  VF  
Sbjct  181  VSAFAKNIAAPLELVMEVKKLGRLPVVNFAAGGIATPADAALMMHLGCDGIFVGSGVFKS  240

Query  224  SDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
             DP K+  AIV A   YNDP +LA+ S  L +AM G+ +
Sbjct  241  GDPVKRAKAIVAATTYYNDPKILAEISRDLGEAMVGIEI  279



>emb|CEP18624.1| hypothetical protein [Parasitella parasitica]
Length=313

 Score =   325 bits (834),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 156/282 (55%), Positives = 212/282 (75%), Gaps = 7/282 (2%)
 Frame = -1

Query  935  TDAKKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIVSE---PDSR---GIS  774
            T +    + +  G+AQM +GG I++V   +QA+IAE AGAC V+  E    D R   G++
Sbjct  19   TGSDGQSYRLNAGLAQMFKGGVIMDVINAEQARIAEEAGACAVMALERVPADIRKNGGVA  78

Query  773  RMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLAIADEDHFINKH  594
            RM DP +IKEI  AV+IPVMAK R+GHFVEAQI+E++GVDYIDESE+L  ADE + INK 
Sbjct  79   RMSDPQMIKEIIEAVTIPVMAKVRIGHFVEAQIIESIGVDYIDESEVLTPADEANHINKR  138

Query  593  NFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKVMGDIRVLNNMD  414
            NF+VPFVCGA++LGEALRR+ EGAAMIRT+G+  G+GN+V+ VR +R V  +IR  + M 
Sbjct  139  NFKVPFVCGAKNLGEALRRINEGAAMIRTKGE-AGTGNVVEAVRHMRTVTSEIRRASAMS  197

Query  413  EDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQLGCDGIFLGPEV  234
            E+E++A++K + APY+++ +T ++ RLPVV+FA+GG+ TPADAA+MMQLGCDG+F+G  +
Sbjct  198  EEELYAYAKDLQAPYNLLKETAKLGRLPVVNFAAGGVATPADAALMMQLGCDGVFVGSGI  257

Query  233  FNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            F   DP K+  AIVQAV ++ND  VLA  S  L +AM G+NL
Sbjct  258  FKSGDPSKRAKAIVQAVTHFNDAKVLADVSENLGEAMVGINL  299



>ref|WP_026369791.1| pyridoxal biosynthesis protein [bacterium JKG1]
Length=293

 Score =   325 bits (832),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 158/279 (57%), Positives = 209/279 (75%), Gaps = 7/279 (3%)
 Frame = -1

Query  926  KKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIVSE---PDSR---GISRMP  765
            +K+ F  K G+AQML+GG I++V T +QA+IAE AGA  V+  E    D R   G++RM 
Sbjct  2    EKSTFRTKAGLAQMLKGGVIMDVVTPEQARIAEEAGAVAVMALERVPADIRAQGGVARMS  61

Query  764  DPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLAIADEDHFINKHNFR  585
            DP  I  I  AV+IPVMAK R+GHFVEAQ+LE +GVDYIDESE+L  ADE + INKH F+
Sbjct  62   DPERILSIMEAVTIPVMAKCRIGHFVEAQVLEAIGVDYIDESEVLTPADEQNHINKHKFK  121

Query  584  VPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKVMGDIRVLNNMDEDE  405
            VPFVCG R+LGEALRR+ EGAAMIRT+G+  G+GN+V+ VR  R++ G+IR L  MDEDE
Sbjct  122  VPFVCGCRNLGEALRRIAEGAAMIRTKGE-AGTGNVVEAVRHARQLFGEIRRLQTMDEDE  180

Query  404  VFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQLGCDGIFLGPEVFNC  225
            +F  +K++ APY++V +  +  RLPVV+FA+GGI TPADAA+MMQLG DG+F+G  +F  
Sbjct  181  LFVAAKELQAPYELVREVAKAGRLPVVNFAAGGIATPADAALMMQLGMDGVFVGSGIFKS  240

Query  224  SDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
             DP K+  AIV+A  +YNDP ++A+ S GL +AM G+N+
Sbjct  241  GDPVKRARAIVEATTHYNDPKIIAEVSKGLGEAMVGINI  279



>gb|KFH65130.1| pyridoxine biosynthesis protein PDX1 [Mortierella verticillata 
NRRL 6337]
Length=316

 Score =   325 bits (834),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 157/275 (57%), Positives = 211/275 (77%), Gaps = 7/275 (3%)
 Frame = -1

Query  914  FSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIVSE---PDSR---GISRMPDPAL  753
            F++K G+AQML+GG I++V  V+QA IAE+AGAC V+  E    D R   G++RM DP +
Sbjct  29   FNVKAGLAQMLKGGVIMDVINVEQALIAEAAGACAVMALERVPADIRKNGGVARMSDPKM  88

Query  752  IKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLAIADEDHFINKHNFRVPFV  573
            I+EI  AVSIPVMAK R+GH VEAQI+E++GVDYIDESE+L  ADE + INKH+++VPFV
Sbjct  89   IREIINAVSIPVMAKVRIGHIVEAQIIESLGVDYIDESEVLTPADESNHINKHDYKVPFV  148

Query  572  CGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKVMGDIRVLNNMDEDEVFAF  393
            CG ++LGEALRR+ EGAAMIRT+G+  G+GN+V+ VR  R V  +IR    MD+ E+F +
Sbjct  149  CGCKNLGEALRRINEGAAMIRTKGE-AGTGNVVEAVRHCRTVKSEIRKAQLMDDSELFTY  207

Query  392  SKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQLGCDGIFLGPEVFNCSDPY  213
            +K+I APY ++ +T ++ RLPVV+FA+GG+ TPADAA+MMQLGCDG+F+G  +F   DP 
Sbjct  208  AKEIQAPYHLLKETAKLGRLPVVNFAAGGVATPADAALMMQLGCDGVFVGSGIFKSGDPA  267

Query  212  KKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            K+  AIVQAV +Y DP VLA+ S  L +AM G+N+
Sbjct  268  KRARAIVQAVTHYKDPKVLAEVSEDLGEAMVGINI  302



>ref|WP_013821172.1| pyridoxal biosynthesis protein [Desulfotomaculum kuznetsovii]
 gb|AEG13657.1| Pyridoxal biosynthesis lyase pdxS [Desulfotomaculum kuznetsovii 
DSM 6115]
Length=294

 Score =   325 bits (832),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 159/280 (57%), Positives = 211/280 (75%), Gaps = 7/280 (3%)
 Frame = -1

Query  929  AKKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIVSE---PDSR---GISRM  768
            A+K  +++K G+A+ML+GG I++VTT +QAKIAE AGAC V+  E    D R   G++RM
Sbjct  2    AEKGTWTVKKGLAEMLKGGVIMDVTTPEQAKIAEEAGACAVMALERVPADIRAAGGVARM  61

Query  767  PDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLAIADEDHFINKHNF  588
             DP +I  I  AV+IPVMAK R+GHFVEAQILE +GVDYIDESE+L  ADE H I+KH F
Sbjct  62   ADPTVILRIMDAVTIPVMAKVRIGHFVEAQILEQLGVDYIDESEVLTPADEQHHIDKHKF  121

Query  587  RVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKVMGDIRVLNNMDED  408
            +VPFVCGAR+LGEALRR+ EGAAMIRT+G+  G+GN+V+ VR +R +M +IR + NM  +
Sbjct  122  KVPFVCGARNLGEALRRIAEGAAMIRTKGE-PGTGNVVEAVRHMRMMMAEIRRVQNMPRE  180

Query  407  EVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQLGCDGIFLGPEVFN  228
            E+ A +K++ APY++++Q  +  RLPVV+FA+GGI TPADAA+MMQLG DGIF+G  +F 
Sbjct  181  ELMALAKEMGAPYELLLQVAEQGRLPVVNFAAGGIATPADAALMMQLGADGIFVGSGIFK  240

Query  227  CSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
              +P  +  AIV A  +YNDP VLA+ S  L +AM GL +
Sbjct  241  SKNPSARARAIVAATTHYNDPQVLAEVSKDLGEAMPGLEI  280



>gb|EST08052.1| putative Pyridoxine biosynthesis protein PDX1 [Pseudozyma brasiliensis 
GHG001]
Length=326

 Score =   325 bits (834),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 154/284 (54%), Positives = 214/284 (75%), Gaps = 7/284 (2%)
 Frame = -1

Query  935  TDAKKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIVSEP---DSR---GIS  774
            +DA    F +K G+AQML+GG I++V   +QA+IAE AGAC V+  E    D R   G++
Sbjct  32   SDANLGTFGVKSGLAQMLKGGVIMDVVNAEQARIAEDAGACAVMALEKIPADIRVEGGVA  91

Query  773  RMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLAIADEDHFINKH  594
            RM DPA+IKEI+   ++P MAK R+GHFVEAQIL+ +GVDYIDESE+L  AD+ H INKH
Sbjct  92   RMSDPAMIKEIQETTTVPCMAKVRIGHFVEAQILQAIGVDYIDESEVLTPADDQHHINKH  151

Query  593  NFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKVMGDIRVLNNMD  414
            NF+VPFVCGA++LGEALRR+ EGAAMIRT+G+  G+GN+V+ VR  R + G+I+ +++M 
Sbjct  152  NFKVPFVCGAKNLGEALRRISEGAAMIRTKGE-AGTGNVVEAVRHQRTIQGEIKRVSSMS  210

Query  413  EDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQLGCDGIFLGPEV  234
            ++E++ ++K I APY ++ +T ++ RLPVV+FA+GGI TPADAA+MMQLG DG+F+G  +
Sbjct  211  DEELYVYAKDIQAPYHLLKETARLKRLPVVNFAAGGIATPADAALMMQLGSDGVFVGSGI  270

Query  233  FNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNLVR  102
            F  ++P ++  AIV AV +YNDP  LA  S  L +AM GLN+ +
Sbjct  271  FKGNNPAERARAIVAAVTHYNDPAKLAAVSENLGEAMVGLNITK  314



>gb|KIP09091.1| hypothetical protein PHLGIDRAFT_68223 [Phlebiopsis gigantea 11061_1 
CR5-6]
Length=337

 Score =   326 bits (835),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 163/299 (55%), Positives = 217/299 (73%), Gaps = 16/299 (5%)
 Frame = -1

Query  986  AEMAEDGAVTVYSGSAITDAKKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCV  807
            A  ++DGA T   G+         F +K G+AQML+GG I++V   +QA+IAE AGAC V
Sbjct  35   AAHSKDGATTTSLGT---------FGVKSGLAQMLKGGVIMDVVNAEQARIAEEAGACAV  85

Query  806  IVSE---PDSR---GISRMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYID  645
            +  E    D R   G++RM DP +IKEI  AV+IPVMAK R+GHFVEAQIL+++G+DYID
Sbjct  86   MALERVPADIRATGGVARMSDPKMIKEIVDAVTIPVMAKVRIGHFVEAQILQSIGIDYID  145

Query  644  ESELLAIADEDHFINKHNFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTV  465
            ESE+L  ADE+H INKH F+VPFVCG R+LGEALRR+ EGAA IRT+G+  G+GN+V+ V
Sbjct  146  ESEVLTPADEEHHINKHAFKVPFVCGCRNLGEALRRISEGAAFIRTKGE-AGTGNVVEAV  204

Query  464  RSVRKVMGDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADA  285
            R  R V  +IR  + M E+E++A++K I AP+ ++ +T +M RLPVV+FA+GGI TPADA
Sbjct  205  RHTRAVQSEIRKASVMSEEELYAYAKDIQAPFHLLKETARMKRLPVVNFAAGGIATPADA  264

Query  284  AIMMQLGCDGIFLGPEVFNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            A+MMQLGCDG+F+G  +F   D  K+  AIVQAV +YN+P +LA  S  L +AM GL +
Sbjct  265  ALMMQLGCDGVFVGSGIFKSGDAAKRARAIVQAVTHYNNPKLLADVSEDLGEAMVGLTI  323



>ref|WP_007953713.1| pyridoxal biosynthesis protein [Pelosinus fermentans]
 gb|AJQ25387.1| Pyridoxal biosynthesis lyase pdxS [Pelosinus fermentans JBW45]
Length=293

 Score =   324 bits (831),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 159/279 (57%), Positives = 212/279 (76%), Gaps = 7/279 (3%)
 Frame = -1

Query  926  KKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIVSE---PDSR---GISRMP  765
            ++  F +K G+A+ML+GG I++VTT +QAKIAE AGAC V+  E    D R   G++RM 
Sbjct  2    QQGTFRVKAGLAEMLKGGVIMDVTTPEQAKIAEEAGACAVMALERVPADIRAAGGVARMA  61

Query  764  DPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLAIADEDHFINKHNFR  585
            DP +I +I  AV+IPVMAK R+GHFVEAQI+E++GVDYIDESE+L  AD+ + I+KH F 
Sbjct  62   DPTIILKIMEAVTIPVMAKGRIGHFVEAQIIESLGVDYIDESEVLTPADDKYHIDKHQFN  121

Query  584  VPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKVMGDIRVLNNMDEDE  405
            VPFVCGA++LGEALRR+ EGAAMIRT+G+  G+GN+V+ V+ +R VM +IR L N+  +E
Sbjct  122  VPFVCGAKNLGEALRRIGEGAAMIRTKGE-PGTGNVVEAVKHIRMVMSEIRQLQNLPNEE  180

Query  404  VFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQLGCDGIFLGPEVFNC  225
            V AF+K IAAP ++V++ K++ RLPVV+FA+GGI TPADAA+MM LGCDGIF+G  VF  
Sbjct  181  VSAFAKNIAAPLELVMEVKKLGRLPVVNFAAGGIATPADAALMMHLGCDGIFVGSGVFKS  240

Query  224  SDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
             DP K+  AIV A   YNDP +LA+ S  L +AM G+ +
Sbjct  241  GDPVKRAKAIVAATTYYNDPKILAEISRDLGEAMVGIEI  279



>ref|WP_044276923.1| pyridoxal biosynthesis protein [Caldilinea aerophila]
Length=279

 Score =   323 bits (829),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 161/266 (61%), Positives = 202/266 (76%), Gaps = 7/266 (3%)
 Frame = -1

Query  887  MLRGGAIVEVTTVDQAKIAESAGACCVIVSE---PDSR---GISRMPDPALIKEIKRAVS  726
            ML+GG I++V T +QA+IAE AGAC V+  E    D R   G++RM DP  IKEI  AV+
Sbjct  1    MLKGGVIMDVVTAEQARIAEEAGACAVMALERVPADIRRDGGVARMSDPRKIKEIIEAVT  60

Query  725  IPVMAKSRVGHFVEAQILETVGVDYIDESELLAIADEDHFINKHNFRVPFVCGARDLGEA  546
            IPVMAK R+GHFVEAQIL+ +GVDYIDESE+L  ADE+H INKH F  PFVCGARDLGEA
Sbjct  61   IPVMAKVRIGHFVEAQILQALGVDYIDESEVLTPADEEHHINKHKFTTPFVCGARDLGEA  120

Query  545  LRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKVMGDIRVLNNMDEDEVFAFSKKIAAPYD  366
            LRR+ EGAAMIRT+G+  G+GNIV+ VR  R V G IR L +MDEDE+FA++K+I APY 
Sbjct  121  LRRIAEGAAMIRTKGE-AGTGNIVEAVRHARAVNGAIRRLRSMDEDELFAYAKEIRAPYS  179

Query  365  IVVQTKQMARLPVVHFASGGIVTPADAAIMMQLGCDGIFLGPEVFNCSDPYKKVWAIVQA  186
            +V  T ++ RLPVV+FA+GG+ TPADAA+MMQLG DG+F+G  +F   +P K+  AIV A
Sbjct  180  LVKLTAELGRLPVVNFAAGGVATPADAALMMQLGMDGVFVGSGIFKSGNPEKRARAIVMA  239

Query  185  VRNYNDPHVLAKASSGLEDAMAGLNL  108
            V +YNDP +LA+ S  L + M G+NL
Sbjct  240  VTHYNDPQILAEVSEDLGEPMVGINL  265



>ref|XP_004340966.1| thiazole biosynthesis protein ThiG, putative [Acanthamoeba castellanii 
str. Neff]
 gb|ELR18902.1| thiazole biosynthesis protein ThiG, putative [Acanthamoeba castellanii 
str. Neff]
Length=281

 Score =   323 bits (829),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 157/264 (59%), Positives = 202/264 (77%), Gaps = 1/264 (0%)
 Frame = -1

Query  887  MLRGGAIVEVTTVDQAKIAESAGACCVIVSEPDSRGISRMPDPALIKEIKRAVSIPVMAK  708
            ML+GG I++V   +QA+IAE AGA  V+  E    G++RM DP++IK I  AVSIPVMAK
Sbjct  1    MLKGGVIMDVIDAEQARIAEEAGAVAVMALERRDGGVARMSDPSMIKSIMEAVSIPVMAK  60

Query  707  SRVGHFVEAQILETVGVDYIDESELLAIADEDHFINKHNFRVPFVCGARDLGEALRRVRE  528
             R+GHFVEAQILE VGVDYIDESE+L  AD+++ INKHNF VPFVCG+R+LGEALRR+ E
Sbjct  61   VRIGHFVEAQILEAVGVDYIDESEVLTPADDENHINKHNFGVPFVCGSRNLGEALRRISE  120

Query  527  GAAMIRTQGDLTGSGNIVDTVRSVRKVMGDIRVLNNMDEDEVFAFSKKIAAPYDIVVQTK  348
            GAAMIRT+G+  G+GN+V+ VR  R V G+IR L  MDE+E++ ++K I AP D+V QT 
Sbjct  121  GAAMIRTKGE-AGTGNVVEAVRHARTVNGEIRKLTTMDENELYTYAKTIGAPIDLVQQTA  179

Query  347  QMARLPVVHFASGGIVTPADAAIMMQLGCDGIFLGPEVFNCSDPYKKVWAIVQAVRNYND  168
            ++ RLPVV+FA+GG+ TPADAA+MMQLG DG+F+G  +F   +P K+  AIVQAV +Y D
Sbjct  180  KLGRLPVVNFAAGGVATPADAALMMQLGMDGVFVGSGIFKSGNPAKRARAIVQAVTHYKD  239

Query  167  PHVLAKASSGLEDAMAGLNLVRAG  96
            P VLAK S  L +AM G+N  + G
Sbjct  240  PLVLAKVSEDLGEAMVGINCDQMG  263



>gb|KIL69605.1| hypothetical protein M378DRAFT_7449 [Amanita muscaria Koide BX008]
Length=344

 Score =   325 bits (834),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 166/299 (56%), Positives = 219/299 (73%), Gaps = 27/299 (9%)
 Frame = -1

Query  914  FSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIVSE---PDSR---GISRMPDPAL  753
            F +K G+AQML+GG I++VT V+QA+IAE AGAC V+  E    D R   G++RM DP +
Sbjct  40   FGVKSGLAQMLKGGVIMDVTNVEQARIAEEAGACAVMALERVPADIRAQGGVARMSDPRM  99

Query  752  IKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLAIADEDHFINKHNFRVPFV  573
            IK+I  AV+IPVMAK R+GHFVEAQIL+ VGVDYIDESE+L  AD++H INKHNF+VPFV
Sbjct  100  IKDISDAVTIPVMAKVRIGHFVEAQILQAVGVDYIDESEVLTPADDEHHINKHNFKVPFV  159

Query  572  CGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKVMGDIRVLNNMDEDEVFAF  393
            CGAR+LGEALRR+ EGAA IRT+G+  G+GN+V+ VR  R VM +IR  + M+E+E++AF
Sbjct  160  CGARNLGEALRRISEGAAFIRTKGE-AGTGNVVEAVRHQRAVMSEIRKSSVMNEEELYAF  218

Query  392  SKKIAAPYDIVVQTKQMARLPVVHFASGGIVTP----ADAAIMMQLGCDGIFLGPEVFNC  225
            +K+I AP+ +V +T ++ RL VV+FA+GGI TP    ADAA+MMQLGCDG+F+G  +FN 
Sbjct  219  AKEIQAPFHLVKETARLKRLSVVNFAAGGIATPDLYQADAALMMQLGCDGVFVGSGIFNS  278

Query  224  SDPYKKVWAIVQAVRNYNDPHVLAKA----------------SSGLEDAMAGLNLVRAG  96
             DP K+  AIVQAV +YN+P +LA+                 S  L DAM GL +++ G
Sbjct  279  GDPAKRARAIVQAVTHYNNPKILAEVFIISFCLVRVANQVQISEDLGDAMVGLTILKGG  337



>ref|WP_012191338.1| pyridoxal 5'-phosphate synthase subunit PdxS [Herpetosiphon aurantiacus]
 sp|A9B891.1|PDXS_HERA2 RecName: Full=Pyridoxal 5'-phosphate synthase subunit PdxS; Short=PLP 
synthase subunit PdxS; AltName: Full=Pdx1 [Herpetosiphon 
aurantiacus DSM 785]
 gb|ABX06444.1| pyridoxine biosynthesis protein [Herpetosiphon aurantiacus DSM 
785]
Length=293

 Score =   323 bits (829),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 158/275 (57%), Positives = 207/275 (75%), Gaps = 7/275 (3%)
 Frame = -1

Query  914  FSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIVSE---PDSR---GISRMPDPAL  753
            F+ KVG+AQML+GG I++V T DQAKIAE AGA  V+  E    D R   G++RM DP +
Sbjct  6    FTTKVGLAQMLKGGVIMDVVTPDQAKIAEEAGAVAVMALERVPADIRKDGGVARMSDPEM  65

Query  752  IKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLAIADEDHFINKHNFRVPFV  573
            I+ I  AV+IPVMAKSR+GHFVEAQILE +GVDYIDESE+L  ADE+H  NKHNF+VPFV
Sbjct  66   IQGIIEAVTIPVMAKSRIGHFVEAQILEAIGVDYIDESEVLTPADEEHHTNKHNFKVPFV  125

Query  572  CGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKVMGDIRVLNNMDEDEVFAF  393
            CGAR+LGEALRR+ EGAAMIRT+G+  G+GN+V+ VR  R +  +IR L  +D DE+F  
Sbjct  126  CGARNLGEALRRITEGAAMIRTKGE-AGTGNVVEAVRHARTMFAEIRRLQTLDPDELFVA  184

Query  392  SKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQLGCDGIFLGPEVFNCSDPY  213
            +K + APY++V Q  ++ RLPVV+FA+GGI TPADAA+MMQLG DG+F+G  +F   +P 
Sbjct  185  AKNLQAPYELVKQIAELGRLPVVNFAAGGIATPADAALMMQLGVDGVFVGSGIFKSGNPA  244

Query  212  KKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            K+  AIV+A  ++ D  +LA+ S  L +AM G+N+
Sbjct  245  KRAKAIVEATTHFRDAKLLAEISRNLGEAMVGINI  279



>ref|XP_002952566.1| hypothetical protein VOLCADRAFT_109832 [Volvox carteri f. nagariensis]
 gb|EFJ46413.1| hypothetical protein VOLCADRAFT_109832 [Volvox carteri f. nagariensis]
Length=294

 Score =   323 bits (829),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 168/282 (60%), Positives = 218/282 (77%), Gaps = 7/282 (2%)
 Frame = -1

Query  923  KNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIVSE---PDSR---GISRMPD  762
            K  F++KVG+AQML+GG I++VTT ++A+IAE AGA  V+  E    D R   G++RM D
Sbjct  5    KGTFAVKVGLAQMLKGGVIMDVTTAEEARIAEEAGAVAVMALERVPADIRRDGGVARMSD  64

Query  761  PALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLAIADEDHFINKHNFRV  582
            PA+IK IK AV+IPVMAK+R+GHFVEAQILE +GVDYIDESE+L  ADE H INKHNF+V
Sbjct  65   PAMIKAIKAAVTIPVMAKARIGHFVEAQILEALGVDYIDESEVLTPADEIHHINKHNFKV  124

Query  581  PFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKVMGDIRVLNNMDEDEV  402
            PFVCG RDLGEALRR+ EGAAMIRT+G+  G+GN+V+ VR  R VMG IR L  MD+DE+
Sbjct  125  PFVCGCRDLGEALRRIAEGAAMIRTKGE-AGTGNVVEAVRHCRAVMGAIRQLQTMDDDEL  183

Query  401  FAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQLGCDGIFLGPEVFNCS  222
            + ++K+I AP ++V QTK + RLPVV+FA+GG+ TPADAA+MMQLG DG+F+G  +F   
Sbjct  184  YVYAKEIRAPVELVRQTKHLGRLPVVNFAAGGVATPADAALMMQLGMDGVFVGSGIFKSG  243

Query  221  DPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNLVRAG  96
            DP  +  AIVQAV +YN+P VLA+ S+ L + M G+++   G
Sbjct  244  DPAARARAIVQAVTHYNNPTVLAEVSAKLGEPMVGIDIREKG  285



>ref|XP_011390262.1| putative pyridoxine biosynthesis protein SNZ1 [Ustilago maydis 
521]
 gb|KIS68242.1| putative pyridoxine biosynthesis protein SNZ1 [Ustilago maydis 
521]
Length=325

 Score =   325 bits (832),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 153/284 (54%), Positives = 215/284 (76%), Gaps = 7/284 (2%)
 Frame = -1

Query  935  TDAKKNPFSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIVSEP---DSR---GIS  774
            +DA    F +K G+AQML+GG I++V   +QA+IAE AGAC V+  E    D R   G++
Sbjct  31   SDANLGTFGVKSGLAQMLKGGVIMDVVNAEQARIAEDAGACAVMALEKIPADIRVEGGVA  90

Query  773  RMPDPALIKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLAIADEDHFINKH  594
            RM DPA+IKEI+   ++P MAK R+GH VEAQIL+ +GVDYIDESE+L  AD+ H INKH
Sbjct  91   RMSDPAMIKEIQETTTVPCMAKVRIGHIVEAQILQAIGVDYIDESEVLTPADDQHHINKH  150

Query  593  NFRVPFVCGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKVMGDIRVLNNMD  414
            NF+VPFVCGA++LGEALRR+ EGAAMIRT+G+  G+GN+V+ VR  R + G+I+ +++M 
Sbjct  151  NFKVPFVCGAKNLGEALRRISEGAAMIRTKGE-AGTGNVVEAVRHQRTIQGEIKRVSSMS  209

Query  413  EDEVFAFSKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQLGCDGIFLGPEV  234
            ++E++A++K I AP+ ++ +T ++ RLPVV+FA+GGI TPADAA+MMQLG DG+F+G  +
Sbjct  210  DEELYAYAKDIQAPFHLLKETARLKRLPVVNFAAGGIATPADAALMMQLGSDGVFVGSGI  269

Query  233  FNCSDPYKKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNLVR  102
            F  ++P ++  AIV+AV +YNDP  LA  S  L +AM GLN+ +
Sbjct  270  FKGNNPAQRARAIVEAVTHYNDPAKLAAVSENLGEAMVGLNITK  313



>gb|EKD04028.1| hypothetical protein A1Q2_01702 [Trichosporon asahii var. asahii 
CBS 8904]
Length=338

 Score =   325 bits (833),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 160/275 (58%), Positives = 210/275 (76%), Gaps = 7/275 (3%)
 Frame = -1

Query  914  FSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIVSE--PDS----RGISRMPDPAL  753
            F +K G+AQML+GG I++V  V+QAKIAE AGA  V+  E  P +     G++RM DPA+
Sbjct  48   FGVKTGLAQMLKGGVIMDVMNVEQAKIAEEAGAAAVMALERIPANIRRDGGVARMSDPAM  107

Query  752  IKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLAIADEDHFINKHNFRVPFV  573
            IKEI  AVSIPVMAK R+GH VEAQIL+ VGVDYIDESE+L +AD+ H I KH F+VPFV
Sbjct  108  IKEIIDAVSIPVMAKCRIGHSVEAQILQAVGVDYIDESEVLTMADDQHHIGKHAFKVPFV  167

Query  572  CGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKVMGDIRVLNNMDEDEVFAF  393
            CG ++LGEALRR+ EGAAMIRT+G+  G+G++V+ V+  R VM DIR    M ++E++AF
Sbjct  168  CGCKNLGEALRRISEGAAMIRTKGE-AGTGDVVEAVKHQRAVMADIRRAAAMSDEELYAF  226

Query  392  SKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQLGCDGIFLGPEVFNCSDPY  213
            +K+I APY ++ +T ++ RLPVV FA+GGI TPADAA+MMQLGCDG+F+G  +F   DP 
Sbjct  227  AKEIQAPYHLLKETARLKRLPVVSFAAGGIATPADAALMMQLGCDGVFVGSGIFLSGDPA  286

Query  212  KKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            K+  AIVQAV +YN+P VLA  SS L +AM G+++
Sbjct  287  KRARAIVQAVTHYNNPQVLADVSSNLGEAMVGISV  321



>emb|CDO70776.1| hypothetical protein BN946_scf184798.g91 [Trametes cinnabarina]
Length=339

 Score =   325 bits (833),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 156/275 (57%), Positives = 209/275 (76%), Gaps = 7/275 (3%)
 Frame = -1

Query  914  FSIKVGIAQMLRGGAIVEVTTVDQAKIAESAGACCVIVSE---PDSR---GISRMPDPAL  753
            F +K G+AQML+GG I++V   +QA+IAE AGAC V+  E    D R   G++RM DP +
Sbjct  52   FGVKSGLAQMLKGGVIMDVVNAEQARIAEEAGACAVMALERVPADIRANGGVARMSDPKM  111

Query  752  IKEIKRAVSIPVMAKSRVGHFVEAQILETVGVDYIDESELLAIADEDHFINKHNFRVPFV  573
            IKEI  AV+IPVMAK R+GHFVEAQIL+ +G+DYIDESE+L  AD++H INKH F+VPFV
Sbjct  112  IKEIVDAVTIPVMAKVRIGHFVEAQILQAIGIDYIDESEVLTPADDEHHINKHPFKVPFV  171

Query  572  CGARDLGEALRRVREGAAMIRTQGDLTGSGNIVDTVRSVRKVMGDIRVLNNMDEDEVFAF  393
            CGAR+LGEALRR+ EGAA IRT+G+  G+GN+V+ VR  R VM +IR  + M E+E++A+
Sbjct  172  CGARNLGEALRRISEGAAFIRTKGE-AGTGNVVEAVRHQRAVMSEIRKASVMSEEELYAY  230

Query  392  SKKIAAPYDIVVQTKQMARLPVVHFASGGIVTPADAAIMMQLGCDGIFLGPEVFNCSDPY  213
            +K    PY ++ +T ++  LPVV+FA+GGI TPADAA+MMQLGCDG+F+G  +F+  DP 
Sbjct  231  AKHTQVPYHLLKETARLKHLPVVNFAAGGIATPADAALMMQLGCDGVFVGSGIFHSGDPA  290

Query  212  KKVWAIVQAVRNYNDPHVLAKASSGLEDAMAGLNL  108
            K+  AIVQAV +YN+P +LA+ S  L +AM GL +
Sbjct  291  KRARAIVQAVTHYNNPKILAEISEDLGEAMVGLTI  325



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2788341287920