BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig11308

Length=1178
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009782781.1|  PREDICTED: uncharacterized acetyltransferase...    385   6e-127   Nicotiana sylvestris
ref|XP_009625193.1|  PREDICTED: uncharacterized acetyltransferase...    375   1e-122   Nicotiana tomentosiformis
ref|XP_009764197.1|  PREDICTED: uncharacterized acetyltransferase...    372   2e-121   Nicotiana sylvestris
ref|XP_006367771.1|  PREDICTED: uncharacterized acetyltransferase...    367   6e-120   Solanum tuberosum [potatoes]
ref|XP_006342478.1|  PREDICTED: uncharacterized acetyltransferase...    361   2e-117   Solanum tuberosum [potatoes]
ref|XP_004253191.2|  PREDICTED: uncharacterized acetyltransferase...    361   3e-117   Solanum lycopersicum
ref|XP_004244447.2|  PREDICTED: uncharacterized acetyltransferase...    352   4e-114   Solanum lycopersicum
ref|XP_009762458.1|  PREDICTED: uncharacterized acetyltransferase...    327   4e-104   Nicotiana sylvestris
ref|XP_004231858.1|  PREDICTED: uncharacterized acetyltransferase...    324   5e-103   Solanum lycopersicum
ref|XP_009589621.1|  PREDICTED: uncharacterized acetyltransferase...    321   6e-102   Nicotiana tomentosiformis
ref|XP_006339875.1|  PREDICTED: uncharacterized acetyltransferase...    318   2e-100   Solanum tuberosum [potatoes]
ref|XP_011000815.1|  PREDICTED: uncharacterized acetyltransferase...    317   2e-100   Populus euphratica
ref|XP_009777111.1|  PREDICTED: uncharacterized acetyltransferase...    311   4e-100   Nicotiana sylvestris
ref|XP_006385479.1|  hypothetical protein POPTR_0003s05570g             310   5e-99    
gb|ABK94771.1|  unknown                                                 313   6e-99    Populus trichocarpa [western balsam poplar]
ref|XP_002304177.2|  hypothetical protein POPTR_0003s05590g             312   2e-98    Populus trichocarpa [western balsam poplar]
ref|XP_006360905.1|  PREDICTED: uncharacterized acetyltransferase...    311   2e-98    
ref|XP_009625194.1|  PREDICTED: uncharacterized acetyltransferase...    310   4e-98    
gb|ABK94986.1|  unknown                                                 310   7e-98    Populus trichocarpa [western balsam poplar]
ref|XP_002304178.2|  anthranilate N-hydroxycinnamoyl/benzoyltrans...    310   7e-98    
ref|XP_009589622.1|  PREDICTED: uncharacterized acetyltransferase...    308   5e-97    
ref|XP_010274412.1|  PREDICTED: uncharacterized acetyltransferase...    308   1e-96    Nelumbo nucifera [Indian lotus]
ref|XP_002282930.1|  PREDICTED: uncharacterized acetyltransferase...    307   1e-96    Vitis vinifera
ref|XP_007204351.1|  hypothetical protein PRUPE_ppa005715mg             307   1e-96    Prunus persica
ref|XP_011071701.1|  PREDICTED: uncharacterized acetyltransferase...    306   4e-96    Sesamum indicum [beniseed]
ref|XP_008241487.1|  PREDICTED: uncharacterized acetyltransferase...    304   3e-95    Prunus mume [ume]
ref|XP_002533255.1|  Anthranilate N-benzoyltransferase protein, p...    302   9e-95    Ricinus communis
ref|XP_008338333.1|  PREDICTED: uncharacterized acetyltransferase...    296   3e-92    
gb|AAV50009.1|  anthranilate N-hydroxycinnamoyl/benzoyltransferase      294   6e-92    Malus domestica [apple tree]
ref|XP_008367983.1|  PREDICTED: uncharacterized acetyltransferase...    296   8e-92    
ref|XP_007047323.1|  HXXXD-type acyl-transferase family protein, ...    295   1e-91    
ref|XP_008382283.1|  PREDICTED: uncharacterized acetyltransferase...    292   1e-90    
ref|XP_008361493.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    291   2e-90    
ref|XP_012079578.1|  PREDICTED: uncharacterized acetyltransferase...    290   9e-90    Jatropha curcas
ref|XP_007204343.1|  hypothetical protein PRUPE_ppa005635mg             288   3e-89    
ref|XP_009343279.1|  PREDICTED: uncharacterized acetyltransferase...    287   8e-89    Pyrus x bretschneideri [bai li]
ref|XP_009367311.1|  PREDICTED: uncharacterized acetyltransferase...    287   1e-88    Pyrus x bretschneideri [bai li]
ref|XP_008361421.1|  PREDICTED: uncharacterized acetyltransferase...    291   2e-88    
ref|XP_010933132.1|  PREDICTED: uncharacterized acetyltransferase...    286   2e-88    Elaeis guineensis
ref|XP_007203275.1|  hypothetical protein PRUPE_ppa025470mg             286   3e-88    Prunus persica
ref|XP_007047327.1|  HXXXD-type acyl-transferase family protein, ...    285   5e-88    
ref|XP_008778923.1|  PREDICTED: uncharacterized acetyltransferase...    285   1e-87    Phoenix dactylifera
ref|XP_004509127.1|  PREDICTED: uncharacterized acetyltransferase...    283   3e-87    Cicer arietinum [garbanzo]
ref|XP_011071710.1|  PREDICTED: uncharacterized acetyltransferase...    282   3e-87    
ref|XP_007203667.1|  hypothetical protein PRUPE_ppa026934mg             283   4e-87    
ref|XP_008241494.1|  PREDICTED: uncharacterized acetyltransferase...    278   8e-87    
ref|XP_009349545.1|  PREDICTED: uncharacterized acetyltransferase...    281   2e-86    Pyrus x bretschneideri [bai li]
ref|XP_003549969.1|  PREDICTED: uncharacterized acetyltransferase...    280   4e-86    Glycine max [soybeans]
ref|XP_008352605.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    281   4e-86    
ref|XP_007136703.1|  hypothetical protein PHAVU_009G066800g             280   1e-85    Phaseolus vulgaris [French bean]
ref|XP_007021469.1|  HXXXD-type acyl-transferase family protein, ...    278   2e-85    
ref|XP_004230695.1|  PREDICTED: uncharacterized acetyltransferase...    279   2e-85    Solanum lycopersicum
ref|XP_007203377.1|  hypothetical protein PRUPE_ppa025976mg             278   2e-85    
ref|XP_007136702.1|  hypothetical protein PHAVU_009G066700g             279   2e-85    Phaseolus vulgaris [French bean]
emb|CDP11972.1|  unnamed protein product                                278   4e-85    Coffea canephora [robusta coffee]
gb|KHN18660.1|  Putative acetyltransferase                              278   4e-85    Glycine soja [wild soybean]
gb|KJB43780.1|  hypothetical protein B456_007G215400                    276   5e-85    Gossypium raimondii
ref|XP_008241486.1|  PREDICTED: uncharacterized acetyltransferase...    277   5e-85    Prunus mume [ume]
ref|XP_004288019.1|  PREDICTED: uncharacterized acetyltransferase...    277   6e-85    Fragaria vesca subsp. vesca
ref|XP_008361429.1|  PREDICTED: uncharacterized acetyltransferase...    277   8e-85    
ref|XP_010109793.1|  putative acetyltransferase                         277   8e-85    Morus notabilis
ref|XP_008352555.1|  PREDICTED: uncharacterized acetyltransferase...    276   2e-84    
ref|XP_007204342.1|  hypothetical protein PRUPE_ppa005630mg             275   3e-84    Prunus persica
emb|CDP06257.1|  unnamed protein product                                275   7e-84    Coffea canephora [robusta coffee]
ref|XP_006480712.1|  PREDICTED: uncharacterized acetyltransferase...    274   1e-83    Citrus sinensis [apfelsine]
ref|XP_010927209.1|  PREDICTED: uncharacterized acetyltransferase...    274   2e-83    Elaeis guineensis
ref|XP_010317216.1|  PREDICTED: uncharacterized acetyltransferase...    274   2e-83    
ref|XP_010924632.1|  PREDICTED: uncharacterized acetyltransferase...    273   2e-83    Elaeis guineensis
ref|XP_004233972.1|  PREDICTED: uncharacterized acetyltransferase...    273   2e-83    
ref|XP_009338991.1|  PREDICTED: uncharacterized acetyltransferase...    273   3e-83    Pyrus x bretschneideri [bai li]
ref|XP_004288018.1|  PREDICTED: uncharacterized acetyltransferase...    273   3e-83    Fragaria vesca subsp. vesca
gb|KDP31965.1|  hypothetical protein JCGZ_12426                         273   7e-83    Jatropha curcas
ref|XP_008787703.1|  PREDICTED: uncharacterized acetyltransferase...    272   7e-83    
ref|XP_008342727.1|  PREDICTED: uncharacterized acetyltransferase...    272   7e-83    Malus domestica [apple tree]
ref|XP_012079264.1|  PREDICTED: uncharacterized acetyltransferase...    271   8e-83    
ref|XP_008347613.1|  PREDICTED: uncharacterized acetyltransferase...    272   9e-83    
ref|XP_004230696.1|  PREDICTED: uncharacterized acetyltransferase...    272   1e-82    Solanum lycopersicum
ref|XP_007155908.1|  hypothetical protein PHAVU_003G242200g             271   1e-82    Phaseolus vulgaris [French bean]
ref|XP_006428978.1|  hypothetical protein CICLE_v10011715mg             271   1e-82    Citrus clementina [clementine]
ref|XP_006346302.1|  PREDICTED: uncharacterized acetyltransferase...    271   2e-82    Solanum tuberosum [potatoes]
ref|XP_007136696.1|  hypothetical protein PHAVU_009G066100g             271   2e-82    Phaseolus vulgaris [French bean]
ref|XP_008378023.1|  PREDICTED: uncharacterized acetyltransferase...    271   3e-82    
gb|KEH31455.1|  anthranilate N-benzoyltransferase                       270   3e-82    Medicago truncatula
gb|KJB43781.1|  hypothetical protein B456_007G215600                    270   3e-82    Gossypium raimondii
ref|XP_006480713.1|  PREDICTED: uncharacterized acetyltransferase...    270   4e-82    Citrus sinensis [apfelsine]
ref|XP_004291090.1|  PREDICTED: uncharacterized acetyltransferase...    270   4e-82    Fragaria vesca subsp. vesca
ref|XP_007136704.1|  hypothetical protein PHAVU_009G066900g             269   1e-81    Phaseolus vulgaris [French bean]
ref|XP_004289208.1|  PREDICTED: uncharacterized acetyltransferase...    269   2e-81    Fragaria vesca subsp. vesca
ref|XP_008393787.1|  PREDICTED: uncharacterized acetyltransferase...    268   2e-81    
ref|XP_007149064.1|  hypothetical protein PHAVU_005G037900g             268   3e-81    Phaseolus vulgaris [French bean]
ref|XP_003602051.1|  Acetyltransferase, putative                        267   4e-81    Medicago truncatula
ref|XP_010270496.1|  PREDICTED: uncharacterized acetyltransferase...    267   5e-81    Nelumbo nucifera [Indian lotus]
ref|XP_004509128.1|  PREDICTED: uncharacterized acetyltransferase...    267   5e-81    Cicer arietinum [garbanzo]
ref|XP_003524646.1|  PREDICTED: uncharacterized acetyltransferase...    266   6e-81    Glycine max [soybeans]
ref|XP_007224078.1|  hypothetical protein PRUPE_ppa015472mg             267   7e-81    Prunus persica
emb|CDP11973.1|  unnamed protein product                                267   8e-81    Coffea canephora [robusta coffee]
emb|CDP06258.1|  unnamed protein product                                266   1e-80    Coffea canephora [robusta coffee]
ref|XP_003523952.2|  PREDICTED: uncharacterized acetyltransferase...    266   2e-80    
gb|ACU20865.1|  unknown                                                 266   2e-80    Glycine max [soybeans]
gb|ABC47861.1|  N-hydroxycinnamoyl/benzoyltransferase 2                 265   2e-80    Glycine max [soybeans]
gb|KJB64133.1|  hypothetical protein B456_010G034300                    265   2e-80    Gossypium raimondii
ref|XP_004289211.2|  PREDICTED: uncharacterized acetyltransferase...    265   3e-80    Fragaria vesca subsp. vesca
ref|XP_003605008.1|  Acetyltransferase, putative                        265   4e-80    Medicago truncatula
ref|XP_003528298.1|  PREDICTED: uncharacterized acetyltransferase...    265   4e-80    Glycine max [soybeans]
ref|XP_009365277.1|  PREDICTED: uncharacterized acetyltransferase...    265   6e-80    Pyrus x bretschneideri [bai li]
ref|XP_002282951.2|  PREDICTED: uncharacterized protein LOC100245729    275   7e-80    
ref|XP_007204008.1|  hypothetical protein PRUPE_ppa025918mg             264   1e-79    
gb|KEH31451.1|  HXXXD-type acyl-transferase family protein              263   1e-79    Medicago truncatula
gb|KCW66380.1|  hypothetical protein EUGRSUZ_F00196                     261   1e-79    Eucalyptus grandis [rose gum]
ref|XP_003523954.1|  PREDICTED: uncharacterized acetyltransferase...    264   1e-79    Glycine max [soybeans]
ref|XP_010109796.1|  putative acetyltransferase                         266   1e-79    
gb|KEH31452.1|  anthranilate N-benzoyltransferase                       263   1e-79    Medicago truncatula
ref|XP_008452574.1|  PREDICTED: uncharacterized acetyltransferase...    264   1e-79    Cucumis melo [Oriental melon]
ref|XP_002523237.1|  3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransf...    263   2e-79    
gb|KEH29083.1|  HXXXD-type acyl-transferase family protein              262   3e-79    Medicago truncatula
gb|KJB63882.1|  hypothetical protein B456_010G021700                    263   3e-79    Gossypium raimondii
gb|KHN04489.1|  Putative acetyltransferase                              263   4e-79    Glycine soja [wild soybean]
ref|XP_004511082.1|  PREDICTED: uncharacterized acetyltransferase...    261   7e-79    Cicer arietinum [garbanzo]
ref|XP_007136701.1|  hypothetical protein PHAVU_009G066600g             262   7e-79    Phaseolus vulgaris [French bean]
gb|KJB63872.1|  hypothetical protein B456_010G021400                    261   8e-79    Gossypium raimondii
ref|XP_006374905.1|  transferase family protein                         261   2e-78    
ref|XP_003605002.1|  Acetyltransferase, putative                        260   2e-78    Medicago truncatula
ref|XP_003622067.1|  Acetyltransferase, putative                        260   3e-78    Medicago truncatula
ref|XP_004291089.1|  PREDICTED: uncharacterized acetyltransferase...    260   3e-78    Fragaria vesca subsp. vesca
ref|XP_010927437.1|  PREDICTED: uncharacterized acetyltransferase...    260   3e-78    
ref|XP_008338376.1|  PREDICTED: uncharacterized acetyltransferase...    260   3e-78    
ref|XP_004141386.2|  PREDICTED: uncharacterized acetyltransferase...    260   3e-78    Cucumis sativus [cucumbers]
gb|EYU35826.1|  hypothetical protein MIMGU_mgv1a006141mg                260   3e-78    Erythranthe guttata [common monkey flower]
ref|XP_002284916.2|  PREDICTED: uncharacterized acetyltransferase...    260   3e-78    Vitis vinifera
ref|XP_003550055.1|  PREDICTED: uncharacterized acetyltransferase...    259   4e-78    Glycine max [soybeans]
gb|KEH16419.1|  HXXXD-type acyl-transferase family protein              259   4e-78    Medicago truncatula
gb|KHN15623.1|  Putative acetyltransferase                              259   5e-78    Glycine soja [wild soybean]
ref|XP_010064179.1|  PREDICTED: uncharacterized acetyltransferase...    260   5e-78    Eucalyptus grandis [rose gum]
ref|XP_010059906.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    259   5e-78    Eucalyptus grandis [rose gum]
ref|XP_003525889.1|  PREDICTED: uncharacterized acetyltransferase...    259   8e-78    Glycine max [soybeans]
ref|XP_011029557.1|  PREDICTED: uncharacterized acetyltransferase...    259   8e-78    Populus euphratica
gb|ABC47860.1|  N-hydroxycinnamoyl/benzoyltransferase 1                 259   8e-78    Glycine max [soybeans]
ref|XP_008452572.1|  PREDICTED: uncharacterized acetyltransferase...    259   9e-78    Cucumis melo [Oriental melon]
ref|XP_006346306.1|  PREDICTED: uncharacterized acetyltransferase...    259   9e-78    
ref|XP_004141385.1|  PREDICTED: uncharacterized acetyltransferase...    259   1e-77    Cucumis sativus [cucumbers]
ref|XP_007203290.1|  hypothetical protein PRUPE_ppa025724mg             255   1e-77    
ref|XP_010059907.1|  PREDICTED: uncharacterized acetyltransferase...    258   2e-77    
gb|KHN22332.1|  Putative acetyltransferase                              258   2e-77    Glycine soja [wild soybean]
gb|KEH33177.1|  HXXXD-type acyl-transferase family protein              258   2e-77    Medicago truncatula
gb|KJB63871.1|  hypothetical protein B456_010G021300                    258   2e-77    Gossypium raimondii
ref|XP_003628043.1|  Acetyltransferase, putative                        257   3e-77    Medicago truncatula
ref|XP_010064180.1|  PREDICTED: uncharacterized acetyltransferase...    258   3e-77    Eucalyptus grandis [rose gum]
gb|KHN04491.1|  Putative acetyltransferase                              258   3e-77    Glycine soja [wild soybean]
ref|XP_003523950.1|  PREDICTED: uncharacterized acetyltransferase...    258   3e-77    
gb|ACU18586.1|  unknown                                                 258   3e-77    Glycine max [soybeans]
emb|CAN78155.1|  hypothetical protein VITISV_032623                     261   5e-77    Vitis vinifera
ref|XP_003523951.1|  PREDICTED: uncharacterized acetyltransferase...    257   7e-77    Glycine max [soybeans]
ref|XP_007017180.1|  HXXXD-type acyl-transferase family protein         256   9e-77    
gb|KJB63869.1|  hypothetical protein B456_010G021000                    256   1e-76    Gossypium raimondii
ref|XP_009359877.1|  PREDICTED: uncharacterized acetyltransferase...    256   2e-76    Pyrus x bretschneideri [bai li]
ref|XP_010915552.1|  PREDICTED: uncharacterized acetyltransferase...    256   2e-76    Elaeis guineensis
ref|XP_007024494.1|  HXXXD-type acyl-transferase family protein, ...    255   2e-76    
ref|XP_002510186.1|  Anthranilate N-benzoyltransferase protein, p...    255   3e-76    Ricinus communis
gb|KHN29658.1|  Putative acetyltransferase                              254   4e-76    Glycine soja [wild soybean]
ref|XP_010314808.1|  PREDICTED: uncharacterized acetyltransferase...    252   4e-76    Solanum lycopersicum
ref|XP_003604999.1|  Acetyltransferase, putative                        254   4e-76    Medicago truncatula
ref|XP_008351423.1|  PREDICTED: uncharacterized acetyltransferase...    254   5e-76    
ref|XP_008220251.1|  PREDICTED: uncharacterized acetyltransferase...    254   5e-76    Prunus mume [ume]
ref|XP_012068314.1|  PREDICTED: uncharacterized acetyltransferase...    254   5e-76    Jatropha curcas
ref|XP_010107873.1|  putative acetyltransferase                         253   9e-76    
ref|XP_003523662.1|  PREDICTED: uncharacterized acetyltransferase...    254   9e-76    Glycine max [soybeans]
ref|XP_010110811.1|  putative acetyltransferase                         253   1e-75    
emb|CDX81073.1|  BnaC03g03270D                                          253   2e-75    
ref|XP_010059908.1|  PREDICTED: uncharacterized acetyltransferase...    253   2e-75    Eucalyptus grandis [rose gum]
emb|CDX71519.1|  BnaC04g17540D                                          253   2e-75    
ref|XP_010110810.1|  putative acetyltransferase                         252   3e-75    Morus notabilis
ref|XP_007226559.1|  hypothetical protein PRUPE_ppa024441mg             252   4e-75    Prunus persica
ref|XP_003603061.1|  N-hydroxycinnamoyl/benzoyltransferase              252   4e-75    
gb|AES73312.2|  HXXXD-type acyl-transferase family protein              252   5e-75    Medicago truncatula
ref|XP_006393913.1|  hypothetical protein EUTSA_v10004238mg             251   6e-75    Eutrema salsugineum [saltwater cress]
ref|XP_010252439.1|  PREDICTED: uncharacterized acetyltransferase...    252   8e-75    Nelumbo nucifera [Indian lotus]
gb|KDO84111.1|  hypothetical protein CISIN_1g044173mg                   251   1e-74    Citrus sinensis [apfelsine]
gb|KFK31810.1|  hypothetical protein AALP_AA6G161600                    251   1e-74    Arabis alpina [alpine rockcress]
ref|XP_006374906.1|  anthranilate N-hydroxycinamoyl/bensoiltransf...    251   1e-74    
gb|EYU46590.1|  hypothetical protein MIMGU_mgv1a005681mg                251   1e-74    Erythranthe guttata [common monkey flower]
ref|XP_010107871.1|  putative acetyltransferase                         251   1e-74    
ref|XP_008393786.1|  PREDICTED: uncharacterized acetyltransferase...    251   2e-74    
gb|ABC47847.1|  N-hydroxycinnamoyl/benzoyltransferase 5                 251   2e-74    Glycine max [soybeans]
ref|XP_012066806.1|  PREDICTED: uncharacterized acetyltransferase...    249   2e-74    Jatropha curcas
gb|KCW66379.1|  hypothetical protein EUGRSUZ_F00195                     249   2e-74    Eucalyptus grandis [rose gum]
gb|KHN04490.1|  Putative acetyltransferase                              250   2e-74    Glycine soja [wild soybean]
ref|XP_006387348.1|  hypothetical protein POPTR_1203s002001g            245   2e-74    
ref|XP_009409404.1|  PREDICTED: uncharacterized acetyltransferase...    250   3e-74    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008220250.1|  PREDICTED: uncharacterized acetyltransferase...    249   3e-74    
ref|XP_007221613.1|  hypothetical protein PRUPE_ppb015328mg             249   3e-74    
ref|XP_006473294.1|  PREDICTED: uncharacterized acetyltransferase...    249   4e-74    Citrus sinensis [apfelsine]
ref|XP_003603072.1|  N-hydroxycinnamoyl/benzoyltransferase              249   6e-74    Medicago truncatula
ref|XP_007136698.1|  hypothetical protein PHAVU_009G066300g             249   6e-74    Phaseolus vulgaris [French bean]
ref|XP_008220248.1|  PREDICTED: uncharacterized acetyltransferase...    249   6e-74    Prunus mume [ume]
ref|XP_012066805.1|  PREDICTED: uncharacterized acetyltransferase...    249   6e-74    
ref|XP_011654118.1|  PREDICTED: uncharacterized acetyltransferase...    249   7e-74    Cucumis sativus [cucumbers]
ref|XP_007136697.1|  hypothetical protein PHAVU_009G066200g             249   8e-74    Phaseolus vulgaris [French bean]
ref|XP_010064177.1|  PREDICTED: uncharacterized acetyltransferase...    249   9e-74    Eucalyptus grandis [rose gum]
ref|XP_012066803.1|  PREDICTED: uncharacterized acetyltransferase...    248   1e-73    Jatropha curcas
ref|XP_006826188.2|  PREDICTED: BAHD acyltransferase DCR                243   1e-73    
ref|XP_010915553.1|  PREDICTED: uncharacterized acetyltransferase...    248   1e-73    Elaeis guineensis
emb|CBI21394.3|  unnamed protein product                                248   1e-73    Vitis vinifera
gb|KEH31453.1|  HXXXD-type acyl-transferase family protein              247   2e-73    Medicago truncatula
ref|XP_008452575.1|  PREDICTED: uncharacterized acetyltransferase...    247   3e-73    Cucumis melo [Oriental melon]
ref|XP_008801989.1|  PREDICTED: uncharacterized acetyltransferase...    246   6e-73    
emb|CDX78313.1|  BnaA03g02250D                                          246   1e-72    
ref|XP_009131022.1|  PREDICTED: uncharacterized acetyltransferase...    246   1e-72    Brassica rapa
ref|NP_201516.1|  HXXXD-type acyl-transferase-like protein              245   2e-72    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004501558.1|  PREDICTED: uncharacterized acetyltransferase...    244   3e-72    
gb|KEH31450.1|  HXXXD-type acyl-transferase family protein              244   3e-72    Medicago truncatula
ref|XP_004291088.1|  PREDICTED: uncharacterized acetyltransferase...    244   3e-72    Fragaria vesca subsp. vesca
ref|XP_009123701.1|  PREDICTED: uncharacterized acetyltransferase...    244   4e-72    Brassica rapa
ref|XP_002871293.1|  transferase family protein                         244   5e-72    
ref|XP_004501559.1|  PREDICTED: uncharacterized acetyltransferase...    244   5e-72    Cicer arietinum [garbanzo]
ref|XP_002865024.1|  transferase family protein                         244   5e-72    Arabidopsis lyrata subsp. lyrata
gb|AES73322.2|  HXXXD-type acyl-transferase family protein              243   7e-72    Medicago truncatula
ref|XP_011654124.1|  PREDICTED: uncharacterized acetyltransferase...    243   8e-72    Cucumis sativus [cucumbers]
ref|XP_003638160.1|  Anthranilate N-hydroxycinnamoyl/benzoyltrans...    243   8e-72    
ref|XP_002871292.1|  transferase family protein                         243   9e-72    
ref|XP_011654119.1|  PREDICTED: uncharacterized acetyltransferase...    243   9e-72    Cucumis sativus [cucumbers]
ref|XP_004972478.1|  PREDICTED: uncharacterized acetyltransferase...    244   1e-71    Setaria italica
ref|XP_011654123.1|  PREDICTED: uncharacterized acetyltransferase...    243   2e-71    Cucumis sativus [cucumbers]
ref|XP_008452576.1|  PREDICTED: uncharacterized acetyltransferase...    243   2e-71    Cucumis melo [Oriental melon]
ref|XP_004972476.1|  PREDICTED: uncharacterized acetyltransferase...    243   2e-71    Setaria italica
ref|XP_003603067.1|  N-hydroxycinnamoyl/benzoyltransferase              242   3e-71    Medicago truncatula
ref|XP_006354858.1|  PREDICTED: uncharacterized acetyltransferase...    241   4e-71    
ref|XP_006280430.1|  hypothetical protein CARUB_v10026362mg             241   5e-71    
ref|XP_004141266.1|  PREDICTED: uncharacterized acetyltransferase...    241   5e-71    Cucumis sativus [cucumbers]
ref|XP_003603062.1|  N-hydroxycinnamoyl/benzoyltransferase              248   6e-71    
gb|KHN16923.1|  BAHD acyltransferase DCR                                236   6e-71    Glycine soja [wild soybean]
ref|XP_006354859.1|  PREDICTED: uncharacterized acetyltransferase...    241   7e-71    
ref|XP_006850491.2|  PREDICTED: uncharacterized acetyltransferase...    239   8e-71    
ref|NP_199097.1|  HXXXD-type acyl-transferase-like protein              240   1e-70    Arabidopsis thaliana [mouse-ear cress]
ref|NP_196403.1|  HXXXD-type acyl-transferase family protein            240   1e-70    Arabidopsis thaliana [mouse-ear cress]
ref|NP_196402.1|  HXXXD-type acyl-transferase-like protein              240   1e-70    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006659752.1|  PREDICTED: uncharacterized acetyltransferase...    240   1e-70    Oryza brachyantha
ref|XP_008452578.1|  PREDICTED: uncharacterized acetyltransferase...    240   2e-70    Cucumis melo [Oriental melon]
ref|XP_006354860.1|  PREDICTED: uncharacterized acetyltransferase...    239   2e-70    
ref|XP_004238137.1|  PREDICTED: uncharacterized acetyltransferase...    240   2e-70    Solanum lycopersicum
emb|CDY12811.1|  BnaC07g16220D                                          240   3e-70    Brassica napus [oilseed rape]
gb|ERN12072.1|  hypothetical protein AMTR_s00035p00187610               239   3e-70    Amborella trichopoda
ref|XP_003571295.1|  PREDICTED: uncharacterized acetyltransferase...    239   3e-70    
ref|XP_009103449.1|  PREDICTED: uncharacterized acetyltransferase...    239   3e-70    Brassica rapa
ref|XP_003566996.1|  PREDICTED: uncharacterized acetyltransferase...    239   3e-70    
ref|XP_006280460.1|  hypothetical protein CARUB_v10026392mg             239   3e-70    Capsella rubella
ref|XP_010558666.1|  PREDICTED: uncharacterized acetyltransferase...    239   3e-70    Tarenaya hassleriana [spider flower]
ref|XP_004972479.1|  PREDICTED: uncharacterized acetyltransferase...    239   4e-70    Setaria italica
ref|NP_001143242.1|  uncharacterized protein LOC100275767               240   4e-70    Zea mays [maize]
ref|XP_006399269.1|  hypothetical protein EUTSA_v10013445mg             239   4e-70    
gb|AES73315.2|  HXXXD-type acyl-transferase family protein              239   5e-70    Medicago truncatula
ref|XP_011654121.1|  PREDICTED: uncharacterized acetyltransferase...    239   7e-70    Cucumis sativus [cucumbers]
ref|XP_003603064.1|  N-hydroxycinnamoyl/benzoyltransferase              238   8e-70    
ref|XP_010442114.1|  PREDICTED: uncharacterized acetyltransferase...    238   8e-70    Camelina sativa [gold-of-pleasure]
emb|CDY21238.1|  BnaC02g28850D                                          238   8e-70    Brassica napus [oilseed rape]
ref|XP_006659753.1|  PREDICTED: uncharacterized acetyltransferase...    238   1e-69    
ref|XP_003603068.1|  N-hydroxycinnamoyl/benzoyltransferase              237   1e-69    
ref|XP_003571308.1|  PREDICTED: uncharacterized acetyltransferase...    238   1e-69    
ref|XP_010481938.1|  PREDICTED: uncharacterized acetyltransferase...    237   1e-69    
ref|XP_006659050.1|  PREDICTED: uncharacterized acetyltransferase...    237   3e-69    Oryza brachyantha
ref|XP_008378022.1|  PREDICTED: uncharacterized acetyltransferase...    236   3e-69    
ref|XP_003603071.1|  N-hydroxycinnamoyl/benzoyltransferase              245   4e-69    
ref|XP_006403341.1|  hypothetical protein EUTSA_v10003208mg             236   7e-69    Eutrema salsugineum [saltwater cress]
gb|KFK28407.1|  hypothetical protein AALP_AA8G510900                    235   8e-69    Arabis alpina [alpine rockcress]
ref|NP_001060826.1|  Os08g0111300                                       236   9e-69    
emb|CDY01434.1|  BnaA07g12070D                                          235   1e-68    
ref|XP_006399267.1|  hypothetical protein EUTSA_v10015498mg             230   1e-68    
ref|XP_008452577.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    234   2e-68    
ref|XP_010494242.1|  PREDICTED: uncharacterized acetyltransferase...    234   2e-68    Camelina sativa [gold-of-pleasure]
gb|EAZ05362.1|  hypothetical protein OsI_27565                          235   2e-68    Oryza sativa Indica Group [Indian rice]
ref|NP_001060827.1|  Os08g0111800                                       235   2e-68    
ref|NP_196404.1|  HXXXD-type acyl-transferase family protein            234   3e-68    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002444907.1|  hypothetical protein SORBIDRAFT_07g001180          234   4e-68    
gb|KFK25164.1|  hypothetical protein AALP_AA8G074700                    234   5e-68    Arabis alpina [alpine rockcress]
ref|XP_010692375.1|  PREDICTED: uncharacterized acetyltransferase...    233   8e-68    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006367422.1|  PREDICTED: uncharacterized acetyltransferase...    233   8e-68    Solanum tuberosum [potatoes]
ref|XP_009125703.1|  PREDICTED: uncharacterized acetyltransferase...    233   1e-67    Brassica rapa
dbj|BAF01091.1|  N-hydroxycinnamoyl/benzoyltransferase - like pro...    233   1e-67    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009775187.1|  PREDICTED: uncharacterized acetyltransferase...    232   1e-67    Nicotiana sylvestris
ref|XP_010677650.1|  PREDICTED: uncharacterized acetyltransferase...    233   2e-67    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009121271.1|  PREDICTED: uncharacterized acetyltransferase...    232   2e-67    
ref|XP_010677336.1|  PREDICTED: uncharacterized acetyltransferase...    231   3e-67    
ref|XP_006399268.1|  hypothetical protein EUTSA_v10013445mg             232   3e-67    
gb|EAZ05363.1|  hypothetical protein OsI_27566                          231   8e-67    
gb|EEE67923.1|  hypothetical protein OsJ_25794                          230   8e-67    
emb|CDX81074.1|  BnaC03g03280D                                          230   9e-67    
ref|NP_001060828.1|  Os08g0112200                                       231   9e-67    
gb|EMT19626.1|  Putative acetyltransferase                              230   1e-66    
ref|XP_002876021.1|  transferase family protein                         229   1e-66    
ref|XP_003629582.1|  Anthranilate N-hydroxycinnamoyl/benzoyltrans...    229   3e-66    
gb|KCW66381.1|  hypothetical protein EUGRSUZ_F00197                     226   3e-66    
emb|CDY47454.1|  BnaC09g31030D                                          229   3e-66    
ref|XP_008648377.1|  PREDICTED: uncharacterized acetyltransferase...    229   3e-66    
ref|XP_010691627.1|  PREDICTED: uncharacterized acetyltransferase...    229   4e-66    
ref|XP_006434729.1|  hypothetical protein CICLE_v10003138mg             228   4e-66    
ref|XP_007024493.1|  HXXXD-type acyl-transferase family protein         225   4e-66    
ref|XP_009115701.1|  PREDICTED: uncharacterized acetyltransferase...    224   4e-66    
ref|XP_010691628.1|  PREDICTED: uncharacterized acetyltransferase...    229   4e-66    
ref|XP_010491403.1|  PREDICTED: uncharacterized acetyltransferase...    228   5e-66    
ref|XP_010064178.1|  PREDICTED: uncharacterized acetyltransferase...    226   5e-66    
ref|XP_002316230.1|  transferase family protein                         228   5e-66    
ref|XP_006287610.1|  hypothetical protein CARUB_v10000822mg             229   7e-66    
ref|XP_010503697.1|  PREDICTED: uncharacterized acetyltransferase...    228   7e-66    
ref|XP_010677339.1|  PREDICTED: uncharacterized acetyltransferase...    227   1e-65    
ref|NP_001130851.1|  hypothetical protein                               228   1e-65    
gb|KJB43758.1|  hypothetical protein B456_007G215500                    225   2e-65    
ref|XP_010452753.1|  PREDICTED: uncharacterized acetyltransferase...    226   2e-65    
ref|XP_010549240.1|  PREDICTED: uncharacterized acetyltransferase...    226   2e-65    
ref|XP_010423163.1|  PREDICTED: uncharacterized acetyltransferase...    226   3e-65    
gb|EAZ05408.1|  hypothetical protein OsI_27617                          226   3e-65    
ref|XP_010452751.1|  PREDICTED: uncharacterized acetyltransferase...    226   3e-65    
ref|XP_004972480.1|  PREDICTED: uncharacterized acetyltransferase...    227   4e-65    
gb|EEC82800.1|  hypothetical protein OsI_27569                          226   5e-65    
ref|XP_010441191.1|  PREDICTED: uncharacterized acetyltransferase...    226   6e-65    
ref|XP_009613516.1|  PREDICTED: uncharacterized acetyltransferase...    225   6e-65    
emb|CDY07540.1|  BnaC06g15240D                                          225   6e-65    
ref|XP_003580171.2|  PREDICTED: uncharacterized acetyltransferase...    225   7e-65    
gb|AAT38406.1|  HCBT-like putative PR                                   225   8e-65    
ref|XP_009103919.1|  PREDICTED: uncharacterized acetyltransferase...    224   1e-64    
gb|AAM69843.1|  HCBT-like putative defense response protein             227   1e-64    
ref|XP_002443750.1|  hypothetical protein SORBIDRAFT_07g001310          225   1e-64    
emb|CDP09318.1|  unnamed protein product                                223   1e-64    
ref|XP_006659051.1|  PREDICTED: uncharacterized acetyltransferase...    224   1e-64    
ref|XP_010447937.1|  PREDICTED: uncharacterized acetyltransferase...    224   2e-64    
ref|XP_006404046.1|  hypothetical protein EUTSA_v10010370mg             223   3e-64    
ref|XP_006355660.1|  PREDICTED: uncharacterized acetyltransferase...    223   4e-64    
ref|XP_006292899.1|  hypothetical protein CARUB_v10019164mg             223   5e-64    
ref|XP_010491408.1|  PREDICTED: uncharacterized acetyltransferase...    223   6e-64    
ref|XP_003604963.1|  Anthranilate N-hydroxycinnamoyl/benzoyltrans...    222   7e-64    
gb|AFK35573.1|  unknown                                                 222   7e-64    
gb|EPS57660.1|  hypothetical protein M569_17156                         222   8e-64    
ref|XP_009123702.1|  PREDICTED: uncharacterized acetyltransferase...    222   9e-64    
ref|XP_010544154.1|  PREDICTED: uncharacterized acetyltransferase...    222   1e-63    
dbj|BAJ97438.1|  predicted protein                                      222   1e-63    
gb|KFK25163.1|  hypothetical protein AALP_AA8G074600                    222   1e-63    
ref|XP_010445080.1|  PREDICTED: uncharacterized acetyltransferase...    222   1e-63    
ref|NP_190597.1|  HXXXD-type acyl-transferase family protein            221   1e-63    
ref|XP_010426573.1|  PREDICTED: uncharacterized acetyltransferase...    221   2e-63    
ref|XP_004972474.1|  PREDICTED: uncharacterized acetyltransferase...    221   2e-63    
ref|XP_010447938.1|  PREDICTED: uncharacterized acetyltransferase...    221   3e-63    
ref|XP_010667128.1|  PREDICTED: uncharacterized acetyltransferase...    221   4e-63    
ref|XP_009123700.1|  PREDICTED: uncharacterized acetyltransferase...    221   4e-63    
ref|XP_010447942.1|  PREDICTED: uncharacterized acetyltransferase...    220   5e-63    
ref|XP_010438408.1|  PREDICTED: uncharacterized acetyltransferase...    219   9e-63    
ref|XP_010444690.1|  PREDICTED: uncharacterized acetyltransferase...    219   1e-62    
ref|XP_011041436.1|  PREDICTED: uncharacterized acetyltransferase...    220   1e-62    
ref|XP_008367997.1|  PREDICTED: uncharacterized acetyltransferase...    214   1e-62    
ref|XP_009115699.1|  PREDICTED: uncharacterized acetyltransferase...    219   1e-62    
gb|EMT27286.1|  Putative acetyltransferase                              223   2e-62    
ref|XP_010426569.1|  PREDICTED: uncharacterized acetyltransferase...    219   2e-62    
ref|XP_011094979.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    219   2e-62    
gb|KFK23749.1|  hypothetical protein AALP_AAs71196U000200               217   3e-62    
ref|XP_006355661.1|  PREDICTED: uncharacterized acetyltransferase...    218   3e-62    
ref|XP_010433186.1|  PREDICTED: uncharacterized acetyltransferase...    218   4e-62    
emb|CDY55902.1|  BnaAnng13950D                                          219   5e-62    
ref|XP_010515389.1|  PREDICTED: uncharacterized acetyltransferase...    218   5e-62    
ref|XP_008449203.1|  PREDICTED: BAHD acyltransferase DCR-like           218   6e-62    
emb|CBI30421.3|  unnamed protein product                                218   8e-62    
ref|XP_004239935.1|  PREDICTED: BAHD acyltransferase DCR                217   9e-62    
ref|XP_007205148.1|  hypothetical protein PRUPE_ppa005318mg             217   1e-61    
ref|XP_009101733.1|  PREDICTED: uncharacterized acetyltransferase...    216   1e-61    
ref|XP_010101800.1|  BAHD acyltransferase DCR                           217   1e-61    
emb|CBI31531.3|  unnamed protein product                                216   1e-61    
emb|CDX83118.1|  BnaA01g21180D                                          216   2e-61    
emb|CDY48117.1|  BnaC02g03740D                                          217   2e-61    
gb|ABR18470.1|  unknown                                                 215   2e-61    
ref|XP_004239937.1|  PREDICTED: BAHD acyltransferase DCR-like           216   3e-61    
ref|XP_008239572.1|  PREDICTED: BAHD acyltransferase DCR                216   3e-61    
ref|XP_011019146.1|  PREDICTED: BAHD acyltransferase DCR                216   3e-61    
ref|XP_006435679.1|  hypothetical protein CICLE_v10031464mg             215   5e-61    
emb|CAT00083.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxyci...    209   5e-61    
ref|XP_009102495.1|  PREDICTED: uncharacterized acetyltransferase...    215   6e-61    
ref|XP_004147890.1|  PREDICTED: BAHD acyltransferase DCR-like           215   6e-61    
ref|NP_190596.1|  HXXXD-type acyl-transferase-like protein              214   8e-61    
ref|XP_006355659.1|  PREDICTED: BAHD acyltransferase DCR-like           214   8e-61    
gb|ABK24638.1|  unknown                                                 214   8e-61    
gb|KDO53236.1|  hypothetical protein CISIN_1g0453721mg                  214   9e-61    
ref|XP_012087902.1|  PREDICTED: BAHD acyltransferase DCR                214   1e-60    
gb|KDO69082.1|  hypothetical protein CISIN_1g012489mg                   214   1e-60    
gb|KDP24482.1|  hypothetical protein JCGZ_25046                         214   1e-60    
ref|XP_002311205.2|  transferase family protein                         215   1e-60    
ref|XP_003520927.1|  PREDICTED: BAHD acyltransferase DCR-like           214   2e-60    
ref|XP_006480972.1|  PREDICTED: uncharacterized acetyltransferase...    214   2e-60    
ref|XP_009626925.1|  PREDICTED: uncharacterized acetyltransferase...    214   2e-60    
dbj|BAK07674.1|  predicted protein                                      213   2e-60    
gb|KJB76910.1|  hypothetical protein B456_012G112100                    213   3e-60    
ref|XP_006429311.1|  hypothetical protein CICLE_v10011647mg             213   3e-60    
ref|XP_002865023.1|  transferase family protein                         212   3e-60    
ref|XP_004302658.1|  PREDICTED: BAHD acyltransferase DCR                213   3e-60    
emb|CDY40314.1|  BnaA10g27540D                                          213   4e-60    
gb|AAK96747.1|  anthranilate N-hydroxycinnamoyl/benzoyltransferas...    212   4e-60    
ref|NP_201517.1|  BAHD acyltransferase family protein                   212   5e-60    
gb|EMT09482.1|  Putative acetyltransferase                              212   5e-60    
ref|XP_002308212.1|  transferase family protein                         213   5e-60    
emb|CDP19758.1|  unnamed protein product                                207   5e-60    
ref|XP_002873021.1|  transferase family protein                         213   6e-60    
ref|XP_009112358.1|  PREDICTED: uncharacterized acetyltransferase...    212   7e-60    
gb|KCW66383.1|  hypothetical protein EUGRSUZ_F00199                     206   7e-60    
emb|CDY40431.1|  BnaA04g20860D                                          212   7e-60    
ref|XP_004964259.1|  PREDICTED: uncharacterized acetyltransferase...    212   8e-60    
ref|XP_010436746.1|  PREDICTED: uncharacterized acetyltransferase...    211   9e-60    
ref|XP_010503698.1|  PREDICTED: uncharacterized acetyltransferase...    211   9e-60    
ref|XP_010426570.1|  PREDICTED: uncharacterized acetyltransferase...    211   1e-59    
ref|NP_190599.2|  HXXXD-type acyl-transferase family protein            211   1e-59    
ref|XP_010491401.1|  PREDICTED: uncharacterized acetyltransferase...    206   1e-59    
ref|XP_010494241.1|  PREDICTED: uncharacterized acetyltransferase...    212   1e-59    
ref|XP_002876020.1|  transferase family protein                         211   1e-59    
ref|XP_002531355.1|  Anthocyanin 5-aromatic acyltransferase, puta...    211   1e-59    
gb|AGT37414.1|  anthocyanin 5-aromatic acyltransferase                  211   2e-59    
emb|CAB62309.1|  anthranilate N-hydroxycinnamoyl/benzoyltransfera...    211   2e-59    
ref|XP_006307509.1|  hypothetical protein CARUB_v10009133mg             211   2e-59    
ref|XP_010426574.1|  PREDICTED: uncharacterized acetyltransferase...    211   2e-59    
emb|CDY47247.1|  BnaA02g29330D                                          208   2e-59    
ref|XP_006850498.1|  PREDICTED: uncharacterized acetyltransferase...    211   2e-59    
ref|XP_006287651.1|  hypothetical protein CARUB_v10000861mg             211   2e-59    
ref|XP_004239936.1|  PREDICTED: BAHD acyltransferase DCR-like           211   2e-59    
ref|XP_007026775.1|  HXXXD-type acyl-transferase family protein         211   3e-59    
ref|XP_009777112.1|  PREDICTED: uncharacterized acetyltransferase...    201   3e-59    
ref|XP_009125428.1|  PREDICTED: uncharacterized acetyltransferase...    212   4e-59    
ref|XP_002865022.1|  hypothetical protein ARALYDRAFT_919995             210   4e-59    
ref|XP_006291132.1|  hypothetical protein CARUB_v10017245mg             210   4e-59    
ref|XP_006293141.1|  hypothetical protein CARUB_v10019447mg             209   5e-59    
ref|XP_010423922.1|  PREDICTED: uncharacterized acetyltransferase...    210   5e-59    
ref|XP_009781170.1|  PREDICTED: uncharacterized acetyltransferase...    210   5e-59    
ref|NP_195741.1|  HXXXD-type acyl-transferase-like protein              210   6e-59    
ref|XP_003516942.1|  PREDICTED: BAHD acyltransferase DCR-like           210   6e-59    
ref|XP_010452012.1|  PREDICTED: uncharacterized acetyltransferase...    210   7e-59    
ref|XP_006346998.1|  PREDICTED: uncharacterized acetyltransferase...    206   9e-59    
ref|XP_009370265.1|  PREDICTED: BAHD acyltransferase DCR-like           209   1e-58    
ref|XP_010315178.1|  PREDICTED: uncharacterized acetyltransferase...    206   1e-58    
gb|KJB43779.1|  hypothetical protein B456_007G215300                    206   2e-58    
gb|AAM73656.1|AF390211_1  AER                                           208   2e-58    
ref|XP_002870866.1|  hypothetical protein ARALYDRAFT_916554             207   2e-58    
ref|XP_007009085.1|  HXXXD-type acyl-transferase family protein         209   2e-58    
ref|XP_010464414.1|  PREDICTED: uncharacterized acetyltransferase...    208   2e-58    
ref|XP_010691626.1|  PREDICTED: uncharacterized acetyltransferase...    208   2e-58    
emb|CDX81339.1|  BnaC09g07500D                                          208   2e-58    
ref|XP_009602090.1|  PREDICTED: uncharacterized acetyltransferase...    208   2e-58    
emb|CBI21396.3|  unnamed protein product                                205   2e-58    
emb|CCG48011.1|  HCBT-like defense response protein,putative,expr...    208   3e-58    
ref|XP_006404045.1|  hypothetical protein EUTSA_v10011149mg             207   4e-58    
ref|XP_008787429.1|  PREDICTED: BAHD acyltransferase DCR                207   5e-58    
emb|CDY24938.1|  BnaC03g22340D                                          207   5e-58    
gb|EYU40126.1|  hypothetical protein MIMGU_mgv1a021786mg                203   7e-58    
gb|AFF19205.1|  BAHD acyltransferase                                    206   9e-58    
ref|XP_009358855.1|  PREDICTED: uncharacterized acetyltransferase...    207   9e-58    
ref|XP_002322965.1|  transferase family protein                         207   1e-57    
emb|CDY40771.1|  BnaAnng06340D                                          207   1e-57    
ref|XP_006280479.1|  hypothetical protein CARUB_v10026415mg             206   1e-57    
emb|CDY39539.1|  BnaC07g07070D                                          206   1e-57    
ref|XP_008388189.1|  PREDICTED: uncharacterized acetyltransferase...    207   1e-57    
ref|XP_008442462.1|  PREDICTED: uncharacterized acetyltransferase...    207   1e-57    
ref|XP_006405800.1|  hypothetical protein EUTSA_v10027774mg             206   1e-57    
gb|AFF19201.1|  BAHD acyltransferase                                    206   1e-57    
dbj|BAA93453.1|  acyltransferase homolog                                206   1e-57    
ref|XP_008370133.1|  PREDICTED: BAHD acyltransferase DCR                204   1e-57    
ref|XP_009139801.1|  PREDICTED: uncharacterized acetyltransferase...    206   1e-57    
emb|CDX74510.1|  BnaA04g08790D                                          206   2e-57    
ref|XP_011076731.1|  PREDICTED: uncharacterized acetyltransferase...    206   2e-57    
ref|XP_006363050.1|  PREDICTED: BAHD acyltransferase DCR-like           206   2e-57    
emb|CDY18638.1|  BnaA09g07570D                                          205   2e-57    
ref|XP_006398644.1|  hypothetical protein EUTSA_v10013380mg             206   2e-57    
emb|CDP14056.1|  unnamed protein product                                206   2e-57    
ref|XP_009601485.1|  PREDICTED: uncharacterized acetyltransferase...    206   2e-57    
ref|XP_006353890.1|  PREDICTED: BAHD acyltransferase DCR-like           205   2e-57    
gb|KJB63870.1|  hypothetical protein B456_010G021200                    202   3e-57    
ref|XP_012087852.1|  PREDICTED: uncharacterized acetyltransferase...    206   4e-57    
ref|XP_006385480.1|  anthranilate N-hydroxycinnamoyl/benzoyltrans...    202   4e-57    
ref|NP_001060829.1|  Os08g0112300                                       205   4e-57    
ref|XP_008338378.1|  PREDICTED: uncharacterized acetyltransferase...    204   5e-57    
ref|XP_010503699.1|  PREDICTED: uncharacterized acetyltransferase...    204   5e-57    
gb|EMT06482.1|  Putative acetyltransferase                              204   6e-57    
ref|XP_010256629.1|  PREDICTED: BAHD acyltransferase DCR                205   6e-57    
ref|XP_009799023.1|  PREDICTED: uncharacterized acetyltransferase...    205   7e-57    
ref|XP_004137729.1|  PREDICTED: uncharacterized acetyltransferase...    205   7e-57    
gb|KFK34281.1|  hypothetical protein AALP_AA5G124900                    199   8e-57    
ref|XP_004246337.2|  PREDICTED: uncharacterized acetyltransferase...    204   1e-56    
ref|XP_009791334.1|  PREDICTED: BAHD acyltransferase DCR-like           204   1e-56    
ref|XP_002876023.1|  transferase family protein                         202   2e-56    
gb|EMT11091.1|  Putative acetyltransferase                              202   2e-56    
ref|XP_010490596.1|  PREDICTED: uncharacterized acetyltransferase...    204   2e-56    
ref|XP_009620391.1|  PREDICTED: BAHD acyltransferase DCR                203   2e-56    
gb|KFK44567.1|  hypothetical protein AALP_AA1G274300                    203   2e-56    
ref|XP_011036002.1|  PREDICTED: uncharacterized acetyltransferase...    203   2e-56    
emb|CAD40568.2|  OSJNBa0069D17.11                                       202   2e-56    
emb|CAN80937.1|  hypothetical protein VITISV_005841                     203   3e-56    
dbj|BAJ21224.1|  acyltransferase-like                                   202   3e-56    
ref|XP_002276050.1|  PREDICTED: uncharacterized acetyltransferase...    203   3e-56    
ref|NP_001274287.1|  BAHD acyltransferase DCR-like                      202   3e-56    
ref|XP_004957081.1|  PREDICTED: uncharacterized acetyltransferase...    202   3e-56    
gb|KJB74249.1|  hypothetical protein B456_011G282700                    202   4e-56    
emb|CDY01433.1|  BnaA07g12060D                                          201   5e-56    
dbj|BAB11280.1|  anthranilate N-hydroxycinnamoyl/benzoyltransfera...    201   7e-56    
gb|EYU41860.1|  hypothetical protein MIMGU_mgv1a027064mg                202   8e-56    
emb|CDY01691.1|  BnaC04g30610D                                          201   9e-56    
emb|CDX93218.1|  BnaC04g46780D                                          201   9e-56    
ref|XP_009103448.1|  PREDICTED: uncharacterized acetyltransferase...    201   1e-55    
ref|XP_010095065.1|  BAHD acyltransferase DCR                           201   1e-55    
gb|KFK33265.1|  hypothetical protein AALP_AA6G352200                    200   1e-55    
gb|AAM91537.1|  anthranilate N-hydroxycinnamoyl/benzoyltransferas...    196   1e-55    
gb|KFK25764.1|  hypothetical protein AALP_AA8G156600                    201   1e-55    



>ref|XP_009782781.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Nicotiana 
sylvestris]
Length=441

 Score =   385 bits (989),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 183/300 (61%), Positives = 228/300 (76%), Gaps = 0/300 (0%)
 Frame = -1

Query  1151  ISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQLSLPPVLDPWF  972
             +S PLLGVQVTEL DGYFIG AMNH+  D + FWHFFNSWSEISRG   +S  PV + WF
Sbjct  142   VSKPLLGVQVTELIDGYFIGCAMNHSLGDGTCFWHFFNSWSEISRGYEIISKIPVSNRWF  201

Query  971   PGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEMGTDSISSLQ  792
             P N+  P+ LP  L  E L   F  P L+ER+FH SK++IAKLK KANSEM T SISSLQ
Sbjct  202   PENMNLPIHLPLKLDDEKLFEVFEIPHLKERIFHLSKESIAKLKGKANSEMETKSISSLQ  261

Query  791   SYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKLAKANAGELL  612
             +++AHLWR++TR R+L+  E+V I + IGTR R NPPLPE Y+GNAIH K  K  AGELL
Sbjct  262   AFLAHLWRSVTRCRKLDAKEEVVIGLIIGTRSRLNPPLPEVYFGNAIHVKRVKTTAGELL  321

Query  611   KRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIASSPRNNVYA  432
             + GLGWAA ++++VV+ Q+ EEVV+ Y+ W ++PV+  KS +F  + L I+SSPR+N+Y 
Sbjct  322   ENGLGWAAMELNKVVNSQNSEEVVKIYKEWAENPVLFSKSTLFVGSKLAISSSPRHNIYN  381

Query  431   TDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDIEVCLLPHTLHTLGNDQEFMEFVTH  252
             TDFGWGKPVAVR GM NK+DGK +LFPG+E+GSVDIE+C LP TL  + ND EFME VT+
Sbjct  382   TDFGWGKPVAVRSGMANKSDGKITLFPGVEEGSVDIEICCLPKTLQAMENDSEFMEAVTN  441



>ref|XP_009625193.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like isoform 
X1 [Nicotiana tomentosiformis]
Length=457

 Score =   375 bits (962),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 174/299 (58%), Positives = 229/299 (77%), Gaps = 0/299 (0%)
 Frame = -1

Query  1151  ISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQLSLPPVLDPWF  972
             ++ PLLG+QVTEL +GYFIG  M+H+  D + FW+FFNSWSEIS G   +S  PVL  WF
Sbjct  158   VTKPLLGIQVTELVNGYFIGCTMSHSVGDGTCFWNFFNSWSEISSGSEFISRLPVLKRWF  217

Query  971   PGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEMGTDSISSLQ  792
             P NI  P+ LP +L+ + L      PPL+ER+FH SK++I KLK KANSEMGT+SISSLQ
Sbjct  218   PENIKPPIHLPLNLEDQELYECMELPPLKERIFHLSKESIGKLKAKANSEMGTNSISSLQ  277

Query  791   SYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKLAKANAGELL  612
             +++AHLW+++TR R+L+  E+V+I + +GTR R NPPL EGYWGNA + K  K  AGELL
Sbjct  278   AFLAHLWKSVTRCRQLDSKEEVTISIVVGTRPRLNPPLAEGYWGNAAYFKPVKRTAGELL  337

Query  611   KRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIASSPRNNVYA  432
             ++GLGWAA Q++++++ Q++EEVV+ Y+ WV+ PV+  K  +F AN L I+SSP+ +VY+
Sbjct  338   EKGLGWAALQMNKIIASQNNEEVVKLYKEWVEKPVLFTKGSLFVANRLTISSSPKFSVYS  397

Query  431   TDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDIEVCLLPHTLHTLGNDQEFMEFVT  255
             TDFGWGK VAVR GM NK DGK +LFPG E+GSVDIEVCLLP TL  + ND+EFM+ VT
Sbjct  398   TDFGWGKAVAVRSGMANKGDGKVTLFPGAEEGSVDIEVCLLPETLLAMENDEEFMKAVT  456



>ref|XP_009764197.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Nicotiana 
sylvestris]
Length=454

 Score =   372 bits (954),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 178/300 (59%), Positives = 227/300 (76%), Gaps = 1/300 (0%)
 Frame = -1

Query  1151  ISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQLSLPPVLDPWF  972
             ++ PLLG+QVTEL DGYFIG  M+H+  D + FW+FFNSWSEIS G   +S  PVL  WF
Sbjct  154   VTKPLLGIQVTELVDGYFIGCTMSHSVGDGTCFWNFFNSWSEISNGSEFISRFPVLKRWF  213

Query  971   PGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEMGTDSISSLQ  792
             P NI  P+ LP  L+ + L      PPL+ER+FH SK+ I KLK K+NSEMGT SISSLQ
Sbjct  214   PENIKPPIHLPLKLEDQELYECMELPPLKERIFHLSKENIGKLKAKSNSEMGTKSISSLQ  273

Query  791   SYVAHLWRAITRARRLNPTED-VSIYVPIGTRWRTNPPLPEGYWGNAIHSKLAKANAGEL  615
             +++AHLWR+ITR R+L+  E+ V+I + +GTR R NPPL EGYWGNA + K  K  AGEL
Sbjct  274   AFLAHLWRSITRCRQLHSKEEEVTIIIVVGTRPRLNPPLAEGYWGNAAYFKPVKITAGEL  333

Query  614   LKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIASSPRNNVY  435
             L++GLGWAA QI+++V+ Q+++ VV+ Y+ WV+ PV+  KS +F AN L I+SSP+ +VY
Sbjct  334   LEKGLGWAALQINKIVASQNNDVVVKLYKEWVEKPVLFTKSSLFVANRLTISSSPKFSVY  393

Query  434   ATDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDIEVCLLPHTLHTLGNDQEFMEFVT  255
             +TDFGWGKPVAVR G+ NK DGK +LFPG E+GSVDIEVCLLP TL  + ND+EFME VT
Sbjct  394   STDFGWGKPVAVRSGIANKGDGKVTLFPGAEEGSVDIEVCLLPKTLLAMENDEEFMEAVT  453



>ref|XP_006367771.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Solanum 
tuberosum]
Length=450

 Score =   367 bits (943),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 176/311 (57%), Positives = 224/311 (72%), Gaps = 6/311 (2%)
 Frame = -1

Query  1178  FCLTTSR--KGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQ  1005
             F L  +R  +G++ PL GVQ+TEL DGYFIG  MNHT  D + FWHFFNSW+EISRG   
Sbjct  141   FPLNNTRNFEGVTKPLFGVQITELVDGYFIGCTMNHTLGDGTCFWHFFNSWAEISRGYKI  200

Query  1004  LSLPPVLDPWFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANS  825
             +S  P+ + +FP  I  P+  P +L  + L   F    L ERVFH SK+ I +LK KAN+
Sbjct  201   ISKVPIFERYFPEKIDVPIHFPMNLDDQKL---FEVRTLMERVFHLSKENIGRLKNKANN  257

Query  824   EMGTDSISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHS  645
             EMG +SISSLQ+Y+AHLWR +TR R+L+  ++V I +PIG R R NPPLPEGY+GNAIH 
Sbjct  258   EMGINSISSLQAYLAHLWRCVTRCRKLDAGKEVIITIPIGARSRLNPPLPEGYFGNAIHG  317

Query  644   KLAKANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFA-NFL  468
             K  K + GELL+ GLGW A QI+++V  Q+ EEVV+ Y+ WV++PVI +K  V+   N L
Sbjct  318   KQVKTSVGELLENGLGWVAMQINKMVVSQNSEEVVKIYKGWVENPVILKKGSVYEGNNRL  377

Query  467   GIASSPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDIEVCLLPHTLHTL  288
              I+SSPR+N+Y  DFGWG P+ VR GM NK+DGK +LFPG ++GSVDIEVC+L  TL  L
Sbjct  378   LISSSPRHNIYGNDFGWGNPIGVRSGMANKSDGKITLFPGEKEGSVDIEVCILQETLQAL  437

Query  287   GNDQEFMEFVT  255
              NDQEFMEFVT
Sbjct  438   ENDQEFMEFVT  448



>ref|XP_006342478.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Solanum 
tuberosum]
Length=455

 Score =   361 bits (927),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 169/301 (56%), Positives = 219/301 (73%), Gaps = 0/301 (0%)
 Frame = -1

Query  1157  KGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQLSLPPVLDP  978
             + ++ PLLGVQVTEL DGYFIG  M+H+  D + FWHFFNSWSEI+RG   +S  P L+ 
Sbjct  154   QCVTKPLLGVQVTELVDGYFIGCTMSHSLGDGTCFWHFFNSWSEITRGFELISQFPALER  213

Query  977   WFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEMGTDSISS  798
             WFP NI  P+  P +L  E L      P L+ER+FH SK+ + KLK KANSEM T SISS
Sbjct  214   WFPQNINPPIYFPLELVDEKLYECIDMPILKERIFHLSKENVCKLKAKANSEMDTKSISS  273

Query  797   LQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKLAKANAGE  618
             LQ+++AHLWR++TR   +N  E+V++ + +GTR R NPPLP+ YWGNA+  K  K  AGE
Sbjct  274   LQAFLAHLWRSVTRCNCVNANEEVTLNIIVGTRTRLNPPLPQEYWGNAVILKSIKVKAGE  333

Query  617   LLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIASSPRNNV  438
             LL+  LG++A QI++VV  Q++EEV++ Y+ WV+ PV+  K  +  AN L I+SSP+ +V
Sbjct  334   LLENQLGFSALQINKVVVSQNYEEVIDSYKGWVEKPVMFSKKLLLMANKLSISSSPKFSV  393

Query  437   YATDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDIEVCLLPHTLHTLGNDQEFMEFV  258
             Y+ DFGWGKPV VR GM NK DGK +LFPG+E+GSVDIEVCLL  TL  + ND+EFMEFV
Sbjct  394   YSCDFGWGKPVGVRSGMANKGDGKVTLFPGVEEGSVDIEVCLLTSTLLAMENDEEFMEFV  453

Query  257   T  255
             T
Sbjct  454   T  454



>ref|XP_004253191.2| PREDICTED: uncharacterized acetyltransferase At3g50280-like isoform 
X1 [Solanum lycopersicum]
Length=454

 Score =   361 bits (926),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 169/301 (56%), Positives = 219/301 (73%), Gaps = 0/301 (0%)
 Frame = -1

Query  1157  KGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQLSLPPVLDP  978
             + ++ PLLGVQVTEL DGYFIG  M+H+  D + FWHFFNSWSEI+RG   +S  P L+ 
Sbjct  153   QCVTKPLLGVQVTELVDGYFIGCTMSHSLGDGTCFWHFFNSWSEITRGFELISRFPTLER  212

Query  977   WFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEMGTDSISS  798
             WFP N+  P+  P +L  E L      P ++ERVFH SK+ ++KLK KAN EM T SISS
Sbjct  213   WFPQNVNPPIYFPLELDDEKLDVCMEMPIVKERVFHLSKENVSKLKAKANYEMDTKSISS  272

Query  797   LQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKLAKANAGE  618
             LQ+++AHLWR +TR  R+N  E+V + + IGTR R +PPLPE YWGNA   K  K  AGE
Sbjct  273   LQAFLAHLWRCVTRCNRVNANEEVILNIVIGTRTRLDPPLPEEYWGNAAIIKPIKVKAGE  332

Query  617   LLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIASSPRNNV  438
             LL+ GLG+AA  I++VV+ Q++EEV++ Y+ WV++PVI  K  +F AN L I+SSP+ NV
Sbjct  333   LLENGLGYAALLINKVVASQNYEEVMDSYRRWVENPVIVSKKSLFVANRLSISSSPKFNV  392

Query  437   YATDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDIEVCLLPHTLHTLGNDQEFMEFV  258
             Y+ DFGWGKPV VR GM NK +GK +LF G+E+GSVDIEVCL+  TL  + ND+EFMEF+
Sbjct  393   YSCDFGWGKPVGVRSGMANKDNGKVTLFRGVEEGSVDIEVCLMTSTLLAMENDEEFMEFI  452

Query  257   T  255
             T
Sbjct  453   T  453



>ref|XP_004244447.2| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Solanum 
lycopersicum]
Length=437

 Score =   352 bits (903),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 162/303 (53%), Positives = 213/303 (70%), Gaps = 1/303 (0%)
 Frame = -1

Query  1157  KGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQLSLPPVLDP  978
             +G++ PL GVQ+TEL DGYFIG  MNHT  D + FWHFFNSW+EISRG   +S  P+L+ 
Sbjct  135   EGVTKPLFGVQITELVDGYFIGCTMNHTLGDGTCFWHFFNSWAEISRGRKIISRVPILER  194

Query  977   WFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEMGTDSISS  798
             +FP  I  P+  P +L  E L      P L +RVFH SK+ I +LK+KAN EM  +SISS
Sbjct  195   YFPEKIHVPIHFPMNLDDEKLFEKIEIPTLVKRVFHLSKENITRLKKKANDEMSINSISS  254

Query  797   LQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKLAKANAGE  618
             LQ+Y+AHLWR +TR R+++  E+V I + IG R R  PPL EGY+GNA+H K+ K +A E
Sbjct  255   LQAYLAHLWRCVTRCRKIDDREEVYIGILIGARSRLKPPLLEGYFGNAVHIKIVKTSARE  314

Query  617   LLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFF-ANFLGIASSPRNN  441
             LL+ GLGW A QI+++V  Q+ +EV++ Y+ W+++P+I  K++VF     L I SS R N
Sbjct  315   LLENGLGWVAMQINKMVVSQNSKEVIKMYKGWIENPIIFNKTRVFVDETRLSIGSSTRFN  374

Query  440   VYATDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDIEVCLLPHTLHTLGNDQEFMEF  261
             +Y  DFGWGKP+ VR GM NK DG  +LF G  +GSVDIEVC+ PHTL  + NDQEFME 
Sbjct  375   IYGNDFGWGKPIGVRSGMANKRDGGITLFQGANEGSVDIEVCMCPHTLQAMENDQEFMEM  434

Query  260   VTH  252
             VT+
Sbjct  435   VTN  437



>ref|XP_009762458.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Nicotiana 
sylvestris]
Length=451

 Score =   327 bits (838),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 167/308 (54%), Positives = 213/308 (69%), Gaps = 10/308 (3%)
 Frame = -1

Query  1157  KGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMP---QLSLPPV  987
             +G+  P+L VQVTEL DG+FIG  +NH  AD +SFWHF NSWSEISR       ++ PPV
Sbjct  146   EGVCKPVLAVQVTELVDGFFIGCTVNHCVADGTSFWHFINSWSEISRTRSCNLTVNKPPV  205

Query  986   LDPWFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEMGTDS  807
             L+ WFP   A P+ +   L +E L   F PP LEERVFHFSK  IA+LK KANSE GT+ 
Sbjct  206   LERWFPRFTASPIHV--TLPKEHLYDEFDPPLLEERVFHFSKKNIAQLKAKANSEFGTNQ  263

Query  806   ---ISSLQSYVAHLWRAITRARR-LNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKL  639
                ISSLQ+ +AHLW+++   R  +N  E+ S  + IG R R  PPLPEGY+GNA+H   
Sbjct  264   KTCISSLQAVLAHLWQSVICCRSGINADENFSFKILIGARPRLQPPLPEGYFGNAVHFVN  323

Query  638   AKANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIA  459
                 A ELL+   GWAA Q+++VV++Q HEE++ FYQ+WVK+P I +KS+V   N L  +
Sbjct  324   VTTTARELLQNNSGWAALQMNKVVAMQTHEEIMIFYQSWVKNPKIVKKSEVV-TNSLIAS  382

Query  458   SSPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDIEVCLLPHTLHTLGND  279
             SSPR NVYA DFGWG+P+AVR G  NK DGK ++F G+E+GS+DIE CL P TLH +G D
Sbjct  383   SSPRFNVYANDFGWGRPIAVRSGAGNKHDGKMTIFSGVEEGSIDIEACLTPETLHAMGED  442

Query  278   QEFMEFVT  255
              +FME VT
Sbjct  443   AKFMEAVT  450



>ref|XP_004231858.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Solanum 
lycopersicum]
Length=453

 Score =   324 bits (831),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 166/304 (55%), Positives = 206/304 (68%), Gaps = 10/304 (3%)
 Frame = -1

Query  1157  KGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQ---LSLPPV  987
             +G+S PLL VQVTEL DG+FIG  +NH  AD +SFWHFFN WSEI+R       ++ PPV
Sbjct  143   EGVSKPLLAVQVTELVDGFFIGCTINHCVADGTSFWHFFNCWSEIARSGDSNLIVNKPPV  202

Query  986   LDPWFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEMGTDS  807
             LD WFP  +A P+ +P  L  E +   F  P LEERVFHFSK+ IA+LK KANSE G D 
Sbjct  203   LDRWFPEFVASPIHVP--LSNEHVHDEFDLPLLEERVFHFSKENIAQLKAKANSEYGNDQ  260

Query  806   ---ISSLQSYVAHLWRAITRAR-RLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKL  639
                ISSLQ+ +AH+W+++ R R   N  E  S  + IG R R  P LPEGY+GNA+H   
Sbjct  261   KICISSLQAVLAHIWQSVIRCRCGTNANEKFSFKLLIGARTRLQPHLPEGYFGNAVHFVN  320

Query  638   AKANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIA  459
                 A E+L+   GWAA QI++VVS Q HEEV+ FYQNWVK+P I +KS+V  AN L  +
Sbjct  321   VTTTAREMLEHDSGWAAMQINKVVSTQTHEEVMNFYQNWVKNPKIVKKSEV-VANSLIAS  379

Query  458   SSPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDIEVCLLPHTLHTLGND  279
             SSPR +VY  DFGWG+PV VR G  NK DGK ++F G E+GS+DIE CL P TLH +G D
Sbjct  380   SSPRFDVYGNDFGWGRPVGVRSGAGNKHDGKMTIFCGAEEGSIDIEACLTPETLHAMGQD  439

Query  278   QEFM  267
              +FM
Sbjct  440   TKFM  443



>ref|XP_009589621.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like isoform 
X1 [Nicotiana tomentosiformis]
Length=451

 Score =   321 bits (823),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 167/308 (54%), Positives = 208/308 (68%), Gaps = 10/308 (3%)
 Frame = -1

Query  1157  KGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQ---LSLPPV  987
             +G+S PLL VQVTEL DG+FIG  +NH  AD +SFWHFFNSWSEISR       ++  PV
Sbjct  146   EGVSKPLLAVQVTELVDGFFIGCTINHCVADGTSFWHFFNSWSEISRTRSSNLTVNKLPV  205

Query  986   LDPWFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEMGTDS  807
             L+ WFP   A  + +   L +E L   F PP LEERVFHFSK+ IA+LK KANSE GTD 
Sbjct  206   LERWFPKFTASQIHV--TLPKEHLYDEFDPPLLEERVFHFSKENIAQLKAKANSEFGTDQ  263

Query  806   ---ISSLQSYVAHLWRAITRARR-LNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKL  639
                ISSLQ+ +AHLW+ + R R      E  S  + IG R R  PPL EGY+GNA+H   
Sbjct  264   KTCISSLQAVLAHLWQTVIRCRTGTKADEKFSFKILIGARPRLQPPLREGYFGNAVHFVN  323

Query  638   AKANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIA  459
                 A ELL+   GWAA Q+++VV++Q HEEV+ FYQ+WVK+P I +KS+V   N L  +
Sbjct  324   VTTTARELLENNSGWAALQMNKVVAMQTHEEVMNFYQSWVKNPKIVKKSEVV-TNSLIAS  382

Query  458   SSPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDIEVCLLPHTLHTLGND  279
             SSPR +VY  DFGWG+P+AVR G  NK DGK ++F G+E+GS+DIE CL P TLH +G D
Sbjct  383   SSPRFDVYGNDFGWGRPIAVRSGAGNKHDGKMTIFSGVEEGSIDIEACLTPETLHAMGED  442

Query  278   QEFMEFVT  255
               FME VT
Sbjct  443   ANFMEAVT  450



>ref|XP_006339875.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Solanum 
tuberosum]
Length=451

 Score =   318 bits (814),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 165/308 (54%), Positives = 208/308 (68%), Gaps = 10/308 (3%)
 Frame = -1

Query  1157  KGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQ---LSLPPV  987
             +G+S PLL VQVTEL DG+FIG  +NH  AD +SFWHFFN WSEI+R       ++ PPV
Sbjct  142   EGVSKPLLAVQVTELVDGFFIGCTINHCVADGTSFWHFFNCWSEIARNGDSNLIVNKPPV  201

Query  986   LDPWFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEMGTDS  807
             LD WFP  +A P+ +P  L +E +   F  P LEERVFHFSK+ IA+LK KANSE G D 
Sbjct  202   LDRWFPEFVASPIHVP--LSKEHVHDEFDLPLLEERVFHFSKENIAQLKAKANSEYGNDQ  259

Query  806   ---ISSLQSYVAHLWRAITRAR-RLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKL  639
                ISSLQ+ +AHLW+++ R R   N  E  S  + IG R R  P L EGY+GNA+H   
Sbjct  260   KICISSLQAVLAHLWQSVIRCRCGTNADEKFSFKLLIGARPRLQPHLLEGYFGNAVHFVN  319

Query  638   AKANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIA  459
                 A E+L+   GWAA Q+++VVS Q HEEV+ FYQ+WVK+P I +KS+V  AN L  +
Sbjct  320   VTTTAREMLEHDSGWAALQMNKVVSTQTHEEVMNFYQSWVKNPKIVKKSEVV-ANSLIAS  378

Query  458   SSPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDIEVCLLPHTLHTLGND  279
             SS R +VY  DFGWG+PVAVR G  NK DGK ++F G E+GS+DIE CL P TLH +G D
Sbjct  379   SSSRFDVYGNDFGWGRPVAVRSGAGNKHDGKMTIFCGAEQGSIDIEACLTPETLHAMGQD  438

Query  278   QEFMEFVT  255
              +FM  V+
Sbjct  439   TKFMGAVS  446



>ref|XP_011000815.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Populus 
euphratica]
Length=440

 Score =   317 bits (813),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 159/303 (52%), Positives = 204/303 (67%), Gaps = 3/303 (1%)
 Frame = -1

Query  1157  KGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQLSLPPVLDP  978
             + +S PLL VQVTEL DG F+G  MNH A D SSFW+FFNSWSEI RG+  +S  PVL+ 
Sbjct  138   EAVSKPLLAVQVTELVDGIFVGCTMNHAAVDGSSFWNFFNSWSEIHRGLDHISKTPVLER  197

Query  977   W--FPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEMGTDSI  804
             W    G I+ P+ LP  + +   S SF P PL+ERVFHF+K  IA LK KAN E  T SI
Sbjct  198   WSLLNGTISPPIRLPLSIIKNN-SDSFIPSPLQERVFHFTKGKIAVLKAKANDEAATTSI  256

Query  803   SSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKLAKANA  624
             SSLQS +AH+WRA TRAR +   +++ + + IG R R  PPLPE Y GNAI S +     
Sbjct  257   SSLQSLLAHIWRATTRARLVEHDKEIDLIILIGLRARLQPPLPESYCGNAIVSGIVTLRT  316

Query  623   GELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIASSPRN  444
              E+L++GLG+ A +I++VVS     +V +   + +K+P    K+ +   + L I+SSPR+
Sbjct  317   REILEQGLGFVALEINKVVSSYTKNKVTDVLASVLKNPSPLTKADIGRIHSLAISSSPRH  376

Query  443   NVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDIEVCLLPHTLHTLGNDQEFME  264
             NVY TDFGWG+PVAVR G  NK DGK +LFPGLE GS+D+E  +LP TL  LGND EFM+
Sbjct  377   NVYGTDFGWGRPVAVRSGSGNKFDGKLTLFPGLEDGSIDVEFSVLPETLKALGNDLEFMD  436

Query  263   FVT  255
              VT
Sbjct  437   AVT  439



>ref|XP_009777111.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Nicotiana 
sylvestris]
Length=299

 Score =   311 bits (798),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 158/299 (53%), Positives = 196/299 (66%), Gaps = 37/299 (12%)
 Frame = -1

Query  1151  ISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQLSLPPVLDPWF  972
             ++ PLLG+QVTEL DGYFIG  M+H+  D + FW+FFNSWSEIS G   +S  PVL  WF
Sbjct  37    VTKPLLGIQVTELVDGYFIGCTMSHSVGDGTCFWNFFNSWSEISNGSEFISRFPVLKRWF  96

Query  971   PGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEMGTDSISSLQ  792
             P NI  P+ LP  L+ + L      PPL+ER+FH SK+ I KLK KANSEMGT       
Sbjct  97    PENIKPPIHLPLKLEDQELYECMELPPLKERIFHLSKENIGKLKAKANSEMGT-------  149

Query  791   SYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKLAKANAGELL  612
                                           R R NPPL EGYWGNA + K  K  AGELL
Sbjct  150   ------------------------------RPRLNPPLAEGYWGNAAYFKPVKITAGELL  179

Query  611   KRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIASSPRNNVYA  432
             ++GLGWAA QI+++V+ Q+++ VV+ Y+ WV+ PV+  KS +F AN L I+SSP+ +VY+
Sbjct  180   EKGLGWAALQINKIVASQNNDVVVKLYKEWVEKPVLFTKSSLFVANRLTISSSPKFSVYS  239

Query  431   TDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDIEVCLLPHTLHTLGNDQEFMEFVT  255
             TDFGWGKPVAVR GM NK DGK +LFPG E+G+VDIEVCLLP TL  + ND+EFME VT
Sbjct  240   TDFGWGKPVAVRSGMANKGDGKVTLFPGAEEGNVDIEVCLLPKTLLAMENDEEFMEAVT  298



>ref|XP_006385479.1| hypothetical protein POPTR_0003s05570g [Populus trichocarpa]
 gb|ERP63276.1| hypothetical protein POPTR_0003s05570g [Populus trichocarpa]
Length=329

 Score =   310 bits (793),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 159/306 (52%), Positives = 206/306 (67%), Gaps = 3/306 (1%)
 Frame = -1

Query  1166  TSRKGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQLSLPPV  987
             ++ + +S PLL VQVTEL DG F+G  MNH A D SSFW+FFNSWSEI RG+  +S  PV
Sbjct  24    SNYEAVSKPLLAVQVTELVDGIFVGCTMNHAAVDGSSFWNFFNSWSEIHRGLDHISKTPV  83

Query  986   LDPW--FPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEMGT  813
             L+ W    G+I+ P+ LP  + +  L S F P PL+ERVFHF+K  IA LK KAN+E  T
Sbjct  84    LERWSLLNGSISPPIRLPLSIIKNNLDS-FIPSPLQERVFHFAKGKIAMLKAKANAEAAT  142

Query  812   DSISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKLAK  633
              SISSLQS +AH+WRA TRAR     +++ + + IG R R  PPLPE Y GNAI   +  
Sbjct  143   TSISSLQSLLAHIWRATTRARLFEHDKEIDLRIFIGLRARLQPPLPESYCGNAIVPGIVT  202

Query  632   ANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIASS  453
                 E+L++GLG+ A +I++VVS     +V +   + +K+P    K+     + L I+SS
Sbjct  203   LRTREILEQGLGFVALEINKVVSSYTKNKVTDALASLLKNPSPLTKADFGRIHSLSISSS  262

Query  452   PRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDIEVCLLPHTLHTLGNDQE  273
             PR+NVY TDFGWG+PVAVR G  NK DGK +LFPGLE+GS+D+E  LLP TL  LGND E
Sbjct  263   PRHNVYGTDFGWGRPVAVRSGPGNKFDGKLTLFPGLEEGSMDVEFSLLPETLKALGNDLE  322

Query  272   FMEFVT  255
             FM+ VT
Sbjct  323   FMDAVT  328



>gb|ABK94771.1| unknown [Populus trichocarpa]
Length=440

 Score =   313 bits (803),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 159/303 (52%), Positives = 208/303 (69%), Gaps = 3/303 (1%)
 Frame = -1

Query  1157  KGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQLSLPPVLDP  978
             + +S PLL VQVTEL DG F+G  MNH+A D +SFW+FFNSWSEI RG+  +S  PVL+ 
Sbjct  138   EAVSKPLLAVQVTELVDGIFVGCTMNHSAVDGTSFWNFFNSWSEIHRGLDHVSKTPVLER  197

Query  977   W--FPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEMGTDSI  804
             W    G+I+ P+ LP  + +   S S  P PL+ERVFHF+K  IA LK KAN+E  T SI
Sbjct  198   WSLLNGSISPPIRLPLSIIKNN-SDSIIPSPLQERVFHFTKGKIAMLKAKANAEAATTSI  256

Query  803   SSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKLAKANA  624
             SSLQS +AH+WRA TRAR +   ++V + + IG R R  PPLPE Y GNAI S +     
Sbjct  257   SSLQSLLAHIWRATTRARLVEHDKEVDLRIFIGLRARLQPPLPESYCGNAIVSGIVTLRT  316

Query  623   GELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIASSPRN  444
              ++L++GLG+ A +I++VVS     +V +   + +K+P    K+ V   + LGI+SSPR+
Sbjct  317   RDILEQGLGFVALEINKVVSSYTKNKVTDALASLLKNPSPFTKADVGRIHSLGISSSPRH  376

Query  443   NVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDIEVCLLPHTLHTLGNDQEFME  264
             NVY TDFGWG+PVAVR G  NK DGK +LFPGLE+GS+D+E  +LP TL  LGND EFM+
Sbjct  377   NVYGTDFGWGRPVAVRSGPGNKFDGKLTLFPGLEEGSMDVEFSVLPETLKALGNDLEFMD  436

Query  263   FVT  255
              VT
Sbjct  437   AVT  439



>ref|XP_002304177.2| hypothetical protein POPTR_0003s05590g [Populus trichocarpa]
 gb|EEE79156.2| hypothetical protein POPTR_0003s05590g [Populus trichocarpa]
Length=440

 Score =   312 bits (800),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 158/303 (52%), Positives = 208/303 (69%), Gaps = 3/303 (1%)
 Frame = -1

Query  1157  KGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQLSLPPVLDP  978
             + +S PLL VQVTEL DG F+G  MNH+A D +SFW+FFNSWSEI RG+  +S  PVL+ 
Sbjct  138   EAVSKPLLAVQVTELVDGIFVGCTMNHSAVDGTSFWNFFNSWSEIHRGLDHVSKTPVLER  197

Query  977   W--FPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEMGTDSI  804
             W    G+I+ P+ LP  + +   S S  P PL+ERVFHF+K  IA LK KAN+E  T SI
Sbjct  198   WSLLNGSISPPIRLPLSIIKNN-SDSIIPSPLQERVFHFTKGKIAMLKAKANAEAATTSI  256

Query  803   SSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKLAKANA  624
             SSLQS +AH+WRA TRAR +   ++V + + IG R R  PPLP+ Y GNAI S +     
Sbjct  257   SSLQSLLAHIWRATTRARLVEHDKEVDLRIFIGLRARLQPPLPQSYCGNAIVSGIVTLRT  316

Query  623   GELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIASSPRN  444
              ++L++GLG+ A +I++VVS     +V +   + +K+P    K+ V   + LGI+SSPR+
Sbjct  317   RDILEQGLGFVALEINKVVSSYTKNKVTDALASLLKNPSPFTKADVGRIHSLGISSSPRH  376

Query  443   NVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDIEVCLLPHTLHTLGNDQEFME  264
             NVY TDFGWG+PVAVR G  NK DGK +LFPGLE+GS+D+E  +LP TL  LGND EFM+
Sbjct  377   NVYGTDFGWGRPVAVRSGPGNKFDGKLTLFPGLEEGSMDVEFSVLPETLKALGNDLEFMD  436

Query  263   FVT  255
              VT
Sbjct  437   AVT  439



>ref|XP_006360905.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Solanum 
tuberosum]
Length=406

 Score =   311 bits (796),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 160/309 (52%), Positives = 206/309 (67%), Gaps = 14/309 (5%)
 Frame = -1

Query  1157  KGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQ---LSLPPV  987
             +G+S PLL VQVTEL DG FIG  +NH  AD +SFWHFFN WSEI+R       ++ PPV
Sbjct  98    EGVSKPLLAVQVTELVDGIFIGCTINHCVADGTSFWHFFNCWSEITRNSNSKLIVNKPPV  157

Query  986   LDPWFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEMGTDS  807
             LD WFP  +A P+ +    + +     +  P LEERVFHFSK+ IA LK KANS+ G D 
Sbjct  158   LDRWFPEFVASPIHVQ---KHDVHEDEYDVPLLEERVFHFSKENIAHLKAKANSKYGNDD  214

Query  806   -----ISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSK  642
                  ISSLQ+ +AHLW+++ R R  N  E+ S  + IG R R  PPLP+GY+GNA+H  
Sbjct  215   QNIICISSLQALLAHLWQSVIRCR--NADENFSFKLLIGARPRLQPPLPQGYFGNAVHFV  272

Query  641   LAKANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGI  462
                  A E+L+   GWAA Q+++VVS Q HEEV+ FYQ+WVK+P I +KS+V  +N L  
Sbjct  273   NITTTAREILEHDSGWAALQMNKVVSTQTHEEVMNFYQSWVKNPKIVKKSEV-VSNSLIA  331

Query  461   ASSPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDIEVCLLPHTLHTLGN  282
             +SSP  NVY +DFGWG+PVAVR G  NK DGK ++F G E+ S+DI+ CL P TLH +G 
Sbjct  332   SSSPHFNVYDSDFGWGRPVAVRSGAGNKHDGKITIFCGAEQASIDIQACLTPQTLHAMGY  391

Query  281   DQEFMEFVT  255
             D +FM  VT
Sbjct  392   DTKFMAAVT  400



>ref|XP_009625194.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like isoform 
X2 [Nicotiana tomentosiformis]
Length=420

 Score =   310 bits (795),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 155/299 (52%), Positives = 197/299 (66%), Gaps = 37/299 (12%)
 Frame = -1

Query  1151  ISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQLSLPPVLDPWF  972
             ++ PLLG+QVTEL +GYFIG  M+H+  D + FW+FFNSWSEIS G   +S  PVL  WF
Sbjct  158   VTKPLLGIQVTELVNGYFIGCTMSHSVGDGTCFWNFFNSWSEISSGSEFISRLPVLKRWF  217

Query  971   PGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEMGTDSISSLQ  792
             P NI  P+ LP +L+ + L      PPL+ER+FH SK++I KLK KANSEMGT       
Sbjct  218   PENIKPPIHLPLNLEDQELYECMELPPLKERIFHLSKESIGKLKAKANSEMGT-------  270

Query  791   SYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKLAKANAGELL  612
                                           R R NPPL EGYWGNA + K  K  AGELL
Sbjct  271   ------------------------------RPRLNPPLAEGYWGNAAYFKPVKRTAGELL  300

Query  611   KRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIASSPRNNVYA  432
             ++GLGWAA Q++++++ Q++EEVV+ Y+ WV+ PV+  K  +F AN L I+SSP+ +VY+
Sbjct  301   EKGLGWAALQMNKIIASQNNEEVVKLYKEWVEKPVLFTKGSLFVANRLTISSSPKFSVYS  360

Query  431   TDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDIEVCLLPHTLHTLGNDQEFMEFVT  255
             TDFGWGK VAVR GM NK DGK +LFPG E+GSVDIEVCLLP TL  + ND+EFM+ VT
Sbjct  361   TDFGWGKAVAVRSGMANKGDGKVTLFPGAEEGSVDIEVCLLPETLLAMENDEEFMKAVT  419



>gb|ABK94986.1| unknown [Populus trichocarpa]
Length=440

 Score =   310 bits (795),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 156/303 (51%), Positives = 206/303 (68%), Gaps = 3/303 (1%)
 Frame = -1

Query  1157  KGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQLSLPPVLDP  978
             + +S PLL VQVTEL DG F+G  MNH A D +SFW+FFNSWSEI RG+  +S  PVL+ 
Sbjct  138   EAVSKPLLAVQVTELVDGIFVGCTMNHAAVDGTSFWNFFNSWSEIHRGLDHVSKTPVLER  197

Query  977   W--FPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEMGTDSI  804
             W    G+I+ P+ LP  + +     SF P PL+ERVFHF+K  IA LK KAN+E  T SI
Sbjct  198   WSLLNGSISPPIRLPLSIIKNN-PGSFIPSPLQERVFHFTKGKIAMLKAKANAEAATTSI  256

Query  803   SSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKLAKANA  624
             SSLQS +AH+WRA TRAR     +++ + + IG R R  PPLPE Y+GNAI S +     
Sbjct  257   SSLQSLLAHIWRATTRARLFEHDKEIDLRIFIGLRARLQPPLPESYFGNAIVSGIVTLRT  316

Query  623   GELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIASSPRN  444
              E+L++GLG+ A ++++VVS     +V +   + +K+P    K+ +   + L I+SSPR+
Sbjct  317   REILEQGLGFVALEVNKVVSSYTKNKVTDALASVLKNPSPLTKADLGRIHSLAISSSPRH  376

Query  443   NVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDIEVCLLPHTLHTLGNDQEFME  264
             NVY TDFGWG+PVAVR G  NK DGK +LFPGLE+GS+D+E  +LP TL  LGND EFM+
Sbjct  377   NVYGTDFGWGRPVAVRSGPGNKFDGKLTLFPGLEEGSMDVEFSVLPETLKALGNDLEFMD  436

Query  263   FVT  255
              VT
Sbjct  437   AVT  439



>ref|XP_002304178.2| anthranilate N-hydroxycinnamoyl/benzoyltransferase family protein 
[Populus trichocarpa]
 gb|EEE79157.2| anthranilate N-hydroxycinnamoyl/benzoyltransferase family protein 
[Populus trichocarpa]
Length=440

 Score =   310 bits (795),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 156/303 (51%), Positives = 206/303 (68%), Gaps = 3/303 (1%)
 Frame = -1

Query  1157  KGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQLSLPPVLDP  978
             + +S PLL VQVTEL DG F+G  MNH A D +SFW+FFNSWSEI RG+  +S  PVL+ 
Sbjct  138   EAVSKPLLAVQVTELVDGIFVGCTMNHAAVDGTSFWNFFNSWSEIHRGLDHVSKTPVLER  197

Query  977   W--FPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEMGTDSI  804
             W    G+I+ P+ LP  + +     SF P PL+ERVFHF+K  IA LK KAN+E  T SI
Sbjct  198   WSLLNGSISPPIRLPLSIIKNN-PGSFIPSPLQERVFHFTKGKIAMLKAKANAEAATTSI  256

Query  803   SSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKLAKANA  624
             SSLQS +AH+WRA TRAR     +++ + + IG R R  PPLPE Y+GNAI S +     
Sbjct  257   SSLQSLLAHIWRATTRARLFEHDKEIDLRIFIGLRARLQPPLPESYFGNAIVSGIVTLRT  316

Query  623   GELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIASSPRN  444
              E+L++GLG+ A ++++VVS     +V +   + +K+P    K+ +   + L I+SSPR+
Sbjct  317   REILEQGLGFVALEVNKVVSSYTKNKVTDALASVLKNPSPLTKADLGRIHSLAISSSPRH  376

Query  443   NVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDIEVCLLPHTLHTLGNDQEFME  264
             NVY TDFGWG+PVAVR G  NK DGK +LFPGLE+GS+D+E  +LP TL  LGND EFM+
Sbjct  377   NVYGTDFGWGRPVAVRSGPGNKFDGKLTLFPGLEEGSMDVEFSVLPETLKALGNDLEFMD  436

Query  263   FVT  255
              VT
Sbjct  437   AVT  439



>ref|XP_009589622.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like isoform 
X2 [Nicotiana tomentosiformis]
Length=441

 Score =   308 bits (790),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 164/306 (54%), Positives = 204/306 (67%), Gaps = 13/306 (4%)
 Frame = -1

Query  1142  PLLGV---QVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQ---LSLPPVLD  981
             PL GV   +VTEL DG+FIG  +NH  AD +SFWHFFNSWSEISR       ++  PVL+
Sbjct  138   PLNGVHNFEVTELVDGFFIGCTINHCVADGTSFWHFFNSWSEISRTRSSNLTVNKLPVLE  197

Query  980   PWFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEMGTDS--  807
              WFP   A  + +   L +E L   F PP LEERVFHFSK+ IA+LK KANSE GTD   
Sbjct  198   RWFPKFTASQIHV--TLPKEHLYDEFDPPLLEERVFHFSKENIAQLKAKANSEFGTDQKT  255

Query  806   -ISSLQSYVAHLWRAITRARR-LNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKLAK  633
              ISSLQ+ +AHLW+ + R R      E  S  + IG R R  PPL EGY+GNA+H     
Sbjct  256   CISSLQAVLAHLWQTVIRCRTGTKADEKFSFKILIGARPRLQPPLREGYFGNAVHFVNVT  315

Query  632   ANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIASS  453
               A ELL+   GWAA Q+++VV++Q HEEV+ FYQ+WVK+P I +KS+V   N L  +SS
Sbjct  316   TTARELLENNSGWAALQMNKVVAMQTHEEVMNFYQSWVKNPKIVKKSEVV-TNSLIASSS  374

Query  452   PRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDIEVCLLPHTLHTLGNDQE  273
             PR +VY  DFGWG+P+AVR G  NK DGK ++F G+E+GS+DIE CL P TLH +G D  
Sbjct  375   PRFDVYGNDFGWGRPIAVRSGAGNKHDGKMTIFSGVEEGSIDIEACLTPETLHAMGEDAN  434

Query  272   FMEFVT  255
             FME VT
Sbjct  435   FMEAVT  440



>ref|XP_010274412.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Nelumbo 
nucifera]
Length=449

 Score =   308 bits (788),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 151/302 (50%), Positives = 194/302 (64%), Gaps = 2/302 (1%)
 Frame = -1

Query  1157  KGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQLSLPPVLDP  978
             +GI+ PLL VQVTEL DG F+   +NH  AD +SFWHFFNSWSEI RG  ++S PPVL  
Sbjct  140   EGITKPLLAVQVTELTDGIFVACTVNHVVADGTSFWHFFNSWSEICRGADRISRPPVLQR  199

Query  977   WFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEMGTDSISS  798
             WFP     P+       +E  S  +TPPPLEERVF F+K+ IA LK KAN+E GTD ISS
Sbjct  200   WFPTGTNCPVRFSIS-NKEKFSVRYTPPPLEERVFQFTKEKIASLKAKANTECGTDRISS  258

Query  797   LQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKLAKANAGE  618
             LQ+ +AH+WR++ RAR L+  +++  ++ IG R R  PPLP+ ++G  +    A A  GE
Sbjct  259   LQAILAHIWRSVARARGLDSDQEICYWLIIGKRSRLKPPLPDEHFGCFVEGGTATAKVGE  318

Query  617   LLKRGLGWAAWQIHEVV-SIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIASSPRNN  441
             LL RGLGWAAW +++VV S  D        ++  K P       + + N L   SSPR N
Sbjct  319   LLDRGLGWAAWLLNQVVASHNDPTAEKSLVESQTKQPKFVSMDSIVYNNLLLTGSSPRFN  378

Query  440   VYATDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDIEVCLLPHTLHTLGNDQEFMEF  261
             VY  D GWG+P+AVR G  NK DGK ++F G  +GSVD+E CL P TL  LG+D EFM+ 
Sbjct  379   VYGNDLGWGRPLAVRSGCGNKFDGKITVFQGRSEGSVDVEACLSPQTLMVLGDDAEFMDA  438

Query  260   VT  255
             VT
Sbjct  439   VT  440



>ref|XP_002282930.1| PREDICTED: uncharacterized acetyltransferase At3g50280 [Vitis 
vinifera]
Length=437

 Score =   307 bits (787),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 151/300 (50%), Positives = 196/300 (65%), Gaps = 3/300 (1%)
 Frame = -1

Query  1154  GISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQLSLPPVLDPW  975
             G+S PLL VQVTEL DG FIG  +NH  AD +SFWHFFNSWSE SR    +SLPP+  PW
Sbjct  140   GVSEPLLAVQVTELVDGIFIGCTVNHMVADGTSFWHFFNSWSEASRSSNSISLPPIFKPW  199

Query  974   FPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEMGTDSISSL  795
             F  +    + +P   Q   +S+  T PPL+E+VFHF+KD IA LK +AN+EMGTD ISS 
Sbjct  200   FVDDTHYSIQIP---QSALVSAIPTTPPLQEKVFHFTKDKIATLKARANAEMGTDQISSS  256

Query  794   QSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKLAKANAGEL  615
             Q+ +AHLWR++ R R L   ++     PIG R R  PPLP+ Y+G A+        AGEL
Sbjct  257   QALLAHLWRSVIRNRGLAEDQETRYNFPIGIRPRLRPPLPQQYFGVAVQPGTVTMKAGEL  316

Query  614   LKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIASSPRNNVY  435
             L+ GLG AAWQ+++ V+    E   +F ++WVK+P +         + L +++SP+ +VY
Sbjct  317   LELGLGHAAWQVNKTVAAYTEEGATKFLESWVKNPKLLGGGTTMINDSLYMSNSPQFHVY  376

Query  434   ATDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDIEVCLLPHTLHTLGNDQEFMEFVT  255
               DFGWGKPVAVR G  NK DGK + FPG E+GS+DI+VCL P TL  +  D EFME VT
Sbjct  377   GADFGWGKPVAVRSGGGNKLDGKTTFFPGSEEGSIDIQVCLSPETLEAMMEDAEFMEAVT  436



>ref|XP_007204351.1| hypothetical protein PRUPE_ppa005715mg [Prunus persica]
 gb|EMJ05550.1| hypothetical protein PRUPE_ppa005715mg [Prunus persica]
Length=447

 Score =   307 bits (787),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 153/311 (49%), Positives = 209/311 (67%), Gaps = 11/311 (4%)
 Frame = -1

Query  1157  KGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMP-QLSLPPVLD  981
             +G S PLL VQVTEL DG FIG  +NHT  D +SFWHFFNSWSEISRG    +S  PVL 
Sbjct  135   QGTSKPLLAVQVTELADGIFIGCTINHTVVDGTSFWHFFNSWSEISRGSSDHVSKSPVLQ  194

Query  980   PWFPGNIARPLCLPFDLQQETLSSSF-----TPPPLEERVFHFSKDTIAKLKEKANSEMG  816
              WFP  I RP+ +PF   ++ +S  F     TP  L+ERVF FSK+ +A+LK KA++E+ 
Sbjct  195   RWFPDEINRPIRIPFSKLEDQVSGKFIDNIPTPNNLKERVFCFSKEKVAQLKAKASAEIE  254

Query  815   TDS----ISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIH  648
              ++    ISSLQ+ +AHLWR+I R  + +  E+ S  + IG R R  PPLP+ Y+GNA+ 
Sbjct  255   IENTNTKISSLQAVLAHLWRSIVRGSKYSSDEETSYRLLIGARPRMKPPLPQQYFGNAVQ  314

Query  647   SKLAKANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFL  468
             +      AGE+L+RGLG+ AW+++++V++   E++  F + WV+ P +  +  +  AN L
Sbjct  315   AGTVTMKAGEVLERGLGFVAWEMNKMVALHTEEKLRSFLECWVQEPKLLTEDNMA-ANAL  373

Query  467   GIASSPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDIEVCLLPHTLHTL  288
               +SSPR NVY  DFGWG+PV VR G  NK+ GK ++F G+E+GS+DIEVCLL  TL  +
Sbjct  374   VTSSSPRFNVYGNDFGWGRPVGVRSGAGNKSHGKITVFAGVEEGSIDIEVCLLAETLEAM  433

Query  287   GNDQEFMEFVT  255
             GND EFM+ VT
Sbjct  434   GNDSEFMDVVT  444



>ref|XP_011071701.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Sesamum 
indicum]
Length=440

 Score =   306 bits (783),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 151/307 (49%), Positives = 201/307 (65%), Gaps = 10/307 (3%)
 Frame = -1

Query  1157  KGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQLSLPPVLDP  978
             +G+S PL+GVQVTEL DG FI    NH   D +SFWHFFNSWSEISRG+  +S  PV + 
Sbjct  137   EGVSKPLMGVQVTELVDGVFIACTANHAVIDGTSFWHFFNSWSEISRGLETISKTPVFER  196

Query  977   WFPGNIARP-LCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEMGTDSIS  801
             WFP NI++    +P     ++L  SF PPP  ERVF FS++++  LK KANSE GTD IS
Sbjct  197   WFPANISKDNRLIPLPPMDQSLLHSFVPPPSLERVFQFSRESVVMLKAKANSEAGTDKIS  256

Query  800   SLQSYVAHLWRAITRAR---RLNPT--EDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKLA  636
             S Q+ +AHLWR +TR R   R+     ++V + + +GTR R   PLP+ Y+GNA++    
Sbjct  257   SFQALIAHLWRNVTRRRNQLRIEKANNQEVELLLLVGTRSRI--PLPDAYFGNAVYVVKT  314

Query  635   KANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIAS  456
              AN GELL+ GLG+AA +++E+V+ Q  E  +   + WVK+P+I  K          + S
Sbjct  315   VANEGELLENGLGYAALKVNELVAQQSSEAAIALAEEWVKNPIIFNKRPHVIT--FAVTS  372

Query  455   SPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDIEVCLLPHTLHTLGNDQ  276
             SPR++VY+TDFGWGKP+AVR G   K DGK +L+P  E G +D+EVCL P TL  +  D 
Sbjct  373   SPRHDVYSTDFGWGKPIAVRSGKGQKIDGKMTLYPAAEPGGIDVEVCLAPATLQAMEQDA  432

Query  275   EFMEFVT  255
             EFME VT
Sbjct  433   EFMEAVT  439



>ref|XP_008241487.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Prunus 
mume]
Length=445

 Score =   304 bits (778),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 152/309 (49%), Positives = 207/309 (67%), Gaps = 9/309 (3%)
 Frame = -1

Query  1157  KGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMP-QLSLPPVLD  981
             +G S PLL VQVTEL DG FIG  +NHT  D +SFWHFFNSWSEISRG    +S  PVL 
Sbjct  135   QGTSKPLLAVQVTELVDGVFIGCTINHTVVDGTSFWHFFNSWSEISRGSSDHVSKSPVLQ  194

Query  980   PWFPGNIARPLCLPFDLQQETLSSSF-----TPPPLEERVFHFSKDTIAKLKEKANSEMG  816
              WF   I RP+ +PF   ++ +S  F     TP  L+ERVF FSK+ +A+LK KA++E+ 
Sbjct  195   RWFLDEINRPIRIPFSKLEDQVSGKFIDNIPTPNNLKERVFCFSKEKVAQLKAKASAEIE  254

Query  815   TDS--ISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSK  642
               +  ISSLQ+ +AHLWR+I R  + +  E+ S  + IG R R  PPLP+ Y+GNA+ + 
Sbjct  255   NTNTKISSLQAVLAHLWRSIVRGSKYSSDEETSYRLLIGARPRMKPPLPQQYFGNAVQAA  314

Query  641   LAKANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGI  462
                  AGE+L+RGLG+ AW+++++V++   E++  F + WV+ P +  +  +  AN L  
Sbjct  315   TVTMKAGEVLERGLGFVAWEMNKMVALHTEEKLRSFLECWVQEPKLLTEDNMA-ANALVT  373

Query  461   ASSPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDIEVCLLPHTLHTLGN  282
             +SSPR NVY  DFGWG+PV VR G  NK+ GK ++F G+E+GS+DIEVCLL  TL  +GN
Sbjct  374   SSSPRFNVYGNDFGWGRPVGVRSGAGNKSHGKITVFAGVEEGSIDIEVCLLAETLEAMGN  433

Query  281   DQEFMEFVT  255
             D EFM+ VT
Sbjct  434   DSEFMDVVT  442



>ref|XP_002533255.1| Anthranilate N-benzoyltransferase protein, putative [Ricinus 
communis]
 gb|EEF29117.1| Anthranilate N-benzoyltransferase protein, putative [Ricinus 
communis]
Length=437

 Score =   302 bits (774),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 144/303 (48%), Positives = 200/303 (66%), Gaps = 3/303 (1%)
 Frame = -1

Query  1163  SRKGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQLSLPPVL  984
             + +G+S PL+ +QVTEL DG FIG  MNHT AD ++FW+F N WS+I+RG   +   PV+
Sbjct  135   NHEGVSQPLVAIQVTELVDGIFIGCTMNHTVADGTTFWNFINCWSQIARGSDHVPRTPVI  194

Query  983   DPWFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEMGTDSI  804
             + WF      P+ LP  + +      FTPPPL+ERVFHFSK+ I  LK +AN+E G D I
Sbjct  195   EHWFRSERYCPVRLPISIIKT--DDEFTPPPLQERVFHFSKEKITGLKARANAEAGIDKI  252

Query  803   SSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKLAKANA  624
             SSLQS +AHLWR + R R+L+P ++ + ++ IG R R  P +PE Y+GNAI        A
Sbjct  253   SSLQSLLAHLWRGVIRNRKLDPNQEPNFHLQIGIRSRLQPKIPEEYFGNAIQVGTVNLKA  312

Query  623   GELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIASSPRN  444
             GEL++ G+G+AA QI+++++    + V    +  +KSP +   +     N L  +SSPR 
Sbjct  313   GELVEHGVGYAALQINKMIACYTEDNVRNNLEFSIKSPKLVTMN-TLTRNALITSSSPRF  371

Query  443   NVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDIEVCLLPHTLHTLGNDQEFME  264
             NVY  DFGWG+P+AVR G  NK DGK ++FPG E+GS+DIEVC+LP  L  +GND EFM+
Sbjct  372   NVYGNDFGWGRPIAVRSGPANKFDGKVTIFPGAEEGSIDIEVCILPQVLQAIGNDSEFMD  431

Query  263   FVT  255
              +T
Sbjct  432   AIT  434



>ref|XP_008338333.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Malus 
domestica]
Length=461

 Score =   296 bits (759),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 149/305 (49%), Positives = 204/305 (67%), Gaps = 7/305 (2%)
 Frame = -1

Query  1154  GISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMP---QLSLPPVL  984
             G+S PLL VQVTEL DG FIG  MNH+  D SSFWHFFN+WSEISR      +LS PP +
Sbjct  156   GVSKPLLAVQVTELVDGIFIGCTMNHSIVDGSSFWHFFNTWSEISRRGSTNGKLSQPPPI  215

Query  983   --DPWFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEMGTD  810
                 +  G I  P+ +PF  Q +   + F  P L++RVFHFSK+TIA+LK KANSEMGT 
Sbjct  216   FGREYLGGIIDLPVRIPF-FQNQIPKTKFLAPILKQRVFHFSKETIAQLKAKANSEMGTT  274

Query  809   SISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKLAKA  630
              ISSLQ+ +AHLW ++TR + L+  ++    V +G R R  PPLP+ Y GNA+   +  +
Sbjct  275   KISSLQALLAHLWLSVTRNQCLSTGQETMYKVLVGMRQRLQPPLPDQYLGNAVLFGIVTS  334

Query  629   NAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIASSP  450
             + GELL+RGLGWAAW+++++++ Q   +V +  ++W+K+P +     +  +N L   SSP
Sbjct  335   SVGELLERGLGWAAWEMNKMIAAQTEHDVRKLLEDWIKNPKVPNLGSL-ASNSLLTGSSP  393

Query  449   RNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDIEVCLLPHTLHTLGNDQEF  270
             R +V+  DFGWG+P+AVR G  NK DGK ++F G E+GS+D E CL P TLH L +D EF
Sbjct  394   RFDVFGNDFGWGRPLAVRSGAGNKFDGKLTVFQGAEEGSIDFEACLSPQTLHALAHDAEF  453

Query  269   MEFVT  255
             M  +T
Sbjct  454   MASLT  458



>gb|AAV50009.1| anthranilate N-hydroxycinnamoyl/benzoyltransferase [Malus domestica]
Length=398

 Score =   294 bits (752),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 147/311 (47%), Positives = 204/311 (66%), Gaps = 11/311 (4%)
 Frame = -1

Query  1157  KGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQLSLPPVLDP  978
             +G S PLL VQVTEL DG FIG  +NHT  D +SFWHFFNSWSEISRG   +S PPVL  
Sbjct  88    EGTSKPLLAVQVTELGDGIFIGCTVNHTVVDGTSFWHFFNSWSEISRGFDFVSKPPVLKR  147

Query  977   WFPGNIARPLCLPFDLQQETLSSSFTP----PPLEERVFHFSKDTIAKLKEKANSEMGTD  810
             W       P+ +PF   ++ +S  +      P L+ERVFHFSK+ IA+LK KAN+E+  +
Sbjct  148   WLLDGTISPIRIPFSKIEDQVSDKYIGNIRVPLLKERVFHFSKEKIAQLKAKANAEIQLE  207

Query  809   S----ISSLQSYVAHLWRAITRARR--LNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIH  648
             +    ISSLQ+ + HLWR+I R     L+P ++ S  + IG R R NPPL + Y+GNA+ 
Sbjct  208   NTKRKISSLQAVLVHLWRSIIRGSNGDLDPDKESSYRLLIGARSRMNPPLSQQYFGNAVQ  267

Query  647   SKLAKANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFL  468
             +      A E++KRGLG+ AW+++++V++   E++ +F + WV+ P +  +  +  AN L
Sbjct  268   AGTVTIKAREVIKRGLGFVAWEMNKMVALHTEEKLRKFLECWVQEPKLLTEGNM-AANAL  326

Query  467   GIASSPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDIEVCLLPHTLHTL  288
               +SSPR +VY  DFGWG+PV VR G  NK+ GK ++F  +E+GS+DIE CLL  TL  +
Sbjct  327   VTSSSPRFDVYGNDFGWGRPVGVRSGAGNKSHGKITVFSAVEEGSIDIEACLLAETLEAM  386

Query  287   GNDQEFMEFVT  255
             GND EFM+ VT
Sbjct  387   GNDSEFMDAVT  397



>ref|XP_008367983.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Malus 
domestica]
Length=461

 Score =   296 bits (757),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 149/305 (49%), Positives = 203/305 (67%), Gaps = 7/305 (2%)
 Frame = -1

Query  1154  GISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMP---QLSLPPVL  984
             G+S PLL VQVTEL DG FIG  MNH+  D SSFWHFFN+WSEISR      +LS PP +
Sbjct  156   GVSKPLLAVQVTELVDGIFIGCTMNHSIVDGSSFWHFFNTWSEISRRGSTNGKLSQPPPI  215

Query  983   --DPWFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEMGTD  810
                 +  G I  P+ +PF  Q +   + F  P L++RVFHFSK+TIA+LK KANSEMGT 
Sbjct  216   FGREYLGGIIDLPVRIPF-FQNQIPKTKFLAPILKQRVFHFSKETIAQLKAKANSEMGTT  274

Query  809   SISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKLAKA  630
              ISSLQ+ +AHLW ++TR + L+  ++    V +G R R  PPLP+ Y GNA+   +  +
Sbjct  275   KISSLQALLAHLWLSVTRNQCLSTGQETMYKVLVGMRQRLQPPLPDQYLGNAVLFGIVTS  334

Query  629   NAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIASSP  450
             + GELL+RGLGWAAW ++++++ Q   +V +  ++W+K+P +     +  +N L   SSP
Sbjct  335   SVGELLERGLGWAAWXMNKMIAAQTEHDVRKLLEDWIKNPKVPNLGSL-ASNSLLTGSSP  393

Query  449   RNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDIEVCLLPHTLHTLGNDQEF  270
             R +V+  DFGWG+P+AVR G  NK DGK ++F G E+GS+D E CL P TLH L +D EF
Sbjct  394   RFDVFGNDFGWGRPLAVRSGAGNKFDGKLTVFQGAEEGSIDFEACLSPQTLHALAHDAEF  453

Query  269   MEFVT  255
             M  +T
Sbjct  454   MASLT  458



>ref|XP_007047323.1| HXXXD-type acyl-transferase family protein, putative [Theobroma 
cacao]
 gb|EOX91480.1| HXXXD-type acyl-transferase family protein, putative [Theobroma 
cacao]
Length=445

 Score =   295 bits (754),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 145/301 (48%), Positives = 198/301 (66%), Gaps = 2/301 (1%)
 Frame = -1

Query  1157  KGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQLSLPPVLDP  978
             +G   PLL VQVTEL DG FIG  +NH   D +SFWHFFN W+EISRG   LS PPVL  
Sbjct  144   EGTFQPLLAVQVTELVDGIFIGCTINHMVVDGTSFWHFFNFWAEISRGSVHLSKPPVLQR  203

Query  977   WFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEMGTDSISS  798
             WF      P+ +P    ++     FT PPL ERV HF+K+ IAKLK KAN+E GTD ISS
Sbjct  204   WFLDGTDLPIHIPQAYVKQVHEELFTRPPLRERVCHFTKENIAKLKAKANAEAGTDKISS  263

Query  797   LQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKLAKANAGE  618
             LQ+ ++H+W+++ R + L+P E+++  + +G R R N  LPE Y+GNA+ +        E
Sbjct  264   LQALLSHIWQSVIRNKTLDPNEEINYRMLVGARPRLN-ELPEQYFGNAVQAGSITMKVKE  322

Query  617   LLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIASSPRNNV  438
             LL++GLG  AW+++ +V+ Q  E++ +F ++W  SP +     +  +N L  +SSP  N+
Sbjct  323   LLEQGLGNVAWEMNRLVATQTVEKLKKFLEDWTASPKLMSMGSM-ASNALVTSSSPWFNI  381

Query  437   YATDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDIEVCLLPHTLHTLGNDQEFMEFV  258
             Y  DFGWG+PVAVR G  NK DGK ++F G+E+GS+DIE CL P TL  + ND+EFME V
Sbjct  382   YGNDFGWGRPVAVRSGCGNKHDGKITVFRGVEEGSIDIEACLCPDTLEAMANDEEFMEAV  441

Query  257   T  255
             T
Sbjct  442   T  442



>ref|XP_008382283.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Malus 
domestica]
Length=450

 Score =   292 bits (748),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 147/311 (47%), Positives = 204/311 (66%), Gaps = 11/311 (4%)
 Frame = -1

Query  1157  KGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQLSLPPVLDP  978
             +G S PLL VQVTEL DG FIG  +NHT  D +SFWHFFNSWSEISRG   +S PPVL  
Sbjct  140   EGTSKPLLAVQVTELGDGIFIGCTVNHTVVDGTSFWHFFNSWSEISRGFDFVSKPPVLKR  199

Query  977   WFPGNIARPLCLPFDLQQETLSS----SFTPPPLEERVFHFSKDTIAKLKEKANSEMGTD  810
             W       P+ +PF   ++ +S     +   P L+ERVFHFSK+ IA+LK KAN+E+  +
Sbjct  200   WLLDGTISPIRIPFSKIEDQVSDKXIGNIRVPLLKERVFHFSKEKIAQLKAKANAEIQLE  259

Query  809   S----ISSLQSYVAHLWRAITRARR--LNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIH  648
             +    ISSLQ+ + HLWR+I R     L+P ++ S  + IG R R NPPL + Y+GNA+ 
Sbjct  260   NTKRKISSLQAVLVHLWRSIIRGSNGDLDPDKESSYRLLIGARSRMNPPLSQQYFGNAVQ  319

Query  647   SKLAKANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFL  468
             +      A E++KRGLG+ AW+++++V++   E++ +F + WV+ P +  +  +  AN L
Sbjct  320   AGTVTIKAREVIKRGLGFVAWEMNKMVALHTEEKLRKFLECWVQEPKLLTEGNM-AANAL  378

Query  467   GIASSPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDIEVCLLPHTLHTL  288
               +SSPR +VY  DFGWG+PV VR G  NK+ GK ++F  +E+GS+DIE CLL  TL  +
Sbjct  379   XTSSSPRFDVYGNDFGWGRPVGVRSGXGNKSHGKITVFSXVEEGSIDIEACLLAETLEAM  438

Query  287   GNDQEFMEFVT  255
             GND EFM+ VT
Sbjct  439   GNDSEFMDAVT  449



>ref|XP_008361493.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized acetyltransferase 
At3g50280-like [Malus domestica]
Length=449

 Score =   291 bits (746),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 147/311 (47%), Positives = 203/311 (65%), Gaps = 11/311 (4%)
 Frame = -1

Query  1157  KGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQLSLPPVLDP  978
             +G S PLL VQVTEL DG FIG  +NHT  D +SFWHFFNSWSEISRG   +S PPVL  
Sbjct  139   EGTSKPLLAVQVTELGDGIFIGCTVNHTVVDGTSFWHFFNSWSEISRGFDXVSKPPVLKR  198

Query  977   WFPGNIARPLCLPFDLQQETLS----SSFTPPPLEERVFHFSKDTIAKLKEKANSEMGTD  810
             W       P+ +PF    + +S     +   P L+ERVFHFSK+ IA+LK KAN+E+  +
Sbjct  199   WLLDGTISPIRIPFSKIXDQVSDKXIGNIRVPLLKERVFHFSKEKIAQLKAKANAEIQLE  258

Query  809   S----ISSLQSYVAHLWRAITRARR--LNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIH  648
             +    ISSLQ+ + HLWR+I R     L+P ++ S  + IG R R NPPL + Y+GNA+ 
Sbjct  259   NTKRKISSLQAVLVHLWRSIIRGSNGDLDPDKESSYRLLIGARSRMNPPLSQQYFGNAVQ  318

Query  647   SKLAKANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFL  468
             +      A E++KRGLG+ AW+++++V++   E++ +F + WV+ P +  +  +  AN L
Sbjct  319   AGTVTIKAREVIKRGLGFVAWEMNKMVALHTEEKLRKFLECWVQEPKLLTEGNM-AANAL  377

Query  467   GIASSPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDIEVCLLPHTLHTL  288
               +SSP  +VY  DFGWG+PV VR G  NK+ GK ++F G+E+GS+DIE CLL  TL  +
Sbjct  378   XTSSSPXFDVYGNDFGWGRPVGVRSGGGNKSHGKITVFSGVEEGSIDIEACLLAETLEAM  437

Query  287   GNDQEFMEFVT  255
             GND EFM+ VT
Sbjct  438   GNDSEFMDAVT  448



>ref|XP_012079578.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Jatropha 
curcas]
 gb|KDP31964.1| hypothetical protein JCGZ_12425 [Jatropha curcas]
Length=446

 Score =   290 bits (741),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 146/304 (48%), Positives = 198/304 (65%), Gaps = 6/304 (2%)
 Frame = -1

Query  1157  KGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEIS----RGMPQLSLPP  990
             +G S PLL VQVTEL DG FIG   NH  AD +SFW+F N  S++S    + + Q S P 
Sbjct  143   EGHSKPLLAVQVTELVDGIFIGFTYNHAIADGTSFWNFVNKLSDMSISCEKKLLQTSRPV  202

Query  989   VLDPWFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEMGTD  810
                 WF   I  P+ +PF    E +S+ F  PPL ERVFHFS+  IA+LK KAN+E+GT 
Sbjct  203   FGFDWFLDGIDHPIRVPFSYN-EAISNRFISPPLLERVFHFSQKKIAQLKTKANAEIGTS  261

Query  809   SISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKLAKA  630
              ISSLQ+ +  LWR+I R R L+  +++   V +  R R  PPLP+ Y+GNA+   +A  
Sbjct  262   KISSLQAILGQLWRSIIRPRNLDSDQEIYCRVLVNMRQRLQPPLPDKYFGNAVLFGIAAT  321

Query  629   NAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIASSP  450
              AGELL  GLG+AA QI+++V+ Q   EV ++ + WVK P +++ S    +N L +ASSP
Sbjct  322   TAGELLANGLGFAALQINKMVARQTDSEVRKYLEGWVKRPTLSKLSSA-ASNALIVASSP  380

Query  449   RNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDIEVCLLPHTLHTLGNDQEF  270
             R NV+  DFGWG+PVAVR G  N  DGK ++FPG+E+GSVD++ CLLP  LH +  D+EF
Sbjct  381   RFNVFGNDFGWGRPVAVRGGAGNNYDGKITVFPGVEEGSVDVQACLLPQILHAMEEDEEF  440

Query  269   MEFV  258
             M+ +
Sbjct  441   MDVI  444



>ref|XP_007204343.1| hypothetical protein PRUPE_ppa005635mg [Prunus persica]
 gb|EMJ05542.1| hypothetical protein PRUPE_ppa005635mg [Prunus persica]
Length=450

 Score =   288 bits (738),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 146/299 (49%), Positives = 191/299 (64%), Gaps = 8/299 (3%)
 Frame = -1

Query  1148  STPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQ-----LSLPPVL  984
             S PLL VQ+TEL DG FIG  MNH+  D SSFWHFFN+WSEISR +       L  PP  
Sbjct  148   SKPLLAVQITELVDGIFIGCTMNHSVVDGSSFWHFFNTWSEISRRVSTNCGKILQPPPAF  207

Query  983   D-PWFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEMGTDS  807
                +  G I  P+ LP   Q +     F+ P L++RVFHFSK  IA+LK KAN+EMGT  
Sbjct  208   GRDFLNGMIDLPVRLPI-FQNKIPKIRFSAPLLQQRVFHFSKQKIAQLKAKANAEMGTTR  266

Query  806   ISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKLAKAN  627
             ISSLQ+ +AHLW ++TR + L   ++    V +G R R  PPLP+ Y GNA+   +  + 
Sbjct  267   ISSLQALLAHLWVSVTRNQHLETDQETQYKVLVGMRQRLQPPLPDEYLGNAVLFGIVTST  326

Query  626   AGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIASSPR  447
              GELL+RGLGWAAW++++ +S Q  ++V +  + W+K P +  K     +N L   SSPR
Sbjct  327   VGELLERGLGWAAWEMNKTISSQTEQDVRKLLEGWIKDPKVP-KLDGLASNSLLTGSSPR  385

Query  446   NNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDIEVCLLPHTLHTLGNDQEF  270
              NV+  DFGWG+P+AVR G+ NK DGK ++FPG E GS+D E CLLP TL  L +D EF
Sbjct  386   FNVFGNDFGWGRPLAVRSGVGNKFDGKLTVFPGAEDGSIDFEACLLPQTLQALAHDAEF  444



>ref|XP_009343279.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Pyrus 
x bretschneideri]
Length=450

 Score =   287 bits (735),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 145/311 (47%), Positives = 204/311 (66%), Gaps = 11/311 (4%)
 Frame = -1

Query  1157  KGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQLSLPPVLDP  978
             +G S PLL VQVTEL DG FIG  +NHT  D +SFWHFFNSWSEISRG   +S PPVL  
Sbjct  140   EGTSKPLLAVQVTELMDGIFIGCTVNHTVVDGTSFWHFFNSWSEISRGFDFVSKPPVLKR  199

Query  977   WFPGNIARPLCLPFDLQQETLSS----SFTPPPLEERVFHFSKDTIAKLKEKANSEMGTD  810
             W       P+ +PF   ++ +S     +   P L+ERVFHFSK+ IA+LK KAN+E+  +
Sbjct  200   WLLDGTISPIRIPFSKIEDQVSDKHIGNIRVPLLKERVFHFSKEKIAQLKAKANAEIQLE  259

Query  809   S----ISSLQSYVAHLWRAITRARR--LNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIH  648
             +    ISSLQ+ +AHLWR+I R     L+P ++ S  + IG R R NPPL + Y+GNA+ 
Sbjct  260   NSRTKISSLQAVLAHLWRSIIRGSNGDLDPDKESSYRLLIGARSRMNPPLSQQYFGNAVQ  319

Query  647   SKLAKANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFL  468
             +      A E ++ GLG+ AW+++++V++   E++ +F + WV+ P + ++  +   + L
Sbjct  320   AGTVTIKAREAIESGLGFVAWEMNKMVALHTEEKLRKFLEFWVQEPKLLKEGNM-AVHAL  378

Query  467   GIASSPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDIEVCLLPHTLHTL  288
               +SSPR +VY  DFGWG+PV VR G  NK+ GK ++F G+E+GS+DIE CLL  TL  +
Sbjct  379   VTSSSPRFDVYGNDFGWGRPVGVRSGAGNKSHGKITVFSGVEEGSIDIEACLLAETLEAM  438

Query  287   GNDQEFMEFVT  255
             GND EFM+ VT
Sbjct  439   GNDSEFMDAVT  449



>ref|XP_009367311.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Pyrus 
x bretschneideri]
Length=450

 Score =   287 bits (734),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 146/311 (47%), Positives = 202/311 (65%), Gaps = 11/311 (4%)
 Frame = -1

Query  1157  KGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQLSLPPVLDP  978
             +G S PLL VQVTEL DG FIG  +NHT  D +SFWHFFNSWSEISRG   +S PPVL  
Sbjct  140   EGTSKPLLAVQVTELMDGIFIGCTVNHTVVDGTSFWHFFNSWSEISRGFDFVSKPPVLKR  199

Query  977   WFPGNIARPLCLPFDLQQETLSS----SFTPPPLEERVFHFSKDTIAKLKEKANSEMGTD  810
             W       P+ +PF   ++ +S     +   P L+ERVFHFSK+ IA+LK KAN+E+  +
Sbjct  200   WLLDGTISPIRIPFSKIEDQVSDKHIGNIRVPLLKERVFHFSKEKIAQLKAKANAEIQLE  259

Query  809   S----ISSLQSYVAHLWRAITRARR--LNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIH  648
             +    ISSLQ+ +AHLWR+I R     L+P ++ S    IG R R NPPL + Y+GNA+ 
Sbjct  260   NTRTKISSLQAVLAHLWRSIIRGSNGDLDPDKESSYPFIIGARSRMNPPLSQQYFGNAVQ  319

Query  647   SKLAKANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFL  468
             +      A E+++RGLG+ AW+++++V++   E++ +F + WV+ P +     +  AN L
Sbjct  320   AGTVTIKAREVIERGLGFVAWEMNKMVALHTEEKLRKFLEFWVQEPKLLTDGNM-AANAL  378

Query  467   GIASSPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDIEVCLLPHTLHTL  288
               + SPR +VY  DFGWG+PV VR G  NK+  K ++F G+E+GS+DIE CLL  TL  +
Sbjct  379   VTSGSPRFDVYGNDFGWGRPVGVRSGAGNKSHRKITVFSGVEEGSIDIEACLLAETLEAM  438

Query  287   GNDQEFMEFVT  255
             GND EFM+ VT
Sbjct  439   GNDSEFMDAVT  449



>ref|XP_008361421.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like, 
partial [Malus domestica]
Length=594

 Score =   291 bits (744),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 146/299 (49%), Positives = 200/299 (67%), Gaps = 7/299 (2%)
 Frame = -1

Query  1154  GISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMP---QLSLPPVL  984
             G+S PLL VQVTEL DG FIG  MNH+  D SSFWHFFN+WSEISR      +LS PP +
Sbjct  20    GVSKPLLAVQVTELVDGIFIGCTMNHSIVDGSSFWHFFNTWSEISRRGSTNGKLSQPPPI  79

Query  983   --DPWFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEMGTD  810
                 +  G I  P+ +PF  Q +   + F  P L++RVFHFSK+TIA+LK KANSEMGT 
Sbjct  80    FGREYLDGIIDLPVRIPF-FQNQIPKTKFLAPILKQRVFHFSKETIAQLKAKANSEMGTT  138

Query  809   SISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKLAKA  630
              ISSLQ+ +AHLW ++TR + L+  ++    V +G R R  PPLP+ Y GNA+   +  +
Sbjct  139   KISSLQALLAHLWLSVTRNQCLSTGQETMYKVLVGMRQRLQPPLPDQYLGNAVLFGIVTS  198

Query  629   NAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIASSP  450
             + GELL+RGLGWAAW+++++++ Q   +V +  ++W+K+P +     +  +N L   SSP
Sbjct  199   SVGELLERGLGWAAWEMNKMIAAQTEHDVRKLLEDWIKNPKVPNLGSL-ASNSLLTGSSP  257

Query  449   RNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDIEVCLLPHTLHTLGNDQE  273
             R +V+  DFGWG+P+AVR G  NK DGK ++F G E+GS+D E CL P TLH L +D E
Sbjct  258   RFDVFGNDFGWGRPLAVRSGAGNKFDGKLTVFQGAEEGSIDFEACLSPQTLHALAHDAE  316


 Score = 79.3 bits (194),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 38/113 (34%), Positives = 63/113 (56%), Gaps = 9/113 (8%)
 Frame = -1

Query  671  GYWG---------NAIHSKLAKANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWV  519
            G WG         NA+   +  +   +LL R LGW A +++++++ +  E+ + F + W+
Sbjct  445  GIWGRHYPINTLXNAVLFGMTTSTVSDLLYRELGWVALEMNKMIASKTKEDAINFLKQWI  504

Query  518  KSPVIAQKSKVFFANFLGIASSPRNNVYATDFGWGKPVAVRCGMDNKADGKFS  360
            KSP + + + +   + L   SSPR N+Y  +FGWG P+AVR G  NK  GK +
Sbjct  505  KSPKMTKMNALASDHALATGSSPRFNMYINNFGWGSPLAVRSGARNKFXGKLT  557



>ref|XP_010933132.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Elaeis 
guineensis]
Length=452

 Score =   286 bits (732),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 143/294 (49%), Positives = 190/294 (65%), Gaps = 3/294 (1%)
 Frame = -1

Query  1142  PLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISR-GMPQLSLPPVLDPWFPG  966
             PLL VQVTEL DG F+G + NH   D SSFWHF NSWSEISR G  Q+S PPVL  WF  
Sbjct  158   PLLAVQVTELADGVFVGCSANHAVVDGSSFWHFLNSWSEISRTGSSQISRPPVLHRWFLD  217

Query  965   NIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEMGTDSISSLQSY  786
              ++ P+ LPF   QE +    TP  ++E + HFSK +I KLK KAN EM T+ +SSLQ+ 
Sbjct  218   PVSPPILLPFSSHQEFIRRYITPR-IDEAIIHFSKQSIQKLKAKANLEMKTNQLSSLQAL  276

Query  785   VAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKLAKANAGELLKR  606
             +AH+WR++ RARRL   ++ S  + IG RWR  PPLP  Y+GN+     AK  AGE++ R
Sbjct  277   LAHVWRSVLRARRLEHDQETSYSLAIGDRWRIEPPLPANYFGNSSLRATAKLLAGEVVDR  336

Query  605   GLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIASSPRNNVYATD  426
             GLGW AWQ++  V+      V  + ++W ++P+ +    +   N L   SSPR +VY  D
Sbjct  337   GLGWVAWQLNRAVAAHTTTVVKSWLESWQQNPIFSYFDCLETRN-LAAGSSPRFDVYGND  395

Query  425   FGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDIEVCLLPHTLHTLGNDQEFME  264
             FGWG+P+AVR G+ NK DG   ++ G E GS+D+E+CL P  L +L  D+EFME
Sbjct  396   FGWGRPLAVRSGIANKRDGNVMVYEGNEDGSMDLEICLSPQALASLLEDKEFME  449



>ref|XP_007203275.1| hypothetical protein PRUPE_ppa025470mg [Prunus persica]
 gb|EMJ04474.1| hypothetical protein PRUPE_ppa025470mg [Prunus persica]
Length=446

 Score =   286 bits (731),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 149/305 (49%), Positives = 197/305 (65%), Gaps = 9/305 (3%)
 Frame = -1

Query  1157  KGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISR--GMPQLSLPPVL  984
             + +S PLL VQVTEL DG FIG  MNH   D S FW FFN+WSEISR  G  ++S PP++
Sbjct  145   ESVSNPLLAVQVTELVDGIFIGCTMNHCVVDGSIFWRFFNTWSEISRDHGFGKISQPPLI  204

Query  983   --DPWFPGNIARPLCLPFDLQQETLSSSFTPP-PLEERVFHFSKDTIAKLKEKANSEMGT  813
                 +F G I  P+ +PF   Q  +   F PP PL++R+FHF K+ IA+LK KAN+EMGT
Sbjct  205   FGREFFDGIIDLPVRIPFFHNQ--IPDKFLPPGPLQQRMFHFPKEKIAQLKAKANAEMGT  262

Query  812   DSISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKLAK  633
               ISSLQ+ +AHLW  ITR RRL+P ++    + +G R R  P LPE Y GNA+      
Sbjct  263   TKISSLQALLAHLWVCITRNRRLSPDQETKYLLLVGLRQRFQP-LPEEYLGNAVLFGTVT  321

Query  632   ANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIASS  453
             +  G+LLK+GLGWAA +++++++ +  +EV +  + WVKSP ++ K      N L   SS
Sbjct  322   STVGDLLKQGLGWAALEMNKMIASKTEQEVRKHLEEWVKSPKLS-KMGTLSVNSLATGSS  380

Query  452   PRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDIEVCLLPHTLHTLGNDQE  273
             PR NV+  DFGWG+P+AVR G  NK DGK ++FPG E GS+D E CL   TL  L  D E
Sbjct  381   PRFNVFGNDFGWGRPLAVRSGAGNKFDGKLTVFPGAEDGSIDFEACLSSQTLQALAQDAE  440

Query  272   FMEFV  258
             FM+ V
Sbjct  441   FMDSV  445



>ref|XP_007047327.1| HXXXD-type acyl-transferase family protein, putative [Theobroma 
cacao]
 gb|EOX91484.1| HXXXD-type acyl-transferase family protein, putative [Theobroma 
cacao]
Length=449

 Score =   285 bits (730),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 142/301 (47%), Positives = 193/301 (64%), Gaps = 3/301 (1%)
 Frame = -1

Query  1157  KGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQLSLPPVLDP  978
             +G S PLL VQVTEL DG FI  +MNH+  D +SFWHFFNSWSE+SRG   LS PP+   
Sbjct  151   EGTSKPLLAVQVTELVDGIFIACSMNHSVVDGTSFWHFFNSWSEVSRGSDHLSKPPIFQR  210

Query  977   WFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEMGTDSISS  798
              F   I  P+ +P  L    +   F PPPL+ RVFH +K  I K+K KAN+EM T+ ISS
Sbjct  211   QFLDGIDYPIRIPQTLYLH-IQDEFVPPPLQVRVFHLAKQDIVKIKTKANAEMNTNKISS  269

Query  797   LQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKLAKANAGE  618
             LQ+  +H W++I R R L+P ++  I++ IG R +    LPE Y+GNA+ S +    AGE
Sbjct  270   LQAVFSHFWQSIMRHRHLDPNQESIIFLVIGLRQKLQ-QLPEEYFGNAVQSAIVTLKAGE  328

Query  617   LLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIASSPRNNV  438
             LL++GLG AAWQ+++ V+    E+ + F ++WV SP + Q S++   N L  ASSPR ++
Sbjct  329   LLEKGLGNAAWQMNKTVANHTEEKFMNFLESWVNSPRLYQTSQM-MNNALLTASSPRFDI  387

Query  437   YATDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDIEVCLLPHTLHTLGNDQEFMEFV  258
             Y  DFGWG+P+A R G  +K  G  +   G+E+GS+ I VCL P T   L ND+EFM  +
Sbjct  388   YGNDFGWGRPIAERTGAGSKCGGVLAASCGVEEGSIQIRVCLSPETFQALENDEEFMAAL  447

Query  257   T  255
             T
Sbjct  448   T  448



>ref|XP_008778923.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Phoenix 
dactylifera]
Length=478

 Score =   285 bits (730),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 143/302 (47%), Positives = 196/302 (65%), Gaps = 5/302 (2%)
 Frame = -1

Query  1154  GISTPLLGVQVTEL-DDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQLSLP--PVL  984
             G+STPLL VQVTEL D G FIG ++NH  AD SSFWHFFNSW+ +SR   Q+S+P  P +
Sbjct  174   GLSTPLLAVQVTELADGGIFIGCSLNHAVADGSSFWHFFNSWAHLSRDRHQVSIPNPPTI  233

Query  983   DPWFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEMGTDSI  804
             D WF  +   P+ LPF  + +++    + PP+ E   HFS  +IAKLK +AN+EMGTD I
Sbjct  234   DRWFLDSCPPPIRLPFADRLDSIQR-ISFPPVRECALHFSARSIAKLKARANTEMGTDRI  292

Query  803   SSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKLAKANA  624
             SSLQ+ + HLWR++ RARRL+PT++ +  V +G R R  P LP  Y GNAI    AK+ A
Sbjct  293   SSLQALLGHLWRSVARARRLDPTQETTYSVLVGCRSRLGPSLPATYLGNAIMIARAKSTA  352

Query  623   GELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIASSPRN  444
             GEL + G GWAAW ++  V+        ++ ++W K P + +       + +   SSPR 
Sbjct  353   GELSEHGPGWAAWLLNRAVASCGEAATRDWLESWAKEPSLVRMDHFNHCDLV-TGSSPRF  411

Query  443   NVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDIEVCLLPHTLHTLGNDQEFME  264
             ++Y  DFGWG+P AVR G+ NK DGK +++PG + GS+ +EVCL P  L +L  DQEFM+
Sbjct  412   DIYGNDFGWGRPAAVRSGVGNKVDGKATIYPGPDPGSMALEVCLSPQALSSLLQDQEFMQ  471

Query  263   FV  258
              V
Sbjct  472   AV  473



>ref|XP_004509127.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Cicer 
arietinum]
Length=451

 Score =   283 bits (725),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 145/306 (47%), Positives = 196/306 (64%), Gaps = 6/306 (2%)
 Frame = -1

Query  1157  KGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQLSLPPVLDP  978
             +G S PLL +QVTEL DG FIG+++NH   D +S WHF NSW+EISRG  Q S  P L+ 
Sbjct  146   EGTSKPLLAIQVTELVDGIFIGVSINHVVVDGNSLWHFINSWAEISRGFHQPSKLPTLNR  205

Query  977   WF-PGNIARPLCLPF--DLQQ--ETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEMGT  813
             WF  G I  P+   F  D +Q  E  +S F P    ER+FHF+K+ IAKLK KAN E  T
Sbjct  206   WFYDGTIETPIKFSFAKDEKQNIEIENSGFVPELPRERIFHFTKEKIAKLKSKANEEANT  265

Query  812   DSISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKLAK  633
             + ISSLQ+ + HLW+A+ R + ++P E++   +PIG R RT PPLPE Y+GNA+   + K
Sbjct  266   NKISSLQALLTHLWQAMIRCQNIDPEEEIMYSLPIGVRGRTVPPLPENYFGNALEVGVVK  325

Query  632   ANAGELL-KRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIAS  456
               A ELL + G G  A ++++V+     + V   Y+ WVK+PV+ Q   +     L  +S
Sbjct  326   VKAKELLVEGGFGKVALEMNKVIGSHCGDNVKRNYECWVKNPVLLQSGALSSVKALATSS  385

Query  455   SPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDIEVCLLPHTLHTLGNDQ  276
             SPR +VY  DFGWGKPVAVR G  N++DG  +LF GLE+GS+D+EVCL  H L  +GN  
Sbjct  386   SPRFDVYGNDFGWGKPVAVRGGGGNRSDGTITLFSGLEEGSIDVEVCLSYHILEAMGNLP  445

Query  275   EFMEFV  258
             +F+  +
Sbjct  446   QFIHVL  451



>ref|XP_011071710.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Sesamum 
indicum]
Length=416

 Score =   282 bits (722),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 146/308 (47%), Positives = 194/308 (63%), Gaps = 36/308 (12%)
 Frame = -1

Query  1157  KGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQLSLPPVLDP  978
             +G+S PL+ VQVTEL DG+FIG   NH   D +SFWHF N+WSEISRG+  +   PV + 
Sbjct  137   EGVSMPLVAVQVTELVDGFFIGCTANHAVIDGTSFWHFINTWSEISRGLETILKTPVFER  196

Query  977   WFPGNIARP-LCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEMGTDSIS  801
             WFP NI+     +P     ++L  SF PPPL ERVFHFS++++AKLK KAN+E GTD IS
Sbjct  197   WFPTNISNDNRLIPLPPLDKSLLQSFVPPPLVERVFHFSRESVAKLKAKANAEAGTDKIS  256

Query  800   SLQSYVAHLWRAITRAR------RLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKL  639
             SLQ+  AHLWR++ R R      ++N +++V +   +GTR R   PLP+ Y+GNA+H   
Sbjct  257   SLQALSAHLWRSVIRCRNQLSIQKVN-SQEVDLVFVVGTRSRI--PLPDSYFGNAVHIVK  313

Query  638   AKANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIA  459
               AN GELL+ GLG+AA +++E+V                     AQ+S + + N     
Sbjct  314   TVANEGELLENGLGYAALKVNELV---------------------AQQSLILWKN-----  347

Query  458   SSPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDIEVCLLPHTLHTLGND  279
              SPR+NVY+ DFGWGKP+AVR G   K DGK +LFP  E G +D+E CL P TL  +  D
Sbjct  348   GSPRHNVYSADFGWGKPIAVRSGKGQKGDGKMTLFPAAEPGGIDVEACLAPATLKVMEAD  407

Query  278   QEFMEFVT  255
              EFM+ VT
Sbjct  408   AEFMDAVT  415



>ref|XP_007203667.1| hypothetical protein PRUPE_ppa026934mg, partial [Prunus persica]
 gb|EMJ04866.1| hypothetical protein PRUPE_ppa026934mg, partial [Prunus persica]
Length=443

 Score =   283 bits (723),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 146/306 (48%), Positives = 200/306 (65%), Gaps = 11/306 (4%)
 Frame = -1

Query  1157  KGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISR-GMPQLSLPPVLD  981
             +GIS PLL VQVTEL DG FIG ++NH   D +SFWHFFN+WSEIS  G   +S PP   
Sbjct  141   EGISKPLLAVQVTELVDGIFIGCSINHAVVDGTSFWHFFNTWSEISSAGCNNISQPP---  197

Query  980   PWFPGN-----IARPLCLPFDLQQETLS-SSFTPPPLEERVFHFSKDTIAKLKEKANSEM  819
             P+F        I  P+ LPF   + T      +   L+  +FHFSK  +A+LK KAN+E+
Sbjct  198   PFFGRQFLDSVIDLPVQLPFSYGEITRKLVRRSSESLQRVLFHFSKQKVAELKSKANAEI  257

Query  818   GTDSISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKL  639
             G ++ISSLQ+ +AHLWRA TR+R LNP +++   V +G R R  PPLPE Y GNA+ + L
Sbjct  258   GINNISSLQALMAHLWRAATRSRNLNPDQEIIYRVMVGLRQRLKPPLPEEYLGNAVKAVL  317

Query  638   AKANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPV-IAQKSKVFFANFLGI  462
              K+ AGELL  GLGWAA QI E ++    +E  +  + WVK+P+ ++  S +  ++ L  
Sbjct  318   VKSTAGELLHHGLGWAALQIKEQIASLTADEARKSLEEWVKTPIFVSNISNISTSSALLT  377

Query  461   ASSPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDIEVCLLPHTLHTLGN  282
              SSPR NV+  DFGWG+P+AVR G  +K +G+ ++FPG E+GS+D+E CL P  L  + +
Sbjct  378   GSSPRFNVFGNDFGWGRPLAVRSGAADKTNGRLTVFPGAEEGSIDVEACLFPEALQAMKD  437

Query  281   DQEFME  264
             D+EFME
Sbjct  438   DKEFME  443



>ref|XP_008241494.1| PREDICTED: uncharacterized acetyltransferase At3g50280 [Prunus 
mume]
Length=338

 Score =   278 bits (712),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 157/322 (49%), Positives = 196/322 (61%), Gaps = 29/322 (9%)
 Frame = -1

Query  1157  KGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISR--GMPQLSLP-PV  987
             +GIS PLL  QVTEL DG FI  ++NH AAD +SFWHFFN+WSEISR  G  ++  P PV
Sbjct  22    EGISKPLLAAQVTELVDGIFIACSINHMAADGTSFWHFFNTWSEISRLGGYDKIYKPHPV  81

Query  986   LDPWF-PGNIARPLCLPFDLQQETLSSSF------TPPPLEERVFHFSKDTIAKLKEKAN  828
             L   F  G I  P+ LP     E  S         +   L   VFHF K+ +A LK KAN
Sbjct  82    LGRQFHEGVIDLPIHLPSSYVNEIKSKQLIIGHGSSADSLRRVVFHFPKEKVAWLKSKAN  141

Query  827   SEMGTD----SISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWG  660
             +EMGT     SISSLQ+ +AHLWRAITR R LNP ++V+  V +G R R NPPLP+ Y G
Sbjct  142   AEMGTIDSNISISSLQALMAHLWRAITRGRHLNPDQEVAYRVAVGLRQRLNPPLPKEYLG  201

Query  659   NAIHSKLAKANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFF  480
             NA+   + K  AGELL+ GLGWAA QI++ ++    EE  ++ ++WVK+P        F 
Sbjct  202   NALLGVIVKCTAGELLEHGLGWAASQINKTIASLTAEEARKYMEDWVKAP-------TFL  254

Query  479   ANFLG--------IASSPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDI  324
             +N L           SSPR NVY  DFGWG PVAVR G+  +  GK ++FPG E GS+D 
Sbjct  255   SNVLREPTNVELITGSSPRFNVYGNDFGWGSPVAVRSGIPERKLGKLTVFPGPEDGSIDF  314

Query  323   EVCLLPHTLHTLGNDQEFMEFV  258
             E CLL  TL  + +D EFME V
Sbjct  315   EACLLTETLRAMADDAEFMEAV  336



>ref|XP_009349545.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Pyrus 
x bretschneideri]
Length=458

 Score =   281 bits (720),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 148/315 (47%), Positives = 200/315 (63%), Gaps = 15/315 (5%)
 Frame = -1

Query  1157  KGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMP--QLSLP-PV  987
             +G++ PLL VQVTEL DG FIG ++NH   D +SFWHFFN+WSEISR  P  ++S P PV
Sbjct  142   EGVTKPLLAVQVTELVDGIFIGCSINHMVVDGTSFWHFFNTWSEISRVEPSGKISQPRPV  201

Query  986   LDPWF-PGNIARPLCLPFDLQQETLSS-------SFTPPPLEERVFHFSKDTIAKLKEKA  831
                 F  G I  P+ LPF   QE ++        S +    +  VFHF K+ +A+LK KA
Sbjct  202   FARQFHDGLIDLPIQLPFSYVQEIMTKKSVIGHGSSSLNSSQRVVFHFPKEKVAELKSKA  261

Query  830   NSEMGT---DSISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWG  660
             N EMGT   ++ISSLQ+ +AHLWRA+TRAR LNP ++V   + +G R R  PPLP+ Y G
Sbjct  262   NVEMGTTDNNTISSLQALMAHLWRAVTRARNLNPDQEVRYLIAVGLRQRMEPPLPKEYLG  321

Query  659   NAIHSKLAKANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFF  480
             NA+   L K  AGEL++ GLGWAA++I+E +     EEV ++ ++WVK+P      ++  
Sbjct  322   NAVLGVLVKCTAGELVQHGLGWAAFRINEKIGSLKAEEVRKYKEDWVKAPTFLPNLQMDP  381

Query  479   ANF-LGIASSPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDIEVCLLPH  303
                 L   SSPR NVY  DFGWG+PVAVR G+  +  G  +++PG E+GS+D E CL P 
Sbjct  382   ETLDLCTGSSPRYNVYGNDFGWGRPVAVRSGIQERKVGSLTVYPGAEEGSIDFEACLWPE  441

Query  302   TLHTLGNDQEFMEFV  258
             TL  +  D EFM+ +
Sbjct  442   TLRAMAEDVEFMQAI  456



>ref|XP_003549969.1| PREDICTED: uncharacterized acetyltransferase At3g50280 [Glycine 
max]
 gb|KHN01667.1| Putative acetyltransferase [Glycine soja]
Length=443

 Score =   280 bits (717),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 142/309 (46%), Positives = 194/309 (63%), Gaps = 5/309 (2%)
 Frame = -1

Query  1163  SRKGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQLSLPPVL  984
             + +G S P+L VQVTEL DG FI   +NH  AD  SFWHF NSW+EISRG+P++S  P  
Sbjct  135   NHEGTSQPVLAVQVTELLDGVFIAFTINHVVADGKSFWHFVNSWAEISRGIPKISKIPFF  194

Query  983   DPWFPGNIARPLCLPFDLQQET----LSSSFTPPPLEERVFHFSKDTIAKLKEKANSEMG  816
             + +FP  I R +  PF   +E      S +  P  L ERVFHF+K  I++LK KAN+E  
Sbjct  195   ERFFPVGIDRAIRFPFTKVEEKEEGEHSQNLEPKTLSERVFHFTKRKISELKSKANAEAN  254

Query  815   TDSISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKLA  636
             TD ISSLQ+ +  LWRA++R + + P E+V   + IG R R  PPL   Y+GNA     A
Sbjct  255   TDKISSLQAVLTLLWRAVSRCKHMGPQEEVHFVLLIGARPRLIPPLANDYFGNAALVGRA  314

Query  635   KANAGELLKRG-LGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIA  459
                A ELL+ G  G  A +I++V+S   HE+V  +Y++WV++P +    ++  +N L  +
Sbjct  315   TMKAEELLQEGGFGMGASEINKVISSHSHEKVRSYYESWVRTPRLFAIGRLANSNSLATS  374

Query  458   SSPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDIEVCLLPHTLHTLGND  279
              SPR NVY  DFGWGKP+ VR G  NK+ GK +LF G E+GS+DIEVCL    L  +GND
Sbjct  375   GSPRFNVYGNDFGWGKPLTVRSGGANKSSGKITLFGGAEEGSMDIEVCLPYVILEAIGND  434

Query  278   QEFMEFVTH  252
              E M+ +++
Sbjct  435   SELMDAISN  443



>ref|XP_008352605.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized acetyltransferase 
At3g50280-like [Malus domestica]
Length=460

 Score =   281 bits (718),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 148/310 (48%), Positives = 192/310 (62%), Gaps = 12/310 (4%)
 Frame = -1

Query  1157  KGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQLSLPPVLD-  981
             +G+S PL  VQVT+L DG FIG  MNH+  + SSFWHFFN+WS+ISR       PP+ D 
Sbjct  138   EGVSKPLXAVQVTKLVDGIFIGCTMNHSVVEGSSFWHFFNTWSKISRSGKNSEPPPIFDR  197

Query  980   -PWFPGNIARPLCLPFDLQQETLSSSFTPP---PLEERVFHFSKDTIAKLKEKANSEMGT  813
                  G    P+ +PF      +S   T P      +RVFHFSK+ IA LK KAN+EMGT
Sbjct  198   XQLLDGLFHLPIPMPF--SHSGISDKVTRPISLNSLQRVFHFSKEKIAHLKSKANAEMGT  255

Query  812   DSISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKLAK  633
             ++ISSLQ+ +AH WRAITR   LNP + +S  V +G R +  PPLP+   GNA+     K
Sbjct  256   NNISSLQALMAHHWRAITRCGHLNPDQVISYRVAVGLRQKLKPPLPKECLGNALQGVSVK  315

Query  632   ANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFAN-----FL  468
             + A ELL+ GLGWAA  I++ ++    EEV +  ++WV +P+I    +           L
Sbjct  316   STACELLQHGLGWAALHINKTIASLTAEEVKKTLKDWVNAPLILSNMRSNIPTSTSTVSL  375

Query  467   GIASSPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDIEVCLLPHTLHTL  288
              I SSP+ NVY  DFG G+PVAVR G  NK +GK ++FPG E+GS+D EVCLLP TLH +
Sbjct  376   LIGSSPQFNVYGNDFGLGRPVAVRSGAANKMNGKIAVFPGAEEGSIDFEVCLLPETLHAM  435

Query  287   GNDQEFMEFV  258
               D EFME V
Sbjct  436   AEDAEFMEAV  445



>ref|XP_007136703.1| hypothetical protein PHAVU_009G066800g [Phaseolus vulgaris]
 gb|ESW08697.1| hypothetical protein PHAVU_009G066800g [Phaseolus vulgaris]
Length=463

 Score =   280 bits (715),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 145/311 (47%), Positives = 199/311 (64%), Gaps = 12/311 (4%)
 Frame = -1

Query  1154  GISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQ---------L  1002
             G + PLL +QVTEL DG FIG +MNH+  D +S+W+FFN+WS+I +   Q         +
Sbjct  147   GHTMPLLSIQVTELVDGVFIGCSMNHSLGDGTSYWNFFNTWSQIFQAQSQAERCEYDVPI  206

Query  1001  SLPPVLDPWFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSE  822
             S  P+ + WFP N   P+ LPF   +E +  S     L ERVFHFS ++IAKLK KANSE
Sbjct  207   SRQPIHNRWFPNNCRPPISLPFKHHEEFIERSEKTTLLRERVFHFSAESIAKLKAKANSE  266

Query  821   MGTDSISSLQSYVAHLWRAITRARRLNPTEDVSI-YVPIGTRWRTNPPLPEGYWGNAIHS  645
               T  ISS QS  A +WR+ITRAR   P++ ++I  +   +R R  PPLPE Y+GN IH+
Sbjct  267   SNTTQISSFQSLSALVWRSITRARS-PPSDQITICRLAANSRSRMEPPLPEEYFGNCIHA  325

Query  644   KLAKANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLG  465
               A+   GELL+  LGWAAW++H  V+   +  V+++ Q W++SP+I Q  + F    + 
Sbjct  326   VSAETTKGELLENDLGWAAWKLHMAVANLSNRVVLQYLQEWLESPLIYQMGRFFDPYCVM  385

Query  464   IASSPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLE-KGSVDIEVCLLPHTLHTL  288
             + SSPR N+Y ++FG GK VA R G  NK DGK S +PG E  GS+D+EVCLLPH++  L
Sbjct  386   MGSSPRFNMYGSEFGMGKAVAARSGHANKFDGKVSSYPGREGGGSIDLEVCLLPHSMSAL  445

Query  287   GNDQEFMEFVT  255
              +D+EFM  V+
Sbjct  446   ESDKEFMNAVS  456



>ref|XP_007021469.1| HXXXD-type acyl-transferase family protein, putative [Theobroma 
cacao]
 gb|EOY12994.1| HXXXD-type acyl-transferase family protein, putative [Theobroma 
cacao]
Length=442

 Score =   278 bits (712),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 132/298 (44%), Positives = 190/298 (64%), Gaps = 4/298 (1%)
 Frame = -1

Query  1148  STPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQLSLPPVLDPWFP  969
             S PLL +QVTEL DG FI    NH   D +SF HFFN W+EISRG  +L+ PP L  WFP
Sbjct  144   SKPLLAIQVTELADGIFISCTYNHVVVDGTSFVHFFNCWAEISRGSIELAKPPALQRWFP  203

Query  968   GNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEMGTDSISSLQS  789
               I  P+ +P      T    F PP L+ R FHF+K +IA LK KAN+E+GTD ISSLQ+
Sbjct  204   NGIEGPVGIPNSYL--TYGHDFIPPCLQVRFFHFTKASIANLKAKANAEVGTDKISSLQA  261

Query  788   YVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKLAKANAGELLK  609
              ++H+WR + R + L+P E+ + ++P+  + R    L + Y GNA+  K+      +LL+
Sbjct  262   LLSHIWRTVIRCKNLDPVEETNFFLPVSAKSRLYQ-LSQQYIGNAMQGKVITMKVKDLLE  320

Query  608   RGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKV-FFANFLGIASSPRNNVYA  432
             +GLG AAW+I++ ++ Q  E++  F ++W +SP++         +N L +  SPR + Y+
Sbjct  321   KGLGNAAWEINKSIASQSEEKMTTFLESWKESPLLLTAGLASTVSNLLVLGGSPRFDYYS  380

Query  431   TDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDIEVCLLPHTLHTLGNDQEFMEFV  258
              DFGWG+P+A+R G+ NK DGK +++ GLE+GS+DIE C +P TL  L N +EFM  V
Sbjct  381   VDFGWGRPIAIRSGVGNKHDGKITVYGGLEEGSMDIEACFIPETLQALANCKEFMNSV  438



>ref|XP_004230695.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Solanum 
lycopersicum]
Length=470

 Score =   279 bits (714),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 139/305 (46%), Positives = 194/305 (64%), Gaps = 6/305 (2%)
 Frame = -1

Query  1157  KGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQLSLPPVLDP  978
             +  S P L VQVTEL DG FIG + NH   D SS+WHF+NSW+EISRG   +S  P L  
Sbjct  154   EATSQPFLAVQVTELVDGVFIGCSANHALVDGSSYWHFYNSWAEISRGCNVISKIPYLKR  213

Query  977   WFP---GNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEMGTDS  807
              FP    + +  + +P   ++      FTPP L E+ FHFS++ ++KLK KAN +M T  
Sbjct  214   KFPFKMDHFSDRIYIPN--ERINAGDKFTPPALREKAFHFSRENVSKLKAKANHQMNTTK  271

Query  806   ISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKLAKAN  627
             ISSLQ+ +AHLW+++ R RRL+ +E+ +  V I  R R NPPLPEG++GNAI+       
Sbjct  272   ISSLQAVLAHLWQSVIRCRRLDHSEETTFEVSIDMRKRLNPPLPEGFFGNAIYPAPTTIK  331

Query  626   AGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIASSPR  447
              GELLK G GWAA QI++ ++  DHE++   Y+NW+K P + +   +  +N+  +  SP+
Sbjct  332   TGELLKHGFGWAALQINKTIATHDHEKLKCIYENWMKEPEVPKLGDL-PSNYFMLNGSPQ  390

Query  446   NNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDIEVCLLPHTLHTLGNDQEFM  267
              NVY  DFGWGKP+A R G+ N  DGK ++ PGLE+GS+ +E+CL   T+  L  D  F 
Sbjct  391   FNVYKYDFGWGKPIAHRGGVGNLLDGKITVAPGLEEGSMIVEICLSSETIQALEEDIIFG  450

Query  266   EFVTH  252
             EFV +
Sbjct  451   EFVNN  455



>ref|XP_007203377.1| hypothetical protein PRUPE_ppa025976mg [Prunus persica]
 gb|EMJ04576.1| hypothetical protein PRUPE_ppa025976mg [Prunus persica]
Length=438

 Score =   278 bits (711),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 150/312 (48%), Positives = 192/312 (62%), Gaps = 27/312 (9%)
 Frame = -1

Query  1157  KGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQLSLPPVLDP  978
             +GIS PLL  QVTEL DG FIG ++NHTAAD +SFWHFFN+WSEISR    + LP  L  
Sbjct  140   EGISKPLLAAQVTELVDGIFIGCSINHTAADGTSFWHFFNTWSEISRLGGVIDLPIHLPS  199

Query  977   WFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEMGTD----  810
              +   I          +Q  +    +   L+  VFHF K+ +A LK KAN+EMGT     
Sbjct  200   SYVNEIKS--------KQLIIGHGSSSDSLQRVVFHFPKEKVAWLKSKANAEMGTIDSNI  251

Query  809   SISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKLAKA  630
             SISSLQ+ +AHLWRAITR R LNP ++V+  V +G R R NP LP+ Y GNA+   + K 
Sbjct  252   SISSLQALMAHLWRAITRGRHLNPDQEVAYRVAVGLRQRLNPRLPKEYLGNALLGVIVKC  311

Query  629   NAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLG-----  465
              AGELL+ GLGWAA QI++ ++    EE  ++ ++WVK+P        F +N LG     
Sbjct  312   TAGELLEHGLGWAASQINKTIASLTAEEARKYMEDWVKAP-------TFLSNMLGEPTNV  364

Query  464   ---IASSPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDIEVCLLPHTLH  294
                  SSPR NVY  DFGWG PVAVR G+  +  GK ++FPG E GS+D E CLL  TL 
Sbjct  365   ELVTGSSPRFNVYGNDFGWGSPVAVRSGIPERKLGKLTVFPGPEDGSIDFEACLLTETLR  424

Query  293   TLGNDQEFMEFV  258
              + +D EFM+ V
Sbjct  425   AMADDAEFMKAV  436



>ref|XP_007136702.1| hypothetical protein PHAVU_009G066700g [Phaseolus vulgaris]
 gb|ESW08696.1| hypothetical protein PHAVU_009G066700g [Phaseolus vulgaris]
Length=462

 Score =   279 bits (713),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 145/314 (46%), Positives = 199/314 (63%), Gaps = 12/314 (4%)
 Frame = -1

Query  1163  SRKGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQ-------  1005
             +  G + PLL +QVTEL DG FIG +MNH+  D +S+W+FFN+WS+I +   Q       
Sbjct  143   NHDGHTMPLLSIQVTELVDGVFIGCSMNHSLGDGTSYWNFFNTWSQIFQAQSQAESHEYD  202

Query  1004  --LSLPPVLDPWFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKA  831
               +S  P+ + WFP N + P+ LPF    E +      P   ER+FHFS ++IA LK KA
Sbjct  203   VPISHQPLHNRWFPNNCSPPISLPFKHHDEFIGRPEETPLPRERIFHFSAESIAALKAKA  262

Query  830   NSEMGTDSISSLQSYVAHLWRAITRARRLNPTEDVSI-YVPIGTRWRTNPPLPEGYWGNA  654
             NSE  T  ISS QS  A +WR+ITRAR   P++ ++I  +    R R  PPLPE Y+GN 
Sbjct  263   NSESNTTRISSFQSLSALVWRSITRARS-PPSDQITICRLAANNRSRMEPPLPEEYFGNC  321

Query  653   IHSKLAKANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFAN  474
             IH+  A+   GELL+ GLGWAAW++H+ V+  +   V+EF + W++SP+I Q  + F   
Sbjct  322   IHAVSAETTTGELLENGLGWAAWKLHKAVTNLNDRVVLEFLEGWLESPLIVQMGRFFDPY  381

Query  473   FLGIASSPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLE-KGSVDIEVCLLPHTL  297
              + + SSPR N+Y ++FG GK VA R G  NK DGK S +PG E  GS+D+EVCLLPHT+
Sbjct  382   SVLMGSSPRFNMYGSEFGMGKAVAARSGYANKFDGKVSSYPGREGGGSIDLEVCLLPHTM  441

Query  296   HTLGNDQEFMEFVT  255
               L +D+EFM  V+
Sbjct  442   SALESDKEFMNAVS  455



>emb|CDP11972.1| unnamed protein product [Coffea canephora]
Length=455

 Score =   278 bits (711),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 144/308 (47%), Positives = 194/308 (63%), Gaps = 6/308 (2%)
 Frame = -1

Query  1163  SRKGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQ---LSLP  993
             +  G + PLL +QVTEL DG FIG ++NH   D ++FWHFFN+WSEI     Q   +S P
Sbjct  143   NHDGHTRPLLTIQVTELTDGIFIGCSINHMIVDGTAFWHFFNTWSEIFSAKGQKTAISRP  202

Query  992   PVLDPWFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEMG-  816
             P+   WFP      L LPF    +        P + ERVFHFS +++AKLK KAN+E   
Sbjct  203   PIHKHWFPEGHGPILSLPFT-HHDQFVRRHEAPQMRERVFHFSSESLAKLKAKANAESSH  261

Query  815   TDSISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKLA  636
             T  ISSLQ+  AH+WR ITR R  +P ++ S  + I  R R +PP+P+ Y GN I +  A
Sbjct  262   TTKISSLQALSAHVWRCITRTRNFSPDQETSCRLAINNRTRLHPPVPQEYVGNCIQTVRA  321

Query  635   KANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIAS  456
              A AGELL RGLGW+AW++H  V     E V ++ ++W++S  I Q ++ F    + + S
Sbjct  322   AAAAGELLDRGLGWSAWKLHLAVHNHTDEIVRDWVESWLQSRFIYQLAQFFDPCSIMMGS  381

Query  455   SPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLE-KGSVDIEVCLLPHTLHTLGND  279
             SPR N+Y  +FG GK VA+R G  NK DGK SL+PG+E  GS+D+E+CLLPH +  L +D
Sbjct  382   SPRFNMYGNEFGLGKAVAIRSGYANKFDGKVSLYPGIEGGGSMDLEICLLPHYMSLLESD  441

Query  278   QEFMEFVT  255
             +EFME VT
Sbjct  442   EEFMETVT  449



>gb|KHN18660.1| Putative acetyltransferase [Glycine soja]
Length=441

 Score =   278 bits (710),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 139/308 (45%), Positives = 198/308 (64%), Gaps = 5/308 (2%)
 Frame = -1

Query  1163  SRKGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQLSLPPVL  984
             + +G S PLL VQVTEL DG F+ + +NH  AD  SFWHF NSW+EISRG+P++S  P  
Sbjct  135   NHEGTSQPLLAVQVTELVDGIFVAVTINHIVADGKSFWHFVNSWAEISRGIPKISKIPFF  194

Query  983   DPWFPGNIARPLCLPFDLQQET----LSSSFTPPPLEERVFHFSKDTIAKLKEKANSEMG  816
             + +FP  I R +  PF   +E      S +  P  L ERVFHF+K  I++LK KAN+E  
Sbjct  195   ERFFPVGIDRAIRFPFTKVEEKEEGEHSQNLEPKTLSERVFHFTKRKISELKSKANAEAN  254

Query  815   TDSISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKLA  636
             TD ISSLQ+ +  LWRA++R + + P E+V   + IG R R  PPL E Y+GNAI +   
Sbjct  255   TDKISSLQAVLTLLWRAVSRCKHMGPQEEVHFVLLIGVRARMIPPLEEDYFGNAILAGRV  314

Query  635   KANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIAS  456
                AGELL+ GLG  A +I++++S+  HE+V   Y++  ++P+++    +  AN L I+S
Sbjct  315   TMKAGELLEGGLGKGALEINKMISLHSHEKVKNHYESLARTPMLSTPG-IGAANSLMISS  373

Query  455   SPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDIEVCLLPHTLHTLGNDQ  276
             SPR ++Y  DFGWGKPVAVR G  N  +GK ++F G ++ S+DI V L    L  +GND 
Sbjct  374   SPRFDIYGNDFGWGKPVAVRSGDANIGNGKVTVFAGSKEDSIDIHVSLPYEILEAMGNDP  433

Query  275   EFMEFVTH  252
             EF++ +++
Sbjct  434   EFVDAISY  441



>gb|KJB43780.1| hypothetical protein B456_007G215400 [Gossypium raimondii]
Length=411

 Score =   276 bits (707),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 133/302 (44%), Positives = 189/302 (63%), Gaps = 5/302 (2%)
 Frame = -1

Query  1157  KGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQLSLPPVLDP  978
             KGI+ PLLG+Q+T+L DG FIG ++NH  AD +SFWHF NSWS IS+G   LS PPV   
Sbjct  113   KGITHPLLGIQITDLADGIFIGCSINHVVADGASFWHFLNSWSGISKGSIYLSKPPVFQR  172

Query  977   WFPGNIARPLCLPFD-LQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEMGTDSIS  801
             WFP  +  P+ +P   +  E  +  F  PP+ ER+FHFSK+ I KLK KAN+EMGT+ IS
Sbjct  173   WFPDGMDIPIRIPQSCVNVEQNNEDFILPPVRERIFHFSKENITKLKAKANAEMGTEKIS  232

Query  800   SLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKLAKANAG  621
             SLQ+ ++H+WR+    R  +P ++ +    +G R R    +P+ Y+GNAI        A 
Sbjct  233   SLQALLSHIWRSAIHNRSFDPDQETNYRFVVGARQRFQ-EIPDNYFGNAILGTFVTMKAK  291

Query  620   ELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIASSPRNN  441
             EL+++G+G ++W+++ +++    E   + ++ W  SP     S     + L  +SSPR  
Sbjct  292   ELVEQGIGNSSWRMNRIIAATTGEGFKKVFECWPASPSFVTLSN---GDALITSSSPRFK  348

Query  440   VYATDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDIEVCLLPHTLHTLGNDQEFMEF  261
             +Y  DFGWGKP+A+R G  NK DG  +L+ G E+GS+DIE C  P TL  + NDQEFM  
Sbjct  349   MYGNDFGWGKPIAIRSGSSNKFDGMLTLYCGAEEGSIDIEACFFPETLEAMANDQEFMHI  408

Query  260   VT  255
             VT
Sbjct  409   VT  410



>ref|XP_008241486.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Prunus 
mume]
Length=446

 Score =   277 bits (709),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 144/305 (47%), Positives = 196/305 (64%), Gaps = 9/305 (3%)
 Frame = -1

Query  1157  KGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISR--GMPQLSLPPVL  984
             + +S PLL VQVTEL DG FIG  +NH   D S FW FFN+WSEISR  G  ++S PP++
Sbjct  145   ESVSNPLLAVQVTELVDGIFIGCTVNHCVVDGSIFWRFFNTWSEISRDHGFGKISQPPLI  204

Query  983   --DPWFPGNIARPLCLPFDLQQETLSSSFTPP-PLEERVFHFSKDTIAKLKEKANSEMGT  813
                 +  G I  P+ +PF   Q  +   F PP  L++R+FHF K+ +A+LK KAN+EMGT
Sbjct  205   FGREFLDGIIDLPVRIPFFHNQ--IPEKFLPPGSLQQRMFHFPKEKLAQLKAKANAEMGT  262

Query  812   DSISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKLAK  633
               ISSLQ+ +AHLW +ITR +RL+P ++    + +G R R  P LPE Y GNA+      
Sbjct  263   TKISSLQALLAHLWVSITRNKRLSPDQETKYLLLVGLRQRFQP-LPEEYLGNAVLLGTVT  321

Query  632   ANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIASS  453
             +  G+LLK+GLGWAA +++++++ +  +EV +  + WVKSP ++ K      N L   SS
Sbjct  322   STVGDLLKQGLGWAALEMNKMIASKTEQEVRKHLEEWVKSPKLS-KMGTLSVNSLATGSS  380

Query  452   PRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDIEVCLLPHTLHTLGNDQE  273
             PR NV+  DFGWG+P+AVR G  NK DGK ++FPG E GS+D E CL   TL  L  D E
Sbjct  381   PRFNVFGNDFGWGRPLAVRSGAGNKFDGKLTVFPGTEDGSIDFEACLSSQTLQALAQDAE  440

Query  272   FMEFV  258
             FM+ V
Sbjct  441   FMDSV  445



>ref|XP_004288019.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Fragaria 
vesca subsp. vesca]
Length=449

 Score =   277 bits (709),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 148/308 (48%), Positives = 192/308 (62%), Gaps = 8/308 (3%)
 Frame = -1

Query  1157  KGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRG----MPQLSLPP  990
             +G S PLL VQVTEL DG FIG ++NH  AD +SFWHFFN+WS ISR         S P 
Sbjct  140   EGTSKPLLAVQVTELADGIFIGCSINHAVADGTSFWHFFNTWSLISRSGSDDTVSQSTPV  199

Query  989   VLDPWFPGNIARPLCLPFDLQQETLSSSFTPPP--LEERVFHFSKDTIAKLKEKANSEMG  816
                 +  G I  P+ +PF   Q         P   L +RVFHF K+ +A+LK KAN+EM 
Sbjct  200   FGRHFLDGLIDLPVRVPFSQIQIQRQLIQQTPSSNLLQRVFHFPKEKVAQLKAKANAEMS  259

Query  815   TDSISSLQSYVAHLWRAITRAR-RLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKL  639
             T +ISSLQ+ +AHLWRA TR R  L   E+++  + IG R +  PPLP+ Y GNA+    
Sbjct  260   TSNISSLQALMAHLWRATTRGRCDLKSNEEITYRIAIGLRQKMKPPLPDLYMGNALRGVS  319

Query  638   AKANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFA-NFLGI  462
               + A +LL+ GLGWAA +I++ +S    E+V    ++WVK+P I    +   + + L  
Sbjct  320   TYSTASDLLQHGLGWAALKINKAISAMRPEDVTRELEDWVKAPSIRPNLRAETSVHGLLT  379

Query  461   ASSPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDIEVCLLPHTLHTLGN  282
              SSPR NVY  DFGWG+PVAVR G  NK +GK ++FPG E+GS+D EVCLLP TLH + N
Sbjct  380   GSSPRFNVYGNDFGWGRPVAVRSGSANKMNGKLTVFPGAEEGSIDFEVCLLPETLHAMEN  439

Query  281   DQEFMEFV  258
             D EFME V
Sbjct  440   DAEFMEAV  447



>ref|XP_008361429.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Malus 
domestica]
Length=458

 Score =   277 bits (709),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 151/316 (48%), Positives = 197/316 (62%), Gaps = 18/316 (6%)
 Frame = -1

Query  1157  KGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMP--QLSLP-PV  987
             +G+  PLL VQVTEL DG FIG ++NH   D +S WHFFN+WSEISR  P  ++S P PV
Sbjct  143   EGVXKPLLAVQVTELVDGIFIGCSINHMVVDGTSXWHFFNTWSEISRVEPSGKISQPRPV  202

Query  986   LDPWF-PGNIARPLCLPFDLQQETL--------SSSFTPPPLEERVFHFSKDTIAKLKEK  834
                 F  G I  P+ LPF   QE +        SSS   P  +  VFHF K+ +A+LK K
Sbjct  203   FARQFHDGMIDLPIQLPFSYVQEIMTKKPVGHGSSSLNSP--QRVVFHFPKEKVAELKSK  260

Query  833   ANSEMGT---DSISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYW  663
             AN EMGT   ++ISSLQ+ +AHLWRA+TRAR LNP ++V   +  G R R  PPLP+ Y 
Sbjct  261   ANVEMGTMDNNTISSLQALMAHLWRAVTRARNLNPDQEVRYRIVAGLRQRMEPPLPKEYL  320

Query  662   GNAIHSKLAKANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVF  483
             GNA+   L K  AGEL + GLGWAA++I+E +     EEV +F ++WVK+P     S++ 
Sbjct  321   GNAVLGVLVKCTAGELAQHGLGWAAFRINEKIGALKAEEVRKFMEDWVKAPTFLPNSQMD  380

Query  482   FANF-LGIASSPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDIEVCLLP  306
                  L   SSPR NVY  DFGWG+P+AVR  +  +  G  S+FPG E+GS+D E CL P
Sbjct  381   PETLDLFTGSSPRFNVYGNDFGWGRPIAVRSRIQERWVGSLSVFPGAEEGSIDFEACLWP  440

Query  305   HTLHTLGNDQEFMEFV  258
              T+  +  D EFM+ +
Sbjct  441   ETVRAMAEDAEFMQAI  456



>ref|XP_010109793.1| putative acetyltransferase [Morus notabilis]
 gb|EXC24719.1| putative acetyltransferase [Morus notabilis]
Length=458

 Score =   277 bits (709),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 146/309 (47%), Positives = 195/309 (63%), Gaps = 15/309 (5%)
 Frame = -1

Query  1142  PLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISR-----GMPQLSLPPVLDP  978
             PLL VQVTE+ DG FI   MNH A D +SFWHFFN WSEISR      + + S P     
Sbjct  152   PLLAVQVTEVVDGIFIACTMNHCAGDGTSFWHFFNVWSEISRQSFDGSVSRCSRPVFGRE  211

Query  977   WFPGNIARPLCLPF--DLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEM-----  819
                G +  P+  PF  DL  + +    +PP L++R+F FSK  IA+LK KAN+EM     
Sbjct  212   RLDGFVNHPISFPFSRDLISK-VKREVSPPNLQQRMFRFSKAKIAELKAKANAEMEIITE  270

Query  818   -GTDSISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSK  642
                 +ISSLQ+ +AHLW ++TR RR++P E+V   V  G R R  PPLPEGY+G+A+ + 
Sbjct  271   SNEITISSLQALLAHLWISVTRNRRIDPDEEVGYKVAAGMRTRIQPPLPEGYFGSAVLAV  330

Query  641   LAKANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGI  462
             + K  A ELL+ GLGW+AW+I+  ++ Q   EV +F ++W +SP +    K + AN L  
Sbjct  331   MPKCTARELLENGLGWSAWKINRAIASQTATEVRKFLEDWAQSPTLPHIGK-YPANTLLT  389

Query  461   ASSPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDIEVCLLPHTLHTLGN  282
              SSPR +VY  DFGWG+P+AVR G   K DGK ++FPG E+GS++ EVCLL  TL +L  
Sbjct  390   GSSPRFDVYGNDFGWGRPIAVRSGPAAKFDGKLTVFPGAEEGSIEFEVCLLDETLESLAC  449

Query  281   DQEFMEFVT  255
             D EFM  V+
Sbjct  450   DAEFMASVS  458



>ref|XP_008352555.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Malus 
domestica]
Length=458

 Score =   276 bits (707),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 151/316 (48%), Positives = 196/316 (62%), Gaps = 18/316 (6%)
 Frame = -1

Query  1157  KGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMP--QLSLP-PV  987
             +G+  PLL VQVTEL DG FIG ++NH   D +S WHFFN+WSEISR  P  ++S P PV
Sbjct  143   EGVXKPLLAVQVTELVDGIFIGCSINHMVVDGTSXWHFFNTWSEISRVEPSGKISQPRPV  202

Query  986   LDPWF-PGNIARPLCLPFDLQQETL--------SSSFTPPPLEERVFHFSKDTIAKLKEK  834
                 F  G I  P+ LPF   QE +        SSS   P  +  VFHF K+ +A+LK K
Sbjct  203   FARQFHDGMIDLPIQLPFSYVQEIMTKKPVGHGSSSLNSP--QRVVFHFPKEKVAELKSK  260

Query  833   ANSEMGT---DSISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYW  663
             AN EMGT   ++ISSLQ+ +AHLWRA+TRAR LNP ++V   +  G R R  PPLP+ Y 
Sbjct  261   ANVEMGTXDNNTISSLQALMAHLWRAVTRARNLNPDQEVRYRIVAGLRQRMEPPLPKEYL  320

Query  662   GNAIHSKLAKANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVF  483
             GNA+   L K  AGEL + GLGWAA++I+E +     EEV +F ++WVK+P     S++ 
Sbjct  321   GNAVLGVLVKCTAGELAQHGLGWAAFRINEKIGALKAEEVRKFMEDWVKAPTFLPNSQMD  380

Query  482   FANF-LGIASSPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDIEVCLLP  306
                  L   SSPR NVY  DFGWG+P+AVR  +  +  G  S+FPG E+GS+D E CL P
Sbjct  381   PETLDLFTGSSPRFNVYGNDFGWGRPIAVRSRIQERWVGSLSVFPGAEEGSIDFEACLWP  440

Query  305   HTLHTLGNDQEFMEFV  258
              T   +  D EFM+ +
Sbjct  441   ETXRAMAEDAEFMQAI  456



>ref|XP_007204342.1| hypothetical protein PRUPE_ppa005630mg [Prunus persica]
 gb|EMJ05541.1| hypothetical protein PRUPE_ppa005630mg [Prunus persica]
Length=450

 Score =   275 bits (704),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 144/305 (47%), Positives = 195/305 (64%), Gaps = 7/305 (2%)
 Frame = -1

Query  1157  KGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISR-GMPQLSLP-PVL  984
             +GIS PLL VQVTEL DG+FIG ++NH   D +SFWHFFN+WSEISR G  ++S P PV 
Sbjct  141   EGISKPLLAVQVTELFDGFFIGCSINHMVVDGTSFWHFFNTWSEISRIGFDKISQPCPVF  200

Query  983   D--PWFPGNIARPLCLPF---DLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEM  819
                 +    I  P+ LP    +++ + L    +   L+  VFHF K+ +A+LK KAN+EM
Sbjct  201   GRREYHDSLIDLPIHLPMSYDEIRSKHLIIGPSSYSLQTVVFHFPKEKLAELKAKANAEM  260

Query  818   GTDSISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKL  639
               ++IS+LQ+ +AHLW A TR R LNP ++V+  + +G R +  PPLP+ Y+GN +    
Sbjct  261   VNNNISTLQALMAHLWLATTRCRHLNPNQEVTYLIAVGLRQKLKPPLPKEYFGNGVLGVN  320

Query  638   AKANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIA  459
              K++A ELL  GLGWAA QI++ ++    EE  ++ Q W K+P+   K        L   
Sbjct  321   VKSSASELLHHGLGWAASQINKTIASLTAEEARKYLQGWEKAPIFLPKFSDPKMVGLLTG  380

Query  458   SSPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDIEVCLLPHTLHTLGND  279
             SSPR NVY  DFGWG+PVAVR G  N  DGK ++FPG E+GSVD E CLLP T+  + +D
Sbjct  381   SSPRFNVYGNDFGWGRPVAVRSGAANNMDGKLTVFPGAEEGSVDFEACLLPETIQAMLDD  440

Query  278   QEFME  264
              EFME
Sbjct  441   AEFME  445



>emb|CDP06257.1| unnamed protein product [Coffea canephora]
Length=449

 Score =   275 bits (702),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 146/309 (47%), Positives = 194/309 (63%), Gaps = 8/309 (3%)
 Frame = -1

Query  1166  TSRKGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEI--SRG-MPQLSL  996
              +  G S  L+ +QVTEL DG FIG + NH   D +SFWHF N+WSE+  ++G +P +S 
Sbjct  143   VNHDGHSMSLMSIQVTELKDGIFIGWSTNHLLVDGTSFWHFINTWSEVFNAKGQIPTISR  202

Query  995   PPVLDPWFPGNIARPLC-LPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEM  819
             PP+L  WFP     P+  LPF    E +S  F  P L ER FHFS +++AKLK KAN+E 
Sbjct  203   PPILKRWFPEGHRSPVIGLPFTHHDEFISR-FQTPELLERYFHFSAESLAKLKAKANAEC  261

Query  818   GTDSISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKL  639
              + +IS+ Q+  A LWR ITRAR +   +  S    + +R R NPPL E Y+GN +    
Sbjct  262   NSTTISTFQALSALLWRCITRARNMPSDQQTSAGTSVNSRLRINPPLSEEYFGNCVQVVA  321

Query  638   AKANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIA  459
                  GELL  GLGWAAW++HE+V  Q    + E+ ++WVKSP I    +  F+N + I 
Sbjct  322   VTTTCGELLTNGLGWAAWKLHELVINQTDRSIREWVESWVKSPFIVWIGR--FSNRIQIG  379

Query  458   SSPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLE-KGSVDIEVCLLPHTLHTLGN  282
             SSPR NVY ++FG GK +AVR G  NK DGK +LFPG E  GS+D+EVCL P ++  L +
Sbjct  380   SSPRFNVYGSEFGLGKALAVRSGFANKPDGKITLFPGREGGGSMDVEVCLPPQSMSFLES  439

Query  281   DQEFMEFVT  255
             DQEFME V+
Sbjct  440   DQEFMENVS  448



>ref|XP_006480712.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Citrus 
sinensis]
Length=448

 Score =   274 bits (700),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 147/302 (49%), Positives = 194/302 (64%), Gaps = 6/302 (2%)
 Frame = -1

Query  1148  STPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQLSLPPVLDPWFP  969
             + PLLGVQVTEL DG FI   +NH+  D +SFWHFFNSWSEISRG   +S  PVL+  F 
Sbjct  149   AKPLLGVQVTELVDGIFIACTINHSVVDGTSFWHFFNSWSEISRGSDCISKLPVLERGFL  208

Query  968   GNIAR-PLCLPFDLQQETLSSSFTPPP-LEERVFHFSKDTIAKLKEKANSEMG-TDSISS  798
                   P+ LP  L     S + TPPP L +RVFHF+K+ IAKLK KAN+E+G T+ ISS
Sbjct  209   SESEYFPIRLP--LWSIEPSGTHTPPPNLRQRVFHFTKENIAKLKAKANAEIGSTNKISS  266

Query  797   LQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKLAKANAGE  618
             LQ+ ++ +WR+ TR R L+P E+V   + IG R R  PPLP  Y+GNA   +     A  
Sbjct  267   LQAILSQIWRSFTRNRSLDPDEEVLFMLGIGVRQRLQPPLPPEYFGNAAQGEFVSMKARY  326

Query  617   LLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIASS-PRNN  441
              L++GLG  A ++++ ++    E++  F ++W K+P I     +   N    ASS PR N
Sbjct  327   QLEQGLGNVALKMNKFIAAYTEEKIKNFLESWGKNPEILTWDSLPMKNNACFASSSPRFN  386

Query  440   VYATDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDIEVCLLPHTLHTLGNDQEFMEF  261
              Y  DFGWG+P+AVR G  NK DGK +LF G+E+GSVD+E C LP TL  +GND EFM+F
Sbjct  387   FYGNDFGWGRPMAVRSGPANKVDGKITLFAGVEEGSVDVEACFLPETLQGMGNDTEFMQF  446

Query  260   VT  255
             V+
Sbjct  447   VS  448



>ref|XP_010927209.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Elaeis 
guineensis]
Length=450

 Score =   274 bits (700),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 145/303 (48%), Positives = 199/303 (66%), Gaps = 8/303 (3%)
 Frame = -1

Query  1154  GISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISR-GMPQLSLPPVLDP  978
             G S PLL VQVTEL DG F+G A+NH  AD +SFWHF NSWSEISR G+PQ+S PP+LD 
Sbjct  151   GHSLPLLAVQVTELADGVFVGCALNHVVADGTSFWHFLNSWSEISRTGVPQISRPPMLDR  210

Query  977   WFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEMGTDSISS  798
             WF  + + P+ LP   ++E          L E  FHFS  TIAKLK +AN EM TD ISS
Sbjct  211   WFQESCSPPIHLPV-YKREDFIKVCPSSHLSEAFFHFSAQTIAKLKLRANMEMSTDRISS  269

Query  797   LQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGN-AIHSKLAKANAG  621
             LQ+ +A +WR++ RA+RL P E  S  V +  R R +PPLPE Y+G+ A+    + A+AG
Sbjct  270   LQALLAFVWRSVLRAQRLPPNEKTSYRVTVNYRPRLDPPLPEEYFGSTAMGVPTSTASAG  329

Query  620   ELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSP--VIAQKSKVFFANFLGIASSPR  447
              +L RGLGWAA  ++++V+ Q ++ +  + ++W ++P  +  +++KV     +   SSPR
Sbjct  330   AVLDRGLGWAASLLNQMVASQTNDMIRNWLESWTRNPTFLCVKEAKV---GTVVTGSSPR  386

Query  446   NNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDIEVCLLPHTLHTLGNDQEFM  267
              +VY  DFGWG+P+AVR G  NK +GK S+FPG E+GS  ++VCL    +  L  D+EFM
Sbjct  387   FDVYGNDFGWGRPIAVRSGAANKLNGKISVFPGSEEGSTALDVCLSSQAMRLLLQDKEFM  446

Query  266   EFV  258
             E V
Sbjct  447   ENV  449



>ref|XP_010317216.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like isoform 
X2 [Solanum lycopersicum]
Length=452

 Score =   274 bits (700),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 139/303 (46%), Positives = 190/303 (63%), Gaps = 7/303 (2%)
 Frame = -1

Query  1157  KGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQLSLPPVLDP  978
             +  S P LGVQVTEL DG FIG   NH+  D SSFWHFF SW+EISRG   +S  P L  
Sbjct  148   EATSKPFLGVQVTELVDGIFIGCTANHSLLDGSSFWHFFTSWAEISRGFNVISQIPFLKR  207

Query  977   WFP---GNIARPLCLPFDLQQETLSSSFT--PPPLEERVFHFSKDTIAKLKEKANSEMGT  813
              FP    N +  +C+P +       S+    PP L++++FHF+K++IAKLK KAN EM T
Sbjct  208   QFPFEIDNFSNRICIPNERINSNSDSTHEHDPPALQDKIFHFTKESIAKLKSKANLEMKT  267

Query  812   DSISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKLAK  633
               ISSLQ+ +AH+W++I R R L+  E+ +  VP+  R R NPPLPEG++GNAI+     
Sbjct  268   TKISSLQAVLAHVWQSIIRCRNLDHNEETTFEVPMDMRKRLNPPLPEGFFGNAIYPATIT  327

Query  632   ANAGELLKR-GLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIAS  456
               AG+LLK  G  WAA QI+E+++  DHE+    Y+NW+K P I +   +   N+  + +
Sbjct  328   VKAGDLLKDGGFEWAALQINEMIASHDHEKFKRIYENWMKDPEITKLGDL-PRNYFMLHN  386

Query  455   SPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDIEVCLLPHTLHTLGNDQ  276
             SPR N    DFGWGKP+A R GM N  +GK  + PG+E+GS+  E+CL P T+  L   +
Sbjct  387   SPRFNYNKYDFGWGKPIAQRGGMSNMLEGKIDVSPGIEEGSMIFEICLSPKTIQALEEHK  446

Query  275   EFM  267
              F+
Sbjct  447   MFV  449



>ref|XP_010924632.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Elaeis 
guineensis]
Length=449

 Score =   273 bits (699),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 138/300 (46%), Positives = 192/300 (64%), Gaps = 3/300 (1%)
 Frame = -1

Query  1154  GISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISR-GMPQLSLPPVLDP  978
             G S PLL VQVTEL DG F+G A+NH  AD +SFWHF NSWSEISR G+PQ+S PP+L+ 
Sbjct  151   GHSLPLLAVQVTELVDGVFVGCALNHVVADGTSFWHFLNSWSEISRTGVPQISRPPILNR  210

Query  977   WFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEMGTDSISS  798
             WF  + + P+ LP   ++E     +    L E  F F   TIAKLK +AN EM TD ISS
Sbjct  211   WFHESCSPPIHLPV-YKREDFIKIYPSSQLSEAFFRFPAQTIAKLKLRANMEMSTDRISS  269

Query  797   LQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKLAKANAGE  618
             LQ+ +A +WR++ RA++L P+E  +  + +  R R +PPLP GY+GN +      A+AGE
Sbjct  270   LQALLAFVWRSVLRAQKLPPSEKTTYRIAVNYRPRLDPPLPGGYFGNTVMGVPTTASAGE  329

Query  617   LLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIASSPRNNV  438
             +L RGLGWAA  ++++V  Q +  +  + ++W ++P+     +      +   SSPR +V
Sbjct  330   VLDRGLGWAASLLNQMVGSQSNNMIRNWLESWTRNPIFLYFKETRVGTVV-TGSSPRFDV  388

Query  437   YATDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDIEVCLLPHTLHTLGNDQEFMEFV  258
             Y  DFGWG+P+AVR G  NK DG  S+FPG E+GS+ ++VCL    +  L  D+EFME V
Sbjct  389   YGNDFGWGRPIAVRSGGSNKVDGTISVFPGSEEGSMALDVCLSSQAMSVLLEDKEFMENV  448



>ref|XP_004233972.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like isoform 
X1 [Solanum lycopersicum]
Length=457

 Score =   273 bits (699),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 139/303 (46%), Positives = 190/303 (63%), Gaps = 7/303 (2%)
 Frame = -1

Query  1157  KGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQLSLPPVLDP  978
             +  S P LGVQVTEL DG FIG   NH+  D SSFWHFF SW+EISRG   +S  P L  
Sbjct  153   EATSKPFLGVQVTELVDGIFIGCTANHSLLDGSSFWHFFTSWAEISRGFNVISQIPFLKR  212

Query  977   WFP---GNIARPLCLPFDLQQETLSSSFT--PPPLEERVFHFSKDTIAKLKEKANSEMGT  813
              FP    N +  +C+P +       S+    PP L++++FHF+K++IAKLK KAN EM T
Sbjct  213   QFPFEIDNFSNRICIPNERINSNSDSTHEHDPPALQDKIFHFTKESIAKLKSKANLEMKT  272

Query  812   DSISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKLAK  633
               ISSLQ+ +AH+W++I R R L+  E+ +  VP+  R R NPPLPEG++GNAI+     
Sbjct  273   TKISSLQAVLAHVWQSIIRCRNLDHNEETTFEVPMDMRKRLNPPLPEGFFGNAIYPATIT  332

Query  632   ANAGELLKR-GLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIAS  456
               AG+LLK  G  WAA QI+E+++  DHE+    Y+NW+K P I +   +   N+  + +
Sbjct  333   VKAGDLLKDGGFEWAALQINEMIASHDHEKFKRIYENWMKDPEITKLGDL-PRNYFMLHN  391

Query  455   SPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDIEVCLLPHTLHTLGNDQ  276
             SPR N    DFGWGKP+A R GM N  +GK  + PG+E+GS+  E+CL P T+  L   +
Sbjct  392   SPRFNYNKYDFGWGKPIAQRGGMSNMLEGKIDVSPGIEEGSMIFEICLSPKTIQALEEHK  451

Query  275   EFM  267
              F+
Sbjct  452   MFV  454



>ref|XP_009338991.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Pyrus 
x bretschneideri]
Length=455

 Score =   273 bits (699),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 141/307 (46%), Positives = 191/307 (62%), Gaps = 10/307 (3%)
 Frame = -1

Query  1157  KGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISR-------GMPQLS  999
             +G+S PLL VQVTEL DG FIG  MNH+  D S+FW FFN+WSEISR          ++S
Sbjct  144   EGVSKPLLAVQVTELVDGIFIGFTMNHSVVDGSTFWLFFNTWSEISRHAETSTANCGKIS  203

Query  998   LPPVL--DPWFPGNIARPLCLPFDLQQETLSSSFTPPP-LEERVFHFSKDTIAKLKEKAN  828
              PP +     F G I  P+ +P    Q   + S TPP  L +R F FSK+ IA+LK KAN
Sbjct  204   QPPPIFSRELFDGIIDFPVRIPNFHNQIPKNRSSTPPAALHQRTFKFSKEKIAQLKAKAN  263

Query  827   SEMGTDSISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIH  648
             +EMGT  ISSLQ+ +AHLW +I R + LNP ++    + IG R R   PLPE Y GN + 
Sbjct  264   AEMGTTKISSLQALLAHLWLSIIRNKHLNPDQETKYTLQIGLRQRFQSPLPEEYLGNLVQ  323

Query  647   SKLAKANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFL  468
                A +   +LL+ GLGWAAW+I+++++ +  +EV ++ + W++SP + Q + +      
Sbjct  324   FGTATSTVSDLLEHGLGWAAWEINKMIASKTKDEVRKYLEEWIESPKLFQLNNLASDYSF  383

Query  467   GIASSPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDIEVCLLPHTLHTL  288
             G  SSPR N+Y  DFGWG+P+AVR G  NKA+GK ++  G E GS++ E CL P TL  L
Sbjct  384   GTGSSPRFNMYGNDFGWGRPLAVRSGASNKAEGKLTVASGAEDGSIEFEACLPPQTLQDL  443

Query  287   GNDQEFM  267
               D EFM
Sbjct  444   AEDAEFM  450



>ref|XP_004288018.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Fragaria 
vesca subsp. vesca]
Length=454

 Score =   273 bits (698),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 151/322 (47%), Positives = 195/322 (61%), Gaps = 34/322 (11%)
 Frame = -1

Query  1157  KGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISR-GMPQLSLPPVLD  981
             +GIS PLL VQVT+L DG FIG + NH A D +SFWHFFN+WSEISR G   +S      
Sbjct  142   EGISNPLLAVQVTQLVDGIFIGCSANHAAIDGTSFWHFFNTWSEISRIGSDHVS------  195

Query  980   PWFPGNIARPLC-------LPFDLQQETLSSSFTPPP----LEERVFHFSKDTIAKLKEK  834
                   I RP+C       LPF   +     + T P     L+  VFHFSK+ + +LK K
Sbjct  196   -----QIPRPVCATGLPIRLPFSYSKIIKGKNRTEPSTDDSLQRVVFHFSKEKMTELKAK  250

Query  833   ANSEMGTDS-ISSLQSYVAHLWRAITRARR-LNPTEDVSIYVPIGTRWRTNPPLPEGYWG  660
             AN+EMGT++ ISSLQ+ VAHLWRAI R++  L+P E  +  V +G R R  PPLP+ Y G
Sbjct  251   ANAEMGTNNVISSLQALVAHLWRAIIRSKHNLSPDEQTTYMVVVGLRQRLKPPLPKEYLG  310

Query  659   NAIHSKLAKANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQK-----  495
             NA+   + K+ AGELL++GLGW A QI++ ++     EV  + + W+ SPV+        
Sbjct  311   NALLGVMVKSTAGELLQQGLGWVALQINKRIASMTAGEVSRYLEEWMTSPVLVPNPSDVP  370

Query  494   ---SKVFFANFLGIASSPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDI  324
                +     N L I SSPR NVY  DFGWG+PVAVR G   K +G  ++FPG E+GS+D 
Sbjct  371   KITTSSSSVNLL-IGSSPRFNVYGNDFGWGRPVAVRSGTAAKQNGNLTVFPGAEEGSIDF  429

Query  323   EVCLLPHTLHTLGNDQEFMEFV  258
             E CLLP TL  +  D EFME V
Sbjct  430   EACLLPETLQAMKEDAEFMEAV  451



>gb|KDP31965.1| hypothetical protein JCGZ_12426 [Jatropha curcas]
Length=466

 Score =   273 bits (697),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 142/302 (47%), Positives = 195/302 (65%), Gaps = 4/302 (1%)
 Frame = -1

Query  1154  GISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQLSLPPVLDPW  975
             GIS PL+ VQVTELDDG FIG  MNH  AD ++FW+F NSWSEISRG   ++ PPV + W
Sbjct  166   GISKPLVAVQVTELDDGIFIGCTMNHVVADGTTFWNFINSWSEISRGSDHITKPPVFEHW  225

Query  974   FPGNIAR-PLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEMGTDSISS  798
             F  N    P+ LP  + + T +S   P   +ERVFHF+K+ IA LKEKA +E G + IS+
Sbjct  226   FRSNSYNCPIRLPLSVIK-TNNSEAIPTLKQERVFHFTKEKIAWLKEKAKTESGCERIST  284

Query  797   LQSYVAHLWRAITRARR-LNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKLAKANAG  621
             LQS +AHLWR++ R  + ++P ++ + +  IG R R  PP+PE Y+G A  +      A 
Sbjct  285   LQSILAHLWRSVIRNEQSIDPDQETNFHFHIGIRTRLQPPIPEEYFGTATQTGTVTLKAR  344

Query  620   ELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIASSPRNN  441
             EL++ GLG+AA QI+ +++    ++V    ++WVK+P + ++   F  N L  +SSPR N
Sbjct  345   ELMENGLGYAALQINRMIAGYTEDKVRNNLESWVKNPKLYKQGG-FPENDLITSSSPRFN  403

Query  440   VYATDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDIEVCLLPHTLHTLGNDQEFMEF  261
             VY  DF WG+P+AVR G  NK   K +LFP  E+GSVDIEV   P  L  +G+D EFM+ 
Sbjct  404   VYGNDFNWGRPIAVRSGPGNKYCRKITLFPEAEEGSVDIEVSFSPEILTAMGSDPEFMDA  463

Query  260   VT  255
             VT
Sbjct  464   VT  465



>ref|XP_008787703.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Phoenix 
dactylifera]
Length=445

 Score =   272 bits (695),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 145/305 (48%), Positives = 197/305 (65%), Gaps = 9/305 (3%)
 Frame = -1

Query  1154  GISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRG---MPQLSLPPVL  984
             G S PLL V+VTEL DG FIG A+NH  AD +SFWHF NSWSEISR    +PQ+S PP+L
Sbjct  145   GHSLPLLAVRVTELADGIFIGCALNHAVADGTSFWHFLNSWSEISRTGCRVPQISRPPML  204

Query  983   DPWFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEMGTDSI  804
             + WF  + + P+ LP   ++E     +    L E  F FS  TIAKLK +AN EM TD I
Sbjct  205   NRWFHDSCSPPIHLPV-YKREDFIKIYPSSQLSEAFFQFSAQTIAKLKLRANMEMNTDRI  263

Query  803   SSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKLAKANA  624
             SSLQ+ +A +WR++ RA+RL P E  S  V +  R R  PPLP GY+GN I      A+A
Sbjct  264   SSLQALLALVWRSVLRAQRLPPNEKTSYRVTVNYRPRLEPPLPGGYFGNTIIGVPTTASA  323

Query  623   GELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIA--QKSKVFFANFLGIASSP  450
             GE+L RGLGWAA  ++++V+ Q ++ +  + ++W ++P     +++KV     +   SSP
Sbjct  324   GEVLHRGLGWAASLLNQMVASQTNDIIQNWLESWSQNPTFLYFKETKV---GTIVTGSSP  380

Query  449   RNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDIEVCLLPHTLHTLGNDQEF  270
             R +V   DFGWG+P+AVR G  NK DG  S+FPG E+GS+ ++VCL  H ++ L  D+EF
Sbjct  381   RFDVNGNDFGWGRPIAVRSGGSNKVDGTISVFPGSEEGSMALDVCLSSHAMNLLLEDKEF  440

Query  269   MEFVT  255
             ME VT
Sbjct  441   MENVT  445



>ref|XP_008342727.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Malus 
domestica]
Length=455

 Score =   272 bits (696),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 139/307 (45%), Positives = 193/307 (63%), Gaps = 10/307 (3%)
 Frame = -1

Query  1157  KGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISR-------GMPQLS  999
             +G+S PLL VQVTEL DG FIG  MNH+  D S+FW FFN+WSEISR          ++S
Sbjct  144   EGVSKPLLAVQVTELVDGIFIGFTMNHSVVDGSTFWLFFNTWSEISRHAETSTASCGKIS  203

Query  998   LPPVL--DPWFPGNIARPLCLPFDLQQETLSSSFTPPP-LEERVFHFSKDTIAKLKEKAN  828
              PP +    +F G I  P+ +P    Q   + S TPP  L +R+F FSK+ IA+LK KAN
Sbjct  204   QPPPIFSREFFDGIIDFPVRIPNFHNQIPKNRSSTPPAALHQRIFKFSKEKIAQLKAKAN  263

Query  827   SEMGTDSISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIH  648
             +EMGT  ISSLQ+ +AHLW +I R +  NP ++    + IG R R   PLPE Y GN + 
Sbjct  264   AEMGTTKISSLQALLAHLWLSIIRNKHFNPDQETKYTLQIGLRQRFQSPLPEEYLGNLVQ  323

Query  647   SKLAKANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFL  468
                A +   +LL+ GLGWAAW+I+++++ +  +EV ++ + W++SP + Q + +      
Sbjct  324   FGTATSTVIDLLEHGLGWAAWEINKMIASKTKDEVRKYLEEWIESPKLFQLNNLASDYSF  383

Query  467   GIASSPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDIEVCLLPHTLHTL  288
             G  SSPR N+Y  DFGWG+P+AV+ G  NKA+GK ++ PG E GS++ E CL P TL  L
Sbjct  384   GTGSSPRFNMYGNDFGWGRPLAVKSGSSNKAEGKLTVAPGAEDGSIEFEACLPPQTLQDL  443

Query  287   GNDQEFM  267
               D EF+
Sbjct  444   AEDAEFL  450



>ref|XP_012079264.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Jatropha 
curcas]
Length=442

 Score =   271 bits (694),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 142/302 (47%), Positives = 195/302 (65%), Gaps = 4/302 (1%)
 Frame = -1

Query  1154  GISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQLSLPPVLDPW  975
             GIS PL+ VQVTELDDG FIG  MNH  AD ++FW+F NSWSEISRG   ++ PPV + W
Sbjct  142   GISKPLVAVQVTELDDGIFIGCTMNHVVADGTTFWNFINSWSEISRGSDHITKPPVFEHW  201

Query  974   FPGNIAR-PLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEMGTDSISS  798
             F  N    P+ LP  + + T +S   P   +ERVFHF+K+ IA LKEKA +E G + IS+
Sbjct  202   FRSNSYNCPIRLPLSVIK-TNNSEAIPTLKQERVFHFTKEKIAWLKEKAKTESGCERIST  260

Query  797   LQSYVAHLWRAITRARR-LNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKLAKANAG  621
             LQS +AHLWR++ R  + ++P ++ + +  IG R R  PP+PE Y+G A  +      A 
Sbjct  261   LQSILAHLWRSVIRNEQSIDPDQETNFHFHIGIRTRLQPPIPEEYFGTATQTGTVTLKAR  320

Query  620   ELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIASSPRNN  441
             EL++ GLG+AA QI+ +++    ++V    ++WVK+P + ++   F  N L  +SSPR N
Sbjct  321   ELMENGLGYAALQINRMIAGYTEDKVRNNLESWVKNPKLYKQGG-FPENDLITSSSPRFN  379

Query  440   VYATDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDIEVCLLPHTLHTLGNDQEFMEF  261
             VY  DF WG+P+AVR G  NK   K +LFP  E+GSVDIEV   P  L  +G+D EFM+ 
Sbjct  380   VYGNDFNWGRPIAVRSGPGNKYCRKITLFPEAEEGSVDIEVSFSPEILTAMGSDPEFMDA  439

Query  260   VT  255
             VT
Sbjct  440   VT  441



>ref|XP_008347613.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Malus 
domestica]
Length=463

 Score =   272 bits (696),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 147/316 (47%), Positives = 190/316 (60%), Gaps = 12/316 (4%)
 Frame = -1

Query  1169  TTSRKGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSE----ISRG----  1014
               +  G +  LL VQVTEL DG FIGL+MNH   D +SFWHFFN+WSE    I++G    
Sbjct  145   AVNHDGHTASLLTVQVTELVDGIFIGLSMNHCLCDGTSFWHFFNTWSELFQAITQGAHDN  204

Query  1013  --MPQLSLPPVLDPWFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLK  840
               +P +S PPVL  WFP      + LP+    E +   F  P L ER+FHFS ++IAKLK
Sbjct  205   TIVPGISRPPVLKRWFPDGHGPIISLPYTNPDEFIGR-FEAPELRERMFHFSSESIAKLK  263

Query  839   EKANSEMGTDSISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWG  660
              KANSE     ISS QS  A LWR+ITRARRL P +     +    R R +PPL   Y+G
Sbjct  264   AKANSESNATKISSFQSLSALLWRSITRARRLPPNQSTRCRLAANNRARLDPPLSGDYFG  323

Query  659   NAIHSKLAKA-NAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVF  483
             N+IH   ++A  AGELL+  LGWAAW++HE V   D  E+  F   W++SP +    + F
Sbjct  324   NSIHPINSEAVTAGELLQHSLGWAAWKLHEAVVKLDDREIRGFVDAWLQSPTVYLLGQFF  383

Query  482   FANFLGIASSPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDIEVCLLPH  303
                 + + SSPR N+Y  +FG GK VA+R G  NK  GK S + G E+GS+D+EVCL P 
Sbjct  384   DPYMVMMGSSPRFNMYGNEFGMGKAVALRSGYANKFGGKVSSYEGRERGSIDLEVCLPPD  443

Query  302   TLHTLGNDQEFMEFVT  255
              +  L  D+EFMEF +
Sbjct  444   AMSALECDEEFMEFAS  459



>ref|XP_004230696.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Solanum 
lycopersicum]
 ref|XP_004230697.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Solanum 
lycopersicum]
Length=471

 Score =   272 bits (696),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 140/300 (47%), Positives = 187/300 (62%), Gaps = 6/300 (2%)
 Frame = -1

Query  1142  PLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQLSLPPVLDPWFPGN  963
             P L VQVTEL DG FIG   NH   D +SFW+F+NSW+E+SRG   +S  P L   FP  
Sbjct  157   PCLAVQVTELVDGIFIGCTNNHVVVDGTSFWNFYNSWAELSRGSKIISKIPFLKREFPFK  216

Query  962   IARPLCLPFDLQQETLSS--SFTPPPLE---ERVFHFSKDTIAKLKEKANSEMGTDSISS  798
             I         +  E ++S   F PP L+   E+VFHF+K+ I KLK KAN EM T  ISS
Sbjct  217   IDGFYPNRISIPNERINSGDKFIPPALQMLREKVFHFTKENIYKLKAKANHEMNTTKISS  276

Query  797   LQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKLAKANAGE  618
             LQ+ +AH+WR++ R RRL+  E+ +  V I  R + NPPLPEGY+GNAI+        G+
Sbjct  277   LQAVLAHVWRSVIRCRRLDHNEETTFEVSINMREKVNPPLPEGYFGNAIYPVTVTIKTGQ  336

Query  617   LLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIASSPRNNV  438
             LL+ G GWAA QI+E ++  DHE++   Y+NW+K P I QK     +N+  + +SPR N 
Sbjct  337   LLEHGFGWAALQINESIASHDHEKLKCIYENWMKDPEI-QKLDELPSNYFMLHNSPRFNF  395

Query  437   YATDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDIEVCLLPHTLHTLGNDQEFMEFV  258
             +  DFGWGKP+A R G  N  DGK ++ PG+E+GS+ +E+CL   T+  L  D  F EFV
Sbjct  396   FKYDFGWGKPIAHRSGEGNMLDGKITVSPGVEEGSMIVEICLSSETIQALEEDIIFGEFV  455



>ref|XP_007155908.1| hypothetical protein PHAVU_003G242200g [Phaseolus vulgaris]
 gb|ESW27902.1| hypothetical protein PHAVU_003G242200g [Phaseolus vulgaris]
Length=441

 Score =   271 bits (693),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 145/306 (47%), Positives = 200/306 (65%), Gaps = 7/306 (2%)
 Frame = -1

Query  1157  KGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQLSLPPVLDP  978
             +G + PLL VQVTEL DG FI L +NH  AD  S WHF NSW+EISRG  Q+S  P L  
Sbjct  137   EGTTQPLLAVQVTELVDGIFIALTVNHVVADGKSLWHFVNSWAEISRGSLQISKLPSLRR  196

Query  977   WFPGNIARPLCLPFDLQQETLSSSFTPP--PLEERVFHFSKDTIAKLKEKANSEMGTDSI  804
             +FP  I  P+  PF  ++E   SS   P  PLE RVFHF+K+ IA LK KAN+E  TD I
Sbjct  197   YFPDGIDHPILFPFTKEEENQRSSNLKPQTPLE-RVFHFTKEIIAALKSKANAEANTDRI  255

Query  803   SSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKLAKANA  624
             SSLQ+ +  LWRA+TR +R++P E+V   + IG   +  PPL EGY+GN++ + +    A
Sbjct  256   SSLQALLTLLWRAVTRCKRVDPQENVHYVLFIGVWSKMVPPLAEGYFGNSVIATVVTMKA  315

Query  623   GELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSP-VIAQKSKVFFANFLGIASSPR  447
             GELL+ GLG  A ++++ +S+  HE+V   Y++WV+ P ++   S V  +N+L  +SSPR
Sbjct  316   GELLEGGLGKGALEMNKAISLHSHEKVKNHYESWVRRPRLLTLPSGVAGSNYLITSSSPR  375

Query  446   NNVYATDFGWGKPVAVRCGMD-NKADGKFSLFPGLEKGSVDIEVCLLPH-TLHTLGNDQE  273
              N++  DFGWGKP AVR G   +K +G  ++F G E+GS+DI V  LP+  L  +GN+ E
Sbjct  376   FNIFGNDFGWGKPEAVRIGGGPHKRNGMITVFGGAEEGSIDI-VANLPYWILEAMGNEPE  434

Query  272   FMEFVT  255
             FM+ V+
Sbjct  435   FMDAVS  440



>ref|XP_006428978.1| hypothetical protein CICLE_v10011715mg [Citrus clementina]
 gb|ESR42218.1| hypothetical protein CICLE_v10011715mg [Citrus clementina]
Length=448

 Score =   271 bits (694),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 146/302 (48%), Positives = 193/302 (64%), Gaps = 6/302 (2%)
 Frame = -1

Query  1148  STPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQLSLPPVLDPWFP  969
             + PLLGVQVTEL DG FI   +NH+  D +SFWHFFNSWSEISRG   +S  PVL+  F 
Sbjct  149   AKPLLGVQVTELVDGIFIACTINHSVVDGTSFWHFFNSWSEISRGSDCISKLPVLERGFL  208

Query  968   GNIAR-PLCLPFDLQQETLSSSFTPPP-LEERVFHFSKDTIAKLKEKANSEMG-TDSISS  798
                   P+ LP  L     S + TPPP L +RVFHF+K+ IAKLK KAN+E+G T+ ISS
Sbjct  209   SESEYFPIRLP--LWSIEPSGTHTPPPNLRQRVFHFTKENIAKLKAKANAEIGSTNKISS  266

Query  797   LQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKLAKANAGE  618
             LQ+ ++ +WR+ TR R L+P E+V   + IG R R  PPLP  Y+GNA   +     A  
Sbjct  267   LQAILSQIWRSFTRNRSLDPDEEVLFMLGIGVRQRLQPPLPPEYFGNAAQGEFVSMKARY  326

Query  617   LLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIASS-PRNN  441
              L++GLG  A ++++ ++    E++  F ++W K+P I     +   N    ASS PR N
Sbjct  327   QLEQGLGNVALKMNKFIAAYTEEKIKNFLESWGKNPEILTWDSLPMKNNACFASSSPRFN  386

Query  440   VYATDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDIEVCLLPHTLHTLGNDQEFMEF  261
              Y  DFGWG+P+AVR G  NK DGK +LF G+E+GSVD+E C L  TL  +GND EFM+F
Sbjct  387   FYGNDFGWGRPMAVRSGPANKVDGKITLFAGVEEGSVDVEACFLAQTLQGMGNDTEFMQF  446

Query  260   VT  255
             V+
Sbjct  447   VS  448



>ref|XP_006346302.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006346303.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like isoform 
X2 [Solanum tuberosum]
 ref|XP_006346304.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like isoform 
X3 [Solanum tuberosum]
 ref|XP_006346305.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like isoform 
X4 [Solanum tuberosum]
Length=467

 Score =   271 bits (694),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 137/305 (45%), Positives = 192/305 (63%), Gaps = 7/305 (2%)
 Frame = -1

Query  1157  KGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQLSLPPVLDP  978
             +  S P   VQVTEL+DG FIG + NH   D +SFWHF+NSW+EISRG   +S  P L  
Sbjct  152   EATSQPCFAVQVTELEDGVFIGCSNNHVVVDGTSFWHFYNSWTEISRGFNVISKLPFLKR  211

Query  977   WFPGNI---ARPLCLPFDLQQETLSSSFTPPP-LEERVFHFSKDTIAKLKEKANSEMGTD  810
              FP NI   +  + +P   ++      F PPP L ERVFHF+K+++AKLK KAN EM T 
Sbjct  212   QFPFNINHFSDRISIPN--ERVNAGHRFIPPPMLRERVFHFAKESVAKLKAKANLEMSTT  269

Query  809   SISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKLAKA  630
              ISSLQ+ +AH+WR++ R RRL+ +E+ +  V I  R R NPPLPEG++GNAI       
Sbjct  270   KISSLQAVLAHVWRSVIRCRRLDLSEETTFEVSIDMRERLNPPLPEGFFGNAICPATVTI  329

Query  629   NAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIASSP  450
               GELL+   GWAA QI+E +++ D E++   Y++W+  P + +   +  +N+  + +SP
Sbjct  330   KTGELLEHEFGWAALQINETIALHDQEKLKCIYESWMNDPEVVKLGDL-PSNYFMLNNSP  388

Query  449   RNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDIEVCLLPHTLHTLGNDQEF  270
             R + Y  DFGWGKP+  R G+ N  +GK ++ PG E+GS+ +E+CL   T+  L  D  F
Sbjct  389   RFDFYKYDFGWGKPITHRGGIGNMLEGKITVSPGQEEGSMILEICLSSETIQALEEDVIF  448

Query  269   MEFVT  255
              EFVT
Sbjct  449   GEFVT  453



>ref|XP_007136696.1| hypothetical protein PHAVU_009G066100g [Phaseolus vulgaris]
 gb|ESW08690.1| hypothetical protein PHAVU_009G066100g [Phaseolus vulgaris]
Length=459

 Score =   271 bits (693),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 142/307 (46%), Positives = 192/307 (63%), Gaps = 8/307 (3%)
 Frame = -1

Query  1163  SRKGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQ-----LS  999
             +  G + PLL +QVTEL DG F+G +MNH   D +S+W+FFN+WSEI +         +S
Sbjct  145   NHDGHTMPLLSIQVTELLDGVFLGCSMNHCIGDGTSYWNFFNTWSEIFQAQGHEHDVPIS  204

Query  998   LPPVLDPWFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEM  819
              PP+ + WFP +   P+ LPF   +E +S  +  P + ER+FHFS ++IAKLK KANSE 
Sbjct  205   HPPIHNRWFPNDCVPPINLPFKHHEEFISR-YEAPLMRERIFHFSAESIAKLKAKANSEC  263

Query  818   GTDSISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKL  639
              T  ISS QS  A +WR ITRARRL P +  S  +    R R  PPL E Y+GN+IH+  
Sbjct  264   NTTKISSFQSLSALVWRCITRARRLGPDQKTSCKLSTNNRRRMEPPLAEEYFGNSIHTLG  323

Query  638   A-KANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGI  462
             A  A +GELL  GLGWAAW++H  V   +   V+ + + W++ P+I Q  + F    + +
Sbjct  324   AGTARSGELLGNGLGWAAWKLHLAVVNHNDRVVLGWVREWLECPLIYQLGRYFDPYCVMM  383

Query  461   ASSPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLE-KGSVDIEVCLLPHTLHTLG  285
              SSPR N+Y  +FG GK +AVR G  NK DGK + +PG E  GSVD+EVCL P  +  L 
Sbjct  384   GSSPRFNMYGNEFGMGKALAVRSGYANKFDGKVTSYPGHEGGGSVDLEVCLSPLVMTALE  443

Query  284   NDQEFME  264
             +DQEFM+
Sbjct  444   SDQEFMD  450



>ref|XP_008378023.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Malus 
domestica]
Length=463

 Score =   271 bits (693),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 145/316 (46%), Positives = 187/316 (59%), Gaps = 12/316 (4%)
 Frame = -1

Query  1169  TTSRKGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGM-------  1011
               +  G +  LL VQVTEL DG FIGL+MNH   D +SFWHFFN+WSE+ + +       
Sbjct  145   AVNHDGHTASLLTVQVTELVDGIFIGLSMNHCLCDGTSFWHFFNTWSELFQAITQXAHDN  204

Query  1010  ---PQLSLPPVLDPWFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLK  840
                P +S PPVL  WFP      + LP+    E +   F  P L ER+FHFS ++IAKLK
Sbjct  205   TIVPGISRPPVLKRWFPDGHGPIISLPYTNPDEFIGR-FEAPELRERMFHFSSESIAKLK  263

Query  839   EKANSEMGTDSISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWG  660
              KANSE     ISS QS  A LWR+ITRARRL P +     +    R R +PPL   Y+G
Sbjct  264   AKANSESNATKISSFQSLSALLWRSITRARRLPPNQSTRCRLAANNRARLDPPLSGDYFG  323

Query  659   NAIHSKLAKA-NAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVF  483
             N+IH   ++A  AGELL+  LGWAAW++HE V   D  E+  F   W+ SP +    + F
Sbjct  324   NSIHPINSEAVTAGELLQHSLGWAAWKLHEAVVKLDDREIRGFVDAWLXSPTVYLLGQXF  383

Query  482   FANFLGIASSPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDIEVCLLPH  303
                 + + SSPR N+Y  +FG GK VA+R G  NK  GK S + G E+GS+D+EVCL P 
Sbjct  384   DPYMVMMGSSPRFNMYGNEFGMGKAVALRSGYANKFGGKVSSYEGRERGSIDLEVCLPPD  443

Query  302   TLHTLGNDQEFMEFVT  255
              +  L  D+EFMEF +
Sbjct  444   AMSALECDEEFMEFAS  459



>gb|KEH31455.1| anthranilate N-benzoyltransferase [Medicago truncatula]
Length=447

 Score =   270 bits (691),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 140/308 (45%), Positives = 193/308 (63%), Gaps = 6/308 (2%)
 Frame = -1

Query  1178  FCLTTSRKGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQLS  999
             F    + +G S PLL VQVTEL DG FIG ++NH   D  SFWHF NSWSEISRG  QLS
Sbjct  139   FNKVKNYEGTSKPLLAVQVTELVDGIFIGFSINHVVVDGKSFWHFINSWSEISRGFDQLS  198

Query  998   LPPVLDPWF-PGNIARPLCLPFDLQQETLSSSF--TPPPLEERVFHFSKDTIAKLKEKAN  828
               P L+ WF   +I  P+  PF  ++   S+     P PLE R+FHF+K+ IAKLK KAN
Sbjct  199   KLPTLNRWFLDESIEIPIKFPFTKEENGKSTEIDENPVPLE-RIFHFTKEKIAKLKSKAN  257

Query  827   SEMGTDSISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIH  648
              E   + ISSLQ+ + HLW+A+ R + ++P E++   + I  R R  PPL E Y+GNA+ 
Sbjct  258   EEANINKISSLQALLTHLWQAVIRGQNIDPEEEIMYCLVIDVRGRIIPPLHENYFGNALQ  317

Query  647   SKLAKANAGELLKRG-LGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANF  471
                 K  A ELL  G  G  A++++++++    + V   Y++WVK+P + Q  ++     
Sbjct  318   VGGVKMKAKELLAEGAFGKVAFEMNKMIASHCDDTVKRHYESWVKNPRLFQ-GRLSSVKA  376

Query  470   LGIASSPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDIEVCLLPHTLHT  291
             L  +SSPR +VY  DFGWGKPVAVR G  NK+DG  ++F G+E+GS+D+EVCL    L  
Sbjct  377   LATSSSPRFDVYGNDFGWGKPVAVRSGGANKSDGTITMFSGIEEGSIDVEVCLSYDILEA  436

Query  290   LGNDQEFM  267
             +GND +F+
Sbjct  437   MGNDPQFI  444



>gb|KJB43781.1| hypothetical protein B456_007G215600 [Gossypium raimondii]
Length=433

 Score =   270 bits (689),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 134/298 (45%), Positives = 196/298 (66%), Gaps = 5/298 (2%)
 Frame = -1

Query  1157  KGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQLSLPPVLDP  978
             +G S PLL VQVTEL DG FI  + NH+  D +SFWHFFNSWSEISRG   LS PP+   
Sbjct  135   EGTSKPLLAVQVTELVDGIFITCSANHSVVDGASFWHFFNSWSEISRGFDYLSRPPIFKR  194

Query  977   WFPGNIARPLCLPFDLQQETLSSS-FTPPPLEERVFHFSKDTIAKLKEKANSEMGTDSIS  801
                 +I  P+ +P  LQ+E +    F P  L+ RVF+F K++I ++K KAN+EM TD IS
Sbjct  195   PLIDDIHYPIRIP--LQKEHIQERFFQPGNLKVRVFNFRKESIVRIKRKANAEMNTDKIS  252

Query  800   SLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKLAKANAG  621
             SLQ+ ++  W++I R RR++P ++  I++ IG R +    L E Y+GNAIHS      AG
Sbjct  253   SLQALLSLFWQSIMRNRRMDPNQETMIFLVIGVRQKLQ-QLSEEYFGNAIHSAEVSLKAG  311

Query  620   ELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIASSPRNN  441
             EL+++GLG AAW+I++VV+    E  + F + WV SP++ Q   +   N L   +SPR +
Sbjct  312   ELVEKGLGNAAWEINQVVANHREENFINFVKWWVNSPLLFQTGPM-MNNALLTGNSPRFD  370

Query  440   VYATDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDIEVCLLPHTLHTLGNDQEFM  267
             +Y  DFGWG+P+A+  G ++K DG  ++ PG+E+G ++I+VCL P T+  + ND++F+
Sbjct  371   IYGNDFGWGRPIAMSHGAESKCDGLVTVSPGVEEGDIEIKVCLSPKTIQAMENDEDFI  428



>ref|XP_006480713.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Citrus 
sinensis]
Length=448

 Score =   270 bits (690),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 146/302 (48%), Positives = 192/302 (64%), Gaps = 6/302 (2%)
 Frame = -1

Query  1148  STPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQLSLPPVLDPWFP  969
             + PLLGVQVTEL DG FI   +NH+  D +SFWHFFNSWSEISRG   +S  PVL+  F 
Sbjct  149   AKPLLGVQVTELVDGIFIACTINHSVVDGTSFWHFFNSWSEISRGSDCISKLPVLERGFL  208

Query  968   GNIAR-PLCLPFDLQQETLSSSFTPPP-LEERVFHFSKDTIAKLKEKANSEMG-TDSISS  798
                   P+ LP  L     S + TPPP L +RVFHF+K+ IAKLK KAN+E+G T+ ISS
Sbjct  209   SESEYFPIRLP--LWSIEPSGTHTPPPNLRQRVFHFTKENIAKLKAKANAEIGSTNKISS  266

Query  797   LQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKLAKANAGE  618
             LQ+ ++ +WR+ TR R L+P E+V   + IG R R  PPLP  Y+GNA   +     A  
Sbjct  267   LQAILSQIWRSFTRNRSLDPDEEVLFMLGIGVRQRLQPPLPPEYFGNAAQGEFVSMKARY  326

Query  617   LLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIASS-PRNN  441
              L++GLG  A ++++ ++    E++  F ++W K P I     +   N    ASS PR N
Sbjct  327   QLEQGLGNVALKMNKFIAAYTDEKIKNFLESWGKIPEILTWDSLPMKNNACFASSSPRFN  386

Query  440   VYATDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDIEVCLLPHTLHTLGNDQEFMEF  261
              Y  DFGWG+P+AVR G  NK DGK +LF G+E+GSVD+E C L  TL  +GND EFM+F
Sbjct  387   FYGNDFGWGRPMAVRSGPANKVDGKITLFAGVEEGSVDVEACFLAQTLQGMGNDTEFMQF  446

Query  260   VT  255
             V+
Sbjct  447   VS  448



>ref|XP_004291090.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Fragaria 
vesca subsp. vesca]
Length=457

 Score =   270 bits (691),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 140/304 (46%), Positives = 188/304 (62%), Gaps = 8/304 (3%)
 Frame = -1

Query  1154  GISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRG------MPQLSLP  993
             G +T LL VQVTEL DG FIG++MNH   D +S+WHFFN+WSEI R       + ++S P
Sbjct  147   GHTTSLLTVQVTELVDGVFIGMSMNHALGDGTSYWHFFNTWSEIFRAEENNITLSEISRP  206

Query  992   PVLDPWFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEMGT  813
             PVL+ WFP  +     LP+    E +   F  P L ER+FHFS ++IAK+K KANSE  T
Sbjct  207   PVLERWFPYGLGPIFSLPYTNPDEFIER-FEAPELRERIFHFSSESIAKIKSKANSECRT  265

Query  812   DSISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHS-KLA  636
               ISS Q+  A LWR++TRAR   P ++ S  +    R R NPPL   Y+GN+IH  K  
Sbjct  266   SKISSFQALSALLWRSLTRARGFAPNQETSCRLAANNRARINPPLSPNYFGNSIHPVKSQ  325

Query  635   KANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIAS  456
                AGELL+ GLGWAAW++HE V   + + + +    W+KSP + Q S+ F  + + + S
Sbjct  326   PVKAGELLENGLGWAAWKLHETVVNHNDKWIRQSIDAWLKSPAVYQLSRTFDPHSIMMGS  385

Query  455   SPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDIEVCLLPHTLHTLGNDQ  276
              PR ++Y  +FG GK VA+R G  NK  GK + + G E GS+D+EVCL P  +  L +D 
Sbjct  386   GPRFDMYGNEFGMGKAVALRSGYANKFIGKVTSYSGREAGSIDLEVCLPPAAMRALESDV  445

Query  275   EFME  264
             EFME
Sbjct  446   EFME  449



>ref|XP_007136704.1| hypothetical protein PHAVU_009G066900g [Phaseolus vulgaris]
 gb|ESW08698.1| hypothetical protein PHAVU_009G066900g [Phaseolus vulgaris]
Length=461

 Score =   269 bits (688),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 141/314 (45%), Positives = 196/314 (62%), Gaps = 11/314 (4%)
 Frame = -1

Query  1166  TSRKGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQ------  1005
              +  G + PLL +QVTEL DG FIG +MNH+  D +S+W+FFN+WS+I +  PQ      
Sbjct  143   VNHDGHTMPLLSIQVTELVDGVFIGCSMNHSVGDGTSYWNFFNAWSKIFQAEPQGQENDV  202

Query  1004  -LSLPPVLDPWFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKAN  828
              +   P+ + WFP N + P+ LPF    E ++  F  P L ER+FHFS ++IAKLK KAN
Sbjct  203   PILHQPIHNRWFPNNCSPPINLPFKHHDEFINR-FEAPLLRERIFHFSAESIAKLKAKAN  261

Query  827   SEM--GTDSISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNA  654
             SE    T  ISS QS  A +WR+I RAR L   +  +  +    R R  PPLP  Y+GN+
Sbjct  262   SESKSNTTKISSFQSLSALVWRSIIRARSLPYEQRTNFTLSANNRSRMEPPLPHEYFGNS  321

Query  653   IHSKLAKANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFAN  474
             ++S  A+   GELLK  LGWAAW++H  V+  + +EV++  Q W + PVI +  +     
Sbjct  322   VNSLSAETTVGELLKNDLGWAAWKLHLAVTRHNDKEVMQSIQEWFQCPVIRKICQPLEPY  381

Query  473   FLGIASSPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLE-KGSVDIEVCLLPHTL  297
              + I+SSPR N+Y ++FG GK VAVR G  NK DGK + FPG E  GS+D+E+CLLPH +
Sbjct  382   LVLISSSPRFNMYGSEFGMGKAVAVRSGYANKFDGKVTSFPGREGGGSIDLEICLLPHIM  441

Query  296   HTLGNDQEFMEFVT  255
              +L +D +FM  V+
Sbjct  442   TSLESDMDFMNAVS  455



>ref|XP_004289208.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Fragaria 
vesca subsp. vesca]
Length=479

 Score =   269 bits (688),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 141/311 (45%), Positives = 196/311 (63%), Gaps = 12/311 (4%)
 Frame = -1

Query  1157  KGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISR-GMPQLSLPPVLD  981
             +G S PLL VQVT+L DG FIG+ MNH+  D + FW+FFN+WSEISR G   ++ P    
Sbjct  168   EGKSKPLLAVQVTDLVDGIFIGMTMNHSVGDGTCFWNFFNTWSEISRSGTSTMAKPIFGR  227

Query  980   PWFPGNIARPLCLPFDLQQETLSSSFTPP--PLEERVFHFSKDTIAKLKEKANSEMGTDS  807
              +  G I  P+ +PF  Q         PP   L++RVFHF K+ IA LK KAN +M T  
Sbjct  228   EFLDGIIHLPIRIPF-FQYPNPEDKVVPPMASLQQRVFHFRKEKIAALKSKANVQMATCK  286

Query  806   ISSLQSYVAHLWRAITRARRL-------NPTEDVSIY-VPIGTRWRTNPPLPEGYWGNAI  651
             ISSLQ+ + HLW +ITRAR L         +++++ Y V +G R R + PL + Y GNA+
Sbjct  287   ISSLQALMGHLWVSITRARGLISSATEYEVSQEITKYMVIVGMRQRLHVPLSDQYLGNAV  346

Query  650   HSKLAKANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANF  471
                 A    GELL+ GLG+AA ++++V+++Q  +EV +F + +V++P + ++  V  +N 
Sbjct  347   LFGTATTTVGELLQGGLGFAAMELNKVIALQTEQEVKKFLEAFVENPSLPKRGAVMKSNS  406

Query  470   LGIASSPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDIEVCLLPHTLHT  291
             L   SSPR +VY  DFGWG+PVAVR G  NK DGK ++F G E+GS+D E CL P TL  
Sbjct  407   LLTGSSPRFDVYGNDFGWGRPVAVRSGSGNKVDGKLTVFAGAEEGSIDFEACLSPQTLQA  466

Query  290   LGNDQEFMEFV  258
             L  D+EFM+ V
Sbjct  467   LVEDEEFMQSV  477



>ref|XP_008393787.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Malus 
domestica]
Length=459

 Score =   268 bits (686),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 146/305 (48%), Positives = 190/305 (62%), Gaps = 12/305 (4%)
 Frame = -1

Query  1139  LLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQ---------LSLPPV  987
             L+ +QVTEL DG FIGL+MNH   D +SFWHFFN WSEI +   Q         +S PPV
Sbjct  153   LVTIQVTELVDGIFIGLSMNHCLGDGTSFWHFFNIWSEIFQAQAQGGHSNFVATISRPPV  212

Query  986   LDPWFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEMGTDS  807
             L  WFP      + LPF    E +   F  PPL ER+FHF+ ++IAKLK KAN+E  T  
Sbjct  213   LKRWFPDGHGPIISLPFKHSDEFIGR-FEAPPLRERMFHFTAESIAKLKAKANAESDTTK  271

Query  806   ISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKLAK-A  630
             ISS Q+  A LWR+ITRAR   P +  S  +    R R +PPL   Y+GN+I+   +K  
Sbjct  272   ISSFQALSALLWRSITRARCQPPDQGTSCRLAANNRARLDPPLSGDYFGNSIYPISSKMV  331

Query  629   NAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIASSP  450
              AGELL+ GLGWAAW++HE V   + + + E    W++SPV+ Q S VF  + + I SSP
Sbjct  332   PAGELLEHGLGWAAWKLHEAVVNHNDKVIREHTNAWLESPVVYQVS-VFEPSSVTIGSSP  390

Query  449   RNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDIEVCLLPHTLHTLGNDQEF  270
             R N+Y T+FG GK VA+R G  +K  GK S + G ++GS+D EVCLLP  +  L  D+EF
Sbjct  391   RFNMYGTEFGMGKAVALRSGYAHKFSGKVSSYEGRKEGSIDTEVCLLPDAMSALECDKEF  450

Query  269   MEFVT  255
             MEFV+
Sbjct  451   MEFVS  455



>ref|XP_007149064.1| hypothetical protein PHAVU_005G037900g [Phaseolus vulgaris]
 gb|ESW21058.1| hypothetical protein PHAVU_005G037900g [Phaseolus vulgaris]
Length=464

 Score =   268 bits (686),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 147/313 (47%), Positives = 194/313 (62%), Gaps = 14/313 (4%)
 Frame = -1

Query  1163  SRKGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQ-------  1005
             +  G + PLL +QVTEL DG FIG +MNH+ AD +SFW+FFN+WS+I +   Q       
Sbjct  144   NHDGHTMPLLSIQVTELLDGVFIGCSMNHSIADGTSFWNFFNTWSQIFQAQSQAESHEHD  203

Query  1004  --LSLPPVLDPWFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKA  831
               +S  P+    FP N   P+ LPF    E +   F  P L ERVFHFS ++IAKLK KA
Sbjct  204   APISHQPLR--LFPNNSGPPISLPFKHHDEFIKR-FEAPLLRERVFHFSAESIAKLKAKA  260

Query  830   NSEMGTDSISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAI  651
             NSE  T  ISS QS  A +WR+ITRAR     +  S  +    R R  PPL E Y+GN I
Sbjct  261   NSEANTTRISSFQSLSAFVWRSITRARSPPSEQKTSCRLMANIRSRMEPPLAEEYFGNCI  320

Query  650   HSKLAKANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANF  471
             H   A+   GELL+ GLGWAAW++H  V+  + E V+EF + W++SP+I Q  +   +  
Sbjct  321   HVLRAETTTGELLENGLGWAAWKLHVAVTNLN-EVVLEFLERWLESPLIIQTGRFSDSCS  379

Query  470   LGIASSPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLE-KGSVDIEVCLLPHTLH  294
             +  ASSPR N+Y ++FG GK VAVR G  NK DGK + + G E  GS+D+EVCLLPHT+ 
Sbjct  380   VLTASSPRFNMYGSEFGMGKAVAVRSGCANKFDGKLTSYAGREGGGSIDLEVCLLPHTMS  439

Query  293   TLGNDQEFMEFVT  255
              L +D++FM  V+
Sbjct  440   ALESDKDFMNAVS  452



>ref|XP_003602051.1| Acetyltransferase, putative [Medicago truncatula]
 ref|XP_003630461.1| Acetyltransferase, putative [Medicago truncatula]
 gb|AES72302.1| anthranilate N-hydroxycinnamoyl/benzoyltransferase, putative 
[Medicago truncatula]
Length=434

 Score =   267 bits (682),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 142/308 (46%), Positives = 193/308 (63%), Gaps = 11/308 (4%)
 Frame = -1

Query  1157  KGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGM-PQLSLPPVLD  981
             +G S PLL VQVTEL DG+FIG   NH   D  S W F NSW++ISRG   Q+S    L+
Sbjct  132   EGTSQPLLAVQVTELVDGFFIGFTFNHAVVDGESTWLFINSWAKISRGCCNQVSKLITLE  191

Query  980   PWFPGNIARPLCLPFDLQQETLSSS----FTPPPLEERVFHFSKDTIAKLKEKANSEMGT  813
              WFP  I  P+  PF ++ +   S     F P    ER+FHF+K+ IA+LK KAN E+GT
Sbjct  192   RWFPSGIQHPIRFPFTIEPQKNDSDDNEKFNP---SERLFHFTKEKIAQLKLKANMEIGT  248

Query  812   DSISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKLAK  633
             + ISSLQS   HLWR++ R+++ +P E+V   V IG R R  PPLPE Y+GNA+      
Sbjct  249   NKISSLQSLFTHLWRSVIRSKQFDPHEEVYYMVAIGARSRFVPPLPEDYFGNAVEVCRVT  308

Query  632   ANAGELLKR-GLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIAS  456
               AGELL+  GLG  AW IH+++S+Q +EE+   Y +W+++P I +       N L  ++
Sbjct  309   MKAGELLEDGGLGKGAWAIHKMISLQSNEELKNHYVSWLENPNIVRFFTAAGKNTLASSN  368

Query  455   SPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDIEVCLLPHTLHTLGNDQ  276
             SP  +VY  DFGWG+PVAVR G  NK  G  ++F G E+GS+D +VCL    L  +GND 
Sbjct  369   SPWFDVYGNDFGWGEPVAVRSG--NKISGMITVFAGKEEGSMDFQVCLPHKILEAMGNDH  426

Query  275   EFMEFVTH  252
             +FM+ V++
Sbjct  427   DFMDVVSN  434



>ref|XP_010270496.1| PREDICTED: uncharacterized acetyltransferase At3g50280 [Nelumbo 
nucifera]
Length=457

 Score =   267 bits (683),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 139/307 (45%), Positives = 186/307 (61%), Gaps = 5/307 (2%)
 Frame = -1

Query  1163  SRKGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISR--GMPQLSLPP  990
             +  G + PLL VQVTEL DG F+G + NHT  D +SFWHFFN+W+E++R  G   +S PP
Sbjct  147   NHDGHTMPLLAVQVTELLDGVFVGCSFNHTIGDGTSFWHFFNTWAELTRDQGKDYISRPP  206

Query  989   VLDPWFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEMGTD  810
             VL  WFP      + LPF    E +   + PPPL ER+FHFS  ++A+LK +AN+E  T 
Sbjct  207   VLKRWFPDGQGPIINLPFTHHSEFIDR-YRPPPLRERIFHFSPQSLARLKARANAESKTT  265

Query  809   SISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKLAKA  630
              IS+ QS  A +WR++TR R L   +  S  + I  R R NPP+   Y+GN I +     
Sbjct  266   VISTFQSLCALVWRSVTRVRNLPSNQKTSCRLAINNRTRLNPPISPDYFGNCIQTVSGTT  325

Query  629   NAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIASSP  450
              AGELL   LGWAAW +H+ V       +  + + W+K+P + Q  + F    + I SSP
Sbjct  326   TAGELLSHDLGWAAWMLHQAVVNHTDSVLRSWLETWMKAPSLYQIGRFFDPYSVMIGSSP  385

Query  449   RNNVY-ATDFGWGKPVAVRCGMDNKADGKFSLFPGLE-KGSVDIEVCLLPHTLHTLGNDQ  276
             R ++Y   DFGWG+ VA+R G  NK DGK S FPG E  GSVD+EVCL P  +  L +D+
Sbjct  386   RFDMYGGNDFGWGQGVAIRSGFANKFDGKVSSFPGKEGGGSVDLEVCLSPEKMSALESDE  445

Query  275   EFMEFVT  255
             EFME V+
Sbjct  446   EFMEAVS  452



>ref|XP_004509128.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Cicer 
arietinum]
Length=437

 Score =   267 bits (682),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 136/296 (46%), Positives = 188/296 (64%), Gaps = 5/296 (2%)
 Frame = -1

Query  1148  STPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQLSLPPVLDPWFP  969
             S P+L +QVTEL DG FIG  +NH  +D  SFWHF NSWS+IS+G     LP  L  WFP
Sbjct  140   SQPILAIQVTELLDGVFIGFTINHVVSDGKSFWHFVNSWSQISKGHKIAKLPS-LKRWFP  198

Query  968   GNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEMGTDSI--SSL  795
              +I  P+ LPF   +     SF   P  ER+FHF+K+ IA+LK KAN+E  T+ I  SSL
Sbjct  199   NDIELPIKLPFTTTELLKEPSFNKLP--ERIFHFTKEKIAELKSKANAEAETEKIKISSL  256

Query  794   QSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKLAKANAGEL  615
             Q+ ++H+WR + R +RL+P E+V   + IG R R  P L E Y+GNA         AGE+
Sbjct  257   QAVLSHVWRCVIRCKRLDPQEEVRYVLLIGVRPRMVPQLEEEYFGNAALVCGVTMKAGEV  316

Query  614   LKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIASSPRNNVY  435
              + G+G  A ++++++S+   E+++E Y+ W+++P +     +   N L  +SSPR +VY
Sbjct  317   QESGIGNVAMEMNKMISLHSDEKIMESYECWLRTPRLLTIGGMTGGNSLATSSSPRFDVY  376

Query  434   ATDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDIEVCLLPHTLHTLGNDQEFM  267
               DFGWGKPVAVR G  NK +GK S+F G ++GS+DIEVCL    L  +GND EFM
Sbjct  377   GNDFGWGKPVAVRSGGANKNNGKISVFVGADEGSMDIEVCLPFEILEAMGNDTEFM  432



>ref|XP_003524646.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Glycine 
max]
 gb|KHN42862.1| Putative acetyltransferase [Glycine soja]
Length=436

 Score =   266 bits (681),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 134/303 (44%), Positives = 192/303 (63%), Gaps = 2/303 (1%)
 Frame = -1

Query  1157  KGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQLSLPPVLDP  978
             +G S PLL VQVTEL DG F+ + +NH  AD  SFWHF NSW+EISRG P++S  P L  
Sbjct  135   EGTSQPLLAVQVTELVDGIFVAVTINHIVADGKSFWHFVNSWAEISRGNPKISKLPTLQR  194

Query  977   WFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEMGTDS-IS  801
              F   I  P+  PF  ++   S +    PL  R+FHF+K+ + +LK KAN+E  TD  IS
Sbjct  195   CFLDGIDCPILFPFTKEEHLHSPNLKRQPLPNRIFHFTKEKVLELKSKANAEANTDKIIS  254

Query  800   SLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKLAKANAG  621
             SLQ+ +  LWR++ R + + P E+V   + IG R R  PPL E Y+GNAI +      AG
Sbjct  255   SLQALLTLLWRSVIRCQHVGPQEEVHFVLLIGVRARMIPPLEEDYFGNAILAGRVTMKAG  314

Query  620   ELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIASSPRNN  441
             ELL+ GLG  A +I++++S+  HE+V   Y++  ++P+++    +  AN L I+SSPR +
Sbjct  315   ELLEGGLGKGALEINKMISLHSHEKVKNHYESLARTPMLSTPG-IGAANSLMISSSPRFD  373

Query  440   VYATDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDIEVCLLPHTLHTLGNDQEFMEF  261
             +Y  DFGWGKPVAVR G  N  +GK ++F G ++ S+DI V L    L  +GND EF++ 
Sbjct  374   IYGNDFGWGKPVAVRSGDANIGNGKVTVFAGSKEDSIDIHVSLPYEILEAMGNDPEFVDA  433

Query  260   VTH  252
             +++
Sbjct  434   ISY  436



>ref|XP_007224078.1| hypothetical protein PRUPE_ppa015472mg [Prunus persica]
 gb|EMJ25277.1| hypothetical protein PRUPE_ppa015472mg [Prunus persica]
Length=465

 Score =   267 bits (683),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 145/321 (45%), Positives = 191/321 (60%), Gaps = 16/321 (5%)
 Frame = -1

Query  1169  TTSRKGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRG--------  1014
               +  G +  LL  QVTEL DG FIGL+MNH  AD +S+WHFFN+WSEI +         
Sbjct  145   AVNHDGHTMSLLTAQVTELVDGIFIGLSMNHCLADGTSYWHFFNTWSEIFQAQTQTHASQ  204

Query  1013  ----MPQLSLPPVLDPWFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAK  846
                 +P +S PPVL  WFP      + LP+    E +   F  P L ER+FHFS + +AK
Sbjct  205   NNNIIPYISRPPVLKRWFPEGHDPIISLPYTHPDEFIGR-FEAPKLRERMFHFSSEALAK  263

Query  845   LKEKANSEMGTDSISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGY  666
             LK KAN+E  T  ISS QS  A LWR ITR RRL P++  S  +    R R +PPL   Y
Sbjct  264   LKAKANAEAKTTKISSFQSLSALLWRCITRVRRLPPSQSTSCRLAANNRARLDPPLSGDY  323

Query  665   WGNAIHS-KLAKANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSK  489
             +GN+IH  K     AGELL+ GLGWAAW++HE V   D + + EF   W++S ++ Q  +
Sbjct  324   FGNSIHPIKSEVVTAGELLEHGLGWAAWKLHEAVVNLDDKSIREFIDAWLQSRMVYQIGQ  383

Query  488   VFFANFLGIASSPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDIEVCLL  309
              F  + + + SSP  N+Y  +FG GK +A+R G  NK  GK S +PG E+GS+D+EVCL+
Sbjct  384   FFDPHSVMMGSSPWFNMYGNEFGMGKALALRSGYANKFSGKVSSYPGGERGSIDLEVCLV  443

Query  308   PHTLHTLGNDQEFMEF--VTH  252
             P  +  +  D EFME   VTH
Sbjct  444   PDAMGAIECDHEFMEAASVTH  464



>emb|CDP11973.1| unnamed protein product [Coffea canephora]
Length=454

 Score =   267 bits (682),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 140/304 (46%), Positives = 188/304 (62%), Gaps = 5/304 (2%)
 Frame = -1

Query  1154  GISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQ---LSLPPVL  984
             G + PLL +QVTEL DG F+G + NH   D +S+WHFFN+WSEI     Q   +S PP+ 
Sbjct  146   GHTRPLLTIQVTELIDGIFMGCSANHMIVDGTSYWHFFNTWSEIFNAKGQKIAISRPPIH  205

Query  983   DPWFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEMGTDSI  804
               WF       L LPF    +        P + ERVFHFS +++AKLK KAN+E  T  I
Sbjct  206   KRWFLEGHGPILSLPF-THHDQFVRRHEAPQMRERVFHFSSESLAKLKAKANAESDTTKI  264

Query  803   SSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKLAKANA  624
             SSLQ+  AH+WR ITR R L P ++ S  + I  R R  PP+P+ Y GN I +  A A A
Sbjct  265   SSLQALAAHVWRCITRTRNLPPDQETSCMMAINNRTRLCPPVPQEYVGNCIQAVRATAAA  324

Query  623   GELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIASSPRN  444
             GELL RGLGW++ ++H  V     E V  + ++W++SPVI Q ++      + + SSPR 
Sbjct  325   GELLDRGLGWSSSKLHLAVHNHTDEIVRNWVESWLQSPVIYQAAEFIDPCSVLMGSSPRF  384

Query  443   NVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLE-KGSVDIEVCLLPHTLHTLGNDQEFM  267
             N+Y ++FG GK VA+R G  NK DGK S FPG+E  GS+D+E+CL PH++  L +D+EFM
Sbjct  385   NMYGSEFGLGKAVAIRSGYANKFDGKVSSFPGVEGGGSMDLEICLRPHSMSLLESDEEFM  444

Query  266   EFVT  255
               VT
Sbjct  445   GAVT  448



>emb|CDP06258.1| unnamed protein product [Coffea canephora]
Length=453

 Score =   266 bits (680),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 142/309 (46%), Positives = 188/309 (61%), Gaps = 8/309 (3%)
 Frame = -1

Query  1166  TSRKGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQLSL---  996
              +  G S  L+ +QVTEL DG FIG + NH   D +SFWHF N+WSE+     Q+S    
Sbjct  147   VNHDGHSMSLISIQVTELKDGIFIGWSTNHLLVDGTSFWHFINTWSEVFNAKGQISTISR  206

Query  995   PPVLDPWFP-GNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEM  819
             PP+L  WFP G+ +    LPF    E +S  F  P L ER FHFS +++AKLK KAN+E 
Sbjct  207   PPILKRWFPEGHRSPVFSLPFAHHDEFISR-FQTPELLERYFHFSAESLAKLKAKANAEC  265

Query  818   GTDSISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKL  639
              + +IS+ Q+  A LWR ITRAR +   +  S    + +R R NPPL E Y+GN I    
Sbjct  266   NSTNISTFQALSALLWRCITRARNMPSDQQTSAGTAVNSRLRINPPLSEEYFGNCIQGVA  325

Query  638   AKANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIA  459
                  GELL  GLGWAAW++H++V  Q    + E+ ++WVKSP I    +  F+N + I 
Sbjct  326   VTTTCGELLTNGLGWAAWKLHDLVINQTDRSIREWVESWVKSPFIVWIGR--FSNRIQIG  383

Query  458   SSPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLE-KGSVDIEVCLLPHTLHTLGN  282
             +SPR N+Y  +FG GK +AVR G  NK DGK +LFPG E  GS+D+E CL   T+  L +
Sbjct  384   NSPRFNIYGNEFGLGKALAVRSGFANKLDGKITLFPGREGGGSMDVEACLPQQTMSFLES  443

Query  281   DQEFMEFVT  255
             DQEFME V+
Sbjct  444   DQEFMENVS  452



>ref|XP_003523952.2| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Glycine 
max]
 gb|ABC47845.1| N-hydroxycinnamoyl/benzoyltransferase 3 [Glycine max]
Length=486

 Score =   266 bits (681),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 140/312 (45%), Positives = 191/312 (61%), Gaps = 9/312 (3%)
 Frame = -1

Query  1166  TSRKGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQ------  1005
              +  G + PLL +QVTEL D  FIG +MNHT  D +S+W+FFN+WS+I +   Q      
Sbjct  170   VNHDGHTMPLLSIQVTELVDAVFIGCSMNHTLGDGTSYWNFFNTWSQIFQSQAQGHEYNV  229

Query  1004  -LSLPPVLDPWFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKAN  828
              +S PP+L+ WFP +    + LPF    E + + F  P L ERVFHFS ++IAKLK KAN
Sbjct  230   PISHPPILNRWFPSDCDPSVNLPFKHHDEFICN-FEAPFLRERVFHFSAESIAKLKAKAN  288

Query  827   SEMGTDSISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIH  648
             SE  T  ISS QS  A +WR+IT AR +   +  S  + I  R R  PP+PE Y+GN + 
Sbjct  289   SESNTTKISSFQSLSALVWRSITLARSVPYEQKTSCKMAINNRSRMEPPMPEEYFGNLVQ  348

Query  647   SKLAKANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFL  468
                A+    ELL+  LGWAAW +H  V+  + + V++  Q W++SP I Q  ++F    +
Sbjct  349   VVSAETTTRELLENDLGWAAWLLHVAVTNHNDKVVLQSLQGWLQSPFIPQIGRLFDPYSV  408

Query  467   GIASSPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLE-KGSVDIEVCLLPHTLHT  291
              + SSPR N Y  +FG GK VA+R G  NK DGK + +PG E  GS+D+EVCLLPH +  
Sbjct  409   LMGSSPRFNKYGCEFGMGKAVAIRSGYANKFDGKVTSYPGREGGGSIDLEVCLLPHIMRA  468

Query  290   LGNDQEFMEFVT  255
             L +D+EFM  V+
Sbjct  469   LESDKEFMNAVS  480



>gb|ACU20865.1| unknown [Glycine max]
Length=459

 Score =   266 bits (679),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 140/312 (45%), Positives = 191/312 (61%), Gaps = 9/312 (3%)
 Frame = -1

Query  1166  TSRKGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQ------  1005
              +  G + PLL +QVTEL D  FIG +MNHT  D +S+W+FFN+WS+I +   Q      
Sbjct  143   VNHDGHTMPLLSIQVTELVDAVFIGCSMNHTLGDGTSYWNFFNTWSQIFQSQAQGHGYNV  202

Query  1004  -LSLPPVLDPWFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKAN  828
              +S PP+L+ WFP +    + LPF    E + + F  P L ERVFHFS ++IAKLK KAN
Sbjct  203   PISHPPILNRWFPSDCDPSVNLPFKHHDEFICN-FEAPFLRERVFHFSAESIAKLKAKAN  261

Query  827   SEMGTDSISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIH  648
             SE  T  ISS QS  A +WR+IT AR +   +  S  + I  R R  PP+PE Y+GN + 
Sbjct  262   SESNTTKISSFQSLSALVWRSITLARSVPYEQKTSCKMAINNRSRMEPPMPEEYFGNLVQ  321

Query  647   SKLAKANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFL  468
                A+    ELL+  LGWAAW +H  V+  + + V++  Q W++SP I Q  ++F    +
Sbjct  322   VVSAETTTRELLENDLGWAAWLLHVAVTNHNDKVVLQSLQGWLQSPFIPQIGRLFDPYSV  381

Query  467   GIASSPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLE-KGSVDIEVCLLPHTLHT  291
              + SSPR N Y  +FG GK VA+R G  NK DGK + +PG E  GS+D+EVCLLPH +  
Sbjct  382   LMGSSPRFNKYGCEFGMGKAVAIRSGYANKFDGKVTSYPGREGGGSIDLEVCLLPHIMRA  441

Query  290   LGNDQEFMEFVT  255
             L +D+EFM  V+
Sbjct  442   LESDKEFMNAVS  453



>gb|ABC47861.1| N-hydroxycinnamoyl/benzoyltransferase 2 [Glycine max]
Length=436

 Score =   265 bits (677),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 138/311 (44%), Positives = 193/311 (62%), Gaps = 9/311 (3%)
 Frame = -1

Query  1163  SRKGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQ-------  1005
             +  G + PLL +QVTEL DG FIG +MNH+  D +S+W+FFN+WS I +   Q       
Sbjct  123   NHDGHTMPLLSIQVTELVDGVFIGCSMNHSVGDGTSYWNFFNTWSHIFQAQAQGHETDLP  182

Query  1004  LSLPPVLDPWFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANS  825
             +S  P+   WFP + A P+ LPF    E +S  F  P + ERVF FS ++IAKLK KAN 
Sbjct  183   ISHRPIHSRWFPNDCAPPINLPFKHHDEFISR-FEAPLMRERVFQFSAESIAKLKAKANM  241

Query  824   EMGTDSISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHS  645
             E  T  ISS QS  AH+WR+ITRA  L   +  S  +   +R R  PPLP+ Y+GN+++ 
Sbjct  242   ESNTTKISSFQSLSAHVWRSITRACSLPYEQRTSCRLTANSRTRMEPPLPQEYFGNSVNR  301

Query  644   KLAKANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLG  465
               A+   GELL+  LGWAAW++H  V+  +++ V++  + W++SP+I Q  +      + 
Sbjct  302   VSAETTVGELLENDLGWAAWKLHMAVANHNNKVVLQSLKEWLQSPLIYQIGQAMDPYVVL  361

Query  464   IASSPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLE-KGSVDIEVCLLPHTLHTL  288
             I+SSPR N+Y  +FG GK VA R G  NK DGK + +PG E  GS+D+EV LLPH +  L
Sbjct  362   ISSSPRFNMYGNEFGMGKAVAARSGYANKFDGKVTSYPGREGGGSIDLEVGLLPHIMSAL  421

Query  287   GNDQEFMEFVT  255
              +D+EFM  V+
Sbjct  422   ESDREFMNAVS  432



>gb|KJB64133.1| hypothetical protein B456_010G034300 [Gossypium raimondii]
Length=438

 Score =   265 bits (677),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 135/306 (44%), Positives = 193/306 (63%), Gaps = 9/306 (3%)
 Frame = -1

Query  1157  KGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQLSLPPVLDP  978
             +G+S PLLGVQVTEL DG FIG+  NH+  D +SFWHFFNSWS ISRG+  L   PV   
Sbjct  133   EGVSNPLLGVQVTELVDGIFIGITANHSVLDGTSFWHFFNSWSAISRGLIHLPKLPVFQR  192

Query  977   WFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEMGTDS---  807
              F  +I  P+ +      +     F  P  +ERVFHFSK +I  LK +AN+E+GT +   
Sbjct  193   RFFNSINFPIQIS-KSHVQNFPDDFVVPLFKERVFHFSKQSIVTLKARANAEVGTGTTNQ  251

Query  806   ---ISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKLA  636
                ISSLQ+ ++HLW++I R + L P ED      IG R R +  LP+ Y+GN + ++  
Sbjct  252   MAQISSLQALLSHLWQSIMRNKNLEPNEDTHYCFIIGGRQRLHD-LPQEYFGNVVKNQKV  310

Query  635   KANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIAS  456
                  +LL++G+G  A ++++V++    E+  +F + W+ SP + + S +  +  L  +S
Sbjct  311   TMKVKQLLEQGVGSVALEMNKVIAANTGEDFNKFIETWIASPELLKISTIS-SRTLATSS  369

Query  455   SPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDIEVCLLPHTLHTLGNDQ  276
             SPR ++Y  DFGWGKP+AVR G  NK DGK +LF G E+GS+D+E CL P TL+ LGND+
Sbjct  370   SPRFDMYGNDFGWGKPIAVRSGSANKFDGKITLFCGAEEGSIDVEACLSPETLNALGNDE  429

Query  275   EFMEFV  258
             EFM+ +
Sbjct  430   EFMDAI  435



>ref|XP_004289211.2| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Fragaria 
vesca subsp. vesca]
Length=464

 Score =   265 bits (678),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 148/325 (46%), Positives = 201/325 (62%), Gaps = 20/325 (6%)
 Frame = -1

Query  1172  LTTSRKGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRG-------  1014
             L  + +GIS PLL  QVTEL DG FIG ++NH   D +SFWHFFN+WSEISR        
Sbjct  135   LVGNYEGISKPLLVAQVTELVDGIFIGCSINHAVIDGTSFWHFFNTWSEISRSGSVHDNV  194

Query  1013  MPQLSLP--PVLDPWF-PGNIARPLCLPF---DLQQETLSSSFTPPPLEERVFHFSKDTI  852
               Q+S    PV    F  G I  P+ +PF    +Q++ +  + +     +R+FHF K+ +
Sbjct  195   ASQISTSNSPVFGRRFLDGLIDLPVQIPFSQIQIQEKLVPHTTSSSNYIQRMFHFPKEKV  254

Query  851   AKLKEKANSEMGTDSISSLQSYVAHLWRAITRARRLNPTEDVSIY--VPIGTRWRTNPPL  678
             A LK KAN+EM  +SISSLQ+ +AHLWRA  R+ R + T D  I   V +G R R +PPL
Sbjct  255   AGLKAKANAEMSINSISSLQALMAHLWRATIRSTRHDMTTDQEIIYRVAVGLRQRMDPPL  314

Query  677   PEGYWGNAIHSKLAKANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQ  498
             PE Y GNA+ +   K+   +LL  GLGW A QI++ +S    EE  ++ ++WVK P  + 
Sbjct  315   PEKYSGNALLTVPVKSTVADLLHHGLGWVALQINKAISSITAEETKKYLEDWVKCPTFSS  374

Query  497   KSK-----VFFANFLGIASSPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGS  333
              ++     ++ +  L   SSPR NVY  DFGWG+P+AVR G  NK  GK ++FPG E+GS
Sbjct  375   NTRGVSTAIWSSTSLLTGSSPRFNVYGNDFGWGRPLAVRSGAANKNPGKLTVFPGAEEGS  434

Query  332   VDIEVCLLPHTLHTLGNDQEFMEFV  258
             VD +VCLLP TL ++G+D EFME V
Sbjct  435   VDFQVCLLPGTLESIGDDAEFMEAV  459



>ref|XP_003605008.1| Acetyltransferase, putative [Medicago truncatula]
 gb|AES87205.1| HXXXD-type acyl-transferase family protein [Medicago truncatula]
Length=443

 Score =   265 bits (676),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 142/316 (45%), Positives = 200/316 (63%), Gaps = 14/316 (4%)
 Frame = -1

Query  1163  SRKGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMP--QLSLPP  990
             S +G S PLL VQVTEL DG FIG + NH   D  S WHF NSW+EISR     Q+S PP
Sbjct  130   SYEGTSKPLLAVQVTELVDGIFIGCSFNHVVVDGKSVWHFINSWAEISRSCCHHQISKPP  189

Query  989   VLDPWFPGNIARPLCLPFDLQQET-----LS-SSFTPPP--LEERVFHFSKDTIAKLKEK  834
              L+ WFP  + RP+  PF L+Q+      LS SSF      L  R+FHF+K+ I +LK K
Sbjct  190   TLERWFPNGVQRPIRFPFTLEQQNDHSDRLSFSSFNEEKYCLSNRLFHFTKEKILQLKSK  249

Query  833   ANSEMGTDSISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNA  654
              N E+GT  ISSLQ+ + H+W  +TR ++ +P E+V   V IG R R  PPLPE Y+GNA
Sbjct  250   INEEIGTTKISSLQALLTHVWCYVTRFKQFDPQEEVFNRVVIGVRPRLVPPLPEDYFGNA  309

Query  653   IHSKLAKANAGELLKR-GLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFA  477
             + S + K  AGELL+  GL   A +++++++    E++   Y++W+++P   + +K    
Sbjct  310   LISCMVKMKAGELLEEGGLCKGALEMNKLIASHTDEKLKNHYESWLRNPSFFRLAKNMVK  369

Query  476   -NFLGIASSPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDIEVCLLPHT  300
              NF+ I+SSP  +VY  DFGWGKP+AVR G   K +G  ++F G+E+GS+D++VCL    
Sbjct  370   NNFISISSSPWFDVYGNDFGWGKPLAVRSGY--KINGLITVFAGIEEGSIDLQVCLPREI  427

Query  299   LHTLGNDQEFMEFVTH  252
             L  +GND  FM+ V++
Sbjct  428   LEGMGNDPNFMDVVSN  443



>ref|XP_003528298.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Glycine 
max]
 gb|KHN22331.1| Putative acetyltransferase [Glycine soja]
Length=457

 Score =   265 bits (677),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 138/311 (44%), Positives = 193/311 (62%), Gaps = 9/311 (3%)
 Frame = -1

Query  1163  SRKGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQ-------  1005
             +  G + PLL +QVTEL DG FIG +MNH+  D +S+W+FFN+WS I +   Q       
Sbjct  144   NHDGHTMPLLSIQVTELVDGVFIGCSMNHSVGDGTSYWNFFNTWSHIFQAQAQGHETDLP  203

Query  1004  LSLPPVLDPWFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANS  825
             +S  P+   WFP + A P+ LPF    E +S  F  P + ERVF FS ++IAKLK KAN 
Sbjct  204   ISHRPIHSRWFPNDCAPPINLPFKHHDEFISR-FEAPLMRERVFQFSAESIAKLKAKANM  262

Query  824   EMGTDSISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHS  645
             E  T  ISS QS  AH+WR+ITRA  L   +  S  +   +R R  PPLP+ Y+GN+++ 
Sbjct  263   ESNTTKISSFQSLSAHVWRSITRACSLPYEQRTSCRLTANSRTRMEPPLPQEYFGNSVNR  322

Query  644   KLAKANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLG  465
               A+   GELL+  LGWAAW++H  V+  +++ V++  + W++SP+I Q  +      + 
Sbjct  323   VSAETTVGELLENDLGWAAWKLHMAVANHNNKVVLQSLKEWLQSPLIYQIGQAMDPYVVL  382

Query  464   IASSPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLE-KGSVDIEVCLLPHTLHTL  288
             I+SSPR N+Y  +FG GK VA R G  NK DGK + +PG E  GS+D+EV LLPH +  L
Sbjct  383   ISSSPRFNMYGNEFGMGKAVAARSGYANKFDGKVTSYPGREGGGSIDLEVGLLPHIMSAL  442

Query  287   GNDQEFMEFVT  255
              +D+EFM  V+
Sbjct  443   ESDREFMNAVS  453



>ref|XP_009365277.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Pyrus 
x bretschneideri]
Length=458

 Score =   265 bits (676),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 146/314 (46%), Positives = 192/314 (61%), Gaps = 11/314 (4%)
 Frame = -1

Query  1169  TTSRKGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQ-----  1005
               +  G +  LL +QVTEL DG FIGL+MNH   D +SFWHFFN WSEI +   Q     
Sbjct  143   AVNHDGHTMSLLTIQVTELVDGIFIGLSMNHCLGDGTSFWHFFNIWSEIFQAQAQGDNNS  202

Query  1004  ---LSLPPVLDPWFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEK  834
                +S PPVL+ WFP      + LPF    E +   F  PPL ER+FHFS +++AKLK K
Sbjct  203   VATISRPPVLERWFPDGHGPIISLPFKHSDEFIGR-FEAPPLRERMFHFSAESLAKLKAK  261

Query  833   ANSEMGTDSISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNA  654
             AN+E  T  ISS QS  A LWR+ITRAR   P +  S  +    R R +PPL   Y+GN+
Sbjct  262   ANAESDTTKISSFQSLSALLWRSITRARCQPPDQGTSCRLAANNRARLDPPLSGDYFGNS  321

Query  653   IHSKLAK-ANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFA  477
             I+   +K   AGELL+ GLGWAA ++HE V   + + + E    W++SPV+ Q S VF  
Sbjct  322   IYPISSKMVPAGELLEHGLGWAARKLHEAVVNHNDKVIREHTNAWLESPVVYQVS-VFEP  380

Query  476   NFLGIASSPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDIEVCLLPHTL  297
               + I SSPR N+Y T+FG GK VA+R G  +K  GK S + G ++GS+D+EVCL+P  +
Sbjct  381   LSVTIGSSPRFNMYGTEFGMGKAVALRSGYAHKFSGKVSSYEGRKEGSMDMEVCLVPDAM  440

Query  296   HTLGNDQEFMEFVT  255
               L  D+EFMEF +
Sbjct  441   SALECDKEFMEFAS  454



>ref|XP_002282951.2| PREDICTED: uncharacterized protein LOC100245729 [Vitis vinifera]
Length=949

 Score =   275 bits (703),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 139/300 (46%), Positives = 182/300 (61%), Gaps = 2/300 (1%)
 Frame = -1

Query  1154  GISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQLSLPPVLDPW  975
             G++ PLL VQVTEL DG F+G ++NH   D  SFWHFFNSWSEISRG  ++S+ PV   W
Sbjct  648   GVTQPLLAVQVTELVDGIFVGCSLNHVVGDGKSFWHFFNSWSEISRGPNKISVSPVFKRW  707

Query  974   FPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEMGTDSISSL  795
             F  +   P+ +P            T  P++E VF  +K+ IA LK +AN+EMG D ISSL
Sbjct  708   FGDDTDYPIRIPRSAM--VFDRPITSSPVQEMVFRSAKEKIAGLKARANAEMGIDRISSL  765

Query  794   QSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKLAKANAGEL  615
             Q+ +AHLWR   R RRL   ++ S ++ I  R R  P +P+ Y+G A+         GEL
Sbjct  766   QALLAHLWRCTIRTRRLPEDQETSYHLCIDMRTRRRPQMPQQYFGVALQRGTLTMKVGEL  825

Query  614   LKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIASSPRNNVY  435
             L  GLG  AWQ+++++S     E   F ++W K P     S V  +N   +ASSPR NVY
Sbjct  826   LGMGLGHVAWQMNKMISTFTEVEATNFLESWAKDPKPISYSTVTMSNAFIMASSPRFNVY  885

Query  434   ATDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDIEVCLLPHTLHTLGNDQEFMEFVT  255
              TDFGWG+PVAVR G   K DGK ++  G E+GS+DIEVC  P TL  +  D +FME VT
Sbjct  886   GTDFGWGRPVAVRSGGGIKLDGKTTISQGAEEGSIDIEVCSSPETLQAMLEDADFMEAVT  945


 Score =   268 bits (685),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 138/300 (46%), Positives = 181/300 (60%), Gaps = 8/300 (3%)
 Frame = -1

Query  1157  KGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQLSLPPVLDP  978
             + ++ PLL VQVTEL DG F+G  +N   AD  SFWHFFNSWSEISRG  ++SL PV   
Sbjct  146   QDVTQPLLSVQVTELVDGIFVGCTLNRVLADGKSFWHFFNSWSEISRGSNKISLSPVFKR  205

Query  977   WFPGNIARPLCLP---FDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEMGTDS  807
             WF  +   P+ +P      ++ T SS     P++E  FHFSK  IA LK +AN+EMGTD 
Sbjct  206   WFGDDTHYPIRIPQSAMVFERPTTSS-----PVQEMFFHFSKGKIAGLKARANAEMGTDR  260

Query  806   ISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKLAKAN  627
             ISSLQ+ +AH WR+  RAR L   ++    + I  R R +P +P+ Y+G A+   +    
Sbjct  261   ISSLQALMAHFWRSTIRARHLPEDQETICTLAIDMRPRRHPQMPQQYFGVAVQGGIVTMK  320

Query  626   AGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIASSPR  447
              GELL  GLG  AWQ+++++S     +   F ++W K P  A  S +     L +A SPR
Sbjct  321   VGELLGMGLGHVAWQMNKIISTFTEVKATNFLKSWAKDPKPATDSTIMMRIALIMAGSPR  380

Query  446   NNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDIEVCLLPHTLHTLGNDQEFM  267
              NVY  DFGWG+PVAVR G   K +GK + F G E+GS+DIE CL P TL  L  D EFM
Sbjct  381   FNVYGNDFGWGRPVAVRGGGGIKLNGKATSFQGAEEGSIDIEACLSPETLKALMEDAEFM  440



>ref|XP_007204008.1| hypothetical protein PRUPE_ppa025918mg [Prunus persica]
 gb|EMJ05207.1| hypothetical protein PRUPE_ppa025918mg [Prunus persica]
Length=452

 Score =   264 bits (674),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 155/320 (48%), Positives = 196/320 (61%), Gaps = 14/320 (4%)
 Frame = -1

Query  1178  FCLTTSR--KGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISR-GMP  1008
             F L   R  +G+S PLL  QVTEL DG FIG ++NH  AD +SFWHFFN+W+EISR G  
Sbjct  133   FSLNEVRNYEGVSKPLLSAQVTELLDGIFIGCSLNHLVADGTSFWHFFNTWAEISRSGSH  192

Query  1007  QLSLP-PVLDPWF-PGNIARPLCLPFD----LQQETLSSSFTPPPLEERVFHFSKDTIAK  846
             ++  P PV    F  G I  P+ LPF     + +  + SS     L+  VFHF K+ IAK
Sbjct  193   KILQPRPVFGRQFLDGVIDLPVHLPFSYSEIIGEPIIKSSSFNAFLQRVVFHFPKEKIAK  252

Query  845   LKEKANSEMGTDS-ISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNP-PLPE  672
             LK KAN+EMGT S ISSLQ+ +AHLW+A TRAR L P + V+    IG R R  P  LP+
Sbjct  253   LKAKANAEMGTTSNISSLQALMAHLWQATTRARHLQPDQQVNYRFAIGLRQRWEPETLPK  312

Query  671   GYWGNAIHSKLAKANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIA--Q  498
              Y G AI      A A ELL+ GLGWAA QI++ +S    E+      +WV  P +    
Sbjct  313   EYLGTAIIGVNVTAIASELLQNGLGWAASQINKKISSLTPEQARNDLVDWVNKPTLIPNM  372

Query  497   KSKVFFANFLGIASSPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDIEV  318
             ++    A  L   SSPR NVY  DFGWG+P+AVR G  +K DGK ++FPG E+GS+D E 
Sbjct  373   RNPTLLARLL-TGSSPRFNVYGNDFGWGRPLAVRSGAGDKMDGKLTVFPGAEEGSIDFEA  431

Query  317   CLLPHTLHTLGNDQEFMEFV  258
             CLLP T+ T+ +D EFME V
Sbjct  432   CLLPETIQTMMDDAEFMEAV  451



>gb|KEH31451.1| HXXXD-type acyl-transferase family protein [Medicago truncatula]
Length=431

 Score =   263 bits (673),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 131/299 (44%), Positives = 186/299 (62%), Gaps = 8/299 (3%)
 Frame = -1

Query  1148  STPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQLSLPPVLDPWFP  969
             S P+L VQVTEL +G FI   +NH   D  SFWHF NSWSEIS+G  ++S  P    WFP
Sbjct  131   SQPILAVQVTELSNGIFIAFTVNHVVLDGKSFWHFVNSWSEISKGSHKISKLPSFQRWFP  190

Query  968   GNIARPLCLPFDLQQETLSSSFTPPP-LEERVFHFSKDTIAKLKEKANSEMGTDS----I  804
              N+  P+  PF    +T S    P   L ER+FHF+K+ IA+LK KAN E  T++    I
Sbjct  191   NNVELPIRFPF---TKTESQCRKPRQNLPERIFHFTKEKIAELKSKANEETKTENVQIKI  247

Query  803   SSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKLAKANA  624
             SSLQ+ + H+WR + R ++L+P ED    + IG R R  PPL EGY+GNA          
Sbjct  248   SSLQALLTHVWRCVVRCKKLDPEEDFRYVLSIGVRPRMIPPLDEGYFGNAAIFGGVTMKV  307

Query  623   GELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIASSPRN  444
             GE+L+ G+G  A ++++++ ++  E++ + Y+ W++ P + +   +  +N L  +SS R 
Sbjct  308   GEILECGIGKVALEMNKMIMLRSDEKIRDDYECWLRMPKLFEVGNLAGSNSLATSSSQRF  367

Query  443   NVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDIEVCLLPHTLHTLGNDQEFM  267
             +VY  DFGWGKPV VR G  NK++GK +++ G E+GS+DIEVCL    L  LGND EF+
Sbjct  368   DVYGNDFGWGKPVGVRSGGSNKSNGKITVYAGAEEGSIDIEVCLSFEILEALGNDAEFL  426



>gb|KCW66380.1| hypothetical protein EUGRSUZ_F00196, partial [Eucalyptus grandis]
Length=365

 Score =   261 bits (667),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 143/308 (46%), Positives = 180/308 (58%), Gaps = 8/308 (3%)
 Frame = -1

Query  1154  GISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQ-------LSL  996
             G +  LL VQVTEL DG FIGL+MNHT  D +SFW FFNSWS+I +   +       LS 
Sbjct  56    GHTLSLLSVQVTELADGVFIGLSMNHTIGDGTSFWLFFNSWSKIFQAQEKGAVDVVPLSR  115

Query  995   PPVLDPWFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEMG  816
             PP L  WFP N   PL LP+     +L + F  P L ERVFHFS D IA LK +AN + G
Sbjct  116   PPALTRWFPENHPGPLSLPYTDDPSSLLARFEAPELRERVFHFSADAIAGLKAEANRQCG  175

Query  815   TDSISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKLA  636
             T SISS QS  A +WR I RARR  P++     +    R R +PPL   Y+GN+I     
Sbjct  176   TTSISSFQSLTALVWRCIARARRFPPSQVTGCRMAANNRARLDPPLSPEYFGNSITPVRT  235

Query  635   KANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIAS  456
              A  GELL  GLGWAA  +H  V+     ++ E+ ++W+K P +    K F    + + S
Sbjct  236   AAKVGELLGSGLGWAARLLHTAVAEHSSAKLREWNEDWIKRPQVYHLDKTFDQYSIMMGS  295

Query  455   SPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLE-KGSVDIEVCLLPHTLHTLGND  279
             SPR + Y  +FG GK VA+R G  NK DGK S +PG E  GS+D+E+CL P T+  L  D
Sbjct  296   SPRFDKYGNEFGLGKAVALRSGYANKFDGKVSAYPGHEGGGSIDLEICLPPTTMALLEAD  355

Query  278   QEFMEFVT  255
              EFM  VT
Sbjct  356   PEFMAAVT  363



>ref|XP_003523954.1| PREDICTED: uncharacterized acetyltransferase At3g50280 [Glycine 
max]
 gb|ABC47844.1| N-hydroxycinnamoyl/benzoyltransferase 2 [Glycine max]
Length=460

 Score =   264 bits (675),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 139/312 (45%), Positives = 191/312 (61%), Gaps = 9/312 (3%)
 Frame = -1

Query  1166  TSRKGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQ------  1005
              +  G S PLL +QVTEL DG F+G +MNH   D +S+W+FFN+WS+I +   +      
Sbjct  144   VNHDGHSMPLLSIQVTELVDGVFLGCSMNHAVGDGTSYWNFFNTWSQIFQSQAKGHETDV  203

Query  1004  -LSLPPVLDPWFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKAN  828
              +S  P+L  WFP + A P+ LPF    E +S  F  P + ERVFHFS ++IAKLK KAN
Sbjct  204   PISHQPILSRWFPNDCAPPINLPFKHHDEFISR-FEAPLMRERVFHFSAESIAKLKAKAN  262

Query  827   SEMGTDSISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIH  648
              E  T  ISS QS  A +WR+ITRA  L   +  S  +    R R  PPLP+ Y+GN++ 
Sbjct  263   MESDTTKISSFQSLSALVWRSITRACSLPYEQRTSCRLTANNRTRMEPPLPQEYFGNSVS  322

Query  647   SKLAKANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFL  468
                A+   GELL+  LGWAAW++H  V+  +   V++  + W++SP+I Q  +      +
Sbjct  323   RVSAETTVGELLENNLGWAAWKLHLAVTNHNDRVVLQSLKEWLQSPLIYQLGQPMDPYVV  382

Query  467   GIASSPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLE-KGSVDIEVCLLPHTLHT  291
              I+SSPR N+Y  +FG GK VAVR G  NK DGK + +PG E  GS+D+EV LLPH +  
Sbjct  383   LISSSPRFNMYGNEFGMGKAVAVRSGYANKFDGKVTSYPGREGGGSIDLEVGLLPHIMSA  442

Query  290   LGNDQEFMEFVT  255
             L +D+EFM  V+
Sbjct  443   LESDEEFMNVVS  454



>ref|XP_010109796.1| putative acetyltransferase [Morus notabilis]
 gb|EXC24722.1| putative acetyltransferase [Morus notabilis]
Length=535

 Score =   266 bits (680),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 140/304 (46%), Positives = 186/304 (61%), Gaps = 13/304 (4%)
 Frame = -1

Query  1142  PLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISR-----GMPQLSLPPVLDP  978
             PLL VQVTE+ DG FI   MNH A D  SFWHFFN WSEISR      + + S P     
Sbjct  153   PLLAVQVTEVVDGIFIACTMNHCAGDGKSFWHFFNVWSEISRQSFDGSVSRCSRPVFGRE  212

Query  977   WFPGNIARPLCLPFDLQQ-ETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEM------  819
              F G +  P+  PF       +    +PP L++R+F FSK  IA+LK KA++EM      
Sbjct  213   RFDGFVNLPISFPFSRDSISKVKREVSPPNLQQRMFRFSKAKIAELKAKASAEMEIITES  272

Query  818   GTDSISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKL  639
                +ISSLQ+ +AHL  ++TR RR++P E+V   V +G R R  PPLPEGY+G+A    +
Sbjct  273   NEIAISSLQALLAHLCISVTRNRRIDPDEEVGYKVAVGMRTRIQPPLPEGYFGSAALVVM  332

Query  638   AKANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIA  459
              K  A ELL+ GLGW+AW+I+  ++ Q   EV +  ++W + P +    K+  AN L   
Sbjct  333   PKCTARELLENGLGWSAWKINRAIASQTATEVRKLLEDWAQRPTLPYIGKI-LANTLLTG  391

Query  458   SSPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDIEVCLLPHTLHTLGND  279
             SSPR +VY  DFGWG+P+AVR G   K DGK ++FPG E+GS++ EVCLL  TL +L  D
Sbjct  392   SSPRFDVYGNDFGWGRPIAVRSGPAAKFDGKLTVFPGAEEGSIEFEVCLLVETLESLACD  451

Query  278   QEFM  267
              EFM
Sbjct  452   AEFM  455



>gb|KEH31452.1| anthranilate N-benzoyltransferase [Medicago truncatula]
Length=447

 Score =   263 bits (673),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 132/302 (44%), Positives = 188/302 (62%), Gaps = 8/302 (3%)
 Frame = -1

Query  1157  KGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQLSLPPVLDP  978
             +  S P+LGVQVTEL +G FIGL +NH   D   FWHF N+WS+IS+    +   P    
Sbjct  144   EATSQPILGVQVTELANGIFIGLTLNHVVCDGKMFWHFINTWSQISKNFQSIPKLPSFQR  203

Query  977   WFPGNIARPLCLPFDLQQETLSSSFTPPP-LEERVFHFSKDTIAKLKEKANSEMGTDS--  807
             WFP  +  P+  PF    +T S    PP  L ER+FHF+K+ IA+LK KAN E  T +  
Sbjct  204   WFPNEVELPIRFPF---TKTESQRRKPPQNLPERIFHFTKEKIAELKSKANEETKTKNVQ  260

Query  806   --ISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKLAK  633
               ISSLQ+ ++H+WR + R+++L+P ED    + IG R R  PPL E Y+GNA       
Sbjct  261   TKISSLQALLSHVWRCVVRSKKLDPEEDFRYVLVIGVRPRMTPPLDEDYFGNAGIIGSVT  320

Query  632   ANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIASS  453
               AGE+L+ G+G  + ++++++ ++  E++ + Y+ W+K P +   + +  AN L  +SS
Sbjct  321   MKAGEILECGIGKCSLEMNKMIMLRSDEKIRDDYECWLKMPKLFGINSLAGANSLATSSS  380

Query  452   PRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDIEVCLLPHTLHTLGNDQE  273
             PR +VY  DFGWGKPV VR G  NK++GK ++F G ++GS+DIEVCL    L  LGND E
Sbjct  381   PRFDVYDNDFGWGKPVGVRSGGANKSNGKITVFAGADEGSIDIEVCLSYEILEALGNDAE  440

Query  272   FM  267
             FM
Sbjct  441   FM  442



>ref|XP_008452574.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Cucumis 
melo]
Length=467

 Score =   264 bits (674),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 138/308 (45%), Positives = 188/308 (61%), Gaps = 9/308 (3%)
 Frame = -1

Query  1154  GISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRG-------MPQLSL  996
             G + PLL +QVTEL DG FI  + NH   D +S+W+FFN WSEI +        +  +S 
Sbjct  150   GHTMPLLSIQVTELLDGVFIACSFNHAIGDGTSYWNFFNMWSEIFQATSSDGDEIISISR  209

Query  995   PPVLDPWFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEMG  816
             PP+L  WFP  I   + LPF    +   S F  P L ER+FHFS ++IAKLK KAN+E  
Sbjct  210   PPILKRWFPDGIGPIISLPFT-HPDQFISRFEAPELRERIFHFSAESIAKLKAKANAECK  268

Query  815   TDSISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKLA  636
                ISS QS  A +WR+ITRARR+   +  S  +    R + +P L E Y+GN + S  A
Sbjct  269   AKEISSFQSLSALVWRSITRARRVPENQISSCSMAANNRGKLDPKLSENYFGNVVTSVKA  328

Query  635   KANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIAS  456
             +A AGEL++RGLGWAAW++HEVV    +E++ +    W++SP   Q  + F A  + + S
Sbjct  329   EAKAGELVERGLGWAAWKLHEVVVQNTNEKLRKALDKWIESPFTFQLGRFFDAYSVLMGS  388

Query  455   SPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLE-KGSVDIEVCLLPHTLHTLGND  279
             SPR N Y  +FG GK VA+R G  NK DGK S +PG E  GS+D+E+CLLP  +  L +D
Sbjct  389   SPRFNKYGNEFGMGKAVALRSGYANKFDGKVSAYPGYEGGGSIDLEICLLPQNMANLESD  448

Query  278   QEFMEFVT  255
              EF+  ++
Sbjct  449   LEFINSIS  456



>ref|XP_002523237.1| 3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransferase, putative [Ricinus 
communis]
 gb|EEF39158.1| 3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransferase, putative [Ricinus 
communis]
Length=423

 Score =   263 bits (671),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 130/298 (44%), Positives = 191/298 (64%), Gaps = 16/298 (5%)
 Frame = -1

Query  1157  KGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQLSLPPVLDP  978
             +G+S PLL VQVTEL D  FIG A+NH  AD  +FW+F NSWSEISRG  Q+S PP+ + 
Sbjct  137   EGVSKPLLAVQVTELADRVFIGFAVNHVVADGIAFWNFINSWSEISRGSDQISEPPLFEH  196

Query  977   WFPGNIAR-PLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEMGTDSIS  801
             WF G  +  P+ LP  L +    S  TPP   ER+ HF K+TI +L+ KAN+E GTD IS
Sbjct  197   WFRGAESYCPISLPLALIKTDDES--TPPQFRERILHFGKETIGRLRAKANAEAGTDRIS  254

Query  800   SLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKLAKANAG  621
             SLQS +AH+WR++ R ++L+P+++ +  +PI  R R             + SKL K    
Sbjct  255   SLQSILAHVWRSVIRNKQLDPSQETTFRLPIEVRSRM------------LQSKLPKVREP  302

Query  620   ELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIASSPRNN  441
                ++GLG+AA Q+++ ++    + +    ++W+KSP +   S++   N LG+ +SPR N
Sbjct  303   LDEQQGLGYAALQMNKAIACYTEDNIRNDIESWIKSPNLGTVSELS-KNALGVGNSPRFN  361

Query  440   VYATDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDIEVCLLPHTLHTLGNDQEFM  267
             VY  DFGWG+P+AVR G+ NK DGK  +FPG ++ ++D+++CL P  +H + ND EF+
Sbjct  362   VYGNDFGWGRPIAVRSGLGNKFDGKIIVFPGAKECNIDLQICLNPDVMHAMENDPEFL  419



>gb|KEH29083.1| HXXXD-type acyl-transferase family protein [Medicago truncatula]
Length=440

 Score =   262 bits (670),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 138/311 (44%), Positives = 191/311 (61%), Gaps = 12/311 (4%)
 Frame = -1

Query  1157  KGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMP-QLSLPPVLD  981
             +G S PLL VQVTEL DG FIG   NH  AD  S WHF NSW+E+SRG   Q+S  P L+
Sbjct  132   EGTSKPLLAVQVTELVDGIFIGFNFNHVVADGQSTWHFINSWAEMSRGCHHQISNSPTLE  191

Query  980   PWFPGNIARPLCLPFDLQQETLSS---SFTPPP-----LEERVFHFSKDTIAKLKEKANS  825
              WFP  I RP+  P  ++ +   S   SF+        L ER+FHF+K  I +LK K N+
Sbjct  192   RWFPNGIQRPIRFPLTIEPQKNHSDGLSFSSSDDEKLFLSERIFHFTKKKIMQLKSKVNA  251

Query  824   EMGTDSISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHS  645
             E+ T  ISSLQ+ + HLW ++ R++ L+P ED      IG R R  PPLPE Y+GNAI  
Sbjct  252   EIDTKKISSLQALLTHLWCSVIRSKHLDPQEDALNTFIIGVRPRLVPPLPEDYFGNAIIG  311

Query  644   KLAKANAGELLKR-GLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFL  468
                K   GELL+  G+G  A  +++++++  +E++   Y++W+++P   +   +   NFL
Sbjct  312   CGFKMKVGELLEEGGIGKGALLMNKLIALHSNEKLKNDYESWLRNPNFIRLDSLSTKNFL  371

Query  467   GIASSPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDIEVCLLPHTLHTL  288
              I+SSP+ +VY  DFGWGKPVAVR G  NK +G    F G+E+ S+D++VCL    L  +
Sbjct  372   AISSSPKFDVYGNDFGWGKPVAVRSG--NKTNGMVCAFAGIEEASIDLQVCLPYKILEAM  429

Query  287   GNDQEFMEFVT  255
             GND EFM+ V 
Sbjct  430   GNDPEFMDMVN  440



>gb|KJB63882.1| hypothetical protein B456_010G021700 [Gossypium raimondii]
Length=455

 Score =   263 bits (671),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 144/306 (47%), Positives = 188/306 (61%), Gaps = 8/306 (3%)
 Frame = -1

Query  1154  GISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMP----QLSLPPV  987
             G + PLL +QVTEL DG FIG +MNH   D +SFWHFFN+ SEI +       ++S PPV
Sbjct  146   GHTRPLLSIQVTELVDGVFIGCSMNHAIGDGTSFWHFFNTLSEIFQAQGDTNLKISRPPV  205

Query  986   LDPWFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEMGTDS  807
             L+ WFP      L LPF  Q E L S F  P L ER+FHFS  +IAKLKE+AN+E  T  
Sbjct  206   LEKWFPEGHGPLLNLPFTNQDE-LISRFEAPELLERIFHFSAKSIAKLKERANTESNTTK  264

Query  806   ISSLQSYVAHLWRAITRARRLNPTEDVS-IYVPIGTRWRTNPPLPEGYWGNAIHSKLAKA  630
             ISS QS  A +WR+IT+ARR  P E V+   + I  R R  P L   Y+GN+I +  A  
Sbjct  265   ISSFQSLSAFVWRSITKARRF-PNETVTGCRLAINNRSRLEPALSPDYFGNSIQTVRAVT  323

Query  629   NAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIASSP  450
              AGELL  GLGWAAW++H+ V     ++V  F   W+ SP I Q +++F    + + SSP
Sbjct  324   TAGELLNHGLGWAAWKLHQAVVNHTDKQVRGFVNGWLDSPFIYQIAQLFDPQSVMMGSSP  383

Query  449   RNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLE-KGSVDIEVCLLPHTLHTLGNDQE  273
             R N Y  +FG GK + +R G  +K DGK S +PG E  GS+D+E+CL P ++  L  D+E
Sbjct  384   RFNKYGNEFGLGKALTLRSGYAHKFDGKVSAYPGHEGGGSIDLEICLPPSSMKALELDEE  443

Query  272   FMEFVT  255
             FM  V+
Sbjct  444   FMSVVS  449



>gb|KHN04489.1| Putative acetyltransferase, partial [Glycine soja]
Length=481

 Score =   263 bits (673),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 139/312 (45%), Positives = 190/312 (61%), Gaps = 9/312 (3%)
 Frame = -1

Query  1166  TSRKGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQ------  1005
              +  G S PLL +QVTEL DG F+G +MNH   D +S+W+FFN+WS+I +   +      
Sbjct  165   VNHDGHSMPLLSIQVTELVDGVFLGCSMNHAVGDGTSYWNFFNTWSQIFQSQAKGHETDV  224

Query  1004  -LSLPPVLDPWFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKAN  828
              +S  P+L  WFP + A P+ LPF    E +S  F  P + ERVFHFS ++IAKLK KAN
Sbjct  225   PISHQPILSRWFPNDCAPPINLPFKHHDEFISR-FEAPLMRERVFHFSAESIAKLKAKAN  283

Query  827   SEMGTDSISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIH  648
              E  T  ISS QS  A +WR ITRA  L   +  S  +    R R  PPLP+ Y+GN++ 
Sbjct  284   MESDTTKISSFQSLSALVWRCITRACSLPYEQRTSCRLTANNRTRMEPPLPQEYFGNSVS  343

Query  647   SKLAKANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFL  468
                A+   GELL+  LGWAAW++H  V+  +   V++  + W++SP+I Q  +      +
Sbjct  344   RVSAETTVGELLENNLGWAAWKLHLAVTNHNDRVVLQSLKEWLQSPLIYQLGQPMDPYVV  403

Query  467   GIASSPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLE-KGSVDIEVCLLPHTLHT  291
              I+SSPR N+Y  +FG GK VAVR G  NK DGK + +PG E  GS+D+EV LLPH +  
Sbjct  404   LISSSPRFNMYGNEFGMGKAVAVRSGYANKFDGKVTSYPGREGGGSIDLEVGLLPHIMSA  463

Query  290   LGNDQEFMEFVT  255
             L +D+EFM  V+
Sbjct  464   LESDEEFMNVVS  475



>ref|XP_004511082.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Cicer 
arietinum]
Length=448

 Score =   261 bits (668),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 142/310 (46%), Positives = 193/310 (62%), Gaps = 12/310 (4%)
 Frame = -1

Query  1157  KGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQLSLPPVLDP  978
             +G S PLL VQVTEL DG FIG  +NH   D  S WHF NSW+EIS+G  + S  P  + 
Sbjct  141   QGTSQPLLAVQVTELLDGIFIGFTINHVVVDGKSIWHFVNSWAEISKGCLKTSKLPTFER  200

Query  977   WFPGNI-ARPLCLPFDLQQETLSSS-------FTPPPLEERVFHFSKDTIAKLKEKANSE  822
             WFP NI  RP+  PF ++Q+  +S+         PP   ER+FHF+K+ IAKLK KAN E
Sbjct  201   WFPNNIIQRPIRFPFTIEQQNNNSNNKGEDQNLNPP---ERLFHFTKENIAKLKLKANIE  257

Query  821   MGTDSISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNA-IHS  645
             +GT  +SSLQ+   H+WR+I R++ L P E+V   V IG R R  P L E Y+GNA I  
Sbjct  258   VGTKKLSSLQALFTHIWRSIIRSKLLEPQEEVKYMVVIGIRPRLVPALQEDYFGNAMIIC  317

Query  644   KLAKANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLG  465
              +       L + GLG +AW++++++++   E++ + Y+ W K+P       V  +N L 
Sbjct  318   GVTMKVGELLEEGGLGKSAWEMNKMIALHSDEKLKKHYETWSKTPTFITPGSVANSNTLV  377

Query  464   IASSPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDIEVCLLPHTLHTLG  285
              +SSP  +VY  DFGWGKPV VR G  NK +GK S+F G+E+GS+D+EVCL    L  +G
Sbjct  378   TSSSPWFDVYGNDFGWGKPVGVRSGGANKKNGKISVFAGVEEGSMDLEVCLPYEILEAIG  437

Query  284   NDQEFMEFVT  255
             ND EFM FV+
Sbjct  438   NDPEFMAFVS  447



>ref|XP_007136701.1| hypothetical protein PHAVU_009G066600g [Phaseolus vulgaris]
 gb|ESW08695.1| hypothetical protein PHAVU_009G066600g [Phaseolus vulgaris]
Length=465

 Score =   262 bits (669),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 141/310 (45%), Positives = 187/310 (60%), Gaps = 12/310 (4%)
 Frame = -1

Query  1166  TSRKGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQ------  1005
              +  G + PLL +QVTEL DG FIG +MNH  AD +S+W+FFN+WS I +   Q      
Sbjct  143   VNHDGHTMPLLSIQVTELVDGVFIGCSMNHAIADGTSYWNFFNTWSRIFQAHVQAQGHEY  202

Query  1004  ---LSLPPVLDPWFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEK  834
                 S   + + WFP + + P+ LPF    E ++  F  P L ERVFHFS D+IAKLK K
Sbjct  203   EVSTSHQLIHNRWFPNDCSPPINLPFKHHDEFITR-FEAPFLRERVFHFSADSIAKLKAK  261

Query  833   ANSEMGTDSISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNA  654
             ANSE  T  ISS QS  A +WR ITRAR     +  S  +    R R  P LPE Y+GN+
Sbjct  262   ANSECNTTKISSFQSLSALVWRCITRARSPRYDQRTSCKLATNNRSRMEP-LPEEYFGNS  320

Query  653   IHSKLAKANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFAN  474
             IH   A+   GELL+ GLGWAAW++H  V+  +   V++F + W++SP+I +  + F   
Sbjct  321   IHLVSAETTTGELLENGLGWAAWKLHLTVANHNETVVLQFLKEWLQSPLIYELGRFFDPY  380

Query  473   FLGIASSPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLE-KGSVDIEVCLLPHTL  297
              + + SSPR NVY  +FG GK VA R G  NK DGK + +PG E  GS+D+EVCL P  +
Sbjct  381   CVSMGSSPRFNVYGNEFGMGKAVAARSGYANKFDGKVTSYPGREGGGSIDLEVCLSPDNM  440

Query  296   HTLGNDQEFM  267
               L +D+EFM
Sbjct  441   SMLESDEEFM  450



>gb|KJB63872.1| hypothetical protein B456_010G021400 [Gossypium raimondii]
Length=436

 Score =   261 bits (667),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 140/306 (46%), Positives = 190/306 (62%), Gaps = 8/306 (3%)
 Frame = -1

Query  1154  GISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMP----QLSLPPV  987
             G + PLL +QVTEL DG FIG +MNH   D ++FWHFFN+ SEI +       ++S PPV
Sbjct  129   GHTRPLLSIQVTELVDGVFIGCSMNHVLGDGATFWHFFNTLSEIFQAQGDTKMKISRPPV  188

Query  986   LDPWFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEMGTDS  807
             L+ WFP   +  L LPF  Q E ++  F  P L ER+FHFS  +IAKLKE+AN+E  T  
Sbjct  189   LEKWFPEGHSPLLNLPFTNQDEFITR-FEAPELLERMFHFSAKSIAKLKERANTESNTTK  247

Query  806   ISSLQSYVAHLWRAITRARRLNPTEDVS-IYVPIGTRWRTNPPLPEGYWGNAIHSKLAKA  630
             ISS QS  A +WR+IT+ARR  P E V+   + I  R R  P LP+ Y+GN+I +  A  
Sbjct  248   ISSFQSLSAFVWRSITKARRF-PNETVTGCRLAINNRSRLEPALPQDYFGNSIQTVRAVT  306

Query  629   NAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIASSP  450
              A ELL   LGWAAW++H+ V     +++  F   W+ SP I Q +++F    +   SSP
Sbjct  307   TASELLDHNLGWAAWKLHQAVVNHTDKQLCGFVNGWLDSPFIYQIAQLFDPQSVMFGSSP  366

Query  449   RNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLE-KGSVDIEVCLLPHTLHTLGNDQE  273
             R N+Y  +FG GK + +R G  +K DGK S +PG E  GSVD+E+CL P ++  L +D+E
Sbjct  367   RFNMYENEFGLGKALMLRSGYAHKFDGKVSSYPGREGGGSVDLEICLPPSSMKALESDEE  426

Query  272   FMEFVT  255
             FM  V+
Sbjct  427   FMSVVS  432



>ref|XP_006374905.1| transferase family protein [Populus trichocarpa]
 gb|ERP52702.1| transferase family protein [Populus trichocarpa]
Length=460

 Score =   261 bits (667),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 142/305 (47%), Positives = 189/305 (62%), Gaps = 6/305 (2%)
 Frame = -1

Query  1154  GISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQ---LSLPPVL  984
             G +  LL +QVTEL DG FIG ++NH+  D SSFWHFFN WSEI +G      +S PPVL
Sbjct  148   GHTKSLLTIQVTELIDGIFIGCSVNHSIVDGSSFWHFFNMWSEIFQGKGDDVSISRPPVL  207

Query  983   DPWFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEMGTDSI  804
             + WFP      L LPF    + LS  F  P L+ER+FHFS ++IA+LK KAN+E  T+ I
Sbjct  208   NRWFPDGHGPALSLPFTHHDQFLSP-FEAPLLKERMFHFSSESIARLKAKANAESNTNKI  266

Query  803   SSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHS-KLAKAN  627
             SS QS  A +WR ITRAR L   +     + I  R R NPPL   Y+GN+I + K   + 
Sbjct  267   SSFQSLSALVWRCITRARNLPHDQVTCCRMAINNRSRLNPPLSPDYFGNSIQALKAGVST  326

Query  626   AGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIASSPR  447
              GELL++ LGWAAWQ+H+ V     E+  EF   W+KS  I Q  K+F  + + + SSPR
Sbjct  327   VGELLEQNLGWAAWQLHQAVVSHSDEKAREFLNLWLKSRFIYQIGKLFDPHSVMMGSSPR  386

Query  446   NNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLE-KGSVDIEVCLLPHTLHTLGNDQEF  270
              N Y  +FG GK +A+R G  +K  GK S +PG E  GS+++E+CL P  +  L +D+EF
Sbjct  387   FNKYGNEFGLGKALALRSGYAHKFSGKASAYPGHEGGGSIELEICLSPDEMSALESDKEF  446

Query  269   MEFVT  255
             M+ V+
Sbjct  447   MDVVS  451



>ref|XP_003605002.1| Acetyltransferase, putative [Medicago truncatula]
 gb|AES87199.1| HXXXD-type acyl-transferase family protein [Medicago truncatula]
Length=436

 Score =   260 bits (664),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 138/316 (44%), Positives = 194/316 (61%), Gaps = 9/316 (3%)
 Frame = -1

Query  1178  FCLT--TSRKGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMP-  1008
             F LT   S +G S PLL VQVTEL DG FIG + NH   D  S WHF NSW+EISR    
Sbjct  123   FALTGVESYEGTSKPLLAVQVTELVDGIFIGCSFNHVVVDGESVWHFINSWAEISRSCCH  182

Query  1007  -QLSLPPVLDPWFPGNIARPLCLPFDLQQETLSSSFTPPPL--EERVFHFSKDTIAKLKE  837
              Q+S PP L+ WFP  + +P+  PF    E   SS     L    R+FHF+K+ I +LK 
Sbjct  183   HQISKPPTLERWFPNGVQQPIRFPFVYGDELSFSSSNEEKLCLSNRIFHFTKEKIVQLKS  242

Query  836   KANSEMGTDSISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGN  657
             K N E+GT  ISSLQ  + HLW ++ R+ + +P E+V   V IG R R  PPLPE Y+GN
Sbjct  243   KINDEIGTIKISSLQVLLTHLWCSVMRSIKFDPQEEVFNIVVIGVRPRLVPPLPEYYFGN  302

Query  656   AIHSKLAKANAGELLKR-GLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFF  480
             A+ S + K   GEL++  GL   A ++++++     E++   Y++W+++P  A+   +  
Sbjct  303   ALISCMVKMKVGELVEEGGLCKGACEMNKLIVSHTDEKLKNHYESWLRNPSFARYPNMAK  362

Query  479   ANFLGIASSPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDIEVCLLPHT  300
              NF+ I+SSP  +VY  DFGWGKPVAVR G   K +G  ++F G+E+GS+D++VCL    
Sbjct  363   NNFIAISSSPWFDVYGNDFGWGKPVAVRSGY--KGNGLITVFAGIEEGSIDLQVCLSHEI  420

Query  299   LHTLGNDQEFMEFVTH  252
             L  +GND +FM+  ++
Sbjct  421   LEAMGNDPQFMDVASN  436



>ref|XP_003622067.1| Acetyltransferase, putative [Medicago truncatula]
 gb|AES78285.1| HXXXD-type acyl-transferase family protein [Medicago truncatula]
Length=439

 Score =   260 bits (664),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 139/322 (43%), Positives = 198/322 (61%), Gaps = 18/322 (6%)
 Frame = -1

Query  1178  FCLTTSR--KGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMP-  1008
             F LT  R  +G S PLL VQVTEL DG FIG + NH   D  S WHF NSW+EISR    
Sbjct  123   FALTDVRSYEGTSKPLLAVQVTELIDGIFIGCSFNHAVIDGKSVWHFINSWAEISRSCCH  182

Query  1007  -QLSLPPVLDPWFPGNIARPLCLPFDLQQET--------LSSSFTPPPLEERVFHFSKDT  855
              Q+S PP L+ WFP  + RP+  PF L+Q+         LS          R+FHF+K+ 
Sbjct  183   HQISKPPTLERWFPDGVQRPIRFPFTLEQQKNHSDGLSFLSLDDEKLCFSNRIFHFTKEK  242

Query  854   IAKLKEKANSEMGTDSISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLP  675
             I +LK K N E+GT  ISSLQ+ + HLW  +  +++++P E+V   + IG   R  PPLP
Sbjct  243   IVQLKLKINEEIGTIKISSLQAPLTHLWCCVMCSKKIDPQEEVVNRIVIGVGPRLVPPLP  302

Query  674   EGYWGNAIHSKLAKANAGELLKR-GLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQ  498
             E Y+GNA+ S + K  AGELLK  GL   A ++++++++   E++   Y++W+++P  + 
Sbjct  303   EYYFGNAVISCMVKMTAGELLKEGGLCKGACEMNKLIALHTDEKLKNHYESWLRNPSFSN  362

Query  497   KSKVFFANFLGIASSPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDIEV  318
               K    NF+ I+SSP  +VY  DFGWGKPVA R G   KA+G  ++F G+E+GS+D++V
Sbjct  363   MPK---KNFIAISSSPWFDVYGNDFGWGKPVAGRGGY--KANGLITVFAGIEEGSIDLQV  417

Query  317   CLLPHTLHTLGNDQEFMEFVTH  252
             CL    L  +GND +FM+  ++
Sbjct  418   CLPYEILEAMGNDPQFMDVASN  439



>ref|XP_004291089.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Fragaria 
vesca subsp. vesca]
Length=455

 Score =   260 bits (665),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 141/302 (47%), Positives = 187/302 (62%), Gaps = 8/302 (3%)
 Frame = -1

Query  1154  GISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQ---LSLPPVL  984
             G ST LL  QVTEL DG FIGL+MNH+  D +S+W+FFN+WSEI +       LS PPV+
Sbjct  146   GHSTSLLTAQVTELVDGVFIGLSMNHSLVDGTSYWNFFNTWSEIFQAQNNNITLSNPPVM  205

Query  983   DPWFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEMGTDSI  804
             D W P  +   + LP+    E +   F PP L ER+FHFS +++AKLK KANSE  T  I
Sbjct  206   DRWIPEGLDPIISLPYTEPSEFIDR-FEPPKLRERMFHFSSESLAKLKAKANSECNTSKI  264

Query  803   SSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKLAK-AN  627
             S+ Q+  A LWR ITRAR L P ++    +    R R +PPL   Y+GN+++   ++   
Sbjct  265   STFQALSALLWRTITRARVLPPDQETRCKLAANNRARLDPPLAPNYFGNSVYPITSEPIK  324

Query  626   AGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANF-LGIASSP  450
             AGELL  GLGWAA ++H  V   +H+ +  F  +W+KSP +   S  FF  F + + SSP
Sbjct  325   AGELLDHGLGWAALKVHRAVVTLNHQALKGFLDHWLKSPAVF--SPRFFDPFSVMMGSSP  382

Query  449   RNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDIEVCLLPHTLHTLGNDQEF  270
             R ++Y  +FG GK VA+R G  NK  GK S F G E GS+D+EVCL P T+  L +D EF
Sbjct  383   RFDMYRNEFGMGKAVALRSGYANKFSGKVSAFQGRESGSIDLEVCLPPETMGALESDDEF  442

Query  269   ME  264
             ME
Sbjct  443   ME  444



>ref|XP_010927437.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Elaeis 
guineensis]
Length=455

 Score =   260 bits (665),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 141/309 (46%), Positives = 194/309 (63%), Gaps = 8/309 (3%)
 Frame = -1

Query  1163  SRKGISTPLLGVQVTEL-DDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQLSLP--  993
             S  G S PLL VQVTEL D G F+G +++H  AD +SFWHFFNSWS + R   Q+S+P  
Sbjct  146   SCDGHSMPLLAVQVTELADGGIFVGCSLSHAVADGTSFWHFFNSWSHLGRDHHQVSIPNP  205

Query  992   PVLDPWFPGNIARPLCLPFDLQQETLSSSFTP-PPLEERVFHFSKDTIAKLKEKANSEMG  816
             P +D WF  +   P+ LPF   Q+ +   + P PP+ E   HFS  TIA +K +AN+EMG
Sbjct  206   PTIDRWFLDSCPPPIRLPFADPQDFIR--WIPYPPVRECALHFSARTIANIKSRANTEMG  263

Query  815   TDSISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPP-LPEGYWGNAIHSKL  639
             TD ISSLQ+ +  LWR++TRARRL+P ++ + +V +G R R  P  LP  Y GNA+    
Sbjct  264   TDRISSLQALLGFLWRSVTRARRLDPAQETTYFVLVGCRSRLGPSSLPATYLGNALTIVQ  323

Query  638   AKANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIA  459
             AK+ AGEL + G GWAA+ ++  V+      + +  + W + P     ++ F    L   
Sbjct  324   AKSTAGELSEHGPGWAAFLLNRAVASSSGSMLRDELEMWTREPSFTYMNQ-FKPCDLITG  382

Query  458   SSPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDIEVCLLPHTLHTLGND  279
             SSPR N+Y  DFGWG+PVAVR G  NK DGK +++PG + GS+ +EVCL P  L +L  D
Sbjct  383   SSPRFNIYDNDFGWGRPVAVRSGPGNKVDGKATIYPGPDPGSMALEVCLSPQALSSLIQD  442

Query  278   QEFMEFVTH  252
             +EFM+ VT+
Sbjct  443   EEFMQVVTN  451



>ref|XP_008338376.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Malus 
domestica]
Length=459

 Score =   260 bits (665),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 144/326 (44%), Positives = 194/326 (60%), Gaps = 25/326 (8%)
 Frame = -1

Query  1178  FCLTTS--RKGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMP-  1008
             FC+  +   +GI+ PL+ VQVTEL DG FIG ++NH   D +SFWHFFN+WSEISR  P 
Sbjct  134   FCMMDAWNYEGITKPLVAVQVTELVDGIFIGCSINHVVVDGTSFWHFFNTWSEISRVGPS  193

Query  1007  -QLSLP-PVL-DPWFPGNIARPLCLPFDLQQETLSSSFTPPPL-----------EERVFH  870
              ++S P PV    ++ G I  P+ L F   QE +    T  PL           +  VFH
Sbjct  194   GKISQPRPVFAREFYDGVIDLPIQLXFSNIQEIM----TKKPLIGHGLSSSNSSQRVVFH  249

Query  869   FSKDTIAKLKEKANSEMGT---DSISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTR  699
             F K+ + +LK KAN E GT   ++ISSLQ+ +AHLWRA+TRAR LNP ++VS  + +G R
Sbjct  250   FRKEKVVELKSKANVEXGTTDNNTISSLQALMAHLWRAVTRARNLNPDQEVSYRIAVGVR  309

Query  698   WRTNPPLPEGYWGNAIHSKLAKANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWV  519
              R   PLP+ Y GN     + K  AGEL + GLGWAA+ I++ +     EE  ++ ++WV
Sbjct  310   QRMEXPLPKEYIGNGALGLIVKCTAGELXRHGLGWAAFLINKKIGSLKAEEARKYMEDWV  369

Query  518   KSPVIAQKSKVFFANF-LGIASSPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLE  342
             K+P      +   A   L   SS R NVY  DFGWG+PVAVR     +  GK ++FPG E
Sbjct  370   KAPTFLSNPQRDTATLDLLTGSSXRFNVYGNDFGWGRPVAVRSRTQERKVGKLTVFPGPE  429

Query  341   KGSVDIEVCLLPHTLHTLGNDQEFME  264
             +GS+D E CL P T+  +  D EFM+
Sbjct  430   EGSIDFECCLWPETIRAMAEDVEFMQ  455



>ref|XP_004141386.2| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Cucumis 
sativus]
 gb|KGN55211.1| hypothetical protein Csa_4G640970 [Cucumis sativus]
Length=468

 Score =   260 bits (665),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 138/308 (45%), Positives = 186/308 (60%), Gaps = 9/308 (3%)
 Frame = -1

Query  1154  GISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRG-------MPQLSL  996
             G + PLL VQVTEL DG FI  + NH   D +S+W+FFN WSEI +        +  +S 
Sbjct  151   GHTMPLLSVQVTELLDGVFIACSFNHAIGDGTSYWNFFNMWSEIFQATSSDGDEIISISQ  210

Query  995   PPVLDPWFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEMG  816
             PP+L  WFP  I   + LPF    +   S F  P L ER+FHFS ++IAKLK KANSE  
Sbjct  211   PPILKRWFPDGIGPIINLPFT-HPDQFISRFEAPELRERIFHFSAESIAKLKAKANSECK  269

Query  815   TDSISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKLA  636
                ISS QS  A +WR+ITRARR+   +  S  +    R R +P L E Y+GN + S  A
Sbjct  270   AKEISSFQSLSALVWRSITRARRVPENQISSCSMAANNRGRLDPKLSENYFGNVVTSVKA  329

Query  635   KANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIAS  456
             +A AGEL++RG+GWAAW++HE V    +E++ +    W++SP   Q  + F    + + S
Sbjct  330   EAKAGELVERGVGWAAWKLHEAVVQNTNEKLRKALDKWMESPFTFQLGRFFDQYSVLMGS  389

Query  455   SPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLE-KGSVDIEVCLLPHTLHTLGND  279
             SPR N Y  +FG GK VA+R G  NK DGK S +PG E  GS+D+E+CLLP  +  L +D
Sbjct  390   SPRFNKYGNEFGMGKAVALRSGYANKFDGKVSAYPGYEGGGSIDLEICLLPQNMANLESD  449

Query  278   QEFMEFVT  255
              EF+  ++
Sbjct  450   LEFINSIS  457



>gb|EYU35826.1| hypothetical protein MIMGU_mgv1a006141mg [Erythranthe guttata]
Length=455

 Score =   260 bits (664),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 143/309 (46%), Positives = 186/309 (60%), Gaps = 13/309 (4%)
 Frame = -1

Query  1154  GISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQLSLPPVLDPW  975
             GIS PL GVQVTEL DG+FI    NH   D +SFWHFFNSWSEISRG  ++S  P+ + W
Sbjct  143   GISKPLFGVQVTELVDGFFISCTANHAIIDGTSFWHFFNSWSEISRGFDKISKMPLFEKW  202

Query  974   FPGNIARPLCLPFDLQQETL--SSSFTPPPLEERVFHFSKDTIAKLKEKANSEMGTDS--  807
             FP N    L L   L+Q  L        P L +RVFHFSK+++AKLK KANSE G+D   
Sbjct  203   FPSNCNDGLILLPPLEQNNLLPKRHVMMPQLLQRVFHFSKESVAKLKAKANSEAGSDKII  262

Query  806   ISSLQSYVAHLWRAITRARRLN--------PTEDVSIYVPIGTRWRTNPPLPEGYWGNAI  651
             ISSLQ   AHLWR+I R +  N          E+V   +      R   PL +GY+GN  
Sbjct  263   ISSLQVVSAHLWRSIARNKNRNRRTPQINTQEEEVCCIMLFVVGARARIPLGDGYFGNGT  322

Query  650   HSKLAKANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANF  471
             +      +  ELL +GLG+   +I+E V+ Q+ EEVV+F ++W++ P I +K  +     
Sbjct  323   YIAKTSISETELLGKGLGYLGMKINEFVASQNREEVVKFVEDWIEKPTIVRKGSIGNCT-  381

Query  470   LGIASSPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDIEVCLLPHTLHT  291
             L I SSPR+NVY  DFGWGKP+AVR G   K DGK + FP  E G +D+EVCL   T+  
Sbjct  382   LAITSSPRHNVYGNDFGWGKPIAVRSGKSQKFDGKMTTFPAAEDGGIDVEVCLAAETMQA  441

Query  290   LGNDQEFME  264
             + +D EF++
Sbjct  442   MESDAEFLD  450



>ref|XP_002284916.2| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Vitis 
vinifera]
Length=454

 Score =   260 bits (664),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 139/309 (45%), Positives = 190/309 (61%), Gaps = 7/309 (2%)
 Frame = -1

Query  1163  SRKGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQ-----LS  999
             +  G +  LL +QVTEL DG FIG ++NH+  D +SFWHFFN+WSE+     +     LS
Sbjct  144   NHDGHTLSLLSIQVTELVDGIFIGCSINHSMVDGTSFWHFFNAWSEVFTAQEKNSPITLS  203

Query  998   LPPVLDPWFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEM  819
              PP+L  WFP      + LPF    E +S  F  P L ER+FHFS ++IAKLK KAN++ 
Sbjct  204   RPPILKRWFPDGYGPIINLPFTHHDEFISR-FEAPVLRERIFHFSSESIAKLKAKANAQC  262

Query  818   GTDSISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKL  639
              ++ ISS Q+  A +WR+ITRAR     +  S  + IG R R +PPLPE Y+GN+I +  
Sbjct  263   NSNKISSFQALSALVWRSITRARCFPHEQVTSCRLAIGNRTRLDPPLPENYFGNSIQTVR  322

Query  638   AKANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIA  459
               A AGELL+  LGWAAW +H+ V     + V  + ++W +S  I Q    F  N + + 
Sbjct  323   GIATAGELLEHDLGWAAWLLHQAVVGHTDKAVRGWLESWFQSHFIYQLGLFFDPNSVMMG  382

Query  458   SSPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLE-KGSVDIEVCLLPHTLHTLGN  282
             SSPR N Y  +FG GK +AVR G  +K DG  S +PG E  GS+D+EVCL P+++  L +
Sbjct  383   SSPRFNKYGIEFGLGKGLAVRSGYAHKFDGTVSCYPGREGGGSIDLEVCLPPNSMSALES  442

Query  281   DQEFMEFVT  255
             +QEFME V+
Sbjct  443   NQEFMEAVS  451



>ref|XP_003550055.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Glycine 
max]
Length=439

 Score =   259 bits (662),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 137/299 (46%), Positives = 187/299 (63%), Gaps = 6/299 (2%)
 Frame = -1

Query  1157  KGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQLSLPPVLDP  978
             +  S P+L VQVTEL DG FI L++NH  AD  SFW F NSW+EISRG  ++S  P L  
Sbjct  139   EATSQPVLAVQVTELFDGIFIALSINHVVADGKSFWLFVNSWAEISRGSLKISKFPSLKR  198

Query  977   WFPGNIARPLCLPF--DLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEMGTDSI  804
              F   + RP+   F  +L++E  S +  P     RVFHF+K+ IA LK KAN+E  TD I
Sbjct  199   CFLDGVDRPIRFLFTKELEKEP-SKNLQPQTRPVRVFHFTKEKIADLKSKANAEANTDKI  257

Query  803   SSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKLAKANA  624
             SSLQ+ +A+LWR++ R + + P E++   +P+G R R  PPLPE Y+GNA         A
Sbjct  258   SSLQALLANLWRSVIRCQHVEPHEEIQFTMPVGVRPRVVPPLPEDYFGNAALIGRVTMKA  317

Query  623   GELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIASSPRN  444
             GELL+  LG  A +I++++S Q  E+V   Y++W ++P   ++  V ++N L + SSPR 
Sbjct  318   GELLQGELGKIALEINKMISSQSDEKVKNHYESWARTP---RQRGVAYSNTLNVGSSPRF  374

Query  443   NVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDIEVCLLPHTLHTLGNDQEFM  267
             N+Y  DFGWGKP+AVR G D  +     LF G E+GS+DIEV L    L  +GND EFM
Sbjct  375   NIYGNDFGWGKPMAVRSGGDFMSYSIVFLFAGFEEGSIDIEVFLPYEILEAMGNDPEFM  433



>gb|KEH16419.1| HXXXD-type acyl-transferase family protein [Medicago truncatula]
Length=443

 Score =   259 bits (663),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 136/309 (44%), Positives = 189/309 (61%), Gaps = 13/309 (4%)
 Frame = -1

Query  1157  KGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQLSLPPVLDP  978
             +G S PLL +QVTEL DG FIG  +NH   D +SFWHF NSW+EIS+G  ++S  P  D 
Sbjct  141   EGTSQPLLAIQVTELVDGIFIGFTVNHVIVDGTSFWHFINSWAEISKGCLKISKLPTFDR  200

Query  977   WFPGNIARPLCLPFDLQQETLSSSFTPPPLE------ERVFHFSKDTIAKLKEKANSEMG  816
             WF   I  P+  PF     T+ S +     E      ERVFHF K++IAKLK KAN E+G
Sbjct  201   WFSKGIECPIRFPF-----TIESRYNDNDEEGKINFPERVFHFKKESIAKLKFKANLEVG  255

Query  815   TDSISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKLA  636
             T +ISSLQ+   H+WR+I R ++L+P  +V   + IG R R  PPLPE Y+GNA+   + 
Sbjct  256   TKNISSLQAIFTHIWRSIIRCKKLDPQAEVKFVLDIGIRPRLIPPLPEDYFGNAVIDCVV  315

Query  635   KANAGELLKR-GLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIA  459
                A +LLK  GLG  + ++++++ +   E +   Y+NW+ +P     S +  ++ L I 
Sbjct  316   SIRADDLLKDGGLGKGSLEMNKMIVLHSDERLKNHYENWLITPSFVT-SGMANSDSLVIG  374

Query  458   SSPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDIEVCLLPHTLHTLGND  279
              SP  +VY  DFGWGKPV VR G  NK +GK  ++ G+E GS+D+EVCL    L  + ND
Sbjct  375   GSPWFDVYGNDFGWGKPVGVRSGGSNKRNGKIYVYAGVEDGSMDLEVCLPCEILEAIRND  434

Query  278   QEFMEFVTH  252
              EFM+ V++
Sbjct  435   PEFMDVVSY  443



>gb|KHN15623.1| Putative acetyltransferase [Glycine soja]
Length=433

 Score =   259 bits (661),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 137/299 (46%), Positives = 187/299 (63%), Gaps = 6/299 (2%)
 Frame = -1

Query  1157  KGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQLSLPPVLDP  978
             +  S P+L VQVTEL DG FI L++NH  AD  SFW F NSW+EISRG  ++S  P L  
Sbjct  133   EATSQPVLAVQVTELFDGIFIALSINHVVADGKSFWLFVNSWAEISRGSLKISKFPSLKR  192

Query  977   WFPGNIARPLCLPF--DLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEMGTDSI  804
              F   + RP+   F  +L++E  S +  P     RVFHF+K+ IA LK KAN+E  TD I
Sbjct  193   CFLDGVDRPIRFLFTKELEKEP-SKNLQPQTRPVRVFHFTKEKIADLKSKANAEANTDKI  251

Query  803   SSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKLAKANA  624
             SSLQ+ +A+LWR++ R + + P E++   +P+G R R  PPLPE Y+GNA         A
Sbjct  252   SSLQALLANLWRSVIRCQHVEPHEEIQFTMPVGVRPRVVPPLPEDYFGNAALIGRVTMKA  311

Query  623   GELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIASSPRN  444
             GELL+  LG  A +I++++S Q  E+V   Y++W ++P   ++  V ++N L + SSPR 
Sbjct  312   GELLQGELGKIALEINKMISSQSDEKVKNHYESWARTP---RQRGVAYSNTLNVGSSPRF  368

Query  443   NVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDIEVCLLPHTLHTLGNDQEFM  267
             N+Y  DFGWGKP+AVR G D  +     LF G E+GS+DIEV L    L  +GND EFM
Sbjct  369   NIYGNDFGWGKPMAVRSGGDFMSYSIVFLFAGFEEGSIDIEVFLPYEILEAMGNDPEFM  427



>ref|XP_010064179.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Eucalyptus 
grandis]
 gb|KCW66384.1| hypothetical protein EUGRSUZ_F00200 [Eucalyptus grandis]
Length=464

 Score =   260 bits (664),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 140/311 (45%), Positives = 184/311 (59%), Gaps = 8/311 (3%)
 Frame = -1

Query  1163  SRKGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEI-------SRGMPQ  1005
             +  G    LL  QVTEL DG FIGL+MNH   D SSFWHFFNSWSEI       +  + Q
Sbjct  152   NHDGHDLSLLSAQVTELADGLFIGLSMNHVVGDGSSFWHFFNSWSEIFQAQEKGTADVVQ  211

Query  1004  LSLPPVLDPWFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANS  825
             LS PP+L  WFP N   P+ LP+     +  +    P L+ER FHFS D IA LK +AN 
Sbjct  212   LSRPPILTRWFPENHPGPVSLPYTNDPSSFFAHPDAPELKERFFHFSTDAIAGLKGEANR  271

Query  824   EMGTDSISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHS  645
             + GT +ISS QS  AH+WR ITRA RL P +  S Y+    R R  PP+P  Y+GN +  
Sbjct  272   QCGTTNISSFQSLTAHVWRCITRASRLPPDQISSCYMNADNRGRLEPPVPPEYYGNMVTP  331

Query  644   KLAKANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLG  465
                 A  GELL RG GWAA Q+H  V+  +  ++ ++ + W+K+P +    ++F    + 
Sbjct  332   LRTAATVGELLDRGPGWAARQLHATVAEHNDAKLRKWNEEWIKNPHMYHLGRMFDPCNIM  391

Query  464   IASSPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLE-KGSVDIEVCLLPHTLHTL  288
             + SSPR N+Y  +FG GK VA+R G  NK DGK S +PG +  GS+D+E+CL    +  L
Sbjct  392   MWSSPRFNMYGNEFGLGKAVALRGGQGNKFDGKVSGYPGRDGGGSIDLEICLSQEKMAVL  451

Query  287   GNDQEFMEFVT  255
              +D EFM  VT
Sbjct  452   EDDAEFMTAVT  462



>ref|XP_010059906.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized acetyltransferase 
At3g50280-like [Eucalyptus grandis]
Length=463

 Score =   259 bits (663),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 143/308 (46%), Positives = 180/308 (58%), Gaps = 8/308 (3%)
 Frame = -1

Query  1154  GISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQ-------LSL  996
             G +  LL VQVTEL DG FIGL+MNHT  D +SFW FFNSWS+I +   +       LS 
Sbjct  154   GHTLSLLSVQVTELADGVFIGLSMNHTIGDGTSFWLFFNSWSKIFQAQEKGAVDVVPLSR  213

Query  995   PPVLDPWFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEMG  816
             PP L  WFP N   PL LP+     +L + F  P L ERVFHFS D IA LK +AN + G
Sbjct  214   PPALTRWFPENHPGPLSLPYTDDPSSLLARFEAPELRERVFHFSADAIAGLKAEANRQCG  273

Query  815   TDSISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKLA  636
             T SISS QS  A +WR I RARR  P++     +    R R +PPL   Y+GN+I     
Sbjct  274   TTSISSFQSLTALVWRCIARARRFPPSQVTGCRMAANNRARLDPPLSPEYFGNSITPVRT  333

Query  635   KANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIAS  456
              A  GELL  GLGWAA  +H  V+     ++ E+ ++W+K P +    K F    + + S
Sbjct  334   AAKVGELLGSGLGWAARLLHTAVAEHSSAKLREWNEDWIKRPQVYHLDKTFDQYSIMMGS  393

Query  455   SPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLE-KGSVDIEVCLLPHTLHTLGND  279
             SPR + Y  +FG GK VA+R G  NK DGK S +PG E  GS+D+E+CL P T+  L  D
Sbjct  394   SPRFDKYGNEFGLGKAVALRSGYANKFDGKVSAYPGHEGGGSIDLEICLPPTTMALLEAD  453

Query  278   QEFMEFVT  255
              EFM  VT
Sbjct  454   PEFMAAVT  461



>ref|XP_003525889.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Glycine 
max]
Length=456

 Score =   259 bits (662),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 137/311 (44%), Positives = 187/311 (60%), Gaps = 9/311 (3%)
 Frame = -1

Query  1166  TSRKGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQ------  1005
              +  G + PLL +QVT+L D  FIG +MNH   D +S+W+FFN+WSEI +   +      
Sbjct  146   VNHDGHTMPLLSIQVTQLVDAVFIGCSMNHVIGDGTSYWNFFNTWSEIFQAQAEGHEYDV  205

Query  1004  -LSLPPVLDPWFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKAN  828
              +S  P+ + WFP      + LPF    E +S  F  P L ER+FHFS ++IAKLK KAN
Sbjct  206   PISHNPIHNRWFPELYGPLINLPFKNHDEFISR-FESPKLRERIFHFSAESIAKLKAKAN  264

Query  827   SEMGTDSISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIH  648
              E  T  ISS QS  A +WR+ITRAR +   +  S  +    R R  PPLP+ Y+GN++H
Sbjct  265   KECNTTKISSFQSLSALVWRSITRARSVPQEQRTSCKLATDNRSRMEPPLPKEYFGNSLH  324

Query  647   SKLAKANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFL  468
             +   +A   ELL+ GLGWAAW++H  V+  +   V++F + W++SP I Q    F    +
Sbjct  325   AVSGEATTRELLENGLGWAAWKLHLAVANHNASAVLDFLKEWLESPFIYQIGGFFDPYCV  384

Query  467   GIASSPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLE-KGSVDIEVCLLPHTLHT  291
              + SSPR N+Y  +FG GK VAVR G  NK DGK + +PG E  GS+D+EVCL P T+  
Sbjct  385   MMGSSPRFNMYGNEFGMGKAVAVRSGYANKFDGKVTSYPGHEGGGSIDLEVCLSPDTMSA  444

Query  290   LGNDQEFMEFV  258
             L +D EFM  V
Sbjct  445   LESDDEFMSAV  455



>ref|XP_011029557.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Populus 
euphratica]
Length=460

 Score =   259 bits (662),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 142/305 (47%), Positives = 189/305 (62%), Gaps = 6/305 (2%)
 Frame = -1

Query  1154  GISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQ---LSLPPVL  984
             G +  LL +QVTEL DG FIG ++NH+  D SSFWHFFN WSEI +G      +S PPVL
Sbjct  148   GHTKSLLTIQVTELTDGIFIGCSINHSIVDGSSFWHFFNMWSEIFQGKGDDVSISRPPVL  207

Query  983   DPWFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEMGTDSI  804
             + WFP      L LPF    + LS  F  P L+ER+FHFS ++IA+ K KAN+E+ T+ I
Sbjct  208   NRWFPDGHGPVLTLPFTHHDQFLSP-FEAPLLKERMFHFSSESIARPKAKANAEINTNKI  266

Query  803   SSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHS-KLAKAN  627
             SS QS  A +WR ITRAR L   +     + I  R R NPPL   Y+GN+I + K   + 
Sbjct  267   SSFQSLSALVWRCITRARNLPHDQVTCCRMAINNRSRLNPPLSPDYFGNSIQALKAGVST  326

Query  626   AGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIASSPR  447
             AGELL++ LGWAAWQ+H+ V     E+  EF   W+KS  I Q  K+F  + + + SSPR
Sbjct  327   AGELLEQNLGWAAWQLHQAVVSHSDEKAREFLSLWLKSRFIYQIGKLFDPHSVMMGSSPR  386

Query  446   NNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLE-KGSVDIEVCLLPHTLHTLGNDQEF  270
              N Y  +FG GK +A+R G  +K  GK S +PG E  GS+++E+CL P  +  L +D+EF
Sbjct  387   FNKYGNEFGLGKALALRSGYAHKFSGKASAYPGHEGGGSIELEICLSPDEMTALESDKEF  446

Query  269   MEFVT  255
             M  V+
Sbjct  447   MGVVS  451



>gb|ABC47860.1| N-hydroxycinnamoyl/benzoyltransferase 1 [Glycine max]
Length=455

 Score =   259 bits (662),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 137/311 (44%), Positives = 187/311 (60%), Gaps = 9/311 (3%)
 Frame = -1

Query  1166  TSRKGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQ------  1005
              +  G + PLL +QVT+L D  FIG +MNH   D +S+W+FFN+WSEI +   +      
Sbjct  145   VNHDGHTMPLLSIQVTQLVDAVFIGCSMNHVIGDGTSYWNFFNTWSEIFQAQAEGHEYDV  204

Query  1004  -LSLPPVLDPWFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKAN  828
              +S  P+ + WFP      + LPF    E +S  F  P L ER+FHFS ++IAKLK KAN
Sbjct  205   PISHNPIHNRWFPELYGPLINLPFKNHDEFISR-FESPKLRERIFHFSAESIAKLKAKAN  263

Query  827   SEMGTDSISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIH  648
              E  T  ISS QS  A +WR+ITRAR +   +  S  +    R R  PPLP+ Y+GN++H
Sbjct  264   KECNTTKISSFQSLSALVWRSITRARSVPQEQRTSCKLATDNRSRMEPPLPKEYFGNSLH  323

Query  647   SKLAKANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFL  468
             +   +A   ELL+ GLGWAAW++H  V+  +   V++F + W++SP I Q    F    +
Sbjct  324   AVSGEATTRELLENGLGWAAWKLHLAVANHNASAVLDFLKEWLESPFIYQIGGFFDPYCV  383

Query  467   GIASSPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLE-KGSVDIEVCLLPHTLHT  291
              + SSPR N+Y  +FG GK VAVR G  NK DGK + +PG E  GS+D+EVCL P T+  
Sbjct  384   MMGSSPRFNMYGNEFGMGKAVAVRSGYANKFDGKVTSYPGHEGGGSIDLEVCLSPDTMSA  443

Query  290   LGNDQEFMEFV  258
             L +D EFM  V
Sbjct  444   LESDDEFMSAV  454



>ref|XP_008452572.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Cucumis 
melo]
Length=462

 Score =   259 bits (662),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 137/309 (44%), Positives = 185/309 (60%), Gaps = 5/309 (2%)
 Frame = -1

Query  1169  TTSRKGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQ---LS  999
               +  G ST LL +QVTEL DG FIG ++NH+  D SS+WHF N WSEI +   +   +S
Sbjct  147   AANHDGHSTSLLSIQVTELLDGVFIGCSINHSLVDGSSYWHFLNMWSEIFQAEDENYSIS  206

Query  998   LPPVLDPWFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEM  819
              PP+L  WFP      L LPF    +   + F  P L ER+FHF+  ++A LK +AN+E 
Sbjct  207   RPPILQRWFPDGHGPILKLPFT-NPDQFITKFEAPQLRERMFHFTSASLAVLKARANTEY  265

Query  818   GTDSISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKL  639
              T+ ISS QS  A +WR+ITRAR L+P +  S  + +  R R NPPLPE Y+GN+I +  
Sbjct  266   KTNKISSFQSLSALVWRSITRARGLSPDQTTSCRLAVNNRLRLNPPLPENYFGNSIQAIR  325

Query  638   AKANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIA  459
               A   ELL+  LGWAAW++HE V   D E+V +    WV+SP +    ++F    + + 
Sbjct  326   GVAIVKELLENNLGWAAWKLHEAVVNHDDEKVRDHVNKWVESPFVYHIEQLFDPLSVMMG  385

Query  458   SSPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLE-KGSVDIEVCLLPHTLHTLGN  282
             SSPR N Y   FG GK +A+R G  +K DGK S +PG E  GS+D+E+CL P  +  L  
Sbjct  386   SSPRFNKYGNVFGMGKALALRSGYAHKFDGKVSCYPGSEGGGSIDLELCLRPEFMSVLEA  445

Query  281   DQEFMEFVT  255
             D+EFM   T
Sbjct  446   DEEFMNATT  454



>ref|XP_006346306.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Solanum 
tuberosum]
Length=471

 Score =   259 bits (663),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 135/301 (45%), Positives = 187/301 (62%), Gaps = 8/301 (3%)
 Frame = -1

Query  1142  PLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQLSLPPVLDPWFPGN  963
             P L VQVTEL DG FIG A NH   D +SFWHF+NSW+E+SRG   +S  P L   FP  
Sbjct  157   PCLAVQVTELVDGIFIGCANNHALVDGTSFWHFYNSWAEVSRGFNVISKIPYLKRKFPFK  216

Query  962   IARPLCLPFDLQQETLSS--SFTPPPLE---ERVFHFSKDTIAKLKEKANSEMGTDSISS  798
             I         +  E ++S   F PP L+   E++FHFSK+ ++KLK KAN EM T  ISS
Sbjct  217   IDH-FSDRISIPNERINSGDKFIPPALQMLREKLFHFSKENVSKLKAKANHEMNTSKISS  275

Query  797   LQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRW-RTNPPLPEGYWGNAIHSKLAKANAG  621
             LQ+ V H+W ++ R RRL+ +E+ +  V I  R  R NPPLPEG++GNAI+        G
Sbjct  276   LQAVVTHVWLSVIRCRRLDHSEETTFEVSIDMRRKRLNPPLPEGFFGNAIYPAPTTIKTG  335

Query  620   ELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIASSPRNN  441
             ELL+ G GWAA QI++ ++  DHE++   Y+NW+  P + +   +  +N+  +  SP+ +
Sbjct  336   ELLEHGFGWAALQINKTIASHDHEKLKCIYENWMNDPEVPKLGDL-PSNYFMLNGSPQFD  394

Query  440   VYATDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDIEVCLLPHTLHTLGNDQEFMEF  261
              Y  DFGWG+P+A R G+ N  DGK ++ PGLE+GS+ +E+CL   T+  L  D  F EF
Sbjct  395   FYKYDFGWGQPIAHRSGVGNMLDGKITVSPGLEEGSMILEICLSSETIQALVEDIIFGEF  454

Query  260   V  258
             V
Sbjct  455   V  455



>ref|XP_004141385.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Cucumis 
sativus]
 gb|KGN55209.1| hypothetical protein Csa_4G639960 [Cucumis sativus]
Length=464

 Score =   259 bits (661),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 139/308 (45%), Positives = 186/308 (60%), Gaps = 5/308 (2%)
 Frame = -1

Query  1166  TSRKGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQ---LSL  996
             T+  G ST LL +Q+TEL DG FIG ++NH+  D SS+W+FFN WSEI +       +S 
Sbjct  150   TNHDGHSTSLLSIQITELLDGVFIGCSINHSLVDGSSYWNFFNMWSEIFQAEDDNFSISR  209

Query  995   PPVLDPWFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEMG  816
             PPVL  WFP      L LPF    +   + F  P L ER+FHFS  ++A LK +AN+E  
Sbjct  210   PPVLQRWFPDAHGPILKLPFT-NLDQFITKFEAPQLRERMFHFSPASLAVLKARANTEYK  268

Query  815   TDSISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKLA  636
             T+ ISS QS  A +WR+ITRAR L+P +     + I  R R NPPLPE Y+GN+I +   
Sbjct  269   TNKISSFQSLSALVWRSITRARGLSPDQTTGCRLAINNRTRLNPPLPENYFGNSIQAIRT  328

Query  635   KANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIAS  456
              A   ELL+  LGWAAW++HE V   D+E+V +    WV+SP + +  K+F    + + S
Sbjct  329   AATVKELLENNLGWAAWKLHEAVVNHDNEKVRDHVNKWVESPFVYRMEKLFDPLSVMMGS  388

Query  455   SPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLE-KGSVDIEVCLLPHTLHTLGND  279
             SPR N Y   FG GK +A+R G  +K DGK S +PG E  GS+ +E+CL P  +  L  D
Sbjct  389   SPRFNKYGNVFGMGKALALRSGYAHKFDGKVSCYPGSEGGGSIVLELCLRPEFMSVLEAD  448

Query  278   QEFMEFVT  255
             +EFM   T
Sbjct  449   EEFMNATT  456



>ref|XP_007203290.1| hypothetical protein PRUPE_ppa025724mg [Prunus persica]
 gb|EMJ04489.1| hypothetical protein PRUPE_ppa025724mg [Prunus persica]
Length=359

 Score =   255 bits (652),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 138/314 (44%), Positives = 185/314 (59%), Gaps = 40/314 (13%)
 Frame = -1

Query  1157  KGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQLSL--PPVL  984
             +G+  PLL VQVTEL DG FIG  MNH   D SSFWHFFN+WSEIS      +   PPV 
Sbjct  70    EGVPKPLLAVQVTELVDGIFIGCTMNHCVVDGSSFWHFFNTWSEISCSGSDENFQPPPVF  129

Query  983   DPWFPGNIARPLCLPFDLQQETLSSSFTPP---PLEERVFHFSKDTIAKLKEKANSEMGT  813
             D  F            D++      S  PP      + VFHFS++  A++K KAN+EMGT
Sbjct  130   DRQF-----------LDVKYRI---SLNPPISLNYLQTVFHFSREKTAQIKSKANAEMGT  175

Query  812   DSISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKLAK  633
              +ISSLQ+ +AHLWRA+TRA  LN  +++   + +G R +  PPLP+ Y GNA+     K
Sbjct  176   HNISSLQALMAHLWRAVTRASHLNLDQEIIYKIEVGLRQKLKPPLPKEYLGNALQGVHVK  235

Query  632   ANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQK---------SKVFF  480
             + AGELL+  LGWAA  I++ ++    E+V++  ++W K+P ++ K         +   F
Sbjct  236   STAGELLQHELGWAALHINKTIASLTAEQVMKVLEDWAKTPTVSSKLRENIPTSTTSSIF  295

Query  479   ANFLGIASSPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDIEVCLLPHT  300
             +   G  SSPR NVY  DFGWG+PVAV+ G +NK          + +GS+D EVCLLP T
Sbjct  296   SLLTG--SSPRFNVYGNDFGWGRPVAVQSGSENK----------MNEGSIDFEVCLLPET  343

Query  299   LHTLGNDQEFMEFV  258
             LH +  D EFME V
Sbjct  344   LHAMAEDAEFMEAV  357



>ref|XP_010059907.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Eucalyptus 
grandis]
 gb|KCW66382.1| hypothetical protein EUGRSUZ_F00198 [Eucalyptus grandis]
Length=462

 Score =   258 bits (660),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 141/308 (46%), Positives = 180/308 (58%), Gaps = 8/308 (3%)
 Frame = -1

Query  1154  GISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQ-------LSL  996
             G +  LL VQVTEL DG FIGL+MNHT  D +SFW FFNSWS+I +   +       LS 
Sbjct  153   GHTLSLLSVQVTELADGVFIGLSMNHTIGDGTSFWLFFNSWSKIFQAQEKGAVDVVPLSR  212

Query  995   PPVLDPWFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEMG  816
             PP L  WFP N+  PL LP+     +  + F  P L ERVFHFS D IA LK +AN + G
Sbjct  213   PPALTRWFPENLPGPLSLPYTDDPSSFLARFEAPELRERVFHFSADAIAGLKAEANRQCG  272

Query  815   TDSISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKLA  636
             T +ISS QS  A +WR I RARR  P++     +    R R +PPL   Y+GN+I     
Sbjct  273   TTNISSFQSLTALVWRCIARARRFPPSQVTGCRMAANNRARLDPPLSPEYFGNSITPVRT  332

Query  635   KANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIAS  456
              A  GELL  GLGWAA  +H  V+     ++ E+ ++W+K P +    K F    + + S
Sbjct  333   AAKVGELLGSGLGWAARLLHTAVAEHSSAKLREWNEDWIKRPQVYHLDKTFDQYSIMMGS  392

Query  455   SPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLE-KGSVDIEVCLLPHTLHTLGND  279
             SPR + Y  +FG GK VA+R G  NK DGK S +PG E  GS+D+E+CL P T+  L  D
Sbjct  393   SPRFDKYGNEFGLGKAVALRSGYANKFDGKVSAYPGHEGGGSIDLEICLPPTTMALLEVD  452

Query  278   QEFMEFVT  255
              EFM  VT
Sbjct  453   PEFMAAVT  460



>gb|KHN22332.1| Putative acetyltransferase [Glycine soja]
Length=456

 Score =   258 bits (659),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 137/311 (44%), Positives = 187/311 (60%), Gaps = 9/311 (3%)
 Frame = -1

Query  1166  TSRKGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQ------  1005
              +  G + PLL +QVT+L D  FIG +MNH   D +S+W+FFN+WSEI +   +      
Sbjct  146   VNHDGHTMPLLSIQVTQLVDAVFIGCSMNHVIGDGTSYWNFFNTWSEIFQAQAEGHEYDV  205

Query  1004  -LSLPPVLDPWFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKAN  828
              +S  P+ + WFP      + LPF    E +S  F  P L ER+FHFS ++IAKLK KAN
Sbjct  206   PISHNPIHNRWFPELYGPLINLPFKNHDEFISR-FESPKLRERIFHFSAESIAKLKAKAN  264

Query  827   SEMGTDSISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIH  648
              E  T  ISS QS  A +WR+ITRAR +   +  S  +    R R  PPLP+ Y+GN++H
Sbjct  265   KECNTTKISSFQSLSALVWRSITRARSVPQEQRTSCKLATDNRSRMEPPLPKEYFGNSLH  324

Query  647   SKLAKANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFL  468
             +   +A   ELL+ GLGWAAW++H  V+  +   V++F + W++SP I Q    F    +
Sbjct  325   AVSGEATTRELLENGLGWAAWKLHLAVANHNASAVLDFLKVWLESPFIYQIGGFFDPYCV  384

Query  467   GIASSPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLE-KGSVDIEVCLLPHTLHT  291
              + SSPR N+Y  +FG GK VAVR G  NK DGK + +PG E  GS+D+EVCL P T+  
Sbjct  385   MMGSSPRFNMYGNEFGMGKAVAVRSGYANKFDGKVTSYPGHEGGGSIDLEVCLSPDTMSA  444

Query  290   LGNDQEFMEFV  258
             L +D EFM  V
Sbjct  445   LESDDEFMSAV  455



>gb|KEH33177.1| HXXXD-type acyl-transferase family protein [Medicago truncatula]
Length=449

 Score =   258 bits (658),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 139/320 (43%), Positives = 194/320 (61%), Gaps = 20/320 (6%)
 Frame = -1

Query  1157  KGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRG--MPQLSLPPVL  984
             +G S PL  VQVTEL DG FIG   NH   D +S W+F NSW+EISRG    Q S    L
Sbjct  132   EGTSQPLFAVQVTELVDGIFIGFTFNHVVVDGTSAWYFINSWAEISRGGCCNQTSKLSTL  191

Query  983   DPWFPGNIARPLCLPFDLQQETLSS---SFTPPPLEE----------RVFHFSKDTIAKL  843
             + WFP  I  P+  PF  + +   S   SF+    E+          R+FHF+K+ I++L
Sbjct  192   ERWFPDGIQCPIRFPFTKKLQNNQSDGLSFSSSNNEKLNNEKLNPSVRLFHFTKEKISQL  251

Query  842   KEKANSEMGTDSISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYW  663
             K KAN E GT+ ISSLQ+  AHLW ++ R+ +L+P E+    V IG R R  PPLPE Y+
Sbjct  252   KLKANLETGTNKISSLQALFAHLWCSVIRSDQLDPQENAYFMVGIGVRQRFVPPLPEDYF  311

Query  662   GNAIHSKLAKANAGELLKR-GLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKV  486
             GNA+ + +     GELL+  G G  AW++HE + +  +E++   Y+NWV++P+I +    
Sbjct  312   GNAVVASMVAMKVGELLEEGGFGKCAWKMHETICLHSNEKLKNDYENWVRNPIIYRLGDS  371

Query  485   FFANFLGIASSPRN--NVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDIEVCL  312
               A++  +ASS     +VY  +FGWGKPVAVR G  NK  G F++F G+E+GS+D++VCL
Sbjct  372   NVADYHVLASSSSQWFDVYGNNFGWGKPVAVRSG--NKQSGLFAVFAGIEEGSMDLQVCL  429

Query  311   LPHTLHTLGNDQEFMEFVTH  252
                 L  +GND  FM FV++
Sbjct  430   PHKILEAMGNDPVFMNFVSN  449



>gb|KJB63871.1| hypothetical protein B456_010G021300 [Gossypium raimondii]
Length=455

 Score =   258 bits (658),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 142/306 (46%), Positives = 187/306 (61%), Gaps = 8/306 (3%)
 Frame = -1

Query  1154  GISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMP----QLSLPPV  987
             G + PLL +QVTEL DG FIG +MNH   D ++FWHFFN+ SEI +       ++S PPV
Sbjct  146   GHTRPLLSIQVTELVDGVFIGCSMNHVLGDGATFWHFFNALSEIFQAQGDTKMKISRPPV  205

Query  986   LDPWFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEMGTDS  807
             L+ WFP      L LPF  Q E ++  F  P L ER+FHFS  +IAKLKE+AN+E  T  
Sbjct  206   LEKWFPEGHGPLLNLPFTNQDEFITR-FEAPELLERMFHFSAKSIAKLKERANTESNTIE  264

Query  806   ISSLQSYVAHLWRAITRARRLNPTEDVS-IYVPIGTRWRTNPPLPEGYWGNAIHSKLAKA  630
             ISS QS  A +WR IT+ARR  P E V+   + I  R R  P LP  Y+GN+I S  A  
Sbjct  265   ISSFQSLSAFVWRTITKARRF-PNETVTGCRLAINNRSRLEPALPLDYFGNSIQSVRAVT  323

Query  629   NAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIASSP  450
              AGELL   LGWAAW++H+ V     ++V  F   W+ SP I + +++F    +   SSP
Sbjct  324   TAGELLHHNLGWAAWKLHQAVVNHTDKQVRGFVNGWLDSPFIYKIAQLFDPQSVMFGSSP  383

Query  449   RNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLE-KGSVDIEVCLLPHTLHTLGNDQE  273
             R N+Y  +FG GK + +R G  +K DGK S +PG E  GSVD+E+CL P ++  L  D+E
Sbjct  384   RFNMYENEFGLGKALMLRSGYAHKFDGKVSSYPGREGGGSVDLEICLPPSSMKALELDEE  443

Query  272   FMEFVT  255
             FM  V+
Sbjct  444   FMSVVS  449



>ref|XP_003628043.1| Acetyltransferase, putative [Medicago truncatula]
 gb|ABE88091.1| Transferase family [Medicago truncatula]
 gb|AET02519.1| HXXXD-type acyl-transferase family protein [Medicago truncatula]
Length=442

 Score =   257 bits (657),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 132/303 (44%), Positives = 188/303 (62%), Gaps = 2/303 (1%)
 Frame = -1

Query  1157  KGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQLSLPPVLDP  978
             +G S PLL VQVTEL +G FI   +NH  AD +S WHF NSW++IS G  ++S  P  + 
Sbjct  141   EGTSMPLLAVQVTELVNGIFIACTVNHVVADGTSIWHFINSWAKISNGSLEISKIPSFER  200

Query  977   WFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEMGTDSISS  798
             WF  +I  P+  PF ++ + +        L ER+FHF+K+ IAKLK KAN E GT +ISS
Sbjct  201   WFSDDIQPPIQFPFTIEPQNIHHKEEKLNLYERMFHFTKENIAKLKFKANLEAGTKNISS  260

Query  797   LQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKLAKANAGE  618
             LQ+   H+WR+I R++ L+P E+V   V IG R R  P L + Y+GNA+         G+
Sbjct  261   LQALFTHIWRSIIRSKNLDPEEEVHYVVVIGVRPRLIPLLKKDYFGNALIDPAVSMKVGD  320

Query  617   LLK-RGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIASSPRNN  441
             LL+  GLG  A ++++++++Q  E +   Y++W+K+P     +K      +G +SSP  +
Sbjct  321   LLQDNGLGKGALEMNKMIALQSDEMLKNEYESWLKTPSFITDAKFNCKTLVG-SSSPWFD  379

Query  440   VYATDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDIEVCLLPHTLHTLGNDQEFMEF  261
             VY  DFGWGKPV VR G  NK +G   +F G+EK S+D+EVCL   TL  +GND EFM  
Sbjct  380   VYGNDFGWGKPVGVRTGGANKENGNICVFQGVEKDSMDLEVCLSHETLEAIGNDPEFMNV  439

Query  260   VTH  252
             V++
Sbjct  440   VSN  442



>ref|XP_010064180.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Eucalyptus 
grandis]
 gb|KCW66385.1| hypothetical protein EUGRSUZ_F00202 [Eucalyptus grandis]
Length=465

 Score =   258 bits (659),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 144/308 (47%), Positives = 183/308 (59%), Gaps = 8/308 (3%)
 Frame = -1

Query  1154  GISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRG-------MPQLSL  996
             G +  LL VQVTEL DG FIGL+MNH  AD +SFW FFNSWSEI +        + QLS 
Sbjct  156   GHTLSLLSVQVTELADGVFIGLSMNHAIADGTSFWLFFNSWSEIFQAQEKGAVDVVQLSR  215

Query  995   PPVLDPWFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEMG  816
             PPVL  WFP N   PL LP+     +  + F  P L ERVFHFS D IA+LK +AN + G
Sbjct  216   PPVLTRWFPENHPGPLSLPYTDDPSSFLARFESPELRERVFHFSADAIAELKAEANRQCG  275

Query  815   TDSISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKLA  636
             T +ISS QS  A +WR ITRAR   P +     +    R R +P L   Y+GN+I+    
Sbjct  276   TTNISSFQSLTALIWRCITRARHFPPNQVTGCRMAANNRARLDPQLSPEYFGNSINFLRT  335

Query  635   KANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIAS  456
              A  GELL  GLGWAA  +H  V+   + ++ E+ ++W+K P +    K F    + + S
Sbjct  336   VATVGELLGSGLGWAAQLLHAAVAGHSNAKLREWNEDWIKRPQVYNPDKTFDRYSVMMGS  395

Query  455   SPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLE-KGSVDIEVCLLPHTLHTLGND  279
             SPR + Y ++FG GK VA+R G  NK DGK S +PG E  GSVD+E+CL P T+  L  D
Sbjct  396   SPRFDKYGSEFGLGKAVALRSGYANKWDGKASGYPGREGGGSVDLEICLPPVTMALLEAD  455

Query  278   QEFMEFVT  255
              EFM  VT
Sbjct  456   PEFMAAVT  463



>gb|KHN04491.1| Putative acetyltransferase [Glycine soja]
Length=461

 Score =   258 bits (658),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 136/307 (44%), Positives = 188/307 (61%), Gaps = 8/307 (3%)
 Frame = -1

Query  1166  TSRKGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQ-----L  1002
              +  G + PLL VQVTE  DG FIG +MNHT  D +S+W+FFN+WS+I +         +
Sbjct  145   VNHDGHTMPLLSVQVTEFVDGVFIGCSMNHTLGDGTSYWNFFNTWSQIFQVQGHEHDVPI  204

Query  1001  SLPPVLDPWFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSE  822
             S PP+ + WFP      + LPF    +   + +  P L ER+FHFS ++IAKLK KANSE
Sbjct  205   SHPPIHNRWFPEGCGPLINLPFK-HHDDFINRYETPLLRERIFHFSAESIAKLKAKANSE  263

Query  821   MGTDSISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHS-  645
               T  ISS QS  A +WR ITRARRL   +  S  +    R R  PPLP+ Y+GN+I++ 
Sbjct  264   CNTTKISSFQSLSALVWRCITRARRLPYDQRTSCKLSANNRTRMEPPLPQEYFGNSIYTL  323

Query  644   KLAKANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLG  465
                 A +G+LL+ G+GWAAW++H+ V   +   V+E  + W++SP+I    + F    + 
Sbjct  324   NAGTATSGKLLENGIGWAAWKLHKSVVNHNDRAVLETLKEWLESPLIYDLGRYFDPYCVM  383

Query  464   IASSPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLE-KGSVDIEVCLLPHTLHTL  288
             + SSPR N+Y  +FG GK VA+R G  NK DGK + +PG E  GSVD+EVCL P  +  L
Sbjct  384   MGSSPRFNMYGNEFGMGKAVALRSGYANKFDGKVTSYPGHEGGGSVDLEVCLSPAVMSAL  443

Query  287   GNDQEFM  267
              +D+EFM
Sbjct  444   ESDEEFM  450



>ref|XP_003523950.1| PREDICTED: uncharacterized acetyltransferase At3g50280 [Glycine 
max]
 gb|ABC47848.1| N-hydroxycinnamoyl/benzoyltransferase 6 [Glycine max]
Length=461

 Score =   258 bits (658),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 136/307 (44%), Positives = 188/307 (61%), Gaps = 8/307 (3%)
 Frame = -1

Query  1166  TSRKGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQ-----L  1002
              +  G + PLL VQVTE  DG FIG +MNHT  D +S+W+FFN+WS+I +         +
Sbjct  145   VNHDGHTMPLLSVQVTEFVDGVFIGCSMNHTLGDGTSYWNFFNTWSQIFQVQGHEHDVPI  204

Query  1001  SLPPVLDPWFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSE  822
             S PP+ + WFP      + LPF    +   + +  P L ER+FHFS ++IAKLK KANSE
Sbjct  205   SHPPIHNRWFPEGCGPLINLPFK-HHDDFINRYETPLLRERIFHFSAESIAKLKAKANSE  263

Query  821   MGTDSISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHS-  645
               T  ISS QS  A +WR ITRARRL   +  S  +    R R  PPLP+ Y+GN+I++ 
Sbjct  264   CNTTKISSFQSLSALVWRCITRARRLPYDQRTSCKLSANNRTRMEPPLPQEYFGNSIYTL  323

Query  644   KLAKANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLG  465
                 A +G+LL+ G+GWAAW++H+ V   +   V+E  + W++SP+I    + F    + 
Sbjct  324   NAGTATSGKLLENGIGWAAWKLHKSVVNHNDRAVLETLKEWLESPLIYDLGRYFDPYCVM  383

Query  464   IASSPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLE-KGSVDIEVCLLPHTLHTL  288
             + SSPR N+Y  +FG GK VA+R G  NK DGK + +PG E  GSVD+EVCL P  +  L
Sbjct  384   MGSSPRFNMYGNEFGMGKAVALRSGYANKFDGKVTSYPGHEGGGSVDLEVCLSPAVMSAL  443

Query  287   GNDQEFM  267
              +D+EFM
Sbjct  444   ESDEEFM  450



>gb|ACU18586.1| unknown [Glycine max]
Length=461

 Score =   258 bits (658),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 136/307 (44%), Positives = 188/307 (61%), Gaps = 8/307 (3%)
 Frame = -1

Query  1166  TSRKGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQ-----L  1002
              +  G + PLL VQVTE  DG FIG +MNHT  D +S+W+FFN+WS+I +         +
Sbjct  145   VNHDGHTMPLLSVQVTEFVDGVFIGCSMNHTLGDGTSYWNFFNTWSQIFQVQGHEHDVPI  204

Query  1001  SLPPVLDPWFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSE  822
             S PP+ + WFP      + LPF    +   + +  P L ER+FHFS ++IAKLK KANSE
Sbjct  205   SHPPIHNRWFPEGCGPLINLPFK-HHDDFINRYETPLLRERIFHFSAESIAKLKAKANSE  263

Query  821   MGTDSISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHS-  645
               T  ISS QS  A +WR ITRARRL   +  S  +    R R  PPLP+ Y+GN+I++ 
Sbjct  264   CNTTKISSFQSLSALVWRCITRARRLPYDQRTSCKLSANNRTRMEPPLPQEYFGNSIYTL  323

Query  644   KLAKANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLG  465
                 A +G+LL+ G+GWAAW++H+ V   +   V+E  + W++SP+I    + F    + 
Sbjct  324   NAGTATSGKLLENGIGWAAWKLHKSVVNHNDRAVLETLKEWLESPLIYDLGRYFDLYCVM  383

Query  464   IASSPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLE-KGSVDIEVCLLPHTLHTL  288
             + SSPR N+Y  +FG GK VA+R G  NK DGK + +PG E  GSVD+EVCL P  +  L
Sbjct  384   MGSSPRFNMYGKEFGMGKAVALRSGYANKFDGKVTSYPGHEGGGSVDLEVCLSPAVMSAL  443

Query  287   GNDQEFM  267
              +D+EFM
Sbjct  444   ESDEEFM  450



>emb|CAN78155.1| hypothetical protein VITISV_032623 [Vitis vinifera]
Length=602

 Score =   261 bits (667),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 138/306 (45%), Positives = 189/306 (62%), Gaps = 7/306 (2%)
 Frame = -1

Query  1154  GISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQ-----LSLPP  990
             G +  LL +Q+TEL DG FIG ++NH+  D +SFWHFFN+WSE+     +     LS PP
Sbjct  226   GRTLSLLSIQITELVDGIFIGCSINHSMVDGTSFWHFFNAWSEVFTAQGKNSSITLSRPP  285

Query  989   VLDPWFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEMGTD  810
             +L  WFP      + LPF    E +S  F  P L ER+FHFS ++IAKLK KAN++  ++
Sbjct  286   ILKRWFPDGYGPIINLPFTHHDEFISR-FEAPVLRERIFHFSSESIAKLKAKANAQCNSN  344

Query  809   SISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKLAKA  630
              ISS Q+  A +WR+ITRAR     +  S  +  G R R +PPLPE Y+GN+I +    A
Sbjct  345   KISSFQALSALVWRSITRARCFPHEQVTSCRLATGNRTRLDPPLPENYFGNSIQTVRGIA  404

Query  629   NAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIASSP  450
              AGELL+  LGWAAW +H+ V     + V  + ++W +S  I Q    F  N + + SSP
Sbjct  405   TAGELLEHDLGWAAWLLHQAVVGHTDKAVRGWLESWFQSHFIYQLGLFFDPNSVMMGSSP  464

Query  449   RNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLE-KGSVDIEVCLLPHTLHTLGNDQE  273
             R N Y  +FG GK +AVR G  +K DGK S +PG E  GS+D+EVCL P+++  L ++QE
Sbjct  465   RFNKYGIEFGLGKGLAVRSGYAHKFDGKVSCYPGREGGGSIDLEVCLPPNSMSALESNQE  524

Query  272   FMEFVT  255
             FME V+
Sbjct  525   FMEAVS  530



>ref|XP_003523951.1| PREDICTED: uncharacterized acetyltransferase At3g50280 [Glycine 
max]
 gb|ABC47846.1| N-hydroxycinnamoyl/benzoyltransferase 4 [Glycine max]
Length=469

 Score =   257 bits (656),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 131/309 (42%), Positives = 189/309 (61%), Gaps = 6/309 (2%)
 Frame = -1

Query  1166  TSRKGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEI----SRGMPQLS  999
              +  G +  LL +QVTEL D  FIG +MNH   D +S+W+FFN+WS+I    S  +    
Sbjct  144   VNHDGHTMSLLSIQVTELVDAVFIGCSMNHVVGDGTSYWNFFNTWSQIFQSQSHALGHEY  203

Query  998   LPPVLDPWFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEM  819
               P+ + WFP + A P+ LPF +  + + S +  P L ER+FHFS ++IAKLK KANSE 
Sbjct  204   DVPIHNRWFPKDCAPPINLPF-IHHDEIISRYEAPKLRERIFHFSAESIAKLKAKANSES  262

Query  818   GTDSISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKL  639
              T  ISS QS  A +WR++TRAR     +  +  +    R R  PPLP+ Y+GN++H   
Sbjct  263   NTTKISSFQSLSALVWRSVTRARSPPNDQRTTCRLAANNRSRMEPPLPQEYFGNSVHVVS  322

Query  638   AKANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIA  459
             A+   GELL+ G+GWAAW++H  V+  ++  V++  + W++SP + Q  + F    + + 
Sbjct  323   AETTTGELLENGIGWAAWKLHMAVANYNNGVVLQSLKVWLESPFVIQMGRFFDPYCVMMG  382

Query  458   SSPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLE-KGSVDIEVCLLPHTLHTLGN  282
             SSPR NVY  +FG GK VA R G  NK +GK + +PG E  GS+D+EVCL P  +  L +
Sbjct  383   SSPRFNVYGNEFGMGKAVAARSGYANKFEGKVTSYPGREGGGSIDLEVCLSPENMTALES  442

Query  281   DQEFMEFVT  255
             D+EFM  V+
Sbjct  443   DEEFMNAVS  451



>ref|XP_007017180.1| HXXXD-type acyl-transferase family protein [Theobroma cacao]
 gb|EOY14405.1| HXXXD-type acyl-transferase family protein [Theobroma cacao]
Length=452

 Score =   256 bits (654),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 140/304 (46%), Positives = 184/304 (61%), Gaps = 5/304 (2%)
 Frame = -1

Query  1154  GISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMP---QLSLPPVL  984
             G + PLL +QVTEL DG FIG +MNH   D S+FWHFFN  SEI +      ++S  PVL
Sbjct  147   GHTRPLLSIQVTELVDGVFIGCSMNHAIGDGSTFWHFFNILSEIFQAQGDNVKISRQPVL  206

Query  983   DPWFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEMGTDSI  804
               WFP      + LPF  Q E L   F  P L ER+FHFS ++IAKLK +ANSE  T  I
Sbjct  207   KRWFPEGHGPLINLPFTHQDE-LIRRFEAPQLLERIFHFSAESIAKLKARANSEYNTSKI  265

Query  803   SSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKLAKANA  624
             SS QS  A +W +IT+ARR    +  S  + I  R R +PPL   Y+GN+I +  A   A
Sbjct  266   SSFQSLSAFVWMSITKARRFPNDQLTSCRLAINNRSRLDPPLSPDYFGNSIQTVRAVTTA  325

Query  623   GELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIASSPRN  444
             GEL+++ LGWAAWQ+H  V     + V  F  +W++SP I Q  + F    + + SSPR 
Sbjct  326   GELVEQNLGWAAWQLHLAVVNHTDKSVRGFVNDWLRSPFIYQLGQFFDPQSVMMGSSPRF  385

Query  443   NVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLE-KGSVDIEVCLLPHTLHTLGNDQEFM  267
             N Y  +FG GK +A+R G  +K DGK S +PG E  GS+D+EVCL  H+++ L +D EFM
Sbjct  386   NKYGNEFGLGKALALRSGYAHKFDGKVSSYPGREGGGSIDLEVCLPAHSMNALESDAEFM  445

Query  266   EFVT  255
               V+
Sbjct  446   AAVS  449



>gb|KJB63869.1| hypothetical protein B456_010G021000 [Gossypium raimondii]
Length=454

 Score =   256 bits (654),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 140/306 (46%), Positives = 191/306 (62%), Gaps = 8/306 (3%)
 Frame = -1

Query  1154  GISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMP---QLSLPPVL  984
             G + PLL +QVTEL DG FIG +MNH  AD ++F HF N+ SEI +      ++S PPVL
Sbjct  148   GHTKPLLSIQVTELVDGVFIGCSMNHAVADGTTFCHFINTLSEIFQAQGDNIKISRPPVL  207

Query  983   DPWFP-GNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEMGTDS  807
             + W P GN    L LPF  Q E ++   TP  LE R+FHFS ++IAKLK+KAN E  T  
Sbjct  208   ERWCPEGNNGPLLTLPFSHQDEFITRLETPHVLE-RIFHFSAESIAKLKKKANVESNTTE  266

Query  806   ISSLQSYVAHLWRAITRARRLNPTEDVS-IYVPIGTRWRTNPPLPEGYWGNAIHSKLAKA  630
             ISS Q+  A +W ++T+ARR  P E V+   + +  R R  PPL   Y+GN+  ++    
Sbjct  267   ISSFQALSAFVWLSLTKARRF-PCETVTACTLAMNNRSRLEPPLSPNYFGNSFQTETVMT  325

Query  629   NAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIASSP  450
              AGELL+ GLGWAAW++++VV     + V  F  +W++SP + Q     +A  + I SSP
Sbjct  326   TAGELLEHGLGWAAWKLNQVVVNHTDKSVRGFVNDWLRSPFVYQCLTHLYARSVLIGSSP  385

Query  449   RNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLE-KGSVDIEVCLLPHTLHTLGNDQE  273
             R N Y  +FG GK + VR G DNK DGK SL+PGLE  GS+D+E+CL   ++  L +D+E
Sbjct  386   RFNTYGNEFGLGKALTVRSGYDNKFDGKVSLYPGLEGGGSIDMEICLPLSSMKALESDEE  445

Query  272   FMEFVT  255
             FM  V+
Sbjct  446   FMAVVS  451



>ref|XP_009359877.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Pyrus 
x bretschneideri]
Length=459

 Score =   256 bits (653),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 144/312 (46%), Positives = 183/312 (59%), Gaps = 12/312 (4%)
 Frame = -1

Query  1169  TTSRKGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQ-----  1005
               +  G +  LL VQVTEL DG FIGL++NH+  D +SFWHFFN WSEI +   Q     
Sbjct  143   AVNHDGHTMSLLSVQVTELVDGIFIGLSINHSLVDGTSFWHFFNVWSEIFQVQAQEGQNH  202

Query  1004  ----LSLPPVLDPWFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKE  837
                 +  PPVL  WFP      + LPF    E +   F  PPL ER+FHFS ++IAKLK 
Sbjct  203   FVANILRPPVLKRWFPDGHGPIINLPFKHSDEFIGR-FEAPPLRERMFHFSSESIAKLKA  261

Query  836   KANSEMGTDSISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGN  657
             KAN+E  T  ISS +S  A LWR ITRAR L P E  S  +    R R +PPL   Y+GN
Sbjct  262   KANAESDTTKISSFKSLSALLWRTITRARCLAPDEGTSCRLAANNRGRIDPPLSGDYFGN  321

Query  656   AIHS-KLAKANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFF  480
             +IH  K     AGELL+ G+GWAAW++HE V   D + +      W+KSP +   S  F 
Sbjct  322   SIHPVKSETVAAGELLEHGIGWAAWKLHEAVVNHDGKVIRGQVDAWLKSPSVYLVS-YFD  380

Query  479   ANFLGIASSPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDIEVCLLPHT  300
                + + SSPR N+Y  +FG GK +A+R G  +K  GK S + G EKGS+D+EVCL P  
Sbjct  381   PLSVMMGSSPRFNMYGNEFGMGKALALRSGYAHKFSGKVSAYEGREKGSIDLEVCLPPDA  440

Query  299   LHTLGNDQEFME  264
             +  L  D+EFME
Sbjct  441   MSALECDKEFME  452



>ref|XP_010915552.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Elaeis 
guineensis]
Length=461

 Score =   256 bits (653),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 136/306 (44%), Positives = 190/306 (62%), Gaps = 6/306 (2%)
 Frame = -1

Query  1163  SRKGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISR--GMPQLSLPP  990
             +  G + PLL +Q+TEL DG FIG + NH   D +S+W+FFN+W++I+R  G+  LS PP
Sbjct  144   NHDGHTQPLLSIQLTELADGIFIGCSFNHAVGDGTSYWNFFNAWAQIARTKGVAPLSRPP  203

Query  989   VLDPWF-PGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEMGT  813
             V D WF  G+   P+ LPF    +    SF+PPPL E++FHFS  +IA+LK KAN E GT
Sbjct  204   VHDRWFIDGSDTAPIKLPF-THPDDFIESFSPPPLREKIFHFSVQSIARLKAKANQECGT  262

Query  812   DSISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKLAK  633
             +SISS Q+  A +WR+ITR R L+  +  S  +    R R +PPL   Y+GN+I+  +  
Sbjct  263   NSISSHQALSALVWRSITRTRNLSADQKTSCRLAAQNRGRLSPPLSPDYFGNSIYPIIGT  322

Query  632   ANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIASS  453
                GELL   LGWAAW ++  V+  +   +      W+  PV+  +S +F    + + SS
Sbjct  323   TTVGELLNHDLGWAAWLLNRTVADHNDSTIRGRLMAWMARPVVYPQS-LFDPFSVMMGSS  381

Query  452   PRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLEK-GSVDIEVCLLPHTLHTLGNDQ  276
             PR ++Y  DFGWGKPVA R G  NK DGK + + G E  GSVD+EVCL+P ++  L +D+
Sbjct  382   PRFDLYGCDFGWGKPVAGRSGSANKFDGKVTSYLGWEGVGSVDLEVCLVPESMSALESDE  441

Query  275   EFMEFV  258
             EFM  V
Sbjct  442   EFMSVV  447



>ref|XP_007024494.1| HXXXD-type acyl-transferase family protein, putative [Theobroma 
cacao]
 gb|EOY27116.1| HXXXD-type acyl-transferase family protein, putative [Theobroma 
cacao]
Length=444

 Score =   255 bits (651),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 133/301 (44%), Positives = 187/301 (62%), Gaps = 3/301 (1%)
 Frame = -1

Query  1157  KGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQLSLPPVLDP  978
             +G S PLL VQVTEL DG+FI +++NH+  D +SF+HFFNSW  I+    QLS PPV   
Sbjct  146   QGTSNPLLAVQVTELVDGFFISVSVNHSIVDGASFFHFFNSWLAIACDPTQLSKPPVFQR  205

Query  977   WFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEMGTDSISS  798
              F  +I  P+ LP     +T    F PPPL  RVFHFS++ +AKLK KANSE+GT  ISS
Sbjct  206   DFFKDIDFPIRLPRSYFHQT-HDKFIPPPLRVRVFHFSRENVAKLKAKANSEVGTKDISS  264

Query  797   LQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKLAKANAGE  618
             LQ+ ++HLWRA+ R R+ +P E+ +  + I  R +    LPE Y+GN +          E
Sbjct  265   LQALLSHLWRAVIRNRKADPDEETNYCLMISGRPKLQ-QLPERYFGNVLQVGAITMKVKE  323

Query  617   LLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIASSPRNNV  438
             LL  GLG AA Q+++VV+  + E    F + W+++P +     +  +N L  + SPR N+
Sbjct  324   LLDLGLGNAARQMNKVVAAHNEEMFKNFLKTWMETPKLRTMGNM-VSNSLVTSDSPRFNI  382

Query  437   YATDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDIEVCLLPHTLHTLGNDQEFMEFV  258
             Y  + G G P+A+R G  NK DG+ ++  G+E+GS+DIE+CL P T   + ND EFM+ V
Sbjct  383   YGGETGLGTPIAIRSGPANKFDGRVTVHCGVEEGSIDIEICLAPATFGAMENDNEFMDAV  442

Query  257   T  255
             T
Sbjct  443   T  443



>ref|XP_002510186.1| Anthranilate N-benzoyltransferase protein, putative [Ricinus 
communis]
 gb|EEF52373.1| Anthranilate N-benzoyltransferase protein, putative [Ricinus 
communis]
Length=452

 Score =   255 bits (651),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 137/299 (46%), Positives = 182/299 (61%), Gaps = 5/299 (2%)
 Frame = -1

Query  1139  LLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMP---QLSLPPVLDPWFP  969
             LL +QVT+L DG FIG +MNH   D SSFW F NS+SEI +      Q++ PP L  WFP
Sbjct  149   LLTIQVTDLVDGVFIGCSMNHAIGDGSSFWQFLNSFSEIFQAQGSEFQIAHPPDLKRWFP  208

Query  968   GNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEMGTDSISSLQS  789
                   + LPF   ++ L   F  PP  ERVFHFS ++IAKLK +ANSE  T+ ISS QS
Sbjct  209   DGYGPIVNLPFTHHEQFLGH-FEAPPFRERVFHFSSESIAKLKARANSEYNTNKISSFQS  267

Query  788   YVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKLAKANAGELLK  609
               A +WR I R R+L   +  S  +    R R  PPL   Y+GN I+   A   AGELL+
Sbjct  268   LSAFMWRCIMRTRKLPHDQITSCRLACNNRSRLKPPLSADYFGNCIYPLRASTTAGELLE  327

Query  608   RGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIASSPRNNVYAT  429
               LGWAAW+ H+ V  Q  E++ E  ++W+KSP+I Q  ++F    + + SSPR N Y +
Sbjct  328   NNLGWAAWRTHQAVVNQSDEKIRESLESWLKSPIIYQIGQLFDPFSVMMGSSPRFNKYGS  387

Query  428   DFGWGKPVAVRCGMDNKADGKFSLFPGLE-KGSVDIEVCLLPHTLHTLGNDQEFMEFVT  255
             +FG GK +A+  G  +K  GK S +PG E  GSVD+EVCL P+ +  L +DQEFM+ V+
Sbjct  388   EFGLGKALALLSGYAHKFSGKVSAYPGREGGGSVDLEVCLPPNLMTALEDDQEFMDAVS  446



>gb|KHN29658.1| Putative acetyltransferase [Glycine soja]
Length=424

 Score =   254 bits (648),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 133/312 (43%), Positives = 189/312 (61%), Gaps = 9/312 (3%)
 Frame = -1

Query  1166  TSRKGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQ------  1005
              +  G + PLL +QVTE+ DG F+G +MNH   D +S+W+FFN+WS+I +   +      
Sbjct  108   VNHDGHTMPLLSIQVTEIVDGVFLGCSMNHAVGDGTSYWNFFNTWSQIFQAHAKGHDTDV  167

Query  1004  -LSLPPVLDPWFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKAN  828
              +S  P+L  WFP + A P+ LPF    E +S     P + ERVFHFS ++IA+LK KAN
Sbjct  168   PISHQPILSRWFPNDCAPPINLPFKHHDEFISR-IEAPLMRERVFHFSAESIARLKAKAN  226

Query  827   SEMGTDSISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIH  648
              E  T  ISS QS  A +WR ITRA  L   +  S  +    R R  PPLP+ Y+GN++ 
Sbjct  227   MESDTTKISSFQSLSALVWRCITRACSLPYEQRTSCRLTANNRTRMEPPLPQQYFGNSVS  286

Query  647   SKLAKANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFL  468
                A+   GELL+  LGWAAW++H  V+  + + V++  + W++ P+I Q  +      +
Sbjct  287   RLNAQTTVGELLENNLGWAAWKLHLAVTNHNDKVVLQSLKKWLQCPLIYQIGQPMDPYDV  346

Query  467   GIASSPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLE-KGSVDIEVCLLPHTLHT  291
              I+SSPR N+Y  +FG GK VAVR G  NK  GK + +PG E  GS+D+EV LLPH +  
Sbjct  347   LISSSPRFNMYGNEFGMGKAVAVRSGYANKFHGKVTSYPGREGGGSIDLEVGLLPHIMSA  406

Query  290   LGNDQEFMEFVT  255
             L +D+EFM+ V+
Sbjct  407   LESDEEFMKVVS  418



>ref|XP_010314808.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like isoform 
X2 [Solanum lycopersicum]
Length=372

 Score =   252 bits (643),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 118/218 (54%), Positives = 156/218 (72%), Gaps = 0/218 (0%)
 Frame = -1

Query  1157  KGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQLSLPPVLDP  978
             + ++ PLLGVQVTEL DGYFIG  M+H+  D + FWHFFNSWSEI+RG   +S  P L+ 
Sbjct  153   QCVTKPLLGVQVTELVDGYFIGCTMSHSLGDGTCFWHFFNSWSEITRGFELISRFPTLER  212

Query  977   WFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEMGTDSISS  798
             WFP N+  P+  P +L  E L      P ++ERVFH SK+ ++KLK KAN EM T SISS
Sbjct  213   WFPQNVNPPIYFPLELDDEKLDVCMEMPIVKERVFHLSKENVSKLKAKANYEMDTKSISS  272

Query  797   LQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKLAKANAGE  618
             LQ+++AHLWR +TR  R+N  E+V + + IGTR R +PPLPE YWGNA   K  K  AGE
Sbjct  273   LQAFLAHLWRCVTRCNRVNANEEVILNIVIGTRTRLDPPLPEEYWGNAAIIKPIKVKAGE  332

Query  617   LLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVI  504
             LL+ GLG+AA  I++VV+ Q++EEV++ Y+ WV++PVI
Sbjct  333   LLENGLGYAALLINKVVASQNYEEVMDSYRRWVENPVI  370



>ref|XP_003604999.1| Acetyltransferase, putative [Medicago truncatula]
 gb|AES87196.1| HXXXD-type acyl-transferase family protein [Medicago truncatula]
Length=442

 Score =   254 bits (649),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 132/313 (42%), Positives = 193/313 (62%), Gaps = 13/313 (4%)
 Frame = -1

Query  1157  KGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGM--PQLSLPPVL  984
             +G S PLL VQ+TEL DG FIG + NH   D  S WHF NSW+EISRG    Q+S PP L
Sbjct  132   EGTSKPLLAVQITELVDGIFIGCSFNHVVVDGKSVWHFINSWAEISRGCCGDQISKPPTL  191

Query  983   DPWFPGNIARPLCLPFDLQQET--------LSSSFTPPPLEERVFHFSKDTIAKLKEKAN  828
             + WFP  I  P+  PF  +Q+          SS+     L  R+FHF+K+ I +LK K N
Sbjct  192   ERWFPNGIQLPIRFPFTTEQQNNHCDELSFSSSNEEKLCLSNRLFHFTKEKIIQLKSKIN  251

Query  827   SEMGTDSISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIH  648
              E+GT  I+SLQ+ + HLW ++ R+++ +  E+V   V IG   R  PPLPE Y+GN+I 
Sbjct  252   EEVGTIKITSLQALLTHLWCSVVRSKQFDLQEEVYNLVVIGVGPRFVPPLPEDYFGNSII  311

Query  647   SKLAKANAGELLKR-GLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANF  471
             S + K   GELL   GL   A +++++++    E++   Y++W+++P   + + +   NF
Sbjct  312   SCIVKMKVGELLDEGGLYKGACEMNKLIASHTDEKLKNHYESWLRNPSFVRVASMSNNNF  371

Query  470   LGIASSPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDIEVCLLPHTLHT  291
             + I+SSP  +VY  DFGWGKP+AVR G   K +G  ++F G+E+GS+D++VCL    L  
Sbjct  372   ISISSSPWFDVYGNDFGWGKPIAVRSGY--KINGIVNVFAGIEEGSIDLQVCLPYKVLEA  429

Query  290   LGNDQEFMEFVTH  252
             +G+D  FM+ VT+
Sbjct  430   MGSDPHFMDVVTN  442



>ref|XP_008351423.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Malus 
domestica]
Length=456

 Score =   254 bits (650),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 133/308 (43%), Positives = 187/308 (61%), Gaps = 11/308 (4%)
 Frame = -1

Query  1157  KGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISR-------GMPQLS  999
             +G+S PLL VQVTEL DG FIG   NH+  D S+FW FFN+ SEISR          ++S
Sbjct  144   EGVSEPLLAVQVTELFDGIFIGCTTNHSVVDGSTFWRFFNTXSEISRRTETSTENCRKIS  203

Query  998   LPPVL--DPWFPGNIAR-PLCLP-FDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKA  831
              PP +    +F G I   P+ +  F  Q     S     PL +R+F+FSK+ IA+LK KA
Sbjct  204   QPPPIFSREFFDGGIIDFPVRIANFHNQVPKNRSPALSAPLHQRIFNFSKEKIAQLKAKA  263

Query  830   NSEMGTDSISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAI  651
             N+EMGT  ISSLQ+ +AHLW +I R + LNP ++    + +G R R   PLPE Y GN +
Sbjct  264   NAEMGTTKISSLQALLAHLWLSIIRNKHLNPDQESKYTLLVGLRQRFQLPLPEEYLGNVV  323

Query  650   HSKLAKANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANF  471
                   +   +LL+ GLGW AW+I+++++ +  +EV ++ + W++SP + Q + +     
Sbjct  324   QFGTVTSTVSDLLEHGLGWTAWEINKMIASKTKDEVRKYLEEWIESPQLIQLNNLASDYS  383

Query  470   LGIASSPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDIEVCLLPHTLHT  291
              G  SSPR N+Y  DFGWG+P+AVR G  NK+ GK ++ PG E GS++ E CL P TL  
Sbjct  384   FGTGSSPRFNMYGNDFGWGRPLAVRSGAANKSVGKLTVAPGAEDGSIEFEACLSPQTLQA  443

Query  290   LGNDQEFM  267
             L  D EF+
Sbjct  444   LDEDAEFI  451



>ref|XP_008220251.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Prunus 
mume]
Length=459

 Score =   254 bits (650),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 142/313 (45%), Positives = 184/313 (59%), Gaps = 14/313 (4%)
 Frame = -1

Query  1169  TTSRKGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRG--------  1014
               +  G +  LL +QVTEL DG FIGL+MNH   D +S+WHFFN WSEI +         
Sbjct  143   AVNHDGHTMSLLTIQVTELVDGIFIGLSMNHCLGDGTSYWHFFNIWSEIFQAQAQGDHNN  202

Query  1013  -MPQLSLPPVLDPWFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKE  837
              +P +S PPVL  WFP      + LPF    E +   +  P L ER+FHFS ++IAKLK 
Sbjct  203   FVPNISRPPVLKRWFPDGHGPIINLPFKHSDEFIGR-YEAPKLRERMFHFSSESIAKLKA  261

Query  836   KANSEMGTDSISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGN  657
             KAN+E  T  ISS QS  A +WR+IT AR L   +  S  +    R R  PPL   Y+GN
Sbjct  262   KANAESNTTKISSFQSLSALMWRSITHARGLPQDQGTSCRLAANNRGRLEPPLSGDYFGN  321

Query  656   AIHSKLAK-ANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFF  480
             +IH   ++   AGELL+ GLGWAAW++HE V   + + + E    W+KSP + Q S  FF
Sbjct  322   SIHPIRSEIVPAGELLEHGLGWAAWKLHEAVVNHNDKLIREHVDGWLKSPAVYQLS--FF  379

Query  479   ANF-LGIASSPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDIEVCLLPH  303
               F + + SSPR N+Y   FG GK +A R G  NK  GK S + G E+GS+D+EVCL P 
Sbjct  380   DPFSVMMGSSPRFNLYGNQFGMGKALAPRSGYANKFSGKVSSYEGREEGSIDLEVCLPPD  439

Query  302   TLHTLGNDQEFME  264
              +  L  D+EFME
Sbjct  440   AMSVLECDREFME  452



>ref|XP_012068314.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Jatropha 
curcas]
 gb|KDP41703.1| hypothetical protein JCGZ_16110 [Jatropha curcas]
Length=450

 Score =   254 bits (649),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 136/300 (45%), Positives = 180/300 (60%), Gaps = 6/300 (2%)
 Frame = -1

Query  1139  LLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGM----PQLSLPPVLDPWF  972
             LL +QVTEL DG FIG + NH   D +S+WHF N+WSEI +        +S PPVL PWF
Sbjct  149   LLTIQVTELVDGIFIGCSFNHAIGDGTSYWHFLNTWSEIFQAEGDDGAAISRPPVLKPWF  208

Query  971   PGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEMGTDSISSLQ  792
             P      + LPF   ++ L   F  P L+ER+FHFS ++IAKLKEKAN+E  T+ ISS Q
Sbjct  209   PDGYGPVINLPFTHHEQFLCP-FESPVLKERIFHFSAESIAKLKEKANAEYNTNKISSFQ  267

Query  791   SYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKLAKANAGELL  612
             S  A +WR ITR+R L   +  +  +    R R NPPL   Y+GN I +  A + AGELL
Sbjct  268   SLSAFMWRCITRSRHLPHDQITNCRLACNNRSRFNPPLSPNYFGNCIDAIAASSTAGELL  327

Query  611   KRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIASSPRNNVYA  432
             ++ LGWAAW +H+ V  Q  E++ E  + W KSP I    + F    + + SSPR N Y 
Sbjct  328   QQNLGWAAWMLHQSVVNQTSEKIQERIEAWKKSPFIYHIGRSFDPFSVMMGSSPRFNKYG  387

Query  431   TDFGWGKPVAVRCGMDNKADGKFSLFPGLE-KGSVDIEVCLLPHTLHTLGNDQEFMEFVT  255
               FG GK + +R G  +K  GK S +PG E  GSVD+EVCL P ++  L +D+EF   V+
Sbjct  388   CQFGLGKALTLRSGYAHKFSGKVSAYPGREGGGSVDLEVCLPPDSMAALESDKEFFAVVS  447



>ref|XP_010107873.1| putative acetyltransferase [Morus notabilis]
 gb|EXC17273.1| putative acetyltransferase [Morus notabilis]
Length=422

 Score =   253 bits (645),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 138/313 (44%), Positives = 190/313 (61%), Gaps = 12/313 (4%)
 Frame = -1

Query  1169  TTSRKGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISR---------  1017
               +  G +  LL VQVTEL DG FIG +MNH   D +S+W+FFNSWSEI +         
Sbjct  109   AVNHDGHTMSLLSVQVTELVDGVFIGCSMNHCLGDGASYWNFFNSWSEIFQPKGDHDHVS  168

Query  1016  GMPQLSLPPVLDPWFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKE  837
                 +S PP+L   FP        LP+    E +S  F  P L+ER+FHFS ++IAKLK 
Sbjct  169   TKISISRPPILKRRFPDGHDPLFNLPYADPDEFISR-FEAPELKERIFHFSAESIAKLKA  227

Query  836   KANSEMGT-DSISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWG  660
             KAN+E    + ISSLQS  A +WR ITRAR +   +  S  +    R R +PP P+ Y+G
Sbjct  228   KANAECNVANQISSLQSLAALVWRCITRARNIPSDQITSCKLAANCRSRLDPPAPDNYFG  287

Query  659   NAIHSKLAKANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFF  480
             N IH   A   A ELL+  LGWAA ++H+ V+  +++EV E+ + W++SP + Q  + F 
Sbjct  288   NLIHELRAFTTAAELLEHDLGWAASKVHKAVANFNNKEVHEWLEEWLQSPYVYQIGRFFD  347

Query  479   ANFLGIASSPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLE-KGSVDIEVCLLPH  303
              N + + SSP+ N Y ++FG GK VA+R G  NK DGK S +PG E  GS+D+E+CLLPH
Sbjct  348   PNCVMMGSSPKFNKYGSEFGMGKAVALRSGYANKFDGKVSSYPGREGGGSIDLEMCLLPH  407

Query  302   TLHTLGNDQEFME  264
              +  L +D+EF+E
Sbjct  408   RMRALESDKEFIE  420



>ref|XP_003523662.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Glycine 
max]
Length=460

 Score =   254 bits (648),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 133/312 (43%), Positives = 189/312 (61%), Gaps = 9/312 (3%)
 Frame = -1

Query  1166  TSRKGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQ------  1005
              +  G + PLL +QVTE+ DG F+G +MNH   D +S+W+FFN+WS+I +   +      
Sbjct  144   VNHDGHTMPLLSIQVTEIVDGVFLGCSMNHAVGDGTSYWNFFNTWSQIFQAHAKGHDTDV  203

Query  1004  -LSLPPVLDPWFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKAN  828
              +S  P+L  WFP + A P+ LPF    E +S     P + ERVFHFS ++IA+LK KAN
Sbjct  204   PISHQPILSRWFPNDCAPPINLPFKHHDEFISR-IEAPLMRERVFHFSAESIARLKAKAN  262

Query  827   SEMGTDSISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIH  648
              E  T  ISS QS  A +WR ITRA  L   +  S  +    R R  PPLP+ Y+GN++ 
Sbjct  263   MESDTTKISSFQSLSALVWRCITRACSLPYEQRTSCRLTANNRTRMEPPLPQQYFGNSVS  322

Query  647   SKLAKANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFL  468
                A+   GELL+  LGWAAW++H  V+  + + V++  + W++ P+I Q  +      +
Sbjct  323   RLNAQTTVGELLENNLGWAAWKLHLAVTNHNDKVVLQSLKKWLQCPLIYQIGQPMDPYDV  382

Query  467   GIASSPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLE-KGSVDIEVCLLPHTLHT  291
              I+SSPR N+Y  +FG GK VAVR G  NK  GK + +PG E  GS+D+EV LLPH +  
Sbjct  383   LISSSPRFNMYGNEFGMGKAVAVRSGYANKFHGKVTSYPGREGGGSIDLEVGLLPHIMSA  442

Query  290   LGNDQEFMEFVT  255
             L +D+EFM+ V+
Sbjct  443   LESDEEFMKVVS  454



>ref|XP_010110811.1| putative acetyltransferase [Morus notabilis]
 gb|EXC28183.1| putative acetyltransferase [Morus notabilis]
Length=455

 Score =   253 bits (647),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 136/306 (44%), Positives = 182/306 (59%), Gaps = 6/306 (2%)
 Frame = -1

Query  1166  TSRKGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMP----QLS  999
              +  G +T L+ +QVTEL DG FIG +MNH  AD +SFW+F+N WSEI R       Q+S
Sbjct  144   VNHDGHTTSLVTIQVTELVDGVFIGCSMNHIIADGTSFWNFWNMWSEIFRAKDNNDLQIS  203

Query  998   LPPVLDPWFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEM  819
              PP+   WFP      L LP+    E + S F  P L ERVFHFS +++AKLK  AN E 
Sbjct  204   RPPIFKRWFPEGHGPILSLPYRHPNEFIGS-FEAPKLRERVFHFSAESLAKLKASANLEY  262

Query  818   GTDSISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKL  639
              T  ISSLQS  A +WR+ITR R L P +  S  +    R R +PP+ E Y+GNA++   
Sbjct  263   NTSKISSLQSLSALVWRSITRVRNLPPDQVTSCRISANNRARLDPPISENYFGNAVYIIR  322

Query  638   AKANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIA  459
                 AGELL+  LGWAAW++HE V   + + +      W+KSP + Q   +F  + + + 
Sbjct  323   GFTTAGELLQHDLGWAAWKLHEAVVNHNDKSIRGLLDAWLKSPCVYQLRTLFDPHSVIMG  382

Query  458   SSPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLE-KGSVDIEVCLLPHTLHTLGN  282
             SSPR N Y  +FG GK +A+R G  NK DG    +PG E  GS+D+E+ L P T+  L +
Sbjct  383   SSPRFNKYGNEFGMGKALALRSGYANKFDGCVYCYPGHEGGGSIDLEMSLSPETMRALES  442

Query  281   DQEFME  264
             D+EFME
Sbjct  443   DEEFME  448



>emb|CDX81073.1| BnaC03g03270D [Brassica napus]
Length=461

 Score =   253 bits (646),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 134/304 (44%), Positives = 191/304 (63%), Gaps = 7/304 (2%)
 Frame = -1

Query  1154  GISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQLSLPPVLDPW  975
             G +  LL V++TEL DG FIGL+MNH+  D S+FW+FFNSWSEI       +   + +P 
Sbjct  159   GQTLSLLSVKITELVDGVFIGLSMNHSVGDGSTFWNFFNSWSEIFNSQQDDNNFCLKNPQ  218

Query  974   FPGNIARPLC-LPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEMGTDSISS  798
                 ++ PLC LP+    E++  S   P L+ER+FHFS +T+  LK KAN + G   ISS
Sbjct  219   IFRQVSGPLCRLPYSPLDESIGQS-ESPDLKERMFHFSSETLRSLKSKANLDCGATMISS  277

Query  797   LQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKLAK--ANA  624
             LQS  A +WR+ITRAR L+  ++ +    +GTR R +PPLP  ++G  +++ LA   A  
Sbjct  278   LQSLTAFIWRSITRARSLSNDQETTCRFAVGTRIRMDPPLPANHFG--VYTSLASTTAKT  335

Query  623   GELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIASSPRN  444
             G+LL+  LGWAA ++H+ V+ Q  E++     +W+KSP + Q  +    N + + SSPR 
Sbjct  336   GDLLENVLGWAASKLHQAVTEQSSEKIASEIDHWLKSPFVLQPDQFSEPNLVHMGSSPRF  395

Query  443   NVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLE-KGSVDIEVCLLPHTLHTLGNDQEFM  267
             + Y + FG GK VAVR G ++K DGK S +PG E  GS+D+EVCLLP  +  L +DQEFM
Sbjct  396   DKYGSQFGMGKAVAVRSGYNSKHDGKVSAYPGREGGGSIDLEVCLLPEFMEALESDQEFM  455

Query  266   EFVT  255
               V+
Sbjct  456   SLVS  459



>ref|XP_010059908.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Eucalyptus 
grandis]
 gb|KCW66386.1| hypothetical protein EUGRSUZ_F00203 [Eucalyptus grandis]
Length=463

 Score =   253 bits (646),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 142/308 (46%), Positives = 179/308 (58%), Gaps = 8/308 (3%)
 Frame = -1

Query  1154  GISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMP-------QLSL  996
             G +  LL VQVTEL DG FIGL+MNH   D +SFW FFNSWSEI +          QLS 
Sbjct  154   GHTLSLLSVQVTELADGVFIGLSMNHAIGDGTSFWLFFNSWSEIFQAQEKGAVDVFQLSR  213

Query  995   PPVLDPWFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEMG  816
             PPVL  WFP N   PL LP+     +  + +  P L ERVFHFS D IA LK +AN + G
Sbjct  214   PPVLTRWFPENHPGPLSLPYTDDPSSFLARYEAPELRERVFHFSADAIAGLKAEANRQCG  273

Query  815   TDSISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKLA  636
             T +ISS QS  A +WR ITRARR  P +     +    R R +P L   Y+GN+I     
Sbjct  274   TTNISSWQSLTALVWRCITRARRFPPNQVTGCRMAASNRARLDPQLSPEYFGNSITPLRT  333

Query  635   KANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIAS  456
              A  GELL  GLGWAA  +H  V+   + ++ E+ ++W+K P +    K F  + + + S
Sbjct  334   AATVGELLGSGLGWAAQLLHAAVAGHSNAKLREWNEDWIKRPQVYHMDKTFDRHSIMMGS  393

Query  455   SPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLE-KGSVDIEVCLLPHTLHTLGND  279
             SPR + Y  +FG GK VA+R G   K DGK S +PG E  GSVD+E+CL P T+  L  D
Sbjct  394   SPRFDKYGNEFGLGKAVALRSGYAFKFDGKASGYPGREGGGSVDLEICLPPVTMALLEAD  453

Query  278   QEFMEFVT  255
              EFM  VT
Sbjct  454   PEFMAAVT  461



>emb|CDX71519.1| BnaC04g17540D [Brassica napus]
Length=449

 Score =   253 bits (645),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 135/308 (44%), Positives = 183/308 (59%), Gaps = 9/308 (3%)
 Frame = -1

Query  1154  GISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQ-------LSL  996
             G +  LL VQVTEL DG F+G++MNHT  D +SFW+FFN+WSEI +           L  
Sbjct  142   GHTMSLLSVQVTELQDGIFLGVSMNHTMGDGTSFWNFFNAWSEIFQAQESNKTESLCLKN  201

Query  995   PPVLDPWFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEMG  816
             PPVL+ + P        LP+    E +   +  P L+ER+F FS +T   LK K N   G
Sbjct  202   PPVLNRYIPQGYGPLYSLPYSHPDEFIRR-YKSPLLKERIFCFSSETTRVLKGKVNQMCG  260

Query  815   TDSISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKLA  636
             T SISSLQS  A +WR ITRARRL   ++ S  +    R R  PPLP  Y+GN I +   
Sbjct  261   TTSISSLQSLTAFIWRCITRARRLPLEQETSCRLAADNRGRMYPPLPRDYFGNCISALRT  320

Query  635   KANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIAS  456
              A AGELL+  LGWAA ++H+VV+ Q  E+V +   +W+KSP + Q  ++F    + + S
Sbjct  321   AAKAGELLENDLGWAALKLHQVVAEQTSEKVSQMIDHWLKSPFMYQTDRLFEPMSVMMGS  380

Query  455   SPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLE-KGSVDIEVCLLPHTLHTLGND  279
             SPR N Y  +FG GK + +R G  +K DGK S +PG E  GS+D+EVCL P  +  L +D
Sbjct  381   SPRFNKYGCEFGMGKALTLRSGYAHKFDGKVSAYPGREGGGSIDLEVCLAPEFMKALESD  440

Query  278   QEFMEFVT  255
             ++FM  V+
Sbjct  441   EDFMSLVS  448



>ref|XP_010110810.1| putative acetyltransferase [Morus notabilis]
 gb|EXC28182.1| putative acetyltransferase [Morus notabilis]
Length=454

 Score =   252 bits (644),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 134/306 (44%), Positives = 181/306 (59%), Gaps = 6/306 (2%)
 Frame = -1

Query  1166  TSRKGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGM----PQLS  999
              +  G +T L+ +QVTEL DG FIG +MNH  AD +SFW+F+N WSEI R       Q+S
Sbjct  143   VNHDGHTTSLVTIQVTELVDGVFIGCSMNHVIADGASFWNFWNMWSEIFRAKDNKNKQIS  202

Query  998   LPPVLDPWFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEM  819
              PP+   WFP      L LP+    E +   F  P L ERVFHFS ++IAKLK +AN E 
Sbjct  203   RPPIFKRWFPEGHGPILSLPYKHPDEFIGR-FEAPKLRERVFHFSVESIAKLKARANLEY  261

Query  818   GTDSISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKL  639
              T  ISS QS  A +WR+I R R L P +  S  +    R R +PP+ E Y+GN I+   
Sbjct  262   NTRKISSFQSLSALVWRSIIRVRNLPPDQVTSCRLAANNRARLDPPISENYFGNVIYPIR  321

Query  638   AKANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIA  459
                 AGELL+  LGWAAW++HE V   + + +      W++SP + Q  K+F    + + 
Sbjct  322   GFTTAGELLQNDLGWAAWKLHEAVVNHNDKSIRGLLDAWLRSPTVYQIGKLFDPYSVMMG  381

Query  458   SSPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLE-KGSVDIEVCLLPHTLHTLGN  282
             SSPR + Y  +FG G+ +A+R G  +K DGK S +PG E  GS+D+E CL P T+  L +
Sbjct  382   SSPRFDKYGNEFGMGRALALRSGYAHKFDGKVSCYPGHEGGGSIDLETCLPPETMRALES  441

Query  281   DQEFME  264
             D+EFME
Sbjct  442   DKEFME  447



>ref|XP_007226559.1| hypothetical protein PRUPE_ppa024441mg [Prunus persica]
 gb|EMJ27758.1| hypothetical protein PRUPE_ppa024441mg [Prunus persica]
Length=459

 Score =   252 bits (644),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 140/313 (45%), Positives = 185/313 (59%), Gaps = 14/313 (4%)
 Frame = -1

Query  1169  TTSRKGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRG--------  1014
               +  G +  LL +QVTEL DG FIGL+MNH   D +S+WHFFN WSEI +         
Sbjct  143   AVNHDGHTMSLLTIQVTELVDGIFIGLSMNHCLGDGTSYWHFFNIWSEIFQAQAQGDHNN  202

Query  1013  -MPQLSLPPVLDPWFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKE  837
              +P++S PPVL  WFP      + LPF    E +   +  P L ER+FHFS ++IAKLK 
Sbjct  203   FVPKISRPPVLKRWFPDGHGPIINLPFKHSDEFIGR-YEAPKLRERMFHFSSESIAKLKA  261

Query  836   KANSEMGTDSISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGN  657
             KAN+E  T  ISS +S  A +WR+ITRAR L   +  S  +    R R  PPL   Y+GN
Sbjct  262   KANAESNTTKISSFKSLSALMWRSITRARGLPRDQGTSCRLAANNRGRLEPPLSGDYFGN  321

Query  656   AIHSKLAK-ANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFF  480
             +IH   ++   AGELL+ GLGWAAW++HE V   + + + E    W+KSP + Q S  FF
Sbjct  322   SIHPIRSEIVPAGELLEHGLGWAAWKLHEAVVNHNDKLIREHVDGWLKSPAVYQVS--FF  379

Query  479   ANF-LGIASSPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDIEVCLLPH  303
                 + + SSPR N+Y   FG GK +A+R G  +K  GK S + G E+GS+D+EVCL P 
Sbjct  380   DPLSVMMGSSPRFNMYGNQFGMGKALALRSGYAHKFSGKVSSYEGREEGSIDLEVCLPPD  439

Query  302   TLHTLGNDQEFME  264
              +  L  D EFME
Sbjct  440   AMSALECDSEFME  452



>ref|XP_003603061.1| N-hydroxycinnamoyl/benzoyltransferase [Medicago truncatula]
Length=448

 Score =   252 bits (643),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 131/307 (43%), Positives = 182/307 (59%), Gaps = 5/307 (2%)
 Frame = -1

Query  1163  SRKGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMP---QLSLP  993
             +  G + PLL +QVTEL DG FIG +MNH   D +S+W+FFN+WSEI +G     ++S  
Sbjct  142   NHDGHTMPLLSIQVTELVDGVFIGCSMNHYIGDGTSYWNFFNTWSEIFQGQGHDVRISRQ  201

Query  992   PVLDPWFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEMGT  813
             P    WFP      + LPF    E ++  + PP L ER FHF+ ++IAKLK KAN E  T
Sbjct  202   PSHIRWFPEGYGPLINLPFKHHDEIITR-YEPPKLRERFFHFTAESIAKLKAKANMESNT  260

Query  812   DSISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKLAK  633
             + ISS QS  AH+WR ITRAR L   +  +  + +  R R  PPLP+ Y+G ++ +   K
Sbjct  261   NKISSFQSLSAHVWRGITRARDLTNDQVTTCMLAVNNRPRMKPPLPKEYFGTSVDTVSVK  320

Query  632   ANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIASS  453
                GELL+  LGWAAW++H  V+     E+ +  + W++SP+I      F A  + + SS
Sbjct  321   TTVGELLENDLGWAAWKVHSAVANHVDLEIRKMVKKWLESPMILSLKHHFDAGSVAMISS  380

Query  452   PRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLE-KGSVDIEVCLLPHTLHTLGNDQ  276
             PR N+Y  +FG GKPVAV  G  NK DG  + + G E  GS+D+E+ L P+ +  L  DQ
Sbjct  381   PRFNMYGNEFGMGKPVAVLSGYANKCDGNVTAYEGHEGGGSMDLEISLSPNVMRALELDQ  440

Query  275   EFMEFVT  255
              FM  V+
Sbjct  441   NFMNAVS  447



>gb|AES73312.2| HXXXD-type acyl-transferase family protein [Medicago truncatula]
Length=449

 Score =   252 bits (643),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 131/307 (43%), Positives = 182/307 (59%), Gaps = 5/307 (2%)
 Frame = -1

Query  1163  SRKGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMP---QLSLP  993
             +  G + PLL +QVTEL DG FIG +MNH   D +S+W+FFN+WSEI +G     ++S  
Sbjct  143   NHDGHTMPLLSIQVTELVDGVFIGCSMNHYIGDGTSYWNFFNTWSEIFQGQGHDVRISRQ  202

Query  992   PVLDPWFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEMGT  813
             P    WFP      + LPF    E ++  + PP L ER FHF+ ++IAKLK KAN E  T
Sbjct  203   PSHIRWFPEGYGPLINLPFKHHDEIITR-YEPPKLRERFFHFTAESIAKLKAKANMESNT  261

Query  812   DSISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKLAK  633
             + ISS QS  AH+WR ITRAR L   +  +  + +  R R  PPLP+ Y+G ++ +   K
Sbjct  262   NKISSFQSLSAHVWRGITRARDLTNDQVTTCMLAVNNRPRMKPPLPKEYFGTSVDTVSVK  321

Query  632   ANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIASS  453
                GELL+  LGWAAW++H  V+     E+ +  + W++SP+I      F A  + + SS
Sbjct  322   TTVGELLENDLGWAAWKVHSAVANHVDLEIRKMVKKWLESPMILSLKHHFDAGSVAMISS  381

Query  452   PRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLE-KGSVDIEVCLLPHTLHTLGNDQ  276
             PR N+Y  +FG GKPVAV  G  NK DG  + + G E  GS+D+E+ L P+ +  L  DQ
Sbjct  382   PRFNMYGNEFGMGKPVAVLSGYANKCDGNVTAYEGHEGGGSMDLEISLSPNVMRALELDQ  441

Query  275   EFMEFVT  255
              FM  V+
Sbjct  442   NFMNAVS  448



>ref|XP_006393913.1| hypothetical protein EUTSA_v10004238mg [Eutrema salsugineum]
 gb|ESQ31199.1| hypothetical protein EUTSA_v10004238mg [Eutrema salsugineum]
Length=438

 Score =   251 bits (641),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 136/307 (44%), Positives = 185/307 (60%), Gaps = 10/307 (3%)
 Frame = -1

Query  1163  SRKGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQLSLPPVL  984
             S +GIS  L+  QVT+L DG FIG   NH  AD SSFW+FFN+WS+I       S P +L
Sbjct  134   SCEGISESLIAFQVTKLKDGVFIGFGYNHMVADGSSFWNFFNTWSQICSTGKNFS-PLLL  192

Query  983   DPWFPGNIARPLCLPFDLQQETLSSSFTPPP---LEERVFHFSKDTIAKLKEKANSEMGT  813
               WF   I  P+ +P     ET+SS     P   L+E+VF F+   I++LK KAN E+  
Sbjct  193   RGWFLDGIEYPIRIPI---SETVSSPIRVVPSSLLQEKVFRFTSRNISELKSKANGEVSP  249

Query  812   DS--ISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKL  639
             D   ISSLQ+  AH+WR+I +   LNP E +   + +  R R NPPL +  +GN +    
Sbjct  250   DDRKISSLQAISAHMWRSIIKNSDLNPEEVIHCKLLMDMRRRLNPPLEKECFGNVVGFAT  309

Query  638   AKANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIA  459
             A   AGE+L  GLGWAA QI++ V  Q +EE   F +NWVK P+I     V  +N + +A
Sbjct  310   ATTTAGEMLSNGLGWAALQINKTVGSQTNEEFRVFAENWVKKPIIPNHVAV-SSNSIIVA  368

Query  458   SSPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDIEVCLLPHTLHTLGND  279
             SSP  NV+  DFGWGKP+AVR G  N +DGK  ++PG+++G+++I+ CL  H L  L  D
Sbjct  369   SSPWFNVFGNDFGWGKPIAVRAGPGNTSDGKLIVYPGIDQGNIEIQTCLSSHVLEKLSTD  428

Query  278   QEFMEFV  258
              EF++ V
Sbjct  429   AEFLKHV  435



>ref|XP_010252439.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Nelumbo 
nucifera]
Length=474

 Score =   252 bits (643),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 138/310 (45%), Positives = 181/310 (58%), Gaps = 5/310 (2%)
 Frame = -1

Query  1169  TTSRKGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGM---PQLS  999
               +  G + PLL VQVTEL DG F+G + NH   D +SFWHF N+WSE+ R      ++S
Sbjct  147   VVNHDGHTMPLLAVQVTELLDGIFMGCSFNHAIGDGASFWHFINTWSELCREKVKDKRIS  206

Query  998   LPPV-LDPWFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSE  822
             LPP+ L+ WFP      + LPF    E +   + PP L ER FHFS  T+A+LK KAN+E
Sbjct  207   LPPIILERWFPNGHGPIVNLPFSDHSEFIIEGYNPPKLRERFFHFSAQTMARLKAKANAE  266

Query  821   MGTDSISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSK  642
                 +ISSLQ+  A LWRA T+ARRL+  +  +    I  R R NPPL   Y+G AI + 
Sbjct  267   CNITTISSLQALSALLWRATTQARRLDVNQTTNCTFVISNRPRLNPPLSPNYFGTAIQAV  326

Query  641   LAKANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGI  462
                   GELL RGLGWAA  +H+ V+      V E  +  + +P I    + F    + +
Sbjct  327   SGTTTVGELLSRGLGWAALILHQAVARHTDSVVREQMEANMVAPFIYYLRESFDPCSVMV  386

Query  461   ASSPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLE-KGSVDIEVCLLPHTLHTLG  285
             ASSPR ++Y  DFGWG+P+AVRCG  NK  G     PG E  GSVD+EVCL P  +  L 
Sbjct  387   ASSPRFDMYGNDFGWGEPMAVRCGPANKFGGMVFAHPGKEGGGSVDLEVCLPPEEMGALE  446

Query  284   NDQEFMEFVT  255
             + +EFME V+
Sbjct  447   SIEEFMEAVS  456



>gb|KDO84111.1| hypothetical protein CISIN_1g044173mg [Citrus sinensis]
Length=455

 Score =   251 bits (641),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 136/306 (44%), Positives = 186/306 (61%), Gaps = 7/306 (2%)
 Frame = -1

Query  1154  GISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRG---MPQLSLPPVL  984
             G S PLL +QVTEL DG FIG +MNH   D +SFW+FFN++SEI +    M  +S PPV+
Sbjct  150   GHSRPLLSIQVTELVDGIFIGCSMNHVLGDGTSFWNFFNAFSEIFQAQGKMDSISRPPVV  209

Query  983   DPWFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEMG--TD  810
               WFP      + LPF  + E +   +  P L ER+FHF+ ++IA+LK KAN+E G  T+
Sbjct  210   KRWFPDGRDPIINLPFTHRDEFIRR-YEAPQLLERIFHFTGESIARLKAKANAEAGNNTN  268

Query  809   SISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKLAKA  630
              ISS Q+  A +WR+ITR R L P +  S  +    R R  PPLP  Y+GN+I+      
Sbjct  269   KISSFQALSALVWRSITRTRNLPPDQTTSCRMAADNRPRLEPPLPREYFGNSINPLRGVT  328

Query  629   NAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIASSP  450
               GELL   LGWAAW++H+ V  Q  + V E+   W KSP +    ++F    + + SSP
Sbjct  329   TVGELLGHDLGWAAWKLHQTVVNQTDKAVREWLDAWWKSPFMYHLDRLFDPFSIMMGSSP  388

Query  449   RNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLE-KGSVDIEVCLLPHTLHTLGNDQE  273
             R N Y  +FG G+ VA+R G  +K DGK S +PG E  GS+D+E+CL PH++  L  D+E
Sbjct  389   RFNKYGNEFGLGQAVALRSGYAHKFDGKVSAYPGHEGGGSIDLEICLPPHSMTALEADEE  448

Query  272   FMEFVT  255
             FME  +
Sbjct  449   FMEVTS  454



>gb|KFK31810.1| hypothetical protein AALP_AA6G161600 [Arabis alpina]
Length=449

 Score =   251 bits (640),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 138/308 (45%), Positives = 181/308 (59%), Gaps = 9/308 (3%)
 Frame = -1

Query  1154  GISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQ-------LSL  996
             G +T LL VQVTEL DG FIGL+MNH   D +SFW FF +WSEI +           L  
Sbjct  142   GHTTSLLSVQVTELVDGIFIGLSMNHVMGDGTSFWKFFTAWSEIFQAQDSNKTNDLCLKN  201

Query  995   PPVLDPWFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEMG  816
             PPVL+ + P        LPF  Q E +   F  P L+ER+F FS +TI  LK K N   G
Sbjct  202   PPVLNRYIPQGYGPLFSLPFSHQDEFIRP-FESPILKERMFCFSSETIKLLKAKTNQICG  260

Query  815   TDSISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKLA  636
             T SISS QS  A +WR +TRARRL   ++ S  +    R R  PPL   Y+GN+I +   
Sbjct  261   TTSISSFQSLTAVIWRCVTRARRLPYEQETSCRLAADNRARMYPPLHPEYFGNSISALRT  320

Query  635   KANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIAS  456
              A AGELL+  LGWAA ++H+ V+    E+V++    W+KSP I    ++F    + + S
Sbjct  321   AAKAGELLENDLGWAALKLHQAVAEHTSEKVIQMIDQWLKSPFIYHIDRLFEPLSVMMGS  380

Query  455   SPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLE-KGSVDIEVCLLPHTLHTLGND  279
             SPR + Y  +FG GK + +R G  +K DGK S +PG E KGSVD+EVCL+P  +  L +D
Sbjct  381   SPRFDKYGCEFGMGKALTLRSGYAHKFDGKVSGYPGREGKGSVDLEVCLVPEYMEALESD  440

Query  278   QEFMEFVT  255
             QEFM  V+
Sbjct  441   QEFMSLVS  448



>ref|XP_006374906.1| anthranilate N-hydroxycinamoyl/bensoiltransferase-like family 
protein [Populus trichocarpa]
 gb|ERP52703.1| anthranilate N-hydroxycinamoyl/bensoiltransferase-like family 
protein [Populus trichocarpa]
Length=455

 Score =   251 bits (640),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 136/305 (45%), Positives = 185/305 (61%), Gaps = 6/305 (2%)
 Frame = -1

Query  1154  GISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQ---LSLPPVL  984
             G +  LL +QVTEL DG FIG ++NH+  D SSFWHFFN WSEI +G      +S PPVL
Sbjct  148   GHTKSLLTIQVTELIDGIFIGCSVNHSIVDGSSFWHFFNMWSEIFQGKGDDVSISRPPVL  207

Query  983   DPWFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEMGTDSI  804
             + WFP      L LPF    + L   F  P L+ER+FHFS ++IA+LK KAN+E  T+ I
Sbjct  208   NRWFPDGHGPALSLPFTHHDQFLRP-FEAPLLKERMFHFSSESIARLKAKANAEFNTNKI  266

Query  803   SSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHS-KLAKAN  627
             SS QS  A +WR ITRAR L   +     +    R R NPPL   Y+G +I + +   + 
Sbjct  267   SSFQSLSALVWRCITRARNLPRDQVTCCRLATNNRSRLNPPLSPDYFGCSIQALRAGVST  326

Query  626   AGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIASSPR  447
             AGE+L++ LGW AWQ+H+ V     E+  EF   W+KSP I    K+F  + + + SSPR
Sbjct  327   AGEVLEQNLGWTAWQLHQAVVSHGDEKAREFLNLWLKSPFINHIGKLFDPHSVMMGSSPR  386

Query  446   NNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLE-KGSVDIEVCLLPHTLHTLGNDQEF  270
              N Y  +FG GK +A+R G   K  GK S +PG E  GS+++E+CL P  +  + +D+EF
Sbjct  387   FNKYGNEFGLGKALALRSGYALKFSGKASAYPGHEGGGSIELEICLSPDEMTAIESDKEF  446

Query  269   MEFVT  255
             M+ V+
Sbjct  447   MDVVS  451



>gb|EYU46590.1| hypothetical protein MIMGU_mgv1a005681mg [Erythranthe guttata]
Length=474

 Score =   251 bits (641),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 145/333 (44%), Positives = 200/333 (60%), Gaps = 27/333 (8%)
 Frame = -1

Query  1178  FCLTTSRK--GISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRG--M  1011
             F LT  R   G++ PL+ VQVTEL DG F+G ++NH   D +SFWHFFNSW++ISRG  +
Sbjct  142   FPLTGVRNHGGVTQPLMAVQVTELADGLFVGCSINHLLVDGTSFWHFFNSWAQISRGDNI  201

Query  1010  PQLSLPPVL-------DPWFPGNI--------ARPLCLPFDLQQETLSSSFTPPPLEERV  876
               +S PP+L       D    G+I          P     +      + S     L++R+
Sbjct  202   NPISKPPILNRDQINLDLSGSGSIYIHDKHLIHLPNNNNNNNNNNNQAESRRRQVLKDRI  261

Query  875   FHFSKDTIAKLKEKANSEMGTDS---ISSLQSYVAHLWRAITRAR-RLNPTEDVSIY-VP  711
             FH SK+++AKLK +AN EMG  S   ISSLQ+ VAH+WR I R R  ++  E+ + + VP
Sbjct  262   FHLSKESVAKLKRRANEEMGEISKGKISSLQAIVAHVWRCIIRCRFAMDDCEETTTFEVP  321

Query  710   IGTRWRTNPPLPEGYWGNAIHSKLAKANAGELLKRGLGWAAWQIHEVV-SIQDHEEVVEF  534
             +G R R  PPLPE Y+GNA+   +      +LL+ GLGWAAWQI+ +V S     +V E 
Sbjct  322   MGARQRMEPPLPEEYFGNAVFPGIVTVETSKLLENGLGWAAWQINRMVGSGNGPGKVKEL  381

Query  533   YQNWVKSPVIAQKSKVFFANFLGIASSPRNNVY-ATDFGWGKPVAVRCGMDNKADGKFSL  357
             Y  W+K PV  Q   +   +F+ + +SPR +VY   DFGWGKPVAVR G  + +DG+ ++
Sbjct  382   YTGWIKEPVFLQFEGLPRNSFI-LINSPRFDVYDGNDFGWGKPVAVRSGKASSSDGRITV  440

Query  356   FPGLEKGSVDIEVCLLPHTLHTLGNDQEFMEFV  258
               G+ +GSVDIE CL P TL  + +D EFME+V
Sbjct  441   TRGVGEGSVDIEACLAPETLSAMADDSEFMEYV  473



>ref|XP_010107871.1| putative acetyltransferase [Morus notabilis]
 gb|EXC17271.1| putative acetyltransferase [Morus notabilis]
Length=460

 Score =   251 bits (640),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 138/311 (44%), Positives = 186/311 (60%), Gaps = 10/311 (3%)
 Frame = -1

Query  1169  TTSRKGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRG-------M  1011
               +  G +  LL VQVTEL DG FIG +MNH   D +S+W+FFNSWSE  +         
Sbjct  144   AVNHDGHTMSLLSVQVTELVDGVFIGCSMNHCLGDGTSYWNFFNSWSETFQAKGGDIVST  203

Query  1010  PQLSLPPVLDPWFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKA  831
               +S PP+   WFP      + LPF    E +S  F  P L+ER+FHFS +++ KLKEKA
Sbjct  204   ISISRPPIFKRWFPEGHGPIINLPFTDPDEFISR-FEAPKLKERIFHFSAESMTKLKEKA  262

Query  830   NSEMGT-DSISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNA  654
             N+E    + +SSLQS  A +WR ITRAR L P +  S  +    R R +PP+ E Y+GN 
Sbjct  263   NAECNVVNQVSSLQSLSALVWRCITRARNLPPDQSTSCRLAANNRSRLDPPISENYFGNF  322

Query  653   IHSKLAKANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFAN  474
             I+   A A A ELL R LGWAA ++H+ V   + + V EF    ++SP + Q  ++F   
Sbjct  323   INGLKAFATASELLDRDLGWAARKVHQAVINYNDKAVREFLDFLLQSPFVLQIGQIFDPY  382

Query  473   FLGIASSPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLE-KGSVDIEVCLLPHTL  297
              + I SSPR N Y ++FG GK +A+R G  +K D K S +PG E  GSVD+E+CLLP T+
Sbjct  383   SVVIGSSPRFNKYGSEFGMGKALALRSGYAHKFDAKVSCYPGREGGGSVDLEICLLPDTM  442

Query  296   HTLGNDQEFME  264
               L +D+EFME
Sbjct  443   CALESDKEFME  453



>ref|XP_008393786.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Malus 
domestica]
Length=459

 Score =   251 bits (640),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 141/312 (45%), Positives = 182/312 (58%), Gaps = 12/312 (4%)
 Frame = -1

Query  1169  TTSRKGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQ-----  1005
               +  G +  LL +QVTEL DG FIGL+MNH+  D +SFW FFN WSEI +   Q     
Sbjct  143   AVNHDGHTMSLLSIQVTELVDGIFIGLSMNHSLGDGTSFWLFFNVWSEIFQAQAQEGHDH  202

Query  1004  ----LSLPPVLDPWFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKE  837
                 +S PPVL  WFP      + LPF    E +   F  PPL ER+FHFS ++IAKLK 
Sbjct  203   FVANISRPPVLKRWFPDGHGPIINLPFKHSDEFIGR-FEAPPLRERMFHFSSESIAKLKA  261

Query  836   KANSEMGTDSISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGN  657
             KAN+E  T  ISS QS  A LWR ITRAR L P +  S  +    R R +PPL   Y+GN
Sbjct  262   KANAESDTTKISSFQSLSALLWRTITRARCLAPDQGTSCRLAANNRGRIDPPLSGDYFGN  321

Query  656   AIHS-KLAKANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFF  480
             +I+  K     AGELL+ G+GWAAW++HE V   D + +      W+KSP +   S  F 
Sbjct  322   SIYPVKSETVAAGELLEHGIGWAAWKLHEAVVNHDDKVIRGQVDAWLKSPSVYLVS-YFD  380

Query  479   ANFLGIASSPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDIEVCLLPHT  300
                + + SSPR N+Y  +FG GK +A+R G  +K  GK S + G E+ S+D+EVCL P  
Sbjct  381   PLSVMMGSSPRFNMYGNEFGMGKALALRSGYAHKFSGKVSAYEGREERSIDLEVCLPPDA  440

Query  299   LHTLGNDQEFME  264
             +  L  D+EFME
Sbjct  441   MSALECDKEFME  452



>gb|ABC47847.1| N-hydroxycinnamoyl/benzoyltransferase 5 [Glycine max]
Length=465

 Score =   251 bits (640),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 138/315 (44%), Positives = 191/315 (61%), Gaps = 15/315 (5%)
 Frame = -1

Query  1166  TSRKGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEI-----SRGMPQ-  1005
              +  G + PLL +QVTEL DG FIG +MNHT  D +S+W+FFN+WSEI     ++G+   
Sbjct  143   VNHDGHTMPLLSIQVTELLDGVFIGCSMNHTIGDGTSYWNFFNTWSEIFFQTQAQGLEYD  202

Query  1004  ----LSLPPVLDPWFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKE  837
                 +S  P+ + WFP      + LPF  + E +   F  P L  R+FHFS ++IAKLK 
Sbjct  203   ATVPISRHPIHNRWFPDGCGPLINLPFKHEDEFIDR-FESPKLRVRIFHFSAESIAKLKA  261

Query  836   KANSEMG--TDSISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYW  663
             +ANSE    T  ISS QS  AH+WR++TRAR+L   E  S  + I  R R  PPLP  Y+
Sbjct  262   RANSESKSKTSEISSFQSLSAHVWRSVTRARKLPNDEITSCKLAISNRSRLEPPLPHEYF  321

Query  662   GNAIHS-KLAKANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKV  486
             GNA+     A   AGELL++ LGWAAW++H  V+ Q+ + V +  + W+K PV+ Q    
Sbjct  322   GNAVDVVSTAGFTAGELLEKDLGWAAWKVHVAVANQNDKAVRQKLKEWLKLPVVYQLGVH  381

Query  485   FFANFLGIASSPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLE-KGSVDIEVCLL  309
             F    + ++SSPR N+Y  +FG GK VAV  G  NK DG  + + G E +GS+D+E+CL 
Sbjct  382   FDPCTVTMSSSPRFNMYGNEFGMGKAVAVLSGYANKNDGNVTAYQGYEGEGSIDLEICLS  441

Query  308   PHTLHTLGNDQEFME  264
             P  +  L +D+EFME
Sbjct  442   PDAVSALESDEEFME  456



>ref|XP_012066806.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like isoform 
X2 [Jatropha curcas]
 ref|XP_012066807.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like isoform 
X2 [Jatropha curcas]
Length=401

 Score =   249 bits (635),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 134/308 (44%), Positives = 182/308 (59%), Gaps = 6/308 (2%)
 Frame = -1

Query  1163  SRKGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQ----LSL  996
             + +G    LL +QVTEL DG FIG + NH   D +S+WHF N+WSEI +        +S 
Sbjct  95    NHEGHVRSLLTIQVTELIDGIFIGCSFNHVIGDGTSYWHFLNTWSEIFQAQRDDHVPISQ  154

Query  995   PPVLDPWFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEMG  816
             PPVL  WFP N    + LPF   ++ L   F  P L+ER+FHFS ++IAKLK KAN+E  
Sbjct  155   PPVLKRWFPDNCGPIINLPFTHHEQFLVP-FEAPLLKERIFHFSAESIAKLKVKANTEYN  213

Query  815   TDSISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKLA  636
             TD ISS QS  A +WR ITRAR +   +     +    R R NPPL   Y+GN + +  A
Sbjct  214   TDKISSFQSLSAFMWRCITRARHIPHDQVTHCSLACNNRSRLNPPLSPNYFGNFVDAVSA  273

Query  635   KANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIAS  456
                  ELL++ LGWAAW +H+ V  Q  ++  +   +W+KSP+I    + F    +   S
Sbjct  274   STTGCELLEQNLGWAAWLLHQAVINQTDKKFRDRIDSWIKSPIIYHLGQFFGLYGVVFGS  333

Query  455   SPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLE-KGSVDIEVCLLPHTLHTLGND  279
             SPR + Y  +FG GK +++R G  NK  GK S +PG E  GSVD+EVCLLP ++  L +D
Sbjct  334   SPRFSKYGCEFGLGKALSLRSGYANKFCGKVSAYPGREGGGSVDLEVCLLPDSMTALESD  393

Query  278   QEFMEFVT  255
             +EFM  V+
Sbjct  394   KEFMAAVS  401



>gb|KCW66379.1| hypothetical protein EUGRSUZ_F00195 [Eucalyptus grandis]
Length=426

 Score =   249 bits (636),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 145/313 (46%), Positives = 184/313 (59%), Gaps = 8/313 (3%)
 Frame = -1

Query  1169  TTSRKGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRG-------M  1011
               +  G S  LL  QVTEL DG FIGL+MNH+  D +SFW FFNSWSEI +        +
Sbjct  112   AVNHDGHSLSLLSAQVTELADGVFIGLSMNHSIGDGTSFWLFFNSWSEIFQAQQKGDVDV  171

Query  1010  PQLSLPPVLDPWFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKA  831
              QLS PPVL  WFP N    + LP      +    +  P L ERVFHFS D IA LK +A
Sbjct  172   VQLSRPPVLTRWFPENHPGSVSLPSADDPSSFHPRYRVPDLRERVFHFSADAIASLKAEA  231

Query  830   NSEMGTDSISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAI  651
             N + GT  ISS QS  A LWR ITRAR L P++  S  V    R R +PPLP  Y+GN +
Sbjct  232   NRQCGTPKISSFQSLTALLWRCITRARCLPPSQVTSCRVISNNRARLDPPLPPEYFGNPV  291

Query  650   HSKLAKANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANF  471
                 A   AGELL   LGWAA  +H +V+   + +V+E+ + W+KSP + +  + F    
Sbjct  292   TMLRAATTAGELLGGDLGWAALLLHALVAEHGNAKVLEWNEEWIKSPQVYRLDRTFDPCS  351

Query  470   LGIASSPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLE-KGSVDIEVCLLPHTLH  294
             + ++SSPR N+Y  DFG GK  A R G  NK DGK + +PG E  GS+D+E+CL P T+ 
Sbjct  352   IIMSSSPRFNMYGNDFGLGKAAAPRSGCANKIDGKVTSYPGREGGGSIDLEICLSPATMA  411

Query  293   TLGNDQEFMEFVT  255
             +L  D EFM  VT
Sbjct  412   SLEADAEFMAAVT  424



>gb|KHN04490.1| Putative acetyltransferase [Glycine soja]
Length=465

 Score =   250 bits (639),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 137/315 (43%), Positives = 191/315 (61%), Gaps = 15/315 (5%)
 Frame = -1

Query  1166  TSRKGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEI-----SRGMPQ-  1005
              +  G + PLL +QVTEL DG FIG +MNHT  D +S+W+FFN+WSEI     ++G+   
Sbjct  143   VNHDGHTMPLLSIQVTELLDGVFIGCSMNHTIGDGTSYWNFFNTWSEIFFQTQAQGLEYD  202

Query  1004  ----LSLPPVLDPWFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKE  837
                 +S  P+ + WFP      + LPF  + E +   F  P L  R+FHFS ++IAKLK 
Sbjct  203   ATVPISRHPIHNRWFPDGCGPLINLPFKHEDEFIDR-FESPKLRVRIFHFSAESIAKLKA  261

Query  836   KANSEMG--TDSISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYW  663
             +ANSE    T  ISS QS  AH+WR++TRAR+L   E  S  + I  R R  PPLP  Y+
Sbjct  262   RANSESKSKTSEISSFQSLSAHVWRSVTRARKLPNDEITSCKLAISNRSRLEPPLPHEYF  321

Query  662   GNAIHS-KLAKANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKV  486
             GNA+     A   AGELL++ LGWAAW++H  V+ Q+ + V +  + W+K PV+ Q    
Sbjct  322   GNAVDVVSTAGFTAGELLEKDLGWAAWKVHVAVANQNDKAVRQKLKEWLKLPVVYQLGVH  381

Query  485   FFANFLGIASSPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLE-KGSVDIEVCLL  309
             F    + ++SSPR N+Y  +FG GK +AV  G  NK DG  + + G E +GS+D+E+CL 
Sbjct  382   FDPCTVTMSSSPRFNMYGNEFGMGKAIAVLSGYANKNDGNVTAYQGYEGEGSIDLEICLS  441

Query  308   PHTLHTLGNDQEFME  264
             P  +  L +D+EFME
Sbjct  442   PDAVSALESDEEFME  456



>ref|XP_006387348.1| hypothetical protein POPTR_1203s002001g, partial [Populus trichocarpa]
 gb|ERP46262.1| hypothetical protein POPTR_1203s002001g, partial [Populus trichocarpa]
Length=302

 Score =   245 bits (626),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 135/294 (46%), Positives = 180/294 (61%), Gaps = 6/294 (2%)
 Frame = -1

Query  1121  TELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQ---LSLPPVLDPWFPGNIARP  951
             TEL  G FIG ++NH+    SSFWHFFN WSEI +G      +S PPVL+ WFP      
Sbjct  1     TELMMGIFIGCSVNHSIVMGSSFWHFFNMWSEIFQGKGDDVSISRPPVLNRWFPDGHGPA  60

Query  950   LCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEMGTDSISSLQSYVAHLW  771
             L LPF    + LS  F  P L+ER+FHFS ++IA+LK KAN+E  T+ ISS QS  A +W
Sbjct  61    LSLPFTHHDQFLSP-FEAPLLKERMFHFSSESIARLKAKANAESNTNKISSFQSLSALVW  119

Query  770   RAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHS-KLAKANAGELLKRGLGW  594
             R ITRAR L   +     + I  R R NPPL   Y+GN+I + K   +  GELL++ LGW
Sbjct  120   RCITRARNLPHDQVTCCRMAINNRSRLNPPLSPDYFGNSIQALKAGVSTVGELLEQNLGW  179

Query  593   AAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIASSPRNNVYATDFGWG  414
             AAWQ+H+ V     E+  EF   W+KS  I Q  K+F  + + + SSPR N Y  +FG G
Sbjct  180   AAWQLHQAVVSHSDEKAREFLNLWLKSRFIYQIGKLFDPHSVMMGSSPRFNKYGNEFGLG  239

Query  413   KPVAVRCGMDNKADGKFSLFPGLE-KGSVDIEVCLLPHTLHTLGNDQEFMEFVT  255
             K +A+R G  +K  GK S +PG E  GS+++E+CL P  +  L +D+EFM+ V+
Sbjct  240   KALALRSGYAHKFSGKASAYPGHEGGGSIELEICLSPDEMTALESDKEFMDVVS  293



>ref|XP_009409404.1| PREDICTED: uncharacterized acetyltransferase At3g50280 [Musa 
acuminata subsp. malaccensis]
Length=468

 Score =   250 bits (639),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 136/305 (45%), Positives = 181/305 (59%), Gaps = 6/305 (2%)
 Frame = -1

Query  1154  GISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRG---MPQLSLPPVL  984
             G S PLL VQ+TEL DG+F+G + NH   D +S+W FFN+W+EI+R      ++S PPV 
Sbjct  148   GHSEPLLAVQLTELADGFFVGCSFNHVVGDGTSYWQFFNAWAEIARADGAAAEMSHPPVH  207

Query  983   DPWF-PGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEMGTDS  807
             D WF  G+   P+ LPF    E +     PP   ER+FH S ++IA+LK +AN E GT S
Sbjct  208   DRWFIDGSGGLPIKLPFTRPDEFIDRPTQPPLYRERIFHLSAESIARLKARANLECGTSS  267

Query  806   ISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKLAKAN  627
             ISS QS  + LWR ITRAR L   +     V    R R  PP+   Y+GN+I+   A A 
Sbjct  268   ISSFQSVASLLWRCITRARGLPAEQTTHCRVATQNRARLQPPMSPDYFGNSIYPLPAAAT  327

Query  626   AGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIASSPR  447
             AGELL  GLGWAA  IHE V+      + E  + W+ +PV+  K  +F    + + SSPR
Sbjct  328   AGELLAHGLGWAARLIHETVAGHTDTAIREKVEAWMAAPVV-YKMNMFDKFSVMMGSSPR  386

Query  446   NNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLE-KGSVDIEVCLLPHTLHTLGNDQEF  270
              +VY  +FG GK VAVR G  +K DGK + +PG E  GS+D+E+CL P  +     D+EF
Sbjct  387   FDVYGCNFGLGKAVAVRSGTAHKFDGKVTFYPGWEGGGSMDLEICLEPPFMSAFEADEEF  446

Query  269   MEFVT  255
             M  V+
Sbjct  447   MSAVS  451



>ref|XP_008220250.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like isoform 
X2 [Prunus mume]
Length=424

 Score =   249 bits (635),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 139/313 (44%), Positives = 182/313 (58%), Gaps = 14/313 (4%)
 Frame = -1

Query  1169  TTSRKGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRG--------  1014
               +  G +  LL +QVTEL DG FIGL+MNH   D +S+WHFFN WSEI +         
Sbjct  108   AVNHDGHTMSLLTIQVTELVDGIFIGLSMNHCLGDGTSYWHFFNIWSEIFQAQAQGDHNN  167

Query  1013  -MPQLSLPPVLDPWFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKE  837
              +P +S PPVL  WFP      + LPF    E +   +  P L ER+FHFS ++IAKLK 
Sbjct  168   FVPNISRPPVLKRWFPDGHGPIINLPFKHSDEFIGR-YEAPKLRERMFHFSSESIAKLKA  226

Query  836   KANSEMGTDSISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGN  657
             KAN+E  T  ISS QS  A +WR+ITR R L   +  S  +    R R  PPL   Y+GN
Sbjct  227   KANAESNTTKISSFQSLSALMWRSITRVRGLPQDQGTSCRLAANNRGRLEPPLSGDYFGN  286

Query  656   AIHSKLAK-ANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFF  480
             +IH   ++   AGELL  GLGWAAW++HE V   +++ + E    W+ SP + Q S  FF
Sbjct  287   SIHPIRSEIVPAGELLDHGLGWAAWKLHEAVVNHNNKWIREHVDGWLNSPAVYQVS--FF  344

Query  479   ANF-LGIASSPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDIEVCLLPH  303
                 + + SSPR N+Y   FG GK +A+R G  +K  GK S + G E+GS+D+EVCL P 
Sbjct  345   DPLSVMMGSSPRFNMYGNQFGMGKALALRSGYAHKFSGKVSSYEGREEGSIDLEVCLPPD  404

Query  302   TLHTLGNDQEFME  264
              +  L  D EFME
Sbjct  405   AMSALECDTEFME  417



>ref|XP_007221613.1| hypothetical protein PRUPE_ppb015328mg [Prunus persica]
 gb|EMJ22812.1| hypothetical protein PRUPE_ppb015328mg [Prunus persica]
Length=453

 Score =   249 bits (637),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 142/313 (45%), Positives = 184/313 (59%), Gaps = 20/313 (6%)
 Frame = -1

Query  1169  TTSRKGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRG--------  1014
               +  G +  LL +QVTEL DG FIGL+MNH   D +S+WHFFN WSEI +         
Sbjct  143   AVNHDGHTMSLLTIQVTELVDGIFIGLSMNHCLGDGTSYWHFFNIWSEIFQAQAQGDHNN  202

Query  1013  -MPQLSLPPVLDPWFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKE  837
              +P++S PPVL  WFP      + LPF    E +   +  P L ER+FHFS ++IAKLK 
Sbjct  203   FVPKISRPPVLKRWFPDGHGPIINLPFKHSDEFIGR-YEAPKLRERMFHFSSESIAKLKA  261

Query  836   KANSEMGTDSISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGN  657
             KAN+E  T  ISS QS  A +WR+ITRAR L   +  +       R R  PPL   Y+GN
Sbjct  262   KANAESNTTKISSFQSLSALMWRSITRARGLPRDQGTN------CRGRLEPPLSGDYFGN  315

Query  656   AIHSKLAK-ANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFF  480
             +IH   ++   AGELL+ GLGWAAW++HE V   + + + E    W+KSP + Q S  FF
Sbjct  316   SIHPIRSEIVPAGELLEHGLGWAAWKLHEAVVNHNDKLIREHVDGWLKSPAVYQLS--FF  373

Query  479   ANF-LGIASSPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDIEVCLLPH  303
               F + + SSPR N+Y   FG GK +A R G  NK  GK S + G E+GS+D+EVCL P 
Sbjct  374   DPFSVMMGSSPRFNMYGNQFGMGKALAPRSGYANKFSGKVSSYEGREEGSIDLEVCLPPD  433

Query  302   TLHTLGNDQEFME  264
              +  L  D EFME
Sbjct  434   AMSALECDSEFME  446



>ref|XP_006473294.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Citrus 
sinensis]
Length=455

 Score =   249 bits (636),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 135/303 (45%), Positives = 184/303 (61%), Gaps = 7/303 (2%)
 Frame = -1

Query  1154  GISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRG---MPQLSLPPVL  984
             G S PLL +QVTEL DG FIG +MNH   D +SFW+FFN++SEI +    M  +S PPV+
Sbjct  150   GHSRPLLSIQVTELVDGIFIGCSMNHVLGDGTSFWNFFNAFSEIFQAQGKMASISRPPVI  209

Query  983   DPWFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEMG--TD  810
               WFP      + LPF  + E +   +  P L ER+FHF+ ++IA+LK KAN+E G  T+
Sbjct  210   KRWFPDGRDPIINLPFTHRDEFIRR-YEAPQLLERIFHFTGESIARLKAKANAEAGNNTN  268

Query  809   SISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKLAKA  630
              ISS Q+  A +WR+ITR R L P +     +    R R  PPLP  Y+GN+I+      
Sbjct  269   KISSFQALSALVWRSITRIRNLPPDQTTGCRMAADNRPRLEPPLPREYFGNSINPLRGVT  328

Query  629   NAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIASSP  450
               GELL   LGWAAW++H+ V  Q  + V E+   W KSP +    ++F    + + SSP
Sbjct  329   TVGELLGHDLGWAAWKLHQTVVNQTDKAVREWLDAWWKSPFMYHLDRLFDPFSIMMGSSP  388

Query  449   RNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLE-KGSVDIEVCLLPHTLHTLGNDQE  273
             R N Y  +FG G+ VA+R G  +K DGK S +PG E  GS+D+E+CL PH++  L  D+E
Sbjct  389   RFNKYGNEFGLGQAVALRSGYAHKFDGKVSAYPGHEGGGSIDLEICLPPHSMTALEADEE  448

Query  272   FME  264
             FME
Sbjct  449   FME  451



>ref|XP_003603072.1| N-hydroxycinnamoyl/benzoyltransferase [Medicago truncatula]
 gb|AES73323.1| HXXXD-type acyl-transferase family protein [Medicago truncatula]
Length=457

 Score =   249 bits (636),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 129/305 (42%), Positives = 183/305 (60%), Gaps = 6/305 (2%)
 Frame = -1

Query  1166  TSRKGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQLSLP--  993
              +  G +  LL +QVTEL D  FIG +MNH   D + +W+FFNS+SEI +    + +P  
Sbjct  144   VNHDGHTMSLLSIQVTELLDSVFIGCSMNHCIGDGTGYWNFFNSFSEIFQNDVHVPVPIS  203

Query  992   --PVLDPWFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEM  819
               P+ + WFP      + LPF    E +   +  P L ER+FHFS ++IAKLK KAN E 
Sbjct  204   HKPIHNRWFPEGYGPIISLPFKHHDEFIHR-YETPILRERIFHFSAESIAKLKAKANKES  262

Query  818   GTDSISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKL  639
              T+ ISS QS  A +WR++TRAR+L   +  +  + +  R R  PPLP+ Y+GN+I++  
Sbjct  263   DTNKISSFQSLSALVWRSLTRARQLQQGQRTTCKLAVNNRTRMEPPLPKEYFGNSIYAVR  322

Query  638   AKANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIA  459
             A+   GELL+  LGWAAW+IH  ++  D + V    + W++SP + +    F    + + 
Sbjct  323   AETTVGELLENDLGWAAWKIHLAIANYDDKVVRNSVEEWLRSPFVYRMDLFFDPYTVMMG  382

Query  458   SSPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLE-KGSVDIEVCLLPHTLHTLGN  282
             SSPR N+Y  +FG GK +AVR G  NK DGK + +PG E  GS+D+EVCL P  +  L  
Sbjct  383   SSPRFNMYGNEFGMGKALAVRSGYANKFDGKVTSYPGQEGGGSIDLEVCLSPEKMMVLET  442

Query  281   DQEFM  267
             DQEFM
Sbjct  443   DQEFM  447



>ref|XP_007136698.1| hypothetical protein PHAVU_009G066300g [Phaseolus vulgaris]
 gb|ESW08692.1| hypothetical protein PHAVU_009G066300g [Phaseolus vulgaris]
Length=460

 Score =   249 bits (636),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 131/312 (42%), Positives = 186/312 (60%), Gaps = 9/312 (3%)
 Frame = -1

Query  1166  TSRKGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQ------  1005
              +  G + PLL ++VTEL DG FIG +MNH   D +S+W+FFN+WS+I +   Q      
Sbjct  144   VNHDGHTMPLLSIKVTELVDGVFIGCSMNHNIGDGTSYWNFFNAWSQIFQAQAQGNEHDV  203

Query  1004  -LSLPPVLDPWFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKAN  828
              +S  P+ + WFP      + LPF    E +S  F  P L  R+FHFS ++IA+LKE+AN
Sbjct  204   PISCYPIHNRWFPDGCGPVINLPFKHHDEFISR-FEAPLLRGRIFHFSSESIARLKERAN  262

Query  827   SEMGTDSISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIH  648
             SE  T  ISSLQS  AH+WR +TRAR+    E  S  + I  R R  PPL   Y+G+A+ 
Sbjct  263   SESKTTKISSLQSLSAHVWRCVTRARQTAHDERTSCKLAINNRSRMEPPLAAEYFGSAVS  322

Query  647   SKLAKANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFL  468
                A +  GELL+  LGWAAW++H  V+  +   V +  + W++ PVI Q      ++ +
Sbjct  323   VVSADSTGGELLENDLGWAAWKVHLAVANHNGRVVRDMLKEWLQHPVIYQLGVNIDSSCV  382

Query  467   GIASSPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLE-KGSVDIEVCLLPHTLHT  291
              I+SSP+ ++Y  +FG GK VAV  G  NK DG  + +PG +  GS+D E+ L PH +  
Sbjct  383   MISSSPKFDMYGNEFGMGKAVAVLSGYANKFDGNVTAYPGRDGGGSIDFELSLSPHVMTA  442

Query  290   LGNDQEFMEFVT  255
             L +D+EFME V+
Sbjct  443   LESDEEFMEAVS  454



>ref|XP_008220248.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like isoform 
X1 [Prunus mume]
 ref|XP_008220249.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like isoform 
X1 [Prunus mume]
Length=459

 Score =   249 bits (636),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 139/313 (44%), Positives = 182/313 (58%), Gaps = 14/313 (4%)
 Frame = -1

Query  1169  TTSRKGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRG--------  1014
               +  G +  LL +QVTEL DG FIGL+MNH   D +S+WHFFN WSEI +         
Sbjct  143   AVNHDGHTMSLLTIQVTELVDGIFIGLSMNHCLGDGTSYWHFFNIWSEIFQAQAQGDHNN  202

Query  1013  -MPQLSLPPVLDPWFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKE  837
              +P +S PPVL  WFP      + LPF    E +   +  P L ER+FHFS ++IAKLK 
Sbjct  203   FVPNISRPPVLKRWFPDGHGPIINLPFKHSDEFIGR-YEAPKLRERMFHFSSESIAKLKA  261

Query  836   KANSEMGTDSISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGN  657
             KAN+E  T  ISS QS  A +WR+ITR R L   +  S  +    R R  PPL   Y+GN
Sbjct  262   KANAESNTTKISSFQSLSALMWRSITRVRGLPQDQGTSCRLAANNRGRLEPPLSGDYFGN  321

Query  656   AIHSKLAK-ANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFF  480
             +IH   ++   AGELL  GLGWAAW++HE V   +++ + E    W+ SP + Q S  FF
Sbjct  322   SIHPIRSEIVPAGELLDHGLGWAAWKLHEAVVNHNNKWIREHVDGWLNSPAVYQVS--FF  379

Query  479   ANF-LGIASSPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDIEVCLLPH  303
                 + + SSPR N+Y   FG GK +A+R G  +K  GK S + G E+GS+D+EVCL P 
Sbjct  380   DPLSVMMGSSPRFNMYGNQFGMGKALALRSGYAHKFSGKVSSYEGREEGSIDLEVCLPPD  439

Query  302   TLHTLGNDQEFME  264
              +  L  D EFME
Sbjct  440   AMSALECDTEFME  452



>ref|XP_012066805.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like isoform 
X1 [Jatropha curcas]
 gb|KDP42394.1| hypothetical protein JCGZ_02451 [Jatropha curcas]
Length=448

 Score =   249 bits (635),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 134/308 (44%), Positives = 182/308 (59%), Gaps = 6/308 (2%)
 Frame = -1

Query  1163  SRKGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQ----LSL  996
             + +G    LL +QVTEL DG FIG + NH   D +S+WHF N+WSEI +        +S 
Sbjct  142   NHEGHVRSLLTIQVTELIDGIFIGCSFNHVIGDGTSYWHFLNTWSEIFQAQRDDHVPISQ  201

Query  995   PPVLDPWFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEMG  816
             PPVL  WFP N    + LPF   ++ L   F  P L+ER+FHFS ++IAKLK KAN+E  
Sbjct  202   PPVLKRWFPDNCGPIINLPFTHHEQFLVP-FEAPLLKERIFHFSAESIAKLKVKANTEYN  260

Query  815   TDSISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKLA  636
             TD ISS QS  A +WR ITRAR +   +     +    R R NPPL   Y+GN + +  A
Sbjct  261   TDKISSFQSLSAFMWRCITRARHIPHDQVTHCSLACNNRSRLNPPLSPNYFGNFVDAVSA  320

Query  635   KANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIAS  456
                  ELL++ LGWAAW +H+ V  Q  ++  +   +W+KSP+I    + F    +   S
Sbjct  321   STTGCELLEQNLGWAAWLLHQAVINQTDKKFRDRIDSWIKSPIIYHLGQFFGLYGVVFGS  380

Query  455   SPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLE-KGSVDIEVCLLPHTLHTLGND  279
             SPR + Y  +FG GK +++R G  NK  GK S +PG E  GSVD+EVCLLP ++  L +D
Sbjct  381   SPRFSKYGCEFGLGKALSLRSGYANKFCGKVSAYPGREGGGSVDLEVCLLPDSMTALESD  440

Query  278   QEFMEFVT  255
             +EFM  V+
Sbjct  441   KEFMAAVS  448



>ref|XP_011654118.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Cucumis 
sativus]
 gb|KGN55210.1| hypothetical protein Csa_4G640960 [Cucumis sativus]
Length=454

 Score =   249 bits (635),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 132/309 (43%), Positives = 181/309 (59%), Gaps = 5/309 (2%)
 Frame = -1

Query  1169  TTSRKGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQ---LS  999
               +  G S PLL +QVTEL DG FIG ++NH+  D +S+WHFFN WSEI         +S
Sbjct  145   AVNHDGHSRPLLSIQVTELHDGVFIGCSINHSIVDGTSYWHFFNMWSEIFEAQDDNVSIS  204

Query  998   LPPVLDPWFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEM  819
              PP+L  WFP      L LPF    +   + F  P L ++ FHFS +++A LK++AN+E 
Sbjct  205   RPPILQRWFPEGHGPILKLPF-THPDQFINRFEAPELSKKHFHFSSESVAVLKKRANTEY  263

Query  818   GTDSISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKL  639
              T+ ISS QS  A +WR+ITR R L P + +   + I  R R +PPL E Y+GN+IH+  
Sbjct  264   KTNKISSFQSLSALVWRSITRVRELPPDQTIGCIMAINNRSRLDPPLSENYFGNSIHTIK  323

Query  638   AKANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIA  459
               A   ELL+  LGWAAW++HE V       V +F + WV+SP I + + +F    + I 
Sbjct  324   GVATVKELLENNLGWAAWKLHEAVVNHKDSIVRDFVKKWVESPSIYRIAGMFDPLSVMIG  383

Query  458   SSPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLE-KGSVDIEVCLLPHTLHTLGN  282
             SSPR N Y   FG GK V +R G  +K DG  + +PG E  GS+++E+CL  H +  L  
Sbjct  384   SSPRFNKYGNVFGMGKAVGIRSGYAHKFDGIVTCYPGHEGGGSIELEICLPLHFMAALEA  443

Query  281   DQEFMEFVT  255
             D EFM+  T
Sbjct  444   DGEFMDATT  452



>ref|XP_007136697.1| hypothetical protein PHAVU_009G066200g [Phaseolus vulgaris]
 gb|ESW08691.1| hypothetical protein PHAVU_009G066200g [Phaseolus vulgaris]
Length=461

 Score =   249 bits (635),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 134/312 (43%), Positives = 185/312 (59%), Gaps = 9/312 (3%)
 Frame = -1

Query  1166  TSRKGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQ------  1005
              +  G + PLL ++VTEL DG FIG +MNH   D +S+W+FFN+WSEI     Q      
Sbjct  141   VNHDGHTMPLLSIKVTELLDGVFIGCSMNHAIGDGTSYWNFFNTWSEIFLAQAQGHEYGV  200

Query  1004  -LSLPPVLDPWFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKAN  828
              +S  P+ + WFP      + LPF    E +S  F  P + ER+FHFS ++IAKLK +AN
Sbjct  201   SISRHPIHNRWFPDGCGPLINLPFKHHDEFISR-FEAPKMRERIFHFSAESIAKLKARAN  259

Query  827   SEMGTDSISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIH  648
             S+  T  ISS QS  AH+WR ITRAR L   E  S  + I  R R  PPLP  Y+GN I 
Sbjct  260   SDSKTTKISSFQSLSAHVWRCITRARHLPHDEITSCKLAINNRARMEPPLPYEYFGNLIG  319

Query  647   SKLAKANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFL  468
                A   AGELL+  LGWAAW++H  V+ Q+   V +  + W++ PV+ Q    F +  +
Sbjct  320   VVSAGTTAGELLENDLGWAAWKVHLAVANQNDRVVRDAVKEWLQRPVVYQLGVHFDSCSV  379

Query  467   GIASSPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLE-KGSVDIEVCLLPHTLHT  291
              ++SSPR ++Y  +FG G+ VAV  G  NK DG  + +PG E  GS+D+E+ L P  +  
Sbjct  380   TMSSSPRFDMYGNEFGMGRAVAVLSGYANKFDGSVTSYPGSEGGGSIDLELSLSPKAMTL  439

Query  290   LGNDQEFMEFVT  255
             L +D+EFM+ V+
Sbjct  440   LESDEEFMQAVS  451



>ref|XP_010064177.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Eucalyptus 
grandis]
Length=470

 Score =   249 bits (635),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 145/312 (46%), Positives = 184/312 (59%), Gaps = 8/312 (3%)
 Frame = -1

Query  1166  TSRKGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRG-------MP  1008
              +  G S  LL  QVTEL DG FIGL+MNH+  D +SFW FFNSWSEI +        + 
Sbjct  157   VNHDGHSLSLLSAQVTELADGVFIGLSMNHSIGDGTSFWLFFNSWSEIFQAQQKGDVDVV  216

Query  1007  QLSLPPVLDPWFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKAN  828
             QLS PPVL  WFP N    + LP      +    +  P L ERVFHFS D IA LK +AN
Sbjct  217   QLSRPPVLTRWFPENHPGSVSLPSADDPSSFHPRYRVPDLRERVFHFSADAIASLKAEAN  276

Query  827   SEMGTDSISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIH  648
              + GT  ISS QS  A LWR ITRAR L P++  S  V    R R +PPLP  Y+GN + 
Sbjct  277   RQCGTPKISSFQSLTALLWRCITRARCLPPSQVTSCRVISNNRARLDPPLPPEYFGNPVT  336

Query  647   SKLAKANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFL  468
                A   AGELL   LGWAA  +H +V+   + +V+E+ + W+KSP + +  + F    +
Sbjct  337   MLRAATTAGELLGGDLGWAALLLHALVAEHGNAKVLEWNEEWIKSPQVYRLDRTFDPCSI  396

Query  467   GIASSPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLE-KGSVDIEVCLLPHTLHT  291
              ++SSPR N+Y  DFG GK  A R G  NK DGK + +PG E  GS+D+E+CL P T+ +
Sbjct  397   IMSSSPRFNMYGNDFGLGKAAAPRSGCANKIDGKVTSYPGREGGGSIDLEICLSPATMAS  456

Query  290   LGNDQEFMEFVT  255
             L  D EFM  VT
Sbjct  457   LEADAEFMAAVT  468



>ref|XP_012066803.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Jatropha 
curcas]
 gb|KDP42392.1| hypothetical protein JCGZ_02449 [Jatropha curcas]
Length=448

 Score =   248 bits (633),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 133/308 (43%), Positives = 181/308 (59%), Gaps = 6/308 (2%)
 Frame = -1

Query  1163  SRKGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQ----LSL  996
             + +G    LL +QVTEL DG FIG + NH   D +S+WHF N+WSEI +        +S 
Sbjct  142   NHEGHVRSLLTIQVTELIDGIFIGCSFNHVIGDGTSYWHFLNTWSEIFQAQRDDHVPISQ  201

Query  995   PPVLDPWFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEMG  816
             PPVL  WFP N    + LPF+  ++ L   F  P L+ER+FHFS ++IAKLK KAN+E  
Sbjct  202   PPVLKRWFPDNCGPIINLPFNHHEQFLVP-FEAPLLKERIFHFSAESIAKLKVKANTEYN  260

Query  815   TDSISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKLA  636
             TD ISS QS  A +WR ITRAR +   +     +    R R NPPL   Y+GN + +  A
Sbjct  261   TDKISSFQSLSAFMWRCITRARHIPHDQVTHCSLACNNRSRLNPPLSPNYFGNFVDAVSA  320

Query  635   KANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIAS  456
                  ELL++ LGWAAW +H+ V  Q  ++  +   +W+KSP+I    + F    +   S
Sbjct  321   STTGCELLEQNLGWAAWLLHQAVINQTDKKFRDRIDSWIKSPIIYHLGQFFGLYGVHFGS  380

Query  455   SPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLE-KGSVDIEVCLLPHTLHTLGND  279
             SPR N Y  + G GK + +R G  +K  GK S +PG E  GSVD+EVCLLP ++  L +D
Sbjct  381   SPRFNKYGCELGLGKALTLRSGYAHKFCGKVSAYPGREGGGSVDLEVCLLPDSMTALESD  440

Query  278   QEFMEFVT  255
             +EFM  V+
Sbjct  441   KEFMAAVS  448



>ref|XP_006826188.2| PREDICTED: BAHD acyltransferase DCR, partial [Amborella trichopoda]
Length=296

 Score =   243 bits (621),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 143/309 (46%), Positives = 183/309 (59%), Gaps = 33/309 (11%)
 Frame = -1

Query  1127  QVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRG---MPQLSLPPVLDPWFPGNIA  957
             QVTEL DG FIG +MNHT AD SSFW FFNSW+EISRG     ++S  PVL+PWF     
Sbjct  3     QVTELSDGLFIGCSMNHTVADGSSFWSFFNSWAEISRGDGSSLKISQQPVLEPWF----L  58

Query  956   RPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKAN---SEMGTDSISSLQSY  786
             +   +  +L ++TL   ++PPPL ER FHFS  +IA LK KAN    E G+  ISSLQS 
Sbjct  59    KDRRIAMNLSEDTLER-YSPPPLTERFFHFSAQSIALLKHKANMHIDEDGSGKISSLQSL  117

Query  785   VAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKLAKANAGELLKR  606
              A +WRA+TRAR   PT+     +  G R R +PPL   Y+GN I +       GELL +
Sbjct  118   TALMWRAVTRARGFPPTQTTKCGMAAGNRSRLSPPLSPDYFGNCIQAIAVSTTVGELLSQ  177

Query  605   GLGWAAWQI------HEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANF----LGIAS  456
              LGWAA  +      H  VS++ H EV      W+K+P          +NF    + + S
Sbjct  178   ELGWAASMLRQATLGHTDVSVRAHLEV------WMKAP-----RPYHLSNFDPFSIVVGS  226

Query  455   SPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLE-KGSVDIEVCLLPHTLHTLGND  279
             SPR  +Y  DFGWG P+AVR G  NK DGK S + G E +GS+D+EVCL P  +  L +D
Sbjct  227   SPRFPMYQNDFGWGIPLAVRSGNANKFDGKISAYQGREGEGSMDMEVCLAPQVMTALESD  286

Query  278   QEFMEFVTH  252
             QEF+  VT+
Sbjct  287   QEFLAAVTY  295



>ref|XP_010915553.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Elaeis 
guineensis]
Length=469

 Score =   248 bits (634),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 131/307 (43%), Positives = 186/307 (61%), Gaps = 8/307 (3%)
 Frame = -1

Query  1163  SRKGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISR--GMPQLSLPP  990
             +  G + PLL VQ+TEL DG FIG + NH   D +S+W+FFN+W++I+R  G+  LS PP
Sbjct  149   NHDGHTQPLLAVQLTELADGIFIGCSFNHAVGDGTSYWNFFNAWAQIARTKGVAPLSRPP  208

Query  989   VLDPWF-PGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEMGT  813
             V D WF  G    P+ LPF    + +   F+PPP  E++FHFS  +IA+LK +AN E GT
Sbjct  209   VHDRWFIDGYDTAPIKLPFTHPHDFIER-FSPPPFREKIFHFSARSIAQLKARANQECGT  267

Query  812   DSISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKLAK  633
             +S+SS Q+  A +WR+ITR R L   +  S  +    R R NPPL   Y+GN+++   A 
Sbjct  268   NSVSSFQALTAVVWRSITRTRNLPADQKTSCRLAAENRSRLNPPLSPAYFGNSVYPIAAT  327

Query  632   ANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKV-FFANFLGIAS  456
                GELL  GLGWAAW ++  V+  +   +      W+  P++ ++S    F+  +G  S
Sbjct  328   TTVGELLNHGLGWAAWLLNRTVADHNDSTIRGRLMAWMARPMVYRQSGFDRFSVLMG--S  385

Query  455   SPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLE-KGSVDIEVCLLPHTLHTLGND  279
             SPR ++Y  DFGWGK VA R G  +K DGK + +PG E  GS+D+E+CL+P ++  L  D
Sbjct  386   SPRFDMYGCDFGWGKAVAARSGSASKFDGKVTSYPGWEGGGSMDLEICLVPKSMSMLETD  445

Query  278   QEFMEFV  258
              EF   V
Sbjct  446   DEFRSAV  452



>emb|CBI21394.3| unnamed protein product [Vitis vinifera]
Length=446

 Score =   248 bits (632),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 129/300 (43%), Positives = 168/300 (56%), Gaps = 34/300 (11%)
 Frame = -1

Query  1154  GISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQLSLPPVLDPW  975
             G++ PLL VQVTEL DG F+G ++NH   D  SFWHFFNSWSEISRG  ++S+ PV   W
Sbjct  147   GVTQPLLAVQVTELVDGIFVGCSLNHVVGDGKSFWHFFNSWSEISRGPNKISVSPVFKRW  206

Query  974   FPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEMGTDSISSL  795
             F  +   P+ +P                                  +AN+EMG D ISSL
Sbjct  207   FGDDTDYPIRIP----------------------------------RANAEMGIDRISSL  232

Query  794   QSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKLAKANAGEL  615
             Q+ +AHLWR   R RRL   ++ S ++ I  R R  P +P+ Y+G A+         GEL
Sbjct  233   QALLAHLWRCTIRTRRLPEDQETSYHLCIDMRTRRRPQMPQQYFGVALQRGTLTMKVGEL  292

Query  614   LKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIASSPRNNVY  435
             L  GLG  AWQ+++++S     E   F ++W K P     S V  +N   +ASSPR NVY
Sbjct  293   LGMGLGHVAWQMNKMISTFTEVEATNFLESWAKDPKPISYSTVTMSNAFIMASSPRFNVY  352

Query  434   ATDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDIEVCLLPHTLHTLGNDQEFMEFVT  255
              TDFGWG+PVAVR G   K DGK ++  G E+GS+DIEVC  P TL  +  D +FME VT
Sbjct  353   GTDFGWGRPVAVRSGGGIKLDGKTTISQGAEEGSIDIEVCSSPETLQAMLEDADFMEAVT  412



>gb|KEH31453.1| HXXXD-type acyl-transferase family protein [Medicago truncatula]
Length=433

 Score =   247 bits (630),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 124/303 (41%), Positives = 180/303 (59%), Gaps = 22/303 (7%)
 Frame = -1

Query  1163  SRKGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQLSLPPVL  984
             + +  S P+L VQVTEL +G FIG  +NH  +D  SFWHF N+WS+IS+   +++  P  
Sbjct  144   NHEATSQPILAVQVTELANGIFIGFTVNHVVSDGKSFWHFVNTWSQISKNSHEVTKLP--  201

Query  983   DPWFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEMGTDS-  807
                               +Q    S   P  L ER+FHF+K+ IA+LK KA  E  T++ 
Sbjct  202   ----------------SFKQTEAKSRKPPQNLPERIFHFTKEKIAELKSKATEETKTENV  245

Query  806   ---ISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKLA  636
                ISSLQ  ++H+WR + R+++L+P ED    + IG R R  PPL E Y+GNA      
Sbjct  246   QIKISSLQVLLSHVWRCVVRSKKLDPQEDFCYILSIGVRPRMIPPLEEDYFGNASMIGGV  305

Query  635   KANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIAS  456
                AGE+L+ G+G  A ++++++     E++ ++Y+ W++ P I     +   N LG +S
Sbjct  306   TMKAGEILECGIGKVALELNKMIMSHSDEKIRDYYECWLRMPKIFGIDVLTGGNTLGTSS  365

Query  455   SPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDIEVCLLPHTLHTLGNDQ  276
             SPR +VY  DFGWGKPV VRCG  NK +GK ++F G+E+GS+D+EVCL    L  LGND 
Sbjct  366   SPRFDVYGNDFGWGKPVGVRCGGANKNNGKITVFAGVEEGSIDVEVCLSYEILEALGNDA  425

Query  275   EFM  267
             EF+
Sbjct  426   EFL  428



>ref|XP_008452575.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Cucumis 
melo]
Length=455

 Score =   247 bits (631),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 132/309 (43%), Positives = 180/309 (58%), Gaps = 5/309 (2%)
 Frame = -1

Query  1169  TTSRKGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQ---LS  999
               +  G S PLL +QVTEL DG FIG ++NH+  D +S+WHFFN WSEI         +S
Sbjct  146   AVNHDGHSRPLLSIQVTELHDGVFIGCSINHSIVDGTSYWHFFNMWSEIFEAEDDNVSIS  205

Query  998   LPPVLDPWFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEM  819
              PP+L  WFP      L LPF    +   + F  P L ++ FHFS +++A LK++AN+E 
Sbjct  206   RPPILQRWFPEGHGPILKLPF-THPDQFINRFEAPQLSKKHFHFSSESVAVLKKRANTEY  264

Query  818   GTDSISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKL  639
              T+ ISS QS  A +WR+ITR R L P + +   + I  R R +PPL E Y+GN+IH+  
Sbjct  265   KTNKISSFQSLSALVWRSITRVRGLPPDQTIGCIMAINNRSRLDPPLSENYFGNSIHTIK  324

Query  638   AKANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIA  459
               A   ELL   LGWAAW++HE V       V +F + WV+SP I + + +F    + I 
Sbjct  325   GVATVKELLGNNLGWAAWKLHEAVVNHKDSIVRDFVKKWVESPSIYRIAGMFDPLSVMIG  384

Query  458   SSPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLE-KGSVDIEVCLLPHTLHTLGN  282
             SSPR N Y   FG GK V +R G  +K DG  + +PG E  GS+++E+CL  H +  L  
Sbjct  385   SSPRFNKYGNVFGMGKAVGIRSGYAHKFDGIVTCYPGYEGGGSIELEICLPLHFMAALET  444

Query  281   DQEFMEFVT  255
             D EFM+  T
Sbjct  445   DGEFMDATT  453



>ref|XP_008801989.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Phoenix 
dactylifera]
Length=464

 Score =   246 bits (629),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 132/304 (43%), Positives = 185/304 (61%), Gaps = 8/304 (3%)
 Frame = -1

Query  1154  GISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISR--GMPQLSLPPVLD  981
             G + PLL VQ+TEL DG FIG + NH   D +S+W+FFN+W++I+R  G+  LS PPV D
Sbjct  147   GHAQPLLAVQLTELADGIFIGCSFNHAVGDGTSYWNFFNAWAQITRTKGVAALSRPPVYD  206

Query  980   PWF-PGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEMGTDSI  804
              WF  G    P+ LPF    +     F+PPPL E++ HFS  +IA+LK +AN   GT+SI
Sbjct  207   RWFIDGYDNPPVKLPFS-HPDDFIERFSPPPLREKIVHFSAQSIAQLKARANQARGTNSI  265

Query  803   SSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKLAKANA  624
             SS Q+  A +WR+ITR R L   +  S  +    R R +PPL   Y+GN+++  +A    
Sbjct  266   SSFQALSALVWRSITRTRNLPADQKTSCRMAAQNRARLSPPLSPDYFGNSMYPIIATTTV  325

Query  623   GELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANF-LGIASSPR  447
             GELL   LGWAAW ++  V+  D   + +  + W+  PV+ + S   F  F + + SSPR
Sbjct  326   GELLNHDLGWAAWLLNRTVAEHDDSAIRDKLRAWMARPVVYRLS--MFDRFSVMMGSSPR  383

Query  446   NNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLE-KGSVDIEVCLLPHTLHTLGNDQEF  270
              +VY  +FGWGK VA R G  NK DGK + + G E  GSVD+E+CL+P ++  L +D+EF
Sbjct  384   FDVYGCEFGWGKAVAARSGSANKFDGKVTSYSGWEGGGSVDLEICLVPESMSVLESDEEF  443

Query  269   MEFV  258
                V
Sbjct  444   RSAV  447



>emb|CDX78313.1| BnaA03g02250D [Brassica napus]
Length=471

 Score =   246 bits (628),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 135/313 (43%), Positives = 198/313 (63%), Gaps = 21/313 (7%)
 Frame = -1

Query  1154  GISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEI--------SRGMPQLS  999
             G +  +  V+VTEL DG FIGL+MNH+  D S+FW+FFNS SEI        ++ +  L 
Sbjct  163   GQTLSVFSVKVTELVDGVFIGLSMNHSVGDGSTFWNFFNSLSEIFNSQQEDETKDLFCLK  222

Query  998   LPPVLDPWFPGNIARPLC-LPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSE  822
              PP+         + P+C LP+     +++ S TP  L+ER+FHFS +T+  LK KAN +
Sbjct  223   NPPIFREE-----SGPMCRLPYSPLDASITLSETPV-LKERMFHFSSETLRSLKSKANKD  276

Query  821   MG-TDSISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHS  645
              G T  ISSLQS  A +WR+ITRAR L+  ++ +    +GTR RT+PPLP  ++G  +++
Sbjct  277   CGETTMISSLQSLTAFIWRSITRARSLSNDQETTCRFAVGTRTRTDPPLPTNHFG--VYT  334

Query  644   KLAK--ANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANF  471
              LA   A  G+LL+ GLGWAA ++H+ V+ Q+ E++     +W+K+P + Q  ++   N 
Sbjct  335   SLASTTAKTGDLLENGLGWAASKLHQAVTEQNGEKIASELDHWLKAPFVLQPDQLSEPNL  394

Query  470   LGIASSPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLE-KGSVDIEVCLLPHTLH  294
             + + SSPR + Y ++FG GK VAVR G ++K DGK S +PG E  GS+D+EVCLLP  + 
Sbjct  395   VHMGSSPRFDKYGSEFGMGKAVAVRSGYNSKHDGKVSAYPGREGGGSIDLEVCLLPEFME  454

Query  293   TLGNDQEFMEFVT  255
              L +DQEFM  V+
Sbjct  455   ALESDQEFMSLVS  467



>ref|XP_009131022.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Brassica 
rapa]
Length=471

 Score =   246 bits (627),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 135/313 (43%), Positives = 198/313 (63%), Gaps = 21/313 (7%)
 Frame = -1

Query  1154  GISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEI--------SRGMPQLS  999
             G +  +  V+VTEL DG FIGL+MNH+  D S+FW+FFNS SEI        ++ +  L 
Sbjct  163   GQTLSVFSVKVTELVDGVFIGLSMNHSVGDGSTFWNFFNSLSEIFNSQQDDETKDLFCLK  222

Query  998   LPPVLDPWFPGNIARPLC-LPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSE  822
              PP+         + P+C LP+     +++ S TP  L+ER+FHFS +T+  LK KAN +
Sbjct  223   NPPIFREE-----SGPMCRLPYSPLDASITLSETPV-LKERMFHFSSETLRSLKSKANKD  276

Query  821   MG-TDSISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHS  645
              G T  ISSLQS  A +WR+ITRAR L+  ++ +    +GTR RT+PPLP  ++G  +++
Sbjct  277   CGETTMISSLQSLTAFIWRSITRARSLSNDQETTCRFAVGTRTRTDPPLPTNHFG--VYT  334

Query  644   KLAK--ANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANF  471
              LA   A  G+LL+ GLGWAA ++H+ V+ Q+ E++     +W+K+P + Q  ++   N 
Sbjct  335   SLASTTAKTGDLLENGLGWAASKLHQAVTEQNGEKIASELDHWLKAPFVLQPDQLSEPNL  394

Query  470   LGIASSPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLE-KGSVDIEVCLLPHTLH  294
             + + SSPR + Y ++FG GK VAVR G ++K DGK S +PG E  GS+D+EVCLLP  + 
Sbjct  395   VHMGSSPRFDKYGSEFGMGKAVAVRSGYNSKHDGKVSAYPGREGGGSIDLEVCLLPEFME  454

Query  293   TLGNDQEFMEFVT  255
              L +DQEFM  V+
Sbjct  455   ALESDQEFMSLVS  467



>ref|NP_201516.1| HXXXD-type acyl-transferase-like protein [Arabidopsis thaliana]
 dbj|BAB10949.1| anthranilate N-hydroxycinnamoyl/benzoyltransferase-like protein 
[Arabidopsis thaliana]
 gb|AAL36423.1| putative anthranilate N-hydroxycinnamoyl/benzoyltransferase [Arabidopsis 
thaliana]
 gb|AAM51419.1| putative anthranilate N-hydroxycinnamoyl/benzoyltransferase [Arabidopsis 
thaliana]
 gb|AAM61217.1| anthranilate N-hydroxycinnamoyl/benzoyltransferase-like protein 
[Arabidopsis thaliana]
 gb|AED98307.1| HXXXD-type acyl-transferase-like protein [Arabidopsis thaliana]
Length=448

 Score =   245 bits (625),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 133/313 (42%), Positives = 176/313 (56%), Gaps = 17/313 (5%)
 Frame = -1

Query  1163  SRKGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEIS---------RGM  1011
             S +GIS  L+  QVTEL DG FIG   NH  AD SSFW FFN+WSEI          R  
Sbjct  139   SCEGISESLIAFQVTELKDGVFIGFGYNHIVADGSSFWSFFNTWSEICFNGFDADHRRKF  198

Query  1010  PQLSLPPVLDPWFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKA  831
             P    P +L  WF   I  P+ +P    +       T   L+E++F  +   I++LK KA
Sbjct  199   P----PLLLRGWFLDGIEYPIRIPLPETETPNRVVVTSSLLQEKIFRVTSRNISELKAKA  254

Query  830   NSEMGTDS--ISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGN  657
             N E+ +D   ISSLQ+  A++WR+I R   LNP E +   + +  R R NPPL +  +GN
Sbjct  255   NGEVDSDDRKISSLQAVSAYMWRSIIRNSGLNPEEVIHCKLLVDMRGRLNPPLEKECFGN  314

Query  656   AIHSKLAKANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFA  477
              +          E+L  GLGWAA QI++ V  Q +EE  EF +NWVK P I       F+
Sbjct  315   VVGFATVTTTVAEMLHNGLGWAALQINKTVGSQTNEEFREFAENWVKKPSILNAKA--FS  372

Query  476   NFLGIASSPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDIEVCLLPHTL  297
             N + IASSPR NVY  DFGWGKP+AVR G  N  DGK   +PG+E+G+++ + CL    L
Sbjct  373   NSITIASSPRFNVYGNDFGWGKPIAVRAGPGNTTDGKLIAYPGIEEGNIEFQTCLSSSVL  432

Query  296   HTLGNDQEFMEFV  258
               L  D+EF++ V
Sbjct  433   EKLSTDEEFLKHV  445



>ref|XP_004501558.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Cicer 
arietinum]
Length=446

 Score =   244 bits (624),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 126/309 (41%), Positives = 176/309 (57%), Gaps = 10/309 (3%)
 Frame = -1

Query  1166  TSRKGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQLSLPPV  987
             T+  G + PLL +QVTEL DG FIG +MNH   D +SFW+FFN WSEI +    + +   
Sbjct  136   TNHDGHTLPLLSIQVTELIDGVFIGCSMNHCIGDGTSFWNFFNVWSEIFQHENDVHVHVS  195

Query  986   LDPWFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSK---------DTIAKLKEK  834
              + WFP     P  LPF   +E ++  +  P   +R FHF+K         + IAKLK+K
Sbjct  196   HNRWFPNGYGPPTNLPFKHHEEFINK-YESPNFRDRFFHFTKXXXXXXXXXECIAKLKQK  254

Query  833   ANSEMGTDSISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNA  654
             AN E  T  ISS Q+  AH+WR +TRAR L   +  S  + I  R R  PPLP+ Y+GN+
Sbjct  255   ANKEYKTTKISSFQALSAHVWRCVTRARGLRDDQKTSCKLAINNRLRMEPPLPKEYFGNS  314

Query  653   IHSKLAKANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFAN  474
             +     + +  EL++  LGWAAW++H  V   D  EV E  Q W++ PV+ Q  + F   
Sbjct  315   VDVVSTETSVKELVENDLGWAAWKVHMSVVNHDDREVREMIQKWLEDPVVYQLGRHFDPY  374

Query  473   FLGIASSPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDIEVCLLPHTLH  294
              + ++SSPR N+Y  +FG GK VAV  G  NK DG  S + G E G++D+ + L PH + 
Sbjct  375   SITVSSSPRFNMYGNEFGMGKAVAVLSGYANKFDGNVSSYEGYEPGTIDLALTLTPHAMM  434

Query  293   TLGNDQEFM  267
              L +D  F+
Sbjct  435   ALESDPHFL  443



>gb|KEH31450.1| HXXXD-type acyl-transferase family protein [Medicago truncatula]
Length=451

 Score =   244 bits (624),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 137/319 (43%), Positives = 190/319 (60%), Gaps = 19/319 (6%)
 Frame = -1

Query  1163  SRKGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQLSLPPVL  984
             + KG S PLL VQVTEL DG FIG A+NH   DA SFWHF NSW+EIS+G  + +  P  
Sbjct  135   NHKGTSQPLLAVQVTELIDGIFIGFAINHVGVDAKSFWHFINSWAEISQGFNKPTNIPSF  194

Query  983   DPWFPGNIARPLCLPFDLQQETLSSSFTPPP-------LEERVFHFSKDTIAKLKEKANS  825
               WF  NI RP+  PF   +E     FT          L  R+FHFSK+ I +LK KAN+
Sbjct  195   KRWFTNNINRPIRFPFT--KEAQKQPFTNEAQNQQCEVLSHRIFHFSKEQILQLKSKANA  252

Query  824   EMGTDS------ISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYW  663
             E+ + +      ISSLQ+ ++H+WR I   + L P E  +  +PI  R R  P L + Y+
Sbjct  253   EISSSNSSEKIIISSLQALLSHVWRLIISKQNLKPEERSAFVLPIDCRTRMCPKLEDNYF  312

Query  662   GNAIHSK-LAKANAGELLKRGLGWAAWQIHEVVSIQD-HEEVVEFYQNWVKSPVIAQKSK  489
             G+ I +        GEL++ G+G  A ++++V+SIQ  HE+VV  Y++W+K+P I +  +
Sbjct  313   GSGIGATGYVIMQVGELMESGIGKIAMEMNKVISIQSHHEKVVNNYESWLKTPSIPEAGR  372

Query  488   VFFANFLGIASSPRNNVYATDFGWGKPVAVRCGMDNKAD-GKFSLFPGLEKGSVDIEVCL  312
                +N L  +SSPR N Y  DFGWGKP+AVR G+  K + G+  +  G E+GSVDI+VCL
Sbjct  373   S-SSNLLIASSSPRFNYYGNDFGWGKPIAVRNGVGLKRNIGRVIVLGGEEEGSVDIQVCL  431

Query  311   LPHTLHTLGNDQEFMEFVT  255
                 L  +GND   M+ +T
Sbjct  432   PYDILEAMGNDHLSMDPIT  450



>ref|XP_004291088.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Fragaria 
vesca subsp. vesca]
Length=453

 Score =   244 bits (623),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 137/302 (45%), Positives = 183/302 (61%), Gaps = 8/302 (3%)
 Frame = -1

Query  1154  GISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQ---LSLPPVL  984
             G +T LL  +VTEL DG FIGL+MNH   D +S+W+FFN+WSEI +       LS PPVL
Sbjct  146   GHTTSLLTAKVTELVDGVFIGLSMNHCLGDGTSYWNFFNTWSEIFQAQGSNITLSNPPVL  205

Query  983   DPWFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEMGTDSI  804
             D  FP      + LPF    E +   F  P L ER+FHFS +++A LK KANSE  T  I
Sbjct  206   DRCFPEGHGPIISLPFTDPSEFIDR-FEAPKLRERMFHFSSESLANLKAKANSECNTRKI  264

Query  803   SSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKLAK-AN  627
             S+ Q+  A +WR ITRAR L P ++ S  +    R R +PPL   Y+GN+++   +K   
Sbjct  265   STFQALSALVWRTITRARFLPPDQETSCRLAANNRARLDPPLAPNYFGNSVYPITSKPIK  324

Query  626   AGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANF-LGIASSP  450
             AGELL  GLGWAA+++H  V   +H+ +  F  + +KSP +   S  +F  F + + SSP
Sbjct  325   AGELLDHGLGWAAFKVHRAVVNLNHQALKGFLDHLLKSPTVF--SLRYFDPFSVMMGSSP  382

Query  449   RNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDIEVCLLPHTLHTLGNDQEF  270
             R ++Y  +FG GK VA+R G  NK  GK S F G E GS+D+EVCL P  +  L +D EF
Sbjct  383   RFDMYRNEFGMGKAVALRSGYANKFSGKVSSFQGGEAGSIDLEVCLPPEAMRALESDVEF  442

Query  269   ME  264
             ME
Sbjct  443   ME  444



>ref|XP_009123701.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like isoform 
X2 [Brassica rapa]
 emb|CDY02424.1| BnaA02g23330D [Brassica napus]
Length=449

 Score =   244 bits (623),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 130/307 (42%), Positives = 178/307 (58%), Gaps = 9/307 (3%)
 Frame = -1

Query  1154  GISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMP-------QLSL  996
             G++  LL VQVTEL DG F+GL++NH   D +SFW+FF++WSEI +           L  
Sbjct  142   GLTVSLLTVQVTELVDGIFVGLSINHAMGDGTSFWNFFSAWSEIFQAQECNKTDELYLKN  201

Query  995   PPVLDPWFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEMG  816
             PPVL  + P        LP+    E + + +  P L+ER+F FS +TI  LK K N   G
Sbjct  202   PPVLKRYIPQGYGPLFSLPYSHPDEFIRT-YESPILKERIFCFSSETIRLLKAKINQVCG  260

Query  815   TDSISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKLA  636
             T SISS QS  A +WR ITRARRL    + S  +    R R  PPLP  Y+GN + +   
Sbjct  261   TTSISSFQSLTAVIWRCITRARRLPIERETSCRLAADNRGRMYPPLPRDYFGNCLSALRT  320

Query  635   KANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIAS  456
              A AGELL+  LGWAA ++H+ V+    E+V +    W+KSP I    ++F    + + S
Sbjct  321   AAKAGELLENDLGWAALKVHQAVADHTSEKVTQMIDQWLKSPFIYHIDRLFEPMSVMMGS  380

Query  455   SPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLE-KGSVDIEVCLLPHTLHTLGND  279
             SPR + Y  +FG GK + +R G  +K DGK S +PG E  GS+D+EVCL+P  +  L +D
Sbjct  381   SPRFDKYGCEFGMGKAMTLRSGYAHKFDGKVSAYPGREGGGSIDLEVCLVPQFMEALESD  440

Query  278   QEFMEFV  258
             +EFM  V
Sbjct  441   EEFMSLV  447



>ref|XP_002871293.1| transferase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47552.1| transferase family protein [Arabidopsis lyrata subsp. lyrata]
Length=460

 Score =   244 bits (623),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 137/310 (44%), Positives = 188/310 (61%), Gaps = 10/310 (3%)
 Frame = -1

Query  1163  SRKGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQL---SLP  993
             +R G +  LL V+VTEL DG FIGL+MNH+  D SSFW FFNS SEI     +    +L 
Sbjct  151   NRDGDTMSLLSVKVTELVDGVFIGLSMNHSLGDGSSFWQFFNSLSEIFNSQEETIGNALL  210

Query  992   PVLDPWFPGNIARPL-CLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEMG  816
              + +P     ++ P+  LPF    E+LS S  PP L+ER+FHFS +T+  LK KAN E G
Sbjct  211   CLKNPPIFREVSGPIYSLPFSEPDESLSQS-EPPVLKERMFHFSSETVRSLKSKANQECG  269

Query  815   TDSISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKLA  636
             T  IS LQS  A +WR+ITRAR+L   ++ +  +  G R R NPPLP+ ++G  ++  L 
Sbjct  270   TTKISLLQSLTAFIWRSITRARKLPNDQETTCRLAAGNRSRMNPPLPKNHFG--VYVSLV  327

Query  635   KANA--GELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGI  462
             KA    G LL+    WAA ++H+ V+    E++      W+KSP+  Q  ++   N + +
Sbjct  328   KATTIIGNLLENEFEWAALKLHQAVTEHTGEKISYEVDQWLKSPLPLQVYRLSNLNIVHM  387

Query  461   ASSPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLEKG-SVDIEVCLLPHTLHTLG  285
              SSPR N Y  +FG GK VAVR G   K DGK S +PG E G S+D+EVCLLP ++  L 
Sbjct  388   GSSPRFNKYGCEFGMGKAVAVRSGYGGKYDGKVSAYPGREGGASIDLEVCLLPESMEALE  447

Query  284   NDQEFMEFVT  255
             +DQEF+  V+
Sbjct  448   SDQEFISLVS  457



>ref|XP_004501559.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Cicer 
arietinum]
Length=460

 Score =   244 bits (623),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 133/309 (43%), Positives = 182/309 (59%), Gaps = 7/309 (2%)
 Frame = -1

Query  1166  TSRKGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEI----SRGMPQLS  999
              +  G + PLL +Q+TEL DG FIG +MNH  AD +S+W+FFN+WSEI      G+P +S
Sbjct  144   VNHDGHTMPLLSIQITELLDGVFIGCSMNHHIADGTSYWNFFNTWSEIFQAEDHGVP-IS  202

Query  998   LPPVLDPWFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEM  819
               P  + WFP      + LPF    E +S  F  P L ER FHF+ ++IAKLK KAN E 
Sbjct  203   HQPFHNRWFPNGYGPLINLPFKHHDEFISR-FEKPELRERFFHFTTESIAKLKAKANIES  261

Query  818   GTDSISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKL  639
              T+ ISS QS  AH+WR +TRAR L      S  + I  R R  P LPE Y+G+ I++  
Sbjct  262   NTNKISSFQSLSAHVWRCVTRARGLAKDRKTSCQLAINNRPRMEPQLPEEYFGSCINTVS  321

Query  638   AKANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIA  459
             A+A+ GEL++  LGWAAW++H  V   D  +V +  + W++ PVI Q  + F    + + 
Sbjct  322   AEASVGELVENDLGWAAWKVHVAVVEYDDIKVRKIVKEWLECPVIFQVKRHFDPLSVAMI  381

Query  458   SSPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLE-KGSVDIEVCLLPHTLHTLGN  282
             SSPR N+Y  +FG GK VAV  G  NK DG  + + G E  GS D+E+CL    +  L  
Sbjct  382   SSPRFNMYGNEFGMGKAVAVLSGYANKCDGNVTAYEGREGGGSSDLEICLSHDAMTNLEL  441

Query  281   DQEFMEFVT  255
             D+ F+  V+
Sbjct  442   DETFLSTVS  450



>ref|XP_002865024.1| transferase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41283.1| transferase family protein [Arabidopsis lyrata subsp. lyrata]
Length=448

 Score =   244 bits (622),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 131/315 (42%), Positives = 176/315 (56%), Gaps = 17/315 (5%)
 Frame = -1

Query  1169  TTSRKGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEIS---------R  1017
              TS +GIS  L+  QVTEL DG FIG   NH  AD SSFW FFN+WSEI          R
Sbjct  137   VTSFEGISDSLIAFQVTELKDGVFIGFGYNHMVADGSSFWSFFNTWSEICFNGFDSDHRR  196

Query  1016  GMPQLSLPPVLDPWFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKE  837
               P    P +L  WF   I  P+ +P    +       T   ++E++F  +   I++LK 
Sbjct  197   KFP----PLLLRGWFLDGIEYPIRIPISETETPNRVVVTSSLIQEKIFRVTSRNISELKA  252

Query  836   KANSEMGTD--SISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYW  663
             KAN E+ ++   ISSLQ+  A +WR+I R   LNP E +   + +  R R NPPL +  +
Sbjct  253   KANGEVSSNDRKISSLQAVSAFMWRSIIRNSGLNPEEVIHCKLLVDMRRRLNPPLEKECF  312

Query  662   GNAIHSKLAKANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVF  483
             GN +          E+L  GLGWAA QI++ V  Q +EE  EF +NWVK P I       
Sbjct  313   GNMVGFATVTTTVAEMLNNGLGWAALQINKTVGSQTNEEFREFAENWVKKPSILNAKA--  370

Query  482   FANFLGIASSPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDIEVCLLPH  303
             F+N + IASSPR NVY  DFGWGKP+AVR G  N  +GK   +PG+E+G+++ + CL   
Sbjct  371   FSNCITIASSPRFNVYGNDFGWGKPIAVRAGPGNTTNGKLIAYPGIEEGNIEFQTCLSSS  430

Query  302   TLHTLGNDQEFMEFV  258
              L  L  D EF+++V
Sbjct  431   VLEKLSTDAEFLKYV  445



>gb|AES73322.2| HXXXD-type acyl-transferase family protein [Medicago truncatula]
Length=457

 Score =   243 bits (621),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 127/313 (41%), Positives = 184/313 (59%), Gaps = 10/313 (3%)
 Frame = -1

Query  1166  TSRKGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQ------  1005
              +  G +  LL +QVTEL DG FIG +MNH   D +++W+FFN+ SEI + +        
Sbjct  140   VNHDGHTMSLLSIQVTELLDGVFIGCSMNHAVGDGTAYWNFFNTLSEIFQKVVDVDVHIP  199

Query  1004  --LSLPPVLDPWFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKA  831
               +S  P+ + WFP      + LPF    E +   +  P L ER+FHFS + IAKLK KA
Sbjct  200   VPISHQPIHNRWFPEGYGPIINLPFKHHDEFIHR-YEAPILRERIFHFSAEFIAKLKAKA  258

Query  830   NSEMGTDSISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAI  651
             N E  T  ISS QS  A +WR+ITR RRL+  +  +  + I  R R  P LP+ Y+GN++
Sbjct  259   NKECETTKISSFQSLSALVWRSITRVRRLHHDQRTTCKLAINNRTRMEPSLPKEYFGNSV  318

Query  650   HSKLAKANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANF  471
             ++   +   GELL+ GLG A+W+IH  ++  DH  V +  + W++SP++ +   +     
Sbjct  319   YAVSTETTKGELLENGLGLASWKIHLAIAKYDHRVVRQLVEEWLRSPIVVRMDMLVDPYS  378

Query  470   LGIASSPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLE-KGSVDIEVCLLPHTLH  294
             + + SSPR N+Y ++FG GK + VR G  NK DGK + +PG E  GSVD+EVCL P  + 
Sbjct  379   VMMGSSPRFNMYGSEFGMGKALGVRSGYANKFDGKVTSYPGQEGGGSVDLEVCLSPEKMT  438

Query  293   TLGNDQEFMEFVT  255
              L  D+EFM  V+
Sbjct  439   LLETDEEFMNSVS  451



>ref|XP_011654124.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like isoform 
X4 [Cucumis sativus]
Length=456

 Score =   243 bits (621),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 133/307 (43%), Positives = 176/307 (57%), Gaps = 11/307 (4%)
 Frame = -1

Query  1154  GISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISR------GMPQLSLP  993
             G + PLL +QVTEL DG FI  + NH+  D +SFW+FFN WSEI +      G+  +S P
Sbjct  147   GHTLPLLSIQVTELLDGVFIACSFNHSLGDGTSFWNFFNMWSEIFQAHGDGDGVISISRP  206

Query  992   PVLDPWFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEMGT  813
             P+L+ WFP      + LP  +Q E     F  P L  R FHFS + IA LK KAN+E  T
Sbjct  207   PILERWFPDGYGPTINLPPFVQLE----QFEAPELRRRFFHFSAELIANLKAKANAECKT  262

Query  812   DSISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKLAK  633
               ISS QS  A +W+AITRAR +   +    ++ +  R R  P LPE Y GN I S    
Sbjct  263   KEISSFQSLSALVWKAITRARCIKQDQSTRCHMAVNYRGRLKPALPENYLGNMITSVKVD  322

Query  632   ANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIASS  453
             A AGEL++ GLGW AW++HE V+   +E + E  + W++ P   + S V     + I SS
Sbjct  323   AEAGELVETGLGWGAWKLHEAVTNITNEMIRESLEKWIQCPFTLRWSSVSNPCIVLITSS  382

Query  452   PRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLE-KGSVDIEVCLLPHTLHTLGNDQ  276
              R N+Y T FG GK + V  G  N  DGK   +PG E  GSVD+E+CL P T+  L +D 
Sbjct  383   SRFNMYGTKFGMGKAMGVLSGYGNTIDGKVVAYPGYEGGGSVDLEICLQPQTMANLESDL  442

Query  275   EFMEFVT  255
             EFM  ++
Sbjct  443   EFMNAIS  449



>ref|XP_003638160.1| Anthranilate N-hydroxycinnamoyl/benzoyltransferase [Medicago 
truncatula]
Length=451

 Score =   243 bits (621),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 134/315 (43%), Positives = 191/315 (61%), Gaps = 15/315 (5%)
 Frame = -1

Query  1157  KGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQLSLPPVLDP  978
             +G S PLL VQVTEL DG FIG A+NH   DA SFWHF NSW+EIS+G  + +  P    
Sbjct  137   EGTSQPLLAVQVTELIDGIFIGFAINHVGVDAKSFWHFINSWAEISQGFNKPTNIPSFKR  196

Query  977   WFPGNIARPLCLPF--DLQQETLSSSFTPPPLE---ERVFHFSKDTIAKLKEKANSEMGT  813
             WF  NI RP+  PF  + Q++  ++       E    R+FHFSK+ I +LK KAN+E+ +
Sbjct  197   WFSNNINRPIRFPFTKEAQKQPFTNEAQNQQCEVSSHRIFHFSKEQILQLKSKANAEISS  256

Query  812   DS------ISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAI  651
              +      ISSLQ+ ++H+WR I   + L P E  +  +PI  R R  P L + Y+G+ I
Sbjct  257   SNSSEKIIISSLQALLSHVWRLIISKQNLKPEERSAFVLPIDCRTRMCPKLEDNYFGSGI  316

Query  650   HSK-LAKANAGELLKRGLGWAAWQIHEVVSIQD-HEEVVEFYQNWVKSPVIAQKSKVFFA  477
              +        GEL++ G+G  A ++++V+SIQ  HE+VV  Y++W+K+P I +  +   +
Sbjct  317   GATGYVIMQVGELMESGIGKIAMEMNKVISIQSHHEKVVNNYESWLKTPSIPEAGRS-SS  375

Query  476   NFLGIASSPRNNVYATDFGWGKPVAVRCGMDNKAD-GKFSLFPGLEKGSVDIEVCLLPHT  300
             N L  +SSPR N Y  DFGWGKP+AVR G+  K + G+  +  G E+GSVDI+VCL    
Sbjct  376   NLLIASSSPRFNYYGNDFGWGKPIAVRNGVGLKRNIGRVIVLGGEEEGSVDIQVCLPYDI  435

Query  299   LHTLGNDQEFMEFVT  255
             L  +GND   M+ +T
Sbjct  436   LEAMGNDHLSMDAIT  450



>ref|XP_002871292.1| transferase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47551.1| transferase family protein, partial [Arabidopsis lyrata subsp. 
lyrata]
Length=456

 Score =   243 bits (621),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 135/306 (44%), Positives = 174/306 (57%), Gaps = 7/306 (2%)
 Frame = -1

Query  1166  TSRKGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQLSL---  996
              S  G +  L  V+VTEL DG FIGL++NH   D  + WHFFNS SEI       +L   
Sbjct  145   VSHDGHTMSLFSVKVTELVDGVFIGLSLNHAVGDGGTLWHFFNSLSEIFNAHETDNLLLK  204

Query  995   -PPVLDPWFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEM  819
              PPVL  WFP        LPF    E +S  F  P L+ER+FHFS +TI  LK KAN E 
Sbjct  205   NPPVLSRWFPKGYGPVYSLPFTHSDEFISR-FESPVLKERIFHFSSETITSLKSKANQEC  263

Query  818   GTDSISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKL  639
              T +ISS Q+  A +WR ITRAR+L    ++   +      + +PPLP  Y+GN I +  
Sbjct  264   RTTTISSFQALTAFIWRCITRARKLPYDHEIRCSLAANNGTKLDPPLPLSYFGNCISAIK  323

Query  638   AK-ANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGI  462
             +K   + ELL+  LGWAA ++H+ V     EEV    +NW+KS  +    K+  A  + I
Sbjct  324   SKTVTSSELLENDLGWAALKMHKAVIGNTSEEVSATIENWMKSSYVFHLEKLLGAMVVHI  383

Query  461   ASSPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLE-KGSVDIEVCLLPHTLHTLG  285
              SSPR  +Y  +FG GK VAVR G   K DGK S + G E  GS+D+EVCLLP  +  L 
Sbjct  384   GSSPRFKMYECEFGMGKAVAVRSGYGGKFDGKISAYAGREGGGSIDLEVCLLPEFMEALE  443

Query  284   NDQEFM  267
             +DQEFM
Sbjct  444   SDQEFM  449



>ref|XP_011654119.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Cucumis 
sativus]
 gb|KGN55212.1| hypothetical protein Csa_4G640980 [Cucumis sativus]
Length=460

 Score =   243 bits (621),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 129/309 (42%), Positives = 173/309 (56%), Gaps = 10/309 (3%)
 Frame = -1

Query  1154  GISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEI--------SRGMPQLS  999
             G + PLL +QVTEL DG FI  + NH   D +S W+FFN+WS++        S G+  +S
Sbjct  145   GQTLPLLSIQVTELLDGVFIACSFNHCLGDGTSIWNFFNTWSDVFQAPSSEDSYGINSIS  204

Query  998   LPPVLDPWFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEM  819
              PP+LD WFP      + +PF    + +S  F  P L  R FHFS  +IA LK KAN E 
Sbjct  205   QPPILDRWFPDGYDPVINIPFTDPSQFISR-FEVPELRRRFFHFSAKSIADLKAKANKEC  263

Query  818   GTDSISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKL  639
              T  ISS Q+  A +WRAITRARR+   +     +    R R  P LPE Y GN I S  
Sbjct  264   NTKDISSFQTLTALVWRAITRARRIPLDQSTCCVMSANYRGRLKPALPENYLGNMITSVK  323

Query  638   AKANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIA  459
               A  GEL++RGLGW A ++HE V    +E++ E  + W+K P   Q   +   N + + 
Sbjct  324   VDAKVGELVERGLGWGARKLHEAVKNLTYEKIRESLEEWIKCPYTYQWGSILNPNIIKMG  383

Query  458   SSPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLE-KGSVDIEVCLLPHTLHTLGN  282
                + NVY ++FG GK V VR G  N  DGK  ++PG E  GSVD+E+CLLP  +  L +
Sbjct  384   GWSKFNVYGSEFGMGKAVGVRSGYGNTFDGKVIVYPGCEGGGSVDLEICLLPQNMANLES  443

Query  281   DQEFMEFVT  255
             D E M  ++
Sbjct  444   DLELMNAIS  452



>ref|XP_004972478.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Setaria 
italica]
Length=491

 Score =   244 bits (622),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 143/318 (45%), Positives = 191/318 (60%), Gaps = 23/318 (7%)
 Frame = -1

Query  1148  STPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISR------GMPQLSL---  996
             S PL+ VQVTEL DG FIG+ +NH+A D ++FWHF N+WSEI R      G+    L   
Sbjct  160   SLPLVSVQVTELADGVFIGMTLNHSAGDGTAFWHFLNTWSEIHRRAGGGVGVSDDDLRDL  219

Query  995   ---PPVLDPWFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANS  825
                PPVL  WF      P+ +PF  + E +   F    ++E  F FS  ++ KLK +AN+
Sbjct  220   STPPPVLQRWFVETCPVPIPMPFS-KLEHIVKKFERTAVQECFFTFSAASVKKLKAQANA  278

Query  824   EM-GTD----SISSLQSYVAHLWRAITRARRLNPTEDVSIY-VPIGTRWRTNPPLPEGYW  663
             E+ GTD    +ISSLQ+ +AHLWRA+ RARRL P E V+ Y V +G R R N  +P GY 
Sbjct  279   EIAGTDTAAATISSLQAVLAHLWRAVCRARRL-PREQVTFYSVVVGCRGRVN-GIPPGYV  336

Query  662   GNAIHSKLAKANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVF  483
             GNA+    A A AGE+  +GLGW AW ++  V+  D   + E  ++WV+ P       + 
Sbjct  337   GNAMVFGKAVATAGEIDDKGLGWTAWLLNRAVASFDEASMRESLESWVRDPDFTYMGNLS  396

Query  482   FA-NFLGIASSPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLEK-GSVDIEVCLL  309
              A   L   SSPR +V+  DFGWGKPVA+R G  NKADGK ++F G E+ GS+ +EVC+ 
Sbjct  397   SAGTALVTGSSPRFDVFGNDFGWGKPVAIRSGAGNKADGKATVFEGPERGGSISLEVCIA  456

Query  308   PHTLHTLGNDQEFMEFVT  255
             P  L  L  D+EFM+ VT
Sbjct  457   PDALKRLVADEEFMDAVT  474



>ref|XP_011654123.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like isoform 
X3 [Cucumis sativus]
Length=458

 Score =   243 bits (619),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 133/309 (43%), Positives = 176/309 (57%), Gaps = 13/309 (4%)
 Frame = -1

Query  1154  GISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISR--------GMPQLS  999
             G + PLL +QVTEL DG FI  + NH+  D +SFW+FFN WSEI +        G+  +S
Sbjct  147   GHTLPLLSIQVTELLDGVFIACSFNHSLGDGTSFWNFFNMWSEIFQAQGDGDGDGVISIS  206

Query  998   LPPVLDPWFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEM  819
              PP+L+ WFP      + LP  +Q E     F  P L  R FHFS + IA LK KAN+E 
Sbjct  207   RPPILERWFPDGYGPTINLPPFVQLE----QFEAPELRRRFFHFSAELIANLKAKANAEC  262

Query  818   GTDSISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKL  639
              T  ISS QS  A +W+AITRAR +   +    ++ +  R R  P LPE Y GN I S  
Sbjct  263   KTKEISSFQSLSALVWKAITRARCIKQDQSTRCHMAVNYRGRLKPALPENYLGNMITSVK  322

Query  638   AKANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIA  459
               A AGEL++ GLGW AW++HE V+   +E + E  + W++ P   + S V     + I 
Sbjct  323   VDAEAGELVETGLGWGAWKLHEAVTNITNEMIRESLEKWIQCPFTLRWSSVSNPCIVLIT  382

Query  458   SSPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLE-KGSVDIEVCLLPHTLHTLGN  282
             SS R N+Y T FG GK + V  G  N  DGK   +PG E  GSVD+E+CL P T+  L +
Sbjct  383   SSSRFNMYGTKFGMGKAMGVLSGYGNTIDGKVVAYPGYEGGGSVDLEICLQPQTMANLES  442

Query  281   DQEFMEFVT  255
             D EFM  ++
Sbjct  443   DLEFMNAIS  451



>ref|XP_008452576.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Cucumis 
melo]
Length=462

 Score =   243 bits (619),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 130/309 (42%), Positives = 171/309 (55%), Gaps = 10/309 (3%)
 Frame = -1

Query  1154  GISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEI--------SRGMPQLS  999
             G + PLL +QVTEL D  FI  + NH   D +SFW+FFN WSEI           +  +S
Sbjct  146   GQTLPLLSIQVTELLDAVFIACSFNHCLGDGTSFWNFFNMWSEIFQAPSSEDGHAIISIS  205

Query  998   LPPVLDPWFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEM  819
              PP+L+ WFP      + LPF    + +S  F  P L  R FHFS  +IA LK KAN E 
Sbjct  206   QPPILERWFPDGYDPIINLPFTDPSQFISR-FEAPELRRRFFHFSAKSIADLKAKANEEC  264

Query  818   GTDSISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKL  639
              T  ISS Q+  A +WRAITRARR+   +     +    R R  P L E Y GN I S  
Sbjct  265   DTKDISSFQTLTALVWRAITRARRIPLDQSTCCMMSANYRRRLKPALRENYLGNMITSVK  324

Query  638   AKANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIA  459
             A A  GEL++R LGW AW++HE V    +E++ E  + W+K P   Q   +   N + + 
Sbjct  325   ADAKVGELVERRLGWGAWKLHEAVKNLTYEKIRESLEEWIKCPYTYQWGSILNPNIIKMG  384

Query  458   SSPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLE-KGSVDIEVCLLPHTLHTLGN  282
                R NVY ++FG GK V VR G  N  DGK  ++PG E  GS+D+E+CLLP  +  L +
Sbjct  385   GWSRFNVYGSEFGMGKAVGVRSGYGNTFDGKVIVYPGCEGGGSIDLEICLLPQNMANLES  444

Query  281   DQEFMEFVT  255
             D EFM  ++
Sbjct  445   DLEFMNAIS  453



>ref|XP_004972476.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Setaria 
italica]
Length=468

 Score =   243 bits (619),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 132/312 (42%), Positives = 190/312 (61%), Gaps = 15/312 (5%)
 Frame = -1

Query  1151  ISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISR------GMPQLSLPP  990
             +S P+L  QVTEL DG F+ +++NH  AD ++FWHFF++WSEISR      G    + PP
Sbjct  154   VSLPVLAAQVTELADGVFVAMSLNHGVADGTTFWHFFSTWSEISRSGSSDAGGELSTPPP  213

Query  989   VLDPWFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEM---  819
             VL+ WF    + P+ LPF  + E +      PP++E  F+FS +++ KLK +AN+EM   
Sbjct  214   VLERWFLETSSVPITLPFG-KLEDIVRRPEYPPVQECFFNFSAESVRKLKARANAEMAGT  272

Query  818   --GTDSISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHS  645
                T +ISSLQS +AH WRA+ RAR L P  + + ++ +G R R    +P  Y GN++ S
Sbjct  273   ATATSTISSLQSLLAHTWRAVCRARELAPERETTYFLLVGCRGRVK-GIPRDYVGNSVAS  331

Query  644   KLAKANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSP-VIAQKSKVFFANFL  468
              +A+  AGE++++GLGWAAW ++  V+  D   V +   +W + P  +  K     A  +
Sbjct  332   AVARWTAGEVVEKGLGWAAWLLNRAVASFDEATVRDNLASWPQDPKFLYVKPPGEAAAAI  391

Query  467   GIASSPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGL-EKGSVDIEVCLLPHTLHT  291
                SSPR +VY  DFGWG+PVAVR G  NK DGK +++ G    GS+ +EVCL P  L  
Sbjct  392   MTGSSPRFDVYGNDFGWGRPVAVRSGAGNKTDGKVTVYAGRGGAGSMALEVCLEPEVLAR  451

Query  290   LGNDQEFMEFVT  255
             L  D+EFME V+
Sbjct  452   LVADEEFMEAVS  463



>ref|XP_003603067.1| N-hydroxycinnamoyl/benzoyltransferase [Medicago truncatula]
 gb|AES73318.1| HXXXD-type acyl-transferase family protein [Medicago truncatula]
Length=456

 Score =   242 bits (617),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 129/304 (42%), Positives = 176/304 (58%), Gaps = 6/304 (2%)
 Frame = -1

Query  1166  TSRKGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQLSLP--  993
              S  G +  LL +QVTEL DG FIG +MNH   D + +W+FFNS+SEI +    + +P  
Sbjct  143   VSHDGHTMSLLTIQVTELLDGVFIGCSMNHCIGDGTGYWNFFNSFSEIFQNDIHVLVPIS  202

Query  992   --PVLDPWFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEM  819
               P+ + WFP      + LPF    E     +    L ER+FHFS ++I KLK KAN E 
Sbjct  203   HQPIHNRWFPQGYGPIINLPFK-HHEEFVHRYETSILRERIFHFSAESIMKLKAKANEES  261

Query  818   GTDSISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKL  639
              T  ISS QS  A +WR+ITRAR+L   +  +  +    R R  PPLP+ Y+GN++H+  
Sbjct  262   NTRKISSFQSLSALVWRSITRARQLQHGQRTTCKLATNNRTRMEPPLPKEYFGNSLHAVS  321

Query  638   AKANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIA  459
             A+   GELL+  LGWAAW+IH  V   D + V    + W +SP + +    F    + + 
Sbjct  322   AETTVGELLENDLGWAAWKIHLAVVNHDDKVVRRSVEEWFRSPFVYRTDLFFDPYTVMMG  381

Query  458   SSPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLE-KGSVDIEVCLLPHTLHTLGN  282
             SSPR N+Y  +FG GK +AVR G  NK DGK + +PG E  GS+D+EVCL P  +  L  
Sbjct  382   SSPRFNMYGNEFGMGKVLAVRSGYANKFDGKVTSYPGQEGGGSIDLEVCLSPEKMMALEA  441

Query  281   DQEF  270
             D+EF
Sbjct  442   DEEF  445



>ref|XP_006354858.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like isoform 
X1 [Solanum tuberosum]
Length=448

 Score =   241 bits (616),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 133/307 (43%), Positives = 183/307 (60%), Gaps = 9/307 (3%)
 Frame = -1

Query  1163  SRKGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEI---SRGMPQ---L  1002
             +  G    LL VQ+TEL DG FIGL++NH  AD SSFWHFFNS+SE+   + G  Q   +
Sbjct  140   NHDGHDLSLLTVQLTELIDGVFIGLSINHVLADGSSFWHFFNSFSEVFKANNGQKQSIPI  199

Query  1001  SLPPVLDPWFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSE  822
             S  P  + WFP      + LP+    +   S    P L ER FHFS +++ KLK KAN E
Sbjct  200   SKSPNFNHWFPEGHGPIINLPYT-HHDQFISRHESPNLRERFFHFSAESLKKLKAKANQE  258

Query  821   MGTDSISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSK  642
               T  ISSLQ+  AH+WR ITR R+       S  + I  R R  PPLPE Y+GN I + 
Sbjct  259   CHTSKISSLQALSAHMWRCITRVRKFPADHVTSCRMAINNRARLEPPLPENYFGNCIQTV  318

Query  641   LAKANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGI  462
                A+ G+LL+  LGWAAW++H+ V    ++E+ E+ +  ++  V+ Q         + I
Sbjct  319   RRNASVGKLLENNLGWAAWELHQAVVNHKNKEIREWVEK-LECGVVYQLGSFCDPCSIVI  377

Query  461   ASSPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLE-KGSVDIEVCLLPHTLHTLG  285
              SSPR ++Y  +FG+GK VA+R G  +K DGK SL+ G+E  GS+D+EVCLLP  + +L 
Sbjct  378   GSSPRFDMYGNEFGFGKGVALRSGYAHKFDGKVSLYEGIEGDGSMDLEVCLLPDFMASLE  437

Query  284   NDQEFME  264
              D+EFM+
Sbjct  438   TDKEFMD  444



>ref|XP_006280430.1| hypothetical protein CARUB_v10026362mg [Capsella rubella]
 gb|EOA13328.1| hypothetical protein CARUB_v10026362mg [Capsella rubella]
Length=462

 Score =   241 bits (616),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 130/308 (42%), Positives = 179/308 (58%), Gaps = 9/308 (3%)
 Frame = -1

Query  1154  GISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQ-------LSL  996
             G +  LL V+VTEL DG FIGL+MNH   D ++FW FF +WSEI +G+         L  
Sbjct  155   GHTMSLLSVKVTELVDGIFIGLSMNHAMGDGTAFWKFFTAWSEIFQGLESNKGDDLYLKN  214

Query  995   PPVLDPWFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEMG  816
             PP L  + P        LP+    E + + +  P L+ER+F FS +TI  LK K N   G
Sbjct  215   PPFLKRYIPEGYGPLFSLPYSHPDEFIRT-YESPVLKERMFRFSSETIKLLKAKVNQICG  273

Query  815   TDSISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKLA  636
             T SISS QS  A +WR ITRARRL   ++ S  V    R R +PPL + Y+GN + +   
Sbjct  274   TTSISSFQSLTAVIWRCITRARRLPVDQETSCRVAADNRGRMHPPLHKDYFGNCLAALRT  333

Query  635   KANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIAS  456
              A AGEL++  LGWAA +IH+ V+    E+V +    W+KSP +    ++F    + + S
Sbjct  334   AAKAGELMENDLGWAALKIHQAVAEHTSEKVSQMIDQWLKSPYLYHIDRLFEPLSVMMGS  393

Query  455   SPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLE-KGSVDIEVCLLPHTLHTLGND  279
             SPR N Y  +FG GK + +R G  +K DGK S +PG E  GS+D+EVCL+P  +  L +D
Sbjct  394   SPRFNKYGCEFGMGKGLTLRSGYAHKFDGKVSAYPGREGGGSIDLEVCLVPEFMDALESD  453

Query  278   QEFMEFVT  255
             +EFM  V+
Sbjct  454   EEFMSLVS  461



>ref|XP_004141266.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Cucumis 
sativus]
 gb|KGN55215.1| hypothetical protein Csa_4G641500 [Cucumis sativus]
Length=450

 Score =   241 bits (615),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 135/306 (44%), Positives = 184/306 (60%), Gaps = 7/306 (2%)
 Frame = -1

Query  1154  GISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEI----SRGMPQLSLPPV  987
             G S PLL +QVTEL DG FIG ++NH   D +S+W+FF   SEI    S     +S PPV
Sbjct  143   GHSLPLLSLQVTELLDGIFIGCSLNHAIGDGASYWNFFTMLSEIFQSPSPKHISISRPPV  202

Query  986   LDPWFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEMGT-D  810
             L  WFP      + LPF+L  E   + F  P   ER+FHFS ++IAKLK KAN++ G   
Sbjct  203   LKRWFPDGDGPIVNLPFNLP-EKFMNRFKGPKFRERIFHFSAESIAKLKAKANADCGARG  261

Query  809   SISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKLAKA  630
             +ISSLQS  A +WR+ITRARR++  +     +    R +  PPL E Y+GN        A
Sbjct  262   TISSLQSLTAFVWRSITRARRISEEQPTHCIMMANNRAKLEPPLSENYFGNVTKYLKVDA  321

Query  629   NAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIASSP  450
             NA EL+ + LGWAAW++H+VV    +++  E  +  ++S    Q  ++F  N + +ASSP
Sbjct  322   NAEELVGKELGWAAWKLHDVVVNNTNKKFRETIEERLQSIHTIQVGRIFEPNTVLMASSP  381

Query  449   RNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLE-KGSVDIEVCLLPHTLHTLGNDQE  273
             R N Y  +FG GK V +R G  NK DGK +++PG E  GSVD+E+CLLP  +  L +D E
Sbjct  382   RFNKYGVEFGMGKAVTLRSGYSNKWDGKVTIYPGHEGGGSVDLEICLLPQNMVNLESDFE  441

Query  272   FMEFVT  255
             FM  V+
Sbjct  442   FMVAVS  447



>ref|XP_003603062.1| N-hydroxycinnamoyl/benzoyltransferase [Medicago truncatula]
Length=754

 Score =   248 bits (633),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 132/309 (43%), Positives = 182/309 (59%), Gaps = 6/309 (2%)
 Frame = -1

Query  1163  SRKGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQ-----LS  999
             +  G + PLL +QVTEL DG FIG +MNH   D +SFW+FFN WSEI +   +     +S
Sbjct  152   NHDGHTMPLLSIQVTELGDGVFIGCSMNHCIGDGTSFWNFFNIWSEIYQAQAKDHDVLIS  211

Query  998   LPPVLDPWFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEM  819
               P  + WF       + LPF    E  S     P L+E+ FHFS ++IAKLK KAN E 
Sbjct  212   HQPFHNRWFLEGYGPLINLPFKHFNEFTSRFEAVPKLKEKFFHFSAESIAKLKAKANKES  271

Query  818   GTDSISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKL  639
              T+ ISS QS  A +WR++T ARRL   +  S  + I  R R  PPLP+ Y+GN++    
Sbjct  272   NTNEISSFQSLSAFVWRSVTCARRLKHDQKTSCKLAINNRSRIKPPLPQEYFGNSVDVVS  331

Query  638   AKANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIA  459
              +   GELL+  LGWAAW++H +V   D  EV E  + W++SPV+ Q  + F    + ++
Sbjct  332   TETTVGELLENDLGWAAWKVHTLVVNHDDREVREMLKKWLESPVVYQLGRHFDPFSVVMS  391

Query  458   SSPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLE-KGSVDIEVCLLPHTLHTLGN  282
             SSPR N+Y  +FG GK VAV  G  NK DG  + + G E  GS+D+ V LLP+ +  L +
Sbjct  392   SSPRFNMYGNEFGMGKAVAVLSGYANKFDGNVTAYEGFEGGGSMDLAVSLLPNAMSALES  451

Query  281   DQEFMEFVT  255
             D++FM  V+
Sbjct  452   DEDFMNAVS  460



>gb|KHN16923.1| BAHD acyltransferase DCR [Glycine soja]
Length=290

 Score =   236 bits (602),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 126/285 (44%), Positives = 172/285 (60%), Gaps = 9/285 (3%)
 Frame = -1

Query  1085  MNHTAADASSFWHFFNSWSEISRGMPQ-------LSLPPVLDPWFPGNIARPLCLPFDLQ  927
             MNHT  D +S+W+FFN+WS+I +   Q       +S  P+L+ WFP +    + LPF   
Sbjct  1     MNHTLGDGTSYWNFFNTWSQIFQSQAQGHEYNVPISHQPILNRWFPSDCDPSVNLPFKHH  60

Query  926   QETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEMGTDSISSLQSYVAHLWRAITRARR  747
              E + + F  P L ERVFHFS ++IAKLK KANSE  T  ISS QS  A +WR+IT AR 
Sbjct  61    DEFICN-FEAPFLRERVFHFSAESIAKLKAKANSESNTTKISSFQSLSALVWRSITLARS  119

Query  746   LNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKLAKANAGELLKRGLGWAAWQIHEVV  567
             +   +  S  + I  R R  PP+PE Y+GN +    A+    ELL+  LGWAAW +H  V
Sbjct  120   VPYEQKTSCKMAINNRSRMEPPMPEEYFGNLVQVVSAETTTRELLENDLGWAAWLLHVAV  179

Query  566   SIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIASSPRNNVYATDFGWGKPVAVRCGM  387
             +  + + V++  Q W +SP I Q  ++F    + + SSPR N Y  +FG GK VA+R G 
Sbjct  180   TNHNDKVVLQSLQGWSQSPFIPQIGRLFDPYSVLMGSSPRFNKYGCEFGMGKAVAIRSGY  239

Query  386   DNKADGKFSLFPGLE-KGSVDIEVCLLPHTLHTLGNDQEFMEFVT  255
              NK DGK + +PG E  GS+D+EVCLLPH +  L +D+EFM  V+
Sbjct  240   ANKFDGKVTSYPGREGGGSIDLEVCLLPHIMRALESDKEFMNAVS  284



>ref|XP_006354859.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like isoform 
X2 [Solanum tuberosum]
Length=447

 Score =   241 bits (614),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 135/307 (44%), Positives = 186/307 (61%), Gaps = 10/307 (3%)
 Frame = -1

Query  1163  SRKGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEI---SRGMPQ---L  1002
             +  G    LL VQ+TEL DG FIGL++NH  AD SSFWHFFNS+SE+   + G  Q   +
Sbjct  140   NHDGHDLSLLTVQLTELIDGVFIGLSINHVLADGSSFWHFFNSFSEVFKANNGQKQSIPI  199

Query  1001  SLPPVLDPWFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSE  822
             S  P  + WFP      + LP+    +   S    P L ER FHFS +++ KLK KAN E
Sbjct  200   SKSPNFNHWFPEGHGPIINLPYT-HHDQFISRHESPNLRERFFHFSAESLKKLKAKANQE  258

Query  821   MGTDSISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSK  642
               T  ISSLQ+  AH+WR ITR R+       S  + I  R R  PPLPE Y+GN I + 
Sbjct  259   CHTSKISSLQALSAHMWRCITRVRKFPADHVTSCRMAINNRARLEPPLPENYFGNCIQTV  318

Query  641   LAKANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGI  462
                A+AG+LL+  LGWAAW++HE V    ++++ E+ +  ++S +I Q    F  + + +
Sbjct  319   RGIASAGKLLENSLGWAAWEMHEAVVNHKNKDIREWVEK-LESGMIYQLG-FFDPSSVMM  376

Query  461   ASSPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLE-KGSVDIEVCLLPHTLHTLG  285
              SSPR ++Y  +FG GK VA+R G  +K DGK SL+ G+E  GS+D+EVCLLP  + +L 
Sbjct  377   GSSPRFDMYGNEFGLGKGVALRSGYAHKFDGKVSLYEGIEGDGSMDLEVCLLPDFMASLE  436

Query  284   NDQEFME  264
              D+EFM+
Sbjct  437   TDKEFMD  443



>ref|XP_006850491.2| PREDICTED: uncharacterized acetyltransferase At3g50280 [Amborella 
trichopoda]
Length=401

 Score =   239 bits (610),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 133/303 (44%), Positives = 175/303 (58%), Gaps = 9/303 (3%)
 Frame = -1

Query  1154  GISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQLSLPPVLDPW  975
             G++ PLL +QVTEL DG FIG + NH   D +S+W   N+ SE+ RG  ++S PPV + W
Sbjct  103   GMTLPLLAIQVTELVDGVFIGTSTNHALFDGTSYWMIVNALSELCRGAEKISRPPVSEQW  162

Query  974   FPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEMGTDS--IS  801
             FP  +  P+ LPF      L   FTPPPL+ERVFHFS  +IA LK KAN+    D+   S
Sbjct  163   FPYPV--PIKLPF---HPGLVDRFTPPPLKERVFHFSAASIAILKAKANATKDPDAPPFS  217

Query  800   SLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKLAKANAG  621
             S Q   AHLWR +TRAR+    E V   + +  R R  PP+P    GN I S  A   AG
Sbjct  218   SFQVLYAHLWRGVTRARKNPEGETVRCSLYVTYRQRVTPPMPANSIGNIIRSVYALTTAG  277

Query  620   ELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIASSPRNN  441
             ELL   L WAA  + +++S Q  +E  E      ++P +   S  F +  L + SSPR +
Sbjct  278   ELLSHNLAWAAGLLQKLISSQTDQESREGLAAQARNPHVTHLSS-FGSTHLLMGSSPRFD  336

Query  440   VYATDFGWGKPVAVRCGMDNKADGKFSLFPGLE-KGSVDIEVCLLPHTLHTLGNDQEFME  264
             +Y  DFGWGKP+  R G DN+ DGK    P  E  GS ++E+CLLP  +  L  D+EF+E
Sbjct  337   MYGNDFGWGKPIQARVGHDNRYDGKAFALPAPEGGGSTEVELCLLPEYMDALEVDEEFLE  396

Query  263   FVT  255
              VT
Sbjct  397   AVT  399



>ref|NP_199097.1| HXXXD-type acyl-transferase-like protein [Arabidopsis thaliana]
 dbj|BAB09184.1| N-hydroxycinnamoyl/benzoyltransferase-like protein [Arabidopsis 
thaliana]
 gb|AED94871.1| HXXXD-type acyl-transferase-like protein [Arabidopsis thaliana]
Length=450

 Score =   240 bits (613),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 132/308 (43%), Positives = 177/308 (57%), Gaps = 9/308 (3%)
 Frame = -1

Query  1154  GISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQ-------LSL  996
             G +  LL VQVTEL DG FIGL+MNH   D ++FW FF +WSEI +G          L  
Sbjct  143   GHTMSLLSVQVTELVDGIFIGLSMNHAMGDGTAFWKFFTAWSEIFQGQESNQNDDLCLKN  202

Query  995   PPVLDPWFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEMG  816
             PPVL  + P        LP+    E + + +  P L+ER+F FS +TI  LK + N   G
Sbjct  203   PPVLKRYIPEGYGPLFSLPYSHPDEFIRT-YESPILKERMFCFSSETIRMLKTRVNQICG  261

Query  815   TDSISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKLA  636
             T SISS QS  A +WR ITRARRL    + S  V    R R  PPL + Y+GN + +   
Sbjct  262   TTSISSFQSLTAVIWRCITRARRLPLDRETSCRVAADNRGRMYPPLHKDYFGNCLSALRT  321

Query  635   KANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIAS  456
              A AGELL+  LG+AA ++H+ V+    E+V +    W+KSP I    ++F    + + S
Sbjct  322   AAKAGELLENDLGFAALKVHQAVAEHTSEKVSQMIDQWLKSPYIYHIDRLFEPMSVMMGS  381

Query  455   SPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLE-KGSVDIEVCLLPHTLHTLGND  279
             SPR N Y  +FG GK V +R G  +K DGK S +PG E  GS+D+EVCL+P  +  L +D
Sbjct  382   SPRFNKYGCEFGLGKGVTLRSGYAHKFDGKVSAYPGREGGGSIDLEVCLVPEFMEALESD  441

Query  278   QEFMEFVT  255
             +EFM  V+
Sbjct  442   EEFMSLVS  449



>ref|NP_196403.1| HXXXD-type acyl-transferase family protein [Arabidopsis thaliana]
 emb|CAB62598.1| N-hydroxycinnamoyl/benzoyltransferase-like protein [Arabidopsis 
thaliana]
 dbj|BAB09950.1| N-hydroxycinnamoyl/benzoyltransferase-like protein [Arabidopsis 
thaliana]
 gb|AAL32752.1| N-hydroxycinnamoyl/benzoyltransferase-like protein [Arabidopsis 
thaliana]
 gb|AAN15449.1| N-hydroxycinnamoyl/benzoyltransferase-like protein [Arabidopsis 
thaliana]
 gb|AED91213.1| HXXXD-type acyl-transferase family protein [Arabidopsis thaliana]
Length=454

 Score =   240 bits (613),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 139/311 (45%), Positives = 183/311 (59%), Gaps = 18/311 (6%)
 Frame = -1

Query  1163  SRKGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQ------L  1002
             SR G +  LL V+VTEL DG FIGL+MNH+  D SSFWHFFNS SEI            L
Sbjct  147   SRDGDTMTLLSVKVTELVDGVFIGLSMNHSLGDGSSFWHFFNSLSEIFNSQEDNNKFLCL  206

Query  1001  SLPPVLDPWFPGNIARPL-CLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANS  825
               PP+        ++ P+  LPF    E++S S   P L+ER+FHFS +T+  LK KAN 
Sbjct  207   KNPPIFR-----EVSGPMYSLPFSEPDESISQS-ERPVLKERMFHFSSETVRSLKSKANE  260

Query  824   EMGTDSISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHS  645
             E GT  ISSLQS  A +WR+ITRAR+L   ++ +  +  G R R NPPLP  ++GN I  
Sbjct  261   ECGTTKISSLQSLTALIWRSITRARKLPNDQETTCRLAAGNRSRMNPPLPMNHFGNYISL  320

Query  644   KLAKANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFA-NFL  468
              +A    G+LL+   G AA ++H+ V+    E++      W+K+ +   K   FF+ N +
Sbjct  321   VIATTTTGDLLENEFGCAALKLHQAVTEHTGEKISADMDRWLKAHL---KLDGFFSPNIV  377

Query  467   GIASSPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLEKG-SVDIEVCLLPHTLHT  291
              + SSPR N Y ++FG GK VAVR G   K DGK S +PG E G S+D+EVCL P  +  
Sbjct  378   HMGSSPRFNKYGSEFGMGKAVAVRSGYGGKYDGKVSAYPGREGGASIDLEVCLPPECMEA  437

Query  290   LGNDQEFMEFV  258
             L  DQEFM  V
Sbjct  438   LELDQEFMSLV  448



>ref|NP_196402.1| HXXXD-type acyl-transferase-like protein [Arabidopsis thaliana]
 emb|CAB62597.1| proanthranilate N-benzoyltransferase-like protein [Arabidopsis 
thaliana]
 dbj|BAB09949.1| anthranilate N-hydroxycinnamoyl/benzoyltransferase-like protein 
[Arabidopsis thaliana]
 gb|AED91212.1| HXXXD-type acyl-transferase-like protein [Arabidopsis thaliana]
Length=456

 Score =   240 bits (613),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 135/310 (44%), Positives = 173/310 (56%), Gaps = 7/310 (2%)
 Frame = -1

Query  1166  TSRKGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQLSL---  996
              S  G +  L  V+VTEL DG FIG ++NH   D  S WHFFNS SEI       +L   
Sbjct  145   VSHDGHTMSLFSVKVTELVDGVFIGFSLNHAVGDGGSLWHFFNSLSEIFNAQETDNLLLK  204

Query  995   -PPVLDPWFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEM  819
              PPVL  WFP        LPF    E +S  F  P L+ER+FHFS +TI  LK KAN E 
Sbjct  205   NPPVLSRWFPKGYGPVYNLPFTHSDEFISR-FESPVLKERIFHFSSETITSLKSKANEES  263

Query  818   GTDSISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKL  639
              T +ISS Q+  A +WR ITRAR L    ++   +      + +PPL   Y GN + +  
Sbjct  264   RTTTISSFQALAAFMWRCITRARNLPYDHEIRCSLAANNGTKLDPPLSLSYLGNCLSAVK  323

Query  638   AK-ANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGI  462
             +K   +GELL+  LGWAA ++HE V     E V E  +NW+KS  +    K+  A  + I
Sbjct  324   SKTVTSGELLENDLGWAALKMHEAVIGNTSEVVSETIKNWLKSSYVFHLEKLLGAMVVHI  383

Query  461   ASSPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLE-KGSVDIEVCLLPHTLHTLG  285
              SSPR  +Y  +FG GK VAVR G   K DGK S + G E  G++D+EVCLLP  +  L 
Sbjct  384   GSSPRFKMYECEFGMGKAVAVRSGYGGKFDGKISAYAGREGGGTIDLEVCLLPEFMEALE  443

Query  284   NDQEFMEFVT  255
             +DQEFM  V+
Sbjct  444   SDQEFMSVVS  453



>ref|XP_006659752.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Oryza 
brachyantha]
Length=462

 Score =   240 bits (613),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 135/309 (44%), Positives = 180/309 (58%), Gaps = 14/309 (5%)
 Frame = -1

Query  1148  STPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISR----GMPQLSLPP-VL  984
             S P+L  QVTEL DG F+ L++NH  AD  SFWHFF++WSEISR       +LS PP V 
Sbjct  153   SRPVLAAQVTELADGMFVALSLNHGVADGFSFWHFFHTWSEISRSGDDAERELSTPPPVF  212

Query  983   DPWFPGNIARPLCLPF-DLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEMG---  816
             D WF      P+ LPF  L        +TP  ++E   H S +++  LKEKAN+EM    
Sbjct  213   DRWFAYGSPVPIPLPFAKLDDMIRRPVYTP--VDECFLHLSAESVRALKEKANAEMAGAA  270

Query  815   TDSISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKLA  636
             T +ISSLQS +AH+WRA+ RARR+ P  +    + +G R R    +P+ Y GN +    A
Sbjct  271   TATISSLQSVLAHVWRAVCRARRVAPELEAHYGISVGWRARLKE-VPQEYMGNTVAGASA  329

Query  635   KANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSP--VIAQKSKVFFANFLGI  462
             KA  GE+L +GLGW AWQ++  V+  D   V      W + P  ++    +   A  LGI
Sbjct  330   KATVGEILGKGLGWTAWQLNRAVASTDEGSVRRMVAAWPEKPSFMMVNALQRRPAGALGI  389

Query  461   ASSPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDIEVCLLPHTLHTLGN  282
             + SPR +VY  DFGWG+PV VR G  NK DGK +++ G   GS+ +E+CL P  L  L  
Sbjct  390   SGSPRFDVYGNDFGWGRPVGVRSGGGNKLDGKMTVYEGRGGGSMALEICLEPAALARLVA  449

Query  281   DQEFMEFVT  255
             D+EFM  VT
Sbjct  450   DEEFMGAVT  458



>ref|XP_008452578.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Cucumis 
melo]
Length=459

 Score =   240 bits (612),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 132/308 (43%), Positives = 179/308 (58%), Gaps = 12/308 (4%)
 Frame = -1

Query  1154  GISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRG------MPQLSLP  993
             G + PLL +QVTEL DG FI  + NH+  D +SFW+FFN WSEI +       +  +S P
Sbjct  147   GRTLPLLSIQVTELLDGVFIASSFNHSLGDGTSFWNFFNMWSEIFQAHGDGDEVISISRP  206

Query  992   PVLDPWFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEMGT  813
             P+L+ WFP      + LP  +      + F  P L  R FHFS ++IA LK KAN+E  T
Sbjct  207   PILERWFPDGYGPTINLPPFVHL----NEFEAPELRRRFFHFSAESIANLKAKANAECKT  262

Query  812   DSISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKLAK  633
               ISS QS  A +W+AITRAR +   +  S  + +  R R  P LPE Y GN I S  A 
Sbjct  263   KEISSFQSLSALVWKAITRARCIKQDQITSCRMAVNYRGRLKPALPENYLGNMITSVKAD  322

Query  632   ANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIASS  453
             A AG+L++RGLGW A ++HE V+   +E++ E  + WV+ P   Q S V     + ++SS
Sbjct  323   AKAGDLVERGLGWGAQKLHEAVTNITNEKIRESLEKWVQCPCTHQLSSVSNPYNVLMSSS  382

Query  452   PRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGL--EKGSVDIEVCLLPHTLHTLGND  279
             PR N+Y   FG GK + VR G  N  +GK + +PG   E GSVD+E+CL P T+  L  D
Sbjct  383   PRFNMYGNKFGMGKAMGVRSGYANTMEGKVTAYPGNEGEGGSVDLEICLQPQTMANLEFD  442

Query  278   QEFMEFVT  255
              EFM  ++
Sbjct  443   LEFMNAIS  450



>ref|XP_006354860.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like isoform 
X3 [Solanum tuberosum]
Length=457

 Score =   239 bits (611),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 136/313 (43%), Positives = 186/313 (59%), Gaps = 18/313 (6%)
 Frame = -1

Query  1154  GISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEI---SRGMPQ---LSLP  993
             G    LL VQ+TEL DG FIGL++NH  AD SSFWHFFNS+SE+   + G  Q   +S  
Sbjct  143   GHDLSLLTVQLTELIDGVFIGLSINHVLADGSSFWHFFNSFSEVFKANNGQKQSIPISKS  202

Query  992   PVLDPWFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEMGT  813
             P  + WFP      + LP+    +   S    P L ER FHFS +++ KLK KAN E  T
Sbjct  203   PNFNHWFPEGHGPIINLPYT-HHDQFISRHESPNLRERFFHFSAESLKKLKAKANQECHT  261

Query  812   DSISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKLAK  633
               ISSLQ+  AH+WR ITR R+       S  + I  R R  PPLPE Y+GN I +    
Sbjct  262   SKISSLQALSAHMWRCITRVRKFPADHVTSCRMAINNRARLEPPLPENYFGNCIQTVRRN  321

Query  632   ANAGELLKRGLGWAAWQIHEVVSIQDHEEV------VEFYQNWV---KSPVIAQKSKVFF  480
             A+ G+LL+  LGWAAW++H+ V    ++E+      +E+ + WV   +S +I Q    F 
Sbjct  322   ASVGKLLENNLGWAAWELHQAVVNHKNKEIREWVEKLEYIREWVEKLESGMIYQLG-FFD  380

Query  479   ANFLGIASSPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLE-KGSVDIEVCLLPH  303
              + + + SSPR ++Y  +FG GK VA+R G  +K DGK SL+ G+E  GS+D+EVCLLP 
Sbjct  381   PSSVMMGSSPRFDMYGNEFGLGKGVALRSGYAHKFDGKVSLYEGIEGDGSMDLEVCLLPD  440

Query  302   TLHTLGNDQEFME  264
              + +L  D+EFM+
Sbjct  441   FMASLETDKEFMD  453



>ref|XP_004238137.1| PREDICTED: uncharacterized acetyltransferase At3g50280 [Solanum 
lycopersicum]
Length=470

 Score =   240 bits (612),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 134/307 (44%), Positives = 186/307 (61%), Gaps = 10/307 (3%)
 Frame = -1

Query  1163  SRKGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEI---SRGMPQL---  1002
             +  G    LL VQ+TEL DG FIGL++NH  AD SSFWHFFNS+S++   + G  Q+   
Sbjct  163   NHDGHDLSLLTVQLTELIDGVFIGLSINHVLADGSSFWHFFNSFSQVFKANNGQKQIIPI  222

Query  1001  SLPPVLDPWFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSE  822
             S  P  + WFP      + LP+    +   S    P L ER FHFS + + KLK KAN E
Sbjct  223   SKSPNFNHWFPEGHGPIINLPYT-HHDQFISRHESPILRERFFHFSSECLKKLKAKANEE  281

Query  821   MGTDSISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSK  642
               T  ISSLQ+  AH+WR ITR R+       S  + I  R R +PPLPE Y+GN I + 
Sbjct  282   CHTSKISSLQALSAHMWRCITRVRKFPADHITSCRMAINNRARLDPPLPENYFGNCIQTV  341

Query  641   LAKANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGI  462
                A+AG+LL+  LGWAAW++HE V    ++++ E+ +  ++S +I Q    F  + + +
Sbjct  342   RGIASAGKLLENSLGWAAWEMHEAVVNHKNKDIREWVEK-LESGMIYQLG-FFDPSSIMM  399

Query  461   ASSPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLE-KGSVDIEVCLLPHTLHTLG  285
              SSPR ++Y  +FG GK VA+R G  +K DGK SL+ G+E  GS+D+EVCLLP  + +L 
Sbjct  400   GSSPRFDMYGNEFGLGKGVALRSGYAHKFDGKVSLYEGIEGDGSMDLEVCLLPDFMASLE  459

Query  284   NDQEFME  264
              D+EFM+
Sbjct  460   TDKEFMD  466



>emb|CDY12811.1| BnaC07g16220D [Brassica napus]
Length=473

 Score =   240 bits (612),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 133/305 (44%), Positives = 179/305 (59%), Gaps = 7/305 (2%)
 Frame = -1

Query  1163  SRKGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEI-SRGMPQ-LSLPP  990
             S +G S  L+  QVTEL DG FI    NH  AD SSFW FFN+WSEI S G+ +    PP
Sbjct  166   SCEGTSESLIAFQVTELRDGVFIAFGYNHMVADGSSFWSFFNTWSEICSTGVDRNKKFPP  225

Query  989   VL-DPWFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEMGT  813
             +L   WF   I  P+ +P        S   +   L+E++F F++  I++LK KAN E+ +
Sbjct  226   LLLRGWFLDGIDHPIRIPISETVPPSSPVASSSLLQEKLFRFTRRNISELKSKANGEVSS  285

Query  812   DS--ISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKL  639
             D   ISSLQ+  AH+WR+I +   LNP E V   + +  R R NPPL +  +GN +    
Sbjct  286   DDRKISSLQAIAAHMWRSIIKNSDLNPEEVVYCKLLMDMRRRLNPPLDKECFGNVVGFAT  345

Query  638   AKANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIA  459
             A   AGE++  GLGWAA QI++ V  Q  E    F  NWVK P I     V  +N + +A
Sbjct  346   ATTTAGEMVSNGLGWAALQINKTVGSQTDEGFRMFAGNWVKEPKIPNHVAV--SNSVIVA  403

Query  458   SSPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDIEVCLLPHTLHTLGND  279
             SSP  NVY  DFGWGKP+AVR G  N +DGK  ++PG+E+G+++I+ CL  H L  +  D
Sbjct  404   SSPWFNVYGNDFGWGKPIAVRAGPGNTSDGKLIVYPGIEEGNIEIQTCLSSHVLKKISAD  463

Query  278   QEFME  264
              EF+E
Sbjct  464   AEFLE  468



>gb|ERN12072.1| hypothetical protein AMTR_s00035p00187610 [Amborella trichopoda]
Length=441

 Score =   239 bits (610),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 133/303 (44%), Positives = 175/303 (58%), Gaps = 9/303 (3%)
 Frame = -1

Query  1154  GISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQLSLPPVLDPW  975
             G++ PLL +QVTEL DG FIG + NH   D +S+W   N+ SE+ RG  ++S PPV + W
Sbjct  143   GMTLPLLAIQVTELVDGVFIGTSTNHALFDGTSYWMIVNALSELCRGAEKISRPPVSEQW  202

Query  974   FPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEMGTDS--IS  801
             FP  +  P+ LPF      L   FTPPPL+ERVFHFS  +IA LK KAN+    D+   S
Sbjct  203   FPYPV--PIKLPF---HPGLVDRFTPPPLKERVFHFSAASIAILKAKANATKDPDAPPFS  257

Query  800   SLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKLAKANAG  621
             S Q   AHLWR +TRAR+    E V   + +  R R  PP+P    GN I S  A   AG
Sbjct  258   SFQVLYAHLWRGVTRARKNPEGETVRCSLYVTYRQRVTPPMPANSIGNIIRSVYALTTAG  317

Query  620   ELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGIASSPRNN  441
             ELL   L WAA  + +++S Q  +E  E      ++P +   S  F +  L + SSPR +
Sbjct  318   ELLSHNLAWAAGLLQKLISSQTDQESREGLAAQARNPHVTHLSS-FGSTHLLMGSSPRFD  376

Query  440   VYATDFGWGKPVAVRCGMDNKADGKFSLFPGLE-KGSVDIEVCLLPHTLHTLGNDQEFME  264
             +Y  DFGWGKP+  R G DN+ DGK    P  E  GS ++E+CLLP  +  L  D+EF+E
Sbjct  377   MYGNDFGWGKPIQARVGHDNRYDGKAFALPAPEGGGSTEVELCLLPEYMDALEVDEEFLE  436

Query  263   FVT  255
              VT
Sbjct  437   AVT  439



>ref|XP_003571295.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Brachypodium 
distachyon]
Length=465

 Score =   239 bits (611),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 131/314 (42%), Positives = 183/314 (58%), Gaps = 17/314 (5%)
 Frame = -1

Query  1148  STPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISR----------GMPQLS  999
             S P+L VQ TELDDG F+ +++NH  AD ++FWHFFN+WSEISR          G    S
Sbjct  149   SLPVLAVQATELDDGVFLAMSLNHGVADGTTFWHFFNTWSEISRRSGNHDAAAIGCEIAS  208

Query  998   LPPVLDPWFPGNIARPLCLPFDLQQETLSSSFTP-PPLEERVFHFSKDTIAKLKEKANSE  822
               P+L  WFP     P+ LPFD  ++ +       P ++E  F FS +++ +LK KAN+E
Sbjct  209   PLPLLQRWFPEGCPIPIPLPFDKPEDIVGEQRAKYPSVQECFFRFSAESVKELKAKANAE  268

Query  821   MGT--DSISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIH  648
             M     +ISSLQ+  AH+WRA+ RARRL   +DV+  + +G R R    +P  Y GNA+ 
Sbjct  269   MAGAPATISSLQALFAHMWRAVCRARRLARDQDVTYIILVGCRGRLE-SMPSAYMGNAVS  327

Query  647   SKLAKANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSP--VIAQKSKVFFAN  474
               +A++ AGE+L +GLGWA W ++  V+  +         +W ++P  V    S +    
Sbjct  328   LIMARSTAGEILDKGLGWAGWLLNRAVASFNMASATAETASWPRNPGFVRPLASVLDGQP  387

Query  473   FLGIASSPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLE-KGSVDIEVCLLPHTL  297
              L   SSPR ++Y  DFGWG PV VR G  NK DGK +++ G E  GS+ +EVCL P  L
Sbjct  388   KLSTGSSPRFDIYGNDFGWGSPVTVRSGSANKVDGKMTVYEGGEGAGSMALEVCLAPEAL  447

Query  296   HTLGNDQEFMEFVT  255
               L  DQEFM+ V+
Sbjct  448   ARLVADQEFMDVVS  461



>ref|XP_009103449.1| PREDICTED: uncharacterized acetyltransferase At3g50280 [Brassica 
rapa]
Length=445

 Score =   239 bits (610),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 137/309 (44%), Positives = 182/309 (59%), Gaps = 13/309 (4%)
 Frame = -1

Query  1163  SRKGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEI-SRGMP--QLSLP  993
             S +G+S  L+  QVTEL DG FI    NH  AD SSFW FFN+WSEI S G+   + S P
Sbjct  136   SCEGVSESLIAFQVTELRDGVFIAFGYNHMVADGSSFWSFFNTWSEICSTGVDRDKKSPP  195

Query  992   PVLDPWFPGNIARPLCLPFDLQQETL----SSSFTPPPLEERVFHFSKDTIAKLKEKANS  825
              +L  WF   I  P+ +P     ET+      + +   L E+VF F++  I++LK KAN 
Sbjct  196   LLLRGWFLDGIDHPIRIPI---SETVIPSPPVASSSSLLREKVFRFTRRNISELKSKANG  252

Query  824   EMGTDS--ISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAI  651
             E+ +D   ISSLQ+  AH+WR+I R   LNP E V   + +  R R NPPL +  +GN +
Sbjct  253   EVSSDDRRISSLQAVSAHMWRSIIRNSDLNPEEVVYCKLLMDMRRRLNPPLDKECFGNVV  312

Query  650   HSKLAKANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANF  471
                 A   AGE++  GLGWAA QI++ V  Q  E    F  NWVK P I     V  +N 
Sbjct  313   GFPTAMTTAGEMVSNGLGWAALQINKTVGAQRDEGFRVFAGNWVKEPKIPNHVAVS-SNS  371

Query  470   LGIASSPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDIEVCLLPHTLHT  291
             + +ASSP  NVY  DFGWGKP+AVR G  N +DGK  ++PG+E+G+++I+ CL  H L  
Sbjct  372   VIVASSPWFNVYGNDFGWGKPIAVRAGPGNTSDGKLIVYPGIEEGNIEIQTCLSSHVLEK  431

Query  290   LGNDQEFME  264
             L  D EF+E
Sbjct  432   LSADAEFLE  440



>ref|XP_003566996.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Brachypodium 
distachyon]
Length=463

 Score =   239 bits (611),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 134/310 (43%), Positives = 179/310 (58%), Gaps = 13/310 (4%)
 Frame = -1

Query  1148  STPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMPQLS--LPPVLDPW  975
             S PLL  QVTEL DG F+G++MNH+A D ++FW FFN+WSEI+R   ++S   P     W
Sbjct  152   SLPLLSAQVTELADGVFVGVSMNHSAGDGTAFWEFFNAWSEINRRGNEMSSRRPVQQQRW  211

Query  974   FPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEM------GT  813
             F G    P+ +PF   Q  +     P  + E  F FS  +I KLK +AN E+      G 
Sbjct  212   FTGTSPVPIAMPFSKLQHVVQRFQRPAAVAECFFTFSGASIKKLKARANDEIEMAGGAGA  271

Query  812   DSISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKLAK  633
               ISSLQ+ +AHLWRA+ RAR   P ++ S  + +G R R    +PE Y GNA+    A+
Sbjct  272   IIISSLQALLAHLWRAVCRARLARPEQETSYSMLVGCRGRVT-GIPEDYMGNAVTFGKAR  330

Query  632   ANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFAN-FLGIAS  456
             + AGE++  GLGWAA Q++ VV+  D   V E+   W   P      +V      L   S
Sbjct  331   STAGEIMGNGLGWAALQLNRVVASFDEASVREWLGRWAADPRFVYNGEVSSGGTALATGS  390

Query  455   SPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLE---KGSVDIEVCLLPHTLHTLG  285
             SPR +V+  DFGWGKPVAVR G  NK DGK ++F G E   +GS+ +EVC+ P  L  L 
Sbjct  391   SPRFDVFGNDFGWGKPVAVRSGSGNKIDGKATVFQGPEEQGEGSMSLEVCVAPDVLDRLV  450

Query  284   NDQEFMEFVT  255
             ND EFM+ V+
Sbjct  451   NDLEFMDAVS  460



>ref|XP_006280460.1| hypothetical protein CARUB_v10026392mg [Capsella rubella]
 gb|EOA13358.1| hypothetical protein CARUB_v10026392mg [Capsella rubella]
Length=449

 Score =   239 bits (610),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 132/315 (42%), Positives = 175/315 (56%), Gaps = 17/315 (5%)
 Frame = -1

Query  1169  TTSRKGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEIS---------R  1017
              TS +GIS  L+  QVTEL DG FIG   NH  AD SSFW FFNSWSEI          R
Sbjct  138   VTSCEGISDSLIAFQVTELKDGVFIGFGYNHIVADGSSFWSFFNSWSEICFNGFDPHHRR  197

Query  1016  GMPQLSLPPVLDPWFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKE  837
               P    P +L  WF   I  P+ +P            T   ++E++F F+   +++LK 
Sbjct  198   KFP----PLLLRGWFLDGIEYPIRIPTSETDTPNRVVVTSSLIQEKIFRFTSGNVSELKA  253

Query  836   KANSEMGTDS--ISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYW  663
             KAN E+  D   ISSLQ+  A++WR+I R   L+P E +   + +  R R +PPL +  +
Sbjct  254   KANGEVSVDDRKISSLQAVSAYMWRSIIRNSELSPEEVIHCKLLVDMRQRLDPPLKKECF  313

Query  662   GNAIHSKLAKANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVF  483
             GN +    A     E+L  GLGWAA QI+  V  Q +E+V EF  +WVK P I     + 
Sbjct  314   GNMVGFATATTTVAEMLNNGLGWAALQINTSVGSQTNEKVREFAADWVKRPSIMNVKAL-  372

Query  482   FANFLGIASSPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDIEVCLLPH  303
              +N + IASSPR NVY  DFGWGKP+AVR G  N  DGK   +PG E+G+++I+ CL   
Sbjct  373   -SNSIVIASSPRFNVYGNDFGWGKPIAVRAGPGNTCDGKLIAYPGTEQGNIEIQTCLSST  431

Query  302   TLHTLGNDQEFMEFV  258
              L  L  D EF++ V
Sbjct  432   VLEKLSTDVEFLKHV  446



>ref|XP_010558666.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Tarenaya 
hassleriana]
Length=466

 Score =   239 bits (611),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 134/315 (43%), Positives = 189/315 (60%), Gaps = 12/315 (4%)
 Frame = -1

Query  1169  TTSRKGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEIS-RGMP---QL  1002
             T S +G+S  LL VQVTE++DG FIG   NH  AD SSFW FFN+WSEI  +G+    + 
Sbjct  152   TRSYEGVSESLLAVQVTEMEDGVFIGFGYNHMVADGSSFWKFFNTWSEICLKGLHSDHRK  211

Query  1001  SLPPVL-DPWFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANS  825
             SLPP+L   WF   I  P+ +P    +       + P L+E+VF F+K+ I++LK KAN+
Sbjct  212   SLPPILLKGWFLDGIDPPIHIPISETKPPTRGISSSPTLQEKVFRFTKENISQLKAKANN  271

Query  824   EMGTDS--ISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAI  651
             E+G+++  ISSLQ+   H+WR+I R   LN  ++V   +    R R NPPL    +GN +
Sbjct  272   EIGSNAEKISSLQAISGHMWRSIIRNSGLNRDQEVQCNLLANMRQRLNPPLETECFGNVV  331

Query  650   HSKLAKANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKS---PVIAQKSKVFF  480
                  +   GEL+   L WAA QI+++V    +E +  F + WVK+   P I        
Sbjct  332   CFGTTRTTVGELMDHDLCWAALQINKMVGSITNENLRNFAEKWVKNVEFPNIGGGG--IP  389

Query  479   ANFLGIASSPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDIEVCLLPHT  300
             +N L +ASSPR NVY  DFGWGKP++VR G  N +DGK  ++PG ++ S+DI++CL  + 
Sbjct  390   SNPLLVASSPRFNVYGNDFGWGKPISVRAGPGNTSDGKAIVYPGTQEASIDIQLCLSSNV  449

Query  299   LHTLGNDQEFMEFVT  255
             L  L  D EF+E VT
Sbjct  450   LAKLLTDAEFLESVT  464



>ref|XP_004972479.1| PREDICTED: uncharacterized acetyltransferase At3g50280-like [Setaria 
italica]
Length=468

 Score =   239 bits (611),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 131/312 (42%), Positives = 187/312 (60%), Gaps = 15/312 (5%)
 Frame = -1

Query  1151  ISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISR------GMPQLSLPP  990
             +S P+L  QVTEL DG F+ +++NH  AD ++FWHFF++WSEISR      G    + PP
Sbjct  154   VSLPVLAAQVTELADGVFVAMSLNHGVADGATFWHFFSTWSEISRSGSSDAGGELSTPPP  213

Query  989   VLDPWFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEM---  819
             VL+ WF    + P+ LPF  + E +      PP++E  F+FS +++ KLK +AN+EM   
Sbjct  214   VLERWFLETSSVPITLPFG-KLEDIVRRPEYPPVQECFFNFSAESVRKLKARANAEMAGT  272

Query  818   --GTDSISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHS  645
                T +ISSLQS +AH WRA+ RAR L P  + +  + +G R R    +P  Y GN +  
Sbjct  273   ATATSTISSLQSLLAHTWRAVCRARELAPERETTYTLLVGCRGRMK-GIPRDYVGNTVAF  331

Query  644   KLAKANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSP-VIAQKSKVFFANFL  468
              +A+  AGE++++GLGWAAW ++  V+  D   V +   +W + P  +  K     A  +
Sbjct  332   AVARCTAGEVVEKGLGWAAWLMNRAVASFDEATVRDDLASWPQDPRFLYVKPPREAAATI  391

Query  467   GIASSPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGL-EKGSVDIEVCLLPHTLHT  291
                SSPR +VY  DFGWG+PVAVR G  NK DGK +++ G    GS+ +EVCL P  L  
Sbjct  392   ITGSSPRFDVYGNDFGWGRPVAVRSGAGNKTDGKVTVYAGRGGAGSMALEVCLEPEVLAR  451

Query  290   LGNDQEFMEFVT  255
             L  D+EFME V+
Sbjct  452   LVADEEFMEAVS  463



>ref|NP_001143242.1| uncharacterized protein LOC100275767 [Zea mays]
 gb|ACG30097.1| hypothetical protein [Zea mays]
 gb|AFW61422.1| hypothetical protein ZEAMMB73_089688 [Zea mays]
Length=480

 Score =   240 bits (612),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 137/305 (45%), Positives = 180/305 (59%), Gaps = 11/305 (4%)
 Frame = -1

Query  1142  PLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISR---GMPQLSL-PPVLDPW  975
             P+L  QVT L D  FIG+ +NH+  D ++FWHFFN+WSEI+R   G   LS  PPV   W
Sbjct  167   PVLAAQVTVLADSVFIGMTLNHSVGDGTAFWHFFNTWSEINRATGGGADLSTPPPVFGRW  226

Query  974   FPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSEM---GTDSI  804
             FP     P+ LPF  + E +   F    ++E  F FS  ++ KLK +AN EM    T +I
Sbjct  227   FPEACPVPIPLPFR-RLEDIVRRFERTEVKECFFTFSAASVRKLKARANDEMAGSATATI  285

Query  803   SSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSKLAKANA  624
             SSLQS +AHLWRA+ RARRL P       V +G R R +  +P GY GNA+    A+A A
Sbjct  286   SSLQSVLAHLWRAVCRARRLPPEHGTFYSVVVGCRGRVD-GVPPGYVGNAMVFGRAEATA  344

Query  623   GELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFA-NFLGIASSPR  447
             GE+ ++GLGW AW ++  V+  D   V E  + WV  P       +  A   L   SSPR
Sbjct  345   GEIEEKGLGWTAWLLNRAVASFDEAAVRESLERWVGEPDFTYMDNLSSAGTALVTGSSPR  404

Query  446   NNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLEK-GSVDIEVCLLPHTLHTLGNDQEF  270
              +V+  DFGWGKP+AVR G  NKADGK ++F G E+ GS+ +EVC+ P  L  L  D EF
Sbjct  405   FDVFGNDFGWGKPLAVRSGSGNKADGKATVFEGPERGGSISLEVCIAPDALQRLVADHEF  464

Query  269   MEFVT  255
             M+ V+
Sbjct  465   MDAVS  469



>ref|XP_006399269.1| hypothetical protein EUTSA_v10013445mg [Eutrema salsugineum]
 gb|ESQ40722.1| hypothetical protein EUTSA_v10013445mg [Eutrema salsugineum]
Length=471

 Score =   239 bits (611),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 130/306 (42%), Positives = 175/306 (57%), Gaps = 15/306 (5%)
 Frame = -1

Query  1154  GISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEI--------SRGMPQLS  999
             G +  LL V+VTEL DG FIG++MNH+  D SSFW FFNS SEI              L 
Sbjct  163   GQTMSLLSVKVTELVDGVFIGMSMNHSIGDGSSFWQFFNSLSEIFNSEEDTTHNKFSCLK  222

Query  998   LPPVLDPWFPGNIARPLC-LPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANSE  822
              PP+    +      P+C LPF    +++S+ F  P L+ R+FHFS +T+  LK KAN E
Sbjct  223   NPPIFREAYG-----PICRLPFSPLDQSISTRFESPVLKVRMFHFSSETVRSLKSKANQE  277

Query  821   MGTDSISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHSK  642
              GT  ISSLQS  A +WR+ITRAR++   ++ +  +  G R R NPPLP  ++G  +   
Sbjct  278   CGTTKISSLQSLTAFIWRSITRARKVPNDQETTCRLVAGNRSRMNPPLPMNHFGVYVSLA  337

Query  641   LAKANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLGI  462
                   G LL+   GWAA ++H+ V+    +++      W+KS    Q  K    N + +
Sbjct  338   STTTRIGNLLENDFGWAALKLHQAVNEHTGQKIASEIDQWLKSLSGLQSEKFSKPNLVHM  397

Query  461   ASSPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLE-KGSVDIEVCLLPHTLHTLG  285
              SSPR N Y  +FG GK VA R G +NK DGK S +PG E  GS+D+EVCLLP  +  L 
Sbjct  398   GSSPRFNKYGCEFGLGKAVAARSGYNNKHDGKVSAYPGREGGGSIDLEVCLLPEFMEALE  457

Query  284   NDQEFM  267
             +DQEFM
Sbjct  458   SDQEFM  463



>gb|AES73315.2| HXXXD-type acyl-transferase family protein [Medicago truncatula]
Length=455

 Score =   239 bits (609),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 123/310 (40%), Positives = 176/310 (57%), Gaps = 8/310 (3%)
 Frame = -1

Query  1163  SRKGISTPLLGVQVTELDDGYFIGLAMNHTAADASSFWHFFNSWSEISRGMP-------Q  1005
             +  G + PLL +QVTEL DG FIG ++NH   D +SFW+FFN WSEI +           
Sbjct  147   NHDGHTMPLLSIQVTELVDGVFIGCSLNHCIGDGTSFWNFFNIWSEIFQSQSCENENDVP  206

Query  1004  LSLPPVLDPWFPGNIARPLCLPFDLQQETLSSSFTPPPLEERVFHFSKDTIAKLKEKANS  825
             +S  P    WF      P+ LPF   +E +S  +  P   +R FHF+ ++I KLK KAN 
Sbjct  207   ISRLPFHYRWFLQGYGPPISLPFKHHEEFISR-YESPNFRDRFFHFTPESIVKLKAKANK  265

Query  824   EMGTDSISSLQSYVAHLWRAITRARRLNPTEDVSIYVPIGTRWRTNPPLPEGYWGNAIHS  645
             E  T  ISS Q+  AH+WR +TRAR L   +  S  + I  R R  PPLP+ Y+GN +  
Sbjct  266   EFNTTKISSFQALSAHVWRCVTRARGLTNDQKTSCKLAINNRLRLEPPLPQEYFGNTVDV  325

Query  644   KLAKANAGELLKRGLGWAAWQIHEVVSIQDHEEVVEFYQNWVKSPVIAQKSKVFFANFLG  465
               A+    ELL+  LGWAAW+++  V   D ++V +  + W++SPV+ Q  + F    + 
Sbjct  326   VSAEMTVDELLQNNLGWAAWKVNVAVVNHDDKQVRKMLKEWLESPVVYQLGRHFDPQSIT  385

Query  464   IASSPRNNVYATDFGWGKPVAVRCGMDNKADGKFSLFPGLEKGSVDIEVCLLPHTLHTLG  285
             ++SSPR N+Y  +FG GK +AV  G  NK DG  S + G E GS+D+ + L P+ +  L 
Sbjct  386   VSSSPRFNMYGNEFGMGKAMAVLSGYANKFDGNVSSYQGYEHGSIDLALTLTPNAMRALE  445

Query  284   NDQEFMEFVT  255
              D++F+  V 
Sbjct  446   LDEQFVNIVV  455



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3232880819760