BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig11332

Length=642
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006349686.1|  PREDICTED: uncharacterized protein LOC102589...    202   9e-62   Solanum tuberosum [potatoes]
ref|XP_006349685.1|  PREDICTED: uncharacterized protein LOC102589...    194   2e-58   
ref|XP_009796650.1|  PREDICTED: uncharacterized protein LOC104243194    192   7e-58   Nicotiana sylvestris
ref|XP_009598934.1|  PREDICTED: uncharacterized protein LOC104094663    191   2e-57   Nicotiana tomentosiformis
ref|XP_002272980.1|  PREDICTED: uncharacterized protein LOC100244184    188   2e-56   Vitis vinifera
ref|XP_007162442.1|  hypothetical protein PHAVU_001G152500g             186   7e-56   Phaseolus vulgaris [French bean]
ref|NP_001234966.1|  uncharacterized protein LOC100306689               186   8e-56   
gb|KHN10673.1|  hypothetical protein glysoja_019104                     186   8e-56   Glycine soja [wild soybean]
ref|XP_006349684.1|  PREDICTED: uncharacterized protein LOC102589...    186   2e-55   Solanum tuberosum [potatoes]
ref|XP_002307589.1|  hypothetical protein POPTR_0005s23230g             183   2e-54   Populus trichocarpa [western balsam poplar]
ref|XP_011032695.1|  PREDICTED: uncharacterized protein LOC105131426    182   6e-54   Populus euphratica
ref|XP_012092224.1|  PREDICTED: uncharacterized protein LOC105649982    181   1e-53   Jatropha curcas
ref|XP_004290604.1|  PREDICTED: uncharacterized protein LOC101298849    181   2e-53   Fragaria vesca subsp. vesca
ref|XP_010679048.1|  PREDICTED: uncharacterized protein LOC104894499    180   3e-53   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB42118.1|  hypothetical protein B456_007G137700                    179   4e-53   Gossypium raimondii
ref|XP_006288757.1|  hypothetical protein CARUB_v10002075mg             180   4e-53   
ref|XP_004247173.1|  PREDICTED: uncharacterized protein LOC101258...    180   5e-53   Solanum lycopersicum
emb|CAN61445.1|  hypothetical protein VITISV_024138                     185   2e-52   Vitis vinifera
ref|XP_010090412.1|  hypothetical protein L484_025078                   177   4e-52   Morus notabilis
ref|XP_006349683.1|  PREDICTED: uncharacterized protein LOC102589...    178   6e-52   
ref|XP_002520725.1|  conserved hypothetical protein                     176   7e-52   Ricinus communis
emb|CDP03638.1|  unnamed protein product                                177   1e-51   Coffea canephora [robusta coffee]
ref|XP_008235297.1|  PREDICTED: uncharacterized protein LOC103334134    176   1e-51   Prunus mume [ume]
ref|XP_007200381.1|  hypothetical protein PRUPE_ppa012456mg             176   1e-51   Prunus persica
ref|XP_010256008.1|  PREDICTED: uncharacterized protein LOC104596513    176   1e-51   Nelumbo nucifera [Indian lotus]
ref|XP_008386485.1|  PREDICTED: uncharacterized protein LOC103448990    176   2e-51   Malus domestica [apple tree]
ref|XP_007050582.1|  Uncharacterized protein isoform 2                  176   2e-51   
gb|KHG14568.1|  Spindle pole body-associated CIK1                       175   3e-51   Gossypium arboreum [tree cotton]
ref|XP_002874899.1|  hypothetical protein ARALYDRAFT_490284             174   3e-51   
ref|XP_010422549.1|  PREDICTED: uncharacterized protein LOC104707814    174   6e-51   Camelina sativa [gold-of-pleasure]
ref|XP_009367634.1|  PREDICTED: uncharacterized protein LOC103957231    174   7e-51   Pyrus x bretschneideri [bai li]
ref|NP_974503.1|  uncharacterized protein                               173   1e-50   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010907567.1|  PREDICTED: uncharacterized protein LOC105034211    173   2e-50   Elaeis guineensis
emb|CDX97285.1|  BnaA02g20760D                                          172   4e-50   
emb|CDY21914.1|  BnaC09g00200D                                          171   4e-50   Brassica napus [oilseed rape]
ref|XP_009144544.1|  PREDICTED: uncharacterized protein LOC103868192    172   5e-50   Brassica rapa
gb|KFK30877.1|  hypothetical protein AALP_AA6G037500                    171   5e-50   Arabis alpina [alpine rockcress]
emb|CDX91314.1|  BnaC02g27250D                                          171   5e-50   
ref|XP_006396489.1|  hypothetical protein EUTSA_v10029025mg             171   6e-50   Eutrema salsugineum [saltwater cress]
gb|EYU40917.1|  hypothetical protein MIMGU_mgv1a015055mg                171   6e-50   Erythranthe guttata [common monkey flower]
ref|XP_010038095.1|  PREDICTED: uncharacterized protein LOC104426664    172   7e-50   Eucalyptus grandis [rose gum]
emb|CDY22076.1|  BnaA09g01050D                                          170   2e-49   Brassica napus [oilseed rape]
ref|XP_010430119.1|  PREDICTED: uncharacterized protein LOC104714449    170   2e-49   Camelina sativa [gold-of-pleasure]
ref|XP_008809865.1|  PREDICTED: uncharacterized protein LOC103721442    170   2e-49   Phoenix dactylifera
ref|XP_010455987.1|  PREDICTED: uncharacterized protein LOC104737486    170   2e-49   Camelina sativa [gold-of-pleasure]
ref|XP_009111259.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    170   2e-49   Brassica rapa
ref|XP_011082570.1|  PREDICTED: uncharacterized protein LOC105165298    169   4e-49   Sesamum indicum [beniseed]
gb|ABK23447.1|  unknown                                                 170   4e-49   Picea sitchensis
ref|XP_011621405.1|  PREDICTED: uncharacterized protein LOC18428876     169   6e-49   Amborella trichopoda
gb|KEH23777.1|  transmembrane protein, putative                         169   6e-49   Medicago truncatula
ref|XP_006444049.1|  hypothetical protein CICLE_v10022514mg             167   3e-48   Citrus clementina [clementine]
ref|XP_004140096.1|  PREDICTED: uncharacterized protein LOC101202761    167   3e-48   Cucumis sativus [cucumbers]
ref|XP_010522733.1|  PREDICTED: uncharacterized protein LOC104801239    166   9e-48   Tarenaya hassleriana [spider flower]
gb|EAY91537.1|  hypothetical protein OsI_13170                          166   1e-47   Oryza sativa Indica Group [Indian rice]
ref|XP_008449434.1|  PREDICTED: uncharacterized protein LOC103491324    165   2e-47   Cucumis melo [Oriental melon]
ref|XP_002466609.1|  hypothetical protein SORBIDRAFT_01g010980          165   2e-47   Sorghum bicolor [broomcorn]
tpg|DAA50858.1|  TPA: hypothetical protein ZEAMMB73_471178              165   2e-47   
ref|XP_004493684.1|  PREDICTED: uncharacterized protein LOC101509912    162   2e-46   Cicer arietinum [garbanzo]
ref|NP_001145097.1|  uncharacterized protein LOC100278309               162   2e-46   
dbj|BAJ87553.1|  predicted protein                                      160   1e-45   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003559537.1|  PREDICTED: uncharacterized protein LOC100840163    160   2e-45   Brachypodium distachyon [annual false brome]
ref|XP_009396878.1|  PREDICTED: uncharacterized protein LOC103981851    160   2e-45   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004982070.1|  PREDICTED: uncharacterized protein LOC101752557    159   4e-45   Setaria italica
ref|XP_010326380.1|  PREDICTED: uncharacterized protein LOC101258...    158   2e-44   Solanum lycopersicum
ref|XP_002992414.1|  hypothetical protein SELMODRAFT_49189              139   4e-38   
ref|XP_002968018.1|  hypothetical protein SELMODRAFT_440203             148   6e-37   
ref|NP_001078347.1|  uncharacterized protein                            135   3e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001783266.1|  predicted protein                                  133   7e-36   
gb|ERN00805.1|  hypothetical protein AMTR_s00103p00025680               132   5e-34   Amborella trichopoda
gb|KHN02572.1|  hypothetical protein glysoja_002596                     128   2e-33   Glycine soja [wild soybean]
tpg|DAA50857.1|  TPA: hypothetical protein ZEAMMB73_471178              125   3e-32   
gb|KJB42119.1|  hypothetical protein B456_007G137700                    118   1e-29   Gossypium raimondii
gb|EPS62257.1|  hypothetical protein M569_12536                         115   2e-29   Genlisea aurea
gb|KCW45500.1|  hypothetical protein EUGRSUZ_L007782                    111   1e-27   Eucalyptus grandis [rose gum]
gb|KCW80597.1|  hypothetical protein EUGRSUZ_C01960                   90.5    8e-20   Eucalyptus grandis [rose gum]
ref|WP_009546797.1|  MULTISPECIES: hypothetical protein               78.6    2e-15   Cyanothece
ref|WP_004159048.1|  hypothetical protein                             71.6    8e-13   Microcystis aeruginosa
ref|WP_010874233.1|  hypothetical protein                             71.6    9e-13   Synechocystis
ref|WP_019508090.1|  hypothetical protein                             71.2    1e-12   Pleurocapsa sp. PCC 7319
ref|WP_039899993.1|  hypothetical protein                             70.9    1e-12   Microcystis
ref|WP_035998133.1|  hypothetical protein                             70.9    2e-12   [Leptolyngbya] sp. JSC-1
ref|WP_015118387.1|  hypothetical protein                             70.1    3e-12   Rivularia sp. PCC 7116
ref|WP_043999446.1|  hypothetical protein                             69.7    3e-12   Microcystis aeruginosa
ref|WP_007306129.1|  hypothetical protein                             69.3    6e-12   Crocosphaera watsonii
gb|ACL46894.1|  hypothetical protein Cyan7425_4586                    69.3    7e-12   Cyanothece sp. PCC 7425
ref|WP_006507417.1|  hypothetical protein                             68.9    8e-12   Xenococcus sp. PCC 7305
ref|WP_002736158.1|  hypothetical protein                             68.6    9e-12   Microcystis
ref|WP_043997509.1|  hypothetical protein                             68.6    9e-12   Microcystis aeruginosa
ref|WP_016514583.1|  hypothetical protein                             68.6    1e-11   Microcystis
ref|WP_017327514.1|  hypothetical protein                             68.6    1e-11   Synechococcus sp. PCC 7336
ref|WP_043998036.1|  hypothetical protein                             68.2    1e-11   Microcystis aeruginosa
ref|WP_007102395.1|  hypothetical protein                             67.8    1e-11   Synechococcus sp. RS9917
ref|WP_015108331.1|  hypothetical protein                             67.8    2e-11   Cyanobium gracile
emb|CAK23602.1|  Conserved hypothetical protein                       67.4    2e-11   Synechococcus sp. WH 7803
dbj|BAG00489.1|  hypothetical protein MAE_06670                       67.4    2e-11   Microcystis aeruginosa NIES-843
ref|WP_010317840.1|  hypothetical protein                             67.0    3e-11   Synechococcus sp. CB0205
ref|WP_015133066.1|  hypothetical protein                             66.2    6e-11   Leptolyngbya sp. PCC 7376
ref|WP_013322786.1|  hypothetical protein                             66.2    6e-11   Cyanothece sp. PCC 7822
ref|WP_041237345.1|  hypothetical protein                             65.9    6e-11   
ref|WP_008314365.1|  hypothetical protein                             65.1    1e-10   Leptolyngbya sp. PCC 6406
ref|WP_011359571.1|  hypothetical protein                             65.1    2e-10   Synechococcus sp. CC9902
ref|WP_006041433.1|  hypothetical protein                             64.3    2e-10   Synechococcus sp. WH 7805
ref|WP_006909206.1|  hypothetical protein                             64.7    3e-10   Cyanobium sp. PCC 7001
ref|WP_006517125.1|  hypothetical protein                             63.9    4e-10   Leptolyngbya sp. PCC 7375
ref|WP_036484880.1|  hypothetical protein                             63.9    4e-10   Myxosarcina sp. GI1
ref|WP_011619956.1|  hypothetical protein                             63.2    6e-10   Synechococcus sp. CC9311
ref|XP_003084117.1|  Casein kinase (serine/threonine/tyrosine pro...  67.8    6e-10   
ref|XP_005643140.1|  hypothetical protein COCSUDRAFT_26336            65.1    8e-10   Coccomyxa subellipsoidea C-169
gb|KEF42722.1|  hypothetical protein ER33_04065                       63.2    8e-10   Cyanobium sp. CACIAM 14
ref|WP_015227188.1|  hypothetical protein                             62.4    9e-10   Halothece sp. PCC 7418
ref|WP_035830098.1|  hypothetical protein                             62.4    9e-10   
ref|WP_031294808.1|  hypothetical protein                             62.8    1e-09   Leptolyngbya sp. Heron Island J
gb|ESA32045.1|  putative membrane protein                             62.4    1e-09   Leptolyngbya sp. Heron Island J
ref|WP_015148486.1|  hypothetical protein                             62.4    2e-09   Oscillatoria acuminata
ref|WP_010303466.1|  hypothetical protein                             62.0    2e-09   Synechococcus sp. CB0101
ref|WP_017662533.1|  hypothetical protein                             62.0    2e-09   Geitlerinema sp. PCC 7105
ref|WP_038013452.1|  hypothetical protein                             61.6    2e-09   Synechococcus sp. WH 8016
ref|WP_017715973.1|  hypothetical protein                             61.6    2e-09   Oscillatoria sp. PCC 10802
ref|WP_044210474.1|  hypothetical protein                             62.0    2e-09   Coleofasciculus chthonoplastes
tpg|DAA50859.1|  TPA: hypothetical protein ZEAMMB73_471178            62.4    3e-09   
ref|WP_015191521.1|  hypothetical protein                             61.2    3e-09   Stanieria cyanosphaera
ref|WP_019495172.1|  hypothetical protein                             61.2    3e-09   Calothrix sp. PCC 7103
ref|WP_039730257.1|  MULTISPECIES: hypothetical protein               60.8    5e-09   Lyngbya confervoides
ref|WP_045056937.1|  hypothetical protein                             60.5    8e-09   Aliterella atlantica
ref|WP_009628809.1|  hypothetical protein                             59.7    1e-08   Pseudanabaena biceps
ref|WP_038553840.1|  hypothetical protein                             59.7    1e-08   Synechococcus sp. KORDI-52
ref|WP_035159472.1|  hypothetical protein                             59.7    1e-08   Calothrix sp. 336/3
ref|WP_036902869.1|  hypothetical protein                             59.7    1e-08   Prochlorococcus sp. MIT 0601
ref|WP_015198813.1|  hypothetical protein                             59.3    2e-08   Calothrix parietina
ref|WP_011125028.1|  MULTISPECIES: hypothetical protein               59.3    2e-08   Prochlorococcus
ref|WP_009786076.1|  hypothetical protein                             58.9    2e-08   Lyngbya sp. PCC 8106
ref|WP_009555359.1|  hypothetical protein                             58.9    3e-08   Oscillatoriales cyanobacterium JSC-12
ref|WP_035991364.1|  hypothetical protein                             58.9    3e-08   Leptolyngbya sp. KIOST-1
ref|WP_044106418.1|  hypothetical protein                             58.5    3e-08   cyanobacterium endosymbiont of Epithemia turgida
ref|WP_006620720.1|  MULTISPECIES: hypothetical protein               58.2    4e-08   Arthrospira
gb|ERT07357.1|  hypothetical protein M595_2605                        58.5    4e-08   Lyngbya aestuarii BL J
ref|WP_011610490.1|  hypothetical protein                             58.2    4e-08   Trichodesmium erythraeum
gb|AAX95647.1|  hypothetical protein                                  58.2    4e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007511258.1|  predicted protein                                60.5    5e-08   Bathycoccus prasinos
ref|WP_040483970.1|  hypothetical protein                             58.2    5e-08   Lyngbya aestuarii
ref|WP_006619425.1|  hypothetical protein                             58.2    5e-08   Arthrospira platensis
ref|WP_041237784.1|  hypothetical protein                             58.2    5e-08   Cyanothece sp. PCC 7424
ref|NP_001051000.1|  Os03g0701300                                     58.9    5e-08   
ref|WP_011936009.1|  hypothetical protein                             57.4    7e-08   Synechococcus sp. RCC307
ref|WP_015187783.1|  hypothetical protein                             57.4    8e-08   Gloeocapsa sp. PCC 7428
ref|WP_017287959.1|  hypothetical protein                             57.4    9e-08   Leptolyngbya boryana
gb|ABB35636.1|  hypothetical protein Syncc9605_1895                   57.4    1e-07   Synechococcus sp. CC9605
ref|WP_041435741.1|  hypothetical protein                             57.0    1e-07   
ref|WP_015139688.1|  hypothetical protein                             57.4    1e-07   Nostoc sp. PCC 7524
gb|EAU73741.1|  hypothetical protein RS9916_29569                     57.4    1e-07   Synechococcus sp. RS9916
ref|WP_015152373.1|  hypothetical protein                             57.0    1e-07   Chroococcidiopsis thermalis
gb|EMT22781.1|  hypothetical protein F775_42981                       57.4    1e-07   
ref|XP_001422215.1|  predicted protein                                57.0    1e-07   Ostreococcus lucimarinus CCE9901
ref|WP_015230107.1|  hypothetical protein                             56.6    1e-07   Dactylococcopsis salina
ref|WP_038024121.1|  hypothetical protein                             56.6    2e-07   
ref|WP_037217050.1|  hypothetical protein                             56.6    2e-07   
ref|WP_015170070.1|  hypothetical protein                             56.6    2e-07   Synechococcus sp. PCC 7502
ref|XP_003064501.1|  predicted protein                                56.2    2e-07   Micromonas pusilla CCMP1545
ref|WP_015145140.1|  hypothetical protein                             56.6    2e-07   Pleurocapsa minor
ref|XP_005537333.1|  hypothetical protein, conserved                  57.8    2e-07   Cyanidioschyzon merolae strain 10D
ref|WP_040697311.1|  hypothetical protein                             56.2    2e-07   
gb|EDX86967.1|  hypothetical protein S7335_4674                       56.6    3e-07   Synechococcus sp. PCC 7335
ref|WP_025362160.1|  hypothetical protein                             55.8    3e-07   Synechococcus sp. WH 8109
ref|WP_006529657.1|  hypothetical protein                             55.5    4e-07   Gloeocapsa sp. PCC 73106
ref|WP_038653757.1|  membrane protein                                 55.5    4e-07   Prochlorococcus sp. MIT 0801
ref|WP_045871611.1|  hypothetical protein                             55.5    5e-07   Nostocales
emb|CBN58768.1|  conserved hypothetical protein [ [                   55.5    5e-07   [Oscillatoria] sp. PCC 6506
ref|WP_036536154.1|  hypothetical protein                             55.1    5e-07   Neosynechococcus sphagnicola
ref|WP_026793689.1|  MULTISPECIES: hypothetical protein               55.1    6e-07   Planktothrix
ref|WP_038018176.1|  hypothetical protein                             55.1    7e-07   Synechococcus sp. PCC 7335
ref|WP_036905059.1|  membrane protein                                 54.7    8e-07   Prochlorococcus marinus
ref|NP_001183225.1|  uncharacterized protein LOC100501612             56.6    1e-06   
ref|WP_015209405.1|  hypothetical protein                             54.3    1e-06   Cylindrospermum stagnale
ref|WP_012162787.1|  hypothetical protein                             53.9    1e-06   Acaryochloris marina
ref|WP_017652940.1|  hypothetical protein                             53.9    2e-06   Fortiea contorta
ref|WP_018399556.1|  hypothetical protein                             53.9    2e-06   filamentous cyanobacterium ESFC-1
ref|WP_019501153.1|  hypothetical protein                             53.5    2e-06   Pseudanabaena sp. PCC 6802
ref|XP_006386264.1|  hypothetical protein POPTR_0002s05260g           54.7    2e-06   
ref|WP_039778442.1|  hypothetical protein                             53.9    2e-06   Acaryochloris sp. CCMEE 5410
ref|WP_011129890.1|  hypothetical protein                             53.5    2e-06   Prochlorococcus marinus
ref|WP_011294870.1|  membrane protein                                 53.1    3e-06   Prochlorococcus marinus
ref|WP_009632959.1|  hypothetical protein                             53.1    3e-06   Synechocystis sp. PCC 7509
ref|WP_036915524.1|  MULTISPECIES: hypothetical protein               53.1    3e-06   Prochlorococcus
ref|WP_015126925.1|  hypothetical protein                             53.1    4e-06   Calothrix sp. PCC 7507
ref|WP_026101668.1|  hypothetical protein                             52.8    4e-06   cyanobacterium PCC 7702
ref|WP_011824198.1|  membrane protein                                 52.4    6e-06   Prochlorococcus marinus
gb|AFY94914.1|  hypothetical protein Cha6605_3950                     52.0    8e-06   Chamaesiphon minutus PCC 6605
ref|WP_009459171.1|  MULTISPECIES: hypothetical protein               52.0    8e-06   Fischerella thermalis
ref|WP_037991175.1|  hypothetical protein                             51.6    8e-06   
ref|WP_011826385.1|  hypothetical protein                             52.0    9e-06   
ref|WP_015166291.1|  hypothetical protein                             52.0    9e-06   Pseudanabaena sp. PCC 7367
ref|WP_026736472.1|  hypothetical protein                             51.6    1e-05   Fischerella sp. PCC 9605
ref|WP_012407001.1|  hypothetical protein                             51.6    1e-05   Nostoc
ref|WP_006199207.1|  hypothetical protein                             51.2    1e-05   Nodularia spumigena
ref|WP_015185270.1|  hypothetical protein                             51.2    1e-05   Microcoleus sp. PCC 7113
ref|WP_011317125.1|  hypothetical protein                             50.8    2e-05   Trichormus variabilis
ref|WP_044077396.1|  hypothetical protein                             50.8    2e-05   
ref|WP_010996583.1|  hypothetical protein                             50.1    4e-05   Nostocaceae
ref|WP_015174984.1|  hypothetical protein                             50.1    5e-05   Oscillatoria nigro-viridis
ref|WP_016868508.1|  hypothetical protein                             50.1    5e-05   Fischerella muscicola
gb|KIF37672.1|  hypothetical protein PI95_01125                       49.7    6e-05   Hassallia byssoidea VB512170
ref|WP_013192206.1|  hypothetical protein                             49.7    6e-05   Trichormus azollae
ref|XP_008809901.1|  PREDICTED: uncharacterized protein LOC103721454  49.7    6e-05   
ref|WP_016861984.1|  hypothetical protein                             49.7    7e-05   Fischerella muscicola
gb|AFZ13285.1|  hypothetical protein Cri9333_2418                     49.7    7e-05   Crinalium epipsammum PCC 9333
ref|WP_006635664.1|  hypothetical protein                             49.3    8e-05   Microcoleus vaginatus
ref|WP_015215734.1|  hypothetical protein                             49.3    9e-05   Anabaena cylindrica
ref|WP_017312346.1|  hypothetical protein                             48.5    2e-04   Fischerella sp. PCC 9339
gb|EGJ32352.1|  hypothetical protein LYNGBM3L_19510                   48.5    2e-04   Moorea producens 3L
gb|KIE09282.1|  hypothetical protein DA73_0233440                     48.1    2e-04   Tolypothrix bouteillei VB521301
ref|WP_043691961.1|  hypothetical protein                             48.1    2e-04   Synechococcus sp. KORDI-49
ref|WP_038543930.1|  hypothetical protein                             47.8    2e-04   
ref|WP_015078909.1|  hypothetical protein                             48.1    2e-04   Anabaena sp. 90
ref|WP_039201620.1|  hypothetical protein                             47.8    3e-04   Aphanizomenon flos-aquae
ref|WP_016952610.1|  hypothetical protein                             47.8    3e-04   Anabaena sp. PCC 7108
ref|WP_028090945.1|  hypothetical protein                             47.8    4e-04   Dolichospermum circinale
ref|WP_042503158.1|  hypothetical protein                             47.4    4e-04   
ref|WP_026720363.1|  hypothetical protein                             47.4    4e-04   Hapalosiphonaceae
ref|WP_017746215.1|  hypothetical protein                             47.4    5e-04   Scytonema hofmannii
ref|WP_027404173.1|  hypothetical protein                             47.0    5e-04   Aphanizomenon flos-aquae



>ref|XP_006349686.1| PREDICTED: uncharacterized protein LOC102589024 isoform X4 [Solanum 
tuberosum]
Length=178

 Score =   202 bits (514),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 98/149 (66%), Positives = 116/149 (78%), Gaps = 3/149 (2%)
 Frame = +2

Query  131  QFSNI--SAFAPTLALITNHSRSKPIGSWRCRS-KQNEPREMAFFDENGAVKDMDAYLDN  301
            Q S+I  S+  P++  ++ H  SK   +   R    N+P+E AFFDENG V+DMD+YL++
Sbjct  30   QLSDIEFSSKLPSITFLSAHKFSKRTRTSTVRGINSNDPKESAFFDENGVVEDMDSYLNH  89

Query  302  LSLEYDSVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSY  481
            LSLEYDSVWDTKPSWCQPWTI LTG V I+ SWLILHS   TAVV+  I+AWWYIFLYSY
Sbjct  90   LSLEYDSVWDTKPSWCQPWTITLTGTVIISLSWLILHSAVATAVVMTTIAAWWYIFLYSY  149

Query  482  PKAYSEMIAERRERVTNGLEDTYGEEKSQ  568
            PKAYS+MI ERR+RVTNGLEDTYGE KSQ
Sbjct  150  PKAYSDMIEERRKRVTNGLEDTYGERKSQ  178



>ref|XP_006349685.1| PREDICTED: uncharacterized protein LOC102589024 isoform X3 [Solanum 
tuberosum]
Length=179

 Score =   194 bits (492),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 97/150 (65%), Positives = 115/150 (77%), Gaps = 4/150 (3%)
 Frame = +2

Query  131  QFSNI--SAFAPTLALITNHSRSKPIGSWRCRS-KQNEPREMAFFDENGAVKDMDAYLDN  301
            Q S+I  S+  P++  ++ H  SK   +   R    N+P+E AFFDENG V+DMD+YL++
Sbjct  30   QLSDIEFSSKLPSITFLSAHKFSKRTRTSTVRGINSNDPKESAFFDENGVVEDMDSYLNH  89

Query  302  LSLEYDSVWDTKPSW-CQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYS  478
            LSLEYDSVWDTKPS  CQPWTI LTG V I+ SWLILHS   TAVV+  I+AWWYIFLYS
Sbjct  90   LSLEYDSVWDTKPSCRCQPWTITLTGTVIISLSWLILHSAVATAVVMTTIAAWWYIFLYS  149

Query  479  YPKAYSEMIAERRERVTNGLEDTYGEEKSQ  568
            YPKAYS+MI ERR+RVTNGLEDTYGE KSQ
Sbjct  150  YPKAYSDMIEERRKRVTNGLEDTYGERKSQ  179



>ref|XP_009796650.1| PREDICTED: uncharacterized protein LOC104243194 [Nicotiana sylvestris]
Length=178

 Score =   192 bits (488),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 97/156 (62%), Positives = 114/156 (73%), Gaps = 6/156 (4%)
 Frame = +2

Query  116  CFQGHQFSNISAFAPTLA--LITNHS---RSKPIGSWRCRSKQNEPREMAFFDENGAVKD  280
            CF   Q S+ S F+  L    I++H    RS+   S R  +  +   + AFFDENG V+D
Sbjct  24   CFARSQLSD-SKFSSKLQSIAISSHKFSKRSRTSTSLRGINSNDPKEDSAFFDENGVVED  82

Query  281  MDAYLDNLSLEYDSVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWW  460
            MD+YL+ LSLEYDSVWDTKPSWCQPWTI LTG V I+ SWLILHS   TAVV+ +I AWW
Sbjct  83   MDSYLNYLSLEYDSVWDTKPSWCQPWTITLTGAVIISLSWLILHSAVATAVVMTIIGAWW  142

Query  461  YIFLYSYPKAYSEMIAERRERVTNGLEDTYGEEKSQ  568
            YIFLYSYPK+YSEMIA+RR+RVTNGLEDTYG  K Q
Sbjct  143  YIFLYSYPKSYSEMIADRRKRVTNGLEDTYGARKGQ  178



>ref|XP_009598934.1| PREDICTED: uncharacterized protein LOC104094663 [Nicotiana tomentosiformis]
Length=179

 Score =   191 bits (486),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 99/160 (62%), Positives = 114/160 (71%), Gaps = 13/160 (8%)
 Frame = +2

Query  116  CFQGHQFS-------NISAFAPTLALITNHSRSKPIGSWRCRS-KQNEPRE-MAFFDENG  268
            CF   Q S       N+ +FA +    +  SR+  I     R    N+P+E  AFFDENG
Sbjct  24   CFARSQLSDCNFSSSNLQSFAFSSNKFSKRSRTSTI----LRGINSNDPKEDSAFFDENG  79

Query  269  AVKDMDAYLDNLSLEYDSVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALI  448
             V+DMD+YL+ LSLEYDSVWDTKPSWCQPWTI LTG V I+ SWLILHS   TAVV+ +I
Sbjct  80   VVEDMDSYLNYLSLEYDSVWDTKPSWCQPWTITLTGAVIISLSWLILHSAVATAVVMTII  139

Query  449  SAWWYIFLYSYPKAYSEMIAERRERVTNGLEDTYGEEKSQ  568
             AWWYIFLYSYPK+YSEMIAERR+RVTNGLEDTYG  K Q
Sbjct  140  GAWWYIFLYSYPKSYSEMIAERRKRVTNGLEDTYGVRKGQ  179



>ref|XP_002272980.1| PREDICTED: uncharacterized protein LOC100244184 [Vitis vinifera]
 emb|CBI28702.3| unnamed protein product [Vitis vinifera]
Length=169

 Score =   188 bits (477),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/152 (62%), Positives = 116/152 (76%), Gaps = 8/152 (5%)
 Frame = +2

Query  122  QGHQFSNISAFAPTLALITNHSRSKPIG---SWRCRSKQNEPREMAFFDENGAVKDMDAY  292
            Q H FSN S F+P    I++ +R  PI    +    +  N+P+E  F DENGAV DMD Y
Sbjct  23   QTH-FSN-SIFSPK---ISSTTRKPPISRRETVAIAANPNDPKESVFMDENGAVDDMDGY  77

Query  293  LDNLSLEYDSVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFL  472
            L+ LSLEYDSVWDTKPSWCQPWTI LTG+  IA SWLILHS  +T++V+++IS WWYIFL
Sbjct  78   LNYLSLEYDSVWDTKPSWCQPWTIMLTGVSVIACSWLILHSAVITSLVLSVISLWWYIFL  137

Query  473  YSYPKAYSEMIAERRERVTNGLEDTYGEEKSQ  568
            YSYPKAYS+MIAERR++VT G+EDT+G +KSQ
Sbjct  138  YSYPKAYSDMIAERRKKVTRGVEDTFGLKKSQ  169



>ref|XP_007162442.1| hypothetical protein PHAVU_001G152500g [Phaseolus vulgaris]
 gb|ESW34436.1| hypothetical protein PHAVU_001G152500g [Phaseolus vulgaris]
Length=163

 Score =   186 bits (473),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 84/112 (75%), Positives = 101/112 (90%), Gaps = 0/112 (0%)
 Frame = +2

Query  233  EPREMAFFDENGAVKDMDAYLDNLSLEYDSVWDTKPSWCQPWTIALTGIVAIAASWLILH  412
            + ++ +FFDENGAV DM+ YL++LSLEYDSVWDTKPSWCQPWTIALTG+  IA SWLIL+
Sbjct  52   DSKDPSFFDENGAVNDMEGYLNHLSLEYDSVWDTKPSWCQPWTIALTGVAFIAISWLILN  111

Query  413  SLTLTAVVVALISAWWYIFLYSYPKAYSEMIAERRERVTNGLEDTYGEEKSQ  568
            SL +T++V +LI AWWYIFLYSYPKAYSEMIAERRERVTNG+EDT+G+ K+Q
Sbjct  112  SLLVTSLVSSLIFAWWYIFLYSYPKAYSEMIAERRERVTNGVEDTFGQRKNQ  163



>ref|NP_001234966.1| uncharacterized protein LOC100306689 [Glycine max]
 gb|ACU14986.1| unknown [Glycine max]
Length=166

 Score =   186 bits (473),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 82/110 (75%), Positives = 101/110 (92%), Gaps = 0/110 (0%)
 Frame = +2

Query  239  REMAFFDENGAVKDMDAYLDNLSLEYDSVWDTKPSWCQPWTIALTGIVAIAASWLILHSL  418
            ++ +FFDENGAV DM+ YL++LSLEYDSVWDTKPSWCQPWTIALTG+  IA SWLILHS+
Sbjct  57   KDPSFFDENGAVNDMEGYLNHLSLEYDSVWDTKPSWCQPWTIALTGVSIIAISWLILHSV  116

Query  419  TLTAVVVALISAWWYIFLYSYPKAYSEMIAERRERVTNGLEDTYGEEKSQ  568
             +T+++ +LI AWWYIFLYSYPKAYS+MIAERRERVTNG+EDT+G++K+Q
Sbjct  117  IITSLISSLICAWWYIFLYSYPKAYSDMIAERRERVTNGVEDTFGQKKNQ  166



>gb|KHN10673.1| hypothetical protein glysoja_019104 [Glycine soja]
Length=166

 Score =   186 bits (473),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 82/110 (75%), Positives = 101/110 (92%), Gaps = 0/110 (0%)
 Frame = +2

Query  239  REMAFFDENGAVKDMDAYLDNLSLEYDSVWDTKPSWCQPWTIALTGIVAIAASWLILHSL  418
            ++ +FFDENGAV DM+ YL++LSLEYDSVWDTKPSWCQPWTIALTG+  IA SWLILHS+
Sbjct  57   KDPSFFDENGAVNDMEGYLNHLSLEYDSVWDTKPSWCQPWTIALTGVSIIAISWLILHSV  116

Query  419  TLTAVVVALISAWWYIFLYSYPKAYSEMIAERRERVTNGLEDTYGEEKSQ  568
             +T+++ +LI AWWYIFLYSYPKAYS+MIAERRERVTNG+EDT+G++K+Q
Sbjct  117  IITSLISSLICAWWYIFLYSYPKAYSDMIAERRERVTNGVEDTFGQKKNQ  166



>ref|XP_006349684.1| PREDICTED: uncharacterized protein LOC102589024 isoform X2 [Solanum 
tuberosum]
Length=203

 Score =   186 bits (473),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 109/142 (77%), Gaps = 3/142 (2%)
 Frame = +2

Query  131  QFSNI--SAFAPTLALITNHSRSKPIGSWRCRS-KQNEPREMAFFDENGAVKDMDAYLDN  301
            Q S+I  S+  P++  ++ H  SK   +   R    N+P+E AFFDENG V+DMD+YL++
Sbjct  30   QLSDIEFSSKLPSITFLSAHKFSKRTRTSTVRGINSNDPKESAFFDENGVVEDMDSYLNH  89

Query  302  LSLEYDSVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSY  481
            LSLEYDSVWDTKPSWCQPWTI LTG V I+ SWLILHS   TAVV+  I+AWWYIFLYSY
Sbjct  90   LSLEYDSVWDTKPSWCQPWTITLTGTVIISLSWLILHSAVATAVVMTTIAAWWYIFLYSY  149

Query  482  PKAYSEMIAERRERVTNGLEDT  547
            PKAYS+MIAERR+ V NGLEDT
Sbjct  150  PKAYSDMIAERRKSVINGLEDT  171



>ref|XP_002307589.1| hypothetical protein POPTR_0005s23230g [Populus trichocarpa]
 gb|EEE94585.1| hypothetical protein POPTR_0005s23230g [Populus trichocarpa]
Length=174

 Score =   183 bits (465),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 89/145 (61%), Positives = 105/145 (72%), Gaps = 15/145 (10%)
 Frame = +2

Query  158  PTLALITNHSRSKPIGSWRCRSK--------QNEPREMAFFDENGAVKDMDAYLDNLSLE  313
            P ++LIT+ S        R R K         + P E  F DENGAV DMD YL+ LSLE
Sbjct  37   PHISLITSRSN-------RFRGKTVVFGGNSSDIPNESQFLDENGAVDDMDGYLNYLSLE  89

Query  314  YDSVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPKAY  493
            YDSVWDTKPSWCQPWTI LTG++ IA SWLILHS+ +T +V+ LI  WWYIFLYSYPK Y
Sbjct  90   YDSVWDTKPSWCQPWTITLTGVLVIAGSWLILHSVVVTTIVLLLICTWWYIFLYSYPKVY  149

Query  494  SEMIAERRERVTNGLEDTYGEEKSQ  568
            ++MIAERR+RVTNG+EDT+G  KSQ
Sbjct  150  ADMIAERRKRVTNGVEDTFGMTKSQ  174



>ref|XP_011032695.1| PREDICTED: uncharacterized protein LOC105131426 [Populus euphratica]
Length=174

 Score =   182 bits (461),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 88/145 (61%), Positives = 104/145 (72%), Gaps = 15/145 (10%)
 Frame = +2

Query  158  PTLALITNHSRSKPIGSWRCRSK--------QNEPREMAFFDENGAVKDMDAYLDNLSLE  313
            P +ALIT+ S        R R K         + P +  F DENGAV DMD YL+ LSLE
Sbjct  37   PQIALITSRSN-------RFRGKTVVFGGNSSDIPNDSQFLDENGAVDDMDGYLNYLSLE  89

Query  314  YDSVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPKAY  493
            YDSVWDTKPSWCQPWTI LTG++ IA SWLI HS+ +T +V+ LI  WWYIFLYSYPK Y
Sbjct  90   YDSVWDTKPSWCQPWTITLTGVLVIAGSWLIFHSVVVTTIVLLLICTWWYIFLYSYPKVY  149

Query  494  SEMIAERRERVTNGLEDTYGEEKSQ  568
            ++MIAERR+RVTNG+EDT+G  KSQ
Sbjct  150  ADMIAERRKRVTNGVEDTFGMTKSQ  174



>ref|XP_012092224.1| PREDICTED: uncharacterized protein LOC105649982 [Jatropha curcas]
 gb|KDP21449.1| hypothetical protein JCGZ_21920 [Jatropha curcas]
Length=172

 Score =   181 bits (460),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 81/114 (71%), Positives = 96/114 (84%), Gaps = 0/114 (0%)
 Frame = +2

Query  221  SKQNEPREMAFFDENGAVKDMDAYLDNLSLEYDSVWDTKPSWCQPWTIALTGIVAIAASW  400
            S   +P E  FFDENG V DMD YL++LSLEYDSVWDTKPSWCQPWTI LTG++AIA SW
Sbjct  58   SSSTDPNESQFFDENGVVDDMDGYLNSLSLEYDSVWDTKPSWCQPWTITLTGVLAIAFSW  117

Query  401  LILHSLTLTAVVVALISAWWYIFLYSYPKAYSEMIAERRERVTNGLEDTYGEEK  562
            LILHS+ +T++V+ L  +WWYIFLYSYPKAY+EMIAERR++V NG+EDTYG  K
Sbjct  118  LILHSVVVTSIVLFLTCSWWYIFLYSYPKAYAEMIAERRKKVINGVEDTYGLRK  171



>ref|XP_004290604.1| PREDICTED: uncharacterized protein LOC101298849 [Fragaria vesca 
subsp. vesca]
Length=168

 Score =   181 bits (458),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 81/116 (70%), Positives = 98/116 (84%), Gaps = 0/116 (0%)
 Frame = +2

Query  221  SKQNEPREMAFFDENGAVKDMDAYLDNLSLEYDSVWDTKPSWCQPWTIALTGIVAIAASW  400
            SK  +P+E  FFDE+GAV DMD Y++ LSLEYDSVWDTKPSWCQPWTI LTG++ IA SW
Sbjct  53   SKSVDPKESQFFDEDGAVDDMDGYMNYLSLEYDSVWDTKPSWCQPWTITLTGVLVIAFSW  112

Query  401  LILHSLTLTAVVVALISAWWYIFLYSYPKAYSEMIAERRERVTNGLEDTYGEEKSQ  568
            LILHS+  T VVV LI  WWYIFLYSYPKAY++MIAERR+RV+NG+EDT+G  +++
Sbjct  113  LILHSVLATGVVVFLIGLWWYIFLYSYPKAYADMIAERRKRVSNGVEDTFGLRETR  168



>ref|XP_010679048.1| PREDICTED: uncharacterized protein LOC104894499 [Beta vulgaris 
subsp. vulgaris]
Length=171

 Score =   180 bits (456),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 82/121 (68%), Positives = 99/121 (82%), Gaps = 2/121 (2%)
 Frame = +2

Query  212  RCRSKQNEPREM--AFFDENGAVKDMDAYLDNLSLEYDSVWDTKPSWCQPWTIALTGIVA  385
            + RSK N+P E+   F D+NG V DM+ YL++LSLEYDSVWDTKPSWCQPWTI+LTG+  
Sbjct  51   KLRSKSNDPAEIDPMFLDKNGVVDDMETYLNSLSLEYDSVWDTKPSWCQPWTISLTGVSV  110

Query  386  IAASWLILHSLTLTAVVVALISAWWYIFLYSYPKAYSEMIAERRERVTNGLEDTYGEEKS  565
            IA SWL+LHS+ +TA+V +LI AWWYIFLYSYPK YS+MI+ERRERV +G EDTYG  K 
Sbjct  111  IAGSWLVLHSIVITALVSSLICAWWYIFLYSYPKTYSDMISERRERVKSGSEDTYGWSKK  170

Query  566  Q  568
            Q
Sbjct  171  Q  171



>gb|KJB42118.1| hypothetical protein B456_007G137700 [Gossypium raimondii]
Length=164

 Score =   179 bits (455),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 89/147 (61%), Positives = 106/147 (72%), Gaps = 6/147 (4%)
 Frame = +2

Query  143  ISAFAPTLALI-----TNHSRSKPIGSWRCRSKQNEPREMAFFDENGAVKDMDAYLDNLS  307
            ++ FAP   LI     T+  RSK + ++       + +E  F DENG V+DMD YL+NLS
Sbjct  19   LNNFAPKTHLIFFAASTSKLRSKTV-AFGGNPPDPKQKEYLFLDENGVVEDMDGYLNNLS  77

Query  308  LEYDSVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPK  487
            LEY+SVWDTKPSWCQPWTI LTG++ IA SWLILHSL +TA     I  WWYIFLYSYPK
Sbjct  78   LEYESVWDTKPSWCQPWTITLTGLLVIACSWLILHSLVVTAFATLGICTWWYIFLYSYPK  137

Query  488  AYSEMIAERRERVTNGLEDTYGEEKSQ  568
            AY EMIAERRERV NG+EDT+G  K+Q
Sbjct  138  AYMEMIAERRERVENGVEDTFGMSKNQ  164



>ref|XP_006288757.1| hypothetical protein CARUB_v10002075mg, partial [Capsella rubella]
 gb|EOA21655.1| hypothetical protein CARUB_v10002075mg, partial [Capsella rubella]
Length=180

 Score =   180 bits (456),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 83/128 (65%), Positives = 101/128 (79%), Gaps = 4/128 (3%)
 Frame = +2

Query  194  KPIG-SWRCRS---KQNEPREMAFFDENGAVKDMDAYLDNLSLEYDSVWDTKPSWCQPWT  361
            KPI  S + RS    + EP++  F DENG V DM+ +LDNLSLEYDSVWDTKPSWCQPWT
Sbjct  52   KPIRFSTKIRSFGGNRREPKDSRFVDENGVVDDMEGFLDNLSLEYDSVWDTKPSWCQPWT  111

Query  362  IALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPKAYSEMIAERRERVTNGLE  541
            I LTG+  +A SWLILHS+ ++++ V LI AWWYIFLYSYPK+YSEMIAERR+RV +G E
Sbjct  112  IMLTGVSIVACSWLILHSIVVSSLAVGLIGAWWYIFLYSYPKSYSEMIAERRKRVADGFE  171

Query  542  DTYGEEKS  565
            D YG+ K+
Sbjct  172  DIYGDNKT  179



>ref|XP_004247173.1| PREDICTED: uncharacterized protein LOC101258483 isoform X2 [Solanum 
lycopersicum]
Length=178

 Score =   180 bits (456),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 94/149 (63%), Positives = 113/149 (76%), Gaps = 3/149 (2%)
 Frame = +2

Query  131  QFSNI--SAFAPTLALITNHSRSKPIGSWRCRS-KQNEPREMAFFDENGAVKDMDAYLDN  301
            Q S+I  S+  P++  +++H   K   +   R    N+P+E AFF+ENG V+DMD+YL+ 
Sbjct  30   QLSDIEFSSKLPSITSLSSHKFCKRTRTSTVRGINSNDPKESAFFNENGVVEDMDSYLNY  89

Query  302  LSLEYDSVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSY  481
            LSLEYDSVWDTKPSWCQPWTI LTG V I+ SWLILHS   TAVV   I+AWWYIFLYSY
Sbjct  90   LSLEYDSVWDTKPSWCQPWTITLTGTVIISLSWLILHSAVATAVVTTTIAAWWYIFLYSY  149

Query  482  PKAYSEMIAERRERVTNGLEDTYGEEKSQ  568
            PKAYS+MI ERR+RVTNGLEDTYG+ K Q
Sbjct  150  PKAYSDMIEERRKRVTNGLEDTYGDRKRQ  178



>emb|CAN61445.1| hypothetical protein VITISV_024138 [Vitis vinifera]
Length=416

 Score =   185 bits (470),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 82/113 (73%), Positives = 100/113 (88%), Gaps = 0/113 (0%)
 Frame = +2

Query  230  NEPREMAFFDENGAVKDMDAYLDNLSLEYDSVWDTKPSWCQPWTIALTGIVAIAASWLIL  409
            N+P+E  F DENGAV DMD YL++LSLEYDSVWDTKPSWCQPWTI LTG+  IA SWLIL
Sbjct  304  NDPKESVFMDENGAVDDMDGYLNHLSLEYDSVWDTKPSWCQPWTIMLTGVSXIACSWLIL  363

Query  410  HSLTLTAVVVALISAWWYIFLYSYPKAYSEMIAERRERVTNGLEDTYGEEKSQ  568
            HS  +T++V+++IS WWYIFLYSYPKAYS+MIAERR++VT+G+EDT+G +KSQ
Sbjct  364  HSAVITSLVLSVISLWWYIFLYSYPKAYSDMIAERRKKVTSGVEDTFGLKKSQ  416



>ref|XP_010090412.1| hypothetical protein L484_025078 [Morus notabilis]
 gb|EXB39382.1| hypothetical protein L484_025078 [Morus notabilis]
Length=170

 Score =   177 bits (449),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 82/116 (71%), Positives = 93/116 (80%), Gaps = 0/116 (0%)
 Frame = +2

Query  221  SKQNEPREMAFFDENGAVKDMDAYLDNLSLEYDSVWDTKPSWCQPWTIALTGIVAIAASW  400
            S  ++  E  F DENG V DMD YL+ LSLEYDSVWDTKPSWCQPWTI LTG+ AIA SW
Sbjct  53   SNSSDRNESQFLDENGVVDDMDGYLNYLSLEYDSVWDTKPSWCQPWTITLTGVSAIALSW  112

Query  401  LILHSLTLTAVVVALISAWWYIFLYSYPKAYSEMIAERRERVTNGLEDTYGEEKSQ  568
            LILHS+ +T VV  L+ AWWYIFLYSYPKAY +MIAERR++VTNG EDT+G  KSQ
Sbjct  113  LILHSVLVTTVVSLLMCAWWYIFLYSYPKAYEDMIAERRKKVTNGAEDTFGLTKSQ  168



>ref|XP_006349683.1| PREDICTED: uncharacterized protein LOC102589024 isoform X1 [Solanum 
tuberosum]
Length=204

 Score =   178 bits (451),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 90/143 (63%), Positives = 108/143 (76%), Gaps = 4/143 (3%)
 Frame = +2

Query  131  QFSNI--SAFAPTLALITNHSRSKPIGSWRCRS-KQNEPREMAFFDENGAVKDMDAYLDN  301
            Q S+I  S+  P++  ++ H  SK   +   R    N+P+E AFFDENG V+DMD+YL++
Sbjct  30   QLSDIEFSSKLPSITFLSAHKFSKRTRTSTVRGINSNDPKESAFFDENGVVEDMDSYLNH  89

Query  302  LSLEYDSVWDTKPSW-CQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYS  478
            LSLEYDSVWDTKPS  CQPWTI LTG V I+ SWLILHS   TAVV+  I+AWWYIFLYS
Sbjct  90   LSLEYDSVWDTKPSCRCQPWTITLTGTVIISLSWLILHSAVATAVVMTTIAAWWYIFLYS  149

Query  479  YPKAYSEMIAERRERVTNGLEDT  547
            YPKAYS+MIAERR+ V NGLEDT
Sbjct  150  YPKAYSDMIAERRKSVINGLEDT  172



>ref|XP_002520725.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF41687.1| conserved hypothetical protein [Ricinus communis]
Length=173

 Score =   176 bits (447),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = +2

Query  230  NEPREMAFFDENGAVKDMDAYLDNLSLEYDSVWDTKPSWCQPWTIALTGIVAIAASWLIL  409
            ++P E  F DENG V DMD YL+ LSLEYDSVWDTKPSWCQPWTIA+TG+  IA SWLI 
Sbjct  61   SDPNESQFLDENGVVDDMDGYLNYLSLEYDSVWDTKPSWCQPWTIAVTGVSGIACSWLIF  120

Query  410  HSLTLTAVVVALISAWWYIFLYSYPKAYSEMIAERRERVTNGLEDTYGEEKSQ  568
            HS+ +T+VV+ L+ +WWYIFLYSYPKAY+EMIAERR++VT+G EDTYG +K Q
Sbjct  121  HSVVVTSVVLFLVCSWWYIFLYSYPKAYAEMIAERRKKVTSGSEDTYGWKKIQ  173



>emb|CDP03638.1| unnamed protein product [Coffea canephora]
Length=206

 Score =   177 bits (449),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 84/146 (58%), Positives = 109/146 (75%), Gaps = 1/146 (1%)
 Frame = +2

Query  116  CFQGHQFSNISAFAPTLALITNHSRSKPIGSWRCRSKQNEPREMAFFDENGAVKDMDAYL  295
            CF     +++ +   T   I+ +   KP  + +  ++ ++PRE +FFDE+G V+DMD YL
Sbjct  44   CFNYSLVTSLLSPKLTTTSISANKPFKPCAATK-SNRSHDPRESSFFDEDGVVRDMDGYL  102

Query  296  DNLSLEYDSVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLY  475
            + LSLEYDSVWDTKPSWCQPWTI  TG++ IA SWL L SL +TA V+ L+ AWWYIFL+
Sbjct  103  NYLSLEYDSVWDTKPSWCQPWTITTTGVLLIAGSWLFLRSLIVTAGVMGLVCAWWYIFLH  162

Query  476  SYPKAYSEMIAERRERVTNGLEDTYG  553
            SYPKAY EMIAERR+RVT+G+EDTYG
Sbjct  163  SYPKAYLEMIAERRKRVTSGVEDTYG  188



>ref|XP_008235297.1| PREDICTED: uncharacterized protein LOC103334134 [Prunus mume]
Length=169

 Score =   176 bits (446),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 79/116 (68%), Positives = 93/116 (80%), Gaps = 0/116 (0%)
 Frame = +2

Query  221  SKQNEPREMAFFDENGAVKDMDAYLDNLSLEYDSVWDTKPSWCQPWTIALTGIVAIAASW  400
            S   +P+E  F DENG V DMD Y++ LSLEYDSVWDTKPSWCQPWTI LTG++ I  SW
Sbjct  54   SNSIDPKESEFLDENGVVDDMDGYMNYLSLEYDSVWDTKPSWCQPWTITLTGVLVIGGSW  113

Query  401  LILHSLTLTAVVVALISAWWYIFLYSYPKAYSEMIAERRERVTNGLEDTYGEEKSQ  568
            LIL+S+ +T +   LIS WWYIFLYSYPKAY++MIAERR RVTNG+EDT+G  KSQ
Sbjct  114  LILNSVVITVLAGLLISTWWYIFLYSYPKAYADMIAERRSRVTNGVEDTFGLGKSQ  169



>ref|XP_007200381.1| hypothetical protein PRUPE_ppa012456mg [Prunus persica]
 gb|EMJ01580.1| hypothetical protein PRUPE_ppa012456mg [Prunus persica]
Length=169

 Score =   176 bits (445),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 78/116 (67%), Positives = 93/116 (80%), Gaps = 0/116 (0%)
 Frame = +2

Query  221  SKQNEPREMAFFDENGAVKDMDAYLDNLSLEYDSVWDTKPSWCQPWTIALTGIVAIAASW  400
            S   +P+E  F DENG V DMD Y++ LSLEYDSVWDTKPSWCQPWTI LTG++ I  SW
Sbjct  54   SNSIDPKESEFLDENGVVDDMDGYMNYLSLEYDSVWDTKPSWCQPWTITLTGVLVIGGSW  113

Query  401  LILHSLTLTAVVVALISAWWYIFLYSYPKAYSEMIAERRERVTNGLEDTYGEEKSQ  568
            LIL+S+ +T +   LIS WW+IFLYSYPKAY++MIAERR RVTNG+EDT+G  KSQ
Sbjct  114  LILNSVVITVLAALLISTWWFIFLYSYPKAYADMIAERRSRVTNGVEDTFGLGKSQ  169



>ref|XP_010256008.1| PREDICTED: uncharacterized protein LOC104596513 [Nelumbo nucifera]
Length=169

 Score =   176 bits (445),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 78/117 (67%), Positives = 95/117 (81%), Gaps = 0/117 (0%)
 Frame = +2

Query  218  RSKQNEPREMAFFDENGAVKDMDAYLDNLSLEYDSVWDTKPSWCQPWTIALTGIVAIAAS  397
            R  +N+  E  F DENG V+DMD Y++ LSLEYDSVWDTKPSWCQPWTI  TG++ I  S
Sbjct  53   RCNRNDLNESRFVDENGVVEDMDGYMNYLSLEYDSVWDTKPSWCQPWTIMFTGLLVITFS  112

Query  398  WLILHSLTLTAVVVALISAWWYIFLYSYPKAYSEMIAERRERVTNGLEDTYGEEKSQ  568
            WLILHSL +T VV++LI  WWY+FLY+YPKAYS+MIAERRE+V +G+EDT+G  KSQ
Sbjct  113  WLILHSLPVTIVVLSLICVWWYLFLYAYPKAYSDMIAERREKVRSGVEDTFGLRKSQ  169



>ref|XP_008386485.1| PREDICTED: uncharacterized protein LOC103448990 [Malus domestica]
Length=171

 Score =   176 bits (445),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 78/116 (67%), Positives = 92/116 (79%), Gaps = 0/116 (0%)
 Frame = +2

Query  221  SKQNEPREMAFFDENGAVKDMDAYLDNLSLEYDSVWDTKPSWCQPWTIALTGIVAIAASW  400
            S   +P+E  F DE+G V DMD Y++ LSLEYDSVWDTKPSWCQPWTI LTG+V I  SW
Sbjct  56   SNSIDPKESQFLDEDGVVDDMDGYMNYLSLEYDSVWDTKPSWCQPWTITLTGVVVIGGSW  115

Query  401  LILHSLTLTAVVVALISAWWYIFLYSYPKAYSEMIAERRERVTNGLEDTYGEEKSQ  568
            LILHS+ +T +   LIS WWYIFLYSYPKAY++MIAERR +V NG+EDT+G  KSQ
Sbjct  116  LILHSVVVTILATLLISTWWYIFLYSYPKAYADMIAERRSKVNNGVEDTFGFGKSQ  171



>ref|XP_007050582.1| Uncharacterized protein isoform 2, partial [Theobroma cacao]
 gb|EOX94739.1| Uncharacterized protein isoform 2, partial [Theobroma cacao]
Length=201

 Score =   176 bits (447),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 82/116 (71%), Positives = 94/116 (81%), Gaps = 3/116 (3%)
 Frame = +2

Query  221  SKQNEPREMAFFDENGAVKDMDAYLDNLSLEYDSVWDTKPSWCQPWTIALTGIVAIAASW  400
            SKQNE     F DENG V+DMD YL+ LSLEYDSVWDTKPSWCQPWTI LTG++ +A+SW
Sbjct  89   SKQNE---HLFLDENGVVEDMDGYLNYLSLEYDSVWDTKPSWCQPWTITLTGMMVVASSW  145

Query  401  LILHSLTLTAVVVALISAWWYIFLYSYPKAYSEMIAERRERVTNGLEDTYGEEKSQ  568
            LILHS+ +TA+    I  WWYIFLYSYPKAY +MIAERRERVTNG EDT+G  K+Q
Sbjct  146  LILHSVLVTALATVGICTWWYIFLYSYPKAYVDMIAERRERVTNGTEDTFGMRKNQ  201



>gb|KHG14568.1| Spindle pole body-associated CIK1 [Gossypium arboreum]
 gb|KHG17075.1| Spindle pole body-associated CIK1 [Gossypium arboreum]
Length=164

 Score =   175 bits (443),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 88/147 (60%), Positives = 104/147 (71%), Gaps = 6/147 (4%)
 Frame = +2

Query  143  ISAFAPTLALI-----TNHSRSKPIGSWRCRSKQNEPREMAFFDENGAVKDMDAYLDNLS  307
            +S FAP   LI     T+  RSK + ++       + +E  F DENG V+D+D YL+NLS
Sbjct  19   LSKFAPKTHLIFFVASTSKLRSKTV-AFGGNPPDPKQKEYLFLDENGVVEDIDGYLNNLS  77

Query  308  LEYDSVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPK  487
            LEY+SVWDTKPSWCQPWTI LTG + IA SWLIL SL +TA     I  WWYIFLYSYPK
Sbjct  78   LEYESVWDTKPSWCQPWTITLTGSLVIACSWLILRSLVVTAFATVGICTWWYIFLYSYPK  137

Query  488  AYSEMIAERRERVTNGLEDTYGEEKSQ  568
            AY EMIAERRERV NG+EDT+G  K+Q
Sbjct  138  AYMEMIAERRERVENGVEDTFGMSKNQ  164



>ref|XP_002874899.1| hypothetical protein ARALYDRAFT_490284 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51158.1| hypothetical protein ARALYDRAFT_490284 [Arabidopsis lyrata subsp. 
lyrata]
Length=165

 Score =   174 bits (442),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 75/113 (66%), Positives = 94/113 (83%), Gaps = 0/113 (0%)
 Frame = +2

Query  227  QNEPREMAFFDENGAVKDMDAYLDNLSLEYDSVWDTKPSWCQPWTIALTGIVAIAASWLI  406
            + EP++  F DENG V DM+ +LDNLSLEYDSVWDTKPSWCQPWTI LTG+  +A SW+I
Sbjct  52   RREPKDSRFSDENGVVDDMEGFLDNLSLEYDSVWDTKPSWCQPWTIMLTGLSIVACSWVI  111

Query  407  LHSLTLTAVVVALISAWWYIFLYSYPKAYSEMIAERRERVTNGLEDTYGEEKS  565
            LHS+ ++++ V +I AWWYIFLYSYPK+YSEMIAERR+RV +G ED YG+ K+
Sbjct  112  LHSVIVSSLAVGVIGAWWYIFLYSYPKSYSEMIAERRKRVADGFEDIYGKNKT  164



>ref|XP_010422549.1| PREDICTED: uncharacterized protein LOC104707814 [Camelina sativa]
Length=165

 Score =   174 bits (441),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 75/113 (66%), Positives = 94/113 (83%), Gaps = 0/113 (0%)
 Frame = +2

Query  227  QNEPREMAFFDENGAVKDMDAYLDNLSLEYDSVWDTKPSWCQPWTIALTGIVAIAASWLI  406
            + EP++  F +E+G V DM+  LDNLSLEYDSVWDTKPSWCQPWTI LTG+  +A SWLI
Sbjct  52   RREPKDSRFVNESGVVDDMEGLLDNLSLEYDSVWDTKPSWCQPWTIMLTGVSIVACSWLI  111

Query  407  LHSLTLTAVVVALISAWWYIFLYSYPKAYSEMIAERRERVTNGLEDTYGEEKS  565
            LHS+ ++++ V LI AWWYIFLYSYPK+YSEMIAERR+RV++G ED YG+ K+
Sbjct  112  LHSVVVSSLAVGLIGAWWYIFLYSYPKSYSEMIAERRKRVSDGFEDIYGKNKT  164



>ref|XP_009367634.1| PREDICTED: uncharacterized protein LOC103957231 [Pyrus x bretschneideri]
Length=171

 Score =   174 bits (441),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 77/112 (69%), Positives = 90/112 (80%), Gaps = 0/112 (0%)
 Frame = +2

Query  233  EPREMAFFDENGAVKDMDAYLDNLSLEYDSVWDTKPSWCQPWTIALTGIVAIAASWLILH  412
            +P+E  F DE+G V DMD Y++ LSLEYDSVWDTKPSWCQPWTI LTG+V I  SWLILH
Sbjct  60   DPKESQFLDEDGVVDDMDGYMNYLSLEYDSVWDTKPSWCQPWTITLTGVVVIGGSWLILH  119

Query  413  SLTLTAVVVALISAWWYIFLYSYPKAYSEMIAERRERVTNGLEDTYGEEKSQ  568
            S  +T +   LIS WWYIFLYSYPKAY++MIAERR +V NG+EDT+G  KSQ
Sbjct  120  SGVVTILATLLISTWWYIFLYSYPKAYADMIAERRSKVNNGVEDTFGFGKSQ  171



>ref|NP_974503.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAT71938.1| At4g02725 [Arabidopsis thaliana]
 gb|AAU15166.1| At4g02725 [Arabidopsis thaliana]
 gb|AEE82219.1| uncharacterized protein AT4G02725 [Arabidopsis thaliana]
Length=165

 Score =   173 bits (439),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 80/127 (63%), Positives = 99/127 (78%), Gaps = 4/127 (3%)
 Frame = +2

Query  194  KPIG-SWRCRS---KQNEPREMAFFDENGAVKDMDAYLDNLSLEYDSVWDTKPSWCQPWT  361
            KPI  S + RS    + EP++  F DE G V DM+ +LDNLSLEYDSVWDTKPSWCQPWT
Sbjct  37   KPIRISTKVRSFGGNRREPKDSRFVDEKGVVDDMEGFLDNLSLEYDSVWDTKPSWCQPWT  96

Query  362  IALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPKAYSEMIAERRERVTNGLE  541
            I LTG+  +A SW+ILHS+ ++++ V +I AWWYIFLYSYPK+YSEMIAERR+RV +G E
Sbjct  97   IMLTGLSIVACSWVILHSVIVSSLAVGVIGAWWYIFLYSYPKSYSEMIAERRKRVADGFE  156

Query  542  DTYGEEK  562
            D YG+ K
Sbjct  157  DIYGKNK  163



>ref|XP_010907567.1| PREDICTED: uncharacterized protein LOC105034211 [Elaeis guineensis]
Length=171

 Score =   173 bits (438),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 77/106 (73%), Positives = 92/106 (87%), Gaps = 0/106 (0%)
 Frame = +2

Query  251  FFDENGAVKDMDAYLDNLSLEYDSVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTA  430
            F DE+G V D+D YL+ LSLEYDSVWDTKPSWCQPWTI LTG++ ++ SWL LHSL +TA
Sbjct  66   FLDEDGVVDDIDGYLNYLSLEYDSVWDTKPSWCQPWTILLTGVIVVSCSWLFLHSLIITA  125

Query  431  VVVALISAWWYIFLYSYPKAYSEMIAERRERVTNGLEDTYGEEKSQ  568
             V++LI AWWYIFLYSYPKAYS+MIAERR++VT+GLEDT+G  KSQ
Sbjct  126  GVLSLICAWWYIFLYSYPKAYSDMIAERRKKVTSGLEDTFGLRKSQ  171



>emb|CDX97285.1| BnaA02g20760D [Brassica napus]
Length=166

 Score =   172 bits (435),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 77/112 (69%), Positives = 94/112 (84%), Gaps = 3/112 (3%)
 Frame = +2

Query  227  QNEPREMAFFDENGAVKDMDAYLDNLSLEYDSVWDTKPSWCQPWTIALTGIVAIAASWLI  406
            QN+ R   F DENG V+DM+ YLD+LSLEYDSVWDTKPSWCQPWTI +TG+  +A SW+I
Sbjct  55   QNDSR---FVDENGGVEDMEGYLDHLSLEYDSVWDTKPSWCQPWTIVVTGLSIVACSWVI  111

Query  407  LHSLTLTAVVVALISAWWYIFLYSYPKAYSEMIAERRERVTNGLEDTYGEEK  562
            LHS+ ++++ VALI AWWYIFLYSYPK+YSEMIAERR RV +G ED YG++K
Sbjct  112  LHSVLVSSLAVALIGAWWYIFLYSYPKSYSEMIAERRARVADGFEDIYGKDK  163



>emb|CDY21914.1| BnaC09g00200D [Brassica napus]
Length=161

 Score =   171 bits (434),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 77/129 (60%), Positives = 100/129 (78%), Gaps = 3/129 (2%)
 Frame = +2

Query  179  NHSRSKPIGSWRCRSKQNEPREMAFFDENGAVKDMDAYLDNLSLEYDSVWDTKPSWCQPW  358
            N + ++ +   R   ++N+ R   F DENGAV DM+ YLDNLSLEYDSVWDTKPSWCQPW
Sbjct  35   NLNPTRTVSKVRGLREENDSR---FVDENGAVDDMEGYLDNLSLEYDSVWDTKPSWCQPW  91

Query  359  TIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPKAYSEMIAERRERVTNGL  538
            TI +TG+  +A SW+ILHS+ ++++ V L+ AWWYIFLYSYPK+Y EMIAERR+RV +G 
Sbjct  92   TIMVTGLSIVACSWVILHSVLVSSLAVGLVGAWWYIFLYSYPKSYLEMIAERRKRVADGF  151

Query  539  EDTYGEEKS  565
            ED YG+ K+
Sbjct  152  EDIYGKNKT  160



>ref|XP_009144544.1| PREDICTED: uncharacterized protein LOC103868192 [Brassica rapa]
Length=166

 Score =   172 bits (435),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 77/112 (69%), Positives = 94/112 (84%), Gaps = 3/112 (3%)
 Frame = +2

Query  227  QNEPREMAFFDENGAVKDMDAYLDNLSLEYDSVWDTKPSWCQPWTIALTGIVAIAASWLI  406
            QN+ R   F DENG V+DM+ YLD+LSLEYDSVWDTKPSWCQPWTI +TG+  +A SW+I
Sbjct  55   QNDSR---FVDENGGVEDMEGYLDHLSLEYDSVWDTKPSWCQPWTIVVTGLSIVACSWVI  111

Query  407  LHSLTLTAVVVALISAWWYIFLYSYPKAYSEMIAERRERVTNGLEDTYGEEK  562
            LHS+ ++++ VALI+AWWYIFLYSYPK+YSEMIAERR RV +G ED YG+ K
Sbjct  112  LHSVLVSSLAVALIAAWWYIFLYSYPKSYSEMIAERRARVADGFEDIYGKNK  163



>gb|KFK30877.1| hypothetical protein AALP_AA6G037500 [Arabis alpina]
Length=164

 Score =   171 bits (434),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 74/113 (65%), Positives = 92/113 (81%), Gaps = 0/113 (0%)
 Frame = +2

Query  227  QNEPREMAFFDENGAVKDMDAYLDNLSLEYDSVWDTKPSWCQPWTIALTGIVAIAASWLI  406
            + E ++  F DENG V DM+ +LDNLSLEYDSVWDTKP WCQPWTI LTG+  +A SW+I
Sbjct  51   RREKKDSRFVDENGVVDDMEGFLDNLSLEYDSVWDTKPYWCQPWTIMLTGLSIVACSWVI  110

Query  407  LHSLTLTAVVVALISAWWYIFLYSYPKAYSEMIAERRERVTNGLEDTYGEEKS  565
            +HS+ ++++ V LI AWWYIFLYSYPK+YSEMIAERR+RV +G ED YG+ KS
Sbjct  111  MHSVVVSSLAVGLIGAWWYIFLYSYPKSYSEMIAERRKRVADGFEDIYGKNKS  163



>emb|CDX91314.1| BnaC02g27250D [Brassica napus]
Length=166

 Score =   171 bits (434),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 77/112 (69%), Positives = 93/112 (83%), Gaps = 3/112 (3%)
 Frame = +2

Query  227  QNEPREMAFFDENGAVKDMDAYLDNLSLEYDSVWDTKPSWCQPWTIALTGIVAIAASWLI  406
            QN+ R   F DENG V+DM+ YLD+LSLEYDSVWDTKPSWCQPWTI +TG+  +A SW+I
Sbjct  55   QNDSR---FVDENGGVEDMEGYLDHLSLEYDSVWDTKPSWCQPWTIVVTGLSIVACSWVI  111

Query  407  LHSLTLTAVVVALISAWWYIFLYSYPKAYSEMIAERRERVTNGLEDTYGEEK  562
            LHS+ ++++ VALI AWWYIFLYSYPK+YSEMIAERR RV +G ED YG+ K
Sbjct  112  LHSVLVSSLAVALIGAWWYIFLYSYPKSYSEMIAERRARVADGFEDIYGKNK  163



>ref|XP_006396489.1| hypothetical protein EUTSA_v10029025mg [Eutrema salsugineum]
 gb|ESQ37942.1| hypothetical protein EUTSA_v10029025mg [Eutrema salsugineum]
Length=167

 Score =   171 bits (434),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 75/113 (66%), Positives = 93/113 (82%), Gaps = 0/113 (0%)
 Frame = +2

Query  227  QNEPREMAFFDENGAVKDMDAYLDNLSLEYDSVWDTKPSWCQPWTIALTGIVAIAASWLI  406
            + E ++  F +ENGA+ DM+ YLD+LSLEYDSVWDTKPSWCQPWTI LTG+  +A SW I
Sbjct  54   RREEKDSRFVNENGAIDDMEGYLDHLSLEYDSVWDTKPSWCQPWTIMLTGLSIVACSWAI  113

Query  407  LHSLTLTAVVVALISAWWYIFLYSYPKAYSEMIAERRERVTNGLEDTYGEEKS  565
            LHS+ ++++   LI AWWYIFLYSYPK+YSEMIAERR+RV +G EDTYG+ KS
Sbjct  114  LHSVLVSSLAGGLIGAWWYIFLYSYPKSYSEMIAERRKRVADGFEDTYGKNKS  166



>gb|EYU40917.1| hypothetical protein MIMGU_mgv1a015055mg [Erythranthe guttata]
Length=169

 Score =   171 bits (434),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 76/110 (69%), Positives = 93/110 (85%), Gaps = 0/110 (0%)
 Frame = +2

Query  239  REMAFFDENGAVKDMDAYLDNLSLEYDSVWDTKPSWCQPWTIALTGIVAIAASWLILHSL  418
            ++ +FFDENGAV+DMD YL+ LSLEYDSVWDTKPSWCQPWTIALTG+     SWL+L+S+
Sbjct  60   KDPSFFDENGAVEDMDGYLNYLSLEYDSVWDTKPSWCQPWTIALTGVGITGGSWLVLNSV  119

Query  419  TLTAVVVALISAWWYIFLYSYPKAYSEMIAERRERVTNGLEDTYGEEKSQ  568
             +T++V  LIS WWYIFLYSYPKAYS+MIAERR++V  G EDTYG++  Q
Sbjct  120  VVTSIVATLISLWWYIFLYSYPKAYSDMIAERRKKVKGGTEDTYGKQTWQ  169



>ref|XP_010038095.1| PREDICTED: uncharacterized protein LOC104426664 [Eucalyptus grandis]
 gb|KCW49902.1| hypothetical protein EUGRSUZ_K03368 [Eucalyptus grandis]
Length=179

 Score =   172 bits (435),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 83/143 (58%), Positives = 102/143 (71%), Gaps = 6/143 (4%)
 Frame = +2

Query  158  PTLALITNHSRSKPI------GSWRCRSKQNEPREMAFFDENGAVKDMDAYLDNLSLEYD  319
            P L+   + SR K        GS    +  NE  E AF DENG V DMD YL+ LS EY+
Sbjct  30   PVLSARASSSRGKAAAGNSRRGSAAFATGSNERSESAFVDENGVVDDMDGYLNYLSPEYE  89

Query  320  SVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPKAYSE  499
            SVWDTKPSWCQPWTI LTG++AIA SWLILHS+ +T ++  LI +WWYIFLYSYPKAY++
Sbjct  90   SVWDTKPSWCQPWTITLTGMLAIAGSWLILHSMLVTTIISLLICSWWYIFLYSYPKAYTD  149

Query  500  MIAERRERVTNGLEDTYGEEKSQ  568
            MIAERR+RV +G+ED +G  K+ 
Sbjct  150  MIAERRKRVRSGVEDIFGSTKAD  172



>emb|CDY22076.1| BnaA09g01050D [Brassica napus]
Length=160

 Score =   170 bits (430),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 76/129 (59%), Positives = 99/129 (77%), Gaps = 3/129 (2%)
 Frame = +2

Query  179  NHSRSKPIGSWRCRSKQNEPREMAFFDENGAVKDMDAYLDNLSLEYDSVWDTKPSWCQPW  358
            N + ++ +   R   ++N+ R   F DE+GAV DM+ YL NLSLEYDSVWDTKPSWCQPW
Sbjct  35   NLNPTRTVSKVRGLREENDSR---FVDEDGAVDDMEGYLGNLSLEYDSVWDTKPSWCQPW  91

Query  359  TIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPKAYSEMIAERRERVTNGL  538
            TI LTG+  +  SWLILHS+ ++++ + L+ AWWYIFLYSYPK+YSEMIAERR+RV +G 
Sbjct  92   TIMLTGLSIVTCSWLILHSVLVSSLAIGLVGAWWYIFLYSYPKSYSEMIAERRKRVADGF  151

Query  539  EDTYGEEKS  565
            ED YG+ K+
Sbjct  152  EDIYGKNKT  160



>ref|XP_010430119.1| PREDICTED: uncharacterized protein LOC104714449 [Camelina sativa]
Length=165

 Score =   170 bits (431),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 80/128 (63%), Positives = 100/128 (78%), Gaps = 4/128 (3%)
 Frame = +2

Query  194  KPIG-SWRCRS---KQNEPREMAFFDENGAVKDMDAYLDNLSLEYDSVWDTKPSWCQPWT  361
            KPI  S + RS    + EP +  F +ENG V DM+  LDNLSLEYDSVWDTKPSWCQPWT
Sbjct  37   KPIRISTKIRSLGGNRREPNDSRFGNENGVVDDMEGLLDNLSLEYDSVWDTKPSWCQPWT  96

Query  362  IALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPKAYSEMIAERRERVTNGLE  541
            I LTG+  +A SW+ILHS+ ++++ V LI AWWYIFLYSYPK+YS+MIAERR+RV++G E
Sbjct  97   IMLTGVSIVACSWVILHSVLVSSLAVGLIGAWWYIFLYSYPKSYSDMIAERRKRVSDGYE  156

Query  542  DTYGEEKS  565
            D YG+ K+
Sbjct  157  DIYGKNKT  164



>ref|XP_008809865.1| PREDICTED: uncharacterized protein LOC103721442 [Phoenix dactylifera]
Length=171

 Score =   170 bits (431),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 76/106 (72%), Positives = 91/106 (86%), Gaps = 0/106 (0%)
 Frame = +2

Query  251  FFDENGAVKDMDAYLDNLSLEYDSVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTA  430
            F  E+G V+DMD YL+ LSLEYDSVWDTKPSWCQPWTI LTG++ +A SW+ LHSL +TA
Sbjct  66   FLGEDGVVEDMDGYLNYLSLEYDSVWDTKPSWCQPWTILLTGVMVVACSWIFLHSLIITA  125

Query  431  VVVALISAWWYIFLYSYPKAYSEMIAERRERVTNGLEDTYGEEKSQ  568
             V++LI  WWYIFLYSYPKAYS+MIAERR++VT+GLEDT+G  KSQ
Sbjct  126  GVLSLICTWWYIFLYSYPKAYSDMIAERRKKVTSGLEDTFGLRKSQ  171



>ref|XP_010455987.1| PREDICTED: uncharacterized protein LOC104737486 [Camelina sativa]
Length=164

 Score =   170 bits (430),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 74/113 (65%), Positives = 92/113 (81%), Gaps = 0/113 (0%)
 Frame = +2

Query  227  QNEPREMAFFDENGAVKDMDAYLDNLSLEYDSVWDTKPSWCQPWTIALTGIVAIAASWLI  406
            + EP +  F +E+G V DM+  LDNLSLEYDSVWDTKPSWCQPWTI LTG+  +A SWLI
Sbjct  52   RREPNDSRFVNESGVVDDMEGLLDNLSLEYDSVWDTKPSWCQPWTIMLTGVSIVACSWLI  111

Query  407  LHSLTLTAVVVALISAWWYIFLYSYPKAYSEMIAERRERVTNGLEDTYGEEKS  565
            LHS+ ++++ V  I AWWYIFLYSYPK+YSEMIAERR+RV++G ED YG+ K+
Sbjct  112  LHSVVVSSLAVGSIGAWWYIFLYSYPKSYSEMIAERRKRVSDGFEDIYGKNKT  164



>ref|XP_009111259.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103836718 
[Brassica rapa]
Length=161

 Score =   170 bits (430),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 77/129 (60%), Positives = 99/129 (77%), Gaps = 3/129 (2%)
 Frame = +2

Query  179  NHSRSKPIGSWRCRSKQNEPREMAFFDENGAVKDMDAYLDNLSLEYDSVWDTKPSWCQPW  358
            N + ++ +   R   ++N+ R   F DENGAV DM+ YL NLSLEYDSVWDTKPSWCQPW
Sbjct  35   NLNPTRTVSKVRGLREENDSR---FVDENGAVDDMEGYLGNLSLEYDSVWDTKPSWCQPW  91

Query  359  TIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPKAYSEMIAERRERVTNGL  538
            TI +TG+  +A SW+ILHS+ ++++ V L+ AW YIFLYSYPK+YSEMIAERR+RV NG 
Sbjct  92   TIMVTGLSIVACSWVILHSVLVSSLAVGLVGAWXYIFLYSYPKSYSEMIAERRKRVANGF  151

Query  539  EDTYGEEKS  565
            ED YG+ K+
Sbjct  152  EDIYGKNKT  160



>ref|XP_011082570.1| PREDICTED: uncharacterized protein LOC105165298 [Sesamum indicum]
Length=175

 Score =   169 bits (429),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 81/137 (59%), Positives = 104/137 (76%), Gaps = 9/137 (7%)
 Frame = +2

Query  185  SRSKPIGSWRCRS--------KQNEP-REMAFFDENGAVKDMDAYLDNLSLEYDSVWDTK  337
            S SK +G  R R+           EP +E AFFDENGAV+DMD YL++LSLEYDSVWD K
Sbjct  39   SLSKNVGRTRSRTTLVRGDFRDGVEPVQESAFFDENGAVEDMDGYLNHLSLEYDSVWDIK  98

Query  338  PSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPKAYSEMIAERR  517
            P+WCQPWT+ LTG+V I  SWL+ +S+T+T+ V ++I  WWY+FLY YPKAYS+MIAERR
Sbjct  99   PAWCQPWTVTLTGMVIITGSWLVWNSVTVTSAVTSVICLWWYVFLYHYPKAYSDMIAERR  158

Query  518  ERVTNGLEDTYGEEKSQ  568
            ++VT+G+EDTYG +  Q
Sbjct  159  KKVTSGVEDTYGMKTGQ  175



>gb|ABK23447.1| unknown [Picea sitchensis]
Length=189

 Score =   170 bits (430),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 80/146 (55%), Positives = 104/146 (71%), Gaps = 9/146 (6%)
 Frame = +2

Query  143  ISAFAPTLALITNHSRSKPIGSWRCRS------KQNEPREMAFFDENGAVKDMDAYLDNL  304
            I    P L L +   RS   G+   RS       Q+   E  F +++G+++DMD YL+NL
Sbjct  45   ICNCTPNLVLQSKRVRS---GTTTIRSANGNGGGQDTDEESRFLEQDGSIRDMDGYLNNL  101

Query  305  SLEYDSVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYP  484
            SLEY+SVWDTKP+WCQPWTI LTG++A + SW++  S+TLT +V  LI AWWYIFLYSYP
Sbjct  102  SLEYESVWDTKPAWCQPWTIFLTGVLATSGSWIVFQSITLTTIVACLIGAWWYIFLYSYP  161

Query  485  KAYSEMIAERRERVTNGLEDTYGEEK  562
            +AY+EMIAERR++V +GLEDTYG  K
Sbjct  162  QAYTEMIAERRKKVKSGLEDTYGIRK  187



>ref|XP_011621405.1| PREDICTED: uncharacterized protein LOC18428876 [Amborella trichopoda]
Length=186

 Score =   169 bits (429),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 74/117 (63%), Positives = 94/117 (80%), Gaps = 0/117 (0%)
 Frame = +2

Query  218  RSKQNEPREMAFFDENGAVKDMDAYLDNLSLEYDSVWDTKPSWCQPWTIALTGIVAIAAS  397
            RSK+N+  +  F DE+GAVKDMDAYL+ LSLEY+SVWDTKP+WCQPWTI LTG   +  S
Sbjct  70   RSKRNKSVDSRFLDEDGAVKDMDAYLNYLSLEYESVWDTKPAWCQPWTILLTGAATVTGS  129

Query  398  WLILHSLTLTAVVVALISAWWYIFLYSYPKAYSEMIAERRERVTNGLEDTYGEEKSQ  568
            W+++HS+  T  V+ +I  WWYIFLYSYPK Y EMIAERR++V++G+EDT+G  KSQ
Sbjct  130  WIVVHSVVFTMFVLFVICTWWYIFLYSYPKEYKEMIAERRKKVSSGMEDTFGVGKSQ  186



>gb|KEH23777.1| transmembrane protein, putative [Medicago truncatula]
Length=171

 Score =   169 bits (428),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 83/150 (55%), Positives = 101/150 (67%), Gaps = 9/150 (6%)
 Frame = +2

Query  122  QGHQFSNISAFAPTLALITNHSRSKPIGSWRCRSKQNEPREMAFFDENGAV-KDMDAYLD  298
              H FSN         + +N S +K    +      + P    F DEN AV  DMD YL+
Sbjct  30   HTHNFSN--------PIFSNSSTNKKTIVFGINPSDSRPDNPLFLDENNAVVDDMDGYLN  81

Query  299  NLSLEYDSVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYS  478
            NLSLEY+SVWDTKPSWCQPWTI LTG+  I+ SWLI +S+ +T+ +  LI AWWYIFLYS
Sbjct  82   NLSLEYESVWDTKPSWCQPWTITLTGVSIISISWLIFNSIFVTSAISLLIFAWWYIFLYS  141

Query  479  YPKAYSEMIAERRERVTNGLEDTYGEEKSQ  568
            YPKAYS MIAERRE+VT+G+EDT+G  K Q
Sbjct  142  YPKAYSAMIAERREKVTDGVEDTFGRRKKQ  171



>ref|XP_006444049.1| hypothetical protein CICLE_v10022514mg [Citrus clementina]
 ref|XP_006479706.1| PREDICTED: uncharacterized protein LOC102610904 [Citrus sinensis]
 gb|ESR57289.1| hypothetical protein CICLE_v10022514mg [Citrus clementina]
 gb|KDO68704.1| hypothetical protein CISIN_1g030472mg [Citrus sinensis]
Length=177

 Score =   167 bits (424),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 74/116 (64%), Positives = 88/116 (76%), Gaps = 0/116 (0%)
 Frame = +2

Query  221  SKQNEPREMAFFDENGAVKDMDAYLDNLSLEYDSVWDTKPSWCQPWTIALTGIVAIAASW  400
            +   +  +  F DENG V DMD YL+ LSLEYDSVWDTKPSWCQPWTI LTG + I  SW
Sbjct  62   ANSGDQNKSMFMDENGVVDDMDGYLNYLSLEYDSVWDTKPSWCQPWTIVLTGALVIVCSW  121

Query  401  LILHSLTLTAVVVALISAWWYIFLYSYPKAYSEMIAERRERVTNGLEDTYGEEKSQ  568
            LI HSL  + VV  L+  WWYIFLYSYPKAY++MIAERR++V NG EDT+G ++SQ
Sbjct  122  LIFHSLLASTVVSLLVCTWWYIFLYSYPKAYTDMIAERRKKVRNGTEDTFGLDRSQ  177



>ref|XP_004140096.1| PREDICTED: uncharacterized protein LOC101202761 [Cucumis sativus]
 gb|KGN47908.1| hypothetical protein Csa_6G410630 [Cucumis sativus]
Length=168

 Score =   167 bits (423),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 80/147 (54%), Positives = 106/147 (72%), Gaps = 5/147 (3%)
 Frame = +2

Query  134  FSNISAFAPTLALITNHS--RSKPIGSWRCRSKQNEPREMAFFDENGAVKDMDAYLDNLS  307
             SN +A +  L+   N +  RSK +   +     N+ +   F DENG V DMD YL+  S
Sbjct  25   LSNFAASSQLLSFTPNCTKFRSKTLVFGKQSGNDNDSQ---FLDENGVVNDMDGYLNYHS  81

Query  308  LEYDSVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPK  487
             EYDSVWDTKP+WCQPWTI LTG++ IA+SW+ + S+ +TAV++ LI  WWYIFLYSYPK
Sbjct  82   FEYDSVWDTKPAWCQPWTITLTGLLVIASSWVAIKSIAVTAVILTLICLWWYIFLYSYPK  141

Query  488  AYSEMIAERRERVTNGLEDTYGEEKSQ  568
            AYSEMIAERR +V++GLEDT+G +++Q
Sbjct  142  AYSEMIAERRRKVSDGLEDTFGVKRTQ  168



>ref|XP_010522733.1| PREDICTED: uncharacterized protein LOC104801239 [Tarenaya hassleriana]
Length=163

 Score =   166 bits (419),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 70/113 (62%), Positives = 94/113 (83%), Gaps = 0/113 (0%)
 Frame = +2

Query  227  QNEPREMAFFDENGAVKDMDAYLDNLSLEYDSVWDTKPSWCQPWTIALTGIVAIAASWLI  406
            + E +E  F DENGA++DM+ YLD LSLEYDSVWDTKPSWCQPWTI LTG++A+A SW +
Sbjct  50   KRERKESMFIDENGAIEDMEGYLDYLSLEYDSVWDTKPSWCQPWTITLTGLLAVACSWAV  109

Query  407  LHSLTLTAVVVALISAWWYIFLYSYPKAYSEMIAERRERVTNGLEDTYGEEKS  565
            + S+ +T++V   I AWW++FLY YPK+YSEMIA+RR RV +G+EDT+G++K+
Sbjct  110  VRSVLVTSLVAGSIGAWWFLFLYLYPKSYSEMIADRRRRVADGVEDTFGQKKN  162



>gb|EAY91537.1| hypothetical protein OsI_13170 [Oryza sativa Indica Group]
Length=188

 Score =   166 bits (420),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 77/106 (73%), Positives = 87/106 (82%), Gaps = 0/106 (0%)
 Frame = +2

Query  251  FFDENGAVKDMDAYLDNLSLEYDSVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTA  430
            FF E+G V+DMD YL+ LSLEYDSVWDTKPSWCQPWTI L+G VAIA SWL +HS  +T 
Sbjct  83   FFGEDGVVEDMDGYLNYLSLEYDSVWDTKPSWCQPWTILLSGAVAIAGSWLPIHSAVITG  142

Query  431  VVVALISAWWYIFLYSYPKAYSEMIAERRERVTNGLEDTYGEEKSQ  568
             V  +I AWWYIFLYSYPKAY+EMIAERR +V +G EDTYG EKSQ
Sbjct  143  GVSFVICAWWYIFLYSYPKAYTEMIAERRRKVASGAEDTYGMEKSQ  188



>ref|XP_008449434.1| PREDICTED: uncharacterized protein LOC103491324 [Cucumis melo]
Length=168

 Score =   165 bits (418),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 72/106 (68%), Positives = 89/106 (84%), Gaps = 0/106 (0%)
 Frame = +2

Query  251  FFDENGAVKDMDAYLDNLSLEYDSVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTA  430
            F DENG V DMD YL+  S EYDSVWDTKPSWCQPWTI LTG++ IA+SW+ + S+ +TA
Sbjct  63   FLDENGVVDDMDGYLNYHSFEYDSVWDTKPSWCQPWTITLTGLLVIASSWVAIKSVAVTA  122

Query  431  VVVALISAWWYIFLYSYPKAYSEMIAERRERVTNGLEDTYGEEKSQ  568
            V++ LI  WWYIFLYSYPKAYSEMIAERR +V++GLEDT+G +++Q
Sbjct  123  VILTLICLWWYIFLYSYPKAYSEMIAERRRKVSDGLEDTFGVKRTQ  168



>ref|XP_002466609.1| hypothetical protein SORBIDRAFT_01g010980 [Sorghum bicolor]
 gb|EER93607.1| hypothetical protein SORBIDRAFT_01g010980 [Sorghum bicolor]
Length=179

 Score =   165 bits (418),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 75/107 (70%), Positives = 87/107 (81%), Gaps = 0/107 (0%)
 Frame = +2

Query  248  AFFDENGAVKDMDAYLDNLSLEYDSVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLT  427
            AFFDE+G V DMD YL+ LSLEYDSVWDTKP+WCQPWTI LTG V +A SW+++ S  +T
Sbjct  73   AFFDEDGVVDDMDGYLNYLSLEYDSVWDTKPAWCQPWTILLTGTVVVACSWVLIQSAVIT  132

Query  428  AVVVALISAWWYIFLYSYPKAYSEMIAERRERVTNGLEDTYGEEKSQ  568
            A V  +I AWWYIFLYSYPKAY+EMIAERR +V +G EDTYG EK Q
Sbjct  133  AGVSFVICAWWYIFLYSYPKAYTEMIAERRRKVASGAEDTYGMEKIQ  179



>tpg|DAA50858.1| TPA: hypothetical protein ZEAMMB73_471178 [Zea mays]
Length=184

 Score =   165 bits (418),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 88/107 (82%), Gaps = 0/107 (0%)
 Frame = +2

Query  248  AFFDENGAVKDMDAYLDNLSLEYDSVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLT  427
            AFFDE+G V DMD YL+ LSLEYDSVWDTKP+WCQPWTI LTG  A+A SW+++ S+ +T
Sbjct  78   AFFDEDGVVDDMDGYLNYLSLEYDSVWDTKPAWCQPWTILLTGTGAVACSWVLIQSVVIT  137

Query  428  AVVVALISAWWYIFLYSYPKAYSEMIAERRERVTNGLEDTYGEEKSQ  568
            A V  +ISAWWYIFLYSYPKAY+EMIAERR  V +G EDTYG EK Q
Sbjct  138  AGVSFVISAWWYIFLYSYPKAYTEMIAERRRNVASGAEDTYGMEKIQ  184



>ref|XP_004493684.1| PREDICTED: uncharacterized protein LOC101509912 [Cicer arietinum]
Length=170

 Score =   162 bits (411),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 78/116 (67%), Positives = 88/116 (76%), Gaps = 4/116 (3%)
 Frame = +2

Query  218  RSKQNEPREMAFFDENG-AVKDMDAYLDNLSLEYDSVWDTKPSWCQPWTIALTGIVAIAA  394
             S+Q  P    F DEN   V DMD YL+NLSLEYDSVWDTKPSWCQPWTI LTG   IA 
Sbjct  58   NSRQENP---LFLDENNTVVDDMDGYLNNLSLEYDSVWDTKPSWCQPWTITLTGASIIAI  114

Query  395  SWLILHSLTLTAVVVALISAWWYIFLYSYPKAYSEMIAERRERVTNGLEDTYGEEK  562
            +WLI HS+ +T+    LI AWWYIFLYSYPKAYS MIAERRER+T+G+EDT+G  K
Sbjct  115  TWLIFHSIIVTSATSLLICAWWYIFLYSYPKAYSAMIAERRERITDGVEDTFGCMK  170



>ref|NP_001145097.1| uncharacterized protein LOC100278309 [Zea mays]
 gb|ACG44999.1| hypothetical protein [Zea mays]
Length=184

 Score =   162 bits (411),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 75/107 (70%), Positives = 86/107 (80%), Gaps = 0/107 (0%)
 Frame = +2

Query  248  AFFDENGAVKDMDAYLDNLSLEYDSVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLT  427
            AFFDE+G V DMD YL+ LSLEYDSVWDTKP+WCQPWTI LTG  A+A SW+++ S  +T
Sbjct  78   AFFDEDGVVDDMDGYLNYLSLEYDSVWDTKPAWCQPWTILLTGTGAVACSWVLIQSAVIT  137

Query  428  AVVVALISAWWYIFLYSYPKAYSEMIAERRERVTNGLEDTYGEEKSQ  568
            A V  +I AWWYIFLYSYPKAY+EMIAERR  V +G EDTYG EK Q
Sbjct  138  AGVSFVICAWWYIFLYSYPKAYTEMIAERRRNVASGAEDTYGMEKIQ  184



>dbj|BAJ87553.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=171

 Score =   160 bits (405),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 77/136 (57%), Positives = 95/136 (70%), Gaps = 1/136 (1%)
 Frame = +2

Query  158  PTLALITNHSRSKPIGSWRCRSKQNEPREMA-FFDENGAVKDMDAYLDNLSLEYDSVWDT  334
            P   L     R +  G  R   ++      A FF E+G V DMD YL+ LSLEYDSVWDT
Sbjct  35   PRPRLAAGGGRRRLAGVARGSGEKGGKNGGAEFFREDGVVDDMDGYLNYLSLEYDSVWDT  94

Query  335  KPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPKAYSEMIAER  514
            KP+WCQPWTI LTG VA+A SW+++HS  +T  V  +I AWWYIFLYSYPKAY++MI+ER
Sbjct  95   KPAWCQPWTILLTGTVAVACSWVLIHSAVITGGVSFVICAWWYIFLYSYPKAYTDMISER  154

Query  515  RERVTNGLEDTYGEEK  562
            R++V +G EDTYG EK
Sbjct  155  RKKVASGAEDTYGMEK  170



>ref|XP_003559537.1| PREDICTED: uncharacterized protein LOC100840163 [Brachypodium 
distachyon]
Length=178

 Score =   160 bits (405),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 87/104 (84%), Gaps = 0/104 (0%)
 Frame = +2

Query  251  FFDENGAVKDMDAYLDNLSLEYDSVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTA  430
            FF E+G V DMD YL+ LSLEYDSVWDTKP+WCQPWTI L+G VA+A SW+++HS  +T 
Sbjct  74   FFREDGVVDDMDGYLNYLSLEYDSVWDTKPAWCQPWTILLSGAVAVACSWVLIHSALITG  133

Query  431  VVVALISAWWYIFLYSYPKAYSEMIAERRERVTNGLEDTYGEEK  562
             V  +I AWWYIFLYSYPKAY+EMI+ERR++V++G EDTYG EK
Sbjct  134  GVSFVICAWWYIFLYSYPKAYTEMISERRKKVSSGAEDTYGMEK  177



>ref|XP_009396878.1| PREDICTED: uncharacterized protein LOC103981851 [Musa acuminata 
subsp. malaccensis]
Length=183

 Score =   160 bits (405),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 75/125 (60%), Positives = 94/125 (75%), Gaps = 2/125 (2%)
 Frame = +2

Query  197  PIGSWRCRSKQNEPR--EMAFFDENGAVKDMDAYLDNLSLEYDSVWDTKPSWCQPWTIAL  370
            P  S+R  S  N  +  E  FFDE+G V+DMD YL+ LSLEYDSVWDTKPSWCQPWTI L
Sbjct  54   PRESFRISSNVNGEKADESRFFDEDGVVEDMDGYLNYLSLEYDSVWDTKPSWCQPWTILL  113

Query  371  TGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPKAYSEMIAERRERVTNGLEDTY  550
            TG+  +A SW ILHS  ++  +  LI  WWYIFLY+YPKAYS MIAERR+RV++G+EDT+
Sbjct  114  TGVAVVACSWTILHSAAISVGLSILICGWWYIFLYAYPKAYSNMIAERRKRVSSGIEDTF  173

Query  551  GEEKS  565
             + ++
Sbjct  174  EDSEN  178



>ref|XP_004982070.1| PREDICTED: uncharacterized protein LOC101752557 [Setaria italica]
Length=185

 Score =   159 bits (403),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 74/107 (69%), Positives = 86/107 (80%), Gaps = 1/107 (1%)
 Frame = +2

Query  248  AFFDENGAVKDMDAYLDNLSLEYDSVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLT  427
            AFF E+G V+DMD YLD LSLEYDSVWDTKP+WCQPWTI LTG   +A SW +L S+ +T
Sbjct  80   AFFGEDGVVEDMDGYLDYLSLEYDSVWDTKPAWCQPWTILLTGTAVVACSW-VLQSVIIT  138

Query  428  AVVVALISAWWYIFLYSYPKAYSEMIAERRERVTNGLEDTYGEEKSQ  568
            A V  +I AWWYIFLYSYPKAY++MIAERR +V +G EDTYG EK Q
Sbjct  139  AGVSFIICAWWYIFLYSYPKAYTKMIAERRRKVASGAEDTYGMEKIQ  185



>ref|XP_010326380.1| PREDICTED: uncharacterized protein LOC101258483 isoform X1 [Solanum 
lycopersicum]
Length=187

 Score =   158 bits (400),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 84/139 (60%), Positives = 104/139 (75%), Gaps = 3/139 (2%)
 Frame = +2

Query  131  QFSNI--SAFAPTLALITNHSRSKPIGSWRCRS-KQNEPREMAFFDENGAVKDMDAYLDN  301
            Q S+I  S+  P++  +++H   K   +   R    N+P+E AFF+ENG V+DMD+YL+ 
Sbjct  30   QLSDIEFSSKLPSITSLSSHKFCKRTRTSTVRGINSNDPKESAFFNENGVVEDMDSYLNY  89

Query  302  LSLEYDSVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSY  481
            LSLEYDSVWDTKPSWCQPWTI LTG V I+ SWLILHS   TAVV   I+AWWYIFLYSY
Sbjct  90   LSLEYDSVWDTKPSWCQPWTITLTGTVIISLSWLILHSAVATAVVTTTIAAWWYIFLYSY  149

Query  482  PKAYSEMIAERRERVTNGL  538
            PKAYS+MIAERR+ V +G+
Sbjct  150  PKAYSDMIAERRKSVISGI  168



>ref|XP_002992414.1| hypothetical protein SELMODRAFT_49189, partial [Selaginella moellendorffii]
 gb|EFJ06564.1| hypothetical protein SELMODRAFT_49189, partial [Selaginella moellendorffii]
Length=97

 Score =   139 bits (349),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 58/95 (61%), Positives = 81/95 (85%), Gaps = 0/95 (0%)
 Frame = +2

Query  269  AVKDMDAYLDNLSLEYDSVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALI  448
            AV DM+ YL++LSLEY+SVWDTKP+WCQPW+I  TG++ I ASW + HS+ +T+ V  +I
Sbjct  3    AVDDMEQYLEDLSLEYESVWDTKPAWCQPWSIVATGMLTIGASWPVFHSIPVTSFVTLVI  62

Query  449  SAWWYIFLYSYPKAYSEMIAERRERVTNGLEDTYG  553
            +AWW++FLYSYP+AY++MIAERR++V +G EDT+G
Sbjct  63   AAWWFVFLYSYPQAYTQMIAERRKKVEDGDEDTFG  97



>ref|XP_002968018.1| hypothetical protein SELMODRAFT_440203 [Selaginella moellendorffii]
 gb|EFJ31365.1| hypothetical protein SELMODRAFT_440203 [Selaginella moellendorffii]
Length=1234

 Score =   148 bits (374),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 68/135 (50%), Positives = 96/135 (71%), Gaps = 7/135 (5%)
 Frame = +2

Query  164   LALITNHSRSKPIGSWRCRSKQNEPREMAFFDENG-----AVKDMDAYLDNLSLEYDSVW  328
             L  ++     +PI   R   ++ E   +AF   NG     AV DM+ YL++LSLEY+SVW
Sbjct  1099  LKSVSQRRNVRPIAIGRREPRKRET--VAFSSGNGSAGKRAVDDMERYLEDLSLEYESVW  1156

Query  329   DTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPKAYSEMIA  508
             DTKP+WCQPW+I  TGI+ I ASW + HS+ +T+ V  +I+AWW++FLYSYP+AY++MIA
Sbjct  1157  DTKPAWCQPWSIVATGILTIGASWPVFHSIPVTSFVTLVIAAWWFVFLYSYPQAYTQMIA  1216

Query  509   ERRERVTNGLEDTYG  553
             ERR++V +G EDT+G
Sbjct  1217  ERRKKVEDGDEDTFG  1231



>ref|NP_001078347.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE82220.1| uncharacterized protein AT4G02725 [Arabidopsis thaliana]
Length=139

 Score =   135 bits (340),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 63/103 (61%), Positives = 78/103 (76%), Gaps = 4/103 (4%)
 Frame = +2

Query  194  KPIG-SWRCRS---KQNEPREMAFFDENGAVKDMDAYLDNLSLEYDSVWDTKPSWCQPWT  361
            KPI  S + RS    + EP++  F DE G V DM+ +LDNLSLEYDSVWDTKPSWCQPWT
Sbjct  37   KPIRISTKVRSFGGNRREPKDSRFVDEKGVVDDMEGFLDNLSLEYDSVWDTKPSWCQPWT  96

Query  362  IALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPKA  490
            I LTG+  +A SW+ILHS+ ++++ V +I AWWYIFLYSYPK 
Sbjct  97   IMLTGLSIVACSWVILHSVIVSSLAVGVIGAWWYIFLYSYPKV  139



>ref|XP_001783266.1| predicted protein [Physcomitrella patens]
 gb|EDQ51961.1| predicted protein, partial [Physcomitrella patens]
Length=117

 Score =   133 bits (335),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 73/94 (78%), Gaps = 0/94 (0%)
 Frame = +2

Query  272  VKDMDAYLDNLSLEYDSVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALIS  451
            +KDM+ YL+ LS+EY++VWDTKP+WCQPW+I LTG+  ++ SWL + S  +T VV  L++
Sbjct  24   IKDMERYLNELSVEYENVWDTKPAWCQPWSIVLTGVTGVSLSWLAIKSTIVTGVVTVLVA  83

Query  452  AWWYIFLYSYPKAYSEMIAERRERVTNGLEDTYG  553
             WWY+FLY+YP AY+ MIAERR    NG EDTYG
Sbjct  84   GWWYVFLYTYPMAYTAMIAERRRNQRNGTEDTYG  117



>gb|ERN00805.1| hypothetical protein AMTR_s00103p00025680 [Amborella trichopoda]
Length=209

 Score =   132 bits (331),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 57/91 (63%), Positives = 72/91 (79%), Gaps = 0/91 (0%)
 Frame = +2

Query  218  RSKQNEPREMAFFDENGAVKDMDAYLDNLSLEYDSVWDTKPSWCQPWTIALTGIVAIAAS  397
            RSK+N+  +  F DE+GAVKDMDAYL+ LSLEY+SVWDTKP+WCQPWTI LTG   +  S
Sbjct  70   RSKRNKSVDSRFLDEDGAVKDMDAYLNYLSLEYESVWDTKPAWCQPWTILLTGAATVTGS  129

Query  398  WLILHSLTLTAVVVALISAWWYIFLYSYPKA  490
            W+++HS+  T  V+ +I  WWYIFLYSYPK+
Sbjct  130  WIVVHSVVFTMFVLFVICTWWYIFLYSYPKS  160



>gb|KHN02572.1| hypothetical protein glysoja_002596, partial [Glycine soja]
Length=134

 Score =   128 bits (321),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 71/142 (50%), Positives = 89/142 (63%), Gaps = 24/142 (17%)
 Frame = +2

Query  191  SKPIGSWRCRSKQNEPREMAFFDENGAVKDMDAYLDNLSLEYDSVWDTKPS---------  343
            S P G     SK  EP   +F DENG V DM+ YLD     YDSVWDTKPS         
Sbjct  1    SIPFGINPSDSKGKEP---SFLDENGVVNDMEGYLD-----YDSVWDTKPSCKLAWLFIL  52

Query  344  -----WCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWW--YIFLYSYPKAYSEM  502
                  CQPWTIALTG+  IA SWL LHS+ +T+++ +LI AW   +I      +AYS+M
Sbjct  53   SRILFMCQPWTIALTGVSIIAISWLFLHSVIITSLISSLICAWCKIHIIFLVCCQAYSDM  112

Query  503  IAERRERVTNGLEDTYGEEKSQ  568
            IAERRE+VTNG+E+T+G+ K+Q
Sbjct  113  IAERREKVTNGVENTFGQRKNQ  134



>tpg|DAA50857.1| TPA: hypothetical protein ZEAMMB73_471178 [Zea mays]
Length=160

 Score =   125 bits (315),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = +2

Query  248  AFFDENGAVKDMDAYLDNLSLEYDSVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLT  427
            AFFDE+G V DMD YL+ LSLEYDSVWDTKP+WCQPWTI LTG  A+A SW+++ S+ +T
Sbjct  78   AFFDEDGVVDDMDGYLNYLSLEYDSVWDTKPAWCQPWTILLTGTGAVACSWVLIQSVVIT  137

Query  428  AVVVALISAWWYIFLYSYPK  487
            A V  +ISAWWYIFLYSYPK
Sbjct  138  AGVSFVISAWWYIFLYSYPK  157



>gb|KJB42119.1| hypothetical protein B456_007G137700 [Gossypium raimondii]
Length=132

 Score =   118 bits (295),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 61/113 (54%), Positives = 75/113 (66%), Gaps = 6/113 (5%)
 Frame = +2

Query  143  ISAFAPTLALI-----TNHSRSKPIGSWRCRSKQNEPREMAFFDENGAVKDMDAYLDNLS  307
            ++ FAP   LI     T+  RSK + ++       + +E  F DENG V+DMD YL+NLS
Sbjct  19   LNNFAPKTHLIFFAASTSKLRSKTV-AFGGNPPDPKQKEYLFLDENGVVEDMDGYLNNLS  77

Query  308  LEYDSVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYI  466
            LEY+SVWDTKPSWCQPWTI LTG++ IA SWLILHSL +TA     I  WW I
Sbjct  78   LEYESVWDTKPSWCQPWTITLTGLLVIACSWLILHSLVVTAFATLGICTWWLI  130



>gb|EPS62257.1| hypothetical protein M569_12536, partial [Genlisea aurea]
Length=81

 Score =   115 bits (289),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 53/81 (65%), Positives = 62/81 (77%), Gaps = 0/81 (0%)
 Frame = +2

Query  311  EYDSVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPKA  490
            +YD+VW+TKPSWCQPWTI LTGI  I+ SWL   S+ LT+   AL+  WWY FLYSYPKA
Sbjct  1    QYDTVWETKPSWCQPWTITLTGISIISLSWLSFRSVALTSAAAALVFLWWYAFLYSYPKA  60

Query  491  YSEMIAERRERVTNGLEDTYG  553
            YSEMIAERR++   G EDT G
Sbjct  61   YSEMIAERRKKANAGSEDTCG  81



>gb|KCW45500.1| hypothetical protein EUGRSUZ_L007782, partial [Eucalyptus grandis]
Length=81

 Score =   111 bits (277),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 47/73 (64%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = +2

Query  347  CQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPKAYSEMIAERRERV  526
            CQPWTI LTG++AI  SWLILHS+ +T ++  LI +WWYIFLYSYPKAY++MIAERR+RV
Sbjct  1    CQPWTITLTGMLAITGSWLILHSMLVTTIISLLICSWWYIFLYSYPKAYTDMIAERRKRV  60

Query  527  TNGLEDTYGEEKS  565
             +G+ED +G  K+
Sbjct  61   RSGIEDIFGSTKA  73



>gb|KCW80597.1| hypothetical protein EUGRSUZ_C01960 [Eucalyptus grandis]
Length=71

 Score = 90.5 bits (223),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = +2

Query  377  IVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPKAYSEMIAERRERVTNGLEDTYGE  556
            ++AI  SWLILHS+ +T ++  LI +WWYIFLYSYPKAY++MIAERR+RV +G+ED +G 
Sbjct  1    MLAITGSWLILHSMLVTTIISLLICSWWYIFLYSYPKAYTDMIAERRKRVRSGIEDIFGS  60

Query  557  EKSQ  568
             K+ 
Sbjct  61   TKAD  64



>ref|WP_009546797.1| MULTISPECIES: hypothetical protein [Cyanothece]
Length=80

 Score = 78.6 bits (192),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 52/79 (66%), Gaps = 1/79 (1%)
 Frame = +2

Query  296  DNLSLEYDSVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLY  475
            D  +LE  ++WD KP WCQPW+I LTGIV   ASW I + + +T +V +L+  WW  FL 
Sbjct  3    DFSNLESSNIWDYKPRWCQPWSILLTGIVFSVASWFIFNLIWITVIVSSLVMIWWVYFLI  62

Query  476  SYPKAYSEMIAERRERVTN  532
             YP+ + E + E+++R+ N
Sbjct  63   MYPRLFKEYV-EKQQRIQN  80



>ref|WP_004159048.1| hypothetical protein [Microcystis aeruginosa]
 emb|CCH94229.1| conserved hypothetical protein [Microcystis aeruginosa PCC 9432]
Length=79

 Score = 71.6 bits (174),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 41/69 (59%), Gaps = 0/69 (0%)
 Frame = +2

Query  311  EYDSVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPKA  490
            +Y SVWD KP WCQPW+I LTGI  IA  W +   L LT ++   I  WW++FL  YP+ 
Sbjct  5    KYSSVWDHKPRWCQPWSILLTGITLIAGCWFLTQRLWLTLLLSIPILLWWFVFLILYPRT  64

Query  491  YSEMIAERR  517
              + +   R
Sbjct  65   LQQQLNTER  73



>ref|WP_010874233.1| hypothetical protein [Synechocystis sp. PCC 6803]
 dbj|BAA18752.1| ssl1378 [Synechocystis sp. PCC 6803]
 dbj|BAK51794.1| hypothetical protein SYNGTS_3046 [Synechocystis sp. PCC 6803]
 dbj|BAL30792.1| hypothetical protein SYNGTI_3045 [Synechocystis sp. PCC 6803 
substr. GT-I]
 dbj|BAL33961.1| hypothetical protein SYNPCCN_3044 [Synechocystis sp. PCC 6803 
substr. PCC-N]
 dbj|BAL37130.1| hypothetical protein SYNPCCP_3044 [Synechocystis sp. PCC 6803 
substr. PCC-P]
 dbj|BAM53381.1| hypothetical protein BEST7613_4450 [Synechocystis sp. PCC 6803] 
[Synechocystis sp. PCC 6803]
 gb|AGF53301.1| hypothetical protein MYO_130820 [Synechocystis sp. PCC 6803]
Length=84

 Score = 71.6 bits (174),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 45/75 (60%), Gaps = 0/75 (0%)
 Frame = +2

Query  311  EYDSVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPKA  490
            E  +VW  KP WCQPWTI LTG V IA+SWL+ H   L+  V A I+ WW+ FL +YP+ 
Sbjct  5    EGYNVWSDKPRWCQPWTILLTGSVIIASSWLLFHRWWLSLPVAAAIALWWWYFLLAYPRL  64

Query  491  YSEMIAERRERVTNG  535
              + IA   +   N 
Sbjct  65   VRQAIAMELDHSPNS  79



>ref|WP_019508090.1| hypothetical protein [Pleurocapsa sp. PCC 7319]
Length=78

 Score = 71.2 bits (173),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 46/71 (65%), Gaps = 0/71 (0%)
 Frame = +2

Query  311  EYDSVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPKA  490
            E  ++WD KP WCQPW+I L G   IA+SWLILH + +T  +  LI+ WW  FL  YP+ 
Sbjct  8    ESTNIWDYKPWWCQPWSIVLAGTTIIASSWLILHIVWITLGISVLITVWWIYFLVIYPQL  67

Query  491  YSEMIAERRER  523
            +++ +A +  +
Sbjct  68   FAKYVASKPNK  78



>ref|WP_039899993.1| hypothetical protein [Microcystis sp. T1-4]
Length=79

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 40/67 (60%), Gaps = 0/67 (0%)
 Frame = +2

Query  317  DSVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPKAYS  496
            D+VWD KP WCQPW+I LTGI  IA  W +   L LT ++   I  WW++FL  YP+   
Sbjct  7    DNVWDNKPRWCQPWSILLTGIALIAGCWFLTQRLWLTLLLSIPILLWWFVFLILYPRTLQ  66

Query  497  EMIAERR  517
            + +   R
Sbjct  67   QQLNTER  73



>ref|WP_035998133.1| hypothetical protein [Leptolyngbya sp. JSC-1]
Length=91

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/88 (38%), Positives = 50/88 (57%), Gaps = 0/88 (0%)
 Frame = +2

Query  305  SLEYDSVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYP  484
             LE  S+W  KP WCQPW+I LTG++ I+ SW  LH + LT +V   +  W   FL  YP
Sbjct  4    GLERTSIWQYKPWWCQPWSILLTGMLIISGSWFWLHRVWLTGLVAMPVLVWMGFFLLIYP  63

Query  485  KAYSEMIAERRERVTNGLEDTYGEEKSQ  568
            K  ++M+ +  E++     +    E+S+
Sbjct  64   KLMNQMLTDEAEQLIQQPTEVKQAEQSE  91



>ref|WP_015118387.1| hypothetical protein [Rivularia sp. PCC 7116]
 gb|AFY54812.1| hypothetical protein Riv7116_2294 [Rivularia sp. PCC 7116]
Length=78

 Score = 70.1 bits (170),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/72 (50%), Positives = 43/72 (60%), Gaps = 2/72 (3%)
 Frame = +2

Query  320  SVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPKAYSE  499
            SVW  KP WCQPW+I LTG   I+ SWL+ H + LT +V   +  W   FL  YPKAY E
Sbjct  8    SVWQYKPWWCQPWSILLTGTTIISGSWLLFHKVWLTILVSIPLLTWMGFFLLIYPKAYME  67

Query  500  MIAERRERVTNG  535
            MI  R +   NG
Sbjct  68   MI--REQGTGNG  77



>ref|WP_043999446.1| hypothetical protein [Microcystis aeruginosa]
Length=79

 Score = 69.7 bits (169),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 40/67 (60%), Gaps = 0/67 (0%)
 Frame = +2

Query  317  DSVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPKAYS  496
            D+VWD KP WCQPW+I LTGI  IA  W +   L LT ++   I  WW++FL  YP+   
Sbjct  7    DNVWDHKPRWCQPWSILLTGIALIAGCWFLTQRLWLTLLLSIPILLWWFVFLILYPRTLQ  66

Query  497  EMIAERR  517
            + +   R
Sbjct  67   QQLNTER  73



>ref|WP_007306129.1| hypothetical protein [Crocosphaera watsonii]
 gb|EAM50190.1| hypothetical protein CwatDRAFT_2848 [Crocosphaera watsonii WH 
8501]
 gb|ABL97527.1| hypothetical protein HOT0_07D09.0015 [uncultured marine bacterium 
HOT0_07D09]
 gb|EHJ12046.1| hypothetical protein CWATWH0003_3229 [Crocosphaera watsonii WH 
0003]
 emb|CCQ63680.1| hypothetical protein CWATWH0401_4987 [Crocosphaera watsonii WH 
0401]
 emb|CCQ53411.1| hypothetical protein CWATWH8502_3606 [Crocosphaera watsonii WH 
8502]
 emb|CCQ55585.1| hypothetical protein CWATWH0005_3407 [Crocosphaera watsonii WH 
0005]
 emb|CCQ66991.1| hypothetical protein CWATWH0402_4470 [Crocosphaera watsonii WH 
0402]
Length=87

 Score = 69.3 bits (168),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 49/76 (64%), Gaps = 0/76 (0%)
 Frame = +2

Query  296  DNLSLEYDSVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLY  475
            D  +LE  ++WD KP WCQPW+I  TGI  IA SW++ H + +T ++  L++ WW  FL 
Sbjct  3    DLSNLESSNIWDYKPWWCQPWSILSTGIGLIAGSWIMFHIIWITIIMTILVTVWWSYFLI  62

Query  476  SYPKAYSEMIAERRER  523
             YP+ ++E +  ++ +
Sbjct  63   MYPRMFTEYVESQKTK  78



>gb|ACL46894.1| hypothetical protein Cyan7425_4586 [Cyanothece sp. PCC 7425]
Length=94

 Score = 69.3 bits (168),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 41/71 (58%), Gaps = 0/71 (0%)
 Frame = +2

Query  320  SVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPKAYSE  499
            S+W  KP WCQPW+I LTG+      W   H L LT  VV LI  WWY+FLY  P+ Y++
Sbjct  9    SLWQLKPWWCQPWSIVLTGVTVPVGVWWFSHRLWLTLPVVILILLWWYVFLYLVPQEYAQ  68

Query  500  MIAERRERVTN  532
                  + ++N
Sbjct  69   AQLNNPQGISN  79



>ref|WP_006507417.1| hypothetical protein [Xenococcus sp. PCC 7305]
 gb|ELS05484.1| hypothetical protein Xen7305DRAFT_00052300 [Xenococcus sp. PCC 
7305]
Length=86

 Score = 68.9 bits (167),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 43/68 (63%), Gaps = 0/68 (0%)
 Frame = +2

Query  296  DNLSLEYDSVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLY  475
             NL     ++W+ KP WCQPW+I LTG+V IAASWL+L  L LT +V   I  WW+ FL 
Sbjct  8    SNLESNEFNLWNFKPWWCQPWSIILTGVVIIAASWLVLKILWLTILVAIPILLWWFYFLV  67

Query  476  SYPKAYSE  499
             YP+   E
Sbjct  68   KYPQLAKE  75



>ref|WP_002736158.1| hypothetical protein [Microcystis aeruginosa]
 emb|CAO91074.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
 gb|ELP53815.1| hypothetical protein O53_2623 [Microcystis aeruginosa TAIHU98]
 gb|ELS48588.1| hypothetical protein C789_1636 [Microcystis aeruginosa DIANCHI905]
Length=79

 Score = 68.6 bits (166),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 40/67 (60%), Gaps = 0/67 (0%)
 Frame = +2

Query  317  DSVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPKAYS  496
            D+VW+ KP WCQPW+I LTGI  IA  W +   L LT ++   I  WW++FL  YP+   
Sbjct  7    DNVWNHKPRWCQPWSILLTGITLIAGCWFLTQRLWLTLLLSIPILLWWFVFLILYPRTLQ  66

Query  497  EMIAERR  517
            + +   R
Sbjct  67   QQLNTER  73



>ref|WP_043997509.1| hypothetical protein [Microcystis aeruginosa]
Length=79

 Score = 68.6 bits (166),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 40/67 (60%), Gaps = 0/67 (0%)
 Frame = +2

Query  317  DSVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPKAYS  496
            D+VW+ KP WCQPW+I LTGI  IA  W +   L LT ++   I  WW++FL  YP+   
Sbjct  7    DNVWNHKPRWCQPWSILLTGITLIAGCWFLTQRLWLTLLLSIPILLWWFVFLILYPRTLQ  66

Query  497  EMIAERR  517
            + +   R
Sbjct  67   QQLNTER  73



>ref|WP_016514583.1| hypothetical protein [Microcystis aeruginosa]
 gb|EPF24501.1| hypothetical protein MAESPC_00522 [Microcystis aeruginosa SPC777]
 dbj|GAL91368.1| hypothetical protein N44_00737 [Microcystis aeruginosa NIES-44]
Length=79

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 39/67 (58%), Gaps = 0/67 (0%)
 Frame = +2

Query  317  DSVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPKAYS  496
             SVWD KP WCQPW+I LTGI  IA  W +   L LT ++   I  WW++FL  YP+   
Sbjct  7    SSVWDHKPRWCQPWSILLTGITLIAGCWFLTQRLWLTLLLSIPILLWWFVFLILYPRTLQ  66

Query  497  EMIAERR  517
            + +   R
Sbjct  67   QQLNTER  73



>ref|WP_017327514.1| hypothetical protein [Synechococcus sp. PCC 7336]
Length=94

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = +2

Query  320  SVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPKAYSE  499
            SVW+ KP WCQPW+I LTG+  +A S L+ H L +T +V   ++AWW +FL  YPKA +E
Sbjct  15   SVWNYKPWWCQPWSIVLTGVAIVAGSGLLFHRLWVTGLVALPVAAWWVLFLGLYPKAIAE  74



>ref|WP_043998036.1| hypothetical protein [Microcystis aeruginosa]
Length=79

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 39/67 (58%), Gaps = 0/67 (0%)
 Frame = +2

Query  317  DSVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPKAYS  496
             SVWD KP WCQPW+I LTGI  IA  W +   L LT ++   I  WW++FL  YP+   
Sbjct  7    SSVWDHKPRWCQPWSILLTGITLIAGCWFLTQRLWLTLLLSIPILLWWFVFLILYPRMLQ  66

Query  497  EMIAERR  517
            + +   R
Sbjct  67   QQLNTER  73



>ref|WP_007102395.1| hypothetical protein [Synechococcus sp. RS9917]
 gb|EAQ69209.1| hypothetical protein RS9917_12235 [Synechococcus sp. RS9917]
Length=70

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 41/61 (67%), Gaps = 0/61 (0%)
 Frame = +2

Query  317  DSVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPKAYS  496
             S W  KP WCQPW+I LTG+ A+  SW++LH L LTA+V   +SAWW +FL   P+A S
Sbjct  10   PSFWSLKPWWCQPWSILLTGVGAMVGSWVLLHWLWLTALVAVAVSAWWLLFLVLVPRATS  69

Query  497  E  499
             
Sbjct  70   S  70



>ref|WP_015108331.1| hypothetical protein [Cyanobium gracile]
 gb|AFY27877.1| hypothetical protein Cyagr_0689 [Cyanobium gracile PCC 6307]
Length=82

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 41/61 (67%), Gaps = 0/61 (0%)
 Frame = +2

Query  317  DSVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPKAYS  496
             SVWD KP WCQPW+I LTG+  +  SW++LH   +TA V  +I+AWW +FL   P A+ 
Sbjct  14   SSVWDLKPWWCQPWSILLTGLAIVTGSWMVLHLWWITAGVSVVITAWWLLFLILMPAAWR  73

Query  497  E  499
            +
Sbjct  74   Q  74



>emb|CAK23602.1| Conserved hypothetical protein [Synechococcus sp. WH 7803]
Length=70

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 39/57 (68%), Gaps = 0/57 (0%)
 Frame = +2

Query  323  VWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPKAY  493
            +W  KP WCQPWTI LTG++ +A SWL+LH L +T  V   ++ WW++FL   P AY
Sbjct  9    LWSHKPWWCQPWTIVLTGLLVVAGSWLVLHRLWITGPVALAVACWWWLFLVIAPSAY  65



>dbj|BAG00489.1| hypothetical protein MAE_06670 [Microcystis aeruginosa NIES-843]
Length=79

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 39/67 (58%), Gaps = 0/67 (0%)
 Frame = +2

Query  317  DSVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPKAYS  496
             SVWD KP WCQPW+I LTGI  IA  W +   + LT ++   I  WW++FL  YP+   
Sbjct  7    SSVWDHKPRWCQPWSILLTGITLIAGCWFLTQRIWLTLLLSIPILLWWFVFLILYPRTLQ  66

Query  497  EMIAERR  517
            + +   R
Sbjct  67   QQLNTER  73



>ref|WP_010317840.1| hypothetical protein [Synechococcus sp. CB0205]
Length=75

 Score = 67.0 bits (162),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 42/68 (62%), Gaps = 0/68 (0%)
 Frame = +2

Query  320  SVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPKAYSE  499
            + W  KP WCQPW+I LTG++ IA SWL+LH   ++A V   + AWW +FL   P AY +
Sbjct  7    AFWSLKPWWCQPWSILLTGVLVIAGSWLLLHRWWISAPVAVAVLAWWGLFLLLVPAAYLD  66

Query  500  MIAERRER  523
               E  +R
Sbjct  67   EAGEPEKR  74



>ref|WP_015133066.1| hypothetical protein [Leptolyngbya sp. PCC 7376]
 gb|AFY37288.1| hypothetical protein Lepto7376_0914 [Leptolyngbya sp. PCC 7376]
Length=79

 Score = 66.2 bits (160),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 40/64 (63%), Gaps = 0/64 (0%)
 Frame = +2

Query  311  EYDSVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPKA  490
            E   VW+ KP WCQPW+I LTG  AIA SWL+ H   LT++V   + AW   F+  YPK 
Sbjct  8    EKFDVWEYKPWWCQPWSILLTGNGAIAGSWLLFHRYWLTSIVAIPLGAWMIFFILVYPKM  67

Query  491  YSEM  502
             +EM
Sbjct  68   MAEM  71



>ref|WP_013322786.1| hypothetical protein [Cyanothece sp. PCC 7822]
 gb|ADN14681.1| hypothetical protein Cyan7822_2714 [Cyanothece sp. PCC 7822]
Length=77

 Score = 66.2 bits (160),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 43/74 (58%), Gaps = 0/74 (0%)
 Frame = +2

Query  311  EYDSVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPKA  490
            ++ + W+ KP WCQPW+I LTGI+ +  SWLI   + LT +V   I  WW  FL  +PK 
Sbjct  3    QFVNPWNYKPWWCQPWSILLTGILIVGGSWLIFKIIWLTLLVAIPIVLWWVYFLLIWPKL  62

Query  491  YSEMIAERRERVTN  532
              E + + +   TN
Sbjct  63   VRESLMQAKNNATN  76



>ref|WP_041237345.1| hypothetical protein, partial [Cyanothece sp. PCC 7425]
Length=72

 Score = 65.9 bits (159),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 37/60 (62%), Gaps = 0/60 (0%)
 Frame = +2

Query  320  SVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPKAYSE  499
            S+W  KP WCQPW+I LTG+      W   H L LT  VV LI  WWY+FLY  P+ Y++
Sbjct  9    SLWQLKPWWCQPWSIVLTGVTVPVGVWWFSHRLWLTLPVVILILLWWYVFLYLVPQEYAQ  68



>ref|WP_008314365.1| hypothetical protein [Leptolyngbya sp. PCC 6406]
Length=78

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 42/68 (62%), Gaps = 0/68 (0%)
 Frame = +2

Query  317  DSVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPKAYS  496
            +S+W  KP WCQPW+I LTG+   A +W   H L LT  VV ++  WW +FLY  P+ Y+
Sbjct  8    NSLWQHKPWWCQPWSIVLTGLALPAIAWGFTHRLWLTLPVVGVVLGWWTLFLYLAPRQYA  67

Query  497  EMIAERRE  520
            + +  ++ 
Sbjct  68   DAMQHQQS  75



>ref|WP_011359571.1| hypothetical protein [Synechococcus sp. CC9902]
 gb|ABB25731.1| hypothetical protein Syncc9902_0763 [Synechococcus sp. CC9902]
Length=85

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 39/67 (58%), Gaps = 0/67 (0%)
 Frame = +2

Query  311  EYDSVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPKA  490
            E    W  KP WCQPW+I  TGI+ +  SWLILH L +T  +   ++ WW +FL   P A
Sbjct  12   ELPPFWALKPWWCQPWSIVSTGIIGVLGSWLILHRLWITLPMAIAVALWWGLFLVVVPSA  71

Query  491  YSEMIAE  511
            Y E + +
Sbjct  72   YKESLQQ  78



>ref|WP_006041433.1| hypothetical protein [Synechococcus sp. WH 7805]
 gb|EAR18786.1| hypothetical protein WH7805_03087 [Synechococcus sp. WH 7805]
Length=70

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 36/58 (62%), Gaps = 0/58 (0%)
 Frame = +2

Query  320  SVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPKAY  493
             +W  KP WCQPWTI LTG++ +  SWL+LH L +T  +   +  WW +FL   P AY
Sbjct  8    GLWSHKPWWCQPWTIVLTGLIVVGGSWLMLHRLWVTGSIAIAVVCWWVLFLVIAPAAY  65



>ref|WP_006909206.1| hypothetical protein [Cyanobium sp. PCC 7001]
 gb|EDY37303.1| conserved hypothetical protein [Cyanobium sp. PCC 7001]
Length=95

 Score = 64.7 bits (156),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 46/86 (53%), Gaps = 0/86 (0%)
 Frame = +2

Query  320  SVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPKAYSE  499
            S+W  KP WCQPW+I LTG+     SW +LH   +TA V A + AWW++FL   P  Y++
Sbjct  6    SIWALKPWWCQPWSIVLTGVAVSIGSWWLLHRWWITAPVAAAVLAWWWLFLVLVPAGYTQ  65

Query  500  MIAERRERVTNGLEDTYGEEKSQ*PP  577
             +  +    T     +    ++  PP
Sbjct  66   SVVAQEAAGTVEPPRSTDPPRTAPPP  91



>ref|WP_006517125.1| hypothetical protein [Leptolyngbya sp. PCC 7375]
 gb|EKV02753.1| hypothetical protein Lepto7375DRAFT_5015 [Leptolyngbya sp. PCC 
7375]
Length=73

 Score = 63.9 bits (154),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 36/60 (60%), Gaps = 0/60 (0%)
 Frame = +2

Query  317  DSVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPKAYS  496
             S+W  KP WCQPW+I LTG+     SW+ LH   +T  V  +I  WWY+FLY  PK Y 
Sbjct  8    QSLWQLKPWWCQPWSIVLTGLALPTVSWIWLHRWWITTPVAFVIFVWWYLFLYLVPKQYK  67



>ref|WP_036484880.1| hypothetical protein [Myxosarcina sp. GI1]
Length=81

 Score = 63.9 bits (154),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 44/71 (62%), Gaps = 4/71 (6%)
 Frame = +2

Query  320  SVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPKAYSE  499
            SVW+ KP WCQPW+I LTG+  I  SWL+ H++ ++  +   I+ WW  FL  YP    +
Sbjct  11   SVWNYKPWWCQPWSIILTGVSIIGGSWLLFHTVWISVGISIPIAVWWVYFLILYP----Q  66

Query  500  MIAERRERVTN  532
            M+ E  E+ +N
Sbjct  67   MMKEYLEQSSN  77



>ref|WP_011619956.1| hypothetical protein [Synechococcus sp. CC9311]
 gb|ABI47388.1| Uncharacterized membrane protein [Synechococcus sp. CC9311]
Length=70

 Score = 63.2 bits (152),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 36/60 (60%), Gaps = 0/60 (0%)
 Frame = +2

Query  320  SVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPKAYSE  499
            + W  KP WCQPW+I LTG V    SWL LH L +T  +  +I AWW +FL   P AYS 
Sbjct  7    AFWSLKPWWCQPWSILLTGFVLAIGSWLFLHQLWITLPITLVILAWWILFLVLVPAAYSR  66



>ref|XP_003084117.1| Casein kinase (serine/threonine/tyrosine protein kinase) (ISS) 
[Ostreococcus tauri]
Length=404

 Score = 67.8 bits (164),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 45/76 (59%), Gaps = 5/76 (7%)
 Frame = +2

Query  281  MDAYLDNLSLEYDSVWDTKPSWCQPWTIALTGIVAIAASWLILHS----LTLTAVVVAL-  445
            + AY + +     S WD KP+WCQPWTI  TG VAIA    + H     +    VVVAL 
Sbjct  312  LRAYAEFVVNNQSSFWDAKPAWCQPWTIVSTGTVAIATPGALFHDGGWLVNAATVVVALG  371

Query  446  ISAWWYIFLYSYPKAY  493
            +SAWW++FL+  P+ Y
Sbjct  372  VSAWWFLFLWVVPREY  387



>ref|XP_005643140.1| hypothetical protein COCSUDRAFT_26336 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE18596.1| hypothetical protein COCSUDRAFT_26336 [Coccomyxa subellipsoidea 
C-169]
Length=190

 Score = 65.1 bits (157),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 41/67 (61%), Gaps = 1/67 (1%)
 Frame = +2

Query  320  SVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVAL-ISAWWYIFLYSYPKAYS  496
            +VW  KP WCQPWTI  TG    A + L+ H   L  +VV + ISAWW++FL  YP  Y 
Sbjct  116  NVWAYKPFWCQPWTILGTGAALTAFANLVSHGSVLWTLVVGIPISAWWFLFLVVYPAQYR  175

Query  497  EMIAERR  517
            E + E+R
Sbjct  176  EYVEEQR  182



>gb|KEF42722.1| hypothetical protein ER33_04065 [Cyanobium sp. CACIAM 14]
Length=94

 Score = 63.2 bits (152),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = +2

Query  320  SVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPKAY  493
            S+W  KP WCQPW+I L+G++ + ASW +LH   LTA V   I AWW +FL   P A+
Sbjct  18   SLWHLKPWWCQPWSILLSGLIVVGASWQLLHLRWLTAGVALAIGAWWLLFLVLVPAAW  75



>ref|WP_015227188.1| hypothetical protein [Halothece sp. PCC 7418]
 gb|AFZ45316.1| hypothetical protein PCC7418_3200 [Halothece sp. PCC 7418]
Length=67

 Score = 62.4 bits (150),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 36/58 (62%), Gaps = 0/58 (0%)
 Frame = +2

Query  320  SVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPKAY  493
            S+W  KP WCQPW+I LTGI     +W + H   LT  V+  I  WWY+FLY  PK+Y
Sbjct  9    SIWQQKPWWCQPWSIILTGIALPTMTWFVTHWWWLTLPVILGILLWWYVFLYLVPKSY  66



>ref|WP_035830098.1| hypothetical protein, partial [Cyanobium sp. CACIAM 14]
Length=66

 Score = 62.4 bits (150),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 38/60 (63%), Gaps = 0/60 (0%)
 Frame = +2

Query  317  DSVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPKAYS  496
             S+W  KP WCQPW+I L+G++ + ASW +LH   LTA V   I AWW +FL   P A+ 
Sbjct  2    RSLWHLKPWWCQPWSILLSGLIVVGASWQLLHLRWLTAGVALAIGAWWLLFLVLVPAAWK  61



>ref|WP_031294808.1| hypothetical protein [Leptolyngbya sp. Heron Island J]
Length=73

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 40/70 (57%), Gaps = 0/70 (0%)
 Frame = +2

Query  305  SLEYDSVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYP  484
            S +  S+W  KP WCQPW+I LTG+     SW+ LH   +T      I  WWY+FLY  P
Sbjct  4    SQQPQSLWQLKPWWCQPWSIVLTGLAVPTMSWVWLHRWWITTPAAIAILVWWYLFLYLVP  63

Query  485  KAYSEMIAER  514
            + Y  M +++
Sbjct  64   QQYKAMQSDQ  73



>gb|ESA32045.1| putative membrane protein [Leptolyngbya sp. Heron Island J]
Length=75

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 40/70 (57%), Gaps = 0/70 (0%)
 Frame = +2

Query  305  SLEYDSVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYP  484
            S +  S+W  KP WCQPW+I LTG+     SW+ LH   +T      I  WWY+FLY  P
Sbjct  6    SQQPQSLWQLKPWWCQPWSIVLTGLAVPTMSWVWLHRWWITTPAAIAILVWWYLFLYLVP  65

Query  485  KAYSEMIAER  514
            + Y  M +++
Sbjct  66   QQYKAMQSDQ  75



>ref|WP_015148486.1| hypothetical protein [Oscillatoria acuminata]
 gb|AFY81843.1| hypothetical protein Oscil6304_2209 [Oscillatoria acuminata PCC 
6304]
Length=88

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 39/66 (59%), Gaps = 1/66 (2%)
 Frame = +2

Query  326  WDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPKAYSE-M  502
            W  KP WCQPW+I LTGI  I  SWL+ H L +TA+V   + AW   FL  +P+   E  
Sbjct  10   WHYKPWWCQPWSILLTGITLIVGSWLVFHKLWVTAIVAVPLVAWMGFFLLVWPRLMIESG  69

Query  503  IAERRE  520
            I ER E
Sbjct  70   ILERYE  75



>ref|WP_010303466.1| hypothetical protein [Synechococcus sp. CB0101]
Length=78

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 45/81 (56%), Gaps = 7/81 (9%)
 Frame = +2

Query  317  DSVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPKAYS  496
            +S+W  KP WCQPW+I LTG+V +  SW  L    +TA +   +  WW++FL + P AY 
Sbjct  3    ESLWSQKPWWCQPWSILLTGVVVVGGSWWWLRIWWITAPLALGVLLWWWLFLVAVPAAY-  61

Query  497  EMIAERRERVTNG-LEDTYGE  556
                 R E+V  G   D Y E
Sbjct  62   -----RAEQVAEGKAPDQYTE  77



>ref|WP_017662533.1| hypothetical protein [Geitlerinema sp. PCC 7105]
Length=77

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 36/56 (64%), Gaps = 0/56 (0%)
 Frame = +2

Query  320  SVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPK  487
            ++W  KP WCQPW+I LTGI  IA SWL+ H L LT +V   I AW   FL  +P+
Sbjct  8    NIWKYKPWWCQPWSILLTGIAIIAGSWLLFHRLWLTGLVAVPILAWMGYFLLLFPR  63



>ref|WP_038013452.1| hypothetical protein [Synechococcus sp. WH 8016]
Length=74

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 38/67 (57%), Gaps = 5/67 (7%)
 Frame = +2

Query  326  WDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPKAYSEMI  505
            W  KP WCQPW+I LTG V    SWL LH L +T  +  +I AWW +FL   P AY    
Sbjct  9    WSLKPWWCQPWSIVLTGCVISIGSWLFLHRLWITLPITLVILAWWMLFLVLVPTAY----  64

Query  506  AERRERV  526
              R+E +
Sbjct  65   -RRQEEI  70



>ref|WP_017715973.1| hypothetical protein [Oscillatoria sp. PCC 10802]
Length=83

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = +2

Query  320  SVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPKAYSE  499
            S WD KP WCQPW+I LTG+  I+ SWL+L ++ +TA+V   + AW   FL  +PK   E
Sbjct  11   SPWDYKPWWCQPWSILLTGVTLISGSWLLLKTVWITAIVAVPVLAWMGFFLLIWPKLMQE  70



>ref|WP_044210474.1| hypothetical protein [Coleofasciculus chthonoplastes]
Length=92

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/83 (35%), Positives = 48/83 (58%), Gaps = 4/83 (5%)
 Frame = +2

Query  326  WDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPK----AY  493
            W+ KP WCQPW+I LTG V IA SW++   L +T +V   I  WW+ FL+ +P+    +Y
Sbjct  10   WNYKPWWCQPWSILLTGAVIIAGSWMLAKMLWITLIVATPILVWWFYFLWLWPRLLRHSY  69

Query  494  SEMIAERRERVTNGLEDTYGEEK  562
             E+   + ++ +  +   Y  ++
Sbjct  70   LELTNRQPDQESESVATIYPSDE  92



>tpg|DAA50859.1| TPA: hypothetical protein ZEAMMB73_471178 [Zea mays]
Length=117

 Score = 62.4 bits (150),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +2

Query  248  AFFDENGAVKDMDAYLDNLSLEYDSVWDTKPSWCQPW  358
            AFFDE+G V DMD YL+ LSLEYDSVWDTKP+W  P+
Sbjct  78   AFFDEDGVVDDMDGYLNYLSLEYDSVWDTKPAWSVPF  114



>ref|WP_015191521.1| hypothetical protein [Stanieria cyanosphaera]
 gb|AFZ33848.1| hypothetical protein Sta7437_0231 [Stanieria cyanosphaera PCC 
7437]
Length=81

 Score = 61.2 bits (147),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 39/64 (61%), Gaps = 0/64 (0%)
 Frame = +2

Query  320  SVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPKAYSE  499
            ++W+ KP WCQPW+I LTGI  ++  W++   L LT ++  LI  WW  FL  YP+   E
Sbjct  11   NIWNYKPWWCQPWSIILTGISLVSVCWVLTKILWLTLILAILIGLWWGYFLILYPRMIKE  70

Query  500  MIAE  511
            + A 
Sbjct  71   LYAN  74



>ref|WP_019495172.1| hypothetical protein [Calothrix sp. PCC 7103]
Length=74

 Score = 61.2 bits (147),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 41/67 (61%), Gaps = 2/67 (3%)
 Frame = +2

Query  320  SVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPK--AY  493
            +VWD KP WCQPW+I LTGI  + ASW+I   + LT +V   I  W   FL  YPK  A 
Sbjct  8    NVWDYKPWWCQPWSILLTGITIVGASWIIFKIIWLTILVTIPILTWMGFFLLVYPKLVAN  67

Query  494  SEMIAER  514
            S M+ E+
Sbjct  68   SGMLDEQ  74



>ref|WP_039730257.1| MULTISPECIES: hypothetical protein [Oscillatoriophycideae]
 gb|KIF16996.1| hypothetical protein QP59_38880 [Aphanocapsa montana BDHKU210001]
 gb|KIF42006.1| hypothetical protein QQ91_31835 [Lyngbya confervoides BDU141951]
Length=86

 Score = 60.8 bits (146),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 35/60 (58%), Gaps = 0/60 (0%)
 Frame = +2

Query  320  SVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPKAYSE  499
            SVWD KP WCQPW+I LTG+  I  SW + H   +T +V   I  W   FL  YP+  +E
Sbjct  8    SVWDYKPWWCQPWSILLTGVSIIGGSWFLFHRYWVTGLVAVPILVWMGFFLLVYPRLMAE  67



>ref|WP_045056937.1| hypothetical protein [Chroococcales cyanobacterium CENA595]
 gb|KJH69686.1| hypothetical protein UH38_22435 [Chroococcales cyanobacterium 
CENA595]
Length=81

 Score = 60.5 bits (145),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 36/55 (65%), Gaps = 0/55 (0%)
 Frame = +2

Query  323  VWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPK  487
            VW+ KP WCQPW+I LTGI  I+ SWL+LH + LTA+    +  W   F+  YPK
Sbjct  13   VWEYKPWWCQPWSILLTGIALISGSWLLLHKIWLTAIASVPVIIWMSYFILLYPK  67



>ref|WP_009628809.1| hypothetical protein [Pseudanabaena biceps]
 gb|ELS31120.1| hypothetical protein Pse7429DRAFT_3512 [Pseudanabaena biceps 
PCC 7429]
Length=70

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 39/57 (68%), Gaps = 0/57 (0%)
 Frame = +2

Query  317  DSVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPK  487
            DSVW+ KP WCQPW+I LTG   I+ASWL+   + L+A+V   I+AW   F+  +PK
Sbjct  7    DSVWNHKPWWCQPWSIILTGFSIISASWLLFKIIWLSALVAIPITAWMGFFVIVFPK  63



>ref|WP_038553840.1| hypothetical protein [Synechococcus sp. KORDI-52]
Length=79

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 41/70 (59%), Gaps = 1/70 (1%)
 Frame = +2

Query  305  SLEYDSVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYP  484
            S E    W  KP WCQPW+I +TG++ ++ SW +LH L ++  +   + AWW +FL   P
Sbjct  9    SREQPPFWSLKPWWCQPWSILVTGVLMVSGSWALLHRLWISLPLALGVLAWWLLFLVLVP  68

Query  485  KAYSEMIAER  514
             AY    AER
Sbjct  69   AAYRSA-AER  77



>ref|WP_035159472.1| hypothetical protein [Calothrix sp. 336/3]
 gb|KFB85459.1| hypothetical protein IJ00_23280 [Calothrix sp. 336/3]
Length=78

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 40/69 (58%), Gaps = 1/69 (1%)
 Frame = +2

Query  317  DSVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPKAYS  496
             ++W  KP WCQPW+I LTGI+ I  SWLI   + LT +V   +S W   FL  YP+   
Sbjct  5    KTIWQYKPWWCQPWSILLTGIILITGSWLISKLIWLTVLVAIPVSIWMIFFLLIYPRFVK  64

Query  497  EM-IAERRE  520
            E  I E+ E
Sbjct  65   ESGILEQME  73



>ref|WP_036902869.1| hypothetical protein [Prochlorococcus sp. MIT 0601]
Length=79

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 38/60 (63%), Gaps = 0/60 (0%)
 Frame = +2

Query  320  SVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPKAYSE  499
            S W  KP WC+PW+I LTG+V I +++  +  L +  ++ +LI  WW +FLY  PK Y+ 
Sbjct  9    SFWSGKPFWCRPWSILLTGLVIIISTYFFIEILFVDILITSLIIIWWVLFLYYVPKIYTN  68



>ref|WP_015198813.1| hypothetical protein [Calothrix parietina]
 gb|AFZ02184.1| hypothetical protein Cal6303_3243 [Calothrix sp. PCC 6303]
Length=79

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 42/75 (56%), Gaps = 4/75 (5%)
 Frame = +2

Query  311  EYDSVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPK-  487
            +  SVW  KP WCQPW+I LTGI  I  SWL+   + LT +V   I  W   FL  YPK 
Sbjct  5    QSPSVWQYKPWWCQPWSILLTGITLIGGSWLVFQIIWLTIIVAIPILTWMIFFLIIYPKL  64

Query  488  -AYSEM--IAERRER  523
               SEM  I E+++ 
Sbjct  65   AINSEMPNIIEQQKH  79



>ref|WP_011125028.1| MULTISPECIES: hypothetical protein [Prochlorococcus]
 ref|NP_875268.1| Uncharacterized membrane protein [Prochlorococcus marinus subsp. 
marinus str. CCMP1375]
 gb|AAP99920.1| Uncharacterized membrane protein [Prochlorococcus marinus subsp. 
marinus str. CCMP1375]
 gb|KGG11732.1| putative membrane protein [Prochlorococcus marinus str. LG]
 gb|KGG18854.1| putative membrane protein [Prochlorococcus marinus str. SS2]
 gb|KGG23608.1| putative membrane protein [Prochlorococcus marinus str. SS35]
 gb|KGG32156.1| putative membrane protein [Prochlorococcus marinus str. SS51]
 gb|KGG35153.1| putative membrane protein [Prochlorococcus sp. SS52]
Length=81

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/74 (34%), Positives = 44/74 (59%), Gaps = 1/74 (1%)
 Frame = +2

Query  305  SLEYDSVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYP  484
            S   +  WD+KP WCQPW+I +TG+++I   ++   +  LT +   LI+ WW +FL+  P
Sbjct  7    SFTKNHYWDSKPKWCQPWSIIITGVLSIIIIFVTFKNFWLTIIASFLITLWWILFLFIAP  66

Query  485  KAYS-EMIAERRER  523
              Y+ E++   ++ 
Sbjct  67   MIYNIELVQSEKDE  80



>ref|WP_009786076.1| hypothetical protein [Lyngbya sp. PCC 8106]
 gb|EAW35329.1| hypothetical protein L8106_20635 [Lyngbya sp. PCC 8106]
Length=77

 Score = 58.9 bits (141),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 36/58 (62%), Gaps = 0/58 (0%)
 Frame = +2

Query  326  WDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPKAYSE  499
            W+ KP WCQPW+I LTGI  IA SWL+  +L LTA++   I  W   FL  +PK   E
Sbjct  12   WNYKPWWCQPWSILLTGISLIAGSWLVFQTLWLTAIIAIPILVWMGYFLLLWPKLMVE  69



>ref|WP_009555359.1| hypothetical protein [Oscillatoriales cyanobacterium JSC-12]
 gb|EKQ70785.1| hypothetical protein OsccyDRAFT_1090 [Oscillatoriales cyanobacterium 
JSC-12]
Length=89

 Score = 58.9 bits (141),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 41/75 (55%), Gaps = 1/75 (1%)
 Frame = +2

Query  320  SVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPKAYSE  499
            +VW  KP WCQPW+I LTG   +  SW + H + LT  +   I  W   FL  YP+ +++
Sbjct  14   NVWSYKPWWCQPWSILLTGCGVVGGSWWLFHRIWLTGFITVPILTWMGFFLLVYPRLFAQ  73

Query  500  MIAERRERVTNGLED  544
             + +  E VT   E+
Sbjct  74   SMQQEIE-VTQTTEE  87



>ref|WP_035991364.1| hypothetical protein [Leptolyngbya sp. KIOST-1]
Length=83

 Score = 58.9 bits (141),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 35/60 (58%), Gaps = 0/60 (0%)
 Frame = +2

Query  320  SVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPKAYSE  499
            S W  KP WCQPW+I LTG+  +  SWL+ H L L+ ++   I  W   FL  +P+  +E
Sbjct  9    SPWQLKPWWCQPWSIVLTGVTIVGGSWLLFHRLWLSGLIAIPIGVWMGFFLLLWPRLMAE  68



>ref|WP_044106418.1| hypothetical protein [cyanobacterium endosymbiont of Epithemia 
turgida]
 dbj|BAP17680.1| hypothetical protein ETSB_0874 [cyanobacterium endosymbiont of 
Epithemia turgida isolate EtSB Lake Yunoko]
Length=74

 Score = 58.5 bits (140),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 25/68 (37%), Positives = 36/68 (53%), Gaps = 0/68 (0%)
 Frame = +2

Query  317  DSVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPKAYS  496
             ++W  KP WCQPWT+ LTG   I  SW + H + L A+    I  WW+ FL   P  + 
Sbjct  7    TNIWKYKPWWCQPWTVLLTGTGVILGSWFLFHIIWLMAMTSLSILVWWFYFLIFIPHLFR  66

Query  497  EMIAERRE  520
            +    R++
Sbjct  67   QQSLNRKQ  74



>ref|WP_006620720.1| MULTISPECIES: hypothetical protein [Arthrospira]
 gb|EDZ93071.1| conserved hypothetical protein [Arthrospira maxima CS-328]
 emb|CCE15461.1| conserved hypothetical protein [Arthrospira sp. PCC 8005]
 gb|EKD11338.1| hypothetical protein SPLC1_S031680 [Arthrospira platensis C1]
 emb|CDM94025.1| conserved hypothetical protein [Arthrospira sp. PCC 8005]
Length=79

 Score = 58.2 bits (139),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 27/68 (40%), Positives = 37/68 (54%), Gaps = 0/68 (0%)
 Frame = +2

Query  317  DSVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPKAYS  496
            D+ WD KP WCQPW+I LTG+  I+ SWLI H + L+ +V   +  W   FL  +P    
Sbjct  9    DNPWDYKPWWCQPWSIMLTGVSLISGSWLIFHQVWLSVIVGVPVLTWMGFFLLIWPGLMR  68

Query  497  EMIAERRE  520
              +    E
Sbjct  69   SAMMSDAE  76



>gb|ERT07357.1| hypothetical protein M595_2605 [Lyngbya aestuarii BL J]
Length=87

 Score = 58.5 bits (140),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 35/58 (60%), Gaps = 0/58 (0%)
 Frame = +2

Query  326  WDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPKAYSE  499
            W+ KP WCQPW+I LTGI  I  SWL+  +L LTA++   I  W   FL  +PK   E
Sbjct  22   WNYKPWWCQPWSILLTGISLIGGSWLVFQTLWLTAIIAIPILVWMGYFLLLWPKLMVE  79



>ref|WP_011610490.1| hypothetical protein [Trichodesmium erythraeum]
 gb|ABG50097.1| conserved hypothetical protein [Trichodesmium erythraeum IMS101]
Length=77

 Score = 58.2 bits (139),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 42/69 (61%), Gaps = 2/69 (3%)
 Frame = +2

Query  299  NLSLEYDSV--WDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFL  472
            N S+E +    W+ KP WCQPW+I LTGI  I++SWLI  ++ LT ++   I  W   FL
Sbjct  2    NKSVETEKFNPWNYKPWWCQPWSILLTGITIISSSWLIFRTIWLTVIISIPILTWMGFFL  61

Query  473  YSYPKAYSE  499
              +PK  +E
Sbjct  62   IVWPKLMAE  70



>gb|AAX95647.1| hypothetical protein [Oryza sativa Japonica Group]
 gb|ABF98405.1| hypothetical protein LOC_Os03g49450 [Oryza sativa Japonica Group]
Length=77

 Score = 58.2 bits (139),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +2

Query  251  FFDENGAVKDMDAYLDNLSLEYDSVWDTKPSW  346
            FF E+G V+DMD YL+ LSLEYDSVWDTKPSW
Sbjct  18   FFGEDGVVEDMDGYLNYLSLEYDSVWDTKPSW  49



>ref|XP_007511258.1| predicted protein [Bathycoccus prasinos]
 emb|CCO66818.1| predicted protein [Bathycoccus prasinos]
Length=221

 Score = 60.5 bits (145),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 36/62 (58%), Gaps = 0/62 (0%)
 Frame = +2

Query  335  KPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPKAYSEMIAER  514
            KP WCQPWTI L G+  ++   L      ++  V   ISAWWY+FL  YPK+Y+    E 
Sbjct  155  KPFWCQPWTIVLFGVFCVSLPTLAFDWKFVSVAVAVPISAWWYVFLVLYPKSYASSSFEE  214

Query  515  RE  520
            +E
Sbjct  215  KE  216



>ref|WP_040483970.1| hypothetical protein [Lyngbya aestuarii]
Length=77

 Score = 58.2 bits (139),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 35/58 (60%), Gaps = 0/58 (0%)
 Frame = +2

Query  326  WDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPKAYSE  499
            W+ KP WCQPW+I LTGI  I  SWL+  +L LTA++   I  W   FL  +PK   E
Sbjct  12   WNYKPWWCQPWSILLTGISLIGGSWLVFQTLWLTAIIAIPILVWMGYFLLLWPKLMVE  69



>ref|WP_006619425.1| hypothetical protein [Arthrospira platensis]
 dbj|BAI89470.1| hypothetical protein [Arthrospira platensis NIES-39]
 gb|KDR58183.1| hypothetical protein APPUASWS_006680 [Arthrospira platensis str. 
Paraca]
Length=79

 Score = 58.2 bits (139),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 27/68 (40%), Positives = 37/68 (54%), Gaps = 0/68 (0%)
 Frame = +2

Query  317  DSVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPKAYS  496
            D+ WD KP WCQPW+I LTG+  I+ SWLI H + L+ +V   +  W   FL  +P    
Sbjct  9    DNPWDYKPWWCQPWSILLTGVSLISGSWLIFHQVWLSVIVGVPVLTWMGFFLLIWPGLMR  68

Query  497  EMIAERRE  520
              +    E
Sbjct  69   SAMMSDAE  76



>ref|WP_041237784.1| hypothetical protein [Cyanothece sp. PCC 7424]
Length=83

 Score = 58.2 bits (139),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 35/54 (65%), Gaps = 0/54 (0%)
 Frame = +2

Query  326  WDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPK  487
            W+ KP WCQPW+I LTG++ +  SWL+  ++ +T +V   I  WW  FL  +PK
Sbjct  8    WNYKPWWCQPWSILLTGVLIVGGSWLMFQTIWVTVLVAMPILVWWIYFLILWPK  61



>ref|NP_001051000.1| Os03g0701300 [Oryza sativa Japonica Group]
 dbj|BAF12914.1| Os03g0701300 [Oryza sativa Japonica Group]
Length=128

 Score = 58.9 bits (141),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +2

Query  251  FFDENGAVKDMDAYLDNLSLEYDSVWDTKPSW  346
            FF E+G V+DMD YL+ LSLEYDSVWDTKPSW
Sbjct  69   FFGEDGVVEDMDGYLNYLSLEYDSVWDTKPSW  100



>ref|WP_011936009.1| hypothetical protein [Synechococcus sp. RCC307]
 emb|CAK28495.1| Uncharacterized conserved membrane protein [Synechococcus sp. 
RCC307]
Length=68

 Score = 57.4 bits (137),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 39/67 (58%), Gaps = 2/67 (3%)
 Frame = +2

Query  317  DSVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPKAYS  496
             S W  KP WCQPW+I LTG V +A SWL+     LTA+V   + AWW +FL   P  Y+
Sbjct  3    QSFWSQKPWWCQPWSILLTGAVIMAGSWLLFERWWLTALVSLPVLAWWGLFLVVVP--YT  60

Query  497  EMIAERR  517
              + E+ 
Sbjct  61   TPVEEQE  67



>ref|WP_015187783.1| hypothetical protein [Gloeocapsa sp. PCC 7428]
 gb|AFZ29907.1| hypothetical protein Glo7428_1339 [Gloeocapsa sp. PCC 7428]
Length=74

 Score = 57.4 bits (137),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 27/66 (41%), Positives = 42/66 (64%), Gaps = 2/66 (3%)
 Frame = +2

Query  320  SVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPK--AY  493
            SVW+ KP WCQPW+I LTG+  I+ SW++  +L LT +V   +  W   FL  YP+   Y
Sbjct  8    SVWNYKPWWCQPWSILLTGVTLISGSWILFQTLWLTILVAIPVLTWMGFFLLIYPRIGVY  67

Query  494  SEMIAE  511
            ++++ +
Sbjct  68   NDLLDK  73



>ref|WP_017287959.1| hypothetical protein [Leptolyngbya boryana]
Length=79

 Score = 57.4 bits (137),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 37/64 (58%), Gaps = 0/64 (0%)
 Frame = +2

Query  320  SVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPKAYSE  499
            ++W  KP WCQPW+I LTG+  IA SW +   L LT +V   I AW   FL  YP+    
Sbjct  7    NIWQYKPWWCQPWSILLTGMCMIAGSWFVFTKLWLTTLVAVPILAWIIFFLIIYPQQMQA  66

Query  500  MIAE  511
             +++
Sbjct  67   YLSK  70



>gb|ABB35636.1| hypothetical protein Syncc9605_1895 [Synechococcus sp. CC9605]
Length=89

 Score = 57.4 bits (137),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 35/61 (57%), Gaps = 0/61 (0%)
 Frame = +2

Query  311  EYDSVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPKA  490
            E    W  KP WCQPW+I  TG++ +  SW +LH L ++  +   + AWW +FL   P A
Sbjct  21   EQPPFWSLKPWWCQPWSIVSTGVLFVGGSWAVLHCLWISLPLALGVLAWWLLFLVLVPAA  80

Query  491  Y  493
            Y
Sbjct  81   Y  81



>ref|WP_041435741.1| hypothetical protein [Synechococcus sp. CC9605]
Length=78

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 35/61 (57%), Gaps = 0/61 (0%)
 Frame = +2

Query  311  EYDSVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPKA  490
            E    W  KP WCQPW+I  TG++ +  SW +LH L ++  +   + AWW +FL   P A
Sbjct  10   EQPPFWSLKPWWCQPWSIVSTGVLFVGGSWAVLHCLWISLPLALGVLAWWLLFLVLVPAA  69

Query  491  Y  493
            Y
Sbjct  70   Y  70



>ref|WP_015139688.1| hypothetical protein [Nostoc sp. PCC 7524]
 gb|AFY49258.1| hypothetical protein Nos7524_3466 [Nostoc sp. PCC 7524]
Length=81

 Score = 57.4 bits (137),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 45/81 (56%), Gaps = 10/81 (12%)
 Frame = +2

Query  326  WDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPKAYSEMI  505
            W  KP WCQPW+I LTGI  I++SWLI H++ LT ++   +  W   FL  +P+      
Sbjct  10   WRYKPWWCQPWSILLTGITIISSSWLIFHTIWLTVIISMPVLVWMAFFLLIWPQLM----  65

Query  506  AERRERVTNGLEDTYGEEKSQ  568
                  + +G+ ++  +EK Q
Sbjct  66   ------IRSGVLESDQQEKIQ  80



>gb|EAU73741.1| hypothetical protein RS9916_29569 [Synechococcus sp. RS9916]
Length=91

 Score = 57.4 bits (137),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 33/54 (61%), Gaps = 0/54 (0%)
 Frame = +2

Query  323  VWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYP  484
            +W  KP WCQPW+I LTG++    SWLILH L +T  V   +  WW +FL   P
Sbjct  18   LWSQKPWWCQPWSIVLTGVLVSLGSWLILHKLWITIPVTVGVLMWWLLFLVLAP  71



>ref|WP_015152373.1| hypothetical protein [Chroococcidiopsis thermalis]
 gb|AFY85822.1| hypothetical protein Chro_0267 [Chroococcidiopsis thermalis PCC 
7203]
Length=82

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 37/57 (65%), Gaps = 0/57 (0%)
 Frame = +2

Query  320  SVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPKA  490
            SVW+ KP WCQPW+I LTG+  I+ SWL++ +  LT +V   +  W   FL+ YP+ 
Sbjct  11   SVWNYKPWWCQPWSIFLTGVTLISGSWLLVKTWWLTILVAIPVLTWMTFFLFIYPRV  67



>gb|EMT22781.1| hypothetical protein F775_42981 [Aegilops tauschii]
Length=105

 Score = 57.4 bits (137),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 36/64 (56%), Gaps = 1/64 (2%)
 Frame = +2

Query  158  PTLALITNHSRSKPIGSWRCRSKQNEPREMA-FFDENGAVKDMDAYLDNLSLEYDSVWDT  334
            P   L     R +  G  R   ++      A FF E+G V DMD YL+ LSLEYDSVWDT
Sbjct  42   PRPQLAAGGGRRRLAGVARGSGEKGGKNGGAEFFREDGVVDDMDGYLNYLSLEYDSVWDT  101

Query  335  KPSW  346
            KP+W
Sbjct  102  KPAW  105



>ref|XP_001422215.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABP00532.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=86

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 41/75 (55%), Gaps = 9/75 (12%)
 Frame = +2

Query  323  VWDTKPSWCQPWTIALTGIVAIAASWLILH---------SLTLTAVVVALISAWWYIFLY  475
            +W TKP+WCQP++I  TG++A A    +LH             T +V A + AWW++FLY
Sbjct  1    MWKTKPAWCQPYSIVATGVLATATPVNVLHLDERVAGWFGTLSTTIVGAAVLAWWFLFLY  60

Query  476  SYPKAYSEMIAERRE  520
              P+ Y   +   RE
Sbjct  61   VVPREYERSVEAFRE  75



>ref|WP_015230107.1| hypothetical protein [Dactylococcopsis salina]
 gb|AFZ51117.1| hypothetical protein Dacsa_2527 [Dactylococcopsis salina PCC 
8305]
Length=70

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 40/60 (67%), Gaps = 0/60 (0%)
 Frame = +2

Query  320  SVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPKAYSE  499
            S+W  KP WCQPW+I LTGI+  +  WL+ H   LT  VV  I  WWY+FLY  PK+Y+E
Sbjct  5    SIWQKKPWWCQPWSIILTGIIIPSTVWLLTHLWWLTLPVVMGILVWWYVFLYLVPKSYTE  64



>ref|WP_038024121.1| hypothetical protein [Synechococcus sp. RS9916]
Length=85

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 33/54 (61%), Gaps = 0/54 (0%)
 Frame = +2

Query  323  VWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYP  484
            +W  KP WCQPW+I LTG++    SWLILH L +T  V   +  WW +FL   P
Sbjct  12   LWSQKPWWCQPWSIVLTGVLVSLGSWLILHKLWITIPVTVGVLMWWLLFLVLAP  65



>ref|WP_037217050.1| hypothetical protein [Richelia intracellularis]
 emb|CDN10918.1| hypothetical protein RintRC_4691 [Richelia intracellularis]
Length=82

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 43/83 (52%), Gaps = 10/83 (12%)
 Frame = +2

Query  320  SVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPKAYSE  499
            S W+ KP WCQPW+I LTG+  +  SW+I  ++  T +V   ISAW   FL  +P     
Sbjct  8    SPWEIKPWWCQPWSIILTGLTTVGGSWVIFKAIWFTILVAIPISAWMGFFLLVWP-----  62

Query  500  MIAERRERVTNGLEDTYGEEKSQ  568
                 +  + +GL D    E S+
Sbjct  63   -----QRMIQSGLLDIDNYENSE  80



>ref|WP_015170070.1| hypothetical protein [Synechococcus sp. PCC 7502]
 gb|AFY75419.1| hypothetical protein Syn7502_03582 [Synechococcus sp. PCC 7502]
Length=77

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 37/57 (65%), Gaps = 0/57 (0%)
 Frame = +2

Query  317  DSVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPK  487
            DSVW+ KP WCQPW+I LTGI  I++SWL+   + L+ +V   I  W   FL  +P+
Sbjct  14   DSVWNHKPWWCQPWSILLTGIAIISSSWLLFKLIWLSILVAIPILIWMGFFLILFPR  70



>ref|XP_003064501.1| predicted protein, partial [Micromonas pusilla CCMP1545]
 gb|EEH51406.1| predicted protein, partial [Micromonas pusilla CCMP1545]
Length=62

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 36/61 (59%), Gaps = 0/61 (0%)
 Frame = +2

Query  323  VWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPKAYSEM  502
            VW TKP WCQPWTI +TG + + A   +      +A +   I AWW+ FL +YPK + E 
Sbjct  2    VWATKPPWCQPWTIVMTGAMIVCAPTAVFGWKWASAFLTLPIGAWWFAFLIAYPKQFREY  61

Query  503  I  505
            +
Sbjct  62   V  62



>ref|WP_015145140.1| hypothetical protein [Pleurocapsa minor]
 gb|AFY78841.1| hypothetical protein Ple7327_3647 [Pleurocapsa sp. PCC 7327]
Length=85

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 35/56 (63%), Gaps = 0/56 (0%)
 Frame = +2

Query  320  SVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPK  487
            +VW+ KP WCQPW+I LTGI  +  SWL+  +L +T  +   +  WW  FL  YP+
Sbjct  8    NVWNYKPWWCQPWSILLTGISTVGGSWLLAKNLWITGGLSISVLLWWSYFLILYPR  63



>ref|XP_005537333.1| hypothetical protein, conserved [Cyanidioschyzon merolae strain 
10D]
 dbj|BAM81297.1| hypothetical protein, conserved [Cyanidioschyzon merolae strain 
10D]
Length=157

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 39/71 (55%), Gaps = 1/71 (1%)
 Frame = +2

Query  335  KPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVA-LISAWWYIFLYSYPKAYSEMIAE  511
            KP WCQPWTI L G   I  SW +L     +A++ + LI  WWY+FL+ YP+     +  
Sbjct  82   KPPWCQPWTILLFGEACITFSWCLLPFRPYSAIITSVLILVWWYVFLWEYPRIAKATLHS  141

Query  512  RRERVTNGLED  544
             R   + G ++
Sbjct  142  FRSTASRGRKN  152



>ref|WP_040697311.1| hypothetical protein, partial [Nodosilinea nodulosa]
Length=73

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 34/60 (57%), Gaps = 0/60 (0%)
 Frame = +2

Query  320  SVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPKAYSE  499
            S W  KP WCQPW+I LTG+  +  SW  LH + LT++V   I  W   FL  +P+   E
Sbjct  9    SPWQLKPWWCQPWSIVLTGVAIVGGSWFALHRVWLTSLVAVPIGVWIGFFLILWPRLMRE  68



>gb|EDX86967.1| hypothetical protein S7335_4674 [Synechococcus sp. PCC 7335]
Length=116

 Score = 56.6 bits (135),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 45/78 (58%), Gaps = 8/78 (10%)
 Frame = +2

Query  320  SVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPKAYSE  499
            S+W TKP WCQPW+I LTG+   +ASWL+LH L +T  V   I+ WW +FL   P  Y++
Sbjct  42   SIWQTKPWWCQPWSIVLTGVAVPSASWLLLHRLWITLPVAVAIALWWLLFLVLVPAQYAQ  101

Query  500  MIAERRERVTNGLEDTYG  553
                        L+DT G
Sbjct  102  Y--------ATALQDTAG  111



>ref|WP_025362160.1| hypothetical protein [Synechococcus sp. WH 8109]
Length=79

 Score = 55.8 bits (133),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 35/61 (57%), Gaps = 0/61 (0%)
 Frame = +2

Query  311  EYDSVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPKA  490
            E    W  KP WCQPW+I  TG++ ++ SW +LH L ++  +   + AWW +FL   P  
Sbjct  11   EQPPFWSLKPWWCQPWSIICTGVLMVSGSWTLLHRLWISLPLAIGVLAWWLMFLVLVPAV  70

Query  491  Y  493
            Y
Sbjct  71   Y  71



>ref|WP_006529657.1| hypothetical protein [Gloeocapsa sp. PCC 73106]
 gb|ELR97473.1| hypothetical protein GLO73106DRAFT_00012830 [Gloeocapsa sp. PCC 
73106]
Length=78

 Score = 55.5 bits (132),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 39/66 (59%), Gaps = 0/66 (0%)
 Frame = +2

Query  326  WDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPKAYSEMI  505
            W  KP WCQPW+I LTGI+ I  SW +   + L+ +V  LI AWW  FL  +PK  +E  
Sbjct  9    WKYKPWWCQPWSILLTGIIVIFGSWEVTQLIWLSILVSLLILAWWSYFLLIWPKMVNEYY  68

Query  506  AERRER  523
              R E+
Sbjct  69   GSRGEK  74



>ref|WP_038653757.1| membrane protein [Prochlorococcus sp. MIT 0801]
 gb|AIQ97781.1| hypothetical protein EW15_1689 [Prochlorococcus sp. MIT 0801]
Length=71

 Score = 55.5 bits (132),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 23/58 (40%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = +2

Query  320  SVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPKAY  493
            S WD+KP WCQPW+I   G++ +  S+ +L+++ +T+V+   I  WW +FL   P +Y
Sbjct  8    SFWDSKPYWCQPWSIISFGVLVLIFSFKLLNNIIITSVLGFFILVWWIVFLILAPNSY  65



>ref|WP_045871611.1| hypothetical protein [Tolypothrix sp. PCC 7601]
 gb|EKF00563.1| hypothetical protein FDUTEX481_08708 [Tolypothrix sp. PCC 7601]
Length=81

 Score = 55.5 bits (132),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 28/81 (35%), Positives = 43/81 (53%), Gaps = 10/81 (12%)
 Frame = +2

Query  320  SVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPKAYSE  499
            S W+ KP WCQPW+I LTGI  I+ SWL+  ++ LT ++   I  W   FL  +P+    
Sbjct  8    SPWNYKPWWCQPWSIVLTGITLISGSWLVFKTIWLTVIISIPILVWMGFFLLIWPQLI--  65

Query  500  MIAERRERVTNGLEDTYGEEK  562
                    + +G+ D+Y  + 
Sbjct  66   --------IRSGILDSYQNQN  78



>emb|CBN58768.1| conserved hypothetical protein [ [[Oscillatoria] sp. PCC 6506]
Length=78

 Score = 55.5 bits (132),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 43/79 (54%), Gaps = 10/79 (13%)
 Frame = +2

Query  320  SVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPKAYSE  499
            S WD KP WCQPW+I LTGI  I+ SW +  ++ +T +V   +  W   FL  +P     
Sbjct  10   SAWDYKPWWCQPWSILLTGITLISGSWFVFKTVWITVIVSIPLLIWMGFFLLIWP-----  64

Query  500  MIAERRERVTNGLEDTYGE  556
                 R  +++GL D++ E
Sbjct  65   -----RLMLSSGLLDSHQE  78



>ref|WP_036536154.1| hypothetical protein [Neosynechococcus sphagnicola]
 gb|KGF71666.1| hypothetical protein DO97_16510 [Neosynechococcus sphagnicola 
sy1]
Length=75

 Score = 55.1 bits (131),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 37/61 (61%), Gaps = 0/61 (0%)
 Frame = +2

Query  320  SVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPKAYSE  499
            S W  KP WCQPW+I LTG+  I  SWL+LH   LTA++   +  W   F+  +P+  ++
Sbjct  11   SPWSYKPWWCQPWSIVLTGVTLIGGSWLLLHIGWLTALIAVPVLTWMGFFVLVWPRLMAQ  70

Query  500  M  502
            +
Sbjct  71   I  71



>ref|WP_026793689.1| MULTISPECIES: hypothetical protein [Planktothrix]
 gb|KEI65345.1| GTP cyclohydrolase I [Planktothrix agardhii NIVA-CYA 126/8]
Length=83

 Score = 55.1 bits (131),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 39/63 (62%), Gaps = 0/63 (0%)
 Frame = +2

Query  326  WDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPKAYSEMI  505
            W+ KP WCQPW+I LTGI  I+ SW +  +L +T +V   + AW   F+  +PK  +E+ 
Sbjct  15   WNYKPWWCQPWSILLTGITLISGSWFLFKTLWITILVAIPLLAWMGFFVLIWPKLMAEVY  74

Query  506  AER  514
            ++ 
Sbjct  75   SQE  77



>ref|WP_038018176.1| hypothetical protein [Synechococcus sp. PCC 7335]
Length=86

 Score = 55.1 bits (131),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 45/78 (58%), Gaps = 8/78 (10%)
 Frame = +2

Query  320  SVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPKAYSE  499
            S+W TKP WCQPW+I LTG+   +ASWL+LH L +T  V   I+ WW +FL   P  Y++
Sbjct  12   SIWQTKPWWCQPWSIVLTGVAVPSASWLLLHRLWITLPVAVAIALWWLLFLVLVPAQYAQ  71

Query  500  MIAERRERVTNGLEDTYG  553
                        L+DT G
Sbjct  72   Y--------ATALQDTAG  81



>ref|WP_036905059.1| membrane protein [Prochlorococcus marinus]
 gb|KGG21305.1| hypothetical protein EV03_0639 [Prochlorococcus marinus str. 
PAC1]
Length=71

 Score = 54.7 bits (130),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 22/58 (38%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = +2

Query  320  SVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPKAY  493
            S WD+KP WCQPW+I   G++ +  S+ +L+++ +T+++   I  WW +FL   P +Y
Sbjct  8    SFWDSKPYWCQPWSIISFGVLVLIFSFKLLNNIIITSILGFFILVWWILFLIIAPNSY  65



>ref|NP_001183225.1| uncharacterized protein LOC100501612 [Zea mays]
 gb|ACR36121.1| unknown [Zea mays]
Length=205

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 43/83 (52%), Gaps = 0/83 (0%)
 Frame = -3

Query  571  SLTLLLSICIFKAICYSLSALGDHL*ISLRVGVEEDVPPCRY*SHNHCSESKRVQNEPAC  392
            SL  L  + IF +  Y  S+L  HL + LRV VE+ VPPC Y   N  S   R+   P  
Sbjct  56   SLDFLHPVGIFSSTGYISSSLCYHLGVCLRVRVEKYVPPCGYYKRNPSSNYNRLDKHPTT  115

Query  391  CNCYYTSQCYCPWLAP*GLGVPN  323
             N   + + YCP L P  LGVP+
Sbjct  116  GNGTSSRKQYCPRLTPGRLGVPD  138



>ref|WP_015209405.1| hypothetical protein [Cylindrospermum stagnale]
 gb|AFZ26162.1| hypothetical protein Cylst_4052 [Cylindrospermum stagnale PCC 
7417]
Length=79

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 36/56 (64%), Gaps = 0/56 (0%)
 Frame = +2

Query  320  SVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPK  487
            S W+ KP WCQPW+I LTG+  I+ SWL+  ++ LT +V   + AW   FL  +P+
Sbjct  8    SPWNYKPWWCQPWSILLTGVTLISGSWLLFKTIWLTVLVAIPLLAWMGFFLLVWPQ  63



>ref|WP_012162787.1| hypothetical protein [Acaryochloris marina]
 gb|ABW27313.1| conserved hypothetical protein [Acaryochloris marina MBIC11017]
Length=78

 Score = 53.9 bits (128),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 39/63 (62%), Gaps = 0/63 (0%)
 Frame = +2

Query  326  WDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPKAYSEMI  505
            W+ KP WCQPW+I +TGI  IA +W +   + LT +V   + AW  +FL  +P+A  +  
Sbjct  8    WNDKPWWCQPWSILVTGITLIAGTWFVTKIVWLTLLVALPVLAWMGLFLILWPQAMKQAH  67

Query  506  AER  514
            +E+
Sbjct  68   SEQ  70



>ref|WP_017652940.1| hypothetical protein [Microchaete sp. PCC 7126]
Length=81

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/81 (35%), Positives = 43/81 (53%), Gaps = 10/81 (12%)
 Frame = +2

Query  320  SVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPKAYSE  499
            S W+ KP WCQPW+I LTG+  I+ SWLI  ++ +T +V   +  W   FL  +P+    
Sbjct  8    SPWNYKPWWCQPWSILLTGVSLISGSWLIFKNIWITVIVAIPVFTWMGFFLLIWPQLI--  65

Query  500  MIAERRERVTNGLEDTYGEEK  562
                    + +G+ DTY  + 
Sbjct  66   --------IRSGVLDTYETQN  78



>ref|WP_018399556.1| hypothetical protein [filamentous cyanobacterium ESFC-1]
Length=88

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 40/77 (52%), Gaps = 3/77 (4%)
 Frame = +2

Query  299  NLSLEYDSVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYS  478
             L L+  S W  KP WCQPW+I LTG +AI     +  +  LTA V   IS WW  FL  
Sbjct  11   KLDLDTFSPWHYKPWWCQPWSILLTGAIAIFLPAGLTRNPWLTAGVAVPISLWWGYFLMV  70

Query  479  YP---KAYSEMIAERRE  520
            +P   KAY    A  RE
Sbjct  71   WPRQLKAYYRAEANNRE  87



>ref|WP_019501153.1| hypothetical protein [Pseudanabaena sp. PCC 6802]
Length=72

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 37/60 (62%), Gaps = 0/60 (0%)
 Frame = +2

Query  317  DSVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPKAYS  496
            D+ W+ KP WCQPW+I LTG+  I  SWL+  ++ ++ +V   I AW   FL  +P+  S
Sbjct  5    DNPWNYKPWWCQPWSILLTGVAIILGSWLLFETIWISILVALPILAWMGFFLLLWPQLVS  64



>ref|XP_006386264.1| hypothetical protein POPTR_0002s05260g, partial [Populus trichocarpa]
 gb|ERP64061.1| hypothetical protein POPTR_0002s05260g, partial [Populus trichocarpa]
Length=122

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +2

Query  242  EMAFFDENGAVKDMDAYLDNLSLEYDSVWDTKPS  343
            E  F DENG V DMD YL+ LSLEYDSVWDTK S
Sbjct  89   ESRFLDENGVVDDMDGYLNYLSLEYDSVWDTKTS  122



>ref|WP_039778442.1| hypothetical protein [Acaryochloris sp. CCMEE 5410]
Length=78

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 39/63 (62%), Gaps = 0/63 (0%)
 Frame = +2

Query  326  WDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPKAYSEMI  505
            W+ KP WCQPW+I +TGI  IA +W +   + LT +V   + AW  +FL  +P+A  +  
Sbjct  8    WNYKPWWCQPWSILVTGITLIAGTWFVTKIVWLTILVAVPVLAWMGLFLILWPQAMKQAH  67

Query  506  AER  514
            +E+
Sbjct  68   SEQ  70



>ref|WP_011129890.1| hypothetical protein [Prochlorococcus marinus]
 emb|CAE20686.1| conserved hypothetical protein [Prochlorococcus marinus str. 
MIT 9313]
Length=81

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 33/58 (57%), Gaps = 0/58 (0%)
 Frame = +2

Query  320  SVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPKAY  493
            S WD KP WCQPW+I LTG+  +A SW   + L  T ++   +  WW +FL   P  Y
Sbjct  12   SFWDEKPWWCQPWSILLTGVACVAVSWWWPNLLWFTVLIAIGVIGWWGLFLVLAPAIY  69



>ref|WP_011294870.1| membrane protein [Prochlorococcus marinus]
 gb|AAZ58273.1| uncharacterized membrane protein [Prochlorococcus marinus str. 
NATL2A]
Length=71

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = +2

Query  320  SVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPKAY  493
            S WD+KP WCQPW+I   G++ +  S+ +L+++ +++++   I  WW +FL   P +Y
Sbjct  8    SFWDSKPYWCQPWSIISFGVLVLIFSFKLLNNIIISSILGFFILVWWILFLIIAPNSY  65



>ref|WP_009632959.1| hypothetical protein [Synechocystis sp. PCC 7509]
Length=73

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 36/56 (64%), Gaps = 0/56 (0%)
 Frame = +2

Query  320  SVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPK  487
            S+WD KP WCQPW+I LT I+ I+ SW++L  L +T +V   +  W   F+  +PK
Sbjct  7    SIWDYKPWWCQPWSIILTSILLISGSWVLLSKLWVTILVAIPVLTWMIYFVVIFPK  62



>ref|WP_036915524.1| MULTISPECIES: hypothetical protein [Prochlorococcus]
 gb|KGG24992.1| hypothetical protein EV12_2871 [Prochlorococcus sp. MIT 0701]
 gb|KGG26144.1| hypothetical protein EV13_2925 [Prochlorococcus sp. MIT 0702]
 gb|KGG32968.1| hypothetical protein EV14_1809 [Prochlorococcus sp. MIT 0703]
Length=85

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 33/58 (57%), Gaps = 0/58 (0%)
 Frame = +2

Query  320  SVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPKAY  493
            S WD KP WCQPW+I LTG+  +A SW   + L  T ++   +  WW +FL   P  Y
Sbjct  12   SFWDEKPWWCQPWSILLTGVAFVAFSWWWPNLLWFTVLIAIGVIGWWGLFLVLAPAVY  69



>ref|WP_015126925.1| hypothetical protein [Calothrix sp. PCC 7507]
 gb|AFY31100.1| hypothetical protein Cal7507_0611 [Calothrix sp. PCC 7507]
Length=81

 Score = 53.1 bits (126),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 40/75 (53%), Gaps = 10/75 (13%)
 Frame = +2

Query  326  WDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPKAYSEMI  505
            W+ KP WCQPW+I LTG+  I+ SWLI   + LT ++   I  W   FL  +P+      
Sbjct  10   WNYKPWWCQPWSILLTGVTLISGSWLIFKIIWLTILISIPILIWMGFFLLIWPQL-----  64

Query  506  AERRERVTNGLEDTY  550
                  + +G+ DTY
Sbjct  65   -----MIRSGVLDTY  74



>ref|WP_026101668.1| hypothetical protein [cyanobacterium PCC 7702]
Length=87

 Score = 52.8 bits (125),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = +2

Query  326  WDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYP  484
            W  KP WCQPW+I LTG+  IA SW++   + LT V+   I AW   FL+ +P
Sbjct  10   WKYKPWWCQPWSIFLTGLTLIAGSWIVFKIVWLTVVISIPILAWMGFFLFLWP  62



>ref|WP_011824198.1| membrane protein [Prochlorococcus marinus]
 gb|ABM76189.1| Hypothetical protein NATL1_16321 [Prochlorococcus marinus str. 
NATL1A]
Length=71

 Score = 52.4 bits (124),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 21/57 (37%), Positives = 37/57 (65%), Gaps = 0/57 (0%)
 Frame = +2

Query  320  SVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPKA  490
            S WD+KP WCQPW+I   G++ +  S+ +L+++ +T+++   I  WW +FL   P +
Sbjct  8    SFWDSKPYWCQPWSIISFGVLVLIFSFKLLNNIIITSILGFFILVWWILFLIIAPNS  64



>gb|AFY94914.1| hypothetical protein Cha6605_3950 [Chamaesiphon minutus PCC 6605]
Length=70

 Score = 52.0 bits (123),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = +2

Query  320  SVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPKAYSE  499
            ++W++KP WCQPWTI LTGI+ IA SWL+ H+  LT  V ALI  WW  FL   P+  + 
Sbjct  5    NLWESKPWWCQPWTIILTGIIIIAGSWLVFHTFWLTVPVGALIVLWWTYFLIVVPRILAA  64

Query  500  MIAER  514
               +R
Sbjct  65   KDLDR  69



>ref|WP_009459171.1| MULTISPECIES: hypothetical protein [Fischerella]
 gb|EHC09684.1| hypothetical protein FJSC11DRAFT_3856 [Fischerella sp. JSC-11]
Length=86

 Score = 52.0 bits (123),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 28/85 (33%), Positives = 45/85 (53%), Gaps = 10/85 (12%)
 Frame = +2

Query  320  SVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPKAYSE  499
            S W  KP WCQPW+I LTG + I+ASW+I  ++ LT ++   +  W   FL  +P+    
Sbjct  8    SPWKFKPWWCQPWSILLTGTMLISASWVIFKTVWLTVLIAIPVLTWMGFFLLIWPQLI--  65

Query  500  MIAERRERVTNGLEDTYGEEKSQ*P  574
                    + +G+ ++Y   K + P
Sbjct  66   --------IRSGILESYQLSKDKIP  82



>ref|WP_037991175.1| hypothetical protein [Synechococcus sp. CC9616]
Length=63

 Score = 51.6 bits (122),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = +2

Query  335  KPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPKAY  493
            KP WCQPW+I LTG+V +A SW     + +T  +   ++AWW +FL   P AY
Sbjct  2    KPWWCQPWSILLTGLVVVAGSWWWPQRIWITLPLGVAVAAWWTLFLVLVPAAY  54



>ref|WP_011826385.1| hypothetical protein [Prochlorococcus marinus]
 gb|ABM78498.1| conserved hypothetical protein [Prochlorococcus marinus str. 
MIT 9303]
Length=85

 Score = 52.0 bits (123),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 33/58 (57%), Gaps = 0/58 (0%)
 Frame = +2

Query  320  SVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPKAY  493
            S W+ KP WCQPW+I LTG+  +A SW   + L  T ++   +  WW +FL   P  Y
Sbjct  12   SFWNEKPWWCQPWSILLTGVACVAVSWWWPNLLWFTVLIAIGVFGWWGLFLVLAPAIY  69



>ref|WP_015166291.1| hypothetical protein [Pseudanabaena sp. PCC 7367]
 gb|AFY71335.1| hypothetical protein Pse7367_3086 [Pseudanabaena sp. PCC 7367]
Length=83

 Score = 52.0 bits (123),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 37/61 (61%), Gaps = 0/61 (0%)
 Frame = +2

Query  326  WDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPKAYSEMI  505
            W  KP WCQPW+I LT +V IA SWL+  S  LTA+V   + +W   F+  +P+  + + 
Sbjct  13   WQYKPWWCQPWSIVLTAVVLIAGSWLLFTSKWLTAIVAIPVISWAIFFVGIWPRLVAPIY  72

Query  506  A  508
            A
Sbjct  73   A  73



>ref|WP_026736472.1| hypothetical protein [Fischerella sp. PCC 9605]
Length=80

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 41/77 (53%), Gaps = 10/77 (13%)
 Frame = +2

Query  320  SVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPKAYSE  499
            S W  KP WCQPW+I LTG+  I +SWLI  ++ LT ++   +  W   FL  +P+    
Sbjct  7    SPWQFKPWWCQPWSILLTGVTLIGSSWLIFKTVWLTVLISIPVLVWMGFFLLIWPQLI--  64

Query  500  MIAERRERVTNGLEDTY  550
                    + +G+ D+Y
Sbjct  65   --------IRSGILDSY  73



>ref|WP_012407001.1| hypothetical protein [Nostoc punctiforme]
 gb|ACC78973.1| conserved hypothetical protein [Nostoc punctiforme PCC 73102]
Length=76

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 35/56 (63%), Gaps = 0/56 (0%)
 Frame = +2

Query  320  SVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPK  487
            S W+ KP WCQPW+I LTG+  I+ SWL+  ++ LT +V   I  W   F+  +P+
Sbjct  8    SPWNYKPWWCQPWSIVLTGVTIISGSWLLFKTIWLTILVSIPIVMWMGFFVLFWPQ  63



>ref|WP_006199207.1| hypothetical protein [Nodularia spumigena]
 gb|EAW42677.1| hypothetical protein N9414_19302 [Nodularia spumigena CCY9414]
 gb|AHJ30199.1| hypothetical protein NSP_38960 [Nodularia spumigena CCY9414]
Length=68

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 35/56 (63%), Gaps = 0/56 (0%)
 Frame = +2

Query  320  SVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPK  487
            S W  KP WCQPW+I LTG++ ++ SWL+  ++ LT +V   +  W   FL  +PK
Sbjct  8    SPWHYKPWWCQPWSILLTGVMLMSGSWLLFKTIWLTVLVSIPVLTWMGFFLLIWPK  63



>ref|WP_015185270.1| hypothetical protein [Microcoleus sp. PCC 7113]
 gb|AFZ21137.1| hypothetical protein Mic7113_5501 [Microcoleus sp. PCC 7113]
Length=76

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 34/53 (64%), Gaps = 0/53 (0%)
 Frame = +2

Query  326  WDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYP  484
            W  KP WCQPW+I LTG + IA+SW ++ ++ +T +V   I  WW  FL  +P
Sbjct  12   WSYKPWWCQPWSILLTGTMIIASSWALVKTVWVTILVALPILLWWTFFLLIWP  64



>ref|WP_011317125.1| hypothetical protein [Anabaena variabilis]
 gb|ABA19863.1| conserved hypothetical protein [Anabaena variabilis ATCC 29413]
Length=78

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/54 (43%), Positives = 33/54 (61%), Gaps = 0/54 (0%)
 Frame = +2

Query  326  WDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPK  487
            W+ KP WCQPW+I LTG+  I  SWL+L  + +T +V   +  W   FL  +P+
Sbjct  10   WNYKPWWCQPWSILLTGLTLIGGSWLLLKIIWVTVMVAIPVLVWMGFFLLIWPQ  63



>ref|WP_044077396.1| hypothetical protein, partial [Prochlorothrix hollandica]
Length=73

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 34/56 (61%), Gaps = 0/56 (0%)
 Frame = +2

Query  320  SVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPK  487
            +VW  KP WCQPW+I  TG  AIAASW + H   LT VV   + AW   F+  +P+
Sbjct  9    NVWAYKPWWCQPWSILATGWGAIAASWWLFHRYWLTIVVALPLLAWMVFFVILWPR  64



>ref|WP_010996583.1| hypothetical protein [Nostoc sp. PCC 7120]
 dbj|BAB74126.1| asr2427 [Nostoc sp. PCC 7120]
Length=78

 Score = 50.1 bits (118),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 32/53 (60%), Gaps = 0/53 (0%)
 Frame = +2

Query  326  WDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYP  484
            W+ KP WCQPW+I LTG+  I  SWL+L  + +T +V   +  W   FL  +P
Sbjct  10   WNYKPWWCQPWSILLTGLSLIGGSWLLLKIIWVTVIVAIPVLVWMGFFLLIWP  62



>ref|WP_015174984.1| hypothetical protein [Oscillatoria nigro-viridis]
 gb|AFZ05658.1| hypothetical protein Osc7112_1108 [Oscillatoria nigro-viridis 
PCC 7112]
Length=79

 Score = 50.1 bits (118),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 33/56 (59%), Gaps = 0/56 (0%)
 Frame = +2

Query  320  SVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPK  487
            S W  KP WCQPW+I LTG   I  SW +L ++ +T +V   + AW   FL  +P+
Sbjct  11   SPWSYKPWWCQPWSILLTGTSLIGGSWFLLKTVWITVLVAIPLLAWMGFFLLVWPR  66



>ref|WP_016868508.1| hypothetical protein [Fischerella muscicola]
Length=86

 Score = 50.1 bits (118),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 27/85 (32%), Positives = 43/85 (51%), Gaps = 10/85 (12%)
 Frame = +2

Query  320  SVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPKAYSE  499
            S W  KP WCQPW+I LTG + I+ SW+I   + LT ++   +  W   FL  +P+    
Sbjct  8    SPWKFKPWWCQPWSILLTGTMLISGSWVIFKIVWLTVLIAIPVVIWMGFFLLIWPQLI--  65

Query  500  MIAERRERVTNGLEDTYGEEKSQ*P  574
                    + +G+ ++Y   K + P
Sbjct  66   --------IRSGILESYQLSKDEIP  82



>gb|KIF37672.1| hypothetical protein PI95_01125 [Hassallia byssoidea VB512170]
Length=77

 Score = 49.7 bits (117),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 32/56 (57%), Gaps = 0/56 (0%)
 Frame = +2

Query  320  SVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPK  487
            S W  KP WCQPW+I LTG+  I  SW++   + LT +V   I  W   FL  +P+
Sbjct  8    SPWKYKPWWCQPWSILLTGVTLITGSWVLFKIIWLTVLVSVPILTWMGFFLLMWPQ  63



>ref|WP_013192206.1| hypothetical protein [Trichormus azollae]
 gb|ADI65192.1| conserved hypothetical protein ['Nostoc azollae' 0708]
Length=75

 Score = 49.7 bits (117),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 34/56 (61%), Gaps = 0/56 (0%)
 Frame = +2

Query  320  SVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPK  487
            S W  KP WCQPW+I LTG++ I+ SWLI   + LT +V   +  W   +L  +P+
Sbjct  8    SPWSYKPWWCQPWSIMLTGVILISGSWLIFKIIWLTILVAIPVLIWIGFYLLIWPQ  63



>ref|XP_008809901.1| PREDICTED: uncharacterized protein LOC103721454, partial [Phoenix 
dactylifera]
Length=74

 Score = 49.7 bits (117),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 21/30 (70%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = +2

Query  248  AFFDENGAVKDMDAYLDNLSLEYDSVWDTK  337
             F  E+G V+DMD YL+ LSLEYDSVWDTK
Sbjct  45   PFLGEDGVVEDMDGYLNYLSLEYDSVWDTK  74



>ref|WP_016861984.1| hypothetical protein [Fischerella muscicola]
Length=86

 Score = 49.7 bits (117),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 23/55 (42%), Positives = 32/55 (58%), Gaps = 0/55 (0%)
 Frame = +2

Query  320  SVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYP  484
            S W  KP WCQPW+I LTG+  I+ SW+I   + LT ++   +  W   FL  +P
Sbjct  8    SPWKFKPWWCQPWSIMLTGVTLISGSWIIFKIVWLTVLIAIPVITWMSFFLLIWP  62



>gb|AFZ13285.1| hypothetical protein Cri9333_2418 [Crinalium epipsammum PCC 9333]
Length=82

 Score = 49.7 bits (117),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 36/56 (64%), Gaps = 0/56 (0%)
 Frame = +2

Query  320  SVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPK  487
            S W+ KP WCQPW+I LTG+  I +SWL+  ++ +T ++   + AW   FL  +P+
Sbjct  8    SPWNHKPWWCQPWSILLTGVTIIFSSWLLAKTIWITLLISIPVVAWMGYFLLIWPR  63



>ref|WP_006635664.1| hypothetical protein [Microcoleus vaginatus]
 gb|EGK83872.1| hypothetical protein MicvaDRAFT_0194 [Microcoleus vaginatus FGP-2]
Length=79

 Score = 49.3 bits (116),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 22/54 (41%), Positives = 33/54 (61%), Gaps = 0/54 (0%)
 Frame = +2

Query  326  WDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPK  487
            W+ KP WCQPW+I LTG   I+ SW +  ++ +T +V   + AW   FL  +P+
Sbjct  13   WNYKPWWCQPWSILLTGTSLISGSWFLFKTVWITVLVAIPLLAWMSFFLLVWPR  66



>ref|WP_015215734.1| hypothetical protein [Anabaena cylindrica]
 gb|AFZ59113.1| hypothetical protein Anacy_3729 [Anabaena cylindrica PCC 7122]
Length=79

 Score = 49.3 bits (116),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 37/70 (53%), Gaps = 1/70 (1%)
 Frame = +2

Query  326  WDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPKAYSEMI  505
            W+ KP WCQPW+I LT I  I+ SWLI   + LT +V   +  W   F+  +PK   +  
Sbjct  10   WNYKPWWCQPWSIILTAITLISGSWLIFKIIWLTILVAIPLLIWMGFFVLIWPKLMIQS-  68

Query  506  AERRERVTNG  535
                + + NG
Sbjct  69   GVLEQGIGNG  78



>ref|WP_017312346.1| hypothetical protein [Fischerella sp. PCC 9339]
Length=86

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/55 (42%), Positives = 32/55 (58%), Gaps = 0/55 (0%)
 Frame = +2

Query  320  SVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYP  484
            S W  KP WCQPW+I LTG+  I+ SW+I   + LT ++   +  W   FL  +P
Sbjct  8    SPWKFKPWWCQPWSILLTGLTLISGSWIIFKIVWLTVLIAIPVLTWMGFFLIIWP  62



>gb|EGJ32352.1| hypothetical protein LYNGBM3L_19510 [Moorea producens 3L]
Length=81

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/54 (43%), Positives = 32/54 (59%), Gaps = 0/54 (0%)
 Frame = +2

Query  326  WDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPK  487
            W  KP WCQPW+I LTG   I + W++  +L +T +V   I  WW  FL  +P+
Sbjct  10   WSYKPWWCQPWSILLTGGGIILSIWVVFKTLWITLLVAMPILLWWTYFLLIWPE  63



>gb|KIE09282.1| hypothetical protein DA73_0233440 [Tolypothrix bouteillei VB521301]
Length=76

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/54 (41%), Positives = 30/54 (56%), Gaps = 0/54 (0%)
 Frame = +2

Query  326  WDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPK  487
            W  KP WCQPW+I LTG+  I  SW++  ++  T  V   I  W   FL  +P+
Sbjct  10   WKYKPWWCQPWSILLTGVTLIGGSWVLFKTIWFTIFVSIPILVWMGFFLLIWPQ  63



>ref|WP_043691961.1| hypothetical protein [Synechococcus sp. KORDI-49]
 gb|AII45754.1| hypothetical protein KR49_04695 [Synechococcus sp. KORDI-49]
Length=78

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 39/62 (63%), Gaps = 0/62 (0%)
 Frame = +2

Query  305  SLEYDSVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYP  484
            S E  S W  KP WCQPWTI +TG +AI  SW +LH L LT  +  L+  WW++FL   P
Sbjct  7    SPEPTSFWSHKPWWCQPWTILMTGSLAIGGSWWLLHWLWLTLPIALLVLIWWWLFLIVVP  66

Query  485  KA  490
            ++
Sbjct  67   RS  68



>ref|WP_038543930.1| hypothetical protein [Synechococcus sp. KORDI-100]
 gb|AII42927.1| hypothetical protein KR100_06045 [Synechococcus sp. KORDI-100]
Length=63

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/55 (42%), Positives = 31/55 (56%), Gaps = 0/55 (0%)
 Frame = +2

Query  335  KPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPKAYSE  499
            KP WCQPW+I LTGI  ++ SW     + +T  +   + AWW +FL   P AY  
Sbjct  2    KPWWCQPWSILLTGIAVVSGSWWWPQRIWITLPLGLAVVAWWTLFLVLVPAAYRH  56



>ref|WP_015078909.1| hypothetical protein [Anabaena sp. 90]
 gb|AFW93745.1| hypothetical protein ANA_C10955 [Anabaena sp. 90]
Length=76

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 33/56 (59%), Gaps = 0/56 (0%)
 Frame = +2

Query  320  SVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPK  487
            S W +KP WCQPW+I LT +  I+ SWLI   + LT +V   +  W   FL  +P+
Sbjct  8    SPWQSKPWWCQPWSIILTSLTLISGSWLIFKIIWLTILVAIPLLIWMGFFLLIWPQ  63



>ref|WP_039201620.1| hypothetical protein [Aphanizomenon flos-aquae]
 gb|KHG41542.1| hypothetical protein OA07_10735 [Aphanizomenon flos-aquae 2012/KM1/D3]
Length=78

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 38/75 (51%), Gaps = 6/75 (8%)
 Frame = +2

Query  320  SVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPKAYSE  499
            S W  KP WCQPW+I LT +  I  SWLI   L +T +V   +  W   FL  +P+    
Sbjct  8    SPWKYKPWWCQPWSIILTAVTLIGGSWLIFKILWVTILVAIPLLIWMGFFLLIWPQM---  64

Query  500  MIAERRERVTNGLED  544
            MI   R  V + LE 
Sbjct  65   MI---RSGVLDNLEK  76



>ref|WP_016952610.1| hypothetical protein [Anabaena sp. PCC 7108]
Length=78

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 39/75 (52%), Gaps = 6/75 (8%)
 Frame = +2

Query  320  SVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPKAYSE  499
            S W  KP WCQPW+I LT +  I+ SWLI   + LT +V   +  W   FL  +P+    
Sbjct  8    SPWKFKPWWCQPWSIMLTTVTLISGSWLIFKIIWLTILVAIPLLIWMGFFLLIWPQL---  64

Query  500  MIAERRERVTNGLED  544
            MI   R  V + LE 
Sbjct  65   MI---RSGVLDNLEK  76



>ref|WP_028090945.1| hypothetical protein [Dolichospermum circinale]
Length=84

 Score = 47.8 bits (112),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 41/82 (50%), Gaps = 6/82 (7%)
 Frame = +2

Query  320  SVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPKAYSE  499
            S W  KP WCQPW+I +T I  I+ SWL+   + LT +V   +  W   FL  +P+    
Sbjct  8    SPWKYKPWWCQPWSIIMTTITLISGSWLVFKIMWLTILVAIPLLIWMGFFLLIWPQMMV-  66

Query  500  MIAERRERVTNGLEDTYGEEKS  565
                 +  + N +++    E++
Sbjct  67   -----KSGLLNNIDNDDNHERN  83



>ref|WP_042503158.1| hypothetical protein [Synechococcus sp. WH 8102]
Length=78

 Score = 47.4 bits (111),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 33/71 (46%), Gaps = 0/71 (0%)
 Frame = +2

Query  281  MDAYLDNLSLEYDSVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWW  460
            M       S +    W  KP WCQPW+I  TG   I  SW     L ++  +   +SAWW
Sbjct  1    MPPVSSKPSADQPPFWSLKPWWCQPWSIISTGSAVIGLSWWWPGRLWISIPIGLAVSAWW  60

Query  461  YIFLYSYPKAY  493
             +FL   P AY
Sbjct  61   LLFLVIVPAAY  71



>ref|WP_026720363.1| hypothetical protein [Fischerella sp. PCC 9431]
Length=85

 Score = 47.4 bits (111),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/55 (42%), Positives = 31/55 (56%), Gaps = 0/55 (0%)
 Frame = +2

Query  320  SVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYP  484
            S W  KP WCQPW+I LTG+  I+ SW+I     LT ++   +  W   FL  +P
Sbjct  8    SPWKFKPWWCQPWSILLTGVSLISGSWIIFKIAWLTVLIAIPVLTWMGFFLLIWP  62



>ref|WP_017746215.1| hypothetical protein [Scytonema hofmanni]
Length=76

 Score = 47.4 bits (111),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 21/54 (39%), Positives = 30/54 (56%), Gaps = 0/54 (0%)
 Frame = +2

Query  326  WDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPK  487
            W  KP WCQPW+I LTG+  I   W++  ++  T +V   I  W   FL  +P+
Sbjct  10   WKYKPWWCQPWSILLTGVTVIGGIWVLFRTIWFTLLVSIPIIVWMGFFLLIWPQ  63



>ref|WP_027404173.1| hypothetical protein [Aphanizomenon flos-aquae]
Length=74

 Score = 47.0 bits (110),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 40/76 (53%), Gaps = 9/76 (12%)
 Frame = +2

Query  320  SVWDTKPSWCQPWTIALTGIVAIAASWLILHSLTLTAVVVALISAWWYIFLYSYPKAYSE  499
            S W  KP WCQPW+I LT +  I+ SWLI   L +T +V   +  W   FL  +P+    
Sbjct  8    SPWKYKPWWCQPWSIILTAVTLISGSWLIFKILWVTILVAIPLLIWMGFFLLIWPQM---  64

Query  500  MIAERRERVTNGLEDT  547
            MI   R RV   LED 
Sbjct  65   MI---RSRV---LEDV  74



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 998120974048