BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig11296

Length=834
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KDO85321.1|  hypothetical protein CISIN_1g013739mg                   138   5e-34   Citrus sinensis [apfelsine]
ref|XP_006435506.1|  hypothetical protein CICLE_v10000992mg             137   1e-33   Citrus clementina [clementine]
ref|XP_006342522.1|  PREDICTED: uncharacterized protein At1g76660...    134   2e-32   
ref|XP_004253111.1|  PREDICTED: uncharacterized protein At1g76660...    134   2e-32   Solanum lycopersicum
ref|XP_007209172.1|  hypothetical protein PRUPE_ppa006213mg             131   1e-31   
ref|XP_002510760.1|  conserved hypothetical protein                     131   2e-31   Ricinus communis
ref|XP_008233411.1|  PREDICTED: uncharacterized protein At1g76660...    130   4e-31   Prunus mume [ume]
ref|XP_008233412.1|  PREDICTED: uncharacterized protein At1g76660...    130   5e-31   Prunus mume [ume]
ref|XP_010314833.1|  PREDICTED: uncharacterized protein At1g76660...    129   1e-30   Solanum lycopersicum
ref|XP_009607658.1|  PREDICTED: uncharacterized protein At1g76660       129   1e-30   Nicotiana tomentosiformis
ref|XP_011034745.1|  PREDICTED: uncharacterized protein At1g76660...    128   2e-30   Populus euphratica
ref|XP_011034743.1|  PREDICTED: uncharacterized protein At1g76660...    128   2e-30   Populus euphratica
ref|XP_011034746.1|  PREDICTED: uncharacterized protein At1g76660...    128   2e-30   Populus euphratica
ref|XP_011041105.1|  PREDICTED: uncharacterized protein At1g76660...    128   2e-30   Populus euphratica
ref|XP_011041109.1|  PREDICTED: uncharacterized protein At1g76660...    128   2e-30   Populus euphratica
ref|XP_011041108.1|  PREDICTED: uncharacterized protein At1g76660...    128   3e-30   Populus euphratica
ref|XP_011041106.1|  PREDICTED: uncharacterized protein At1g76660...    128   3e-30   Populus euphratica
ref|XP_002300608.2|  hypothetical protein POPTR_0002s00330g             128   3e-30   
ref|XP_002307833.2|  hypothetical protein POPTR_0005s28120g             128   3e-30   Populus trichocarpa [western balsam poplar]
ref|XP_006383805.1|  hypothetical protein POPTR_0005s28120g             127   4e-30   Populus trichocarpa [western balsam poplar]
ref|XP_007018611.1|  Uncharacterized protein isoform 1                  126   9e-30   
ref|XP_002274136.2|  PREDICTED: uncharacterized protein At1g76660...    125   2e-29   Vitis vinifera
ref|XP_010664049.1|  PREDICTED: uncharacterized protein At1g76660...    125   3e-29   Vitis vinifera
ref|XP_009780471.1|  PREDICTED: uncharacterized protein At1g76660       122   3e-28   Nicotiana sylvestris
ref|XP_009372682.1|  PREDICTED: uncharacterized protein At1g76660...    118   6e-27   Pyrus x bretschneideri [bai li]
ref|XP_007160588.1|  hypothetical protein PHAVU_001G000300g             117   1e-26   Phaseolus vulgaris [French bean]
gb|KHN12610.1|  Hypothetical protein glysoja_040278                     117   1e-26   Glycine soja [wild soybean]
ref|XP_003544997.2|  PREDICTED: uncharacterized protein At1g76660...    117   2e-26   Glycine max [soybeans]
gb|AFK47597.1|  unknown                                                 113   3e-26   Medicago truncatula
ref|XP_007160587.1|  hypothetical protein PHAVU_001G000300g             116   4e-26   Phaseolus vulgaris [French bean]
ref|XP_011074116.1|  PREDICTED: uncharacterized protein At1g76660...    116   4e-26   Sesamum indicum [beniseed]
ref|XP_010063195.1|  PREDICTED: uncharacterized protein At1g76660       115   6e-26   Eucalyptus grandis [rose gum]
ref|XP_012073525.1|  PREDICTED: uncharacterized protein At1g76660...    115   7e-26   Jatropha curcas
ref|XP_012073526.1|  PREDICTED: uncharacterized protein At1g76660...    115   7e-26   Jatropha curcas
gb|KEH40270.1|  hydroxyproline-rich glycoprotein family protein, ...    114   2e-25   Medicago truncatula
ref|XP_004499330.1|  PREDICTED: uncharacterized protein At1g76660...    113   5e-25   Cicer arietinum [garbanzo]
ref|XP_004499331.1|  PREDICTED: uncharacterized protein At1g76660...    112   6e-25   Cicer arietinum [garbanzo]
ref|XP_011100676.1|  PREDICTED: uncharacterized protein At1g76660...    112   1e-24   Sesamum indicum [beniseed]
ref|XP_008453041.1|  PREDICTED: uncharacterized protein At1g76660       110   4e-24   Cucumis melo [Oriental melon]
ref|XP_009340216.1|  PREDICTED: uncharacterized protein At1g76660...    110   4e-24   Pyrus x bretschneideri [bai li]
ref|XP_004150969.1|  PREDICTED: uncharacterized protein At1g76660       110   4e-24   Cucumis sativus [cucumbers]
ref|XP_010094480.1|  hypothetical protein L484_024771                   109   8e-24   
gb|KJB14109.1|  hypothetical protein B456_002G111500                    109   8e-24   Gossypium raimondii
gb|KHG17772.1|  hypothetical protein F383_21155                         109   9e-24   Gossypium arboreum [tree cotton]
gb|KJB14107.1|  hypothetical protein B456_002G111500                    108   2e-23   Gossypium raimondii
gb|KJB14108.1|  hypothetical protein B456_002G111500                    108   2e-23   Gossypium raimondii
ref|XP_003550451.2|  PREDICTED: uncharacterized protein At1g76660...    108   3e-23   Glycine max [soybeans]
gb|KHN48516.1|  Hypothetical protein glysoja_043895                     107   3e-23   Glycine soja [wild soybean]
ref|XP_010061348.1|  PREDICTED: uncharacterized protein At1g76660...    104   4e-22   Eucalyptus grandis [rose gum]
ref|XP_010668142.1|  PREDICTED: uncharacterized protein At1g76660       102   3e-21   Beta vulgaris subsp. vulgaris [field beet]
emb|CDP11003.1|  unnamed protein product                              94.4    2e-20   Coffea canephora [robusta coffee]
ref|XP_010539078.1|  PREDICTED: uncharacterized protein At1g76660...  98.2    9e-20   Tarenaya hassleriana [spider flower]
ref|XP_010539077.1|  PREDICTED: uncharacterized protein At1g76660...  98.2    1e-19   Tarenaya hassleriana [spider flower]
ref|XP_004300068.1|  PREDICTED: uncharacterized protein At1g76660     96.3    3e-19   Fragaria vesca subsp. vesca
ref|XP_010537258.1|  PREDICTED: uncharacterized protein At1g76660     94.4    2e-18   Tarenaya hassleriana [spider flower]
ref|XP_010266324.1|  PREDICTED: uncharacterized protein At1g76660     94.7    2e-18   Nelumbo nucifera [Indian lotus]
gb|EYU24333.1|  hypothetical protein MIMGU_mgv1a007603mg              90.5    2e-17   Erythranthe guttata [common monkey flower]
ref|XP_010523271.1|  PREDICTED: uncharacterized protein At1g76660...  88.2    3e-16   Tarenaya hassleriana [spider flower]
ref|XP_010523273.1|  PREDICTED: uncharacterized protein At1g76660...  88.2    3e-16   Tarenaya hassleriana [spider flower]
ref|XP_006390166.1|  hypothetical protein EUTSA_v10018563mg           83.6    9e-15   Eutrema salsugineum [saltwater cress]
gb|KFK42081.1|  hypothetical protein AALP_AA2G208700                  81.3    5e-14   Arabis alpina [alpine rockcress]
ref|XP_006300482.1|  hypothetical protein CARUB_v10020307mg           77.8    3e-13   
ref|XP_006300483.1|  hypothetical protein CARUB_v10020307mg           77.8    7e-13   Capsella rubella
ref|NP_177792.1|  uncharacterized protein                             77.8    7e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009401517.1|  PREDICTED: uncharacterized protein At1g76660...  77.4    1e-12   Musa acuminata subsp. malaccensis [pisang utan]
emb|CBI40803.3|  unnamed protein product                              71.6    3e-12   Vitis vinifera
emb|CDX88306.1|  BnaC06g37500D                                        74.7    5e-12   
ref|XP_002889094.1|  hypothetical protein ARALYDRAFT_476825           74.3    1e-11   
ref|XP_010416590.1|  PREDICTED: uncharacterized protein At1g76660     73.9    1e-11   Camelina sativa [gold-of-pleasure]
ref|XP_010428730.1|  PREDICTED: uncharacterized protein At1g76660...  73.9    1e-11   Camelina sativa [gold-of-pleasure]
ref|XP_010471824.1|  PREDICTED: uncharacterized protein At1g76660...  73.9    1e-11   Camelina sativa [gold-of-pleasure]
ref|XP_007018612.1|  Uncharacterized protein isoform 2                73.9    1e-11   
ref|XP_009106332.1|  PREDICTED: uncharacterized protein At1g76660...  73.2    2e-11   Brassica rapa
ref|XP_009410355.1|  PREDICTED: uncharacterized protein At1g76660...  72.8    4e-11   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX68089.1|  BnaA07g21290D                                        72.0    6e-11   
ref|XP_009104662.1|  PREDICTED: uncharacterized protein At1g76660...  72.0    6e-11   Brassica rapa
emb|CDX85966.1|  BnaC06g21680D                                        71.6    8e-11   
ref|NP_001041759.1|  Os01g0103800                                     71.6    9e-11   
gb|EPS68040.1|  hypothetical protein M569_06734                       71.6    9e-11   Genlisea aurea
ref|XP_009128189.1|  PREDICTED: uncharacterized protein At1g76660...  71.2    9e-11   Brassica rapa
gb|EAY72181.1|  hypothetical protein OsI_00033                        71.6    9e-11   Oryza sativa Indica Group [Indian rice]
ref|XP_010228811.1|  PREDICTED: uncharacterized protein At1g76660...  71.2    1e-10   Brachypodium distachyon [annual false brome]
ref|XP_003558251.1|  PREDICTED: uncharacterized protein At1g76660...  71.2    1e-10   Brachypodium distachyon [annual false brome]
ref|XP_010927479.1|  PREDICTED: uncharacterized protein At1g76660...  70.5    2e-10   
emb|CDX87575.1|  BnaA07g32980D                                        70.5    2e-10   
ref|XP_010927478.1|  PREDICTED: uncharacterized protein At1g76660...  70.1    3e-10   Elaeis guineensis
ref|XP_008796506.1|  PREDICTED: uncharacterized protein At1g76660...  70.1    3e-10   Phoenix dactylifera
ref|XP_006647280.1|  PREDICTED: uncharacterized protein At1g76660...  69.3    4e-10   
ref|XP_006383806.1|  hypothetical protein POPTR_0005s28120g           69.3    5e-10   
ref|XP_006307497.1|  hypothetical protein CARUB_v10009122mg           67.8    1e-09   Capsella rubella
ref|XP_011041110.1|  PREDICTED: uncharacterized protein At1g76660...  67.4    2e-09   Populus euphratica
gb|ABF95206.1|  expressed protein                                     67.0    3e-09   Oryza sativa Japonica Group [Japonica rice]
gb|EMS49144.1|  hypothetical protein TRIUR3_30392                     67.4    3e-09   Triticum urartu
dbj|BAJ88565.1|  predicted protein                                    67.0    4e-09   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KJB14106.1|  hypothetical protein B456_002G111500                  66.6    4e-09   Gossypium raimondii
dbj|BAJ87829.1|  predicted protein                                    66.6    4e-09   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ89914.1|  predicted protein                                    66.6    4e-09   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EEC74942.1|  hypothetical protein OsI_10915                        67.0    4e-09   Oryza sativa Indica Group [Indian rice]
ref|NP_001049686.1|  Os03g0270700                                     66.2    5e-09   
ref|XP_009107485.1|  PREDICTED: uncharacterized protein At1g76660...  65.9    6e-09   Brassica rapa
emb|CDY36016.1|  BnaA08g04450D                                        65.9    6e-09   Brassica napus [oilseed rape]
gb|ACU17722.1|  unknown                                               60.8    1e-08   Glycine max [soybeans]
ref|XP_010496804.1|  PREDICTED: uncharacterized protein At1g76660...  64.3    3e-08   Camelina sativa [gold-of-pleasure]
ref|XP_010496805.1|  PREDICTED: uncharacterized protein At1g76660...  63.9    3e-08   Camelina sativa [gold-of-pleasure]
ref|XP_010461391.1|  PREDICTED: uncharacterized protein At1g76660...  62.8    8e-08   Camelina sativa [gold-of-pleasure]
ref|XP_010461390.1|  PREDICTED: uncharacterized protein At1g76660...  62.8    8e-08   Camelina sativa [gold-of-pleasure]
ref|XP_004961245.1|  PREDICTED: uncharacterized protein At1g76660...  62.4    1e-07   Setaria italica
ref|XP_010478992.1|  PREDICTED: uncharacterized protein At1g76660...  58.9    1e-06   Camelina sativa [gold-of-pleasure]
ref|XP_010478991.1|  PREDICTED: uncharacterized protein At1g76660...  58.9    2e-06   Camelina sativa [gold-of-pleasure]
ref|XP_010478993.1|  PREDICTED: uncharacterized protein At1g76660...  58.5    2e-06   Camelina sativa [gold-of-pleasure]
ref|NP_001144448.1|  hypothetical protein                             58.5    2e-06   Zea mays [maize]
gb|ACN36198.1|  unknown                                               58.5    3e-06   Zea mays [maize]
ref|XP_002440239.1|  hypothetical protein SORBIDRAFT_09g028275        53.9    6e-05   
gb|ACG47230.1|  hypothetical protein                                  53.5    1e-04   Zea mays [maize]
ref|NP_001145393.1|  hypothetical protein                             53.1    1e-04   Zea mays [maize]
gb|EMT30839.1|  hypothetical protein F775_17309                       53.1    2e-04   
ref|XP_011625403.1|  PREDICTED: uncharacterized protein At1g76660     52.4    2e-04   Amborella trichopoda
gb|ERN11459.1|  hypothetical protein AMTR_s00022p00077030             52.4    2e-04   Amborella trichopoda
emb|CDY72295.1|  BnaCnng76980D                                        51.6    4e-04   Brassica napus [oilseed rape]
ref|XP_008796512.1|  PREDICTED: uncharacterized protein At1g76660...  51.2    6e-04   
gb|AGT15878.1|  hypothetical protein SHCRBa_027_N23_R_80              51.2    6e-04   Saccharum hybrid cultivar R570



>gb|KDO85321.1| hypothetical protein CISIN_1g013739mg [Citrus sinensis]
Length=437

 Score =   138 bits (348),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 81/159 (51%), Positives = 103/159 (65%), Gaps = 13/159 (8%)
 Frame = -3

Query  832  FGFSADEXVSTAQYVEITDVLDDSFSMTPFTSDKSQEQENIQIVSADKRTKAEKANKNML  653
            FGFSADE ++T QYVEITDV+DDSF+M PFTSDK   +E++   S D + K +    N+L
Sbjct  281  FGFSADEIITTPQYVEITDVMDDSFTMMPFTSDKPAFEESLP-ASMDGQ-KPQGRESNLL  338

Query  652  SPQYCKS-------GSNHAADVPDSNKTDNCSKKNHGNAFGAS-PG---VSDDEDIFSKM  506
            +P+  KS       G +H          DN  K+  G+  GAS PG   ++D+EDIFSKM
Sbjct  339  NPKNLKSDSDLMNGGIHHELTESSDGCEDNKPKRQSGDVSGASTPGNQVLTDEEDIFSKM  398

Query  505  GNSRHGRKHHFGLSSSDAEIEYRRGRSWREGKGSGAWRG  389
              SR+ RK+H GLS SDAEI+YRRGRS REGKG  +W G
Sbjct  399  RTSRNSRKYHQGLSCSDAEIDYRRGRSLREGKGDFSWHG  437



>ref|XP_006435506.1| hypothetical protein CICLE_v10000992mg [Citrus clementina]
 ref|XP_006494426.1| PREDICTED: uncharacterized protein At1g76660-like [Citrus sinensis]
 gb|ESR48746.1| hypothetical protein CICLE_v10000992mg [Citrus clementina]
Length=480

 Score =   137 bits (346),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 81/159 (51%), Positives = 103/159 (65%), Gaps = 13/159 (8%)
 Frame = -3

Query  832  FGFSADEXVSTAQYVEITDVLDDSFSMTPFTSDKSQEQENIQIVSADKRTKAEKANKNML  653
            FGFSADE ++T QYVEITDV+DDSF+M PFTSDK   +E++   S D + K +    N+L
Sbjct  324  FGFSADEIITTPQYVEITDVMDDSFTMMPFTSDKPAFEESLP-ASMDGQ-KPQGRESNLL  381

Query  652  SPQYCKS-------GSNHAADVPDSNKTDNCSKKNHGNAFGAS-PG---VSDDEDIFSKM  506
            +P+  KS       G +H          DN  K+  G+  GAS PG   ++D+EDIFSKM
Sbjct  382  NPKNLKSDSDLMNGGIHHELTESSDGCEDNKPKRQSGDVSGASTPGNQVLTDEEDIFSKM  441

Query  505  GNSRHGRKHHFGLSSSDAEIEYRRGRSWREGKGSGAWRG  389
              SR+ RK+H GLS SDAEI+YRRGRS REGKG  +W G
Sbjct  442  RTSRNSRKYHQGLSCSDAEIDYRRGRSLREGKGDFSWHG  480



>ref|XP_006342522.1| PREDICTED: uncharacterized protein At1g76660-like [Solanum tuberosum]
Length=438

 Score =   134 bits (337),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 81/150 (54%), Positives = 98/150 (65%), Gaps = 14/150 (9%)
 Frame = -3

Query  832  FGFSADEXVSTAQYVEITDV-LDDSFSMTPFTSDKSQEQENIQIVSADKRTKAEKANKNM  656
            FGFSADE VST QYVEI+DV LD+SFSMTPFT  K +E+E I  +S  + TKA   + NM
Sbjct  299  FGFSADEIVSTTQYVEISDVALDESFSMTPFT--KPREEEIILTMSTAEGTKAGNIS-NM  355

Query  655  LSPQYCKSGSNHAADVPDSNKTDNCSKKNHGNAFGASPG---VSDDEDIFSKMGNSRHGR  485
             SP  CK G +H          +NC  K+H +    +P    +SDDE IFSK+G  R  R
Sbjct  356  ASPLQCKPGMHHFEGA------NNC-MKDHTSPKQIAPANHAMSDDEGIFSKLGTLRLSR  408

Query  484  KHHFGLSSSDAEIEYRRGRSWREGKGSGAW  395
            KH  GL+SSDAEI+YRRGRS RE KG+ AW
Sbjct  409  KHDHGLASSDAEIDYRRGRSLREAKGNIAW  438



>ref|XP_004253111.1| PREDICTED: uncharacterized protein At1g76660 isoform X1 [Solanum 
lycopersicum]
Length=432

 Score =   134 bits (336),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 80/150 (53%), Positives = 96/150 (64%), Gaps = 20/150 (13%)
 Frame = -3

Query  832  FGFSADEXVSTAQYVEITDV-LDDSFSMTPFTSDKSQEQENIQIVSADKRTKAEKANKNM  656
            FGFSADE VST QYVEI+DV LD+SFSMTPFT  K +E+E I  +S  + TK    + NM
Sbjct  299  FGFSADEIVSTTQYVEISDVALDESFSMTPFT--KPREEEIILTMSTAEGTKGGNIS-NM  355

Query  655  LSPQYCKSGSNHAADVPDSNKTDNCSKKNHGNAFGASPG---VSDDEDIFSKMGNSRHGR  485
             SP  CK G+N            NC  K+H +     P    +SDDE IFSK+G  R  R
Sbjct  356  ASPLLCKPGAN------------NC-MKDHTSPKQIEPANYAMSDDEGIFSKLGTLRLSR  402

Query  484  KHHFGLSSSDAEIEYRRGRSWREGKGSGAW  395
            KH +GL+SSDAEI+YRRGRS RE KG+ AW
Sbjct  403  KHDYGLASSDAEIDYRRGRSLREAKGNIAW  432



>ref|XP_007209172.1| hypothetical protein PRUPE_ppa006213mg [Prunus persica]
 gb|EMJ10371.1| hypothetical protein PRUPE_ppa006213mg [Prunus persica]
Length=422

 Score =   131 bits (330),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 79/158 (50%), Positives = 104/158 (66%), Gaps = 12/158 (8%)
 Frame = -3

Query  832  FGFSADEXVSTAQYVEITDVLDDSFSMTPFTSDKSQEQENIQIVSADKRTKAEKANKNML  653
            FGFSADE ++T QYVEI+DV+DDSF+MTPFTS K   +E+I+  S  +  KA+K    + 
Sbjct  263  FGFSADEIITTTQYVEISDVMDDSFTMTPFTSHKLPTEEHIEPKSVTEGLKAQKTKTILQ  322

Query  652  SPQYCKSGSNH----AADVPDS--NKTDNCSKKNHGNAFGAS---PGV---SDDEDIFSK  509
            S    KS S+     ++D+P S     D+ S +  G+   +S   PGV   +D+EDIFSK
Sbjct  323  SQDTTKSESDLDEGGSSDLPISCNGYEDHKSWRQPGDVSRSSTPGPGVRVLADEEDIFSK  382

Query  508  MGNSRHGRKHHFGLSSSDAEIEYRRGRSWREGKGSGAW  395
            MG+S+  RK+  GLSSSDAEI+YRRGRS RE KG  AW
Sbjct  383  MGSSKLSRKYQLGLSSSDAEIDYRRGRSLRERKGEFAW  420



>ref|XP_002510760.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF52947.1| conserved hypothetical protein [Ricinus communis]
Length=472

 Score =   131 bits (330),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 72/150 (48%), Positives = 96/150 (64%), Gaps = 4/150 (3%)
 Frame = -3

Query  832  FGFSADEXVSTAQYVEITDVLDDSFSMTPFTSDKSQEQENIQIVSADKRTKAEKANKNML  653
            FGFSADE ++T QYVEI+DV+DDSF+MTPF S+KS  +E ++  S  +  KA++   N+ 
Sbjct  322  FGFSADEIITTQQYVEISDVMDDSFTMTPFASNKSTVEETVEAASISESEKAQRIQPNLP  381

Query  652  SPQYCKSGSNHAADVPDSNKTDNCSKKNHGNAFGAS-PGV---SDDEDIFSKMGNSRHGR  485
            S +     +     V      D  S++  G+  G+S PG+   +DD DIF KM +SR  R
Sbjct  382  SIKLKLDLACGEVPVSCDRYEDPKSRRQAGDVSGSSTPGIHVLADDSDIFPKMTSSRISR  441

Query  484  KHHFGLSSSDAEIEYRRGRSWREGKGSGAW  395
            K+H G S SDAEI+YRRGRS REGKG  AW
Sbjct  442  KYHLGSSCSDAEIDYRRGRSLREGKGDFAW  471



>ref|XP_008233411.1| PREDICTED: uncharacterized protein At1g76660 isoform X1 [Prunus 
mume]
Length=479

 Score =   130 bits (328),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 77/158 (49%), Positives = 105/158 (66%), Gaps = 12/158 (8%)
 Frame = -3

Query  832  FGFSADEXVSTAQYVEITDVLDDSFSMTPFTSDKSQEQENIQIVSADKRTKAEKANKNML  653
            FGFSADE ++T QYVEI+DV+DDSF+MTPFTS K   +E+I+ +S  +  KA+K    + 
Sbjct  320  FGFSADEIITTTQYVEISDVMDDSFTMTPFTSHKLPTEEHIEPISVTEGLKAQKTKTILQ  379

Query  652  SPQYCKSGSNH----AADVPDS--NKTDNCSKKNHGNAFGAS---PGV---SDDEDIFSK  509
            S    KS S+     ++D+P S     D+ S +  G+   +S   PG+   +D+EDIFSK
Sbjct  380  SQDTTKSESDLDEGGSSDLPISCNGYEDHKSWRQPGDVSRSSTPGPGIRVLADEEDIFSK  439

Query  508  MGNSRHGRKHHFGLSSSDAEIEYRRGRSWREGKGSGAW  395
            +G+S+  RK+  GLSSSDAEI+YRRGRS RE KG  AW
Sbjct  440  IGSSKLSRKYQLGLSSSDAEIDYRRGRSLRERKGEFAW  477



>ref|XP_008233412.1| PREDICTED: uncharacterized protein At1g76660 isoform X2 [Prunus 
mume]
Length=474

 Score =   130 bits (327),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 73/153 (48%), Positives = 99/153 (65%), Gaps = 7/153 (5%)
 Frame = -3

Query  832  FGFSADEXVSTAQYVEITDVLDDSFSMTPFTSDKSQEQENIQIVSADKRTKAEKANKNML  653
            FGFSADE ++T QYVEI+DV+DDSF+MTPFTS K   +E+I+ +S  +  KA+K    + 
Sbjct  320  FGFSADEIITTTQYVEISDVMDDSFTMTPFTSHKLPTEEHIEPISVTEGLKAQKTKTILQ  379

Query  652  SPQYCKSGSNH----AADVPDSNKTDNCSKKNHGNAFGASPGV---SDDEDIFSKMGNSR  494
            S    KS S+     ++D+P S         +   +    PG+   +D+EDIFSK+G+S+
Sbjct  380  SQDTTKSESDLDEGGSSDLPISYHKSWRQPGDVSRSSTPGPGIRVLADEEDIFSKIGSSK  439

Query  493  HGRKHHFGLSSSDAEIEYRRGRSWREGKGSGAW  395
              RK+  GLSSSDAEI+YRRGRS RE KG  AW
Sbjct  440  LSRKYQLGLSSSDAEIDYRRGRSLRERKGEFAW  472



>ref|XP_010314833.1| PREDICTED: uncharacterized protein At1g76660 isoform X2 [Solanum 
lycopersicum]
Length=425

 Score =   129 bits (324),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 76/147 (52%), Positives = 90/147 (61%), Gaps = 21/147 (14%)
 Frame = -3

Query  832  FGFSADEXVSTAQYVEITDV-LDDSFSMTPFTSDKSQEQENIQIVSADKRTKAEKANKNM  656
            FGFSADE VST QYVEI+DV LD+SFSMTPFT  K +E+E I  +S  + TK    + NM
Sbjct  299  FGFSADEIVSTTQYVEISDVALDESFSMTPFT--KPREEEIILTMSTAEGTKGGNIS-NM  355

Query  655  LSPQYCKSGSNHAADVPDSNKTDNCSKKNHGNAFGASPGVSDDEDIFSKMGNSRHGRKHH  476
             SP  CK         PD          N+         +SDDE IFSK+G  R  RKH 
Sbjct  356  ASPLLCK---------PDHTSPKQIEPANYA--------MSDDEGIFSKLGTLRLSRKHD  398

Query  475  FGLSSSDAEIEYRRGRSWREGKGSGAW  395
            +GL+SSDAEI+YRRGRS RE KG+ AW
Sbjct  399  YGLASSDAEIDYRRGRSLREAKGNIAW  425



>ref|XP_009607658.1| PREDICTED: uncharacterized protein At1g76660 [Nicotiana tomentosiformis]
Length=456

 Score =   129 bits (323),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 80/151 (53%), Positives = 95/151 (63%), Gaps = 10/151 (7%)
 Frame = -3

Query  832  FGFSADEXVSTAQYVEITDV-LDDSFSMTPFTSDKSQEQENIQIVSADKRTKAEKANKNM  656
            FGFSADE V+T QYVEI+DV LDD FSM PF   K +E+E I  +S  + TK    + NM
Sbjct  311  FGFSADEIVTTTQYVEISDVALDDPFSMIPFA--KPREEETILTMSTAEGTKGGNIS-NM  367

Query  655  LSPQYCKSGSNHAADVPDSNKTDNCSKKNHGNAF----GASPGVSDDEDIFSKMGNSRHG  488
             SPQ+CKSG NH          D+ S K   + F     A   +SDDE IFSK+G  R  
Sbjct  368  ASPQHCKSGINHFEA--GYCVKDHMSPKQSVDVFKQVEPAKHAMSDDEGIFSKLGTLRLS  425

Query  487  RKHHFGLSSSDAEIEYRRGRSWREGKGSGAW  395
            RK+  GLSSSDAEI+YRRGRS RE KG+ AW
Sbjct  426  RKYDPGLSSSDAEIDYRRGRSLRERKGNIAW  456



>ref|XP_011034745.1| PREDICTED: uncharacterized protein At1g76660-like isoform X2 
[Populus euphratica]
Length=477

 Score =   128 bits (322),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 76/158 (48%), Positives = 102/158 (65%), Gaps = 15/158 (9%)
 Frame = -3

Query  832  FGFSADEXVSTAQYVEITDVLDDSFSMTPFTSDKSQEQENIQIVSADKRTKAEKANKNML  653
            FGFSADE ++T QYVEI+DV++D+FSMTPFTS K   +E+++   A    +++KAN N+ 
Sbjct  321  FGFSADEIITTPQYVEISDVMEDTFSMTPFTSAKPTMEESME---ASFLNESQKANANLP  377

Query  652  SPQYCKSGSNHA-----ADVPDSN-----KTDNCSKKNHGNAFGASP--GVSDDEDIFSK  509
                 K  S+ A      +VP ++      +D  S+   GN  G+S    V  D+DIFSK
Sbjct  378  KQNSLKLKSDLADRVVCCEVPVTSDRYEVNSDPKSRWQPGNVSGSSTPSNVVTDDDIFSK  437

Query  508  MGNSRHGRKHHFGLSSSDAEIEYRRGRSWREGKGSGAW  395
            M +S+  RK+H GLSSSDAEI+YRRGRS REGKG  AW
Sbjct  438  MASSKTSRKYHLGLSSSDAEIDYRRGRSLREGKGDFAW  475



>ref|XP_011034743.1| PREDICTED: uncharacterized protein At1g76660-like isoform X1 
[Populus euphratica]
Length=479

 Score =   128 bits (322),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 76/158 (48%), Positives = 102/158 (65%), Gaps = 15/158 (9%)
 Frame = -3

Query  832  FGFSADEXVSTAQYVEITDVLDDSFSMTPFTSDKSQEQENIQIVSADKRTKAEKANKNML  653
            FGFSADE ++T QYVEI+DV++D+FSMTPFTS K   +E+++   A    +++KAN N+ 
Sbjct  323  FGFSADEIITTPQYVEISDVMEDTFSMTPFTSAKPTMEESME---ASFLNESQKANANLP  379

Query  652  SPQYCKSGSNHA-----ADVPDSN-----KTDNCSKKNHGNAFGASP--GVSDDEDIFSK  509
                 K  S+ A      +VP ++      +D  S+   GN  G+S    V  D+DIFSK
Sbjct  380  KQNSLKLKSDLADRVVCCEVPVTSDRYEVNSDPKSRWQPGNVSGSSTPSNVVTDDDIFSK  439

Query  508  MGNSRHGRKHHFGLSSSDAEIEYRRGRSWREGKGSGAW  395
            M +S+  RK+H GLSSSDAEI+YRRGRS REGKG  AW
Sbjct  440  MASSKTSRKYHLGLSSSDAEIDYRRGRSLREGKGDFAW  477



>ref|XP_011034746.1| PREDICTED: uncharacterized protein At1g76660-like isoform X3 
[Populus euphratica]
Length=476

 Score =   128 bits (322),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 76/155 (49%), Positives = 101/155 (65%), Gaps = 12/155 (8%)
 Frame = -3

Query  832  FGFSADEXVSTAQYVEITDVLDDSFSMTPFTSDKSQEQENIQIVSADKRTKAEKANKNML  653
            FGFSADE ++T QYVEI+DV++D+FSMTPFTS K   +E+++   A    +++KAN N+ 
Sbjct  323  FGFSADEIITTPQYVEISDVMEDTFSMTPFTSAKPTMEESME---ASFLNESQKANANLP  379

Query  652  SPQYCKSGSNHA-----ADVPDSN--KTDNCSKKNHGNAFGASP--GVSDDEDIFSKMGN  500
                 K  S+ A      +VP ++    D  S+   GN  G+S    V  D+DIFSKM +
Sbjct  380  KQNSLKLKSDLADRVVCCEVPVTSDRYEDPKSRWQPGNVSGSSTPSNVVTDDDIFSKMAS  439

Query  499  SRHGRKHHFGLSSSDAEIEYRRGRSWREGKGSGAW  395
            S+  RK+H GLSSSDAEI+YRRGRS REGKG  AW
Sbjct  440  SKTSRKYHLGLSSSDAEIDYRRGRSLREGKGDFAW  474



>ref|XP_011041105.1| PREDICTED: uncharacterized protein At1g76660-like isoform X1 
[Populus euphratica]
Length=461

 Score =   128 bits (321),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 74/149 (50%), Positives = 93/149 (62%), Gaps = 27/149 (18%)
 Frame = -3

Query  832  FGFSADEXVSTAQYVEITDVLDDSFSMTPFTSDKSQEQENIQIVSADKRTKAEKANKNML  653
            FGFSADE ++T QYVEI+DV +DSFSMTPFTS K   +E+++  S D+  KA        
Sbjct  335  FGFSADEIITTPQYVEISDVTEDSFSMTPFTSTKPTMEESVEASSPDEGQKA--------  386

Query  652  SPQYCKSGSNHAADVPDSNKTDNCSKKNHGNAFGA-SPG--VSDDEDIFSKMGNSRHGRK  482
                      HA      N  D  S++  GN  G+ +PG  V  D+DIFSKM +S+  RK
Sbjct  387  ----------HA------NYEDPKSRRQPGNISGSRTPGNHVVTDDDIFSKMASSKISRK  430

Query  481  HHFGLSSSDAEIEYRRGRSWREGKGSGAW  395
            +H GLS+SDAEI+YRRGRS REGKG  AW
Sbjct  431  YHLGLSTSDAEIDYRRGRSLREGKGDFAW  459



>ref|XP_011041109.1| PREDICTED: uncharacterized protein At1g76660-like isoform X4 
[Populus euphratica]
Length=450

 Score =   128 bits (321),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 74/149 (50%), Positives = 93/149 (62%), Gaps = 27/149 (18%)
 Frame = -3

Query  832  FGFSADEXVSTAQYVEITDVLDDSFSMTPFTSDKSQEQENIQIVSADKRTKAEKANKNML  653
            FGFSADE ++T QYVEI+DV +DSFSMTPFTS K   +E+++  S D+  KA        
Sbjct  324  FGFSADEIITTPQYVEISDVTEDSFSMTPFTSTKPTMEESVEASSPDEGQKA--------  375

Query  652  SPQYCKSGSNHAADVPDSNKTDNCSKKNHGNAFGA-SPG--VSDDEDIFSKMGNSRHGRK  482
                      HA      N  D  S++  GN  G+ +PG  V  D+DIFSKM +S+  RK
Sbjct  376  ----------HA------NYEDPKSRRQPGNISGSRTPGNHVVTDDDIFSKMASSKISRK  419

Query  481  HHFGLSSSDAEIEYRRGRSWREGKGSGAW  395
            +H GLS+SDAEI+YRRGRS REGKG  AW
Sbjct  420  YHLGLSTSDAEIDYRRGRSLREGKGDFAW  448



>ref|XP_011041108.1| PREDICTED: uncharacterized protein At1g76660-like isoform X3 
[Populus euphratica]
Length=451

 Score =   128 bits (321),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 74/149 (50%), Positives = 93/149 (62%), Gaps = 27/149 (18%)
 Frame = -3

Query  832  FGFSADEXVSTAQYVEITDVLDDSFSMTPFTSDKSQEQENIQIVSADKRTKAEKANKNML  653
            FGFSADE ++T QYVEI+DV +DSFSMTPFTS K   +E+++  S D+  KA        
Sbjct  325  FGFSADEIITTPQYVEISDVTEDSFSMTPFTSTKPTMEESVEASSPDEGQKA--------  376

Query  652  SPQYCKSGSNHAADVPDSNKTDNCSKKNHGNAFGA-SPG--VSDDEDIFSKMGNSRHGRK  482
                      HA      N  D  S++  GN  G+ +PG  V  D+DIFSKM +S+  RK
Sbjct  377  ----------HA------NYEDPKSRRQPGNISGSRTPGNHVVTDDDIFSKMASSKISRK  420

Query  481  HHFGLSSSDAEIEYRRGRSWREGKGSGAW  395
            +H GLS+SDAEI+YRRGRS REGKG  AW
Sbjct  421  YHLGLSTSDAEIDYRRGRSLREGKGDFAW  449



>ref|XP_011041106.1| PREDICTED: uncharacterized protein At1g76660-like isoform X2 
[Populus euphratica]
Length=452

 Score =   128 bits (321),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 74/149 (50%), Positives = 93/149 (62%), Gaps = 27/149 (18%)
 Frame = -3

Query  832  FGFSADEXVSTAQYVEITDVLDDSFSMTPFTSDKSQEQENIQIVSADKRTKAEKANKNML  653
            FGFSADE ++T QYVEI+DV +DSFSMTPFTS K   +E+++  S D+  KA        
Sbjct  326  FGFSADEIITTPQYVEISDVTEDSFSMTPFTSTKPTMEESVEASSPDEGQKA--------  377

Query  652  SPQYCKSGSNHAADVPDSNKTDNCSKKNHGNAFGA-SPG--VSDDEDIFSKMGNSRHGRK  482
                      HA      N  D  S++  GN  G+ +PG  V  D+DIFSKM +S+  RK
Sbjct  378  ----------HA------NYEDPKSRRQPGNISGSRTPGNHVVTDDDIFSKMASSKISRK  421

Query  481  HHFGLSSSDAEIEYRRGRSWREGKGSGAW  395
            +H GLS+SDAEI+YRRGRS REGKG  AW
Sbjct  422  YHLGLSTSDAEIDYRRGRSLREGKGDFAW  450



>ref|XP_002300608.2| hypothetical protein POPTR_0002s00330g [Populus trichocarpa]
 gb|EEE79881.2| hypothetical protein POPTR_0002s00330g [Populus trichocarpa]
Length=479

 Score =   128 bits (321),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 76/159 (48%), Positives = 101/159 (64%), Gaps = 16/159 (10%)
 Frame = -3

Query  832  FGFSADEXVSTAQYVEITDVLDDSFSMTPFTSDKSQEQENIQIVSADKRTKAEKANKNML  653
            FGFSADE ++T QYVEI+DV++D+FSMTPFTS K   +E+++   A    + +KAN N+ 
Sbjct  322  FGFSADEIITTPQYVEISDVMEDTFSMTPFTSAKPTMEESME---ASLLNEGQKANANLP  378

Query  652  SPQYCKSGSNHA-----ADVPDSN-----KTDNCSKKNHGNAFGASPG---VSDDEDIFS  512
                 K  S+ A      +VP ++      +D  S+   GN  G+S     V  D+DIFS
Sbjct  379  KQNSLKLKSDLADRVVCCEVPVTSDRYEVNSDPKSRWQPGNVSGSSTPSNHVVTDDDIFS  438

Query  511  KMGNSRHGRKHHFGLSSSDAEIEYRRGRSWREGKGSGAW  395
            KM +S+  RK+H GLSSSDAEI+YRRGRS REGKG  AW
Sbjct  439  KMASSKTSRKYHLGLSSSDAEIDYRRGRSLREGKGDFAW  477



>ref|XP_002307833.2| hypothetical protein POPTR_0005s28120g [Populus trichocarpa]
 gb|EEE94829.2| hypothetical protein POPTR_0005s28120g [Populus trichocarpa]
Length=461

 Score =   128 bits (321),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 71/149 (48%), Positives = 93/149 (62%), Gaps = 27/149 (18%)
 Frame = -3

Query  832  FGFSADEXVSTAQYVEITDVLDDSFSMTPFTSDKSQEQENIQIVSADKRTKAEKANKNML  653
            FGFSADE ++T QYVEI+DV +DSFSMTPFTS K   +E+++ +S D+  KA        
Sbjct  335  FGFSADEIITTPQYVEISDVTEDSFSMTPFTSTKPTMEESVEALSPDEGQKAY-------  387

Query  652  SPQYCKSGSNHAADVPDSNKTDNCSKKNHGNAFGA-SPG--VSDDEDIFSKMGNSRHGRK  482
                             +N  D  S++  GN  G+ +PG  V  D+DIFSKM +S+  RK
Sbjct  388  -----------------ANYEDPKSRRQPGNISGSRTPGNHVVTDDDIFSKMASSKISRK  430

Query  481  HHFGLSSSDAEIEYRRGRSWREGKGSGAW  395
            +H G+S+SDAEI+YRRGRS REGKG  AW
Sbjct  431  YHLGISTSDAEIDYRRGRSLREGKGDFAW  459



>ref|XP_006383805.1| hypothetical protein POPTR_0005s28120g [Populus trichocarpa]
 gb|ERP61602.1| hypothetical protein POPTR_0005s28120g [Populus trichocarpa]
Length=451

 Score =   127 bits (320),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 71/149 (48%), Positives = 93/149 (62%), Gaps = 27/149 (18%)
 Frame = -3

Query  832  FGFSADEXVSTAQYVEITDVLDDSFSMTPFTSDKSQEQENIQIVSADKRTKAEKANKNML  653
            FGFSADE ++T QYVEI+DV +DSFSMTPFTS K   +E+++ +S D+  KA        
Sbjct  325  FGFSADEIITTPQYVEISDVTEDSFSMTPFTSTKPTMEESVEALSPDEGQKAY-------  377

Query  652  SPQYCKSGSNHAADVPDSNKTDNCSKKNHGNAFGA-SPG--VSDDEDIFSKMGNSRHGRK  482
                             +N  D  S++  GN  G+ +PG  V  D+DIFSKM +S+  RK
Sbjct  378  -----------------ANYEDPKSRRQPGNISGSRTPGNHVVTDDDIFSKMASSKISRK  420

Query  481  HHFGLSSSDAEIEYRRGRSWREGKGSGAW  395
            +H G+S+SDAEI+YRRGRS REGKG  AW
Sbjct  421  YHLGISTSDAEIDYRRGRSLREGKGDFAW  449



>ref|XP_007018611.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY15836.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=478

 Score =   126 bits (317),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 70/157 (45%), Positives = 99/157 (63%), Gaps = 12/157 (8%)
 Frame = -3

Query  832  FGFSADEXVSTAQYVEITDVLDDSFSMTPFTSDKSQEQENIQIVSADKRTKAEKANKNML  653
            FGFSADE ++T QYVEITDV +DSF+MTPF +DK   +E++++ S  K    EK  +N+L
Sbjct  321  FGFSADEIITTTQYVEITDVTEDSFTMTPFPTDKPSFEESVELTSIGKGLNTEKIEENLL  380

Query  652  S-------PQYCKSGSNHAADVPDSNKTDNCSKKNHGNAFGASPGV----SDDEDIFSKM  506
            +       P++     +H   +  +   D+ S++   N  G++  V    +D+E I+ K 
Sbjct  381  AEKKRKSKPEFVNEVVHHDVQLSCNGFEDHKSRRQVSNVTGSNTPVNHTLTDEEGIYLKK  440

Query  505  GNSRHGRKHHFGLSSSDAEIEYRRGRSWREGKGSGAW  395
             +SR  RK+H GLSSSDAEI+YRRGRS REGKG  AW
Sbjct  441  CSSR-SRKYHLGLSSSDAEIDYRRGRSLREGKGDFAW  476



>ref|XP_002274136.2| PREDICTED: uncharacterized protein At1g76660 isoform X1 [Vitis 
vinifera]
Length=484

 Score =   125 bits (314),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 79/158 (50%), Positives = 104/158 (66%), Gaps = 17/158 (11%)
 Frame = -3

Query  832  FGFSADEXVSTAQYVEITDVLDDSFSMTPFTSDKSQEQENIQIVSADKRTKAEKANKNML  653
            FGFSADE ++T QYVEI+DVL+DSF+MTPFTS+K   +EN+         +  K   N+L
Sbjct  330  FGFSADEIITTTQYVEISDVLEDSFTMTPFTSNKPDMEENVVPAVVH---EGPKDQTNLL  386

Query  652  SPQYCKSGSNHAAD------VPDSNKT--DNCSKKNHGNAFGAS-PG---VSDDEDIFSK  509
            + +  KS S    +      +P S KT  D+ S++  GN  G+S PG   ++D+E+IF K
Sbjct  387  NEESLKSESGLVDEGGCCEGLP-SCKTFEDHKSERQSGNESGSSTPGKHILTDEEEIFPK  445

Query  508  MGNSRHGRKHHFGLSSSDAEIEYRRGRSWREGKGSGAW  395
             G S+ GRK+H GLSSSDAEI+YRRGRS REGKG  AW
Sbjct  446  -GASKIGRKYHLGLSSSDAEIDYRRGRSLREGKGDFAW  482



>ref|XP_010664049.1| PREDICTED: uncharacterized protein At1g76660 isoform X2 [Vitis 
vinifera]
Length=483

 Score =   125 bits (314),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 79/158 (50%), Positives = 104/158 (66%), Gaps = 17/158 (11%)
 Frame = -3

Query  832  FGFSADEXVSTAQYVEITDVLDDSFSMTPFTSDKSQEQENIQIVSADKRTKAEKANKNML  653
            FGFSADE ++T QYVEI+DVL+DSF+MTPFTS+K   +EN+         +  K   N+L
Sbjct  329  FGFSADEIITTTQYVEISDVLEDSFTMTPFTSNKPDMEENVVPAVVH---EGPKDQTNLL  385

Query  652  SPQYCKSGSNHAAD------VPDSNKT--DNCSKKNHGNAFGAS-PG---VSDDEDIFSK  509
            + +  KS S    +      +P S KT  D+ S++  GN  G+S PG   ++D+E+IF K
Sbjct  386  NEESLKSESGLVDEGGCCEGLP-SCKTFEDHKSERQSGNESGSSTPGKHILTDEEEIFPK  444

Query  508  MGNSRHGRKHHFGLSSSDAEIEYRRGRSWREGKGSGAW  395
             G S+ GRK+H GLSSSDAEI+YRRGRS REGKG  AW
Sbjct  445  -GASKIGRKYHLGLSSSDAEIDYRRGRSLREGKGDFAW  481



>ref|XP_009780471.1| PREDICTED: uncharacterized protein At1g76660 [Nicotiana sylvestris]
Length=447

 Score =   122 bits (306),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 76/151 (50%), Positives = 89/151 (59%), Gaps = 19/151 (13%)
 Frame = -3

Query  832  FGFSADEXVSTAQYVEITDV-LDDSFSMTPFTSDKSQEQENIQIVSADKRTKAEKANKNM  656
            FGFSADE V+T QYVEI+DV LDD FSM PFT   ++  +   I              NM
Sbjct  311  FGFSADEIVTTTQYVEISDVALDDPFSMIPFTMSTAEGTKGGNI-------------SNM  357

Query  655  LSPQYCKSGSNHAADVPDSNKTDNCSKKNHGNAF----GASPGVSDDEDIFSKMGNSRHG  488
             SPQ+CK G NH     +  K D+ S K   + F     A   +SDDE IFSKMG  R  
Sbjct  358  ASPQHCKPGINHFEGAGNCVK-DHMSPKQSVDVFKQIEPAKHAMSDDEGIFSKMGTLRLS  416

Query  487  RKHHFGLSSSDAEIEYRRGRSWREGKGSGAW  395
            RK+  GLSSSDAEI+YRRGRS RE KG+ AW
Sbjct  417  RKYDPGLSSSDAEIDYRRGRSLRERKGNIAW  447



>ref|XP_009372682.1| PREDICTED: uncharacterized protein At1g76660-like [Pyrus x bretschneideri]
 ref|XP_009372683.1| PREDICTED: uncharacterized protein At1g76660-like [Pyrus x bretschneideri]
Length=476

 Score =   118 bits (296),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 70/160 (44%), Positives = 102/160 (64%), Gaps = 18/160 (11%)
 Frame = -3

Query  832  FGFSADEXVSTAQYVEITDVLDDSFSMTPFTSDKSQEQENIQIVSADKRTKAEKANKNML  653
            FGFSADE ++T QYVEI+DV++DSF+MTPF S K   +E+++  S  +  KA K   N+ 
Sbjct  319  FGFSADEIITTTQYVEISDVMEDSFTMTPFPSHKLPTEESMEPTSVIEGLKAHKTKTNLQ  378

Query  652  SPQYCKSGSNHAADVPDSNKTD---NCS--------KKNHGNAFGASPGV---SDDEDIF  515
            S +  KS S    D+ +  + D   +C+        +++   +  ++PG+   +++EDIF
Sbjct  379  SQESHKSES----DLDEGGRCDSLMSCTGSEDHKSWRQSGDVSRSSTPGIRIMANEEDIF  434

Query  514  SKMGNSRHGRKHHFGLSSSDAEIEYRRGRSWREGKGSGAW  395
            SKMG+S+  RK+  G SSSDAEI+YRRGRS RE KG  AW
Sbjct  435  SKMGSSKLSRKYQMGQSSSDAEIDYRRGRSLRERKGEFAW  474



>ref|XP_007160588.1| hypothetical protein PHAVU_001G000300g [Phaseolus vulgaris]
 gb|ESW32582.1| hypothetical protein PHAVU_001G000300g [Phaseolus vulgaris]
Length=363

 Score =   117 bits (292),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 73/155 (47%), Positives = 96/155 (62%), Gaps = 17/155 (11%)
 Frame = -3

Query  832  FGFSADEXVSTAQYVEITDVLDDSFSMTPFTSDKSQEQENIQIVSADKRTKAEKANKNML  653
            FGFSADE ++T+QYVEI+DV++DSF+M PF S KS  +ENI+        K  KA +  +
Sbjct  212  FGFSADEIITTSQYVEISDVMEDSFAMMPFASGKSTVEENIE----PSLMKGFKAQETQV  267

Query  652  SPQYCKS-GSN--------HAADVPDSNKTDNCSKKNHGNAFGAS----PGVSDDEDIFS  512
            + Q  +S GS+        H          D+ S+++  N+ G S    P + DDEDIFS
Sbjct  268  ALQSLRSLGSDPGPVGKEAHNQATIYQGYEDHKSQRHCSNSSGFSTPENPNLVDDEDIFS  327

Query  511  KMGNSRHGRKHHFGLSSSDAEIEYRRGRSWREGKG  407
            KM +SR  RK+  GLS SDAEI+YRRGRS REGKG
Sbjct  328  KMESSRISRKYKMGLSCSDAEIDYRRGRSLREGKG  362



>gb|KHN12610.1| Hypothetical protein glysoja_040278 [Glycine soja]
Length=465

 Score =   117 bits (293),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 73/153 (48%), Positives = 94/153 (61%), Gaps = 13/153 (8%)
 Frame = -3

Query  832  FGFSADEXVSTAQYVEITDVLDDSFSMTPFTSDKSQEQENIQIVSADKRTKAEKANKNML  653
            FGFSADE +ST+QYVEI+DV++DSF+M PF SDKS  +E+I+  S  K  KA++    + 
Sbjct  314  FGFSADEIISTSQYVEISDVMEDSFTMMPFASDKSTMEESIE-PSLMKGFKAQETQVALQ  372

Query  652  SPQYCKS--------GSNHAADVP---DSNKTDNCSKKNHGNAFGASPGVSDDEDIFSKM  506
            S +  +S          N A   P   D     +CS  N G +      + DDEDIFSKM
Sbjct  373  SLRSLRSDPGPVGKEAHNQAPICPGCEDHTSQGHCSN-NSGLSTPEKRTLVDDEDIFSKM  431

Query  505  GNSRHGRKHHFGLSSSDAEIEYRRGRSWREGKG  407
             +SR  RK+  GLS SDAE++YRRGRS REGKG
Sbjct  432  ESSRICRKYQMGLSCSDAEVDYRRGRSLREGKG  464



>ref|XP_003544997.2| PREDICTED: uncharacterized protein At1g76660-like [Glycine max]
Length=473

 Score =   117 bits (293),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 73/153 (48%), Positives = 94/153 (61%), Gaps = 13/153 (8%)
 Frame = -3

Query  832  FGFSADEXVSTAQYVEITDVLDDSFSMTPFTSDKSQEQENIQIVSADKRTKAEKANKNML  653
            FGFSADE +ST+QYVEI+DV++DSF+M PF SDKS  +E+I+  S  K  KA++    + 
Sbjct  322  FGFSADEIISTSQYVEISDVMEDSFTMMPFASDKSTMEESIE-PSLMKGFKAQETQVALQ  380

Query  652  SPQYCKS--------GSNHAADVP---DSNKTDNCSKKNHGNAFGASPGVSDDEDIFSKM  506
            S +  +S          N A   P   D     +CS  N G +      + DDEDIFSKM
Sbjct  381  SLRSLRSDPGPVGKEAHNQAPICPGCEDHTSQGHCSN-NSGLSTPEKRTLVDDEDIFSKM  439

Query  505  GNSRHGRKHHFGLSSSDAEIEYRRGRSWREGKG  407
             +SR  RK+  GLS SDAE++YRRGRS REGKG
Sbjct  440  ESSRICRKYQMGLSCSDAEVDYRRGRSLREGKG  472



>gb|AFK47597.1| unknown [Medicago truncatula]
Length=221

 Score =   113 bits (283),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 70/157 (45%), Positives = 89/157 (57%), Gaps = 21/157 (13%)
 Frame = -3

Query  832  FGFSADEXVSTAQYVEITDVLDDSFSMTPFTSDKSQEQENIQIVSADKRTKAEKANKNML  653
            FGFSADE ++T+QYVEI+DV+DDSF+M P TS KS  +ENI+        K  KA++  +
Sbjct  70   FGFSADEIITTSQYVEISDVMDDSFTMMPLTSGKSMMEENIE----PSLMKEFKAHETQV  125

Query  652  SPQYCKSGSNHAADVPDSNKTDNCSKKNHGNAFGASPG---------------VSDDEDI  518
              Q  K     A+  P   +  N     HG     SPG               + DDEDI
Sbjct  126  GLQNLKCLRLDAS--PVGKQAKNQVPICHGYEDHKSPGYCSNSSGLSTPDNHTLMDDEDI  183

Query  517  FSKMGNSRHGRKHHFGLSSSDAEIEYRRGRSWREGKG  407
            FSK+G+SR  RK+  GLS SDAE++YRRGR  RE KG
Sbjct  184  FSKLGSSRICRKYQMGLSCSDAEVDYRRGRGLRERKG  220



>ref|XP_007160587.1| hypothetical protein PHAVU_001G000300g [Phaseolus vulgaris]
 gb|ESW32581.1| hypothetical protein PHAVU_001G000300g [Phaseolus vulgaris]
Length=473

 Score =   116 bits (290),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 73/155 (47%), Positives = 96/155 (62%), Gaps = 17/155 (11%)
 Frame = -3

Query  832  FGFSADEXVSTAQYVEITDVLDDSFSMTPFTSDKSQEQENIQIVSADKRTKAEKANKNML  653
            FGFSADE ++T+QYVEI+DV++DSF+M PF S KS  +ENI+        K  KA +  +
Sbjct  322  FGFSADEIITTSQYVEISDVMEDSFAMMPFASGKSTVEENIE----PSLMKGFKAQETQV  377

Query  652  SPQYCKS-GSN--------HAADVPDSNKTDNCSKKNHGNAFGAS----PGVSDDEDIFS  512
            + Q  +S GS+        H          D+ S+++  N+ G S    P + DDEDIFS
Sbjct  378  ALQSLRSLGSDPGPVGKEAHNQATIYQGYEDHKSQRHCSNSSGFSTPENPNLVDDEDIFS  437

Query  511  KMGNSRHGRKHHFGLSSSDAEIEYRRGRSWREGKG  407
            KM +SR  RK+  GLS SDAEI+YRRGRS REGKG
Sbjct  438  KMESSRISRKYKMGLSCSDAEIDYRRGRSLREGKG  472



>ref|XP_011074116.1| PREDICTED: uncharacterized protein At1g76660-like [Sesamum indicum]
Length=479

 Score =   116 bits (290),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 69/143 (48%), Positives = 90/143 (63%), Gaps = 9/143 (6%)
 Frame = -3

Query  832  FGFSADEXVSTAQYVEITDVLDDSFSMTPFTSDKSQEQENIQIVSADKRTKAEKANKNML  653
            FGFSADE ++T  YVEI+DVL+DSFSMTPF S K   +E+I   + + R + +K  ++  
Sbjct  323  FGFSADEIITTTNYVEISDVLEDSFSMTPFASIKPVAEEHILTTTTNDRAETQKKKEDFS  382

Query  652  SPQYCKSGSNHA----ADVPDS--NKTDNCSKKNHGNAFGAS---PGVSDDEDIFSKMGN  500
            SPQ  K+G N A      V DS        S+K  G+A  +      +SDD+D+FSKMG 
Sbjct  383  SPQLIKAGMNEANGLHEGVLDSYNGLKVQVSQKQSGDAERSCHIHHNLSDDDDLFSKMGA  442

Query  499  SRHGRKHHFGLSSSDAEIEYRRG  431
             R GRK+ FG S+SDAEIEYRRG
Sbjct  443  PRIGRKYQFGSSNSDAEIEYRRG  465



>ref|XP_010063195.1| PREDICTED: uncharacterized protein At1g76660 [Eucalyptus grandis]
 gb|KCW70398.1| hypothetical protein EUGRSUZ_F03634 [Eucalyptus grandis]
Length=483

 Score =   115 bits (289),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 72/163 (44%), Positives = 92/163 (56%), Gaps = 23/163 (14%)
 Frame = -3

Query  832  FGFSADEXVSTAQYVEITDVLDDSFSMTPFTSDKSQEQENIQIVSADKRTKAEKANKNML  653
            FGFSADE + T  YVEI+D +DDSFSMTPF S+ S   E +Q V   +  KAEK +  +L
Sbjct  327  FGFSADEIIVTNHYVEISDPMDDSFSMTPFASNNSSTGETLQPVFGGEEQKAEKTHITLL  386

Query  652  SPQYCKSGSNHAADVPD----------SNKTDNCSKKNHGNAFGASPGVS------DDED  521
            +       S      PD          S+  +N  ++        +PG+S      DDE+
Sbjct  387  T-------SRSLGVEPDPLTRHARFEVSSSCNNHRERKPWRPSSDAPGLSTPINHTDDEN  439

Query  520  IFSKMGNSRHGRKHHFGLSSSDAEIEYRRGRSWREGKGSGAWR  392
            I  +M +SR  RK+H GLSSSDAEIEYRRGRS REG+   AWR
Sbjct  440  ILWRMRSSRSCRKYHSGLSSSDAEIEYRRGRSLREGRRDFAWR  482



>ref|XP_012073525.1| PREDICTED: uncharacterized protein At1g76660 isoform X1 [Jatropha 
curcas]
 gb|KDP36711.1| hypothetical protein JCGZ_08002 [Jatropha curcas]
Length=470

 Score =   115 bits (288),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 68/150 (45%), Positives = 96/150 (64%), Gaps = 7/150 (5%)
 Frame = -3

Query  832  FGFSADEXVSTAQYVEITDVLDDSFSMTPFTSDKSQEQENIQIVSADKRTKAEKANKNML  653
            FGFSADE ++T QYVEI+DV+DDSF+MTPFTS+K   + + +  S    + ++KA  N+ 
Sbjct  322  FGFSADEIITTQQYVEISDVMDDSFTMTPFTSNKPTIEGSTEAASL---SDSQKAQTNLP  378

Query  652  SPQYCKSGSNHAADVPDSNKTDNCSKKNHGNAFGAS-PGV---SDDEDIFSKMGNSRHGR  485
            + +         A V      D+ S++  G+  G+S PG+   +DD+DIFSKM +S+  R
Sbjct  379  TLKLKSDRVCGEAPVSCDRYEDSKSRRQTGDVSGSSTPGIHALTDDDDIFSKMTSSKISR  438

Query  484  KHHFGLSSSDAEIEYRRGRSWREGKGSGAW  395
            K++ G S SDAEI+YRRGRS  EGK   AW
Sbjct  439  KYNLGSSCSDAEIDYRRGRSLGEGKADFAW  468



>ref|XP_012073526.1| PREDICTED: uncharacterized protein At1g76660 isoform X2 [Jatropha 
curcas]
Length=463

 Score =   115 bits (288),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 68/150 (45%), Positives = 96/150 (64%), Gaps = 7/150 (5%)
 Frame = -3

Query  832  FGFSADEXVSTAQYVEITDVLDDSFSMTPFTSDKSQEQENIQIVSADKRTKAEKANKNML  653
            FGFSADE ++T QYVEI+DV+DDSF+MTPFTS+K   + + +  S    + ++KA  N+ 
Sbjct  315  FGFSADEIITTQQYVEISDVMDDSFTMTPFTSNKPTIEGSTEAASL---SDSQKAQTNLP  371

Query  652  SPQYCKSGSNHAADVPDSNKTDNCSKKNHGNAFGAS-PGV---SDDEDIFSKMGNSRHGR  485
            + +         A V      D+ S++  G+  G+S PG+   +DD+DIFSKM +S+  R
Sbjct  372  TLKLKSDRVCGEAPVSCDRYEDSKSRRQTGDVSGSSTPGIHALTDDDDIFSKMTSSKISR  431

Query  484  KHHFGLSSSDAEIEYRRGRSWREGKGSGAW  395
            K++ G S SDAEI+YRRGRS  EGK   AW
Sbjct  432  KYNLGSSCSDAEIDYRRGRSLGEGKADFAW  461



>gb|KEH40270.1| hydroxyproline-rich glycoprotein family protein, putative [Medicago 
truncatula]
Length=484

 Score =   114 bits (286),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 71/157 (45%), Positives = 90/157 (57%), Gaps = 21/157 (13%)
 Frame = -3

Query  832  FGFSADEXVSTAQYVEITDVLDDSFSMTPFTSDKSQEQENIQIVSADKRTKAEKANKNML  653
            FGFSADE ++T+QYVEI+DV+DDSF+M P TS KS  +ENI+        K  KA++  +
Sbjct  333  FGFSADEIITTSQYVEISDVMDDSFTMMPLTSGKSMMEENIE----PSLMKEFKAHETQV  388

Query  652  SPQYCKSGSNHAADVPDSNKTDNCSKKNHGNAFGASPG---------------VSDDEDI  518
              Q  K     A+ V    +  N     HG     SPG               + DDEDI
Sbjct  389  GLQNLKCLRLDASPV--GKQAKNQVPICHGYEDHKSPGYCSNSSGLSTPDNHTLMDDEDI  446

Query  517  FSKMGNSRHGRKHHFGLSSSDAEIEYRRGRSWREGKG  407
            FSK+G+SR  RK+  GLS SDAE++YRRGRS RE KG
Sbjct  447  FSKLGSSRICRKYQMGLSCSDAEVDYRRGRSLRERKG  483



>ref|XP_004499330.1| PREDICTED: uncharacterized protein At1g76660-like isoform X1 
[Cicer arietinum]
Length=473

 Score =   113 bits (282),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 70/162 (43%), Positives = 92/162 (57%), Gaps = 31/162 (19%)
 Frame = -3

Query  832  FGFSADEXVSTAQYVEITDVLDDSFSMTPFTSDKSQEQENIQI-----------------  704
            FGFSADE ++T+QYVEI+DV+DDSF+M P T+ KS  +ENI+                  
Sbjct  322  FGFSADEIITTSQYVEISDVMDDSFTMMPLTAGKSVMEENIEPSLMKGFKAQETRVALQS  381

Query  703  ---VSADKRTKAEKANKNMLSPQYCKSGSNHAADVPDSNKTDNCSKKNHGNAFGASPGVS  533
               +  D  T  ++A KN +S   C +   H +    SN +   +  NH         + 
Sbjct  382  LKSLRLDPGTAGKQA-KNQVS--LCDAYEAHKSPGHCSNSSGLSTPDNHT--------LM  430

Query  532  DDEDIFSKMGNSRHGRKHHFGLSSSDAEIEYRRGRSWREGKG  407
            DDEDIFSKMG+SR  RK+  GLS SDAE++YRRGRS RE KG
Sbjct  431  DDEDIFSKMGSSRICRKYQMGLSCSDAEVDYRRGRSLRERKG  472



>ref|XP_004499331.1| PREDICTED: uncharacterized protein At1g76660-like isoform X2 
[Cicer arietinum]
Length=468

 Score =   112 bits (281),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 66/154 (43%), Positives = 88/154 (57%), Gaps = 20/154 (13%)
 Frame = -3

Query  832  FGFSADEXVSTAQYVEITDVLDDSFSMTPFTSDKSQEQENIQ------IVSADKRTKAEK  671
            FGFSADE ++T+QYVEI+DV+DDSF+M P T+ KS  +ENI+        + + R   + 
Sbjct  322  FGFSADEIITTSQYVEISDVMDDSFTMMPLTAGKSVMEENIEPSLMKGFKAQETRVALQS  381

Query  670  ANKNMLSPQYCKSGSNHAADVPD------SNKTDNCSKKNHGNAFGASPGVSDDEDIFSK  509
                 L P      + +   + D      SN +   +  NH         + DDEDIFSK
Sbjct  382  LKSLRLDPGTAGKQAKNQVSLCDAYEGHCSNSSGLSTPDNHT--------LMDDEDIFSK  433

Query  508  MGNSRHGRKHHFGLSSSDAEIEYRRGRSWREGKG  407
            MG+SR  RK+  GLS SDAE++YRRGRS RE KG
Sbjct  434  MGSSRICRKYQMGLSCSDAEVDYRRGRSLRERKG  467



>ref|XP_011100676.1| PREDICTED: uncharacterized protein At1g76660-like [Sesamum indicum]
 ref|XP_011100686.1| PREDICTED: uncharacterized protein At1g76660-like [Sesamum indicum]
 ref|XP_011100695.1| PREDICTED: uncharacterized protein At1g76660-like [Sesamum indicum]
Length=479

 Score =   112 bits (280),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 67/144 (47%), Positives = 89/144 (62%), Gaps = 10/144 (7%)
 Frame = -3

Query  832  FGFSADEXVSTAQYVEITDVLDDSFSMTPFTSDKSQEQENIQIVSADKRTKAEKANKNML  653
            FGFSADE ++T  YVEI+DVL+DSFSMTP TS+KS  +E+I      +   A   +++  
Sbjct  324  FGFSADEIITTTHYVEISDVLEDSFSMTPLTSNKSAGEEHILTAPTKEGVGAGARHEDFP  383

Query  652  SPQYCKSGSNHA-ADVPDSNKTDN-----CSKKNHGNAFGAS-PG---VSDDEDIFSKMG  503
            +PQ  K+    A   +P    + N      ++K   N  G S P    +SDD+DIF+KMG
Sbjct  384  TPQLGKAQLTRAEGTLPGKPGSYNSLEEQVTQKQFENVPGRSVPSNDILSDDDDIFTKMG  443

Query  502  NSRHGRKHHFGLSSSDAEIEYRRG  431
              R GRK+HFG S+SDAEIEYRRG
Sbjct  444  THRIGRKYHFGSSNSDAEIEYRRG  467



>ref|XP_008453041.1| PREDICTED: uncharacterized protein At1g76660 [Cucumis melo]
Length=473

 Score =   110 bits (275),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 58/151 (38%), Positives = 94/151 (62%), Gaps = 5/151 (3%)
 Frame = -3

Query  832  FGFSADEXVSTAQYVEITDVLDDSFSMTPFTSDKSQEQENIQIVSADKRTKAEKA---NK  662
            FGFSADE ++T QYVEI+DV++DSF+M PFTS     +E+ +     ++ K+      N+
Sbjct  321  FGFSADEIITTTQYVEISDVMEDSFTMRPFTSTSLSAEESTEPPLLGEKLKSSHTTLQNQ  380

Query  661  NML--SPQYCKSGSNHAADVPDSNKTDNCSKKNHGNAFGASPGVSDDEDIFSKMGNSRHG  488
              +  +P+  +  +        +   DN  ++  G+  G+S     ++D+FS++G+S++ 
Sbjct  381  RSIKSAPEVVEKETCTEVPALCNGYKDNKLQRQPGDILGSSTSDQVEKDVFSRIGSSKNS  440

Query  487  RKHHFGLSSSDAEIEYRRGRSWREGKGSGAW  395
            RK+  GLS SDAE++YRRGRS RE KG+G+W
Sbjct  441  RKYDLGLSCSDAEVDYRRGRSLREAKGNGSW  471



>ref|XP_009340216.1| PREDICTED: uncharacterized protein At1g76660-like [Pyrus x bretschneideri]
Length=469

 Score =   110 bits (275),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 68/155 (44%), Positives = 91/155 (59%), Gaps = 18/155 (12%)
 Frame = -3

Query  832  FGFSADEXVSTAQYVEITDVLDDSFSMTPFTSDKSQEQENIQIVSADKRTKAEKANKNML  653
            FGFSADE ++T QYVEI+DV++DSF+MTPF S K   +E+++  S ++  K  K   N+ 
Sbjct  319  FGFSADEIITTTQYVEISDVMEDSFTMTPFPSHKLPTEESMEPTSVNEGLKGRKTKTNLQ  378

Query  652  SPQYCKSGSNHAADVPDSNKTD---NCSKKNHGNAFGASPGVS-----------DDEDIF  515
            S    KS      D+ D    D   +C+      ++  S  VS           D+EDIF
Sbjct  379  SQDSLKS----EPDLDDGGHCDLAISCTGSEDHKSWRQSSDVSRSGTRGIRIVADEEDIF  434

Query  514  SKMGNSRHGRKHHFGLSSSDAEIEYRRGRSWREGK  410
            SKMG+S+  RK+  G SSSDAEI+YRRGRS RE K
Sbjct  435  SKMGSSKLSRKYQMGQSSSDAEIDYRRGRSLRERK  469



>ref|XP_004150969.1| PREDICTED: uncharacterized protein At1g76660 [Cucumis sativus]
 gb|KGN55558.1| hypothetical protein Csa_4G665140 [Cucumis sativus]
Length=469

 Score =   110 bits (275),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 60/149 (40%), Positives = 96/149 (64%), Gaps = 5/149 (3%)
 Frame = -3

Query  832  FGFSADEXVSTAQYVEITDVLDDSFSMTPFTSDKSQEQENIQIVSADKRTKAEKANKNML  653
            FGFSADE ++T QYVEI+DV++DSF+M PFTS     +E+ +     ++ K+  ++  + 
Sbjct  321  FGFSADEIITTTQYVEISDVMEDSFTMRPFTSTSLSAEESTEPPLLGEKLKS--SHTTLQ  378

Query  652  SPQYCKSGSNHAA-DVPD--SNKTDNCSKKNHGNAFGASPGVSDDEDIFSKMGNSRHGRK  482
            S +  KS       ++P   +   DN  ++  G+  G+S     ++D+FS++G+S++ RK
Sbjct  379  SQRSIKSAPEETCTEMPALCNGYKDNKLQRQPGDISGSSTSNQVEKDVFSRIGSSKNSRK  438

Query  481  HHFGLSSSDAEIEYRRGRSWREGKGSGAW  395
            +  GLS SDAE++YRRGRS RE KG+G+W
Sbjct  439  YDLGLSCSDAEVDYRRGRSLREAKGNGSW  467



>ref|XP_010094480.1| hypothetical protein L484_024771 [Morus notabilis]
 gb|EXB56234.1| hypothetical protein L484_024771 [Morus notabilis]
Length=447

 Score =   109 bits (272),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 68/152 (45%), Positives = 99/152 (65%), Gaps = 11/152 (7%)
 Frame = -3

Query  832  FGFSADEXVSTAQYVEITDVLDDSFSMTPFTSDKSQEQENIQIVSA----DKRTKAEKAN  665
            FGFSADE ++T QYVEI+DV++DSF+MTPF+S+K   +E+++ VS       +T     +
Sbjct  291  FGFSADEIITTTQYVEISDVMEDSFTMTPFSSNKLPMEESMEPVSVSGLKPLKTHTNSHS  350

Query  664  KNMLSPQYCKSGSNHAADVPD-SNKTDNCSKKNHGN-AFGASPG---VSD-DEDIFSKMG  503
            +N       +   +   +VP   N  ++  +  HG+ +  ++PG   +SD D+D+FSKMG
Sbjct  351  QNGFKLPLEQGTRSDFMEVPALPNGYEDHKRMQHGHMSRSSTPGNRILSDEDDDVFSKMG  410

Query  502  -NSRHGRKHHFGLSSSDAEIEYRRGRSWREGK  410
             +S+ GRKH  GLSSSDAEI+YRRGRS RE K
Sbjct  411  SSSKMGRKHQVGLSSSDAEIDYRRGRSLREKK  442



>gb|KJB14109.1| hypothetical protein B456_002G111500 [Gossypium raimondii]
 gb|KJB14110.1| hypothetical protein B456_002G111500 [Gossypium raimondii]
Length=437

 Score =   109 bits (272),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 69/153 (45%), Positives = 93/153 (61%), Gaps = 13/153 (8%)
 Frame = -3

Query  832  FGFSADEXVSTAQYVEITDVLDDSFSMTPFTSDKSQEQENIQIVSADKRTKAEKANKNML  653
            FGFSADE ++T QYVEITDV DDSF+M PF  DK   +E+ +  S  K +K ++  +N L
Sbjct  282  FGFSADEIITTTQYVEITDVTDDSFTMRPFPIDKPAFEESTEPASIAKGSKTDRIQENFL  341

Query  652  SPQYCKSGSN-------HAADVPDSNKTDNCSKKNHGNAFGASPGV----SDDEDIFSKM  506
              +  KS S+       H   V  +   D  S++  G+  G+S  +    +D+EDI+ K 
Sbjct  342  DEKKGKSKSDIVNWAVHHDVQVACNGYEDQKSRRQVGDVSGSSTPINHTLTDEEDIYLKK  401

Query  505  GNSRHGRKHHFGLSSSDAEIEYRRGRSWREGKG  407
             +SR  RK+  GLSSSDAEI+YRRGRS R GKG
Sbjct  402  SSSR-SRKYQLGLSSSDAEIDYRRGRSLR-GKG  432



>gb|KHG17772.1| hypothetical protein F383_21155 [Gossypium arboreum]
Length=478

 Score =   109 bits (273),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 69/153 (45%), Positives = 93/153 (61%), Gaps = 13/153 (8%)
 Frame = -3

Query  832  FGFSADEXVSTAQYVEITDVLDDSFSMTPFTSDKSQEQENIQIVSADKRTKAEKANKNML  653
            FGFSADE ++T QYVEITDV DDSF+M PF  DK   +E+ +  S  K +K ++  +N L
Sbjct  323  FGFSADEIITTTQYVEITDVTDDSFTMRPFPIDKPAFEESTEPASIAKGSKTDRIQENFL  382

Query  652  SPQYCKSGSN-------HAADVPDSNKTDNCSKKNHGNAFGASPGV----SDDEDIFSKM  506
              +  KS S+       H   V  +   D  S++  G+  G+S  +    +D+EDI+ K 
Sbjct  383  D-EKGKSKSDLVNWAVHHDVQVACNGYEDQKSRRQVGDVSGSSTPINHTLTDEEDIYLKK  441

Query  505  GNSRHGRKHHFGLSSSDAEIEYRRGRSWREGKG  407
             +SR  RK+  GLSSSDAEI+YRRGRS R GKG
Sbjct  442  SSSR-SRKYQLGLSSSDAEIDYRRGRSLRGGKG  473



>gb|KJB14107.1| hypothetical protein B456_002G111500 [Gossypium raimondii]
Length=478

 Score =   108 bits (270),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 69/153 (45%), Positives = 93/153 (61%), Gaps = 13/153 (8%)
 Frame = -3

Query  832  FGFSADEXVSTAQYVEITDVLDDSFSMTPFTSDKSQEQENIQIVSADKRTKAEKANKNML  653
            FGFSADE ++T QYVEITDV DDSF+M PF  DK   +E+ +  S  K +K ++  +N L
Sbjct  323  FGFSADEIITTTQYVEITDVTDDSFTMRPFPIDKPAFEESTEPASIAKGSKTDRIQENFL  382

Query  652  SPQYCKSGSN-------HAADVPDSNKTDNCSKKNHGNAFGASPGV----SDDEDIFSKM  506
              +  KS S+       H   V  +   D  S++  G+  G+S  +    +D+EDI+ K 
Sbjct  383  DEKKGKSKSDIVNWAVHHDVQVACNGYEDQKSRRQVGDVSGSSTPINHTLTDEEDIYLKK  442

Query  505  GNSRHGRKHHFGLSSSDAEIEYRRGRSWREGKG  407
             +SR  RK+  GLSSSDAEI+YRRGRS R GKG
Sbjct  443  SSSR-SRKYQLGLSSSDAEIDYRRGRSLR-GKG  473



>gb|KJB14108.1| hypothetical protein B456_002G111500 [Gossypium raimondii]
Length=479

 Score =   108 bits (270),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 69/153 (45%), Positives = 93/153 (61%), Gaps = 13/153 (8%)
 Frame = -3

Query  832  FGFSADEXVSTAQYVEITDVLDDSFSMTPFTSDKSQEQENIQIVSADKRTKAEKANKNML  653
            FGFSADE ++T QYVEITDV DDSF+M PF  DK   +E+ +  S  K +K ++  +N L
Sbjct  324  FGFSADEIITTTQYVEITDVTDDSFTMRPFPIDKPAFEESTEPASIAKGSKTDRIQENFL  383

Query  652  SPQYCKSGSN-------HAADVPDSNKTDNCSKKNHGNAFGASPGV----SDDEDIFSKM  506
              +  KS S+       H   V  +   D  S++  G+  G+S  +    +D+EDI+ K 
Sbjct  384  DEKKGKSKSDIVNWAVHHDVQVACNGYEDQKSRRQVGDVSGSSTPINHTLTDEEDIYLKK  443

Query  505  GNSRHGRKHHFGLSSSDAEIEYRRGRSWREGKG  407
             +SR  RK+  GLSSSDAEI+YRRGRS R GKG
Sbjct  444  SSSR-SRKYQLGLSSSDAEIDYRRGRSLR-GKG  474



>ref|XP_003550451.2| PREDICTED: uncharacterized protein At1g76660-like [Glycine max]
Length=473

 Score =   108 bits (269),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 69/154 (45%), Positives = 95/154 (62%), Gaps = 15/154 (10%)
 Frame = -3

Query  832  FGFSADEXVSTAQYVEITDVLDDSFSMTPFTSDKSQEQENIQIVSADKRTKAEKANKNML  653
            FGFSADE ++T+QYVEI+DV+++SF+M PF S+KS  +E+I+  S  K  KA+     + 
Sbjct  322  FGFSADEIITTSQYVEISDVMEESFTMLPFASNKSTMEESIE-PSFMKGFKAQDTQVALQ  380

Query  652  SPQYCKSGS--------NHAADVPDSNKTDNCSKKNHGNAFGASPG----VSDDEDIFSK  509
            S +  +S          N A   P     D+ S+ +  N+ G S      + DDEDIFSK
Sbjct  381  SQRSLRSDPGPVGKEKDNQAPICP--GYEDHISQGHCSNSSGLSTPENRTLEDDEDIFSK  438

Query  508  MGNSRHGRKHHFGLSSSDAEIEYRRGRSWREGKG  407
            M +SR  RK+  GLS SDAE++YRRGRS+RE KG
Sbjct  439  MESSRICRKYQMGLSCSDAEVDYRRGRSFREEKG  472



>gb|KHN48516.1| Hypothetical protein glysoja_043895 [Glycine soja]
Length=477

 Score =   107 bits (268),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 69/154 (45%), Positives = 95/154 (62%), Gaps = 15/154 (10%)
 Frame = -3

Query  832  FGFSADEXVSTAQYVEITDVLDDSFSMTPFTSDKSQEQENIQIVSADKRTKAEKANKNML  653
            FGFSADE ++T+QYVEI+DV+++SF+M PF S+KS  +E+I+  S  K  KA+     + 
Sbjct  326  FGFSADEIITTSQYVEISDVMEESFTMLPFASNKSTMEESIE-PSFMKGFKAQDTQVALQ  384

Query  652  SPQYCKSGS--------NHAADVPDSNKTDNCSKKNHGNAFGASPG----VSDDEDIFSK  509
            S +  +S          N A   P     D+ S+ +  N+ G S      + DDEDIFSK
Sbjct  385  SQRSLRSDPGPVGKEKDNQAPICP--GYEDHISQGHCSNSSGLSTPENRTLEDDEDIFSK  442

Query  508  MGNSRHGRKHHFGLSSSDAEIEYRRGRSWREGKG  407
            M +SR  RK+  GLS SDAE++YRRGRS+RE KG
Sbjct  443  MESSRICRKYQMGLSCSDAEVDYRRGRSFREEKG  476



>ref|XP_010061348.1| PREDICTED: uncharacterized protein At1g76660-like [Eucalyptus 
grandis]
 gb|KCW68292.1| hypothetical protein EUGRSUZ_F01956 [Eucalyptus grandis]
Length=460

 Score =   104 bits (260),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 64/152 (42%), Positives = 89/152 (59%), Gaps = 6/152 (4%)
 Frame = -3

Query  832  FGFSADEXVSTAQYVEITDVLDDSFSMTPFTSDKSQEQENIQIVSADKRTKAEKANKNML  653
            FGFSADE ++T  YVEI DV DDSF+M+ F S+    +E+       +  K EK   + L
Sbjct  311  FGFSADEIITTTHYVEIADVTDDSFTMSLFPSNNPPTEESTHAGLHSEGQKVEKLGTDFL  370

Query  652  SPQYCKSGSNHAADVPDSNKTDNCSKKNHGNAFGAS-PG---VSDDEDIFSKMGNSRHGR  485
              +  K+  +   D+  S+  D    +N  N  G+S PG   ++DDEDIF+++   ++GR
Sbjct  371  PFKSVKADQDVQRDLLTSH--DTWKDRNSCNVSGSSTPGTHVLTDDEDIFARIHLPKNGR  428

Query  484  KHHFGLSSSDAEIEYRRGRSWREGKGSGAWRG  389
            K+  G S SDAEI+YRRGRS REGK    W G
Sbjct  429  KYELGSSVSDAEIDYRRGRSLREGKVGYRWHG  460



>ref|XP_010668142.1| PREDICTED: uncharacterized protein At1g76660 [Beta vulgaris subsp. 
vulgaris]
Length=459

 Score =   102 bits (253),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 64/152 (42%), Positives = 88/152 (58%), Gaps = 8/152 (5%)
 Frame = -3

Query  832  FGFSADEXVSTAQYVEITDVLDDSFSMTPFTSDKSQEQENIQIVSADKRTKAEKANKNML  653
            FGFSADE ++T QYVEI+DV+DDSFSM P TS+KS  +E   +      ++  K++ N  
Sbjct  309  FGFSADEMITTPQYVEISDVMDDSFSMMPCTSNKSNVEEATLLDWGHGGSR--KSDNNSP  366

Query  652  SPQYCKSGSNH-----AADVPDSNKTDNCSKKNHGNAFGAS-PGVSDDEDIFSKMGNSRH  491
            + ++ KSGS+         V      D    K  G   G S P ++D++D++S MG    
Sbjct  367  TERFAKSGSDMNGKGLQGTVSFKQFRDEKKDKQPGKISGQSTPSLTDEDDMYSNMGKFNK  426

Query  490  GRKHHFGLSSSDAEIEYRRGRSWREGKGSGAW  395
             RK + GLS SDAE+EYRRGRS RE +    W
Sbjct  427  SRKLNMGLSCSDAEVEYRRGRSLRECREDYTW  458



>emb|CDP11003.1| unnamed protein product [Coffea canephora]
Length=111

 Score = 94.4 bits (233),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 56/110 (51%), Positives = 71/110 (65%), Gaps = 11/110 (10%)
 Frame = -3

Query  691  KRTKAEKANKNMLSPQYCKSGSN------HAADVPDSNKTDNCSKKNHGN-AFGASPG--  539
            ++TKAEK  K+  SP++ K   N        A  PD  +  + S +  GN +  ++PG  
Sbjct  2    EKTKAEKTQKDTQSPEFFKPVLNPIVVERKVAVSPD-GRQGHVSDRQSGNISVRSAPGNH  60

Query  538  -VSDDEDIFSKMGNSRHGRKHHFGLSSSDAEIEYRRGRSWREGKGSGAWR  392
             +SDDEDIFSKMG SR  RK+H GLSSSDAE+EYRRGRS R+GKG  AWR
Sbjct  61   LLSDDEDIFSKMGASRISRKYHLGLSSSDAEVEYRRGRSLRQGKGDFAWR  110



>ref|XP_010539078.1| PREDICTED: uncharacterized protein At1g76660-like isoform X2 
[Tarenaya hassleriana]
Length=459

 Score = 98.2 bits (243),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 61/148 (41%), Positives = 87/148 (59%), Gaps = 12/148 (8%)
 Frame = -3

Query  832  FGFSADEXVSTAQYVEITDVLDDSFSMTPFTSDKSQEQENIQIVS-ADKRTKAEKANKNM  656
            FGFSADE ++T+QYVEITDV DDSF++ P T +       I+  S   + + A + N  +
Sbjct  320  FGFSADEIITTSQYVEITDVNDDSFTVRPSTLEVPTSLCAIEAKSQGPEASLARQKNGAL  379

Query  655  LSPQYCKSGSNHAADVPDSNKTDNCSKKNHGNAFGASPGVSDDEDIFSKMGNSRHGRKHH  476
            +S          +   P  +  D+  + + G+  G+S    + EDIF+K+G  R  RK+H
Sbjct  380  VS---------DSTQEPFDSYKDHTPRSDPGHVSGSS-RRGNGEDIFTKLGTVRTSRKYH  429

Query  475  FGLSSSDAEIEYRRG-RSWREGKGSGAW  395
             G+ SSDAE++YRRG RS REGKG  AW
Sbjct  430  MGMCSSDAEVDYRRGRRSLREGKGDFAW  457



>ref|XP_010539077.1| PREDICTED: uncharacterized protein At1g76660-like isoform X1 
[Tarenaya hassleriana]
Length=478

 Score = 98.2 bits (243),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 61/148 (41%), Positives = 87/148 (59%), Gaps = 12/148 (8%)
 Frame = -3

Query  832  FGFSADEXVSTAQYVEITDVLDDSFSMTPFTSDKSQEQENIQIVS-ADKRTKAEKANKNM  656
            FGFSADE ++T+QYVEITDV DDSF++ P T +       I+  S   + + A + N  +
Sbjct  339  FGFSADEIITTSQYVEITDVNDDSFTVRPSTLEVPTSLCAIEAKSQGPEASLARQKNGAL  398

Query  655  LSPQYCKSGSNHAADVPDSNKTDNCSKKNHGNAFGASPGVSDDEDIFSKMGNSRHGRKHH  476
            +S          +   P  +  D+  + + G+  G+S    + EDIF+K+G  R  RK+H
Sbjct  399  VS---------DSTQEPFDSYKDHTPRSDPGHVSGSS-RRGNGEDIFTKLGTVRTSRKYH  448

Query  475  FGLSSSDAEIEYRRG-RSWREGKGSGAW  395
             G+ SSDAE++YRRG RS REGKG  AW
Sbjct  449  MGMCSSDAEVDYRRGRRSLREGKGDFAW  476



>ref|XP_004300068.1| PREDICTED: uncharacterized protein At1g76660 [Fragaria vesca 
subsp. vesca]
Length=450

 Score = 96.3 bits (238),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 64/150 (43%), Positives = 88/150 (59%), Gaps = 27/150 (18%)
 Frame = -3

Query  832  FGFSADEXVSTAQYVEITDVLDDSFSMTPFTSDKSQEQENIQIVSADKRTKAEKANKNML  653
            FGFSADE ++T  YVEITDV+DDSF++    S KS  +E  +  SA     A  ++  +L
Sbjct  320  FGFSADEIITTTHYVEITDVMDDSFTIG---SHKSPPEECTEPKSA----VAGHSDLPVL  372

Query  652  SPQYCKSGSNHAADVPDSNKTDNCSKKNHGNAFGAS-PG---VSDDEDIFSKMGNSRHGR  485
            +  Y                 DN S++   +   +S PG   V+++EDIFSKMG+S+  R
Sbjct  373  TNGY----------------EDNKSRRQPCDVSRSSTPGIHTVTNEEDIFSKMGSSKSSR  416

Query  484  KHHFGLSSSDAEIEYRRGRSWREGKGSGAW  395
            ++  G S SDAEI+YRRGRS REGKG+  W
Sbjct  417  RYPMGQSCSDAEIDYRRGRSLREGKGNFTW  446



>ref|XP_010537258.1| PREDICTED: uncharacterized protein At1g76660 [Tarenaya hassleriana]
Length=448

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 59/148 (40%), Positives = 86/148 (58%), Gaps = 20/148 (14%)
 Frame = -3

Query  832  FGFSADEXVSTAQYVEITDVLDDSFSMTP-FTSDKSQEQENIQIVSADK-----RTKAEK  671
            FGFSADE ++T+QYVEITDV+DDSF+M P    DKS  +E+ +I S        R + +K
Sbjct  310  FGFSADEIITTSQYVEITDVMDDSFTMAPPLGPDKSSFKESSEIFSPSNEQKFLRKEVQK  369

Query  670  ANKNMLSPQYCKSGSNHAADVPDSNKTDNCSKKNHGNAFGASPGV-SDDEDIFSKMGNSR  494
              K+  +    +    HA    + ++       +H       P + +D+E + S++G+ +
Sbjct  370  GGKSETNRSAVEVVDFHALKAANGHR-------DH------KPRIQTDEEALLSRVGSMK  416

Query  493  HGRKHHFGLSSSDAEIEYRRGRSWREGK  410
              R+ H GLS SDAEIEYRRGRS REG+
Sbjct  417  GSRRSHMGLSCSDAEIEYRRGRSLREGR  444



>ref|XP_010266324.1| PREDICTED: uncharacterized protein At1g76660 [Nelumbo nucifera]
Length=503

 Score = 94.7 bits (234),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 62/157 (39%), Positives = 84/157 (54%), Gaps = 11/157 (7%)
 Frame = -3

Query  832  FGFSADEXVSTAQYVEITDVLDDSFSMTPFTSDKSQEQENIQIVSADKRTKAEKANKNML  653
            FGFSADE ++T QYVEI+D++DDSF++ PF S KS  +E++     +   K +    N L
Sbjct  347  FGFSADEIITTPQYVEISDIMDDSFTIAPFASHKSYMEESMAPELTNGVEKMQSKCTNAL  406

Query  652  SPQYCKSGSNHAADVPDSNKTDNCS--------KKNHGNAFGASPGVS---DDEDIFSKM  506
                 K          D    DN S        +    +  G S  V+    DEDIFSKM
Sbjct  407  DRSISKWTQEEVNGGVDGQVLDNSSGHQDDKQKQLQSVDISGQSKPVNHAYTDEDIFSKM  466

Query  505  GNSRHGRKHHFGLSSSDAEIEYRRGRSWREGKGSGAW  395
             +S+  R++  GLSSSDAEI+Y RGRS+R  +G   W
Sbjct  467  EDSKISRRYRLGLSSSDAEIDYGRGRSFRIRQGDFNW  503



>gb|EYU24333.1| hypothetical protein MIMGU_mgv1a007603mg [Erythranthe guttata]
Length=402

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 61/147 (41%), Positives = 78/147 (53%), Gaps = 36/147 (24%)
 Frame = -3

Query  832  FGFSADEXVSTAQYVEITDVLDDSFSMTPFTSDKSQEQENIQIVSADKRTKAEKANKNML  653
            FGFSADE ++TA YVEI+DV                 +E I   S  K  +  K  ++  
Sbjct  290  FGFSADEIITTAHYVEISDV----------------GEEYILTASPKKGVENWKRPEDFP  333

Query  652  SPQYCKSGSNHAADVPDSNKTDNCSKKNHGNAFGASPGVSDDEDIFSKMGNSRHGRKHHF  473
            SPQ  K G  H        +  N +  +          +SDDEDIF+KMGN R+GRK HF
Sbjct  334  SPQLGK-GLPHI-------EARNLASTHV---------LSDDEDIFAKMGNPRNGRKFHF  376

Query  472  GLSSSDAEIEYRRGRSWREGKGSGAWR  392
            G S+SDAE+EYRRGRS RE +   +WR
Sbjct  377  GSSNSDAEVEYRRGRSIREER---SWR  400



>ref|XP_010523271.1| PREDICTED: uncharacterized protein At1g76660-like isoform X1 
[Tarenaya hassleriana]
Length=464

 Score = 88.2 bits (217),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 61/156 (39%), Positives = 86/156 (55%), Gaps = 18/156 (12%)
 Frame = -3

Query  832  FGFSADEXVSTAQYVEITDVLDD-SFSMTPFTSDKSQEQENIQIVSADKRTKAEKANKNM  656
            FGFSADE ++ +QYVEITDV DD SF++ P TS+        +  S  +  K+      +
Sbjct  315  FGFSADEIITKSQYVEITDVNDDDSFTIRPLTSEAPTTLRASETASQCEEPKSYGLETTL  374

Query  655  LSPQYCKSGSNHAADVPD-------SNKTDNCSKKNHGNAFGASPGVSDDEDIFSKMGNS  497
                  +SG     D+         S K D     +HG++   +PG  ++  IF+++G+S
Sbjct  375  ---ARGESGGPDPEDISHDTQEPFGSFKADQTPWSDHGSS---TPG--NENGIFTELGSS  426

Query  496  RHGRKHHFGLSSSDAEIEYRRGR--SWREGKGSGAW  395
            R  RK+  G+ SSDAEI+YRRGR  S REGKG  AW
Sbjct  427  RKSRKYRVGVCSSDAEIDYRRGRRMSLREGKGDFAW  462



>ref|XP_010523273.1| PREDICTED: uncharacterized protein At1g76660-like isoform X2 
[Tarenaya hassleriana]
Length=463

 Score = 88.2 bits (217),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 60/155 (39%), Positives = 86/155 (55%), Gaps = 17/155 (11%)
 Frame = -3

Query  832  FGFSADEXVSTAQYVEITDVLDD-SFSMTPFTSDKSQEQENIQIVSADKRTKAEKANKNM  656
            FGFSADE ++ +QYVEITDV DD SF++ P TS+        +  S  +  K+      +
Sbjct  315  FGFSADEIITKSQYVEITDVNDDDSFTIRPLTSEAPTTLRASETASQCEEPKSYGLETTL  374

Query  655  LSPQYCKSGSNHAADV------PDSNKTDNCSKKNHGNAFGASPGVSDDEDIFSKMGNSR  494
                  +SG     D+      P  +  D     +HG++   +PG  ++  IF+++G+SR
Sbjct  375  ---ARGESGGPDPEDISHDTQEPFGSFKDQTPWSDHGSS---TPG--NENGIFTELGSSR  426

Query  493  HGRKHHFGLSSSDAEIEYRRGR--SWREGKGSGAW  395
              RK+  G+ SSDAEI+YRRGR  S REGKG  AW
Sbjct  427  KSRKYRVGVCSSDAEIDYRRGRRMSLREGKGDFAW  461



>ref|XP_006390166.1| hypothetical protein EUTSA_v10018563mg [Eutrema salsugineum]
 gb|ESQ27452.1| hypothetical protein EUTSA_v10018563mg [Eutrema salsugineum]
Length=442

 Score = 83.6 bits (205),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 57/148 (39%), Positives = 81/148 (55%), Gaps = 28/148 (19%)
 Frame = -3

Query  832  FGFSADEXVSTAQYVEITDVLDDSFSMTPFTSDKSQEQENIQIVSADKRTKAEKANKNML  653
            FGFSADE ++T+QYVEITDV+D+S   + ++ +  Q              K  +   N+L
Sbjct  311  FGFSADEIITTSQYVEITDVMDESLLTSAYSPNDGQ--------------KLLRREANLL  356

Query  652  SPQYCKSGSNHAADVPD--SNKTDNCSK----KNHGNAFGASPGVSDDEDIFSKMGNSRH  491
            S    KS ++  + V D  S K  N  K    +N  +A        D+E + S++G+ + 
Sbjct  357  SQTTSKSEADLDSQVVDFHSPKALNGYKDHRPRNRIHA--------DEEALLSRVGSVKG  408

Query  490  GRKHHFGLSSSDAEIEYRRGRSWREGKG  407
             R +  G SSSDAEIEYRRGRS REG+G
Sbjct  409  SRSYPTGFSSSDAEIEYRRGRSLREGRG  436



>gb|KFK42081.1| hypothetical protein AALP_AA2G208700 [Arabis alpina]
Length=443

 Score = 81.3 bits (199),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 53/145 (37%), Positives = 77/145 (53%), Gaps = 25/145 (17%)
 Frame = -3

Query  832  FGFSADEXVSTAQYVEITDVLDDSFSMTPFTSDKSQEQENIQIVSADKRTKAEKANKNML  653
            FGFSADE ++T+QYVEITDV+DDS++ + ++    Q              K  +   N+L
Sbjct  313  FGFSADEIITTSQYVEITDVMDDSYNNSAYSPSDGQ--------------KLLRREANLL  358

Query  652  SPQYCKSGSNHAADVPDSNKTDNCSKKNHGNAFGASPGV----SDDEDIFSKMGNSRHGR  485
            S          +   PD +  D  S K+  N +          +D+E + S++G+ +  R
Sbjct  359  S-------QKSSISEPDLDSVDLHSPKSSSNGYKDHKPRNRIHADEEALLSRVGSKKGNR  411

Query  484  KHHFGLSSSDAEIEYRRGRSWREGK  410
             +  G SSSDAEIEYRRGRS REG+
Sbjct  412  SYPTGFSSSDAEIEYRRGRSIREGR  436



>ref|XP_006300482.1| hypothetical protein CARUB_v10020307mg [Capsella rubella]
 gb|EOA33380.1| hypothetical protein CARUB_v10020307mg [Capsella rubella]
Length=328

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 60/152 (39%), Positives = 80/152 (53%), Gaps = 39/152 (26%)
 Frame = -3

Query  832  FGFSADEXVSTAQYVEITDVLDDSFSMTPFTSDKSQEQENIQIVSADKRTKAEKANKNML  653
            FGFSADE ++T+QYVEITDV+DDSFS + ++    Q              K  +   N+L
Sbjct  198  FGFSADEIITTSQYVEITDVMDDSFSKSTYSPSDGQ--------------KLLRREVNLL  243

Query  652  SPQYCKSGSNHAADVPDSNKTDNCSKKNHGNAFGASPGV-----------SDDEDIFSKM  506
            S    KS     AD+ DS   D  S K       AS G            +D+E + S++
Sbjct  244  SQTSPKS----EADL-DSQAVDFHSPK-------ASNGYKEHKQRNKRIHADEEALLSRV  291

Query  505  GNSRHGRKHHFGLSSSDAEIEYRRGRSWREGK  410
            G+ +  R   + +SSSDAEIEYRRGRS REG+
Sbjct  292  GSVKGNRS--YPISSSDAEIEYRRGRSLREGR  321



>ref|XP_006300483.1| hypothetical protein CARUB_v10020307mg [Capsella rubella]
 gb|EOA33381.1| hypothetical protein CARUB_v10020307mg [Capsella rubella]
Length=441

 Score = 77.8 bits (190),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 53/141 (38%), Positives = 81/141 (57%), Gaps = 17/141 (12%)
 Frame = -3

Query  832  FGFSADEXVSTAQYVEITDVLDDSFSMTPFTSDKSQEQENIQIVSADKRTKAEKANKNML  653
            FGFSADE ++T+QYVEITDV+DDSFS + ++    Q+    ++    + +   +A+   L
Sbjct  311  FGFSADEIITTSQYVEITDVMDDSFSKSTYSPSDGQKLLRREVNLLSQTSPKSEAD---L  367

Query  652  SPQYCKSGSNHAADVPDSNKTDNCSKKNHGNAFGASPGVSDDEDIFSKMGNSRHGRKHHF  473
              Q     S  A++    +K  N  K+ H          +D+E + S++G+ +  R   +
Sbjct  368  DSQAVDFHSPKASNGYKEHKQRN--KRIH----------ADEEALLSRVGSVKGNRS--Y  413

Query  472  GLSSSDAEIEYRRGRSWREGK  410
             +SSSDAEIEYRRGRS REG+
Sbjct  414  PISSSDAEIEYRRGRSLREGR  434



>ref|NP_177792.1| uncharacterized protein [Arabidopsis thaliana]
 sp|Q9SRE5.1|Y1666_ARATH RecName: Full=Uncharacterized protein At1g76660 [Arabidopsis 
thaliana]
 gb|AAF04432.1|AC010718_1 unknown protein; 7808-5929 [Arabidopsis thaliana]
 dbj|BAC41819.1| unknown protein [Arabidopsis thaliana]
 gb|AAO63442.1| At1g76660 [Arabidopsis thaliana]
 gb|AEE35872.1| uncharacterized protein AT1G76660 [Arabidopsis thaliana]
Length=431

 Score = 77.8 bits (190),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 57/145 (39%), Positives = 82/145 (57%), Gaps = 26/145 (18%)
 Frame = -3

Query  832  FGFSADEXVSTAQYVEITDVLDDSFSMTPFTSDKSQEQENIQIVSADKRTKAEKANKNML  653
            FGFSADE ++T+QYVEITDV+D SF+ + ++    Q              K  +   N+L
Sbjct  302  FGFSADEIITTSQYVEITDVMDGSFNTSAYSPSDGQ--------------KLLRREANLL  347

Query  652  SPQYCKSGSNHAADVPD--SNKTDNCSKKNHG--NAFGASPGVSDDEDIFSKMGNSRHGR  485
            S    KS ++  + V D  S K+ N S K+H   N   A     D+E + S++G+ +  R
Sbjct  348  SQTSPKSEADLDSQVVDFQSPKSSN-SYKDHKQRNRIHA-----DEEALLSRVGSVKGSR  401

Query  484  KHHFGLSSSDAEIEYRRGRSWREGK  410
             +H  +SSSDAE+EYRRGRS RE +
Sbjct  402  SYH--ISSSDAEVEYRRGRSLRESR  424



>ref|XP_009401517.1| PREDICTED: uncharacterized protein At1g76660-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=501

 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 51/151 (34%), Positives = 76/151 (50%), Gaps = 14/151 (9%)
 Frame = -3

Query  832  FGFSADEXVSTAQYVEITDVLDDSFSMTPFTSDKSQEQENIQIVSADKRTKAEKANKNML  653
            FGFSADE ++T  +VE+ D LD+SF+M+PF ++K+  +E   I   D + K      + +
Sbjct  360  FGFSADEIITTQNHVELPDPLDESFTMSPFANNKTG-KEQCPITELDDKGKKLPNLLDTM  418

Query  652  SPQY----CKSGSNHAADVPDSNKTDNCSKKNHGNAFGASPGVSDDEDIFSKMGNSRHGR  485
             P+     CKS  N+    P      NC   ++             E + S+  + +  +
Sbjct  419  GPKQPTSDCKSNQNNIHAAPK----HNCWSADYPPLLNVG-----AEKVDSRTSDDQVRK  469

Query  484  KHHFGLSSSDAEIEYRRGRSWREGKGSGAWR  392
            + H G S SDAEI+YRR RS RE     AWR
Sbjct  470  RAHPGQSFSDAEIDYRRARSLREANTLLAWR  500



>emb|CBI40803.3| unnamed protein product [Vitis vinifera]
Length=119

 Score = 71.6 bits (174),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 41/69 (59%), Positives = 52/69 (75%), Gaps = 5/69 (7%)
 Frame = -3

Query  589  DNCSKKNHGNAFGAS-PG---VSDDEDIFSKMGNSRHGRKHHFGLSSSDAEIEYRRGRSW  422
            D+ S++  GN  G+S PG   ++D+E+IF K G S+ GRK+H GLSSSDAEI+YRRGRS 
Sbjct  50   DHKSERQSGNESGSSTPGKHILTDEEEIFPK-GASKIGRKYHLGLSSSDAEIDYRRGRSL  108

Query  421  REGKGSGAW  395
            REGKG  AW
Sbjct  109  REGKGDFAW  117



>emb|CDX88306.1| BnaC06g37500D [Brassica napus]
Length=372

 Score = 74.7 bits (182),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 48/141 (34%), Positives = 71/141 (50%), Gaps = 36/141 (26%)
 Frame = -3

Query  832  FGFSADEXVSTAQYVEITDVLDDSFSMTPFTSDKSQEQENIQIVSADKRTKAEKANKNML  653
            FGFSADE V+T+QYVEI DV+D+S  + P     S+ Q+ ++                  
Sbjct  262  FGFSADEVVTTSQYVEINDVMDESL-LKPVAYSPSEGQKLLR------------------  302

Query  652  SPQYCKSGSNHAADVPDSNKTDNCSKKNHGNAFGASPGVSDDEDIFSKMGNSRHGRKHHF  473
                        A +  S K++   K  +G         +D+E + S++G+ +  R +  
Sbjct  303  ----------REASLLTSTKSETGHKPRNGIH-------ADEEALLSRVGSVKGSRSYPT  345

Query  472  GLSSSDAEIEYRRGRSWREGK  410
            G SSSDAE+EYRRGRS REG+
Sbjct  346  GFSSSDAEVEYRRGRSLREGR  366



>ref|XP_002889094.1| hypothetical protein ARALYDRAFT_476825 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65353.1| hypothetical protein ARALYDRAFT_476825 [Arabidopsis lyrata subsp. 
lyrata]
Length=440

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 52/147 (35%), Positives = 79/147 (54%), Gaps = 30/147 (20%)
 Frame = -3

Query  832  FGFSADEXVSTAQYVEITDVLDDSFSMTPFTSDKSQEQENIQIVSADKRTKAEKANKNML  653
            FGFSADE ++T+QYVEITDV+DDSF+   ++    Q              K  +   N+L
Sbjct  311  FGFSADEIITTSQYVEITDVMDDSFNTAAYSPSDGQ--------------KLLRREANLL  356

Query  652  SPQYCKSGSNHAADVPD------SNKTDNCSKKNHGNAFGASPGVSDDEDIFSKMGNSRH  491
            S    KS ++  + V +      SN   +  ++N  +A        D+E + S++G+ + 
Sbjct  357  SQTSPKSEADLDSQVVEFHSPKASNGYKDHKQRNRIHA--------DEEALLSRVGSVKG  408

Query  490  GRKHHFGLSSSDAEIEYRRGRSWREGK  410
             R   + +SSSDAE+EYRRGRS RE +
Sbjct  409  SRS--YPISSSDAEVEYRRGRSLRESR  433



>ref|XP_010416590.1| PREDICTED: uncharacterized protein At1g76660 [Camelina sativa]
Length=436

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 58/152 (38%), Positives = 78/152 (51%), Gaps = 39/152 (26%)
 Frame = -3

Query  832  FGFSADEXVSTAQYVEITDVLDDSFSMTPFTSDKSQEQENIQIVSADKRTKAEKANKNML  653
            FGFSADE ++T+QYVEITDV+DDSFS   ++    Q              K  +   N+L
Sbjct  306  FGFSADEIITTSQYVEITDVMDDSFSKATYSPSDGQ--------------KLLRREVNLL  351

Query  652  SPQYCKSGSNHAADVPDSNKTDNCSKKNHGNAFGASPGV-----------SDDEDIFSKM  506
            S    KS     AD+ DS   D  S K       AS G            +D+E + S++
Sbjct  352  SQTSPKS----EADL-DSQAVDFHSPK-------ASNGYKDHKQRNQRIHADEEALLSRV  399

Query  505  GNSRHGRKHHFGLSSSDAEIEYRRGRSWREGK  410
            G+ +  R   + +SSSDAE+EYRRGRS RE +
Sbjct  400  GSVKGSRS--YPISSSDAEVEYRRGRSLRESR  429



>ref|XP_010428730.1| PREDICTED: uncharacterized protein At1g76660-like [Camelina sativa]
Length=436

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 58/152 (38%), Positives = 78/152 (51%), Gaps = 39/152 (26%)
 Frame = -3

Query  832  FGFSADEXVSTAQYVEITDVLDDSFSMTPFTSDKSQEQENIQIVSADKRTKAEKANKNML  653
            FGFSADE ++T+QYVEITDV+DDSFS   ++    Q              K  +   N+L
Sbjct  306  FGFSADEIITTSQYVEITDVMDDSFSKATYSPSDGQ--------------KLLRREVNLL  351

Query  652  SPQYCKSGSNHAADVPDSNKTDNCSKKNHGNAFGASPGV-----------SDDEDIFSKM  506
            S    KS     AD+ DS   D  S K       AS G            +D+E + S++
Sbjct  352  SQTSPKS----EADL-DSQAVDFHSPK-------ASNGYKDHKQRNQRIHADEEALLSRV  399

Query  505  GNSRHGRKHHFGLSSSDAEIEYRRGRSWREGK  410
            G+ +  R   + +SSSDAE+EYRRGRS RE +
Sbjct  400  GSVKGSRS--YPISSSDAEVEYRRGRSLRESR  429



>ref|XP_010471824.1| PREDICTED: uncharacterized protein At1g76660-like [Camelina sativa]
Length=436

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 58/152 (38%), Positives = 78/152 (51%), Gaps = 39/152 (26%)
 Frame = -3

Query  832  FGFSADEXVSTAQYVEITDVLDDSFSMTPFTSDKSQEQENIQIVSADKRTKAEKANKNML  653
            FGFSADE ++T+QYVEITDV+DDSFS   ++    Q              K  +   N+L
Sbjct  306  FGFSADEIITTSQYVEITDVMDDSFSKATYSPSDGQ--------------KLLRREVNLL  351

Query  652  SPQYCKSGSNHAADVPDSNKTDNCSKKNHGNAFGASPGV-----------SDDEDIFSKM  506
            S    KS     AD+ DS   D  S K       AS G            +D+E + S++
Sbjct  352  SQTSPKS----EADL-DSQAVDFHSPK-------ASNGYKDHKQRNQRIHADEEALLSRV  399

Query  505  GNSRHGRKHHFGLSSSDAEIEYRRGRSWREGK  410
            G+ +  R   + +SSSDAE+EYRRGRS RE +
Sbjct  400  GSVKGSRS--YPISSSDAEVEYRRGRSLRESR  429



>ref|XP_007018612.1| Uncharacterized protein isoform 2, partial [Theobroma cacao]
 gb|EOY15837.1| Uncharacterized protein isoform 2, partial [Theobroma cacao]
Length=411

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 45/61 (74%), Gaps = 0/61 (0%)
 Frame = -3

Query  832  FGFSADEXVSTAQYVEITDVLDDSFSMTPFTSDKSQEQENIQIVSADKRTKAEKANKNML  653
            FGFSADE ++T QYVEITDV +DSF+MTPF +DK   +E++++ S  K    EK  +N+L
Sbjct  318  FGFSADEIITTTQYVEITDVTEDSFTMTPFPTDKPSFEESVELTSIGKGLNTEKIEENLL  377

Query  652  S  650
            +
Sbjct  378  A  378



>ref|XP_009106332.1| PREDICTED: uncharacterized protein At1g76660-like [Brassica rapa]
Length=373

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 48/141 (34%), Positives = 71/141 (50%), Gaps = 36/141 (26%)
 Frame = -3

Query  832  FGFSADEXVSTAQYVEITDVLDDSFSMTPFTSDKSQEQENIQIVSADKRTKAEKANKNML  653
            FGFSADE V+T+QYVEI DV+D+S  + P     S+ Q+ ++                  
Sbjct  263  FGFSADEVVTTSQYVEINDVMDESL-LKPAAYSPSEGQKLLR------------------  303

Query  652  SPQYCKSGSNHAADVPDSNKTDNCSKKNHGNAFGASPGVSDDEDIFSKMGNSRHGRKHHF  473
                        A +  S K++   K  +G         +D+E + S++G+ +  R +  
Sbjct  304  ----------REASLLTSTKSETDHKPRNGIH-------ADEEALLSRVGSVKGSRSYPT  346

Query  472  GLSSSDAEIEYRRGRSWREGK  410
            G SSSDAE+EYRRGRS REG+
Sbjct  347  GFSSSDAEVEYRRGRSLREGR  367



>ref|XP_009410355.1| PREDICTED: uncharacterized protein At1g76660-like [Musa acuminata 
subsp. malaccensis]
Length=519

 Score = 72.8 bits (177),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 54/157 (34%), Positives = 78/157 (50%), Gaps = 15/157 (10%)
 Frame = -3

Query  832  FGFSADEXVSTAQYVEITDVLDDSFSMTPFTSDKSQEQENIQIVSADKRTKAEKANKNML  653
            FGFSADE ++T  YVE++D +D SF++TP  + K+  ++   I   DK  K      ++L
Sbjct  364  FGFSADEIITTQNYVELSDPVDVSFTITPLANGKTGMEQYSAIEFDDKGKKV----SDLL  419

Query  652  SPQYCKSGSNHAADVPDSNKTD----------NCSKKNHGNAFGASPGVSDDEDIFSKMG  503
            +P   K  + H A   D  K+D          N   ++      A+P     ED  S+  
Sbjct  420  NPVSPKQMAVHHAVAVD-GKSDQNNMHAGAEPNIQSEDTSAVADANPDTDGGEDSDSRAS  478

Query  502  NSRHGRKHHFGLSSSDAEIEYRRGRSWREGKGSGAWR  392
            + R G++     S SDAEI+YRR RS RE     AWR
Sbjct  479  DHRLGKRAQPRQSFSDAEIDYRRARSLREANAQLAWR  515



>emb|CDX68089.1| BnaA07g21290D [Brassica napus]
Length=387

 Score = 72.0 bits (175),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 50/137 (36%), Positives = 70/137 (51%), Gaps = 26/137 (19%)
 Frame = -3

Query  832  FGFSADEXVSTAQYVEITDVLDDSFSMTPFTSDKSQEQENIQIVSADKRTKAEKANKNML  653
            FGFSADE ++T+ YVEITDV+DDS                  ++S     K  +   N+L
Sbjct  267  FGFSADEVITTSHYVEITDVMDDS------------------LLSPRDGQKLLRREANLL  308

Query  652  SPQYCKSGSNHAADVPDSNKTDNCSKKNHGNAFGASPGVSDDEDIFSKMGNSRHGRKHHF  473
            S    KS +       D  K+ +   K+H    G     +D+E + S++G+ +  R +  
Sbjct  309  SQTSPKSEAGL-----DPPKSSSNGYKDHKPRNGIH---ADEEALLSRVGSVKGSRSYPT  360

Query  472  GLSSSDAEIEYRRGRSW  422
            G SSSDAEIEYRRGRS 
Sbjct  361  GFSSSDAEIEYRRGRSL  377



>ref|XP_009104662.1| PREDICTED: uncharacterized protein At1g76660-like [Brassica rapa]
Length=394

 Score = 72.0 bits (175),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 50/137 (36%), Positives = 70/137 (51%), Gaps = 26/137 (19%)
 Frame = -3

Query  832  FGFSADEXVSTAQYVEITDVLDDSFSMTPFTSDKSQEQENIQIVSADKRTKAEKANKNML  653
            FGFSADE ++T+ YVEITDV+DDS                  ++S     K  +   N+L
Sbjct  274  FGFSADEVITTSHYVEITDVMDDS------------------LLSPRDGQKLLRREANLL  315

Query  652  SPQYCKSGSNHAADVPDSNKTDNCSKKNHGNAFGASPGVSDDEDIFSKMGNSRHGRKHHF  473
            S    KS +       D  K+ +   K+H    G     +D+E + S++G+ +  R +  
Sbjct  316  SQTSPKSEAGL-----DPPKSSSNGYKDHKPRNGIH---ADEEALLSRVGSVKGSRSYPT  367

Query  472  GLSSSDAEIEYRRGRSW  422
            G SSSDAEIEYRRGRS 
Sbjct  368  GFSSSDAEIEYRRGRSL  384



>emb|CDX85966.1| BnaC06g21680D [Brassica napus]
Length=387

 Score = 71.6 bits (174),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 52/137 (38%), Positives = 71/137 (52%), Gaps = 26/137 (19%)
 Frame = -3

Query  832  FGFSADEXVSTAQYVEITDVLDDSFSMTPFTSDKSQEQENIQIVSADKRTKAEKANKNML  653
            FGFSADE ++T+QYVEITDV+D S                  ++S     K  +   N+L
Sbjct  267  FGFSADEVITTSQYVEITDVMDHS------------------LLSPRDGQKLLRREANLL  308

Query  652  SPQYCKSGSNHAADVPDSNKTDNCSKKNHGNAFGASPGVSDDEDIFSKMGNSRHGRKHHF  473
            S    KS     A V D  K+ +   K+H    G     +D+E + S++G+ +  R +  
Sbjct  309  SQTSPKS----EAGV-DPPKSSSNGYKDHKPRNGIH---ADEEALLSRVGSVKGSRSYPT  360

Query  472  GLSSSDAEIEYRRGRSW  422
            G SSSDAEIEYRRGRS 
Sbjct  361  GFSSSDAEIEYRRGRSL  377



>ref|NP_001041759.1| Os01g0103800 [Oryza sativa Japonica Group]
 dbj|BAD44830.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF03673.1| Os01g0103800 [Oryza sativa Japonica Group]
 dbj|BAG95716.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE53704.1| hypothetical protein OsJ_00030 [Oryza sativa Japonica Group]
Length=509

 Score = 71.6 bits (174),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 55/163 (34%), Positives = 74/163 (45%), Gaps = 37/163 (23%)
 Frame = -3

Query  832  FGFSADEXVSTAQYVEITDVLDDSFSMTPFTSDKSQEQENIQIVSADKRTKAEKANKNML  653
            FGFSADE V+T  YVEI D LD+ FS++PF ++    + +  + +    T  +K+ +  L
Sbjct  360  FGFSADEIVTTQTYVEIPDALDEGFSISPFGNNAPATEVDKSLFNVKVITGPKKSTEQKL  419

Query  652  SPQYCKSGSNHAADVPDSNKTDNCSKKN--HGNAFGASPG--VSDDEDIFSKMGNSRHGR  485
            S                     N S +N  H + F  + G  V +DE +       R GR
Sbjct  420  S---------------------NGSPQNVVHLDIFKGTKGGDVCEDEGMVKDCHPFRKGR  458

Query  484  ------------KHHFGLSSSDAEIEYRRGRSWREGKGSGAWR  392
                        K   G S SDAEIEYRR RS RE  G  +WR
Sbjct  459  DEISLKPIEVRKKVGGGQSCSDAEIEYRRARSLREANGVVSWR  501



>gb|EPS68040.1| hypothetical protein M569_06734, partial [Genlisea aurea]
Length=404

 Score = 71.6 bits (174),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 55/147 (37%), Positives = 78/147 (53%), Gaps = 28/147 (19%)
 Frame = -3

Query  832  FGFSADEXVSTA-QYVEITDVLDDSFSMTPFTSDKSQEQENIQIVSADKRTKAEKANKNM  656
            FGFSADE ++ A  YVE++++ DDSF++      K ++ + I        + AE    + 
Sbjct  278  FGFSADEMLNAASHYVEVSEISDDSFTI------KGKKHDLIP-------SAAEGEEWSF  324

Query  655  LSPQYCKSGSNHAADVPDSNKTDNCSKKNHGNA----FGASPGVSDDEDIFSKMGNSRHG  488
                +  S +N          +D   +K +G        +  G SDDEDIFS++     G
Sbjct  325  YFSAFSTSANNFFF------WSDMALEKQYGYIGRIISSSKHGFSDDEDIFSRL----EG  374

Query  487  RKHHFGLSSSDAEIEYRRGRSWREGKG  407
            RKH +GLS+SDAEIEYRRGRS RE  G
Sbjct  375  RKHTYGLSNSDAEIEYRRGRSLRERNG  401



>ref|XP_009128189.1| PREDICTED: uncharacterized protein At1g76660-like [Brassica rapa]
Length=380

 Score = 71.2 bits (173),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 52/142 (37%), Positives = 71/142 (50%), Gaps = 35/142 (25%)
 Frame = -3

Query  832  FGFSADEXVSTAQYVEITDVLDDSFSMTPFTSDKSQEQENIQIVSADKRTKAEKANKNML  653
            FGFSAD+ ++T+QYVE TDV+DDS         K+    N Q        K  +   N+ 
Sbjct  267  FGFSADDVITTSQYVEFTDVMDDSL-----VKAKAYSPSNGQ--------KLLRGEANL-  312

Query  652  SPQYCKSGSNHAADVPDSNKTDNCSKKNHGNAFGASPGVSDDEDIFSKMGNSRHG-RKHH  476
             P   +S S  A              +N  NA        D+E + S++G+ + G R + 
Sbjct  313  -PSQTRSNSEEA-----------LLSRNRINA--------DEEALLSRVGSVKKGSRSYP  352

Query  475  FGLSSSDAEIEYRRGRSWREGK  410
              +SSSDAEIEYRRGRS REG+
Sbjct  353  AAVSSSDAEIEYRRGRSLREGR  374



>gb|EAY72181.1| hypothetical protein OsI_00033 [Oryza sativa Indica Group]
Length=509

 Score = 71.6 bits (174),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 55/163 (34%), Positives = 74/163 (45%), Gaps = 37/163 (23%)
 Frame = -3

Query  832  FGFSADEXVSTAQYVEITDVLDDSFSMTPFTSDKSQEQENIQIVSADKRTKAEKANKNML  653
            FGFSADE V+T  YVEI D LD+ FS++PF ++    + +  + +    T  +K+ +  L
Sbjct  360  FGFSADEIVTTQTYVEIPDALDEGFSISPFGNNAPATEVDKSLFNVKVITGPKKSTEQKL  419

Query  652  SPQYCKSGSNHAADVPDSNKTDNCSKKN--HGNAFGASPG--VSDDEDIFSKMGNSRHGR  485
            S                     N S +N  H + F  + G  V +DE +       R GR
Sbjct  420  S---------------------NGSPQNVVHLDIFKGTKGGDVCEDEGMVKDCHPFRKGR  458

Query  484  ------------KHHFGLSSSDAEIEYRRGRSWREGKGSGAWR  392
                        K   G S SDAEIEYRR RS RE  G  +WR
Sbjct  459  DEISLKPIEVRKKVGGGQSCSDAEIEYRRARSLREANGVVSWR  501



>ref|XP_010228811.1| PREDICTED: uncharacterized protein At1g76660 isoform X2 [Brachypodium 
distachyon]
Length=535

 Score = 71.2 bits (173),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 57/162 (35%), Positives = 75/162 (46%), Gaps = 23/162 (14%)
 Frame = -3

Query  832  FGFSADEXVSTAQYVEITDVLDDSFSMTPF-TSDKSQEQENIQIVSADKRTKAEKANKNM  656
            FGFSADE V+T  Y EI D LDD FS++PF  S  + E         D   +A+K +K++
Sbjct  374  FGFSADEIVTTQHYAEIPDTLDDGFSISPFGNSAPAAEVSPFN----DLPNEAQKVDKSL  429

Query  655  LSPQYCKSGSNHAADVPDSNKTDNCSKKNHGNAFGASPG--VSDDEDIFSKMGNSRHGR-  485
            L+ +   S    A    D   +    K  H + F  + G  +SDD+ I       R  R 
Sbjct  430  LNAKAITSPKKSA----DQLSSGTPQKVLHLDIFKGTKGGHLSDDDGIAKDCHPFRKSRD  485

Query  484  -----------KHHFGLSSSDAEIEYRRGRSWREGKGSGAWR  392
                       K   G + SDAEIEYRR RS RE     +WR
Sbjct  486  EISLKPIEVRKKSPPGQACSDAEIEYRRARSLREANSVLSWR  527



>ref|XP_003558251.1| PREDICTED: uncharacterized protein At1g76660 isoform X1 [Brachypodium 
distachyon]
Length=536

 Score = 71.2 bits (173),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 57/162 (35%), Positives = 75/162 (46%), Gaps = 23/162 (14%)
 Frame = -3

Query  832  FGFSADEXVSTAQYVEITDVLDDSFSMTPF-TSDKSQEQENIQIVSADKRTKAEKANKNM  656
            FGFSADE V+T  Y EI D LDD FS++PF  S  + E         D   +A+K +K++
Sbjct  375  FGFSADEIVTTQHYAEIPDTLDDGFSISPFGNSAPAAEVSPFN----DLPNEAQKVDKSL  430

Query  655  LSPQYCKSGSNHAADVPDSNKTDNCSKKNHGNAFGASPG--VSDDEDIFSKMGNSRHGR-  485
            L+ +   S    A    D   +    K  H + F  + G  +SDD+ I       R  R 
Sbjct  431  LNAKAITSPKKSA----DQLSSGTPQKVLHLDIFKGTKGGHLSDDDGIAKDCHPFRKSRD  486

Query  484  -----------KHHFGLSSSDAEIEYRRGRSWREGKGSGAWR  392
                       K   G + SDAEIEYRR RS RE     +WR
Sbjct  487  EISLKPIEVRKKSPPGQACSDAEIEYRRARSLREANSVLSWR  528



>ref|XP_010927479.1| PREDICTED: uncharacterized protein At1g76660 isoform X2 [Elaeis 
guineensis]
Length=376

 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 50/161 (31%), Positives = 81/161 (50%), Gaps = 21/161 (13%)
 Frame = -3

Query  832  FGFSADEXVSTAQYVEITDVLDDSFSMTPFTSDKS--------------QEQENIQIVSA  695
            FGFSADE ++T  YVE++D LD+SF+M+PF ++K+              Q+ E  Q    
Sbjct  219  FGFSADEIITTQNYVELSDALDESFTMSPFPNNKTCTEQCPGTELGGEGQKMETTQSDIP  278

Query  694  DKRTKAEKANKNMLSPQYCKSGSNHAADVPDSNKTDNCSKKNHGNAFGASPGVSDDEDIF  515
            +  +  E  ++ +++  +C+  SN      ++    NC  K+  +    +  V   E+  
Sbjct  279  EAASPKEVLDQ-LVNGVHCEVPSNT-----NAGPQPNCQYKDASHLDDGNRSVKGAENN-  331

Query  514  SKMGNSRHGRKHHFGLSSSDAEIEYRRGRSWREGKGSGAWR  392
             +  +    ++   G S SDAEI+YRR RS RE  G  AWR
Sbjct  332  PRAADPHVSKRVRPGESCSDAEIDYRRARSLREANGILAWR  372



>emb|CDX87575.1| BnaA07g32980D [Brassica napus]
Length=373

 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 47/141 (33%), Positives = 70/141 (50%), Gaps = 36/141 (26%)
 Frame = -3

Query  832  FGFSADEXVSTAQYVEITDVLDDSFSMTPFTSDKSQEQENIQIVSADKRTKAEKANKNML  653
            FGFSADE V+T+ YVEI DV+D+S  + P     S+ Q+ ++                  
Sbjct  263  FGFSADEVVTTSHYVEINDVMDESL-LKPAAYSPSEGQKLLR------------------  303

Query  652  SPQYCKSGSNHAADVPDSNKTDNCSKKNHGNAFGASPGVSDDEDIFSKMGNSRHGRKHHF  473
                        A +  S K++   K  +G         +D+E + S++G+ +  R +  
Sbjct  304  ----------REASLLTSTKSETDHKPRNGIH-------ADEEALLSRVGSVKGSRSYPT  346

Query  472  GLSSSDAEIEYRRGRSWREGK  410
            G SSSDAE+EYRRGRS REG+
Sbjct  347  GFSSSDAEVEYRRGRSLREGR  367



>ref|XP_010927478.1| PREDICTED: uncharacterized protein At1g76660 isoform X1 [Elaeis 
guineensis]
Length=509

 Score = 70.1 bits (170),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 50/161 (31%), Positives = 81/161 (50%), Gaps = 21/161 (13%)
 Frame = -3

Query  832  FGFSADEXVSTAQYVEITDVLDDSFSMTPFTSDKS--------------QEQENIQIVSA  695
            FGFSADE ++T  YVE++D LD+SF+M+PF ++K+              Q+ E  Q    
Sbjct  352  FGFSADEIITTQNYVELSDALDESFTMSPFPNNKTCTEQCPGTELGGEGQKMETTQSDIP  411

Query  694  DKRTKAEKANKNMLSPQYCKSGSNHAADVPDSNKTDNCSKKNHGNAFGASPGVSDDEDIF  515
            +  +  E  ++ +++  +C+  SN      ++    NC  K+  +    +  V   E+  
Sbjct  412  EAASPKEVLDQ-LVNGVHCEVPSNT-----NAGPQPNCQYKDASHLDDGNRSVKGAENN-  464

Query  514  SKMGNSRHGRKHHFGLSSSDAEIEYRRGRSWREGKGSGAWR  392
             +  +    ++   G S SDAEI+YRR RS RE  G  AWR
Sbjct  465  PRAADPHVSKRVRPGESCSDAEIDYRRARSLREANGILAWR  505



>ref|XP_008796506.1| PREDICTED: uncharacterized protein At1g76660 isoform X1 [Phoenix 
dactylifera]
Length=509

 Score = 70.1 bits (170),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 57/164 (35%), Positives = 81/164 (49%), Gaps = 27/164 (16%)
 Frame = -3

Query  832  FGFSADEXVSTAQYVEITDVLDDSFSMTPFTSDK--------------SQEQENIQIVSA  695
            FGFSADE ++T  YVE++D LD+SF+M+PF ++K               Q+ E IQ    
Sbjct  352  FGFSADEIITTQNYVELSDALDESFTMSPFPNNKICTEQCPITELGSECQKMETIQSDIP  411

Query  694  DKRTKAEKANKNMLS-PQYCKSGSNHAADVPDSNKTDNCSKKNHGN--AFGASPGVSDDE  524
            D  T + K   + L+   +C+  SN  A    + ++ + S  + GN    GA       +
Sbjct  412  D--TASPKVVLDQLANGVHCEMPSNTNAGPQPNCQSKDASLWHDGNHSVKGAENNPKASD  469

Query  523  DIFSKMGNSRHGRKHHFGLSSSDAEIEYRRGRSWREGKGSGAWR  392
             + SK        +   G S SDAEI+YRR RS RE  G  AWR
Sbjct  470  PLVSK--------RVRPGESCSDAEIDYRRARSLREANGILAWR  505



>ref|XP_006647280.1| PREDICTED: uncharacterized protein At1g76660-like [Oryza brachyantha]
Length=378

 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 53/161 (33%), Positives = 72/161 (45%), Gaps = 34/161 (21%)
 Frame = -3

Query  832  FGFSADEXVSTAQYVEITDVLDDSFSMTPFTSDKSQEQENIQIVSADKRTKAEKANKNML  653
            FGFSADE V+T  YVEI D LD+ FS++PF ++                  A + +K++ 
Sbjct  230  FGFSADEIVTTQPYVEIPDALDEGFSISPFGNN----------------APATEVDKSLF  273

Query  652  SPQYCKSGSNHAADVPDSNKTDNCSKKNHGNAFGASPG--VSDDEDIFSKMGNSRHGR--  485
            + +   S    A    D    ++     H + F  + G  +S+DE I       R  R  
Sbjct  274  NVKVITSPKKPA----DQLSIESPQNVVHLDIFKGTKGGDLSEDEGIVKDCHPFRKARDE  329

Query  484  ----------KHHFGLSSSDAEIEYRRGRSWREGKGSGAWR  392
                      K   G S SDAEIEYRR RS RE  G  +WR
Sbjct  330  ISLKPIEVRKKVPPGQSCSDAEIEYRRARSLREANGVLSWR  370



>ref|XP_006383806.1| hypothetical protein POPTR_0005s28120g [Populus trichocarpa]
 gb|ERP61603.1| hypothetical protein POPTR_0005s28120g [Populus trichocarpa]
Length=407

 Score = 69.3 bits (168),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = -3

Query  832  FGFSADEXVSTAQYVEITDVLDDSFSMTPFTSDKSQEQENIQIVSADKRTKA  677
            FGFSADE ++T QYVEI+DV +DSFSMTPFTS K   +E+++ +S D+  KA
Sbjct  325  FGFSADEIITTPQYVEISDVTEDSFSMTPFTSTKPTMEESVEALSPDEGQKA  376



>ref|XP_006307497.1| hypothetical protein CARUB_v10009122mg [Capsella rubella]
 gb|EOA40395.1| hypothetical protein CARUB_v10009122mg [Capsella rubella]
Length=449

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 54/150 (36%), Positives = 74/150 (49%), Gaps = 21/150 (14%)
 Frame = -3

Query  832  FGFSADEXVSTAQYVEITDVLDDSFSMTPF-TSDKSQEQENIQIVSADKRTK--AEKANK  662
            FGFSADE ++T+QYVEIT V DDSF+M P  T D +    NI+  S  K        AN 
Sbjct  315  FGFSADEVITTSQYVEITHVNDDSFTMRPHSTLDATSPNCNIKTASERKGLNFYGSDANL  374

Query  661  NMLSPQYCKSGSNHAADVPDSNKTDNCSKKNHGNAFGASPGVSDDEDIFSKMGNSRHGRK  482
            ++   +Y +       +       D+   +    +  ++PG           G ++  RK
Sbjct  375  DLQKTEYTRCNLQEPLEF----YNDHMQLQPGHISVSSTPG---------NKGQAKTSRK  421

Query  481  HHFGLSSSDAEIEYRR-GRSWREGKGSGAW  395
            +  GL SSDAEI+YRR GRS    KG  AW
Sbjct  422  YKMGLYSSDAEIDYRRSGRS----KGDFAW  447



>ref|XP_011041110.1| PREDICTED: uncharacterized protein At1g76660-like isoform X5 
[Populus euphratica]
Length=421

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = -3

Query  832  FGFSADEXVSTAQYVEITDVLDDSFSMTPFTSDKSQEQENIQIVSADKRTKA  677
            FGFSADE ++T QYVEI+DV +DSFSMTPFTS K   +E+++  S D+  KA
Sbjct  335  FGFSADEIITTPQYVEISDVTEDSFSMTPFTSTKPTMEESVEASSPDEGQKA  386



>gb|ABF95206.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAG91837.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE58773.1| hypothetical protein OsJ_10291 [Oryza sativa Japonica Group]
Length=380

 Score = 67.0 bits (162),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 52/159 (33%), Positives = 73/159 (46%), Gaps = 29/159 (18%)
 Frame = -3

Query  832  FGFSADEXVSTAQYVEITDVLDDSFSMTPF-----TSDKSQEQENIQIVSADKRTKAEKA  668
            FGFSADE V+T  YVEI D LD+ FS++PF      ++  +   N+++ ++ K++  + +
Sbjct  231  FGFSADEIVTTQAYVEIPDALDEGFSISPFGNNAPATEVDKPLFNVKVTTSPKKSADQLS  290

Query  667  NKNMLSPQYCKSGSNHAADVPDSNKTDNCSKKNHGNAFGASPGVSDDEDIFSK------M  506
            N                 D P +    +  K   G       GV  D   F K      +
Sbjct  291  N-----------------DSPHNVVHLDIFKGTKGGDLSEDEGVVKDCHPFRKAMDEISL  333

Query  505  GNSRHGRKHHFGL-SSSDAEIEYRRGRSWREGKGSGAWR  392
                  +K   G  SSSDAEIEYRR RS RE  G  +WR
Sbjct  334  KPIEVRKKVQPGQSSSSDAEIEYRRARSLREANGVLSWR  372



>gb|EMS49144.1| hypothetical protein TRIUR3_30392 [Triticum urartu]
Length=564

 Score = 67.4 bits (163),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 53/161 (33%), Positives = 75/161 (47%), Gaps = 18/161 (11%)
 Frame = -3

Query  832  FGFSADEXVSTAQYVEITDVLDDSFSMTPFTSDKSQEQENIQIVSADKRTKAEKANKNML  653
            FGFSADE V+T  YVEI D LDD FS++PF ++    + +      ++  K +K +K++ 
Sbjct  400  FGFSADEIVTTQHYVEIPDALDDGFSISPFGNNAPATEVSPFNDVPNEFQKVDKMDKSLF  459

Query  652  SPQYCKSGSNHAADVPDSNKTDNCSKKNHGNAF-GASPG-VSDDEDIFSKMGNSRHGR--  485
            +     S        PD     +  K  H + F G   G +S+D+         R  R  
Sbjct  460  NANMITSPKKS----PDQISGGSPQKVLHLDIFKGTKAGHLSEDDATTKDCHPFRMARDE  515

Query  484  ----------KHHFGLSSSDAEIEYRRGRSWREGKGSGAWR  392
                      +   G + SDAEIEYRR RS RE  G  +WR
Sbjct  516  ISLKPIEVRKRSPPGQACSDAEIEYRRARSLREANGVLSWR  556



>dbj|BAJ88565.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=539

 Score = 67.0 bits (162),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 52/161 (32%), Positives = 77/161 (48%), Gaps = 18/161 (11%)
 Frame = -3

Query  832  FGFSADEXVSTAQYVEITDVLDDSFSMTPFTSDKSQEQENIQIVSADKRTKAEKANKNML  653
            FGFSADE V+T  YVEI D LDD FS++PF ++    + +  I   ++  K +K +K++ 
Sbjct  375  FGFSADETVTTQHYVEIPDALDDGFSISPFGNNAPATEVSPFIDLPNEVQKVDKMDKSL-  433

Query  652  SPQYCKSGSNHAADVPDSNKTDNCSKKNHGNAFGASPG--VSDDEDI------FSKMGNS  497
               +  + +      PD     +  K  H + F  S    +S+D+        F K G+ 
Sbjct  434  ---FNVNETTSPKKSPDQLSGGSPQKVLHVDIFKGSKAGHLSEDDTTVKDCHPFRKAGDE  490

Query  496  ------RHGRKHHFGLSSSDAEIEYRRGRSWREGKGSGAWR  392
                     +K     + SDAEIEYRR RS RE     +WR
Sbjct  491  ISLKPIEVRKKSPPSQACSDAEIEYRRARSLREANSVLSWR  531



>gb|KJB14106.1| hypothetical protein B456_002G111500 [Gossypium raimondii]
Length=416

 Score = 66.6 bits (161),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 41/60 (68%), Gaps = 0/60 (0%)
 Frame = -3

Query  832  FGFSADEXVSTAQYVEITDVLDDSFSMTPFTSDKSQEQENIQIVSADKRTKAEKANKNML  653
            FGFSADE ++T QYVEITDV DDSF+M PF  DK   +E+ +  S  K +K ++  +N L
Sbjct  323  FGFSADEIITTTQYVEITDVTDDSFTMRPFPIDKPAFEESTEPASIAKGSKTDRIQENFL  382



>dbj|BAJ87829.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=539

 Score = 66.6 bits (161),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 52/161 (32%), Positives = 77/161 (48%), Gaps = 18/161 (11%)
 Frame = -3

Query  832  FGFSADEXVSTAQYVEITDVLDDSFSMTPFTSDKSQEQENIQIVSADKRTKAEKANKNML  653
            FGFSADE V+T  YVEI D LDD FS++PF ++    + +  I   ++  K +K +K++ 
Sbjct  375  FGFSADEIVTTQHYVEIPDALDDGFSISPFGNNAPATEVSPFIDLPNEVQKVDKMDKSL-  433

Query  652  SPQYCKSGSNHAADVPDSNKTDNCSKKNHGNAFGASPG--VSDDEDI------FSKMGNS  497
               +  + +      PD     +  K  H + F  S    +S+D+        F K G+ 
Sbjct  434  ---FNVNETTSPKKSPDQLSGGSPQKVLHVDIFKGSKAGHLSEDDTTVKDCHPFRKAGDE  490

Query  496  ------RHGRKHHFGLSSSDAEIEYRRGRSWREGKGSGAWR  392
                     +K     + SDAEIEYRR RS RE     +WR
Sbjct  491  ISLKPIEVRKKSPPSQACSDAEIEYRRARSLREANSVLSWR  531



>dbj|BAJ89914.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=538

 Score = 66.6 bits (161),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 52/161 (32%), Positives = 77/161 (48%), Gaps = 18/161 (11%)
 Frame = -3

Query  832  FGFSADEXVSTAQYVEITDVLDDSFSMTPFTSDKSQEQENIQIVSADKRTKAEKANKNML  653
            FGFSADE V+T  YVEI D LDD FS++PF ++    + +  I   ++  K +K +K++ 
Sbjct  374  FGFSADEIVTTQHYVEIPDALDDGFSISPFGNNAPATEVSPFIDLPNEVQKVDKMDKSL-  432

Query  652  SPQYCKSGSNHAADVPDSNKTDNCSKKNHGNAFGASPG--VSDDEDI------FSKMGNS  497
               +  + +      PD     +  K  H + F  S    +S+D+        F K G+ 
Sbjct  433  ---FNVNETTSPKKSPDQLSGGSPQKVLHVDIFKGSKAGHLSEDDTTVKDCHPFRKAGDE  489

Query  496  ------RHGRKHHFGLSSSDAEIEYRRGRSWREGKGSGAWR  392
                     +K     + SDAEIEYRR RS RE     +WR
Sbjct  490  ISLKPIEVRKKSPPSQACSDAEIEYRRARSLREANSVLSWR  530



>gb|EEC74942.1| hypothetical protein OsI_10915 [Oryza sativa Indica Group]
Length=646

 Score = 67.0 bits (162),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 52/159 (33%), Positives = 73/159 (46%), Gaps = 29/159 (18%)
 Frame = -3

Query  832  FGFSADEXVSTAQYVEITDVLDDSFSMTPF-----TSDKSQEQENIQIVSADKRTKAEKA  668
            FGFSADE V+T  YVEI D LD+ FS++PF      ++  +   N+++ ++ K++  + +
Sbjct  497  FGFSADEIVTTQAYVEIPDALDEGFSISPFGNNAPATEVDKPLFNVKVTTSPKKSADQLS  556

Query  667  NKNMLSPQYCKSGSNHAADVPDSNKTDNCSKKNHGNAFGASPGVSDDEDIFSK------M  506
            N                 D P +    +  K   G       GV  D   F K      +
Sbjct  557  N-----------------DSPHNVVHLDIFKGTKGGDLSEDEGVVKDCHPFRKAMDEISL  599

Query  505  GNSRHGRKHHFGL-SSSDAEIEYRRGRSWREGKGSGAWR  392
                  +K   G  SSSDAEIEYRR RS RE  G  +WR
Sbjct  600  KPIEVRKKVQPGQSSSSDAEIEYRRARSLREANGVLSWR  638



>ref|NP_001049686.1| Os03g0270700 [Oryza sativa Japonica Group]
 dbj|BAF11600.1| Os03g0270700, partial [Oryza sativa Japonica Group]
Length=540

 Score = 66.2 bits (160),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 52/159 (33%), Positives = 73/159 (46%), Gaps = 29/159 (18%)
 Frame = -3

Query  832  FGFSADEXVSTAQYVEITDVLDDSFSMTPFTSDKSQEQE-----NIQIVSADKRTKAEKA  668
            FGFSADE V+T  YVEI D LD+ FS++PF ++    +      N+++ ++ K++  + +
Sbjct  391  FGFSADEIVTTQAYVEIPDALDEGFSISPFGNNAPATEVDKPLFNVKVTTSPKKSADQLS  450

Query  667  NKNMLSPQYCKSGSNHAADVPDSNKTDNCSKKNHGNAFGASPGVSDDEDIFSK------M  506
            N                 D P +    +  K   G       GV  D   F K      +
Sbjct  451  N-----------------DSPHNVVHLDIFKGTKGGDLSEDEGVVKDCHPFRKAMDEISL  493

Query  505  GNSRHGRKHHFGL-SSSDAEIEYRRGRSWREGKGSGAWR  392
                  +K   G  SSSDAEIEYRR RS RE  G  +WR
Sbjct  494  KPIEVRKKVQPGQSSSSDAEIEYRRARSLREANGVLSWR  532



>ref|XP_009107485.1| PREDICTED: uncharacterized protein At1g76660-like [Brassica rapa]
Length=401

 Score = 65.9 bits (159),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 54/147 (37%), Positives = 72/147 (49%), Gaps = 33/147 (22%)
 Frame = -3

Query  832  FGFSADEXVSTAQYVEITDVLDDSFSMTPFTSDKSQEQENIQIVSADKRTKAEKANKNML  653
            FGFS+D+ +ST+QYVEIT V DDS  + P T+  + + E I +  A +      A+ N+ 
Sbjct  285  FGFSSDDVISTSQYVEITHVQDDS--LRPRTTLDASKDEGINLYGAGE------ASLNL-  335

Query  652  SPQYCKSGSNHAADVPDSNKTDNCSKKNHGNAFGASPGVSDDEDIFSKMGNSRHGRKHHF  473
              Q C             N  D     N      ++PG           G ++  RK+  
Sbjct  336  --QKC------------GNLQDPLDMHNDHMRRSSTPG---------NGGQAKASRKYKT  372

Query  472  GLSSSDAEIEYRR-GRSWREGKGSGAW  395
            GL SSDAEI+YRR GRS  EGKG  AW
Sbjct  373  GLCSSDAEIDYRRSGRSLGEGKGDFAW  399



>emb|CDY36016.1| BnaA08g04450D [Brassica napus]
Length=401

 Score = 65.9 bits (159),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 54/147 (37%), Positives = 72/147 (49%), Gaps = 33/147 (22%)
 Frame = -3

Query  832  FGFSADEXVSTAQYVEITDVLDDSFSMTPFTSDKSQEQENIQIVSADKRTKAEKANKNML  653
            FGFS+D+ +ST+QYVEIT V DDS  + P T+  + + E I +  A +      A+ N+ 
Sbjct  285  FGFSSDDVISTSQYVEITHVQDDS--LRPRTTLDASKDEGINLYGAGE------ASLNL-  335

Query  652  SPQYCKSGSNHAADVPDSNKTDNCSKKNHGNAFGASPGVSDDEDIFSKMGNSRHGRKHHF  473
              Q C             N  D     N      ++PG           G ++  RK+  
Sbjct  336  --QKC------------GNLQDPLDMHNDHMRRSSTPG---------NGGQAKASRKYKT  372

Query  472  GLSSSDAEIEYRR-GRSWREGKGSGAW  395
            GL SSDAEI+YRR GRS  EGKG  AW
Sbjct  373  GLCSSDAEIDYRRSGRSLGEGKGDFAW  399



>gb|ACU17722.1| unknown [Glycine max]
Length=70

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 45/65 (69%), Gaps = 4/65 (6%)
 Frame = -3

Query  592  TDNCSKKNHGNAFGASP----GVSDDEDIFSKMGNSRHGRKHHFGLSSSDAEIEYRRGRS  425
            +D+ S+ +  N+ G S      + DDEDIFSKM +SR  RK+  GLS SDAE++YRRGRS
Sbjct  2    SDHISQGHCSNSSGLSTPENRTLEDDEDIFSKMESSRICRKYQMGLSCSDAEVDYRRGRS  61

Query  424  WREGK  410
            +RE +
Sbjct  62   FREER  66



>ref|XP_010496804.1| PREDICTED: uncharacterized protein At1g76660-like isoform X1 
[Camelina sativa]
Length=451

 Score = 64.3 bits (155),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 53/149 (36%), Positives = 78/149 (52%), Gaps = 19/149 (13%)
 Frame = -3

Query  832  FGFSADEXVSTAQYVEITDVLDDSFSMTPFTS-DKSQEQENIQIVSADKRTKAEKANKNM  656
            FGFSADE ++T+QYVEIT + DDSF+M P ++ D +    NI+  S  +      +  N+
Sbjct  317  FGFSADEVITTSQYVEITHLNDDSFTMRPRSALDATSPNCNIKAASEGEGLNFYGSEANL  376

Query  655  LSPQYCKSGSNHAADV-PDSNKTDNCSKKNHGNAFGASPGVSDDEDIFSKMGNSRHGRKH  479
                  KS  N +  + P     D+  ++    +  ++PG           G ++  RK+
Sbjct  377  ---DLQKSEDNRSNLLEPLEFYNDHMQRQLGHISVSSTPG---------NGGQAKTSRKY  424

Query  478  HFGLSSSDAEIEYRR-GRSWREGKGSGAW  395
              GL SSDAEI+YRR GRS    KG+ AW
Sbjct  425  KMGLCSSDAEIDYRRNGRS----KGNFAW  449



>ref|XP_010496805.1| PREDICTED: uncharacterized protein At1g76660-like isoform X2 
[Camelina sativa]
Length=449

 Score = 63.9 bits (154),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 53/149 (36%), Positives = 78/149 (52%), Gaps = 19/149 (13%)
 Frame = -3

Query  832  FGFSADEXVSTAQYVEITDVLDDSFSMTPFTS-DKSQEQENIQIVSADKRTKAEKANKNM  656
            FGFSADE ++T+QYVEIT + DDSF+M P ++ D +    NI+  S  +      +  N+
Sbjct  315  FGFSADEVITTSQYVEITHLNDDSFTMRPRSALDATSPNCNIKAASEGEGLNFYGSEANL  374

Query  655  LSPQYCKSGSNHAADV-PDSNKTDNCSKKNHGNAFGASPGVSDDEDIFSKMGNSRHGRKH  479
                  KS  N +  + P     D+  ++    +  ++PG           G ++  RK+
Sbjct  375  ---DLQKSEDNRSNLLEPLEFYNDHMQRQLGHISVSSTPG---------NGGQAKTSRKY  422

Query  478  HFGLSSSDAEIEYRR-GRSWREGKGSGAW  395
              GL SSDAEI+YRR GRS    KG+ AW
Sbjct  423  KMGLCSSDAEIDYRRNGRS----KGNFAW  447



>ref|XP_010461391.1| PREDICTED: uncharacterized protein At1g76660-like isoform X2 
[Camelina sativa]
Length=449

 Score = 62.8 bits (151),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 52/149 (35%), Positives = 77/149 (52%), Gaps = 19/149 (13%)
 Frame = -3

Query  832  FGFSADEXVSTAQYVEITDVLDDSFSMTPFTS-DKSQEQENIQIVSADKRTKAEKANKNM  656
            FGFSADE ++T+QYVEIT + DDSF+M P ++ D +    NI+  S  +      +  N+
Sbjct  315  FGFSADEVITTSQYVEITHLNDDSFTMRPRSALDATSPNCNIKAASEGEGINLYGSEANL  374

Query  655  LSPQYCKSGSNHAA-DVPDSNKTDNCSKKNHGNAFGASPGVSDDEDIFSKMGNSRHGRKH  479
                  KS  N ++   P     D+  ++    +  ++PG           G ++  +K+
Sbjct  375  ---DLQKSEDNRSSLQEPLEFYNDHMQRQLGHISVSSTPG---------NGGQAKTSKKY  422

Query  478  HFGLSSSDAEIEYRR-GRSWREGKGSGAW  395
              GL SSDAEI+YRR GRS    KG  AW
Sbjct  423  KMGLCSSDAEIDYRRSGRS----KGDFAW  447



>ref|XP_010461390.1| PREDICTED: uncharacterized protein At1g76660-like isoform X1 
[Camelina sativa]
Length=451

 Score = 62.8 bits (151),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 52/149 (35%), Positives = 77/149 (52%), Gaps = 19/149 (13%)
 Frame = -3

Query  832  FGFSADEXVSTAQYVEITDVLDDSFSMTPFTS-DKSQEQENIQIVSADKRTKAEKANKNM  656
            FGFSADE ++T+QYVEIT + DDSF+M P ++ D +    NI+  S  +      +  N+
Sbjct  317  FGFSADEVITTSQYVEITHLNDDSFTMRPRSALDATSPNCNIKAASEGEGINLYGSEANL  376

Query  655  LSPQYCKSGSNHAA-DVPDSNKTDNCSKKNHGNAFGASPGVSDDEDIFSKMGNSRHGRKH  479
                  KS  N ++   P     D+  ++    +  ++PG           G ++  +K+
Sbjct  377  ---DLQKSEDNRSSLQEPLEFYNDHMQRQLGHISVSSTPG---------NGGQAKTSKKY  424

Query  478  HFGLSSSDAEIEYRR-GRSWREGKGSGAW  395
              GL SSDAEI+YRR GRS    KG  AW
Sbjct  425  KMGLCSSDAEIDYRRSGRS----KGDFAW  449



>ref|XP_004961245.1| PREDICTED: uncharacterized protein At1g76660-like [Setaria italica]
Length=528

 Score = 62.4 bits (150),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 53/158 (34%), Positives = 75/158 (47%), Gaps = 25/158 (16%)
 Frame = -3

Query  832  FGFSADEXVSTAQYVEITDVLDDSFSMTPFTSDKSQEQENIQIVSA--DKRTKAEKANKN  659
            FGFSADE V T  YVEI D LD+SFS++PF +     +     + A  D   +A+K +K+
Sbjct  367  FGFSADEIVQTQSYVEIPDALDESFSISPFGNIAPATE-----ICAFNDLPNEAQKVDKS  421

Query  658  MLSPQYCKSGSNHAADVPDSNKTDNCSKKNHGNAFGASP--------GVSDDEDIFSK--  509
             +   Y K G++      +    D+ +K  H + F  +         G+  D   F K  
Sbjct  422  FV---YVKDGTSPKKSA-NQLSIDSPNKVLHLDIFKGTKGGHQCEHEGIVKDSHPFRKAT  477

Query  508  ----MGNSRHGRKHHFGLSSSDAEIEYRRGRSWREGKG  407
                +      +K   G S SDAEIEYRR RS R+  G
Sbjct  478  DEILLKPIEVRKKSPPGHSCSDAEIEYRRARSLRDANG  515



>ref|XP_010478992.1| PREDICTED: uncharacterized protein At1g76660-like isoform X2 
[Camelina sativa]
Length=455

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 51/149 (34%), Positives = 74/149 (50%), Gaps = 19/149 (13%)
 Frame = -3

Query  832  FGFSADEXVSTAQYVEITDVLDDSFSMTPFTS-DKSQEQENIQIVSADKRTKAEKANKNM  656
            FGFSADE ++T+QYVEIT + D SF+M P ++ D +    NI+  S  +      +  N+
Sbjct  321  FGFSADEVIATSQYVEITHLNDGSFTMRPRSALDATSPNCNIKAASEGEGLNFYCSEANL  380

Query  655  LSPQYCKSGSNHA-ADVPDSNKTDNCSKKNHGNAFGASPGVSDDEDIFSKMGNSRHGRKH  479
                  KS  N +    P     D+  ++    +  ++PG           G ++  RK+
Sbjct  381  ---DLQKSEDNRSNLQEPLEFYNDHMQRQLEHISVSSTPG---------NGGQAKTSRKY  428

Query  478  HFGLSSSDAEIEYRR-GRSWREGKGSGAW  395
              GL SSDAEI+YRR GRS    KG   W
Sbjct  429  KMGLCSSDAEIDYRRSGRS----KGDFVW  453



>ref|XP_010478991.1| PREDICTED: uncharacterized protein At1g76660-like isoform X1 
[Camelina sativa]
Length=456

 Score = 58.9 bits (141),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 49/148 (33%), Positives = 75/148 (51%), Gaps = 16/148 (11%)
 Frame = -3

Query  832  FGFSADEXVSTAQYVEITDVLDDSFSMTPFTS-DKSQEQENIQIVSADKRTKAEKANKNM  656
            FGFSADE ++T+QYVEIT + D SF+M P ++ D +    NI+  S  +      +  N 
Sbjct  321  FGFSADEVIATSQYVEITHLNDGSFTMRPRSALDATSPNCNIKAASEGEGLNFYCSEAN-  379

Query  655  LSPQYCKSGSNHAADVPDSNKTDNCSKKNHGNAFGASPGVSDDEDIFSKMGNSRHGRKHH  476
            L  Q  +   ++  +  +    D+  ++    +  ++PG           G ++  RK+ 
Sbjct  380  LDLQKSEDNRSNLQEPLEFYNADHMQRQLEHISVSSTPG---------NGGQAKTSRKYK  430

Query  475  FGLSSSDAEIEYRR-GRSWREGKGSGAW  395
             GL SSDAEI+YRR GRS    KG   W
Sbjct  431  MGLCSSDAEIDYRRSGRS----KGDFVW  454



>ref|XP_010478993.1| PREDICTED: uncharacterized protein At1g76660-like isoform X3 
[Camelina sativa]
Length=454

 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 49/148 (33%), Positives = 75/148 (51%), Gaps = 16/148 (11%)
 Frame = -3

Query  832  FGFSADEXVSTAQYVEITDVLDDSFSMTPFTS-DKSQEQENIQIVSADKRTKAEKANKNM  656
            FGFSADE ++T+QYVEIT + D SF+M P ++ D +    NI+  S  +      +  N 
Sbjct  319  FGFSADEVIATSQYVEITHLNDGSFTMRPRSALDATSPNCNIKAASEGEGLNFYCSEAN-  377

Query  655  LSPQYCKSGSNHAADVPDSNKTDNCSKKNHGNAFGASPGVSDDEDIFSKMGNSRHGRKHH  476
            L  Q  +   ++  +  +    D+  ++    +  ++PG           G ++  RK+ 
Sbjct  378  LDLQKSEDNRSNLQEPLEFYNADHMQRQLEHISVSSTPG---------NGGQAKTSRKYK  428

Query  475  FGLSSSDAEIEYRR-GRSWREGKGSGAW  395
             GL SSDAEI+YRR GRS    KG   W
Sbjct  429  MGLCSSDAEIDYRRSGRS----KGDFVW  452



>ref|NP_001144448.1| hypothetical protein [Zea mays]
 ref|XP_008647674.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACG40606.1| hypothetical protein [Zea mays]
 gb|ACN34850.1| unknown [Zea mays]
 gb|AFW79128.1| hypothetical protein ZEAMMB73_797568 [Zea mays]
Length=530

 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 49/154 (32%), Positives = 74/154 (48%), Gaps = 17/154 (11%)
 Frame = -3

Query  832  FGFSADEXVSTAQYVEITDVLDDSFSMTPFTSDKSQEQENIQIVSADKRTKAEKANKNM-  656
            FGFSADE V +  YV I D +D+SFS++PF ++    +       +D  ++ +KA+K+  
Sbjct  369  FGFSADEIVQSQSYVGIPDAVDESFSISPFGNNAPATE---ICPFSDLPSEVQKADKSCT  425

Query  655  -----LSPQYCKSGSNHAADVPDSNKTDNCSKKNHGNAFGASPGVSDDEDIFSK------  509
                  SP+  KS +  + D P+     +  K   G       G++ D   F +      
Sbjct  426  YVKDGTSPK--KSANQLSIDSPNKVLRLDVFKVTKGGHLSEDEGIARDGHPFRRTTDEIS  483

Query  508  MGNSRHGRKHHFGLSSSDAEIEYRRGRSWREGKG  407
            +      +K   G S SDAEIEYRR RS R+  G
Sbjct  484  LKPIEVRKKSPPGHSCSDAEIEYRRTRSLRDANG  517



>gb|ACN36198.1| unknown [Zea mays]
Length=530

 Score = 58.5 bits (140),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 49/154 (32%), Positives = 74/154 (48%), Gaps = 17/154 (11%)
 Frame = -3

Query  832  FGFSADEXVSTAQYVEITDVLDDSFSMTPFTSDKSQEQENIQIVSADKRTKAEKANKNM-  656
            FGFSADE V +  YV I D +D+SFS++PF ++    +       +D  ++ +KA+K+  
Sbjct  369  FGFSADEIVQSQSYVGIPDAVDESFSISPFGNNAPATE---ICPFSDLPSEVQKADKSCT  425

Query  655  -----LSPQYCKSGSNHAADVPDSNKTDNCSKKNHGNAFGASPGVSDDEDIFSK------  509
                  SP+  KS +  + D P+     +  K   G       G++ D   F +      
Sbjct  426  YVKDGTSPK--KSANQLSIDSPNKVLRLDVFKVTKGGHLSEDEGIARDGHPFRRTTDEIS  483

Query  508  MGNSRHGRKHHFGLSSSDAEIEYRRGRSWREGKG  407
            +      +K   G S SDAEIEYRR RS R+  G
Sbjct  484  LKPIEVRKKSPPGHSCSDAEIEYRRTRSLRDANG  517



>ref|XP_002440239.1| hypothetical protein SORBIDRAFT_09g028275 [Sorghum bicolor]
 gb|EES18669.1| hypothetical protein SORBIDRAFT_09g028275 [Sorghum bicolor]
Length=322

 Score = 53.9 bits (128),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 48/154 (31%), Positives = 71/154 (46%), Gaps = 17/154 (11%)
 Frame = -3

Query  832  FGFSADEXVSTAQYVEITDVLDDSFSMTPFTSDKSQEQENIQIVSADKRTKAEKANKNM-  656
            FGFSADE V +  YV I D +D+SFS++PF ++    +       +D   + +K +K+  
Sbjct  161  FGFSADEIVQSQSYVGIPDAVDESFSISPFGNNAPATE---ICPFSDLPNEVQKVDKSCA  217

Query  655  -----LSPQYCKSGSNHAADVPDSNKTDNCSKKNHGNAFGASPGVSDDEDIFSK------  509
                  SP+  KS +  + D P+     +  K   G       G+  D   F +      
Sbjct  218  YAKDGTSPK--KSANQLSIDSPNKVLRLDVFKGTKGGHQSEDEGIVKDGHPFRRTTDEIS  275

Query  508  MGNSRHGRKHHFGLSSSDAEIEYRRGRSWREGKG  407
            +      +K   G S SDAEIEYRR RS R+  G
Sbjct  276  LKPIEVRKKSLPGHSCSDAEIEYRRTRSLRDANG  309



>gb|ACG47230.1| hypothetical protein [Zea mays]
Length=526

 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 47/148 (32%), Positives = 69/148 (47%), Gaps = 8/148 (5%)
 Frame = -3

Query  832  FGFSADEXVSTAQYVEITDVLDDSFSMTPFTSDKSQEQENIQIVSADKRTKAEKANKNML  653
            FGFSADE V +  YV I D +D+SFS++PF ++    +        ++  K+    K+  
Sbjct  368  FGFSADEIVQSQSYVGIPDAVDESFSISPFGNNTPATEICPFSDLPNEVDKSCAYAKDDT  427

Query  652  SPQYCKSGSNHAADVPDSNKTDNCSKKNHGNAFGASPGVSDDEDIFSKMGNS------RH  491
            SP+  KS +  + D P+     +  K   G        +  D  +F K  +         
Sbjct  428  SPK--KSANQLSTDSPNKVLRLDVFKGTKGGHQSEDECIRKDGHLFRKTADEISLKPIEV  485

Query  490  GRKHHFGLSSSDAEIEYRRGRSWREGKG  407
             +K   G S SDAEIEYRR RS R+  G
Sbjct  486  RKKSLPGHSCSDAEIEYRRTRSLRDANG  513



>ref|NP_001145393.1| hypothetical protein [Zea mays]
 ref|XP_008654760.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACN34629.1| unknown [Zea mays]
 gb|AFW81103.1| hypothetical protein ZEAMMB73_831247 [Zea mays]
Length=526

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 47/148 (32%), Positives = 69/148 (47%), Gaps = 8/148 (5%)
 Frame = -3

Query  832  FGFSADEXVSTAQYVEITDVLDDSFSMTPFTSDKSQEQENIQIVSADKRTKAEKANKNML  653
            FGFSADE V +  YV I D +D+SFS++PF ++    +        ++  K+    K+  
Sbjct  368  FGFSADEIVQSQSYVGIPDAVDESFSISPFGNNTPATEICPFSDLPNEVDKSCAYAKDDT  427

Query  652  SPQYCKSGSNHAADVPDSNKTDNCSKKNHGNAFGASPGVSDDEDIFSKMGNS------RH  491
            SP+  KS +  + D P+     +  K   G        +  D  +F K  +         
Sbjct  428  SPK--KSANQLSTDSPNKVLRLDVFKGTKGGHQSEDECIRKDGHLFRKTADEISLKPIEV  485

Query  490  GRKHHFGLSSSDAEIEYRRGRSWREGKG  407
             +K   G S SDAEIEYRR RS R+  G
Sbjct  486  RKKSLPGHSCSDAEIEYRRTRSLRDANG  513



>gb|EMT30839.1| hypothetical protein F775_17309 [Aegilops tauschii]
Length=548

 Score = 53.1 bits (126),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = -3

Query  832  FGFSADEXVSTAQYVEITDVLDDSFSMTPFTSDKSQEQENIQIVSADKRTKAEKANKNML  653
            FGFSADE V+T  YVEI D LDD FS++PF ++    + +  I   ++  K +K +K++L
Sbjct  402  FGFSADEIVTTQHYVEIPDALDDGFSISPFGNNAPSTEVSPFIDLPNEVQKVDKMDKSLL  461



>ref|XP_011625403.1| PREDICTED: uncharacterized protein At1g76660 [Amborella trichopoda]
Length=495

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  832  FGFSADEXVSTAQYVEITDVLDDSFSMTPFTS  737
            FGFSADE +ST  YVE++DVL+DSF+M PF +
Sbjct  352  FGFSADEIISTPHYVELSDVLEDSFTMCPFPT  383



>gb|ERN11459.1| hypothetical protein AMTR_s00022p00077030 [Amborella trichopoda]
Length=447

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  832  FGFSADEXVSTAQYVEITDVLDDSFSMTPFTS  737
            FGFSADE +ST  YVE++DVL+DSF+M PF +
Sbjct  352  FGFSADEIISTPHYVELSDVLEDSFTMCPFPT  383



>emb|CDY72295.1| BnaCnng76980D, partial [Brassica napus]
Length=391

 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 47/136 (35%), Positives = 66/136 (49%), Gaps = 33/136 (24%)
 Frame = -3

Query  832  FGFSADEXVSTAQYVEITDVLDDSFSMTPFTSDKSQEQENIQIVSADKRTKAEKANKNML  653
            FGFS+D+ +ST+QYVEIT V DDS  + P ++  + + E I +  A +      A+ N+ 
Sbjct  288  FGFSSDDVISTSQYVEITHVQDDS--LRPRSTLDASKDEGINLYGAGE------ASLNLQ  339

Query  652  SPQYCKSGSNHAADVPDSNKTDNCSKKNHGNAFGASPGVSDDEDIFSKMGNSRHGRKHHF  473
                 KSG          N  D     N      ++PG           G ++  RK+  
Sbjct  340  -----KSG----------NLQDPLDMHNDHMRRSSTPG---------NGGQAKTSRKYKT  375

Query  472  GLSSSDAEIEYRR-GR  428
            GL SSDAEI+YRR GR
Sbjct  376  GLCSSDAEIDYRRSGR  391



>ref|XP_008796512.1| PREDICTED: uncharacterized protein At1g76660 isoform X2 [Phoenix 
dactylifera]
Length=448

 Score = 51.2 bits (121),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 20/34 (59%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -3

Query  832  FGFSADEXVSTAQYVEITDVLDDSFSMTPFTSDK  731
            FGFSADE ++T  YVE++D LD+SF+M+PF ++K
Sbjct  352  FGFSADEIITTQNYVELSDALDESFTMSPFPNNK  385



>gb|AGT15878.1| hypothetical protein SHCRBa_027_N23_R_80 [Saccharum hybrid cultivar 
R570]
Length=528

 Score = 51.2 bits (121),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 47/154 (31%), Positives = 70/154 (45%), Gaps = 17/154 (11%)
 Frame = -3

Query  832  FGFSADEXVSTAQYVEITDVLDDSFSMTPFTSDKSQEQENIQIVSADKRTKAEKANKNM-  656
            FGFSADE V +  YV I D +D+SFS++PF ++    +       +D   +  K +K+  
Sbjct  367  FGFSADEIVQSQSYVGIPDAVDESFSISPFGNNAPATE---ICPFSDLPNEVHKVDKSCT  423

Query  655  -----LSPQYCKSGSNHAADVPDSNKTDNCSKKNHGNAFGASPGVSDDEDIFSK------  509
                  SP+  KS +  + D P+     +  K   G       G++ D   F +      
Sbjct  424  YVKDGTSPK--KSANQLSIDSPNKVLRLDVFKGTKGGHQSEDEGIAKDGHPFRRTTDEIS  481

Query  508  MGNSRHGRKHHFGLSSSDAEIEYRRGRSWREGKG  407
            +      +K   G   SDAEIEYRR RS R+  G
Sbjct  482  LKPIEVRKKSPPGHYCSDAEIEYRRTRSLRDANG  515



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1785100074290