BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig11292

Length=877
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009595113.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    310   8e-103   Nicotiana tomentosiformis
ref|XP_009791997.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    308   5e-102   Nicotiana sylvestris
ref|XP_010313808.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    301   2e-99    Solanum lycopersicum
ref|XP_006365208.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    301   3e-99    Solanum tuberosum [potatoes]
ref|XP_009610517.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    298   2e-98    
ref|XP_006350120.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    290   5e-95    Solanum tuberosum [potatoes]
emb|CDP15543.1|  unnamed protein product                                286   3e-93    Coffea canephora [robusta coffee]
ref|XP_011075540.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    285   6e-93    Sesamum indicum [beniseed]
ref|XP_010263394.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    285   6e-93    Nelumbo nucifera [Indian lotus]
gb|KJB26459.1|  hypothetical protein B456_004G242800                    282   1e-91    Gossypium raimondii
gb|KHG30826.1|  UDP-N-acetylglucosamine transferase subunit ALG13       281   2e-91    Gossypium arboreum [tree cotton]
ref|XP_006449494.1|  hypothetical protein CICLE_v10018002mg             280   5e-91    Citrus clementina [clementine]
ref|XP_012089098.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    280   5e-91    Jatropha curcas
ref|XP_007030904.1|  Glycosyltransferase family protein 28 isoform 1    279   1e-90    Theobroma cacao [chocolate]
ref|NP_001236939.1|  uncharacterized protein LOC100526989               278   2e-90    
emb|CAN71397.1|  hypothetical protein VITISV_015184                     278   3e-90    Vitis vinifera
ref|XP_006580946.1|  PREDICTED: uncharacterized protein LOC100526...    277   8e-90    
ref|XP_010094666.1|  UDP-N-acetylglucosamine transferase subunit ...    273   2e-88    Morus notabilis
ref|XP_010927170.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    273   2e-88    Elaeis guineensis
ref|NP_001237879.1|  uncharacterized protein LOC100527305               273   3e-88    Glycine max [soybeans]
ref|XP_008779667.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    272   4e-88    Phoenix dactylifera
ref|XP_004302448.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    272   5e-88    Fragaria vesca subsp. vesca
ref|XP_007143786.1|  hypothetical protein PHAVU_007G101500g             272   7e-88    Phaseolus vulgaris [French bean]
ref|XP_010927169.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    272   1e-87    Elaeis guineensis
gb|KEH36284.1|  UDP-N-acetylglucosamine transferase subunit alg13       271   1e-87    Medicago truncatula
gb|AFK37777.1|  unknown                                                 271   2e-87    Lotus japonicus
ref|XP_002512346.1|  UDP-N-acetylglucosamine transferase subunit ...    270   3e-87    Ricinus communis
gb|AFK33308.1|  unknown                                                 270   4e-87    Lotus japonicus
ref|XP_002265906.2|  PREDICTED: UDP-N-acetylglucosamine transfera...    270   5e-87    Vitis vinifera
ref|XP_010025168.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    269   8e-87    Eucalyptus grandis [rose gum]
ref|XP_002319026.1|  hypothetical protein POPTR_0013s02650g             269   1e-86    Populus trichocarpa [western balsam poplar]
ref|XP_004135629.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    267   4e-86    Cucumis sativus [cucumbers]
ref|XP_008450672.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    266   8e-86    Cucumis melo [Oriental melon]
ref|XP_006382622.1|  hypothetical protein POPTR_0005s03870g             266   9e-86    Populus trichocarpa [western balsam poplar]
gb|EYU36882.1|  hypothetical protein MIMGU_mgv1a014796mg                264   6e-85    Erythranthe guttata [common monkey flower]
gb|KGN66098.1|  hypothetical protein Csa_1G570230                       268   1e-84    Cucumis sativus [cucumbers]
ref|XP_004516873.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    263   1e-84    Cicer arietinum [garbanzo]
ref|XP_008246505.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    263   3e-84    Prunus mume [ume]
ref|XP_011071318.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    263   3e-84    Sesamum indicum [beniseed]
ref|XP_009335624.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    262   4e-84    Pyrus x bretschneideri [bai li]
ref|XP_006433269.1|  hypothetical protein CICLE_v10002655mg             262   5e-84    Citrus clementina [clementine]
ref|XP_011036753.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    261   7e-84    Populus euphratica
ref|XP_007205993.1|  hypothetical protein PRUPE_ppa012235mg             261   1e-83    Prunus persica
ref|XP_008363984.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    260   2e-83    
ref|XP_010695049.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    258   1e-82    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004952465.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    258   1e-82    Setaria italica
ref|XP_003602650.1|  UDP-N-acetylglucosamine transferase subunit ...    258   1e-82    Medicago truncatula
ref|XP_009399620.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    258   1e-82    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010528864.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    257   4e-82    Tarenaya hassleriana [spider flower]
ref|NP_001137095.1|  UDP-N-acetylglucosamine transferase subunit ...    256   1e-81    Zea mays [maize]
ref|NP_001146447.1|  uncharacterized protein LOC100280032               254   3e-81    Zea mays [maize]
ref|XP_006652163.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    252   3e-80    Oryza brachyantha
ref|XP_011023553.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    251   6e-80    Populus euphratica
ref|XP_003569042.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    251   7e-80    Brachypodium distachyon [annual false brome]
ref|XP_003574954.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    249   3e-79    Brachypodium distachyon [annual false brome]
ref|XP_008647742.1|  PREDICTED: uncharacterized protein LOC100280...    249   9e-79    Zea mays [maize]
ref|XP_009145579.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    248   9e-79    Brassica rapa
ref|XP_010235416.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    248   1e-78    Brachypodium distachyon [annual false brome]
ref|XP_011625777.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    248   1e-78    Amborella trichopoda
ref|XP_003633637.2|  PREDICTED: UDP-N-acetylglucosamine transfera...    248   2e-78    
gb|EPS58427.1|  hypothetical protein M569_16387                         247   3e-78    Genlisea aurea
ref|XP_006850982.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    248   4e-78    
emb|CDY54746.1|  BnaAnng13410D                                          245   2e-77    Brassica napus [oilseed rape]
dbj|BAJ95675.1|  predicted protein                                      245   2e-77    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010451443.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    244   4e-77    
emb|CDY40506.1|  BnaC01g20060D                                          244   5e-77    Brassica napus [oilseed rape]
ref|XP_010434782.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    244   6e-77    Camelina sativa [gold-of-pleasure]
ref|XP_010440110.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    242   3e-76    Camelina sativa [gold-of-pleasure]
ref|XP_010434781.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    240   2e-75    Camelina sativa [gold-of-pleasure]
ref|XP_006284614.1|  hypothetical protein CARUB_v10005862mg             238   9e-75    Capsella rubella
dbj|BAK05537.1|  predicted protein                                      236   5e-74    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMS49968.1|  UDP-N-acetylglucosamine transferase subunit ALG13...    235   1e-73    Triticum urartu
ref|XP_006414313.1|  hypothetical protein EUTSA_v10026361mg             235   2e-73    Eutrema salsugineum [saltwater cress]
ref|XP_009610521.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    233   3e-73    
ref|XP_002870137.1|  glycosyltransferase family protein 28              232   3e-72    Arabidopsis lyrata subsp. lyrata
ref|NP_193404.1|  glycosyltransferase family protein 28                 231   5e-72    Arabidopsis thaliana [mouse-ear cress]
ref|XP_011466454.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    225   7e-70    Fragaria vesca subsp. vesca
ref|XP_002442220.1|  hypothetical protein SORBIDRAFT_08g016480          223   4e-69    
ref|XP_008386681.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-N-acetyl...    218   1e-66    
ref|XP_006365209.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    213   2e-65    Solanum tuberosum [potatoes]
gb|KDO59534.1|  hypothetical protein CISIN_1g033065mg                   205   1e-62    Citrus sinensis [apfelsine]
ref|XP_007030905.1|  Glycosyltransferase family protein 28 isoform 2    204   8e-62    
ref|XP_006580949.1|  PREDICTED: uncharacterized protein LOC100526...    192   2e-57    Glycine max [soybeans]
gb|KEH36285.1|  UDP-N-acetylglucosamine transferase subunit alg13       188   1e-55    Medicago truncatula
ref|NP_001046820.1|  Os02g0467700                                       177   1e-51    
ref|XP_002452045.1|  hypothetical protein SORBIDRAFT_04g017490          175   1e-50    
gb|KEH36286.1|  UDP-N-acetylglucosamine transferase subunit alg13       169   1e-48    Medicago truncatula
gb|EMS66641.1|  UDP-N-acetylglucosamine transferase subunit ALG13...    170   6e-48    Triticum urartu
ref|XP_002977286.1|  hypothetical protein SELMODRAFT_232928             169   1e-47    Selaginella moellendorffii
ref|XP_001778109.1|  predicted protein                                  158   1e-43    
ref|XP_007258720.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    157   1e-43    Astyanax mexicanus [blind cave fish]
gb|ADO28273.1|  UDP-n-acetylglucosamine transferase subunit alg13...    157   3e-43    Ictalurus furcatus
ref|NP_001188158.1|  UDP-N-acetylglucosamine transferase subunit ...    155   8e-43    Ictalurus punctatus
ref|XP_001693856.1|  predicted protein                                  155   2e-42    Chlamydomonas reinhardtii
ref|XP_002948842.1|  hypothetical protein VOLCADRAFT_80368              155   2e-42    Volvox carteri f. nagariensis
ref|XP_009783908.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    149   5e-41    Nicotiana sylvestris
ref|XP_009776141.1|  PREDICTED: putative bifunctional UDP-N-acety...    145   3e-39    Nicotiana sylvestris
ref|XP_003059405.1|  glycosyltransferase                                144   6e-38    Micromonas pusilla CCMP1545
ref|XP_007510078.1|  predicted protein                                  142   6e-38    Bathycoccus prasinos
ref|XP_003492450.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    143   8e-38    Bombus impatiens
ref|XP_002734333.2|  PREDICTED: UDP-N-acetylglucosamine transfera...    142   9e-38    Saccoglossus kowalevskii
ref|XP_001122008.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    142   2e-37    Apis mellifera [bee]
ref|XP_003395166.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    142   2e-37    Bombus terrestris [large earth bumblebee]
ref|XP_003703929.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    142   2e-37    Megachile rotundata
ref|XP_003694307.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    141   2e-37    Apis florea [dwarf honeybee]
ref|XP_003389644.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    142   3e-37    Amphimedon queenslandica
ref|XP_006623782.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    141   3e-37    Apis dorsata [rock honeybee]
ref|NP_001134591.1|  UDP-N-acetylglucosamine transferase subunit ...    140   4e-37    Salmo salar
emb|CDQ77121.1|  unnamed protein product                                140   5e-37    Oncorhynchus mykiss
ref|XP_005093619.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    140   6e-37    Aplysia californica
ref|XP_002500823.1|  glycosyltransferase family 1 protein               140   6e-37    Micromonas commoda
ref|XP_010737500.1|  PREDICTED: putative bifunctional UDP-N-acety...    139   1e-36    
gb|AAH76360.1|  Zgc:92907                                               139   2e-36    Danio rerio [leopard danio]
ref|XP_005511882.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    139   2e-36    
ref|NP_001002460.2|  uncharacterized protein LOC436733                  138   4e-36    Danio rerio [leopard danio]
ref|XP_010900795.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    138   4e-36    Esox lucius
ref|NP_001154175.1|  UDP-N-acetylglucosamine transferase subunit ...    138   5e-36    Oncorhynchus mykiss
ref|XP_005850434.1|  hypothetical protein CHLNCDRAFT_34478              138   6e-36    Chlorella variabilis
ref|XP_001626924.1|  predicted protein                                  137   1e-35    Nematostella vectensis
ref|XP_007555127.1|  PREDICTED: putative bifunctional UDP-N-acety...    137   1e-35    Poecilia formosa
ref|XP_003970264.1|  PREDICTED: putative bifunctional UDP-N-acety...    136   2e-35    
ref|XP_005799535.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    135   4e-35    Xiphophorus maculatus
ref|XP_008866975.1|  hypothetical protein H310_04416                    145   8e-35    Aphanomyces invadans
ref|XP_008419042.1|  PREDICTED: putative bifunctional UDP-N-acety...    134   8e-35    Poecilia reticulata
ref|XP_001603451.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    135   8e-35    Nasonia vitripennis
ref|XP_007211172.1|  hypothetical protein PRUPE_ppb021125mg             132   9e-35    
ref|XP_005527465.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    134   9e-35    Pseudopodoces humilis [Tibetan ground-jay]
ref|XP_005723101.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    134   2e-34    Pundamilia nyererei
ref|XP_002603195.1|  hypothetical protein BRAFLDRAFT_115464             134   2e-34    Branchiostoma floridae
ref|XP_003444657.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    133   3e-34    Oreochromis niloticus
ref|NP_001084877.1|  ALG13, UDP-N-acetylglucosaminyltransferase s...    133   3e-34    Xenopus laevis [clawed frog]
ref|XP_004545661.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    133   3e-34    Maylandia zebra
ref|XP_008325117.1|  PREDICTED: putative bifunctional UDP-N-acety...    133   3e-34    Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_003081472.1|  glycosyltransferase 28 domain containing 1 (...    132   7e-34    Ostreococcus tauri
ref|XP_008558491.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    132   1e-33    Microplitis demolitor
ref|XP_010344639.1|  PREDICTED: putative bifunctional UDP-N-acety...    131   1e-33    Saimiri boliviensis boliviensis
ref|XP_008302280.1|  PREDICTED: putative bifunctional UDP-N-acety...    131   1e-33    Stegastes partitus
ref|XP_009828073.1|  hypothetical protein H257_05053                    132   1e-33    Aphanomyces astaci
ref|XP_003262257.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    131   1e-33    Nomascus leucogenys [White-cheeked Gibbon]
emb|CAG09783.1|  unnamed protein product                                131   2e-33    Tetraodon nigroviridis
ref|XP_009233449.1|  PREDICTED: putative bifunctional UDP-N-acety...    131   2e-33    Pongo abelii [orang utan]
gb|AIC57126.1|  ALG13                                                   131   2e-33    synthetic construct
ref|XP_011501018.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    131   2e-33    Ceratosolen solmsi marchali
ref|NP_060936.1|  putative bifunctional UDP-N-acetylglucosamine t...    130   3e-33    Homo sapiens [man]
ref|XP_006136610.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    130   3e-33    Pelodiscus sinensis [Chinese softshell turtle]
ref|XP_006632919.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    130   3e-33    Lepisosteus oculatus
ref|XP_313491.3|  AGAP003699-PA                                         130   3e-33    Anopheles gambiae str. PEST
ref|XP_004886173.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    130   4e-33    
ref|XP_003317684.1|  PREDICTED: putative bifunctional UDP-N-acety...    130   4e-33    
ref|XP_313489.1|  AGAP003697-PA                                         130   6e-33    Anopheles gambiae str. PEST
ref|XP_003918197.1|  PREDICTED: putative bifunctional UDP-N-acety...    129   9e-33    Papio anubis [baboon]
ref|XP_009047433.1|  hypothetical protein LOTGIDRAFT_205122             129   9e-33    Lottia gigantea
ref|XP_004640078.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    129   9e-33    Octodon degus
ref|XP_005323400.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    129   1e-32    Ictidomys tridecemlineatus
ref|XP_004606352.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    129   1e-32    Sorex araneus [Eurasian shrew]
ref|XP_011839878.1|  PREDICTED: putative bifunctional UDP-N-acety...    129   1e-32    Mandrillus leucophaeus
ref|NP_001017108.1|  ALG13, UDP-N-acetylglucosaminyltransferase s...    129   1e-32    Xenopus tropicalis [western clawed frog]
ref|XP_005594452.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    129   1e-32    Macaca fascicularis [crab eating macaque]
ref|XP_004064768.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    129   2e-32    Gorilla gorilla gorilla [lowland gorilla]
ref|XP_004379839.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    128   2e-32    Trichechus manatus latirostris
ref|XP_007990792.1|  PREDICTED: putative bifunctional UDP-N-acety...    128   2e-32    Chlorocebus sabaeus
ref|XP_001420067.1|  predicted protein                                  127   2e-32    Ostreococcus lucimarinus CCE9901
ref|XP_011349728.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    128   3e-32    Ooceraea biroi
ref|NP_796104.2|  glycosyltransferase 28 domain containing 1-like       128   3e-32    Mus musculus [mouse]
ref|XP_010369656.1|  PREDICTED: putative bifunctional UDP-N-acety...    128   3e-32    Rhinopithecus roxellana
ref|XP_011576549.1|  PREDICTED: putative bifunctional UDP-N-acety...    137   3e-32    Aquila chrysaetos canadensis
ref|XP_011808928.1|  PREDICTED: putative bifunctional UDP-N-acety...    128   3e-32    Colobus angolensis palliatus
ref|XP_007613018.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    127   4e-32    
dbj|BAC26271.1|  unnamed protein product                                127   4e-32    Mus musculus [mouse]
gb|KDO26416.1|  hypothetical protein SPRG_08219                         127   4e-32    Saprolegnia parasitica CBS 223.65
gb|AAI19773.1|  Glycosyltransferase 28 domain containing 2              127   4e-32    Mus musculus [mouse]
ref|XP_008066706.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    127   5e-32    Carlito syrichta
ref|XP_004710113.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    127   6e-32    Echinops telfairi [lesser hedgehog tenrec]
ref|XP_011142325.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    127   6e-32    
ref|XP_003035996.1|  glycosyltransferase family 1 protein               127   8e-32    Schizophyllum commune H4-8
ref|XP_002711985.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    127   9e-32    Oryctolagus cuniculus [domestic rabbit]
ref|XP_011167336.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    126   1e-31    Solenopsis invicta [imported red fire ant]
ref|XP_420312.4|  PREDICTED: UDP-N-acetylglucosamine transferase ...    135   2e-31    
ref|NP_080523.2|  putative bifunctional UDP-N-acetylglucosamine t...    126   2e-31    Mus musculus [mouse]
ref|XP_003467615.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    125   2e-31    Cavia porcellus [guinea pig]
ref|XP_010401658.1|  PREDICTED: putative bifunctional UDP-N-acety...    134   2e-31    
dbj|BAB29554.1|  unnamed protein product                                125   2e-31    Mus musculus [mouse]
emb|CBJ31146.1|  beta(1,4)-N-acetylglucosaminyltransferase              125   3e-31    Ectocarpus siliculosus
gb|KIM62082.1|  glycosyltransferase family 1 protein                    125   4e-31    Scleroderma citrinum Foug A
ref|XP_007873839.1|  hypothetical protein PNEG_01866                    125   4e-31    Pneumocystis murina B123
ref|XP_009013587.1|  hypothetical protein HELRODRAFT_75054              125   4e-31    Helobdella robusta
ref|XP_003342343.2|  PREDICTED: UDP-N-acetylglucosamine transfera...    125   4e-31    Monodelphis domestica
gb|KFB52685.1|  AGAP003697-PA-like protein                              125   4e-31    Anopheles sinensis
ref|NP_001013973.1|  UDP-N-acetylglucosamine transferase subunit ...    125   4e-31    Rattus norvegicus [brown rat]
ref|XP_010713738.1|  PREDICTED: putative bifunctional UDP-N-acety...    134   4e-31    
ref|XP_004440556.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    124   5e-31    
ref|XP_004092542.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    125   6e-31    Nomascus leucogenys [White-cheeked Gibbon]
emb|CDS08315.1|  hypothetical protein LRAMOSA02263                      124   6e-31    Lichtheimia ramosa
ref|XP_005087553.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    125   7e-31    Mesocricetus auratus [Syrian golden hamster]
ref|XP_008608779.1|  hypothetical protein SDRG_04869                    124   7e-31    Saprolegnia diclina VS20
ref|XP_002429801.1|  UDP-N-acetylglucosamine transferase subunit ...    124   8e-31    Pediculus humanus corporis [human body lice]
ref|XP_007535904.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    124   9e-31    
ref|XP_011839877.1|  PREDICTED: putative bifunctional UDP-N-acety...    124   9e-31    Mandrillus leucophaeus
ref|XP_012064457.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    124   9e-31    Atta cephalotes
ref|XP_780873.2|  PREDICTED: UDP-N-acetylglucosamine transferase ...    124   1e-30    Strongylocentrotus purpuratus [purple urchin]
gb|EPQ20339.1|  UDP-N-acetylglucosamine transferase subunit ALG13...    124   1e-30    Myotis brandtii
ref|XP_005404699.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    124   1e-30    Chinchilla lanigera
ref|XP_011264081.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    124   1e-30    Camponotus floridanus
ref|XP_001833706.1|  glycosyltransferase 28                             124   1e-30    Coprinopsis cinerea okayama7#130
ref|XP_006889992.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    123   1e-30    Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_003391987.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    122   2e-30    Amphimedon queenslandica
gb|ETN63472.1|  UDP-N-acetyl glucosamine transferase subunit alg13      123   2e-30    Anopheles darlingi [American malaria mosquito]
ref|XP_011808927.1|  PREDICTED: putative bifunctional UDP-N-acety...    123   2e-30    Colobus angolensis palliatus
gb|ELU04680.1|  hypothetical protein CAPTEDRAFT_198131                  123   3e-30    Capitella teleta
gb|KFM67090.1|  UDP-N-acetylglucosamine transferase subunit ALG13...    122   3e-30    Stegodyphus mimosarum
ref|XP_007439408.1|  PREDICTED: putative bifunctional UDP-N-acety...    131   3e-30    
ref|XP_011054909.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    122   6e-30    Acromyrmex echinatior
ref|XP_001893586.1|  glycosyltransferase 28 domain containing 1         121   1e-29    Brugia malayi [agent of lymphatic filariasis]
ref|XP_004659178.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    121   1e-29    Jaculus jaculus
ref|XP_011647069.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    121   1e-29    Pogonomyrmex barbatus
ref|XP_008168290.1|  PREDICTED: putative bifunctional UDP-N-acety...    129   2e-29    
gb|EJW78168.1|  UDP-N-acetyl glucosamine transferase subunit alg13      120   2e-29    Wuchereria bancrofti [agent of lymphatic filariasis]
ref|XP_011708353.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    120   2e-29    Wasmannia auropunctata
ref|XP_001862584.1|  UDP-N-acetyl glucosamine transferase subunit...    120   2e-29    Culex quinquefasciatus
ref|XP_002402326.1|  glycosyltransferase, putative                      120   3e-29    Ixodes scapularis [blacklegged tick]
ref|XP_007893130.1|  PREDICTED: putative bifunctional UDP-N-acety...    128   3e-29    Callorhinchus milii [Australian ghost shark]
ref|XP_008117428.1|  PREDICTED: putative bifunctional UDP-N-acety...    129   3e-29    Anolis carolinensis [Carolina anole]
ref|XP_003262258.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    119   3e-29    Nomascus leucogenys [White-cheeked Gibbon]
ref|XP_010344641.1|  PREDICTED: putative bifunctional UDP-N-acety...    119   3e-29    Saimiri boliviensis boliviensis
ref|XP_007300992.1|  glycosyltransferase family 1 protein               120   3e-29    Stereum hirsutum FP-91666 SS1
gb|KIK94304.1|  glycosyltransferase family 1 protein                    120   4e-29    Paxillus rubicundulus Ve08.2h10
emb|CCJ30335.1|  unnamed protein product                                119   4e-29    Pneumocystis jirovecii
ref|XP_009233451.1|  PREDICTED: putative bifunctional UDP-N-acety...    119   4e-29    
gb|KIK59811.1|  glycosyltransferase family 1 protein                    120   4e-29    Gymnopus luxurians FD-317 M1
gb|KIK49304.1|  glycosyltransferase family 1 protein                    119   5e-29    Suillus luteus UH-Slu-Lm8-n1
ref|NP_001161857.1|  putative bifunctional UDP-N-acetylglucosamin...    118   6e-29    Homo sapiens [man]
ref|XP_004886174.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    118   6e-29    
gb|KII88584.1|  glycosyltransferase family 1 protein                    119   6e-29    Plicaturopsis crispa FD-325 SS-3
ref|XP_004340683.1|  glycosyltransferase family 28 Cterminal doma...    119   6e-29    Acanthamoeba castellanii str. Neff
ref|XP_011866108.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    119   7e-29    Vollenhovia emeryi
ref|XP_004685774.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    119   9e-29    Condylura cristata
ref|XP_005372154.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    127   9e-29    
ref|XP_003317688.1|  PREDICTED: putative bifunctional UDP-N-acety...    117   1e-28    
ref|XP_011420111.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    119   1e-28    
ref|XP_006136612.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    118   1e-28    Pelodiscus sinensis [Chinese softshell turtle]
ref|XP_001663412.1|  AAEL013240-PA                                      118   1e-28    Aedes aegypti
ref|XP_003145497.1|  glycosyltransferase 28 domain containing 1         118   1e-28    Loa loa
ref|XP_004640079.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    117   2e-28    
gb|ERG83634.1|  udp-n-acetylglucosamine transferase subunit alg13...    118   2e-28    
ref|XP_004281595.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    117   2e-28    
gb|KIJ16891.1|  glycosyltransferase family 1 protein                    117   3e-28    Paxillus involutus ATCC 200175
ref|XP_011839880.1|  PREDICTED: putative bifunctional UDP-N-acety...    116   3e-28    Mandrillus leucophaeus
gb|EJU05656.1|  glycosyltransferase family 1 protein                    117   4e-28    Dacryopinax primogenitus
ref|XP_002130123.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    117   4e-28    Ciona intestinalis [sea vase]
ref|XP_005594453.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    116   4e-28    Macaca fascicularis [crab eating macaque]
gb|EPT06200.1|  hypothetical protein FOMPIDRAFT_41749                   118   4e-28    Fomitopsis pinicola FP-58527 SS1
gb|KIZ02065.1|  beta-1,4-N-acetylglucosaminyltransferase                117   4e-28    Monoraphidium neglectum
gb|KIY68617.1|  glycosyltransferase family 1 protein                    116   5e-28    Cylindrobasidium torrendii FP15055 ss-10
emb|CDH52473.1|  glycosyltransferase family 1 protein                   117   5e-28    Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_007990793.1|  PREDICTED: putative bifunctional UDP-N-acety...    115   6e-28    Chlorocebus sabaeus
gb|KJH46296.1|  glycosyltransferase family 28 protein                   117   6e-28    Dictyocaulus viviparus
tpg|DAA34776.1|  TPA: glycosyltransferase                               116   7e-28    Amblyomma variegatum
ref|XP_011808931.1|  PREDICTED: putative bifunctional UDP-N-acety...    115   9e-28    Colobus angolensis palliatus
ref|XP_007395921.1|  glycosyltransferase family 1 protein               116   1e-27    Phanerochaete carnosa HHB-10118-sp
gb|KDQ07932.1|  glycosyltransferase family 1 protein                    116   1e-27    Botryobasidium botryosum FD-172 SS1
gb|KIJ69232.1|  glycosyltransferase family 1 protein                    116   1e-27    Hydnomerulius pinastri MD-312
ref|XP_967385.1|  PREDICTED: UDP-N-acetylglucosamine transferase ...    115   1e-27    Tribolium castaneum [rust-red flour beetle]
ref|XP_007613019.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    115   2e-27    
gb|ETO72335.1|  hypothetical protein F444_11541                         115   2e-27    Phytophthora parasitica P1976
gb|ELV11080.1|  UDP-N-acetylglucosamine transferase subunit ALG13...    120   2e-27    Tupaia chinensis
ref|XP_007385718.1|  glycosyl transferase                               115   2e-27    Punctularia strigosozonata HHB-11173 SS5
ref|XP_007264003.1|  glycosyl transferase                               115   2e-27    Fomitiporia mediterranea MF3/22
ref|XP_008907520.1|  hypothetical protein PPTG_13536                    115   3e-27    Phytophthora parasitica INRA-310
emb|CCI43574.1|  unnamed protein product                                114   3e-27    Albugo candida
ref|XP_002108161.1|  hypothetical protein TRIADDRAFT_18956              114   4e-27    Trichoplax adhaerens
gb|ESA00316.1|  hypothetical protein GLOINDRAFT_69349                   114   4e-27    
gb|KFH65571.1|  hypothetical protein MVEG_09047                         114   4e-27    Mortierella verticillata NRRL 6337
ref|XP_007863433.1|  glycosyl transferase                               114   4e-27    Gloeophyllum trabeum ATCC 11539
gb|EHJ68711.1|  hypothetical protein KGM_00787                          114   6e-27    
ref|XP_010592982.1|  PREDICTED: LOW QUALITY PROTEIN: putative bif...    121   7e-27    
gb|ETL90309.1|  hypothetical protein L917_10969                         114   7e-27    Phytophthora parasitica
ref|XP_005799536.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    112   7e-27    Xiphophorus maculatus
gb|KDR81846.1|  hypothetical protein GALMADRAFT_114604                  114   8e-27    Galerina marginata CBS 339.88
ref|XP_009523405.1|  hypothetical protein PHYSODRAFT_259480             114   8e-27    Phytophthora sojae
dbj|BAC39689.1|  unnamed protein product                                113   8e-27    
gb|KHN85909.1|  UDP-N-acetylglucosamine transferase subunit ALG13...    114   8e-27    
gb|EFX72445.1|  hypothetical protein DAPPUDRAFT_308239                  114   9e-27    
gb|EPB69514.1|  glycosyltransferase family 28 protein                   114   1e-26    
gb|KIO33457.1|  glycosyltransferase family 1 protein                    114   1e-26    
gb|ETI43653.1|  hypothetical protein F443_11478                         113   1e-26    
gb|AFW86392.1|  hypothetical protein ZEAMMB73_944743                    110   2e-26    
ref|XP_006136613.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    111   2e-26    
gb|KDQ33183.1|  glycosyltransferase family 1 protein                    112   2e-26    
ref|XP_009875273.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    111   2e-26    
ref|XP_010344638.1|  PREDICTED: putative bifunctional UDP-N-acety...    119   3e-26    
gb|ELW64964.1|  UDP-N-acetylglucosamine transferase subunit ALG13...    111   3e-26    
ref|XP_010344633.1|  PREDICTED: putative bifunctional UDP-N-acety...    120   3e-26    
ref|XP_010344630.1|  PREDICTED: putative bifunctional UDP-N-acety...    120   3e-26    
ref|XP_005404700.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    111   3e-26    
ref|XP_010344631.1|  PREDICTED: putative bifunctional UDP-N-acety...    119   3e-26    
ref|XP_010344632.1|  PREDICTED: putative bifunctional UDP-N-acety...    119   3e-26    
gb|EMD38396.1|  glycosyltransferase family 1 protein                    112   3e-26    
ref|XP_003743298.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    112   3e-26    
gb|KIL68566.1|  glycosyltransferase family 1 protein                    112   3e-26    
ref|XP_007361183.1|  glycosyl transferase                               113   4e-26    
ref|XP_003262252.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    119   4e-26    
ref|XP_009233457.1|  PREDICTED: putative bifunctional UDP-N-acety...    119   5e-26    
gb|EHB03856.1|  hypothetical protein GW7_15170                          118   5e-26    
gb|ETE63249.1|  UDP-N-acetylglucosamine transferase subunit ALG13...    111   5e-26    
ref|XP_006724758.1|  PREDICTED: putative bifunctional UDP-N-acety...    119   5e-26    
ref|XP_011529331.1|  PREDICTED: putative bifunctional UDP-N-acety...    119   5e-26    
dbj|BAH13790.1|  unnamed protein product                                119   6e-26    
ref|NP_001093392.1|  putative bifunctional UDP-N-acetylglucosamin...    119   6e-26    
ref|XP_011529332.1|  PREDICTED: putative bifunctional UDP-N-acety...    119   6e-26    
emb|CCA17259.1|  UDPNacetylglucosamine transferase subunit putative     111   7e-26    
ref|XP_006724756.1|  PREDICTED: putative bifunctional UDP-N-acety...    119   7e-26    
ref|XP_011529330.1|  PREDICTED: putative bifunctional UDP-N-acety...    119   7e-26    
ref|XP_004861479.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    119   7e-26    
ref|XP_009437804.1|  PREDICTED: putative bifunctional UDP-N-acety...    118   8e-26    
ref|XP_009437803.1|  PREDICTED: putative bifunctional UDP-N-acety...    118   8e-26    
ref|XP_003317683.1|  PREDICTED: putative bifunctional UDP-N-acety...    118   8e-26    
ref|XP_008973803.1|  PREDICTED: LOW QUALITY PROTEIN: putative bif...    118   9e-26    
ref|XP_008576139.1|  PREDICTED: LOW QUALITY PROTEIN: putative bif...    118   9e-26    
ref|XP_006917340.1|  PREDICTED: LOW QUALITY PROTEIN: putative bif...    118   9e-26    
gb|KIM49481.1|  glycosyltransferase family 1 protein                    110   9e-26    
ref|XP_002908025.1|  UDP-N-acetylglucosamine transferase subunit,...    110   1e-25    
ref|XP_005087987.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    109   1e-25    
gb|KIK06561.1|  glycosyltransferase family 1 protein                    110   1e-25    
gb|KFO24078.1|  UDP-N-acetylglucosamine transferase subunit ALG13...    117   1e-25    
ref|XP_003735851.1|  PREDICTED: LOW QUALITY PROTEIN: putative bif...    117   1e-25    
gb|KIM87027.1|  glycosyltransferase family 1 protein                    111   2e-25    
gb|ERL95562.1|  hypothetical protein D910_12823                         110   2e-25    
ref|XP_009196399.1|  PREDICTED: putative bifunctional UDP-N-acety...    117   2e-25    
emb|CCM02397.1|  predicted protein                                      110   2e-25    
ref|XP_004379838.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    117   2e-25    
ref|XP_009196398.1|  PREDICTED: putative bifunctional UDP-N-acety...    117   2e-25    
ref|XP_010787130.1|  PREDICTED: putative bifunctional UDP-N-acety...    109   2e-25    
gb|AFW75816.1|  hypothetical protein ZEAMMB73_804101                    106   2e-25    
ref|XP_009196396.1|  PREDICTED: putative bifunctional UDP-N-acety...    117   2e-25    
ref|XP_009196397.1|  PREDICTED: putative bifunctional UDP-N-acety...    117   2e-25    
ref|XP_001364502.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    109   2e-25    
ref|XP_010305686.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    108   2e-25    
ref|XP_011943073.1|  PREDICTED: putative bifunctional UDP-N-acety...    117   3e-25    
ref|XP_005594442.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    117   3e-25    
ref|XP_011839873.1|  PREDICTED: putative bifunctional UDP-N-acety...    117   3e-25    
ref|XP_011943075.1|  PREDICTED: putative bifunctional UDP-N-acety...    117   3e-25    
ref|XP_011754473.1|  PREDICTED: putative bifunctional UDP-N-acety...    117   3e-25    
ref|XP_003290127.1|  hypothetical protein DICPUDRAFT_88818              113   3e-25    
ref|XP_011943074.1|  PREDICTED: putative bifunctional UDP-N-acety...    117   3e-25    
gb|KIK30957.1|  glycosyltransferase family 1 protein                    109   3e-25    
ref|XP_011943072.1|  PREDICTED: putative bifunctional UDP-N-acety...    117   3e-25    
ref|XP_011754470.1|  PREDICTED: putative bifunctional UDP-N-acety...    117   3e-25    
ref|XP_005323399.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    117   3e-25    
ref|XP_011754472.1|  PREDICTED: putative bifunctional UDP-N-acety...    117   3e-25    
ref|XP_011754471.1|  PREDICTED: putative bifunctional UDP-N-acety...    117   3e-25    
ref|XP_005594441.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    117   3e-25    
ref|XP_005594439.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    117   3e-25    
gb|EHH61153.1|  UDP-N-acetylglucosamine transferase subunit ALG13...    117   3e-25    
ref|XP_011754469.1|  PREDICTED: putative bifunctional UDP-N-acety...    117   3e-25    
ref|XP_001094961.2|  PREDICTED: hypothetical protein LOC706590          117   3e-25    
ref|XP_005594440.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    117   3e-25    
ref|XP_011754468.1|  PREDICTED: putative bifunctional UDP-N-acety...    117   3e-25    
gb|KDR18886.1|  hypothetical protein L798_07334                         109   4e-25    
ref|XP_003801228.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-N-acetyl...    116   4e-25    
ref|XP_007990785.1|  PREDICTED: putative bifunctional UDP-N-acety...    116   4e-25    
gb|KFV67320.1|  UDP-N-acetylglucosamine transferase subunit ALG13       107   4e-25    
gb|KIP09600.1|  glycosyltransferase family 1 protein                    109   4e-25    
ref|XP_007990782.1|  PREDICTED: putative bifunctional UDP-N-acety...    116   4e-25    
ref|XP_002177178.1|  udp-n-acetylglucosamine transferase subunit ...    107   4e-25    
ref|XP_001742777.1|  hypothetical protein                               107   5e-25    
gb|KFO69854.1|  UDP-N-acetylglucosamine transferase subunit ALG13       107   5e-25    
ref|XP_007990784.1|  PREDICTED: putative bifunctional UDP-N-acety...    116   5e-25    
ref|XP_007990783.1|  PREDICTED: putative bifunctional UDP-N-acety...    116   5e-25    
ref|XP_005641757.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-N-acetyl...    116   5e-25    
ref|XP_011808923.1|  PREDICTED: putative bifunctional UDP-N-acety...    116   6e-25    
ref|XP_010369654.1|  PREDICTED: putative bifunctional UDP-N-acety...    116   6e-25    
ref|XP_010369653.1|  PREDICTED: putative bifunctional UDP-N-acety...    115   7e-25    
emb|CDI95538.1|  UDP N acetylglucosamine transferase subunit            109   7e-25    
ref|XP_006732609.1|  PREDICTED: LOW QUALITY PROTEIN: putative bif...    115   7e-25    
ref|XP_004399802.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-N-acetyl...    115   8e-25    
ref|XP_007338550.1|  glycosyltransferase family 1 protein               108   9e-25    
ref|XP_004806425.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-N-acetyl...    115   9e-25    
gb|KDN51789.1|  hypothetical protein RSAG8_00337                        112   1e-24    
ref|XP_004769141.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-N-acetyl...    115   1e-24    
ref|XP_011555322.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    108   1e-24    
gb|KIO13597.1|  glycosyltransferase family 1 protein                    108   1e-24    
emb|CEL51922.1|  hypothetical protein RSOLAG1IB_00459                   113   1e-24    
ref|XP_007954137.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    108   1e-24    
gb|KFQ66621.1|  UDP-N-acetylglucosamine transferase subunit ALG13       105   1e-24    
ref|XP_010601417.1|  PREDICTED: LOW QUALITY PROTEIN: putative bif...    114   2e-24    
ref|XP_007644121.1|  PREDICTED: LOW QUALITY PROTEIN: putative bif...    114   2e-24    
ref|XP_007326903.1|  hypothetical protein AGABI1DRAFT_97972             107   2e-24    
gb|KFO05788.1|  UDP-N-acetylglucosamine transferase subunit ALG13       105   2e-24    
gb|EUC62125.1|  UDP-N-acetylglucosamine transferase subunit ALG13...    112   2e-24    
gb|KEP53866.1|  UDP-N-acetylglucosamine transferase subunit ALG13...    112   2e-24    
gb|KFM00882.1|  UDP-N-acetylglucosamine transferase subunit ALG13       105   2e-24    
ref|XP_006167796.1|  PREDICTED: LOW QUALITY PROTEIN: putative bif...    114   2e-24    
ref|XP_010129202.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    105   3e-24    
ref|XP_009828074.1|  hypothetical protein, variant                      106   3e-24    
ref|XP_006458528.1|  hypothetical protein AGABI2DRAFT_148978            107   3e-24    
ref|XP_009541777.1|  glycosyltransferase family 1 protein               107   3e-24    
gb|EGT52865.1|  hypothetical protein CAEBREN_17936                      107   3e-24    
ref|XP_001878261.1|  glycosyltransferase family 1 protein               107   3e-24    
ref|XP_003365898.2|  PREDICTED: LOW QUALITY PROTEIN: UDP-N-acetyl...    114   3e-24    
ref|XP_006970342.1|  PREDICTED: LOW QUALITY PROTEIN: putative bif...    114   3e-24    
ref|XP_005535602.1|  hypothetical protein, conserved                    106   4e-24    
gb|KFZ49540.1|  UDP-N-acetylglucosamine transferase subunit ALG13       104   4e-24    
sp|Q9D8C3.2|ALG13_MOUSE  RecName: Full=Putative bifunctional UDP-...    113   5e-24    
gb|KFP60250.1|  UDP-N-acetylglucosamine transferase subunit ALG13       104   5e-24    
gb|KFW69834.1|  UDP-N-acetylglucosamine transferase subunit ALG13       104   5e-24    
ref|XP_003110331.1|  hypothetical protein CRE_05659                     106   5e-24    
ref|XP_006080048.1|  PREDICTED: LOW QUALITY PROTEIN: putative bif...    113   6e-24    
ref|XP_006878484.1|  PREDICTED: LOW QUALITY PROTEIN: ALG13, UDP-N...    113   6e-24    
gb|KHJ42266.1|  hypothetical protein D918_07605                         109   7e-24    
ref|XP_003245014.2|  PREDICTED: UDP-N-acetylglucosamine transfera...    105   7e-24    
ref|XP_005886405.1|  PREDICTED: LOW QUALITY PROTEIN: putative bif...    112   7e-24    
ref|XP_010282270.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    103   8e-24    
ref|XP_011224664.1|  PREDICTED: LOW QUALITY PROTEIN: putative bif...    112   9e-24    
ref|XP_003467616.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    112   9e-24    
ref|XP_005673891.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-N-acetyl...    112   1e-23    
ref|XP_006774547.1|  PREDICTED: LOW QUALITY PROTEIN: putative bif...    112   1e-23    
ref|XP_012015554.1|  PREDICTED: LOW QUALITY PROTEIN: putative bif...    112   1e-23    
ref|XP_003584355.1|  PREDICTED: LOW QUALITY PROTEIN: putative bif...    112   1e-23    
ref|XP_005404694.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    112   1e-23    
ref|XP_011962914.1|  PREDICTED: LOW QUALITY PROTEIN: putative bif...    112   1e-23    
ref|XP_005903726.1|  PREDICTED: LOW QUALITY PROTEIN: putative bif...    112   1e-23    
ref|XP_005954079.1|  PREDICTED: LOW QUALITY PROTEIN: putative bif...    112   1e-23    
ref|XP_005404695.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    112   1e-23    
gb|KIJ44085.1|  glycosyltransferase family 1 protein                    104   1e-23    
ref|XP_005404693.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    112   1e-23    
ref|XP_009963575.1|  PREDICTED: putative bifunctional UDP-N-acety...    103   1e-23    
ref|XP_005404692.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    112   2e-23    
ref|XP_005404691.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    111   2e-23    
gb|ETO07447.1|  hypothetical protein RFI_29944                          105   2e-23    
gb|EPY50873.1|  N-acetylglucosaminyldiphosphodolichol N- acetylgl...    104   2e-23    
ref|XP_007115244.1|  PREDICTED: putative bifunctional UDP-N-acety...    111   2e-23    
ref|XP_005700310.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-N-acetyl...    111   2e-23    
ref|XP_006082279.1|  PREDICTED: LOW QUALITY PROTEIN: putative bif...    111   2e-23    
ref|XP_004925490.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    104   2e-23    
ref|XP_002682670.1|  predicted protein                                  104   2e-23    
gb|KDQ60751.1|  glycosyltransferase family 1 protein                    104   2e-23    
ref|XP_004903132.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    104   2e-23    
ref|XP_010994956.1|  PREDICTED: LOW QUALITY PROTEIN: putative bif...    111   2e-23    
ref|XP_010966101.1|  PREDICTED: LOW QUALITY PROTEIN: putative bif...    111   2e-23    
emb|CDO69541.1|  hypothetical protein BN946_scf184785.g46               104   3e-23    
gb|EGT42419.1|  hypothetical protein CAEBREN_20186                      104   3e-23    
ref|XP_008156827.1|  PREDICTED: LOW QUALITY PROTEIN: putative bif...    110   3e-23    
gb|KFQ30936.1|  UDP-N-acetylglucosamine transferase subunit ALG13       102   3e-23    
ref|XP_010157645.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    102   3e-23    
ref|XP_006215493.1|  PREDICTED: LOW QUALITY PROTEIN: putative bif...    110   3e-23    
ref|XP_008851164.1|  PREDICTED: LOW QUALITY PROTEIN: putative bif...    110   4e-23    
ref|XP_007466369.1|  PREDICTED: LOW QUALITY PROTEIN: putative bif...    110   4e-23    
gb|KFP24760.1|  UDP-N-acetylglucosamine transferase subunit ALG13       101   4e-23    
gb|EMD48397.1|  UDPN-acetylglucosamine transferase subunit ALG14,...    106   5e-23    
ref|NP_593269.1|  N-acetylglucosaminyldiphosphodolichol N-acetylg...    103   5e-23    
gb|KFW75402.1|  UDP-N-acetylglucosamine transferase subunit ALG13       101   6e-23    
ref|XP_005705562.1|  beta-1,4-N-acetylglucosaminyltransferase           103   6e-23    
gb|EPX74753.1|  N-acetylglucosaminyldiphosphodolichol N- acetylgl...    102   7e-23    
ref|XP_011204149.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    103   7e-23    
ref|XP_635810.1|  hypothetical protein DDB_G0290339                     106   8e-23    
ref|XP_007843710.1|  glycosyltransferase family 1 protein               102   9e-23    
ref|XP_009310499.1|  putative glycosyltransferase family 28 protein     106   1e-22    
ref|XP_007764272.1|  glycosyltransferase family 1 protein               102   1e-22    
gb|KFV48969.1|  UDP-N-acetylglucosamine transferase subunit ALG13       100   1e-22    
ref|XP_001994826.1|  GH13947                                            102   1e-22    
gb|KFP00699.1|  UDP-N-acetylglucosamine transferase subunit ALG13       100   1e-22    
ref|XP_810209.1|  glycosyltransferase family 28 protein                 105   1e-22    
gb|KFV86671.1|  UDP-N-acetylglucosamine transferase subunit ALG13       100   2e-22    
gb|KGL73758.1|  UDP-N-acetylglucosamine transferase subunit ALG13       100   2e-22    
gb|ENN74375.1|  hypothetical protein YQE_09032                          107   2e-22    
gb|KFO83210.1|  UDP-N-acetylglucosamine transferase subunit ALG13     99.8    2e-22    
ref|XP_008855077.1|  glycosyltransferase family 28 C-terminal dom...    104   2e-22    
gb|KJP85209.1|  hypothetical protein AK88_05168                         102   2e-22    
gb|KFP35702.1|  UDP-N-acetylglucosamine transferase subunit ALG13     99.8    3e-22    
gb|KFV90314.1|  UDP-N-acetylglucosamine transferase subunit ALG13     99.8    3e-22    
gb|KFQ41214.1|  UDP-N-acetylglucosamine transferase subunit ALG13     99.4    3e-22    
ref|XP_009074023.1|  PREDICTED: UDP-N-acetylglucosamine transfera...  99.8    3e-22    
gb|KGB38364.1|  UDP-N-acetylglucosamine transferase subunit ALG13...    102   3e-22    
ref|XP_006161807.1|  PREDICTED: UDP-N-acetylglucosamine transfera...    102   3e-22    
gb|KFQ73430.1|  UDP-N-acetylglucosamine transferase subunit ALG13     99.4    3e-22    
emb|CCO28086.1|  beta-1,4-N-acetylglucosaminyltransferase             99.8    3e-22    
gb|KFZ60744.1|  UDP-N-acetylglucosamine transferase subunit ALG13     99.0    4e-22    
gb|KFP81061.1|  UDP-N-acetylglucosamine transferase subunit ALG13     99.0    4e-22    
ref|XP_006028658.1|  PREDICTED: UDP-N-acetylglucosamine transfera...  99.4    4e-22    
gb|EEC73135.1|  hypothetical protein OsI_07155                        97.8    4e-22    
ref|XP_004345535.2|  hypothetical protein CAOG_05945                    102   5e-22    
ref|XP_655892.1|  hypothetical protein                                  103   7e-22    
emb|CDJ03305.1|  asparagine linked glycosylation 13                     100   7e-22    
ref|XP_002390883.1|  hypothetical protein MPER_09768                    100   7e-22    
ref|XP_002635180.1|  Hypothetical protein CBG11418                      100   7e-22    
ref|XP_009036050.1|  hypothetical protein AURANDRAFT_16227            98.6    1e-21    
ref|XP_001739889.1|  UDP-N-acetylglucosamine transferase subunit ...    102   1e-21    
ref|XP_004261567.1|  hypothetical protein EIN_246900                    102   1e-21    
gb|ESS63657.1|  glycosyltransferase family 28 protein                   103   1e-21    
gb|EKG05806.1|  glycosyltransferase family 28 protein, putative         103   1e-21    
ref|XP_845317.1|  glycosyltransferase family 28 protein                 103   1e-21    
gb|EUB57240.1|  UDP-N-acetylglucosamine transferase subunit ALG13       100   1e-21    
ref|XP_009558298.1|  PREDICTED: putative bifunctional UDP-N-acety...    105   1e-21    
emb|CEI97377.1|  hypothetical protein RMCBS344292_11512               99.4    1e-21    
ref|XP_004220763.1|  glycosyltransferase                              99.8    2e-21    
ref|XP_001358297.2|  GA13043                                          99.4    2e-21    
gb|KKA77119.1|  Glycosyltransferase                                   99.8    2e-21    
ref|XP_011773975.1|  glycosyltransferase family 28 protein, putative    102   2e-21    
ref|XP_011192014.1|  PREDICTED: UDP-N-acetylglucosamine transfera...  99.0    2e-21    
gb|KFR04252.1|  UDP-N-acetylglucosamine transferase subunit ALG13     96.7    2e-21    



>ref|XP_009595113.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog [Nicotiana tomentosiformis]
Length=178

 Score =   310 bits (794),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 144/169 (85%), Positives = 163/169 (96%), Gaps = 0/169 (0%)
 Frame = -2

Query  696  DKRIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPA  517
            +KR+VFVTVGTTCFDALV AVDTAEV+ ELF+KGYTDI++QMGRG+Y+PTKS ++NGSPA
Sbjct  10   EKRLVFVTVGTTCFDALVRAVDTAEVKNELFKKGYTDILIQMGRGSYIPTKSTADNGSPA  69

Query  516  LDYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELA  337
            LDYFTFSSSIA YLKSASLVISHAGSGSIFETL+LGKPLIVVVNEDLMDNHQSELAEELA
Sbjct  70   LDYFTFSSSIADYLKSASLVISHAGSGSIFETLRLGKPLIVVVNEDLMDNHQSELAEELA  129

Query  336  DRKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGFPEE  190
            +RKHL+CARPQTLY+TI+DMDL S+VPYQPGDAKPVAKLIN +LGFP++
Sbjct  130  ERKHLYCARPQTLYKTISDMDLGSLVPYQPGDAKPVAKLINRYLGFPDD  178



>ref|XP_009791997.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog [Nicotiana sylvestris]
 ref|XP_009791998.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog [Nicotiana sylvestris]
Length=185

 Score =   308 bits (789),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 144/179 (80%), Positives = 164/179 (92%), Gaps = 0/179 (0%)
 Frame = -2

Query  726  HMGDGGANGADKRIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPT  547
             MG+      +KR+VF+TVGTTCFDALV AVDT EV+ ELF+KGYTDI++QMGRG+Y+PT
Sbjct  7    QMGERNDTVKEKRLVFLTVGTTCFDALVRAVDTTEVKNELFKKGYTDILIQMGRGSYIPT  66

Query  546  KSASENGSPALDYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDN  367
            KS +ENGSPALDYFTFSSSIA YLKSASLVISHAGSGSIFETL+LGKPLIVVVNEDLMDN
Sbjct  67   KSTAENGSPALDYFTFSSSIADYLKSASLVISHAGSGSIFETLRLGKPLIVVVNEDLMDN  126

Query  366  HQSELAEELADRKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGFPEE  190
            HQSELAEELA+RKHL+CARPQTLY+TI+DMD  S+VPYQPGDAKPVAKLIN +LGFP++
Sbjct  127  HQSELAEELAERKHLYCARPQTLYKTISDMDPGSLVPYQPGDAKPVAKLINRYLGFPDD  185



>ref|XP_010313808.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog [Solanum lycopersicum]
Length=178

 Score =   301 bits (771),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 144/178 (81%), Positives = 162/178 (91%), Gaps = 0/178 (0%)
 Frame = -2

Query  723  MGDGGANGADKRIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTK  544
            MGD      +KR+VFVTVGTT FDALV AVDT EV+KELF+KGYTDI++QMGRG Y+PTK
Sbjct  1    MGDIDDIAKEKRVVFVTVGTTSFDALVRAVDTPEVKKELFKKGYTDILIQMGRGLYIPTK  60

Query  543  SASENGSPALDYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNH  364
            S +ENGSPALDYFT+SSSIA YLKSASLVISHAGSGSIFETL+LGKPLIVVVNEDLMDNH
Sbjct  61   STAENGSPALDYFTYSSSIADYLKSASLVISHAGSGSIFETLRLGKPLIVVVNEDLMDNH  120

Query  363  QSELAEELADRKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGFPEE  190
            QSELAEELA+RKHL+CARPQTLY+TI+DMD  S+VPYQPGDAKPVA+LI  +LGFPE+
Sbjct  121  QSELAEELAERKHLYCARPQTLYKTISDMDPGSLVPYQPGDAKPVAELIYRYLGFPED  178



>ref|XP_006365208.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog isoform X1 [Solanum tuberosum]
Length=178

 Score =   301 bits (770),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 143/178 (80%), Positives = 162/178 (91%), Gaps = 0/178 (0%)
 Frame = -2

Query  723  MGDGGANGADKRIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTK  544
            MGD      +KR+VFVTVGTT FDALV AVDT EV+ ELF+KGYTDI++QMGRG+Y+PT+
Sbjct  1    MGDIDDIAKEKRVVFVTVGTTSFDALVRAVDTLEVKDELFKKGYTDILIQMGRGSYIPTR  60

Query  543  SASENGSPALDYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNH  364
            + +ENGSPALDYFTFSSSIA YLKSASLVISHAGSGSIFETL+LGKPLIVVVNEDLMDNH
Sbjct  61   ATAENGSPALDYFTFSSSIADYLKSASLVISHAGSGSIFETLRLGKPLIVVVNEDLMDNH  120

Query  363  QSELAEELADRKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGFPEE  190
            QSELAEELA+RKHL+CARPQTLY+TI+DM+  S+VPYQPGDAKPVAKLI  +LGFPEE
Sbjct  121  QSELAEELAERKHLYCARPQTLYKTISDMNPGSLVPYQPGDAKPVAKLIYRYLGFPEE  178



>ref|XP_009610517.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009610518.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009610519.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009610520.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog isoform X1 [Nicotiana tomentosiformis]
Length=178

 Score =   298 bits (764),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 139/178 (78%), Positives = 160/178 (90%), Gaps = 0/178 (0%)
 Frame = -2

Query  723  MGDGGANGADKRIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTK  544
            MG+ G    +K++VFVTVGTTCFDALV AVDT E++ ELF KGYT+I++Q+GRG+Y+PTK
Sbjct  1    MGETGGTVKEKKVVFVTVGTTCFDALVRAVDTPELKNELFRKGYTNILIQIGRGSYIPTK  60

Query  543  SASENGSPALDYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNH  364
            S  ENGS  L+YFTFSSSIA YLK ASLVISHAGSGSIFETL+LGKPLIVVVNEDLMDNH
Sbjct  61   STVENGSAVLEYFTFSSSIADYLKEASLVISHAGSGSIFETLRLGKPLIVVVNEDLMDNH  120

Query  363  QSELAEELADRKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGFPEE  190
            QSELAEELA+RKHLFCARPQTLYQTIADMD  S++PYQPGDA+PVAKLIN +LGFP++
Sbjct  121  QSELAEELAERKHLFCARPQTLYQTIADMDTGSLIPYQPGDAEPVAKLINRYLGFPDD  178



>ref|XP_006350120.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit alg13-like 
[Solanum tuberosum]
Length=178

 Score =   290 bits (742),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 138/178 (78%), Positives = 160/178 (90%), Gaps = 0/178 (0%)
 Frame = -2

Query  723  MGDGGANGADKRIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTK  544
            MGD      +KR+VFVTVGTT FDALV AVDT EV+ ELF+KGYTDI++QMGRG+Y+ T+
Sbjct  1    MGDIDDTAKEKRVVFVTVGTTSFDALVRAVDTPEVKHELFKKGYTDILIQMGRGSYILTR  60

Query  543  SASENGSPALDYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNH  364
            +++ENG PALDYFTFSSSIA YLKSASLVISHAGSGSIFETL+LGKPLIVVVNEDLMDNH
Sbjct  61   ASAENGFPALDYFTFSSSIADYLKSASLVISHAGSGSIFETLRLGKPLIVVVNEDLMDNH  120

Query  363  QSELAEELADRKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGFPEE  190
            QSELAEELA+RKHL+CARPQTLY+TI+DMD  S+VPYQPGDAKPVA+LI  +LGF ++
Sbjct  121  QSELAEELAERKHLYCARPQTLYKTISDMDPGSLVPYQPGDAKPVAELIYRYLGFSDD  178



>emb|CDP15543.1| unnamed protein product [Coffea canephora]
Length=178

 Score =   286 bits (731),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 134/178 (75%), Positives = 155/178 (87%), Gaps = 0/178 (0%)
 Frame = -2

Query  723  MGDGGANGADKRIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTK  544
            M +   +   +R VFVTVGTTCFD+LV AVDT EV++ELF+KGYT +++QMGRG+Y+P K
Sbjct  1    MAEADEDLKSRRTVFVTVGTTCFDSLVRAVDTQEVKEELFKKGYTHLLIQMGRGSYIPAK  60

Query  543  SASENGSPALDYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNH  364
            S  ENGS  +D FTFSSSI  YL+SASLVISHAGSGSIFETL+L KPLIVVVNEDLMDNH
Sbjct  61   STGENGSLEVDCFTFSSSITDYLRSASLVISHAGSGSIFETLRLQKPLIVVVNEDLMDNH  120

Query  363  QSELAEELADRKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGFPEE  190
            QSELAEELA+RKHLFCARPQTLYQTIADMDL S++PYQPGDA PVAKL+NS LGFP++
Sbjct  121  QSELAEELAERKHLFCARPQTLYQTIADMDLGSLIPYQPGDAAPVAKLLNSFLGFPDD  178



>ref|XP_011075540.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog [Sesamum indicum]
 ref|XP_011075541.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog [Sesamum indicum]
 ref|XP_011075542.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog [Sesamum indicum]
 ref|XP_011075543.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog [Sesamum indicum]
Length=178

 Score =   285 bits (728),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 134/178 (75%), Positives = 156/178 (88%), Gaps = 0/178 (0%)
 Frame = -2

Query  723  MGDGGANGADKRIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTK  544
            MG+       KR+VFVTVGTTCFD+LV AVDT EVR+ LF+KGYT +++QMGRG+Y+PTK
Sbjct  1    MGEADDGLKSKRVVFVTVGTTCFDSLVRAVDTQEVREALFKKGYTHLVIQMGRGSYIPTK  60

Query  543  SASENGSPALDYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNH  364
            S  E+GS ++DYFTFSSSIA++LKSASLVISHAGSGSIFETL+L KPLIVVVNEDLMDNH
Sbjct  61   STGEDGSLSVDYFTFSSSIAEFLKSASLVISHAGSGSIFETLRLRKPLIVVVNEDLMDNH  120

Query  363  QSELAEELADRKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGFPEE  190
            QSELAEELA+RKHLFCARPQTLY+TI+ MDL+S+V YQPGDA PVAK IN  LGF +E
Sbjct  121  QSELAEELAERKHLFCARPQTLYKTISAMDLDSLVAYQPGDATPVAKFINRFLGFTDE  178



>ref|XP_010263394.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog [Nelumbo nucifera]
 ref|XP_010263395.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog [Nelumbo nucifera]
Length=177

 Score =   285 bits (728),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 138/178 (78%), Positives = 158/178 (89%), Gaps = 1/178 (1%)
 Frame = -2

Query  723  MGDGGANGADKRIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTK  544
            M +   +G  KR VFVTVGTTCFDALV AVDT EV++EL  +GYT +++QMGRG+Y+PTK
Sbjct  1    MEETDESGYPKRTVFVTVGTTCFDALVRAVDTKEVKEELSRRGYTHLLIQMGRGSYIPTK  60

Query  543  SASENGSPALDYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNH  364
            S   +GS A+DYFTFSSSIA+YLKSASLVISHAGSGSIFETL+LGKPLIVVVNEDLMDNH
Sbjct  61   SIG-DGSLAVDYFTFSSSIAEYLKSASLVISHAGSGSIFETLRLGKPLIVVVNEDLMDNH  119

Query  363  QSELAEELADRKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGFPEE  190
            QSELAEELA+RKHLFCARPQTL+QTIA MDLES++PY PGDA+PVAKLIN  LGFPE+
Sbjct  120  QSELAEELAERKHLFCARPQTLHQTIAGMDLESLIPYPPGDARPVAKLINRFLGFPED  177



>gb|KJB26459.1| hypothetical protein B456_004G242800 [Gossypium raimondii]
 gb|KJB26460.1| hypothetical protein B456_004G242800 [Gossypium raimondii]
 gb|KJB26461.1| hypothetical protein B456_004G242800 [Gossypium raimondii]
Length=179

 Score =   282 bits (721),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 133/178 (75%), Positives = 153/178 (86%), Gaps = 0/178 (0%)
 Frame = -2

Query  723  MGDGGANGADKRIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTK  544
            MG+       KR+VFVTVGTTCFDALV   D+ EV+ EL+ +GYTD+++QMGRG+Y+PTK
Sbjct  1    MGEARDGVQVKRVVFVTVGTTCFDALVKVADSQEVKDELYRRGYTDLLIQMGRGSYLPTK  60

Query  543  SASENGSPALDYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNH  364
            S  ++GS A+DYFTFSSSIA +L+SASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNH
Sbjct  61   STGDDGSLAVDYFTFSSSIADHLRSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNH  120

Query  363  QSELAEELADRKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGFPEE  190
            QSELAEELA+RKHL+CARP TL+QTIA MDL  +VPY PGDA PVAKLIN  LGFPEE
Sbjct  121  QSELAEELAERKHLYCARPLTLHQTIASMDLNCLVPYSPGDATPVAKLINRFLGFPEE  178



>gb|KHG30826.1| UDP-N-acetylglucosamine transferase subunit ALG13 [Gossypium 
arboreum]
Length=179

 Score =   281 bits (719),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 133/178 (75%), Positives = 153/178 (86%), Gaps = 0/178 (0%)
 Frame = -2

Query  723  MGDGGANGADKRIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTK  544
            MG+       KR+VFVTVGTTCFDALV   D+ EV+ EL+ +GYTD+++QMGRG+Y+P K
Sbjct  1    MGEARDGVKVKRVVFVTVGTTCFDALVKVADSQEVKDELYRRGYTDLLIQMGRGSYLPIK  60

Query  543  SASENGSPALDYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNH  364
            S  ++GS A+DYFTFSSSIA +L+SASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNH
Sbjct  61   STGDDGSLAVDYFTFSSSIADHLRSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNH  120

Query  363  QSELAEELADRKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGFPEE  190
            QSELAEELA+RKHL+CARP TL+QTIA MDL S+VPY PGDA PVAKLIN  LGFPEE
Sbjct  121  QSELAEELAERKHLYCARPLTLHQTIAGMDLNSLVPYSPGDATPVAKLINRFLGFPEE  178



>ref|XP_006449494.1| hypothetical protein CICLE_v10018002mg [Citrus clementina]
 ref|XP_006467657.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog isoform X1 [Citrus sinensis]
 ref|XP_006467658.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog isoform X2 [Citrus sinensis]
 ref|XP_006467659.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog isoform X3 [Citrus sinensis]
 ref|XP_006467660.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog isoform X4 [Citrus sinensis]
 gb|ESR62734.1| hypothetical protein CICLE_v10018002mg [Citrus clementina]
 gb|KDO77845.1| hypothetical protein CISIN_1g042754mg [Citrus sinensis]
Length=178

 Score =   280 bits (716),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 135/178 (76%), Positives = 155/178 (87%), Gaps = 0/178 (0%)
 Frame = -2

Query  723  MGDGGANGADKRIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTK  544
            MGD   + + KRIVFVTVGTTCFDALV AVDT EV++EL  +GYT +++QMGRGTYVPTK
Sbjct  1    MGDTRDSVSLKRIVFVTVGTTCFDALVKAVDTLEVKQELTRRGYTHLLIQMGRGTYVPTK  60

Query  543  SASENGSPALDYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNH  364
            S  E+G  A+DYFTFSSSIA +L+SASLVISHAGSGSIFETL+ GKPLIVVVNEDLMDNH
Sbjct  61   SLGEDGLMAVDYFTFSSSIADHLRSASLVISHAGSGSIFETLRHGKPLIVVVNEDLMDNH  120

Query  363  QSELAEELADRKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGFPEE  190
            QSELAEELA RKHL+CA PQ+L+Q IA MDLES++PYQPGDA PVAKLIN  LGFP++
Sbjct  121  QSELAEELAARKHLYCAHPQSLHQVIAGMDLESLLPYQPGDATPVAKLINRFLGFPDD  178



>ref|XP_012089098.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog [Jatropha curcas]
 gb|KDP23541.1| hypothetical protein JCGZ_23374 [Jatropha curcas]
Length=180

 Score =   280 bits (716),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 135/179 (75%), Positives = 156/179 (87%), Gaps = 1/179 (1%)
 Frame = -2

Query  723  MGDGGAN-GADKRIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPT  547
            MGDG A     KRIVFVTVGTT FDALV AVDT EV++ELF +GYT +++QMGRG+Y PT
Sbjct  1    MGDGEATVDQKKRIVFVTVGTTLFDALVRAVDTREVKQELFRRGYTHLLIQMGRGSYTPT  60

Query  546  KSASENGSPALDYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDN  367
            KS  E+GS A+DYFTFSSSIA +L+SASLVISHAGSGSIFETL+L KPLIVVVNEDLMDN
Sbjct  61   KSEGEDGSVAVDYFTFSSSIADHLRSASLVISHAGSGSIFETLRLHKPLIVVVNEDLMDN  120

Query  366  HQSELAEELADRKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGFPEE  190
            HQ+ELAEELA+RKHL+CARPQT++ TIADMDLES++PY  GDA PVAKLIN  LGFP++
Sbjct  121  HQTELAEELAERKHLYCARPQTIHHTIADMDLESLLPYPAGDATPVAKLINRFLGFPDD  179



>ref|XP_007030904.1| Glycosyltransferase family protein 28 isoform 1 [Theobroma cacao]
 gb|EOY11406.1| Glycosyltransferase family protein 28 isoform 1 [Theobroma cacao]
Length=178

 Score =   279 bits (713),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 131/178 (74%), Positives = 155/178 (87%), Gaps = 0/178 (0%)
 Frame = -2

Query  723  MGDGGANGADKRIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTK  544
            MG+       KR+VFVTVGTTCFDALV  VD+ +V+ EL  +GYT +++QMGRG+Y+P K
Sbjct  1    MGEAEDGVKPKRVVFVTVGTTCFDALVKVVDSQKVKDELLRRGYTHLLIQMGRGSYLPEK  60

Query  543  SASENGSPALDYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNH  364
            S  ++GS A+DYFTFSSSIA++L+SASLVISHAGSGSIFETL+LGKPLIVVVNEDLMDNH
Sbjct  61   SIGDDGSLAVDYFTFSSSIAEHLRSASLVISHAGSGSIFETLRLGKPLIVVVNEDLMDNH  120

Query  363  QSELAEELADRKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGFPEE  190
            QSELAEELA+RKHL+CARPQTL+QTIA MDLES++PY PGDA PVAKLIN  LGFPE+
Sbjct  121  QSELAEELAERKHLYCARPQTLHQTIASMDLESLLPYSPGDATPVAKLINRFLGFPED  178



>ref|NP_001236939.1| uncharacterized protein LOC100526989 [Glycine max]
 gb|ACU16025.1| unknown [Glycine max]
Length=177

 Score =   278 bits (712),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 134/178 (75%), Positives = 154/178 (87%), Gaps = 1/178 (1%)
 Frame = -2

Query  723  MGDGGANGADKRIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTK  544
            MGD   N   KR+VFVTVGTTCFDALV AVD+  V++ LF KGYT +++QMGRG+Y+PTK
Sbjct  1    MGDDEGNDKKKRVVFVTVGTTCFDALVRAVDSNNVKQALFAKGYTHLLIQMGRGSYLPTK  60

Query  543  SASENGSPALDYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNH  364
            S  + GS A+DYFTFSSSIA +L+SASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNH
Sbjct  61   SEGD-GSLAVDYFTFSSSIADHLRSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNH  119

Query  363  QSELAEELADRKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGFPEE  190
            QSELAEELADRKHL+CA PQTL+QTIA+MDL S+ PY PGDA PVAK IN+ LGFP++
Sbjct  120  QSELAEELADRKHLYCASPQTLHQTIANMDLSSLFPYSPGDATPVAKHINNLLGFPDD  177



>emb|CAN71397.1| hypothetical protein VITISV_015184 [Vitis vinifera]
Length=169

 Score =   278 bits (710),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 130/167 (78%), Positives = 149/167 (89%), Gaps = 0/167 (0%)
 Frame = -2

Query  690  RIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPALD  511
            R VFVTVGTTCFDALV AVDT E ++ELF +GYT +++QMGRG+Y+PTKS  E+GS  +D
Sbjct  3    RTVFVTVGTTCFDALVKAVDTHEFKRELFARGYTHLLIQMGRGSYIPTKSTGEDGSLVVD  62

Query  510  YFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELADR  331
            +FTFSSSIA  L+SASLVISHAGSGSIFETL+L KPLIVVVNEDLMDNHQSELAEELA+R
Sbjct  63   FFTFSSSIADNLRSASLVISHAGSGSIFETLRLRKPLIVVVNEDLMDNHQSELAEELAER  122

Query  330  KHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGFPEE  190
            KHLFCARPQTLYQTIA M+LES++PY PGDA PVAKLIN  LGFP++
Sbjct  123  KHLFCARPQTLYQTIATMNLESLLPYHPGDAAPVAKLINRFLGFPDD  169



>ref|XP_006580946.1| PREDICTED: uncharacterized protein LOC100526989 isoform X1 [Glycine 
max]
 ref|XP_006580947.1| PREDICTED: uncharacterized protein LOC100526989 isoform X2 [Glycine 
max]
 ref|XP_006580948.1| PREDICTED: uncharacterized protein LOC100526989 isoform X3 [Glycine 
max]
 gb|KHN40946.1| UDP-N-acetylglucosamine transferase subunit ALG13 like [Glycine 
soja]
Length=177

 Score =   277 bits (708),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 133/178 (75%), Positives = 154/178 (87%), Gaps = 1/178 (1%)
 Frame = -2

Query  723  MGDGGANGADKRIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTK  544
            MG+   N   KR+VFVTVGTTCFDALV AVD+  V++ LF KGYT +++QMGRG+Y+PTK
Sbjct  1    MGNDEGNDKKKRVVFVTVGTTCFDALVRAVDSNNVKQALFAKGYTHLLIQMGRGSYLPTK  60

Query  543  SASENGSPALDYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNH  364
            S  + GS A+DYFTFSSSIA +L+SASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNH
Sbjct  61   SEGD-GSLAVDYFTFSSSIADHLRSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNH  119

Query  363  QSELAEELADRKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGFPEE  190
            QSELAEELADRKHL+CA PQTL+QTIA+MDL S+ PY PGDA PVAK IN+ LGFP++
Sbjct  120  QSELAEELADRKHLYCASPQTLHQTIANMDLSSLFPYSPGDATPVAKHINNLLGFPDD  177



>ref|XP_010094666.1| UDP-N-acetylglucosamine transferase subunit ALG13-like protein 
[Morus notabilis]
 gb|EXB56544.1| UDP-N-acetylglucosamine transferase subunit ALG13-like protein 
[Morus notabilis]
Length=177

 Score =   273 bits (699),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 129/168 (77%), Positives = 151/168 (90%), Gaps = 0/168 (0%)
 Frame = -2

Query  693  KRIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPAL  514
            ++IVFVTVGTTCFDALV A+DT  V++EL ++GYT +++QMGRG+YVPTKS   NGS A+
Sbjct  10   RKIVFVTVGTTCFDALVRAMDTQVVKQELLKRGYTHLLIQMGRGSYVPTKSEGGNGSLAV  69

Query  513  DYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELAD  334
            DYFTFSSSIA +LKSASLVISHAGSGSIFETL+L KPLIVVVNEDLMDNHQSELAEELA+
Sbjct  70   DYFTFSSSIADHLKSASLVISHAGSGSIFETLRLRKPLIVVVNEDLMDNHQSELAEELAE  129

Query  333  RKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGFPEE  190
            RKHL+CARPQT+ Q IADM+L+S+VPY PGDA PVAKLIN  LGFP++
Sbjct  130  RKHLYCARPQTVNQIIADMNLDSLVPYHPGDATPVAKLINRFLGFPDD  177



>ref|XP_010927170.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog isoform X2 [Elaeis guineensis]
 ref|XP_010927171.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog isoform X2 [Elaeis guineensis]
Length=178

 Score =   273 bits (698),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 130/176 (74%), Positives = 155/176 (88%), Gaps = 1/176 (1%)
 Frame = -2

Query  714  GGANGADKR-IVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSA  538
            G ++G + R +VFVTVGTTCFDAL+ AVD+  V++EL  KGYTD+++QMGRGTYVP+K +
Sbjct  3    GASDGIESRKMVFVTVGTTCFDALIKAVDSQHVKEELSRKGYTDLLIQMGRGTYVPSKFS  62

Query  537  SENGSPALDYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQS  358
             E+GS A+DYFTFS SIA YL+SASL+ISHAGSGSIFETL+LGKPLIVVVNEDLMDNHQ 
Sbjct  63   GEDGSLAVDYFTFSPSIADYLRSASLIISHAGSGSIFETLRLGKPLIVVVNEDLMDNHQI  122

Query  357  ELAEELADRKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGFPEE  190
            ELAEELADRKHLFCARPQTL+QTI  MDL+S++PY PGDA PVAKLI++ LGFP +
Sbjct  123  ELAEELADRKHLFCARPQTLHQTIEVMDLKSLIPYPPGDAVPVAKLIDNFLGFPAD  178



>ref|NP_001237879.1| uncharacterized protein LOC100527305 [Glycine max]
 gb|ACU16377.1| unknown [Glycine max]
 gb|KHN48143.1| UDP-N-acetylglucosamine transferase subunit ALG13 like [Glycine 
soja]
Length=175

 Score =   273 bits (698),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 127/174 (73%), Positives = 152/174 (87%), Gaps = 0/174 (0%)
 Frame = -2

Query  711  GANGADKRIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASE  532
            G +   +R+VFVTVGTTCFDALV A+D+  V+K LF KGYT +++QMGRG+Y+PTKS  +
Sbjct  2    GNDDMTERVVFVTVGTTCFDALVRAIDSDNVKKALFAKGYTHLLIQMGRGSYLPTKSEGD  61

Query  531  NGSPALDYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSEL  352
            + S A+DYFTFSSSIA +L+SASLVISHAGSGSIFETL+LGKPL+VVVN+DLMDNHQSEL
Sbjct  62   DCSLAVDYFTFSSSIADHLRSASLVISHAGSGSIFETLRLGKPLVVVVNQDLMDNHQSEL  121

Query  351  AEELADRKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGFPEE  190
            AEELADRKHL+CA PQTL+QTIADMDL S++PY PGDA PVAK IN  LGFP++
Sbjct  122  AEELADRKHLYCASPQTLHQTIADMDLSSLLPYSPGDATPVAKHINRFLGFPDD  175



>ref|XP_008779667.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog [Phoenix dactylifera]
 ref|XP_008779668.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog [Phoenix dactylifera]
Length=175

 Score =   272 bits (696),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 130/178 (73%), Positives = 153/178 (86%), Gaps = 3/178 (2%)
 Frame = -2

Query  723  MGDGGANGADKRIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTK  544
            MG+G  +   +++VFVTVGTTCFDALV AVD+ +V+ EL  KGYTD+++QMGRGTYVP+K
Sbjct  1    MGNGKES---RKMVFVTVGTTCFDALVKAVDSQQVKDELLRKGYTDLLIQMGRGTYVPSK  57

Query  543  SASENGSPALDYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNH  364
             + E+GS A+DYFTFS SIA YL+SASL+ISH GSGSIFETL+LGKPLIVVVNEDLMDNH
Sbjct  58   FSGEDGSLAVDYFTFSPSIADYLRSASLIISHPGSGSIFETLRLGKPLIVVVNEDLMDNH  117

Query  363  QSELAEELADRKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGFPEE  190
            QSELAEELADRKHLFCAR QTL+QTI  MDLES++PY PGDA PVA L N+ LGFP +
Sbjct  118  QSELAEELADRKHLFCARSQTLHQTIKVMDLESLIPYPPGDAAPVANLFNNFLGFPAD  175



>ref|XP_004302448.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog [Fragaria vesca subsp. vesca]
 ref|XP_011466318.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog [Fragaria vesca subsp. vesca]
 ref|XP_011466319.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog [Fragaria vesca subsp. vesca]
Length=178

 Score =   272 bits (696),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 130/178 (73%), Positives = 150/178 (84%), Gaps = 0/178 (0%)
 Frame = -2

Query  723  MGDGGANGADKRIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTK  544
            MGD       K+ VFVTVGTT FDALVNAVDT EV++EL+ +GYT+I++QMGRG+Y+P+K
Sbjct  1    MGDTEVRMKSKKTVFVTVGTTSFDALVNAVDTREVKEELWRRGYTEILIQMGRGSYIPSK  60

Query  543  SASENGSPALDYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNH  364
            S   + S A+DYFTFSSSIA +L++ASLVISHAGSGSIFETL LGKPLIVVVNEDLMDNH
Sbjct  61   SEGGDDSIAVDYFTFSSSIADHLRAASLVISHAGSGSIFETLWLGKPLIVVVNEDLMDNH  120

Query  363  QSELAEELADRKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGFPEE  190
            QSELAEELADRKHL+CARPQTL   IADM LES++PY PGD  PVAKLIN  LGF E+
Sbjct  121  QSELAEELADRKHLYCARPQTLCHIIADMKLESLIPYHPGDTTPVAKLINRFLGFSED  178



>ref|XP_007143786.1| hypothetical protein PHAVU_007G101500g [Phaseolus vulgaris]
 gb|ESW15780.1| hypothetical protein PHAVU_007G101500g [Phaseolus vulgaris]
Length=177

 Score =   272 bits (695),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 131/178 (74%), Positives = 152/178 (85%), Gaps = 1/178 (1%)
 Frame = -2

Query  723  MGDGGANGADKRIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTK  544
            MG+   +  +KR+VFVTVGTTCFDALV AVD+  +++ LF KGYT +++QMGRG+Y+P+K
Sbjct  1    MGNDEVSDKEKRVVFVTVGTTCFDALVRAVDSNIIKQALFAKGYTHLLIQMGRGSYIPSK  60

Query  543  SASENGSPALDYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNH  364
            S   NGS A+DYFTFSSSIA YL+SASLVISHAGSGSIFETL+L KPLIVVVNEDLMDNH
Sbjct  61   SEG-NGSLAVDYFTFSSSIAVYLRSASLVISHAGSGSIFETLRLAKPLIVVVNEDLMDNH  119

Query  363  QSELAEELADRKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGFPEE  190
            QSELAEELADRKHL+CA PQTL QTIA MDL S+ PY PGDA PVAK INS LGFP++
Sbjct  120  QSELAEELADRKHLYCASPQTLQQTIAHMDLSSLFPYSPGDATPVAKHINSFLGFPDD  177



>ref|XP_010927169.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog isoform X1 [Elaeis guineensis]
Length=202

 Score =   272 bits (696),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 130/176 (74%), Positives = 155/176 (88%), Gaps = 1/176 (1%)
 Frame = -2

Query  714  GGANGADKR-IVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSA  538
            G ++G + R +VFVTVGTTCFDAL+ AVD+  V++EL  KGYTD+++QMGRGTYVP+K +
Sbjct  27   GASDGIESRKMVFVTVGTTCFDALIKAVDSQHVKEELSRKGYTDLLIQMGRGTYVPSKFS  86

Query  537  SENGSPALDYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQS  358
             E+GS A+DYFTFS SIA YL+SASL+ISHAGSGSIFETL+LGKPLIVVVNEDLMDNHQ 
Sbjct  87   GEDGSLAVDYFTFSPSIADYLRSASLIISHAGSGSIFETLRLGKPLIVVVNEDLMDNHQI  146

Query  357  ELAEELADRKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGFPEE  190
            ELAEELADRKHLFCARPQTL+QTI  MDL+S++PY PGDA PVAKLI++ LGFP +
Sbjct  147  ELAEELADRKHLFCARPQTLHQTIEVMDLKSLIPYPPGDAVPVAKLIDNFLGFPAD  202



>gb|KEH36284.1| UDP-N-acetylglucosamine transferase subunit alg13 [Medicago truncatula]
Length=177

 Score =   271 bits (694),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 131/178 (74%), Positives = 152/178 (85%), Gaps = 1/178 (1%)
 Frame = -2

Query  723  MGDGGANGADKRIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTK  544
            MGD   +   +R+VF+TVGTTCFDALV AVD+  V+KEL  KGYT ++VQMGRG+YVPTK
Sbjct  1    MGDEDGSDKSRRVVFLTVGTTCFDALVRAVDSENVKKELLAKGYTHLLVQMGRGSYVPTK  60

Query  543  SASENGSPALDYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNH  364
            S  E GS A+DYFTFSSSIA +L+SASLVISHAGSGSIFETL+L KPLIVVVNEDLMDNH
Sbjct  61   SEGE-GSLAVDYFTFSSSIADHLRSASLVISHAGSGSIFETLRLRKPLIVVVNEDLMDNH  119

Query  363  QSELAEELADRKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGFPEE  190
            QSELAEELA+ KHL+CA PQTL+QT+ADMDL S++PY PGDA PVAK IN  LGFP++
Sbjct  120  QSELAEELANTKHLYCASPQTLHQTVADMDLNSLLPYTPGDATPVAKHINRFLGFPDD  177



>gb|AFK37777.1| unknown [Lotus japonicus]
Length=177

 Score =   271 bits (692),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 130/178 (73%), Positives = 152/178 (85%), Gaps = 1/178 (1%)
 Frame = -2

Query  723  MGDGGANGADKRIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTK  544
            M D   +   +R+VFVTVGTTCFDALV AVD+  V++ELF KGYT +I+QMGRG+YVP K
Sbjct  1    MEDEEGDQKTRRVVFVTVGTTCFDALVRAVDSQNVKQELFAKGYTHLIIQMGRGSYVPNK  60

Query  543  SASENGSPALDYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNH  364
            S  + GS A+DYFTFSSSIA +L+SASLVISHAGSGSIFE+L+LGKPL+VVVNEDLMDNH
Sbjct  61   SEGD-GSLAVDYFTFSSSIADHLRSASLVISHAGSGSIFESLRLGKPLLVVVNEDLMDNH  119

Query  363  QSELAEELADRKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGFPEE  190
            QSELAEELA+RKHL+CA PQT+ QTIADMDL S++PY PGDA PVAK IN  LGFPE+
Sbjct  120  QSELAEELANRKHLYCASPQTILQTIADMDLNSLLPYSPGDATPVAKHINRFLGFPED  177



>ref|XP_002512346.1| UDP-N-acetylglucosamine transferase subunit alg13, putative [Ricinus 
communis]
 gb|EEF49798.1| UDP-N-acetylglucosamine transferase subunit alg13, putative [Ricinus 
communis]
Length=178

 Score =   270 bits (691),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 128/178 (72%), Positives = 151/178 (85%), Gaps = 0/178 (0%)
 Frame = -2

Query  723  MGDGGANGADKRIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTK  544
            M D       KR+VFVTVGTT FDALV AVDT +V+++LF KGYT +++QMGRG+Y PTK
Sbjct  1    MEDTLDQNKKKRMVFVTVGTTLFDALVRAVDTEQVKQQLFRKGYTHLLIQMGRGSYTPTK  60

Query  543  SASENGSPALDYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNH  364
            +  E+GS A+DYFTFSSSIA +L+SASLVISHAGSGSIFETL+L KPLIVVVNEDLMDNH
Sbjct  61   TEGEDGSLAVDYFTFSSSIADHLRSASLVISHAGSGSIFETLRLQKPLIVVVNEDLMDNH  120

Query  363  QSELAEELADRKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGFPEE  190
            QSELAEELA+RK+L+CARPQTL+  IADMDLES++PY  GDA PV KLIN  LGFP++
Sbjct  121  QSELAEELAERKYLYCARPQTLHHIIADMDLESLLPYSAGDATPVVKLINRFLGFPDD  178



>gb|AFK33308.1| unknown [Lotus japonicus]
Length=177

 Score =   270 bits (690),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 129/178 (72%), Positives = 152/178 (85%), Gaps = 1/178 (1%)
 Frame = -2

Query  723  MGDGGANGADKRIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTK  544
            M DG  +   +R+VFVTVGT CFDALV AVD+  V+++LF KGYT +I+QMGRG+YVPTK
Sbjct  1    MEDGEGDQKTRRVVFVTVGTACFDALVRAVDSHNVKQDLFAKGYTHLIIQMGRGSYVPTK  60

Query  543  SASENGSPALDYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNH  364
            S  + GS A+DYFTFSSSIA +L+SASLVISHAGSGSIFETL+LGKPL+VVVNEDLMDNH
Sbjct  61   SEGD-GSLAVDYFTFSSSIADHLRSASLVISHAGSGSIFETLRLGKPLLVVVNEDLMDNH  119

Query  363  QSELAEELADRKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGFPEE  190
            QSEL EELA+RKHL+CA PQT+ QTIADMDL S++PY PGDA PVAK IN  LGFP++
Sbjct  120  QSELVEELANRKHLYCASPQTILQTIADMDLNSLLPYSPGDATPVAKHINRFLGFPDD  177



>ref|XP_002265906.2| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog [Vitis vinifera]
 ref|XP_010646842.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog [Vitis vinifera]
 emb|CBI18624.3| unnamed protein product [Vitis vinifera]
Length=178

 Score =   270 bits (689),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 129/178 (72%), Positives = 148/178 (83%), Gaps = 0/178 (0%)
 Frame = -2

Query  723  MGDGGANGADKRIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTK  544
            MGD       +R VFVTVGTTCFDALV AVDT E +KEL  +GYT +++QMGRG+Y P K
Sbjct  1    MGDSDDGIKSERTVFVTVGTTCFDALVKAVDTQEFKKELSARGYTHLLIQMGRGSYFPKK  60

Query  543  SASENGSPALDYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNH  364
            S  E+GS  +DYF FSSSIA  L+SASLVISHAGSGSIFETL+L KPLIVVVNEDLMDNH
Sbjct  61   STGEDGSLVVDYFIFSSSIADNLRSASLVISHAGSGSIFETLRLRKPLIVVVNEDLMDNH  120

Query  363  QSELAEELADRKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGFPEE  190
            QSELAEELA+RKHLFCA PQTL+QT+A M+LES++PY PGDA PVAKLIN  LGFP++
Sbjct  121  QSELAEELAERKHLFCAHPQTLFQTVASMNLESLLPYHPGDAAPVAKLINRFLGFPDD  178



>ref|XP_010025168.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog [Eucalyptus grandis]
 gb|KCW61763.1| hypothetical protein EUGRSUZ_H04472 [Eucalyptus grandis]
Length=178

 Score =   269 bits (688),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 129/178 (72%), Positives = 148/178 (83%), Gaps = 0/178 (0%)
 Frame = -2

Query  723  MGDGGANGADKRIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTK  544
            MGD       KR  FVTVGTTCFDALV AVDT EV++EL  +GYTD+++QMGRGTY P K
Sbjct  1    MGDAEDGVRPKRTAFVTVGTTCFDALVRAVDTREVQQELSARGYTDLVIQMGRGTYTPKK  60

Query  543  SASENGSPALDYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNH  364
            S  E+GS  +DYFTFS SI  YL+SASLVISHAGSGSIFETL+LGKPLIVVVNEDLMDNH
Sbjct  61   SNGEDGSLVVDYFTFSPSIVDYLRSASLVISHAGSGSIFETLRLGKPLIVVVNEDLMDNH  120

Query  363  QSELAEELADRKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGFPEE  190
            Q+ELAEELA+RKHL+CARPQ LY+TIADMD+ES++PY  GDA PVAK IN  LGF ++
Sbjct  121  QTELAEELAERKHLYCARPQALYKTIADMDVESLLPYVSGDAAPVAKHINRFLGFSDD  178



>ref|XP_002319026.1| hypothetical protein POPTR_0013s02650g [Populus trichocarpa]
 gb|EEE94949.1| hypothetical protein POPTR_0013s02650g [Populus trichocarpa]
Length=179

 Score =   269 bits (688),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 127/179 (71%), Positives = 155/179 (87%), Gaps = 1/179 (1%)
 Frame = -2

Query  723  MGDGGAN-GADKRIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPT  547
            MGD G +   +K++VFVTVGTT FDALV  VDT EV++EL  KGYTD+++QMGRG+Y PT
Sbjct  1    MGDSGDSVKQEKKVVFVTVGTTLFDALVRTVDTKEVKQELLRKGYTDLVIQMGRGSYTPT  60

Query  546  KSASENGSPALDYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDN  367
            K    +GS A+DYFTFS SIA +L+SASLVISHAGSGS+FETLQLGKPLIVVVNEDLMDN
Sbjct  61   KCDGGHGSLAVDYFTFSPSIADHLRSASLVISHAGSGSVFETLQLGKPLIVVVNEDLMDN  120

Query  366  HQSELAEELADRKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGFPEE  190
            HQSELAEELA+RKHL+CA PQTL+QTI+DM++ES++PY  GDA P+AKL+N+ LGFP++
Sbjct  121  HQSELAEELAERKHLYCAHPQTLHQTISDMNVESLLPYPSGDATPLAKLMNTFLGFPDD  179



>ref|XP_004135629.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog [Cucumis sativus]
 ref|XP_011659902.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog [Cucumis sativus]
Length=177

 Score =   267 bits (683),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 129/178 (72%), Positives = 151/178 (85%), Gaps = 1/178 (1%)
 Frame = -2

Query  723  MGDGGANGADKRIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTK  544
            MGD    G   R+VFVTVGTT FDALV AVDT +V++ L+ +GYT +++QMGRGTY PTK
Sbjct  1    MGDSEVGGKLTRMVFVTVGTTSFDALVRAVDTEQVKQILYARGYTHLLIQMGRGTYNPTK  60

Query  543  SASENGSPALDYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNH  364
            S  E+G   +DYF+FSSSIA +LKSASLVISHAGSGSIFETL+LGKPLIVVVNEDLMDNH
Sbjct  61   SHGEDGL-VVDYFSFSSSIADHLKSASLVISHAGSGSIFETLRLGKPLIVVVNEDLMDNH  119

Query  363  QSELAEELADRKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGFPEE  190
            Q ELAEELA+RKHL+CARPQTL+QTI  ++LES++PY PGDAKPVA LIN  LGFPE+
Sbjct  120  QIELAEELAERKHLYCARPQTLHQTIESLNLESIIPYTPGDAKPVAALINRFLGFPED  177



>ref|XP_008450672.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog [Cucumis melo]
 ref|XP_008450674.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog [Cucumis melo]
 ref|XP_008450675.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog [Cucumis melo]
Length=177

 Score =   266 bits (681),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 129/178 (72%), Positives = 151/178 (85%), Gaps = 1/178 (1%)
 Frame = -2

Query  723  MGDGGANGADKRIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTK  544
            MGD    G   R+VFVTVGTTCFDALV AVDT +V++ L+ +GYT +++QMGRGTY PTK
Sbjct  1    MGDSEVGGKLTRMVFVTVGTTCFDALVRAVDTEQVKQILYARGYTHLLIQMGRGTYNPTK  60

Query  543  SASENGSPALDYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNH  364
            S  E+G   +DYF+FSSSIA +LKSASLVISHAGSGSIFETL+LGKPLIVVVNEDLMDNH
Sbjct  61   SHGEDGL-VVDYFSFSSSIADHLKSASLVISHAGSGSIFETLRLGKPLIVVVNEDLMDNH  119

Query  363  QSELAEELADRKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGFPEE  190
            Q ELAEELA+RKHL+ ARPQTL+QTI  ++LES++PY PGDAKPVA LIN  LGFPE+
Sbjct  120  QIELAEELAERKHLYYARPQTLHQTIESLNLESIIPYTPGDAKPVAALINRFLGFPED  177



>ref|XP_006382622.1| hypothetical protein POPTR_0005s03870g [Populus trichocarpa]
 gb|ERP60419.1| hypothetical protein POPTR_0005s03870g [Populus trichocarpa]
Length=179

 Score =   266 bits (681),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 125/169 (74%), Positives = 148/169 (88%), Gaps = 0/169 (0%)
 Frame = -2

Query  696  DKRIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPA  517
            +K++VFVTVGTT FDALV  VDT EV++EL   GYT +I+QMGRG+Y P KS  ++GS A
Sbjct  11   EKKVVFVTVGTTLFDALVRTVDTKEVKQELLRNGYTHLIIQMGRGSYTPAKSEGKDGSLA  70

Query  516  LDYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELA  337
            +DYFTFS SIA +L+SASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELA
Sbjct  71   VDYFTFSPSIADHLRSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELA  130

Query  336  DRKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGFPEE  190
            +RKHL+CA PQTL+QTI+DM++ES++PY PGDA  VAKLIN  LGFP++
Sbjct  131  ERKHLYCAHPQTLHQTISDMNIESLLPYPPGDAAAVAKLINRFLGFPDD  179



>gb|EYU36882.1| hypothetical protein MIMGU_mgv1a014796mg [Erythranthe guttata]
Length=178

 Score =   264 bits (675),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 123/178 (69%), Positives = 152/178 (85%), Gaps = 0/178 (0%)
 Frame = -2

Query  723  MGDGGANGADKRIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTK  544
            M D   +   K++VFVTVGTT FD+LV +VDT EV++ LF+KGYT +++QMGRG+Y+PTK
Sbjct  1    MSDANDSSDSKKVVFVTVGTTSFDSLVKSVDTREVKEALFKKGYTHLLIQMGRGSYIPTK  60

Query  543  SASENGSPALDYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNH  364
            SA E+GS ++D+FTFSSSIA++LKSASLVISHAGSGSIFETL+L KPLIVVVNEDLMDNH
Sbjct  61   SAGEDGSLSVDHFTFSSSIAEFLKSASLVISHAGSGSIFETLKLRKPLIVVVNEDLMDNH  120

Query  363  QSELAEELADRKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGFPEE  190
            QSELAEELA+R HLFCA P TLY+T++ MD +S+V YQPG+A PVAK I+  LGF +E
Sbjct  121  QSELAEELAERNHLFCAHPNTLYETVSAMDSDSLVAYQPGNATPVAKFIDRFLGFTDE  178



>gb|KGN66098.1| hypothetical protein Csa_1G570230 [Cucumis sativus]
Length=307

 Score =   268 bits (685),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 133/192 (69%), Positives = 157/192 (82%), Gaps = 1/192 (1%)
 Frame = -2

Query  765  PLRIWVSVKIVYFHMGDGGANGADKRIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTD  586
            P+   VS  I+   MGD    G   R+VFVTVGTT FDALV AVDT +V++ L+ +GYT 
Sbjct  117  PVLQGVSGCIIKLGMGDSEVGGKLTRMVFVTVGTTSFDALVRAVDTEQVKQILYARGYTH  176

Query  585  IIVQMGRGTYVPTKSASENGSPALDYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGK  406
            +++QMGRGTY PTKS  E+G   +DYF+FSSSIA +LKSASLVISHAGSGSIFETL+LGK
Sbjct  177  LLIQMGRGTYNPTKSHGEDGL-VVDYFSFSSSIADHLKSASLVISHAGSGSIFETLRLGK  235

Query  405  PLIVVVNEDLMDNHQSELAEELADRKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVA  226
            PLIVVVNEDLMDNHQ ELAEELA+RKHL+CARPQTL+QTI  ++LES++PY PGDAKPVA
Sbjct  236  PLIVVVNEDLMDNHQIELAEELAERKHLYCARPQTLHQTIESLNLESIIPYTPGDAKPVA  295

Query  225  KLINSHLGFPEE  190
             LIN  LGFPE+
Sbjct  296  ALINRFLGFPED  307



>ref|XP_004516873.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog isoform X1 [Cicer arietinum]
 ref|XP_004516874.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog isoform X2 [Cicer arietinum]
Length=177

 Score =   263 bits (673),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 127/178 (71%), Positives = 150/178 (84%), Gaps = 1/178 (1%)
 Frame = -2

Query  723  MGDGGANGADKRIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTK  544
            MG    +   +R+VFVTVGTTCFDALV A+D+  V+KEL  KGYT +++QMGRG+YVPTK
Sbjct  1    MGGEERSEKTRRVVFVTVGTTCFDALVRAMDSENVKKELLAKGYTHLLIQMGRGSYVPTK  60

Query  543  SASENGSPALDYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNH  364
            S  E GS ++D+FTFSSSIA +L+SASLVISHAGSGSIFETL+L KPLIVVVNEDLMDNH
Sbjct  61   SEGE-GSLSVDHFTFSSSIADHLRSASLVISHAGSGSIFETLRLRKPLIVVVNEDLMDNH  119

Query  363  QSELAEELADRKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGFPEE  190
            QSELAEELA+RKHL+CA PQTL+QTIADMDL S++PY PG A PVA  IN  LGFP++
Sbjct  120  QSELAEELANRKHLYCASPQTLHQTIADMDLNSLLPYTPGHATPVANHINRFLGFPDD  177



>ref|XP_008246505.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog [Prunus mume]
 ref|XP_008246506.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog [Prunus mume]
Length=178

 Score =   263 bits (671),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 123/178 (69%), Positives = 151/178 (85%), Gaps = 0/178 (0%)
 Frame = -2

Query  723  MGDGGANGADKRIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTK  544
            MGD  A    K+ VFVTVGTT FDAL+ AVDT EV+ ELF +GYT +++QMGRG+Y+PTK
Sbjct  1    MGDTEATVKSKKTVFVTVGTTSFDALIRAVDTQEVKAELFRRGYTQLLIQMGRGSYIPTK  60

Query  543  SASENGSPALDYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNH  364
            S   + + A++YFTFSSSIA +L++ASLVISHAGSGSIFETL+ GKPLIVVVNEDLMDNH
Sbjct  61   SEGGDETLAVEYFTFSSSIADHLRAASLVISHAGSGSIFETLRHGKPLIVVVNEDLMDNH  120

Query  363  QSELAEELADRKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGFPEE  190
            QSELAEELADRKHL+ ARPQTL++ IADM+L+S++PY PGDA PVAKL++  LGF ++
Sbjct  121  QSELAEELADRKHLYYARPQTLHRVIADMNLDSLIPYHPGDATPVAKLVSRFLGFADD  178



>ref|XP_011071318.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog [Sesamum indicum]
Length=178

 Score =   263 bits (671),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 126/178 (71%), Positives = 148/178 (83%), Gaps = 0/178 (0%)
 Frame = -2

Query  723  MGDGGANGADKRIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTK  544
            MG+       KRIV VTVGTT FD+LV AVDT EVR+  F+KGYT +++QMGRG+Y+P K
Sbjct  1    MGEADDGLKSKRIVIVTVGTTYFDSLVRAVDTQEVREAFFKKGYTHLLIQMGRGSYIPAK  60

Query  543  SASENGSPALDYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNH  364
            S  E+GS ++DYFTFSSSIA++  SASLVI+HAGSGSIFETL+L KPLIVVVNEDLMD+H
Sbjct  61   STREDGSLSVDYFTFSSSIAEFFTSASLVINHAGSGSIFETLRLRKPLIVVVNEDLMDSH  120

Query  363  QSELAEELADRKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGFPEE  190
            QSELAEELA+RKHLFCARPQTLY+TI+ MDL+SVV YQPGDA  VAK IN  L F +E
Sbjct  121  QSELAEELAERKHLFCARPQTLYETISVMDLDSVVAYQPGDATSVAKFINRFLCFTDE  178



>ref|XP_009335624.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog [Pyrus x bretschneideri]
Length=178

 Score =   262 bits (670),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 125/178 (70%), Positives = 150/178 (84%), Gaps = 0/178 (0%)
 Frame = -2

Query  723  MGDGGANGADKRIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTK  544
            MGD   N   ++ VFVTVGTT FDALV AVDT EV++EL ++GYT +++QMGRG+Y+PTK
Sbjct  1    MGDSEVNVKAQKTVFVTVGTTSFDALVRAVDTNEVKEELSKRGYTRLLIQMGRGSYIPTK  60

Query  543  SASENGSPALDYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNH  364
            +   +   A+DYFTFSSSIA +L++ASLVISHAGSGSIFETL+LGKPLIVVVNEDLMDNH
Sbjct  61   AEGGDEPLAVDYFTFSSSIADHLRAASLVISHAGSGSIFETLRLGKPLIVVVNEDLMDNH  120

Query  363  QSELAEELADRKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGFPEE  190
            QSELAEELADRKHL+  RPQTL+  +ADM+L+S+VPY PGDA PVAKLIN  LGF +E
Sbjct  121  QSELAEELADRKHLYYGRPQTLHHVVADMNLDSLVPYHPGDATPVAKLINRFLGFADE  178



>ref|XP_006433269.1| hypothetical protein CICLE_v10002655mg [Citrus clementina]
 ref|XP_006433270.1| hypothetical protein CICLE_v10002655mg [Citrus clementina]
 ref|XP_006433271.1| hypothetical protein CICLE_v10002655mg [Citrus clementina]
 ref|XP_006471997.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog isoform X1 [Citrus sinensis]
 ref|XP_006471998.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog isoform X2 [Citrus sinensis]
 gb|ESR46509.1| hypothetical protein CICLE_v10002655mg [Citrus clementina]
 gb|ESR46510.1| hypothetical protein CICLE_v10002655mg [Citrus clementina]
 gb|ESR46511.1| hypothetical protein CICLE_v10002655mg [Citrus clementina]
Length=177

 Score =   262 bits (669),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 126/176 (72%), Positives = 148/176 (84%), Gaps = 1/176 (1%)
 Frame = -2

Query  714  GGANGAD-KRIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSA  538
            GG +    KRIVF+TVGTT FDALV   DT EV++EL  +GYT +++QMGRGTY+P +S 
Sbjct  2    GGTDSVSLKRIVFLTVGTTSFDALVKVADTLEVKQELTRRGYTHLLIQMGRGTYLPAESI  61

Query  537  SENGSPALDYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQS  358
             E+G  A+D FTFSSSIA +L SASLVISHAGSGSIFETL+LGKPLIVVVNEDLMDNHQS
Sbjct  62   GEDGLLAVDCFTFSSSIADHLSSASLVISHAGSGSIFETLRLGKPLIVVVNEDLMDNHQS  121

Query  357  ELAEELADRKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGFPEE  190
            ELAEELADRKHL+CA PQ+L+Q I  MDL+S++PYQPGDA PVAKLIN  LGFP++
Sbjct  122  ELAEELADRKHLYCAHPQSLHQVIVGMDLKSLLPYQPGDATPVAKLINRFLGFPDD  177



>ref|XP_011036753.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog [Populus euphratica]
Length=176

 Score =   261 bits (668),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 123/168 (73%), Positives = 146/168 (87%), Gaps = 0/168 (0%)
 Frame = -2

Query  693  KRIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPAL  514
            K++VFVTVGTT FDALV  VDT EV++EL  KGYT +++QMGRG+Y P KS  ++GS A+
Sbjct  9    KKVVFVTVGTTLFDALVRTVDTNEVKQELLRKGYTHLVIQMGRGSYTPAKSDGKDGSLAV  68

Query  513  DYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELAD  334
            DYFTFS SIA +L+SASLVISHAGSGSIFETL+LGKPLIVVVNEDLMDNHQSELAEELA+
Sbjct  69   DYFTFSPSIADHLRSASLVISHAGSGSIFETLRLGKPLIVVVNEDLMDNHQSELAEELAE  128

Query  333  RKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGFPEE  190
            RKHL+CA PQTL+QTI+ M++ES++PY PGDA  VAKLIN  LGFP+ 
Sbjct  129  RKHLYCAHPQTLHQTISAMNIESLLPYPPGDATAVAKLINRFLGFPDH  176



>ref|XP_007205993.1| hypothetical protein PRUPE_ppa012235mg [Prunus persica]
 ref|XP_007205994.1| hypothetical protein PRUPE_ppa012235mg [Prunus persica]
 gb|EMJ07192.1| hypothetical protein PRUPE_ppa012235mg [Prunus persica]
 gb|EMJ07193.1| hypothetical protein PRUPE_ppa012235mg [Prunus persica]
Length=178

 Score =   261 bits (667),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 124/178 (70%), Positives = 149/178 (84%), Gaps = 0/178 (0%)
 Frame = -2

Query  723  MGDGGANGADKRIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTK  544
            MGD  A    K+ VFVTVGTT FDAL+ AVDT EV+ EL  +GYT ++VQMGRG+Y+PTK
Sbjct  1    MGDTEATVKSKKTVFVTVGTTSFDALIRAVDTQEVKAELLRRGYTQLLVQMGRGSYIPTK  60

Query  543  SASENGSPALDYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNH  364
            S   + + A+DYFTFSSSIA +L++ASLVISHAGSGSIFETL+ GKPLIVVVNEDLMDNH
Sbjct  61   SEGGDETLAVDYFTFSSSIADHLRAASLVISHAGSGSIFETLRHGKPLIVVVNEDLMDNH  120

Query  363  QSELAEELADRKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGFPEE  190
            QSELAEELADRKHL+ AR +TL++ IADM+L+S++PY PGDA PVAKLIN  LGF ++
Sbjct  121  QSELAEELADRKHLYYARTRTLHRVIADMNLDSLIPYHPGDATPVAKLINQFLGFADD  178



>ref|XP_008363984.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog [Malus domestica]
 ref|XP_008363985.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog [Malus domestica]
 ref|XP_008363986.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog [Malus domestica]
 ref|XP_008363987.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog [Malus domestica]
Length=178

 Score =   260 bits (665),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 124/178 (70%), Positives = 149/178 (84%), Gaps = 0/178 (0%)
 Frame = -2

Query  723  MGDGGANGADKRIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTK  544
            MGD   N   ++ VFVTVGTT FDALV AVDT E ++EL ++GYT +++QMGRG+Y+PTK
Sbjct  1    MGDSEVNVKAQKTVFVTVGTTSFDALVRAVDTHEFKEELSKRGYTRLLIQMGRGSYIPTK  60

Query  543  SASENGSPALDYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNH  364
            +   +   A+DYFTFSSSIA +L++ASLVISHAGSGSIFETL+LGKPLIVVVNEDLMDNH
Sbjct  61   AEGGDEPLAVDYFTFSSSIADHLRAASLVISHAGSGSIFETLRLGKPLIVVVNEDLMDNH  120

Query  363  QSELAEELADRKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGFPEE  190
            QSELAEELADRKHL+  RPQTL+  +ADM+L+S+VPY PGDA PVAKLIN  LGF +E
Sbjct  121  QSELAEELADRKHLYYGRPQTLHHVVADMNLDSLVPYHPGDATPVAKLINRFLGFADE  178



>ref|XP_010695049.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog [Beta vulgaris subsp. vulgaris]
 ref|XP_010695050.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog [Beta vulgaris subsp. vulgaris]
 ref|XP_010695051.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog [Beta vulgaris subsp. vulgaris]
Length=178

 Score =   258 bits (660),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 122/176 (69%), Positives = 151/176 (86%), Gaps = 2/176 (1%)
 Frame = -2

Query  717  DGGANGADKRIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSA  538
            DG  N   KR+VFVTVGTT FDALV AVD  E +++L+ KGYT +++Q+GRG+Y+PT+S 
Sbjct  5    DGSKNS--KRVVFVTVGTTLFDALVRAVDAPEFKQDLYAKGYTHLLIQIGRGSYIPTRST  62

Query  537  SENGSPALDYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQS  358
             ++GS A++YFTFSSSIA+ L+SASLVISHAGSGSIFETL+L KPLIVVVNEDLMDNHQ+
Sbjct  63   GDDGSLAVEYFTFSSSIAESLRSASLVISHAGSGSIFETLRLRKPLIVVVNEDLMDNHQA  122

Query  357  ELAEELADRKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGFPEE  190
            ELAEELA+RKHLFCA PQTL+QT+  M+++ ++PY  GDAKPVAKLIN  LGFPE+
Sbjct  123  ELAEELAERKHLFCAHPQTLHQTLTSMNIDFLLPYPAGDAKPVAKLINKFLGFPED  178



>ref|XP_004952465.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog isoform X1 [Setaria italica]
 ref|XP_004952466.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog isoform X2 [Setaria italica]
Length=172

 Score =   258 bits (659),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 124/169 (73%), Positives = 145/169 (86%), Gaps = 1/169 (1%)
 Frame = -2

Query  702  GADKRIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGS  523
            G ++R VFVTVGTTCFDALV AVD+ EV+K L +KGYTD+++QMGRGTYVP+K  S + +
Sbjct  3    GGERRTVFVTVGTTCFDALVMAVDSPEVKKALLQKGYTDLLIQMGRGTYVPSK-VSGDAT  61

Query  522  PALDYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEE  343
              +D+FTFS SIA  +++ASLVISHAGSGSIFETL+LGKPLIVVVNEDLMDNHQSELAEE
Sbjct  62   LQVDHFTFSPSIADNMRTASLVISHAGSGSIFETLRLGKPLIVVVNEDLMDNHQSELAEE  121

Query  342  LADRKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGFP  196
            LA+RKHLFCARPQTL +TI  MDL ++VPY PGDAKPV  LIN  LGFP
Sbjct  122  LAERKHLFCARPQTLGETIRAMDLGTLVPYVPGDAKPVVTLINKFLGFP  170



>ref|XP_003602650.1| UDP-N-acetylglucosamine transferase subunit ALG13-like protein 
[Medicago truncatula]
 gb|AES72901.1| UDP-N-acetylglucosamine transferase subunit alg13 [Medicago truncatula]
 gb|AFK36594.1| unknown [Medicago truncatula]
Length=173

 Score =   258 bits (660),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 124/168 (74%), Positives = 146/168 (87%), Gaps = 1/168 (1%)
 Frame = -2

Query  693  KRIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPAL  514
            KR+VFVTVGTT FDALV +VD+  V+KEL  KGYT +++QMGRG+Y+PTKS  +  + A+
Sbjct  7    KRVVFVTVGTTSFDALVKSVDSETVQKELLAKGYTHLLIQMGRGSYLPTKSEGD-CTLAV  65

Query  513  DYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELAD  334
            DYFTFSSSIA +++SASL+ISHAGSGSIFETLQL KPLIVVVNEDLMDNHQSELAEELA+
Sbjct  66   DYFTFSSSIADHIRSASLIISHAGSGSIFETLQLCKPLIVVVNEDLMDNHQSELAEELAN  125

Query  333  RKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGFPEE  190
            RKHLFCA PQTL+QTIADMDL ++ PY PGDA PVAK IN  LGFP++
Sbjct  126  RKHLFCASPQTLHQTIADMDLNALRPYSPGDATPVAKHINRFLGFPDD  173



>ref|XP_009399620.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog [Musa acuminata subsp. malaccensis]
 ref|XP_009399621.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog [Musa acuminata subsp. malaccensis]
Length=178

 Score =   258 bits (660),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 124/175 (71%), Positives = 146/175 (83%), Gaps = 1/175 (1%)
 Frame = -2

Query  717  DGGANGADKR-IVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKS  541
            DG  NG   R +VFVTVGTTCFDALV AVD+ +VR+EL  KGYTD+++QMGRG+Y+P+K 
Sbjct  2    DGAENGEHSRKMVFVTVGTTCFDALVKAVDSQQVREELSRKGYTDLLIQMGRGSYMPSKV  61

Query  540  ASENGSPALDYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQ  361
            + E+    +DYFTFS SIA YLKSASL+ISHAGSGSIFETL LGKPLIVVVNE+LMDNHQ
Sbjct  62   SGEDEPLTVDYFTFSPSIADYLKSASLIISHAGSGSIFETLCLGKPLIVVVNEELMDNHQ  121

Query  360  SELAEELADRKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGFP  196
            SELAEELA+RKHLF ARPQTL+QTI DM  ES++PY PG+  PV +L+N  LGFP
Sbjct  122  SELAEELAERKHLFYARPQTLHQTIQDMSPESLIPYSPGNPMPVVRLMNKFLGFP  176



>ref|XP_010528864.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog [Tarenaya hassleriana]
 ref|XP_010528865.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog [Tarenaya hassleriana]
Length=178

 Score =   257 bits (656),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 124/176 (70%), Positives = 146/176 (83%), Gaps = 2/176 (1%)
 Frame = -2

Query  717  DGGANGADKRIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSA  538
            D G N   +R+VFVTVGTTCFDALV AVDT E++ EL ++GYT +++QMGRG Y PTKS 
Sbjct  5    DDGPN--PRRVVFVTVGTTCFDALVKAVDTQEIKDELQKRGYTHLVIQMGRGLYTPTKSD  62

Query  537  SENGSPALDYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQS  358
              +GS  +DYFTFS SI  YL+SASLVISHAGSGSIFETL+LG+PLIVVVNEDLMDNHQ 
Sbjct  63   RADGSLIVDYFTFSPSIQDYLRSASLVISHAGSGSIFETLKLGRPLIVVVNEDLMDNHQC  122

Query  357  ELAEELADRKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGFPEE  190
            ELAEELA+RKHLF ARPQTL +T+A MDL+S+VPY PGD  PVA++I   LGFPE+
Sbjct  123  ELAEELAERKHLFYARPQTLCRTVASMDLDSLVPYTPGDGTPVARIIYRFLGFPED  178



>ref|NP_001137095.1| UDP-N-acetylglucosamine transferase subunit alg13 [Zea mays]
 ref|XP_008647479.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit alg13 
isoform X1 [Zea mays]
 gb|ACF83258.1| unknown [Zea mays]
 gb|ACG30963.1| UDP-N-acetylglucosamine transferase subunit alg13 [Zea mays]
 gb|ACG31479.1| UDP-N-acetylglucosamine transferase subunit alg13 [Zea mays]
 gb|AFW75815.1| UDP-N-acetylglucosamine transferase subunit alg13 [Zea mays]
Length=172

 Score =   256 bits (653),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 122/167 (73%), Positives = 145/167 (87%), Gaps = 1/167 (1%)
 Frame = -2

Query  696  DKRIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPA  517
            + R VFVTVGTTCFDALV AVD+ EV+K L +KGY+++++QMGRGTYVP+K  S + +  
Sbjct  5    EHRTVFVTVGTTCFDALVMAVDSPEVKKALLQKGYSNLLIQMGRGTYVPSK-VSGDATLQ  63

Query  516  LDYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELA  337
            +D+FTFS SIA  +++ASLVISHAGSGSIFETL+LGKPLIVVVNEDLMDNHQSELAEELA
Sbjct  64   VDHFTFSPSIADNMRTASLVISHAGSGSIFETLRLGKPLIVVVNEDLMDNHQSELAEELA  123

Query  336  DRKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGFP  196
            +RKHLFCARPQTL +TI  MDLE++VPY+PGDAKPV  LIN  LGFP
Sbjct  124  ERKHLFCARPQTLGETIRAMDLETLVPYEPGDAKPVVALINRFLGFP  170



>ref|NP_001146447.1| uncharacterized protein LOC100280032 [Zea mays]
 gb|ACG33429.1| UDP-N-acetylglucosamine transferase subunit alg13 [Zea mays]
 gb|ACL54015.1| unknown [Zea mays]
 gb|AFW74655.1| UDP-N-acetylglucosamine transferase subunit alg13 [Zea mays]
Length=172

 Score =   254 bits (650),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 122/167 (73%), Positives = 144/167 (86%), Gaps = 1/167 (1%)
 Frame = -2

Query  696  DKRIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPA  517
            + R VFVTVGTTCFDALV AVD+ EV+K L +KGY+++++QMGRGTYVP K  S + +  
Sbjct  5    EHRTVFVTVGTTCFDALVMAVDSPEVKKALLQKGYSNLLIQMGRGTYVPLK-VSGDATLQ  63

Query  516  LDYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELA  337
            +D+FTFS SIA  +++ASLVISHAGSGSIFETL+LGKPLIVVVNEDLMDNHQSELAEELA
Sbjct  64   VDHFTFSPSIADNMRTASLVISHAGSGSIFETLRLGKPLIVVVNEDLMDNHQSELAEELA  123

Query  336  DRKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGFP  196
            +RKHLFCARPQTL +TI  MDLE++VPY+PGDAKPV  LIN  LGFP
Sbjct  124  ERKHLFCARPQTLGETIRAMDLETLVPYEPGDAKPVVTLINRFLGFP  170



>ref|XP_006652163.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog [Oryza brachyantha]
Length=172

 Score =   252 bits (644),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 124/178 (70%), Positives = 143/178 (80%), Gaps = 6/178 (3%)
 Frame = -2

Query  723  MGDGGANGADKRIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTK  544
            MGDG     +KR VFVT GTTCFDALV AVD+  V++ L +KGYT +++QMGRGTY P+K
Sbjct  1    MGDG-----EKRTVFVTGGTTCFDALVQAVDSERVKEALLQKGYTHLLIQMGRGTYAPSK  55

Query  543  SASENGSPALDYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNH  364
              + N +  +DYFTFS SIA Y++ ASLVISHAGSGSIFETL+L KPLIVVVNEDLMDNH
Sbjct  56   -VTGNSTLQVDYFTFSPSIADYIREASLVISHAGSGSIFETLRLSKPLIVVVNEDLMDNH  114

Query  363  QSELAEELADRKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGFPEE  190
            QSELAEELA+RKHLFCARPQTL +TI  MDL ++ PY PGDAKPV  LIN  LGFP E
Sbjct  115  QSELAEELAERKHLFCARPQTLQETIQAMDLTTLQPYVPGDAKPVVTLINKFLGFPGE  172



>ref|XP_011023553.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog [Populus euphratica]
 ref|XP_011023554.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog [Populus euphratica]
 ref|XP_011023555.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog [Populus euphratica]
Length=179

 Score =   251 bits (642),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 122/179 (68%), Positives = 149/179 (83%), Gaps = 1/179 (1%)
 Frame = -2

Query  723  MGDGG-ANGADKRIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPT  547
            MGD G     +K++VFVTVG T FD LV  VDT EV++EL  KGYTD+++QMGRG+Y PT
Sbjct  1    MGDSGDIVKQEKKVVFVTVGITLFDDLVRTVDTKEVKQELLRKGYTDLVIQMGRGSYTPT  60

Query  546  KSASENGSPALDYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDN  367
            K   E+GS A+DY TFS SIA +L+SAS VISHAGSGSI+ETLQLGKPLIVVVNEDLMDN
Sbjct  61   KCDGEHGSLAVDYSTFSPSIADHLRSASPVISHAGSGSIYETLQLGKPLIVVVNEDLMDN  120

Query  366  HQSELAEELADRKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGFPEE  190
            +QSELAEELA+RKH +CA PQTL+QTI+DM++ES++PY  GDA  VAKL+N+ LGFP++
Sbjct  121  NQSELAEELAERKHFYCAHPQTLHQTISDMNVESLLPYPSGDATLVAKLMNTFLGFPDD  179



>ref|XP_003569042.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog [Brachypodium distachyon]
Length=171

 Score =   251 bits (641),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 120/176 (68%), Positives = 146/176 (83%), Gaps = 6/176 (3%)
 Frame = -2

Query  723  MGDGGANGADKRIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTK  544
            MGD      ++R+VFVTVGTTCFDALV AVD+ EV++ L  KGYTD+++QMGRGTYVP+K
Sbjct  1    MGD-----RERRVVFVTVGTTCFDALVKAVDSEEVKQALLRKGYTDLLIQMGRGTYVPSK  55

Query  543  SASENGSPALDYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNH  364
             + +  +  +D+FTFS SIA Y++ ASLVISHAGSGSIFETL+LGKPLIVVVNEDLMDNH
Sbjct  56   DSGKL-NLQVDHFTFSPSIADYIREASLVISHAGSGSIFETLRLGKPLIVVVNEDLMDNH  114

Query  363  QSELAEELADRKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGFP  196
            QSELAEELA+R HLFC+RPQTL +T+  MDL+++ PY PG+AKPV  LIN  LGFP
Sbjct  115  QSELAEELAERNHLFCSRPQTLQETVEAMDLDALQPYMPGEAKPVVALINKFLGFP  170



>ref|XP_003574954.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog isoform X2 [Brachypodium distachyon]
Length=172

 Score =   249 bits (637),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 121/178 (68%), Positives = 146/178 (82%), Gaps = 6/178 (3%)
 Frame = -2

Query  723  MGDGGANGADKRIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTK  544
            MGD      ++R+VFVTVGTTCFDALV  VD+ +V++ L++KGYTD+ +QMGRGTY P+K
Sbjct  1    MGD-----RERRMVFVTVGTTCFDALVKKVDSPQVKEALWQKGYTDLFIQMGRGTYAPSK  55

Query  543  SASENGSPALDYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNH  364
              S + +  +D+FTFSSSIA Y++ ASLVISHAGSGSIFETL+LGKPLIVVVNEDLMDNH
Sbjct  56   -VSGDATLKVDHFTFSSSIADYIREASLVISHAGSGSIFETLRLGKPLIVVVNEDLMDNH  114

Query  363  QSELAEELADRKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGFPEE  190
            Q ELAEELA+RKHL CARPQTL +TI  MDLE+++ Y PGDAKPV  LIN  LGFP +
Sbjct  115  QIELAEELAERKHLLCARPQTLEETIQGMDLETLLAYIPGDAKPVVALINKFLGFPAD  172



>ref|XP_008647742.1| PREDICTED: uncharacterized protein LOC100280032 isoform X1 [Zea 
mays]
 ref|XP_008647743.1| PREDICTED: uncharacterized protein LOC100280032 isoform X1 [Zea 
mays]
 gb|AFW74656.1| hypothetical protein ZEAMMB73_763143 [Zea mays]
Length=177

 Score =   249 bits (635),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 122/172 (71%), Positives = 144/172 (84%), Gaps = 6/172 (3%)
 Frame = -2

Query  696  DKRIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPA  517
            + R VFVTVGTTCFDALV AVD+ EV+K L +KGY+++++QMGRGTYVP K  S + +  
Sbjct  5    EHRTVFVTVGTTCFDALVMAVDSPEVKKALLQKGYSNLLIQMGRGTYVPLK-VSGDATLQ  63

Query  516  LDYFTFSSSIAKYLKSASLVISHA-----GSGSIFETLQLGKPLIVVVNEDLMDNHQSEL  352
            +D+FTFS SIA  +++ASLVISHA     GSGSIFETL+LGKPLIVVVNEDLMDNHQSEL
Sbjct  64   VDHFTFSPSIADNMRTASLVISHADLALAGSGSIFETLRLGKPLIVVVNEDLMDNHQSEL  123

Query  351  AEELADRKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGFP  196
            AEELA+RKHLFCARPQTL +TI  MDLE++VPY+PGDAKPV  LIN  LGFP
Sbjct  124  AEELAERKHLFCARPQTLGETIRAMDLETLVPYEPGDAKPVVTLINRFLGFP  175



>ref|XP_009145579.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog [Brassica rapa]
Length=176

 Score =   248 bits (634),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 120/178 (67%), Positives = 146/178 (82%), Gaps = 2/178 (1%)
 Frame = -2

Query  723  MGDGGANGADKRIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTK  544
            M DG  +G  KR+VFVTVGTT FDALV AV +  V++EL ++GYT +++QMGRG Y P K
Sbjct  1    MEDGENDG--KRLVFVTVGTTSFDALVKAVVSENVKEELHKRGYTHLLIQMGRGIYSPPK  58

Query  543  SASENGSPALDYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNH  364
                +GS A+DYFTFSSSIA Y++SASLVISHAGSGSIFETL+LGKPLIVVVNEDLMDNH
Sbjct  59   CDGADGSLAVDYFTFSSSIADYIRSASLVISHAGSGSIFETLKLGKPLIVVVNEDLMDNH  118

Query  363  QSELAEELADRKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGFPEE  190
            Q ELAEEL +RKHL+CARP TL+QT+  M+LES+V Y PGD  PVA++I+  LGFP++
Sbjct  119  QCELAEELEERKHLYCARPHTLHQTLTKMELESLVRYTPGDGTPVARIIDRFLGFPDD  176



>ref|XP_010235416.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog isoform X1 [Brachypodium distachyon]
Length=177

 Score =   248 bits (634),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 121/182 (66%), Positives = 146/182 (80%), Gaps = 9/182 (5%)
 Frame = -2

Query  723  MGDGGANGADKRIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTK  544
            MGD      ++R+VFVTVGTTCFDALV  VD+ +V++ L++KGYTD+ +QMGRGTY P+K
Sbjct  1    MGD-----RERRMVFVTVGTTCFDALVKKVDSPQVKEALWQKGYTDLFIQMGRGTYAPSK  55

Query  543  ----SASENGSPALDYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDL  376
                  S + +  +D+FTFSSSIA Y++ ASLVISHAGSGSIFETL+LGKPLIVVVNEDL
Sbjct  56   YSRIQVSGDATLKVDHFTFSSSIADYIREASLVISHAGSGSIFETLRLGKPLIVVVNEDL  115

Query  375  MDNHQSELAEELADRKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGFP  196
            MDNHQ ELAEELA+RKHL CARPQTL +TI  MDLE+++ Y PGDAKPV  LIN  LGFP
Sbjct  116  MDNHQIELAEELAERKHLLCARPQTLEETIQGMDLETLLAYIPGDAKPVVALINKFLGFP  175

Query  195  EE  190
             +
Sbjct  176  AD  177



>ref|XP_011625777.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog isoform X2 [Amborella trichopoda]
 ref|XP_011625778.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog isoform X2 [Amborella trichopoda]
 ref|XP_011625779.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog isoform X2 [Amborella trichopoda]
Length=178

 Score =   248 bits (633),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 115/178 (65%), Positives = 146/178 (82%), Gaps = 0/178 (0%)
 Frame = -2

Query  723  MGDGGANGADKRIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTK  544
            MG+   +   K+ VFVTVGTTCFDALV AVD+  ++ EL  +GYT++++Q+GRG+Y+P+K
Sbjct  1    MGEAHGDVLAKKTVFVTVGTTCFDALVQAVDSQLLKAELLRRGYTNLLIQLGRGSYIPSK  60

Query  543  SASENGSPALDYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNH  364
            SA E+GS  +DYF+FS SIA +++SASLVISHAGSGSIFETL+LGKPLIVVVN  LMDNH
Sbjct  61   SAGEDGSLTVDYFSFSPSIADHMRSASLVISHAGSGSIFETLRLGKPLIVVVNTALMDNH  120

Query  363  QSELAEELADRKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGFPEE  190
            QSELAEELA+RKHL CA P TLY+TI +MDL+++VPY P +   VAKL+N   GFPE+
Sbjct  121  QSELAEELAERKHLLCAYPDTLYETIQNMDLDTLVPYPPSNPMAVAKLMNKFFGFPED  178



>ref|XP_003633637.2| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog [Vitis vinifera]
 ref|XP_010659826.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog [Vitis vinifera]
 ref|XP_010659827.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog [Vitis vinifera]
 emb|CBI36745.3| unnamed protein product [Vitis vinifera]
Length=169

 Score =   248 bits (632),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 118/157 (75%), Positives = 135/157 (86%), Gaps = 0/157 (0%)
 Frame = -2

Query  723  MGDGGANGADKRIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTK  544
            MGD        R VFVTVGTTCFDALV AVDT E ++ELF +GYT +++QMGRG+Y+PTK
Sbjct  1    MGDTDDYIKPVRTVFVTVGTTCFDALVKAVDTHEFKRELFARGYTHLLIQMGRGSYIPTK  60

Query  543  SASENGSPALDYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNH  364
            S  E+GS  +D+FTFSSSIA  L+SASLVISHAGSGSIFETL+L KPLIVVVNEDLMDNH
Sbjct  61   STGEDGSLVVDFFTFSSSIADNLRSASLVISHAGSGSIFETLRLRKPLIVVVNEDLMDNH  120

Query  363  QSELAEELADRKHLFCARPQTLYQTIADMDLESVVPY  253
            QSELAEELA+RKHLFCARPQTLYQTIA M+LES++PY
Sbjct  121  QSELAEELAERKHLFCARPQTLYQTIATMNLESLLPY  157



>gb|EPS58427.1| hypothetical protein M569_16387, partial [Genlisea aurea]
Length=178

 Score =   247 bits (631),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 121/179 (68%), Positives = 150/179 (84%), Gaps = 5/179 (3%)
 Frame = -2

Query  717  DGGANGADKRIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSA  538
            DG  +G  +R+VFVTVGTT FD LV AVD+ +V+K LFE+ YT +++QMGRG Y+P+K  
Sbjct  2    DGSESG--RRVVFVTVGTTSFDKLVGAVDSEDVKKALFERDYTHLVIQMGRGRYLPSKCG  59

Query  537  SENG--SPALDYFTFSSSIAKYLKSASLVISHAG-SGSIFETLQLGKPLIVVVNEDLMDN  367
             E+G  S ++DYFTFSS IA++LKSASLVISHAG SGSIFETL++ KPLIVVVNEDLMDN
Sbjct  60   GEDGGSSISVDYFTFSSDIAEFLKSASLVISHAGRSGSIFETLRMRKPLIVVVNEDLMDN  119

Query  366  HQSELAEELADRKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGFPEE  190
            HQ+ELAEELA+R HLFCARP TL +TI+ + L+S+VPY+PGDAKPVAK+IN  LGF +E
Sbjct  120  HQTELAEELAERSHLFCARPHTLCETISSLHLDSLVPYEPGDAKPVAKVINRFLGFTDE  178



>ref|XP_006850982.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog isoform X1 [Amborella trichopoda]
 gb|ERN12563.1| hypothetical protein AMTR_s00025p00209630 [Amborella trichopoda]
Length=198

 Score =   248 bits (632),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 115/178 (65%), Positives = 146/178 (82%), Gaps = 0/178 (0%)
 Frame = -2

Query  723  MGDGGANGADKRIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTK  544
            MG+   +   K+ VFVTVGTTCFDALV AVD+  ++ EL  +GYT++++Q+GRG+Y+P+K
Sbjct  21   MGEAHGDVLAKKTVFVTVGTTCFDALVQAVDSQLLKAELLRRGYTNLLIQLGRGSYIPSK  80

Query  543  SASENGSPALDYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNH  364
            SA E+GS  +DYF+FS SIA +++SASLVISHAGSGSIFETL+LGKPLIVVVN  LMDNH
Sbjct  81   SAGEDGSLTVDYFSFSPSIADHMRSASLVISHAGSGSIFETLRLGKPLIVVVNTALMDNH  140

Query  363  QSELAEELADRKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGFPEE  190
            QSELAEELA+RKHL CA P TLY+TI +MDL+++VPY P +   VAKL+N   GFPE+
Sbjct  141  QSELAEELAERKHLLCAYPDTLYETIQNMDLDTLVPYPPSNPMAVAKLMNKFFGFPED  198



>emb|CDY54746.1| BnaAnng13410D [Brassica napus]
Length=176

 Score =   245 bits (626),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 119/178 (67%), Positives = 145/178 (81%), Gaps = 2/178 (1%)
 Frame = -2

Query  723  MGDGGANGADKRIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTK  544
            M DG  +G  K +VFVTVGTT FDALV AV +  V++EL ++GYT +++QMGRG Y P K
Sbjct  1    MEDGENDG--KTLVFVTVGTTSFDALVKAVVSENVKEELHKRGYTHLLIQMGRGIYSPPK  58

Query  543  SASENGSPALDYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNH  364
                +GS A+DYFTFSSSIA Y++SASLVISHAGSGSIFETL+LGKPLIVVVNEDLMDNH
Sbjct  59   CDGADGSLAVDYFTFSSSIADYIRSASLVISHAGSGSIFETLKLGKPLIVVVNEDLMDNH  118

Query  363  QSELAEELADRKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGFPEE  190
            Q ELAEEL +RKHL+CARP TL+QT+  M+LES+V Y PGD  PVA++I+  LGFP++
Sbjct  119  QCELAEELEERKHLYCARPHTLHQTLTKMELESLVRYAPGDGTPVARIIDRFLGFPDD  176



>dbj|BAJ95675.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=172

 Score =   245 bits (625),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 119/176 (68%), Positives = 142/176 (81%), Gaps = 6/176 (3%)
 Frame = -2

Query  723  MGDGGANGADKRIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTK  544
            MGD      ++R+VFVTVGTTCFDALV  VD+ EV++ L +KGYTD+++QMGRGTY P+K
Sbjct  1    MGD-----RERRVVFVTVGTTCFDALVKVVDSEEVKQALLQKGYTDLLIQMGRGTYKPSK  55

Query  543  SASENGSPALDYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNH  364
             AS N +  + +FTFS SIA  ++ ASLVISHAGSGSIFETL+LGKPLIVVVNEDLMDNH
Sbjct  56   -ASGNSNLQVKHFTFSPSIADNIREASLVISHAGSGSIFETLRLGKPLIVVVNEDLMDNH  114

Query  363  QSELAEELADRKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGFP  196
            QSELAEELA+R HLFCA PQTL +T+  MDL ++ PY PG+AKPV  LIN  LGFP
Sbjct  115  QSELAEELAERNHLFCAHPQTLRETVEAMDLNALQPYVPGEAKPVVALINRFLGFP  170



>ref|XP_010451443.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog [Camelina sativa]
Length=176

 Score =   244 bits (623),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 115/172 (67%), Positives = 140/172 (81%), Gaps = 0/172 (0%)
 Frame = -2

Query  705  NGADKRIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENG  526
              A KR+VFVTVGTT FDALV AV T  V+ EL ++GYT +++QMGRGT+ PTK    +G
Sbjct  5    QNAKKRLVFVTVGTTSFDALVKAVVTQHVQDELLKRGYTHLLIQMGRGTFFPTKCDGADG  64

Query  525  SPALDYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAE  346
            S  +DYFTFSSSIA +++SASLVISHAGSGSIFETL+LGKPLIVVVNEDLMDNHQ ELAE
Sbjct  65   SLVVDYFTFSSSIADHIRSASLVISHAGSGSIFETLKLGKPLIVVVNEDLMDNHQCELAE  124

Query  345  ELADRKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGFPEE  190
             L +RKHL+  RP TL+QT+  M+LES+VPY PGD  PVA++I+  LGFP++
Sbjct  125  ALEERKHLYYTRPHTLHQTLTKMELESLVPYTPGDGTPVARIIDRFLGFPDD  176



>emb|CDY40506.1| BnaC01g20060D [Brassica napus]
Length=176

 Score =   244 bits (623),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 118/178 (66%), Positives = 145/178 (81%), Gaps = 2/178 (1%)
 Frame = -2

Query  723  MGDGGANGADKRIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTK  544
            M DG  +G  KR+VFVTVGTT FDALV AV +  V++EL ++GYT +++QMGRG Y P K
Sbjct  1    MEDGENDG--KRLVFVTVGTTSFDALVKAVVSQNVKEELHKRGYTHLLIQMGRGIYSPPK  58

Query  543  SASENGSPALDYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNH  364
                +GS A+DYFTFSSSIA Y++SASLVISHAGSGSIFETL+LGKPLIVVVNEDLMDNH
Sbjct  59   CDGADGSLAVDYFTFSSSIADYIRSASLVISHAGSGSIFETLKLGKPLIVVVNEDLMDNH  118

Query  363  QSELAEELADRKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGFPEE  190
            Q ELAEEL +RKHL+CARP +L QT+  M+L+S+V Y PGD  PVA++I+  LGFP++
Sbjct  119  QCELAEELEERKHLYCARPHSLNQTLTKMELDSLVRYTPGDGTPVARIIDRFLGFPDD  176



>ref|XP_010434782.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog [Camelina sativa]
Length=176

 Score =   244 bits (622),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 115/170 (68%), Positives = 140/170 (82%), Gaps = 0/170 (0%)
 Frame = -2

Query  699  ADKRIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSP  520
            A KR+VFVTVGTT FDALV AV T  V+ EL ++GYT +++QMGRGT+ PTK    +GS 
Sbjct  7    AKKRLVFVTVGTTSFDALVKAVVTQHVQDELLKRGYTHLLIQMGRGTFFPTKCDGADGSL  66

Query  519  ALDYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEEL  340
             +DYFTFSSSIA +++SASLVISHAGSGSIFETL+LGKPLIVVVNEDLMDNHQ ELAE L
Sbjct  67   VVDYFTFSSSIADHIRSASLVISHAGSGSIFETLKLGKPLIVVVNEDLMDNHQCELAEAL  126

Query  339  ADRKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGFPEE  190
             +RKHL+  RP TL+QT+  M+LES+VPY PGD  PVA++I+  LGFP++
Sbjct  127  EERKHLYYTRPHTLHQTLTKMELESLVPYTPGDGTPVARIIDRFLGFPDD  176



>ref|XP_010440110.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog [Camelina sativa]
Length=176

 Score =   242 bits (617),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 114/170 (67%), Positives = 139/170 (82%), Gaps = 0/170 (0%)
 Frame = -2

Query  699  ADKRIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSP  520
            A KR+VFVTVGTT FDALV AV T  V+ EL ++GYT +++QMGRGT+ PTK    +GS 
Sbjct  7    AKKRLVFVTVGTTSFDALVKAVVTQHVQDELLKRGYTHLLIQMGRGTFFPTKCDGADGSL  66

Query  519  ALDYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEEL  340
             +DYFTFSS IA +++SASLVISHAGSGSIFETL+LGKPLIVVVNEDLMDNHQ ELAE L
Sbjct  67   VVDYFTFSSCIADHIRSASLVISHAGSGSIFETLKLGKPLIVVVNEDLMDNHQCELAEAL  126

Query  339  ADRKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGFPEE  190
             +RKHL+  RP TL+QT+  M+LES+VPY PGD  PVA++I+  LGFP++
Sbjct  127  EERKHLYYTRPHTLHQTLTKMELESLVPYTPGDGTPVARIIDRFLGFPDD  176



>ref|XP_010434781.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog [Camelina sativa]
Length=176

 Score =   240 bits (613),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 114/170 (67%), Positives = 139/170 (82%), Gaps = 0/170 (0%)
 Frame = -2

Query  699  ADKRIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSP  520
            A KR+VFVTVGTT FDALV AV T  V+ EL ++G T +++QMGRGT+ PTK    +GS 
Sbjct  7    AKKRLVFVTVGTTSFDALVKAVVTQHVQDELLKRGCTHLLIQMGRGTFFPTKCDGADGSL  66

Query  519  ALDYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEEL  340
             +DYFTFSSSIA +++SASLVISHAGSGSIFETL+LGKPLIVVVNEDLMDNHQ ELAE L
Sbjct  67   VVDYFTFSSSIADHIRSASLVISHAGSGSIFETLKLGKPLIVVVNEDLMDNHQCELAEAL  126

Query  339  ADRKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGFPEE  190
             +RKHL+  RP TL+QT+  M+LES+VPY PGD  PVA++I+  LGFP++
Sbjct  127  EERKHLYYTRPHTLHQTLTKMELESLVPYTPGDGTPVARIIDRFLGFPDD  176



>ref|XP_006284614.1| hypothetical protein CARUB_v10005862mg [Capsella rubella]
 gb|EOA17512.1| hypothetical protein CARUB_v10005862mg [Capsella rubella]
Length=176

 Score =   238 bits (608),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 112/173 (65%), Positives = 139/173 (80%), Gaps = 0/173 (0%)
 Frame = -2

Query  708  ANGADKRIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASEN  529
            +  + KRIVFVTVGTT FDALV AV +  V+ EL ++GYT +++QMGRG + PTK    +
Sbjct  4    SENSKKRIVFVTVGTTSFDALVKAVVSEHVKDELLKRGYTHLLIQMGRGIFFPTKCEGAD  63

Query  528  GSPALDYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELA  349
            GS  +DYFTFSSSIA +++SASLVISHAGSGSIFETL+LGKPLIVVVNEDLMDNHQ ELA
Sbjct  64   GSLVVDYFTFSSSIADHIRSASLVISHAGSGSIFETLKLGKPLIVVVNEDLMDNHQCELA  123

Query  348  EELADRKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGFPEE  190
            E L +RKHL+  RP TL+QT+  M+LES+V Y PGD  PVA++I+  LGFP++
Sbjct  124  EALEERKHLYYTRPHTLHQTLTKMELESLVRYTPGDGTPVARIIDRFLGFPDD  176



>dbj|BAK05537.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=173

 Score =   236 bits (602),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 116/176 (66%), Positives = 140/176 (80%), Gaps = 6/176 (3%)
 Frame = -2

Query  723  MGDGGANGADKRIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTK  544
            MGD      ++R+VFVTVGTT FDALV  VD+ EV++ L +KGYTD+ +QMGRGTY+P+K
Sbjct  1    MGD-----RERRMVFVTVGTTSFDALVKVVDSEEVKQALLQKGYTDLRIQMGRGTYMPSK  55

Query  543  SASENGSPALDYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNH  364
             AS N +  +++FTF  SIA  ++ ASLVISHAGSGSIFETL+LGKPLIVVVNEDLMDNH
Sbjct  56   -ASGNSNLQVEHFTFLPSIADNIREASLVISHAGSGSIFETLRLGKPLIVVVNEDLMDNH  114

Query  363  QSELAEELADRKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGFP  196
            QSELAEELA+R HLFCA PQTL +T+  MDL ++ PY PG+AK V  LIN  LGFP
Sbjct  115  QSELAEELAERNHLFCAHPQTLRETVEAMDLNALQPYMPGEAKQVVALINGFLGFP  170



>gb|EMS49968.1| UDP-N-acetylglucosamine transferase subunit ALG13-like protein 
[Triticum urartu]
Length=172

 Score =   235 bits (600),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 115/176 (65%), Positives = 138/176 (78%), Gaps = 6/176 (3%)
 Frame = -2

Query  723  MGDGGANGADKRIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTK  544
            MGD      ++R+VFVTVGTTCFDALV  VD+ EV++ L +KGYTD+ +QMGRGTY P+K
Sbjct  1    MGD-----RERRMVFVTVGTTCFDALVKVVDSEEVKQALLQKGYTDLRIQMGRGTYTPSK  55

Query  543  SASENGSPALDYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNH  364
             AS N +  +++FTF  SIA  ++ ASLVISHA SG IFETL+LGKPLIVVVNEDLMDNH
Sbjct  56   -ASGNSNLQVEHFTFLPSIADNIREASLVISHADSGRIFETLRLGKPLIVVVNEDLMDNH  114

Query  363  QSELAEELADRKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGFP  196
            QSELAEELA+R HL CA PQTL +T+  MDL ++ PY PG+AKPV  LIN  LGFP
Sbjct  115  QSELAEELAERNHLLCAHPQTLRETVEAMDLNALQPYVPGEAKPVVALINQFLGFP  170



>ref|XP_006414313.1| hypothetical protein EUTSA_v10026361mg [Eutrema salsugineum]
 gb|ESQ55766.1| hypothetical protein EUTSA_v10026361mg [Eutrema salsugineum]
Length=179

 Score =   235 bits (599),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 114/179 (64%), Positives = 141/179 (79%), Gaps = 1/179 (1%)
 Frame = -2

Query  723  MGDGGANGAD-KRIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPT  547
            M D   +G D K++VFVTVGTT FDALV AV + +V+ EL ++GYT +++QMGRG Y P+
Sbjct  1    MEDRENDGGDAKKVVFVTVGTTSFDALVEAVVSQDVKDELQKRGYTHLLIQMGRGIYSPS  60

Query  546  KSASENGSPALDYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDN  367
            K    +GS  +DYF FSSSIA Y++SASLVISHAGSGSIFETL+LGKPLIVVVNEDLMDN
Sbjct  61   KCDGADGSLVVDYFRFSSSIADYIRSASLVISHAGSGSIFETLKLGKPLIVVVNEDLMDN  120

Query  366  HQSELAEELADRKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGFPEE  190
            HQ ELAE L +RKHL+  RP TL+Q +  MDLES+V Y PGD  PVA++I+  LGFP++
Sbjct  121  HQCELAEALEERKHLYYTRPHTLHQALMKMDLESLVRYTPGDGAPVARIIDRFLGFPDD  179



>ref|XP_009610521.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog isoform X2 [Nicotiana tomentosiformis]
Length=148

 Score =   233 bits (595),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 114/178 (64%), Positives = 134/178 (75%), Gaps = 30/178 (17%)
 Frame = -2

Query  723  MGDGGANGADKRIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTK  544
            MG+ G    +K++VFVTVGTTCFDALV AVDT E++ ELF KGYT+I++Q+GRG+Y+PTK
Sbjct  1    MGETGGTVKEKKVVFVTVGTTCFDALVRAVDTPELKNELFRKGYTNILIQIGRGSYIPTK  60

Query  543  SASENGSPALDYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNH  364
                                            AGSGSIFETL+LGKPLIVVVNEDLMDNH
Sbjct  61   VP------------------------------AGSGSIFETLRLGKPLIVVVNEDLMDNH  90

Query  363  QSELAEELADRKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGFPEE  190
            QSELAEELA+RKHLFCARPQTLYQTIADMD  S++PYQPGDA+PVAKLIN +LGFP++
Sbjct  91   QSELAEELAERKHLFCARPQTLYQTIADMDTGSLIPYQPGDAEPVAKLINRYLGFPDD  148



>ref|XP_002870137.1| glycosyltransferase family protein 28 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46396.1| glycosyltransferase family protein 28 [Arabidopsis lyrata subsp. 
lyrata]
Length=175

 Score =   232 bits (591),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 109/168 (65%), Positives = 136/168 (81%), Gaps = 0/168 (0%)
 Frame = -2

Query  693  KRIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPAL  514
            KR+VFVTVGTT FDALV AV + +V+ EL ++G+T +++QMGRG + P K    +GS  +
Sbjct  8    KRVVFVTVGTTSFDALVKAVVSEDVKDELQKRGFTHLLIQMGRGIFFPNKCDGADGSLVV  67

Query  513  DYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELAD  334
            DYFTFSSSIA Y++SASLVISHAGSGSIFETL+LGKPLIVVVNEDLMDNHQ ELAE L +
Sbjct  68   DYFTFSSSIADYIRSASLVISHAGSGSIFETLKLGKPLIVVVNEDLMDNHQCELAEALEE  127

Query  333  RKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGFPEE  190
            RKHL+   P TL+QT+  M+LES+V Y PGD  PVA++I+  LGFP++
Sbjct  128  RKHLYYTHPHTLHQTLTKMELESLVQYTPGDGTPVARIIDRFLGFPDD  175



>ref|NP_193404.1| glycosyltransferase family protein 28 [Arabidopsis thaliana]
 ref|NP_849397.1| glycosyltransferase family protein 28 [Arabidopsis thaliana]
 emb|CAB10446.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAB78713.1| hypothetical protein [Arabidopsis thaliana]
 gb|AAQ22656.1| At4g16710 [Arabidopsis thaliana]
 dbj|BAF01562.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE83789.1| glycosyltransferase family protein 28 [Arabidopsis thaliana]
 gb|AEE83790.1| glycosyltransferase family protein 28 [Arabidopsis thaliana]
Length=176

 Score =   231 bits (590),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 109/168 (65%), Positives = 136/168 (81%), Gaps = 0/168 (0%)
 Frame = -2

Query  693  KRIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPAL  514
            KR+VFVTVGTT FDALV AV +  V+ EL ++G+T +++QMGRG + PTK    +GS  +
Sbjct  9    KRVVFVTVGTTSFDALVKAVVSQNVKDELQKRGFTHLLIQMGRGIFFPTKCDGADGSLVV  68

Query  513  DYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELAD  334
            DYFTFSSSIA Y++SASLVISHAGSGSIFETL+LGKPLIVVVNEDLMDNHQ ELAE L +
Sbjct  69   DYFTFSSSIADYIRSASLVISHAGSGSIFETLKLGKPLIVVVNEDLMDNHQCELAEALEE  128

Query  333  RKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGFPEE  190
            RKHL+  RP +L+QT+  M+L S+V Y PGD  PVA++I+  LGFP++
Sbjct  129  RKHLYYTRPHSLHQTLTKMELGSLVQYTPGDGTPVARIIDRFLGFPDD  176



>ref|XP_011466454.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog [Fragaria vesca subsp. vesca]
 ref|XP_011466455.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog [Fragaria vesca subsp. vesca]
Length=157

 Score =   225 bits (573),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 109/157 (69%), Positives = 129/157 (82%), Gaps = 0/157 (0%)
 Frame = -2

Query  723  MGDGGANGADKRIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTK  544
            MGD       K+ VFVTVGTT FDALV A+DT EV++EL  +GYT+I++QMGRG+Y+P+K
Sbjct  1    MGDTEVTMKSKKTVFVTVGTTSFDALVKAMDTREVKEELSRRGYTEILIQMGRGSYIPSK  60

Query  543  SASENGSPALDYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNH  364
            S   + S A+DYF FSSSIA ++++ASLVISHAGSGSIFETL+LGKPLIVVVNEDLMDNH
Sbjct  61   SEGGDDSIAVDYFNFSSSIADHVRAASLVISHAGSGSIFETLRLGKPLIVVVNEDLMDNH  120

Query  363  QSELAEELADRKHLFCARPQTLYQTIADMDLESVVPY  253
            QSELAEELADRKHL+ ARPQTL   IADM LE +  Y
Sbjct  121  QSELAEELADRKHLYYARPQTLRYIIADMKLELIEVY  157



>ref|XP_002442220.1| hypothetical protein SORBIDRAFT_08g016480 [Sorghum bicolor]
 gb|EES16058.1| hypothetical protein SORBIDRAFT_08g016480 [Sorghum bicolor]
Length=150

 Score =   223 bits (568),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 106/148 (72%), Positives = 128/148 (86%), Gaps = 1/148 (1%)
 Frame = -2

Query  639  AVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPALDYFTFSSSIAKYLKSASL  460
            AVD+ EV+  L +KGY+++++QMGRGTYVP+K  S + +  +D+FTFS SIA  +++ASL
Sbjct  2    AVDSPEVKMALLQKGYSNLLIQMGRGTYVPSK-VSGDATLQVDHFTFSPSIADNMRTASL  60

Query  459  VISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELADRKHLFCARPQTLYQTIAD  280
            VISHAGSGSIFETL+LGKPLIVVVNEDLMDNHQSELAEELA+RKHLFCARPQTL +TI  
Sbjct  61   VISHAGSGSIFETLRLGKPLIVVVNEDLMDNHQSELAEELAERKHLFCARPQTLGETIRA  120

Query  279  MDLESVVPYQPGDAKPVAKLINSHLGFP  196
            MDLE++VPY+PGDAKPV  LIN  LGFP
Sbjct  121  MDLETLVPYEPGDAKPVVTLINRFLGFP  148



>ref|XP_008386681.1| PREDICTED: LOW QUALITY PROTEIN: UDP-N-acetylglucosamine transferase 
subunit ALG13 homolog [Malus domestica]
Length=177

 Score =   218 bits (554),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 110/178 (62%), Positives = 137/178 (77%), Gaps = 1/178 (1%)
 Frame = -2

Query  723  MGDGGANGADKRIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTK  544
            MGD   +   K  V VTVGTT FDALV  VD  EV++EL ++G T ++++MGRG Y PTK
Sbjct  1    MGDSKVDVNAKNTVLVTVGTTSFDALVRTVDAHEVKQELSKRGCTRLLIRMGRGFYTPTK  60

Query  543  SASENGSPALDYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNH  364
            +   +   A+D+FTF SSIA +L+++SLVISHAGSGSIFETL+L KPLIVVVN DLMDNH
Sbjct  61   AEGGDEPLAVDHFTFXSSIANHLRASSLVISHAGSGSIFETLRLSKPLIVVVN-DLMDNH  119

Query  363  QSELAEELADRKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGFPEE  190
            QSELAEELADRKHL+ A P TL + IA M+L+S+VP  PGDA PVAK+I+  LGF ++
Sbjct  120  QSELAEELADRKHLYYAPPLTLRRVIAYMNLDSIVPXHPGDAAPVAKVISKFLGFADD  177



>ref|XP_006365209.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog isoform X2 [Solanum tuberosum]
Length=149

 Score =   213 bits (543),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 102/118 (86%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = -2

Query  543  SASENGSPALDYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNH  364
            + +ENGSPALDYFTFSSSIA YLKSASLVISHAGSGSIFETL+LGKPLIVVVNEDLMDNH
Sbjct  32   ATAENGSPALDYFTFSSSIADYLKSASLVISHAGSGSIFETLRLGKPLIVVVNEDLMDNH  91

Query  363  QSELAEELADRKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGFPEE  190
            QSELAEELA+RKHL+CARPQTLY+TI+DM+  S+VPYQPGDAKPVAKLI  +LGFPEE
Sbjct  92   QSELAEELAERKHLYCARPQTLYKTISDMNPGSLVPYQPGDAKPVAKLIYRYLGFPEE  149



>gb|KDO59534.1| hypothetical protein CISIN_1g033065mg [Citrus sinensis]
 gb|KDO59535.1| hypothetical protein CISIN_1g033065mg [Citrus sinensis]
 gb|KDO59536.1| hypothetical protein CISIN_1g033065mg [Citrus sinensis]
Length=128

 Score =   205 bits (522),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 98/128 (77%), Positives = 113/128 (88%), Gaps = 0/128 (0%)
 Frame = -2

Query  573  MGRGTYVPTKSASENGSPALDYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIV  394
            MG+GTY+P +S  E+G  A+D FTFSSSIA +L SASLVISHAGSGSIFETL+LGKPLIV
Sbjct  1    MGQGTYLPAESIGEDGLLAVDCFTFSSSIADHLSSASLVISHAGSGSIFETLRLGKPLIV  60

Query  393  VVNEDLMDNHQSELAEELADRKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLIN  214
            VVNEDLMDNHQSELAEELADRKHL+CA PQ+L+Q I  MDL+S++PYQPGDA PVAKLIN
Sbjct  61   VVNEDLMDNHQSELAEELADRKHLYCAHPQSLHQVIVGMDLKSLLPYQPGDATPVAKLIN  120

Query  213  SHLGFPEE  190
              LGFP++
Sbjct  121  RFLGFPDD  128



>ref|XP_007030905.1| Glycosyltransferase family protein 28 isoform 2, partial [Theobroma 
cacao]
 gb|EOY11407.1| Glycosyltransferase family protein 28 isoform 2, partial [Theobroma 
cacao]
Length=147

 Score =   204 bits (519),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 97/119 (82%), Positives = 111/119 (93%), Gaps = 0/119 (0%)
 Frame = -2

Query  546  KSASENGSPALDYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDN  367
            +S  ++GS A+DYFTFSSSIA++L+SASLVISHAGSGSIFETL+LGKPLIVVVNEDLMDN
Sbjct  29   RSIGDDGSLAVDYFTFSSSIAEHLRSASLVISHAGSGSIFETLRLGKPLIVVVNEDLMDN  88

Query  366  HQSELAEELADRKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGFPEE  190
            HQSELAEELA+RKHL+CARPQTL+QTIA MDLES++PY PGDA PVAKLIN  LGFPE+
Sbjct  89   HQSELAEELAERKHLYCARPQTLHQTIASMDLESLLPYSPGDATPVAKLINRFLGFPED  147



>ref|XP_006580949.1| PREDICTED: uncharacterized protein LOC100526989 isoform X4 [Glycine 
max]
Length=139

 Score =   192 bits (488),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 103/178 (58%), Positives = 120/178 (67%), Gaps = 39/178 (22%)
 Frame = -2

Query  723  MGDGGANGADKRIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTK  544
            MG+   N   KR+VFVTVGTTCFDALV AVD+  V++ LF KGYT +++QMGRG+Y+PTK
Sbjct  1    MGNDEGNDKKKRVVFVTVGTTCFDALVRAVDSNNVKQALFAKGYTHLLIQMGRGSYLPTK  60

Query  543  SASENGSPALDYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNH  364
            S  + GS A+DYFTFSSSIA +L+SASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNH
Sbjct  61   SEGD-GSLAVDYFTFSSSIADHLRSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNH  119

Query  363  QSELAEELADRKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGFPEE  190
            QS                                      DA PVAK IN+ LGFP++
Sbjct  120  QS--------------------------------------DATPVAKHINNLLGFPDD  139



>gb|KEH36285.1| UDP-N-acetylglucosamine transferase subunit alg13 [Medicago truncatula]
Length=142

 Score =   188 bits (477),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 90/113 (80%), Positives = 102/113 (90%), Gaps = 0/113 (0%)
 Frame = -2

Query  528  GSPALDYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELA  349
            GS A+DYFTFSSSIA +L+SASLVISHAGSGSIFETL+L KPLIVVVNEDLMDNHQSELA
Sbjct  30   GSLAVDYFTFSSSIADHLRSASLVISHAGSGSIFETLRLRKPLIVVVNEDLMDNHQSELA  89

Query  348  EELADRKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGFPEE  190
            EELA+ KHL+CA PQTL+QT+ADMDL S++PY PGDA PVAK IN  LGFP++
Sbjct  90   EELANTKHLYCASPQTLHQTVADMDLNSLLPYTPGDATPVAKHINRFLGFPDD  142



>ref|NP_001046820.1| Os02g0467700 [Oryza sativa Japonica Group]
 dbj|BAF08734.1| Os02g0467700, partial [Oryza sativa Japonica Group]
Length=122

 Score =   177 bits (449),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 85/116 (73%), Positives = 98/116 (84%), Gaps = 0/116 (0%)
 Frame = -2

Query  537  SENGSPALDYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQS  358
            S +G+  +DYFTFS SIA Y++ ASLVISHAGSGSIFETL+ GKPLIVVVNEDLMDNHQS
Sbjct  7    SGDGTLQVDYFTFSPSIADYIRDASLVISHAGSGSIFETLRHGKPLIVVVNEDLMDNHQS  66

Query  357  ELAEELADRKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGFPEE  190
            ELAEELA RKHLFCA PQTL +TI +MD+E++ PY PGDAKPV  LIN   GFP++
Sbjct  67   ELAEELATRKHLFCASPQTLGETIQEMDIETLNPYVPGDAKPVVSLINKFFGFPDD  122



>ref|XP_002452045.1| hypothetical protein SORBIDRAFT_04g017490 [Sorghum bicolor]
 gb|EES05021.1| hypothetical protein SORBIDRAFT_04g017490 [Sorghum bicolor]
Length=126

 Score =   175 bits (443),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 84/126 (67%), Positives = 103/126 (82%), Gaps = 1/126 (1%)
 Frame = -2

Query  639  AVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPALDYFTFSSSIAKYLKSASL  460
            AV + EV+K L +KGY+++++QMGRGTYVP+K  S N +  +D+FTFS SIA  + +ASL
Sbjct  2    AVASPEVKKALLQKGYSNLVIQMGRGTYVPSK-VSGNATLQVDHFTFSPSIADNMGTASL  60

Query  459  VISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELADRKHLFCARPQTLYQTIAD  280
            VISHAGSGS+FETL+LGKPLIVVVNEDLMDNHQSELAEE A+RKHLFCARPQTL +    
Sbjct  61   VISHAGSGSVFETLRLGKPLIVVVNEDLMDNHQSELAEEFAERKHLFCARPQTLGEGNGP  120

Query  279  MDLESV  262
             D  S+
Sbjct  121  RDTSSL  126



>gb|KEH36286.1| UDP-N-acetylglucosamine transferase subunit alg13 [Medicago truncatula]
Length=127

 Score =   169 bits (428),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 81/104 (78%), Positives = 92/104 (88%), Gaps = 0/104 (0%)
 Frame = -2

Query  501  FSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELADRKHL  322
            F  SIA +L+SASLVISHAGSGSIFETL+L KPLIVVVNEDLMDNHQSELAEELA+ KHL
Sbjct  24   FLPSIADHLRSASLVISHAGSGSIFETLRLRKPLIVVVNEDLMDNHQSELAEELANTKHL  83

Query  321  FCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGFPEE  190
            +CA PQTL+QT+ADMDL S++PY PGDA PVAK IN  LGFP++
Sbjct  84   YCASPQTLHQTVADMDLNSLLPYTPGDATPVAKHINRFLGFPDD  127



>gb|EMS66641.1| UDP-N-acetylglucosamine transferase subunit ALG13-like protein 
[Triticum urartu]
Length=193

 Score =   170 bits (430),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 82/115 (71%), Positives = 95/115 (83%), Gaps = 0/115 (0%)
 Frame = -2

Query  540  ASENGSPALDYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQ  361
            AS N S  +++FTFS SIA  ++ ASLVISHAGSGSIFETL+LGKPLIVVVNEDLMDNHQ
Sbjct  77   ASGNSSLQVEHFTFSPSIADNIREASLVISHAGSGSIFETLRLGKPLIVVVNEDLMDNHQ  136

Query  360  SELAEELADRKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGFP  196
            SELAEELA+R HLFCA P TL +T+  MDL+++ PY PG+AKPV  LIN  LGFP
Sbjct  137  SELAEELAERNHLFCAHPHTLRETVEAMDLKTLQPYVPGEAKPVVALINRFLGFP  191



>ref|XP_002977286.1| hypothetical protein SELMODRAFT_232928 [Selaginella moellendorffii]
 ref|XP_002992174.1| hypothetical protein SELMODRAFT_134806 [Selaginella moellendorffii]
 gb|EFJ06829.1| hypothetical protein SELMODRAFT_134806 [Selaginella moellendorffii]
 gb|EFJ21895.1| hypothetical protein SELMODRAFT_232928 [Selaginella moellendorffii]
Length=171

 Score =   169 bits (427),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 83/165 (50%), Positives = 111/165 (67%), Gaps = 4/165 (2%)
 Frame = -2

Query  684  VFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSP----A  517
            VFVTVGTT FDAL+  VD+ E +  L  +GY+ + +Q+GRGTY+P  +  E         
Sbjct  7    VFVTVGTTSFDALIRIVDSNEFQDVLLSRGYSSLRLQIGRGTYLPQITTRERDDDHHRLR  66

Query  516  LDYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELA  337
            +DYFTF+ ++ + L SA LVISHAGSGSIFETL+ GKPL+VV+NEDLMDNHQ ELAEELA
Sbjct  67   VDYFTFAPNLGEQLSSADLVISHAGSGSIFETLRAGKPLVVVINEDLMDNHQCELAEELA  126

Query  336  DRKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLG  202
              + L CA+P TL   +  M+L +++PY       +   ++  LG
Sbjct  127  RNRFLICAKPSTLVAAVKAMELGTLLPYPRSSPAALVAALDKFLG  171



>ref|XP_001778109.1| predicted protein [Physcomitrella patens]
 gb|EDQ57115.1| predicted protein [Physcomitrella patens]
Length=174

 Score =   158 bits (400),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 79/163 (48%), Positives = 114/163 (70%), Gaps = 3/163 (2%)
 Frame = -2

Query  684  VFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPALDYF  505
            V VTVGTT FDALV    +   R+ L + GY+ +++Q G+G+++P  S  ++G   +  F
Sbjct  11   VLVTVGTTLFDALVREASSQPCRQVLADFGYSSLVIQRGKGSFIP--SDGKDGGLKVTSF  68

Query  504  TFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELADRKH  325
             F  +++ ++ S++LVISHAGSGSIFETL+  +PL+VVVN+ LMDNHQ ELAEELA RKH
Sbjct  69   DFEPNLSDHIASSALVISHAGSGSIFETLRAKRPLVVVVNDLLMDNHQCELAEELAARKH  128

Query  324  L-FCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGF  199
            L + + P TL +T+ +M+L S+VPY P +   V   +N +LGF
Sbjct  129  LVYASSPATLIETLKNMELPSLVPYPPSNPLAVVSALNQYLGF  171



>ref|XP_007258720.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog [Astyanax mexicanus]
Length=164

 Score =   157 bits (398),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 78/164 (48%), Positives = 109/164 (66%), Gaps = 2/164 (1%)
 Frame = -2

Query  690  RIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPALD  511
            + VFVTVGTTCFD L++++ +AEV K L  +GYTD+++Q+GRG+ VP   +       L+
Sbjct  2    KTVFVTVGTTCFDDLISSMTSAEVVKALVNRGYTDVVLQVGRGSSVPDSQSCPG--LRLE  59

Query  510  YFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELADR  331
             F F  SIA+ ++ A LVISHAG+GS  E L  GKPL+VVVN+ LMDNHQ ELA++L   
Sbjct  60   AFRFKESIAENIQQADLVISHAGAGSCLEALGAGKPLLVVVNDKLMDNHQLELAKQLQAD  119

Query  330  KHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGF  199
             HL      TL QT+ DMDL +++P+ PG  +  A  ++  +G 
Sbjct  120  SHLLYCTCSTLPQTLRDMDLSALLPFLPGQPQKFASFLDKAVGL  163



>gb|ADO28273.1| UDP-n-acetylglucosamine transferase subunit alg13-like protein 
[Ictalurus furcatus]
Length=164

 Score =   157 bits (396),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 78/164 (48%), Positives = 110/164 (67%), Gaps = 2/164 (1%)
 Frame = -2

Query  690  RIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPALD  511
            + VFVTVGTT FD L+ ++ + EV K L  +GYTD+++Q GRG+++P   A       L+
Sbjct  2    KTVFVTVGTTSFDDLIVSLTSEEVVKALIHRGYTDLVLQFGRGSFIP--DAHSYPGLRLE  59

Query  510  YFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELADR  331
             F F  SIA+ ++SA +VISHAG+GS  E L  GKPL+VVVN+ LMDNHQ ELA++L   
Sbjct  60   AFRFKESIAENIQSADVVISHAGAGSCLEVLGAGKPLLVVVNDKLMDNHQLELAKQLQAD  119

Query  330  KHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGF  199
             HL      TL +T+ DMDL +++P+QPG  +  A+ +N  +GF
Sbjct  120  GHLLYCTCSTLAETLCDMDLSTLLPFQPGQPENFAQFLNKAVGF  163



>ref|NP_001188158.1| UDP-N-acetylglucosamine transferase subunit ALG13 homolog [Ictalurus 
punctatus]
 gb|ADO28896.1| UDP-n-acetylglucosamine transferase subunit alg13-like protein 
[Ictalurus punctatus]
Length=164

 Score =   155 bits (393),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 80/165 (48%), Positives = 114/165 (69%), Gaps = 4/165 (2%)
 Frame = -2

Query  690  RIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPALD  511
            + VFVTVGTT FD L+ ++ + EV K L  +GYTD+++Q GRG+++P   A       L+
Sbjct  2    KTVFVTVGTTSFDDLIVSLTSEEVVKALIHRGYTDLVLQFGRGSFIP--DAHSCPGLRLE  59

Query  510  YFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEEL-AD  334
             F F  SIA+ ++SA +VISHAG+GS  E L  GKPL+VVVN+ LMDNHQ ELA++L AD
Sbjct  60   AFRFKESIAENIQSADVVISHAGAGSCLEVLGAGKPLLVVVNDKLMDNHQLELAKQLQAD  119

Query  333  RKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGF  199
               L+C R  TL +T+ DMDL +++P+QPG  +  A+ ++  +GF
Sbjct  120  GHLLYCTR-STLAETLRDMDLSTLLPFQPGQPENFAQFLDKAVGF  163



>ref|XP_001693856.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDP09110.1| predicted protein [Chlamydomonas reinhardtii]
Length=177

 Score =   155 bits (392),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 84/173 (49%), Positives = 110/173 (64%), Gaps = 6/173 (3%)
 Frame = -2

Query  699  ADKRIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPT----KSASE  532
            A++R VFVTVGTT F+ LV  VD+ E+ + L +KGYT +++Q G G+Y P+    K  ++
Sbjct  3    ANERAVFVTVGTTKFETLVERVDSLELLRALKDKGYTKLVIQKGNGSYCPSVIVPKGQTK  62

Query  531  NGSPALD--YFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQS  358
              +  +D  YF +S S+A Y+ SA+LVISHAGSGSIFETL  G PLIVV N  LMDNHQ 
Sbjct  63   GTTEGVDVEYFDYSPSLAAYITSAALVISHAGSGSIFETLTAGVPLIVVPNPLLMDNHQV  122

Query  357  ELAEELADRKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGF  199
            EL E+LA   HL  A P+ L   +   D   + PY  G A  +A  I+  LGF
Sbjct  123  ELGEQLAAMGHLVSAAPEQLLAAVRSFDPARLKPYVKGSAAGMAAAIDKQLGF  175



>ref|XP_002948842.1| hypothetical protein VOLCADRAFT_80368 [Volvox carteri f. nagariensis]
 gb|EFJ50222.1| hypothetical protein VOLCADRAFT_80368 [Volvox carteri f. nagariensis]
Length=177

 Score =   155 bits (391),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 86/173 (50%), Positives = 107/173 (62%), Gaps = 10/173 (6%)
 Frame = -2

Query  693  KRIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVP--------TKSA  538
             R VFVTVGTT F+ALV  VD+ E+ + L +KGYT II+Q G G Y P        TK+ 
Sbjct  5    NRSVFVTVGTTKFEALVERVDSLELLRALRDKGYTKIIIQKGNGIYCPNVIVPKGQTKAT  64

Query  537  SENGSPALDYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQS  358
            +E     ++YF +S S+A Y+ SA+LVISHAGSGSIFETL    PLIVV N  LMDNHQ 
Sbjct  65   TEGVE--VEYFDYSPSLASYIASAALVISHAGSGSIFETLTARVPLIVVPNPLLMDNHQV  122

Query  357  ELAEELADRKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGF  199
            EL E+LAD  HL  A P  L   +   D   +VPY  G  + + + I+  LGF
Sbjct  123  ELGEQLADMGHLVSAAPCDLLAAVRSFDASRLVPYTKGSTEDMVRAIDRQLGF  175



>ref|XP_009783908.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog [Nicotiana sylvestris]
Length=116

 Score =   149 bits (377),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 69/86 (80%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = -2

Query  447  AGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELADRKHLFCARPQTLYQTIADMDLE  268
            AGSGSIFETL+LGKPLIVVVNEDLMDNHQSELAEELA++KHLFCARPQTLYQTI DMD  
Sbjct  31   AGSGSIFETLRLGKPLIVVVNEDLMDNHQSELAEELAEKKHLFCARPQTLYQTIMDMDTG  90

Query  267  SVVPYQPGDAKPVAKLINSHLGFPEE  190
            S++ YQPGDA+ V K IN +LGFP++
Sbjct  91   SLIAYQPGDAESVTKFINRYLGFPDD  116



>ref|XP_009776141.1| PREDICTED: putative bifunctional UDP-N-acetylglucosamine transferase 
and deubiquitinase ALG13 [Nicotiana sylvestris]
 ref|XP_009776142.1| PREDICTED: putative bifunctional UDP-N-acetylglucosamine transferase 
and deubiquitinase ALG13 [Nicotiana sylvestris]
Length=148

 Score =   145 bits (367),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 67/94 (71%), Positives = 79/94 (84%), Gaps = 0/94 (0%)
 Frame = -2

Query  723  MGDGGANGADKRIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTK  544
            MG+ G    +K++VFVTVGTTCFDALV AVDT EV+KELF KGYT+I++Q+GRG+Y+PTK
Sbjct  1    MGETGGTVKEKKVVFVTVGTTCFDALVRAVDTPEVKKELFRKGYTNILIQIGRGSYIPTK  60

Query  543  SASENGSPALDYFTFSSSIAKYLKSASLVISHAG  442
            S  ENGS  L+YFTFSSSIA Y K ASLVISHAG
Sbjct  61   STVENGSAVLEYFTFSSSIADYFKEASLVISHAG  94



>ref|XP_003059405.1| glycosyltransferase [Micromonas pusilla CCMP1545]
 gb|EEH56537.1| glycosyltransferase [Micromonas pusilla CCMP1545]
Length=206

 Score =   144 bits (363),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 75/160 (47%), Positives = 102/160 (64%), Gaps = 0/160 (0%)
 Frame = -2

Query  684  VFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPALDYF  505
            VFVTVGTT FDALV A+DTA V + L  KG+  +++Q G+G++   ++ ++     +  F
Sbjct  44   VFVTVGTTSFDALVAALDTARVGEILTRKGFKRVVMQTGKGSHGAPRTLAKTRGLRVRAF  103

Query  504  TFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELADRKH  325
             F+ SI   ++ A LV+SHAG+GS+FETL+  KPL+VVVN+ LM NHQ ELAE L +  H
Sbjct  104  AFAPSIDDEIRGADLVVSHAGAGSVFETLRAKKPLLVVVNDALMGNHQQELAETLHEMGH  163

Query  324  LFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHL  205
            L    P+ +   IA  D  S  PYQPGD   V + I S L
Sbjct  164  LRWCAPEGVGDAIAAFDETSSKPYQPGDPAEVQRAIRSML  203



>ref|XP_007510078.1| predicted protein [Bathycoccus prasinos]
 emb|CCO18423.1| predicted protein [Bathycoccus prasinos]
Length=156

 Score =   142 bits (359),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 76/147 (52%), Positives = 97/147 (66%), Gaps = 5/147 (3%)
 Frame = -2

Query  684  VFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVP----TKSASENGSP-  520
            VFVTVGTT FDALV A+D+ E+ + L E+GY  + +Q GRGTY+P    T ++SE  S  
Sbjct  10   VFVTVGTTSFDALVEAMDSEELIQTLIERGYDSLTIQRGRGTYLPKHIVTSTSSERSSAI  69

Query  519  ALDYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEEL  340
             +    F  S+   LK ASLVISHAG+GS+FE+L LGKP +VVVNE LMDNHQ ELAE L
Sbjct  70   KVQVVEFLPSLDAILKEASLVISHAGAGSVFESLSLGKPTLVVVNESLMDNHQVELAETL  129

Query  339  ADRKHLFCARPQTLYQTIADMDLESVV  259
            A   H+   +P  L Q +   D  S++
Sbjct  130  ASLGHVAWTKPDGLLQALNAFDPNSLI  156



>ref|XP_003492450.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog [Bombus impatiens]
Length=170

 Score =   143 bits (360),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 73/162 (45%), Positives = 105/162 (65%), Gaps = 1/162 (1%)
 Frame = -2

Query  684  VFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPALDYF  505
            +FVTVGTT FD L+  V ++EV + L  KGY +II+Q+GR  +VP       G   ++YF
Sbjct  8    IFVTVGTTKFDELIETVLSSEVLEVLSSKGYHEIILQVGRTLFVP-DCTPRCGFVNIEYF  66

Query  504  TFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELADRKH  325
              S+ I  Y+++A L+ISHAG+GSI + L+  K LIVV NE+LMDNHQ ELAE+L + KH
Sbjct  67   NLSADIINYVQNADLIISHAGAGSILDALECRKNLIVVANENLMDNHQLELAEQLYEDKH  126

Query  324  LFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGF  199
            L+    +TL  TI  M+   + P+    ++ +AK I+  +GF
Sbjct  127  LYYCTCKTLLNTIQTMNFTQLKPFVNKRSRHIAKFIDQIMGF  168



>ref|XP_002734333.2| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog [Saccoglossus kowalevskii]
Length=162

 Score =   142 bits (359),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 72/163 (44%), Positives = 101/163 (62%), Gaps = 2/163 (1%)
 Frame = -2

Query  687  IVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPALDY  508
            +VFVTVGTT FDALV AV +  +R++L   G+T +++Q+GRG Y P      N    +D 
Sbjct  1    MVFVTVGTTKFDALVEAVSSPSIRRQLESLGFTRLVLQIGRGQYEPESFIKPNFR--MDV  58

Query  507  FTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELADRK  328
            + F  SIA  +K ASL+ISHAG+GS+ E+L   KPL+VV+NE LM NHQ ELA +L    
Sbjct  59   YRFKDSIADDIKGASLIISHAGAGSVLESLGAKKPLVVVINEHLMGNHQIELAYKLYTEG  118

Query  327  HLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGF  199
            HL    P  L +T+ D+D+  + P+ PG  +  A  ++   G 
Sbjct  119  HLLYCTPSELLKTLQDLDVSKLKPFPPGQPEKFAAYVDQFFGL  161



>ref|XP_001122008.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog [Apis mellifera]
Length=170

 Score =   142 bits (357),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 72/165 (44%), Positives = 106/165 (64%), Gaps = 1/165 (1%)
 Frame = -2

Query  693  KRIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPAL  514
            K+ +FVTVGTT FD L+  V ++EV + L  KGY +II+Q+G+  ++P       G   +
Sbjct  5    KKKIFVTVGTTKFDELIKTVLSSEVLEILSSKGYNEIILQIGKTLFIPN-CTPRYGFVNI  63

Query  513  DYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELAD  334
            +YF  +++I KY+++  L+ISHAG+GSI +  +  K LIVV N+ LMDNHQ ELAEEL  
Sbjct  64   EYFNLNANITKYIENTDLIISHAGAGSILDASENKKDLIVVANQSLMDNHQLELAEELYK  123

Query  333  RKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGF  199
             KHL+    +TL  TI  M+   + P+    +K +AKLI+  +GF
Sbjct  124  NKHLYYCTCETLLNTIQTMNFAELKPFVNYKSKHIAKLIDKIMGF  168



>ref|XP_003395166.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog [Bombus terrestris]
Length=170

 Score =   142 bits (357),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 73/162 (45%), Positives = 104/162 (64%), Gaps = 1/162 (1%)
 Frame = -2

Query  684  VFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPALDYF  505
            +FVTVGTT FD L+  V ++EV + L  KGY +II+Q+GR  +VP       G   ++YF
Sbjct  8    IFVTVGTTKFDELIETVLSSEVLEVLSSKGYYEIILQIGRTLFVP-DCTPRCGFVNIEYF  66

Query  504  TFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELADRKH  325
              S+ I  Y+++A L+ISHAG+GSI + L+  K LIVV NE+LMDNHQ ELAE+L + KH
Sbjct  67   NLSADIINYVQNADLIISHAGAGSILDALECRKNLIVVANENLMDNHQLELAEQLYEDKH  126

Query  324  LFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGF  199
            L+    +TL  TI  M    + P+    ++ +AK I+  +GF
Sbjct  127  LYYCTCKTLLNTIQAMTFTQLKPFVNKRSRHIAKFIDQIMGF  168



>ref|XP_003703929.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog [Megachile rotundata]
Length=170

 Score =   142 bits (357),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 72/166 (43%), Positives = 106/166 (64%), Gaps = 1/166 (1%)
 Frame = -2

Query  693  KRIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPAL  514
            K+ VFVTVGTT FD L+  V T+E+ + L  KGY ++I+Q+G+  +VP       G   +
Sbjct  5    KKTVFVTVGTTKFDDLIKTVLTSEILQALSLKGYNEMILQIGKTVFVP-DCTLHYGFVNI  63

Query  513  DYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELAD  334
            +YF    +I +Y+++A L+ISHAG+GSI + L+  K LIVV N+ LMDNHQ ELAE+L  
Sbjct  64   EYFNLCFNIQEYVENADLIISHAGAGSILDALEKRKNLIVVTNQSLMDNHQLELAEQLYK  123

Query  333  RKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGFP  196
             +HL+    +TL  TI  MD   + P+  G +K +A+ I+  +GF 
Sbjct  124  DEHLYYCTCETLLDTIQTMDFTKLKPFISGKSKRIAEFIDQIMGFS  169



>ref|XP_003694307.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog [Apis florea]
Length=170

 Score =   141 bits (356),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 72/165 (44%), Positives = 106/165 (64%), Gaps = 1/165 (1%)
 Frame = -2

Query  693  KRIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPAL  514
            K+ +FVTVGTT FD L+  V ++EV + L  KGY +II+Q+G+  ++P       G   +
Sbjct  5    KKKIFVTVGTTKFDELIKTVLSSEVLEMLSSKGYNEIILQIGKTLFIPN-CIPRCGFVNI  63

Query  513  DYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELAD  334
            +YF  +++I KY+++  L+ISHAG+GSI +  +  K LIVV N+ LMDNHQ ELAEEL  
Sbjct  64   EYFNLNANITKYIENTDLIISHAGAGSILDASENKKDLIVVANQSLMDNHQLELAEELYK  123

Query  333  RKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGF  199
             KHL+    +TL  TI  M+   + P+    +K +AKLI+  +GF
Sbjct  124  NKHLYYCTCETLLDTIQTMNFAELKPFVNYKSKHIAKLIDKIMGF  168



>ref|XP_003389644.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog [Amphimedon queenslandica]
Length=176

 Score =   142 bits (357),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 75/174 (43%), Positives = 106/174 (61%), Gaps = 3/174 (2%)
 Frame = -2

Query  693  KRIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPA-  517
            K+ V V VGTT F+ L+ AV     +K LF KGYT + +Q+G G Y P  S S +G    
Sbjct  3    KKSVLVVVGTTKFEDLIKAVSEKRFQKLLFSKGYTHLNIQIGHGEYTPANSESGSGREEG  62

Query  516  --LDYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEE  343
              +D+F F  ++A  +  ASL+ISH GSG+IFE+L L K LIVV+NE LM+NHQ+ELA  
Sbjct  63   LIVDWFRFKPTLASDMTEASLIISHGGSGTIFESLSLRKALIVVINETLMNNHQTELASR  122

Query  342  LADRKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGFPEE*SD  181
            LA   HL     ++LY+TI  +D  ++ PY+ G     A  ++  +GF  + +D
Sbjct  123  LAKDGHLVYTFSKSLYETIETLDPGTLKPYEQGQPSLFADHLDKLMGFNGDKTD  176



>ref|XP_006623782.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog [Apis dorsata]
Length=170

 Score =   141 bits (356),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 72/165 (44%), Positives = 106/165 (64%), Gaps = 1/165 (1%)
 Frame = -2

Query  693  KRIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPAL  514
            K+ +FVTVGTT FD L+  V ++EV + L  KGY +II+Q+G+  ++P       G   +
Sbjct  5    KKKIFVTVGTTKFDELIKTVLSSEVLEILSSKGYNEIILQIGKTLFIPN-CIPRCGFINI  63

Query  513  DYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELAD  334
            +YF  +++I KY+++  L+ISHAG+GSI +  +  K LIVV N+ LMDNHQ ELAEEL  
Sbjct  64   EYFNLNANITKYIENTDLIISHAGAGSILDASESKKNLIVVANQSLMDNHQLELAEELHK  123

Query  333  RKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGF  199
             KHL+    +TL  TI  M+   + P+    +K +AKLI+  +GF
Sbjct  124  NKHLYYCTCETLLDTIQTMNFAELKPFVNYKSKHIAKLIDKIMGF  168



>ref|NP_001134591.1| UDP-N-acetylglucosamine transferase subunit ALG13 homolog [Salmo 
salar]
 gb|ACI68128.1| UDP-N-acetylglucosamine transferase subunit ALG13 homolog [Salmo 
salar]
Length=164

 Score =   140 bits (354),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 74/161 (46%), Positives = 100/161 (62%), Gaps = 2/161 (1%)
 Frame = -2

Query  684  VFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPALDYF  505
            VFVTVGTT FD L+  V + E  +EL  +GY  +++Q+G+G+ +P   +    +  L+ F
Sbjct  4    VFVTVGTTSFDDLIERVTSPEAVQELKARGYQHLVLQVGQGSILPDSDSCHELT--LEAF  61

Query  504  TFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELADRKH  325
             F  SIA+ +K A LVISHAG+GS  ETL   KPL+VVVN+ LMDNHQ ELA +L    H
Sbjct  62   RFKDSIAENIKCADLVISHAGAGSCLETLGADKPLLVVVNDKLMDNHQLELARQLHQDSH  121

Query  324  LFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLG  202
            L    P TL +T+  MDL  + P+ PG  K  A  ++  LG
Sbjct  122  LLYCTPSTLNETLKTMDLAVLSPFLPGQPKHFANFLDRALG  162



>emb|CDQ77121.1| unnamed protein product [Oncorhynchus mykiss]
Length=164

 Score =   140 bits (354),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 74/161 (46%), Positives = 100/161 (62%), Gaps = 2/161 (1%)
 Frame = -2

Query  684  VFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPALDYF  505
            VFVTVGTT FD L+  V + E  +EL  +GY  +++Q+G+G+ +P   +    +  L+ F
Sbjct  4    VFVTVGTTSFDDLIERVTSPEAVQELKARGYQHLVLQVGQGSILPDSDSCHELT--LEAF  61

Query  504  TFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELADRKH  325
             F  SIA+ +K A LVISHAG+GS  ETL  GKPL+VVVN+ LMDNHQ ELA +L    H
Sbjct  62   RFKDSIAENIKCADLVISHAGAGSCLETLGAGKPLLVVVNDKLMDNHQLELARQLHQDSH  121

Query  324  LFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLG  202
            L    P TL +T+  MDL  +  + PG  K  A  ++  LG
Sbjct  122  LLYCTPSTLTETLKTMDLAVLSSFLPGQPKHFANFLDRALG  162



>ref|XP_005093619.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog [Aplysia californica]
Length=170

 Score =   140 bits (354),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 70/167 (42%), Positives = 107/167 (64%), Gaps = 3/167 (2%)
 Frame = -2

Query  690  RIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASE-NGSPAL  514
            + +FVTVGTT FD+L+  + + E  + L   GY+ +  Q+GRG Y P++S S  NG PA+
Sbjct  3    KTIFVTVGTTQFDSLIKKITSEEALETLAALGYSQLTAQIGRGEYEPSESTSRTNGHPAV  62

Query  513  D--YFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEEL  340
               +F   +SI   + ++ LV+SHAG+GS+ + L LGKP++VVVNE+LM NHQ+ELA +L
Sbjct  63   SVSWFRLKASIEDDIAASDLVVSHAGAGSVMDCLGLGKPVLVVVNEELMGNHQTELAHKL  122

Query  339  ADRKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGF  199
            A   HL     + L  ++  +D   + P+ PG+   VA+ ++S LGF
Sbjct  123  AKDGHLHFCGVKDLVVSLKSLDWSCLTPFPPGEPAKVARFLDSALGF  169



>ref|XP_002500823.1| glycosyltransferase family 1 protein [Micromonas sp. RCC299]
 gb|ACO62081.1| glycosyltransferase family 1 protein [Micromonas sp. RCC299]
Length=162

 Score =   140 bits (353),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 74/164 (45%), Positives = 101/164 (62%), Gaps = 8/164 (5%)
 Frame = -2

Query  693  KRIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTY-VPTKSASENGSPA  517
            ++ VFVTVGTT FD+L+ A+DT E    L   GY  +++Q G+GT  +PT          
Sbjct  5    RKSVFVTVGTTQFDSLIEALDTPECADALRGNGYGSVVIQRGKGTRELPTPLE-------  57

Query  516  LDYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELA  337
            +  F F+ S+A  + +A LV+SHAGSGS+FE L + KPL+VVVN+ LMDNHQ+ELAEEL 
Sbjct  58   VRVFDFAPSLADEMLAADLVVSHAGSGSVFEALGMRKPLLVVVNDALMDNHQAELAEELG  117

Query  336  DRKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHL  205
             R HL       L   IA  D   + PY+PGD   +A+ ++  L
Sbjct  118  KRGHLRWCESGGLANAIATFDPRGLTPYEPGDPSGIARALDDAL  161



>ref|XP_010737500.1| PREDICTED: putative bifunctional UDP-N-acetylglucosamine transferase 
and deubiquitinase ALG13 [Larimichthys crocea]
Length=163

 Score =   139 bits (351),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 75/163 (46%), Positives = 101/163 (62%), Gaps = 2/163 (1%)
 Frame = -2

Query  690  RIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPALD  511
            + VFVTVGTT FD LV ++  AE  + L  +GY  +++Q+GRG+ +P  +A       L+
Sbjct  2    KTVFVTVGTTSFDELVESITCAESVQALKARGYERLVLQVGRGSLLP--AADSCPHVRLE  59

Query  510  YFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELADR  331
             F F  SIA+ +K A LVISHAG+GS  E+L  GKPL+VVVN+ LMDNHQ ELA +L   
Sbjct  60   AFRFKDSIAEDIKQADLVISHAGAGSCLESLCAGKPLLVVVNDKLMDNHQLELARQLHMD  119

Query  330  KHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLG  202
             HL      TL +T+  MDL  + P+ PG  K  A  ++  LG
Sbjct  120  SHLLYCTCSTLTETLRTMDLSVLQPFLPGQPKLFANFLDKALG  162



>gb|AAH76360.1| Zgc:92907 [Danio rerio]
 gb|AAI63967.1| Zgc:92907 protein [Danio rerio]
Length=164

 Score =   139 bits (349),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 72/164 (44%), Positives = 102/164 (62%), Gaps = 2/164 (1%)
 Frame = -2

Query  690  RIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPALD  511
            + VFVTVGTT FD L++ V + E  K L ++G+T + +Q+GRG+ VP   +       L 
Sbjct  2    KTVFVTVGTTSFDDLIDTVTSDESVKALIQRGFTGVNLQVGRGSVVPDPESCPGLK--LQ  59

Query  510  YFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELADR  331
             F F  SIA+ ++ + LVISHAG+GS  E L   KPL+VVVN+ LMDNHQ ELA +L   
Sbjct  60   VFRFKDSIAEDMRHSDLVISHAGAGSCLEALGANKPLLVVVNDKLMDNHQLELARQLQTD  119

Query  330  KHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGF  199
             HL      TL QT+ +MDL ++ P+ PG+ +  AK ++  +G 
Sbjct  120  SHLIYCTCSTLPQTLREMDLTTLRPFAPGEPQNFAKFLDKAIGL  163



>ref|XP_005511882.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog isoform X1 [Columba livia]
Length=161

 Score =   139 bits (349),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 73/162 (45%), Positives = 101/162 (62%), Gaps = 5/162 (3%)
 Frame = -2

Query  684  VFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPALDYF  505
            VFVTVGTT FD L+  V +    + L  +GY  +++Q+GRG   P  S S   + A++ F
Sbjct  4    VFVTVGTTSFDDLIATVSSPAALQVLRSRGYEQLVLQVGRGALEPAPSGS--AAVAVESF  61

Query  504  TFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELADRKH  325
             F  S+A+    A LVISHAG+GS  ETL+ GKPLIVV+NE LMDNHQ ELA++L    H
Sbjct  62   RFKDSLAR---DADLVISHAGAGSCLETLEEGKPLIVVINEKLMDNHQLELAKQLHRDGH  118

Query  324  LFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGF  199
            + C    TL +T+  MDL ++ P+ PG  +  A  ++  +GF
Sbjct  119  VLCCSCSTLVETLQSMDLSTLKPFPPGQPEKFALFLDKVVGF  160



>ref|NP_001002460.2| uncharacterized protein LOC436733 [Danio rerio]
Length=164

 Score =   138 bits (348),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 72/164 (44%), Positives = 102/164 (62%), Gaps = 2/164 (1%)
 Frame = -2

Query  690  RIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPALD  511
            + VFVTVGTT FD L++ V + E  K L ++G+T + +Q+GRG+ VP   +       L 
Sbjct  2    KTVFVTVGTTSFDDLIDTVTSDESVKALIQRGFTGVNLQVGRGSVVPDPESCPGLK--LQ  59

Query  510  YFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELADR  331
             F F  SIA+ ++ + LVISHAG+GS  E L   KPL+VVVN+ LMDNHQ ELA +L   
Sbjct  60   VFRFKDSIAEDMRHSDLVISHAGAGSCLEALGANKPLLVVVNDKLMDNHQLELARQLQAD  119

Query  330  KHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGF  199
             HL      TL QT+ +MDL ++ P+ PG+ +  AK ++  +G 
Sbjct  120  SHLIYCTCSTLPQTLREMDLTTLRPFAPGEPQNFAKFLDKAVGL  163



>ref|XP_010900795.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog isoform X1 [Esox lucius]
Length=164

 Score =   138 bits (347),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 75/164 (46%), Positives = 100/164 (61%), Gaps = 4/164 (2%)
 Frame = -2

Query  690  RIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVP-TKSASENGSPAL  514
            + VFVTVGTT FD L+  + T E  + L  +G   +++Q+GRG+ +P + S  E G   +
Sbjct  2    KTVFVTVGTTSFDELIERITTPEAVQALKGRGCQQLVLQVGRGSILPESDSCYELG---I  58

Query  513  DYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELAD  334
            + F F  SIA+ +K A LVISHAG+GS  ETL  GKPL+VVVN+ LMDNHQ ELA  L  
Sbjct  59   NAFRFKDSIAEDIKCADLVISHAGAGSCLETLGAGKPLLVVVNDKLMDNHQLELANRLYK  118

Query  333  RKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLG  202
              HL    P TL +T+  MD   + P+ PG  K  A  ++  LG
Sbjct  119  DSHLLYCTPSTLVETLKTMDFSVLSPFLPGQPKHFADFLDRALG  162



>ref|NP_001154175.1| UDP-N-acetylglucosamine transferase subunit ALG13 homolog [Oncorhynchus 
mykiss]
 gb|ACO08147.1| UDP-N-acetylglucosamine transferase subunit alg13 [Oncorhynchus 
mykiss]
Length=164

 Score =   138 bits (347),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 73/161 (45%), Positives = 99/161 (61%), Gaps = 2/161 (1%)
 Frame = -2

Query  684  VFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPALDYF  505
            VFVTVGTT FD L+  V + E  +EL  +GY  +++Q+G+G+ +P   +    +  L+ F
Sbjct  4    VFVTVGTTSFDDLIERVTSPEAVQELKARGYQHLVLQVGQGSILPDSDSCHELT--LEAF  61

Query  504  TFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELADRKH  325
             F  SIA+ +K A LVISHAG+GS  ETL  GKPL+VVVN+ LMDNHQ ELA +L    H
Sbjct  62   RFKDSIAENIKCADLVISHAGAGSCLETLGAGKPLLVVVNDKLMDNHQLELARQLHQNSH  121

Query  324  LFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLG  202
            L    P TL +T+  M L  +  + PG  K  A  ++  LG
Sbjct  122  LLYCTPSTLTETLKTMGLAVLSSFLPGQPKHFADFLDRALG  162



>ref|XP_005850434.1| hypothetical protein CHLNCDRAFT_34478 [Chlorella variabilis]
 gb|EFN58332.1| hypothetical protein CHLNCDRAFT_34478 [Chlorella variabilis]
Length=176

 Score =   138 bits (347),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 75/168 (45%), Positives = 103/168 (61%), Gaps = 9/168 (5%)
 Frame = -2

Query  693  KRIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPA-  517
            +R VFVTVGTT FDAL+ AVD       L   GYT +++Q+GR            G P  
Sbjct  8    ERTVFVTVGTTKFDALIRAVDQQAFADVLVAAGYTRLVMQIGR-----WAGGEAVGGPGR  62

Query  516  ---LDYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAE  346
               ++YF F+ S+A++L++A+LVISHAGSGSIFE L+L  PL+VV N  LMDNHQ+ELA 
Sbjct  63   RLVVEYFDFAPSLAEHLRAAALVISHAGSGSIFEALRLRLPLVVVPNPLLMDNHQAELAT  122

Query  345  ELADRKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLG  202
            +L    +LF A    L   +A M+   +VPY+ GD   + + I+  +G
Sbjct  123  KLESEGYLFAATTDGLAAVVAGMNPARLVPYEKGDPAGIVRHIDGVMG  170



>ref|XP_001626924.1| predicted protein [Nematostella vectensis]
 gb|EDO34824.1| predicted protein, partial [Nematostella vectensis]
Length=162

 Score =   137 bits (344),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 71/162 (44%), Positives = 106/162 (65%), Gaps = 2/162 (1%)
 Frame = -2

Query  687  IVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPALDY  508
            +VFVTVGTT FD LV  V +  + K L   GY  +++Q+G+G + P +  ++NG   +++
Sbjct  1    VVFVTVGTTSFDKLVETVTSPTICKILQGHGYKKLVLQIGKGEFEP-ECCNQNGF-IVEF  58

Query  507  FTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELADRK  328
            + +  SIA+ +  ASLVISHAGSGSI E+LQ  +PL+VV+NE+LM NHQ ELA ELA+  
Sbjct  59   YRYKDSIAQDIAKASLVISHAGSGSILESLQAKRPLVVVINEELMGNHQLELAHELAEYH  118

Query  327  HLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLG  202
            HL  A  +TL   +  +D+ +++P+ PG        +NS +G
Sbjct  119  HLIYANCRTLQGILQTLDVSALLPFPPGRPITFGSYLNSVMG  160



>ref|XP_007555127.1| PREDICTED: putative bifunctional UDP-N-acetylglucosamine transferase 
and deubiquitinase ALG13 [Poecilia formosa]
Length=164

 Score =   137 bits (344),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 72/163 (44%), Positives = 102/163 (63%), Gaps = 2/163 (1%)
 Frame = -2

Query  690  RIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPALD  511
            + VFVTVGTT FD L+ +V ++E  + L  +GY  +++Q+G+G+ +P   A      +++
Sbjct  2    KTVFVTVGTTRFDELIESVTSSEATQLLKFRGYERLVLQVGKGSLLP--DADSCAHLSVE  59

Query  510  YFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELADR  331
             F F  SIA+ +K A LVISHAG+GS  E L  GKPL+VVVN+ LMDNHQ ELA +L   
Sbjct  60   AFRFKDSIAEDMKQADLVISHAGAGSCLEALGAGKPLLVVVNDKLMDNHQLELARQLHMD  119

Query  330  KHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLG  202
             HL      TL +T+ +MDL  + P+ PG  K  A  ++  LG
Sbjct  120  HHLLYCTCSTLIETLKNMDLSVLQPFPPGQPKNFANFLDKALG  162



>ref|XP_003970264.1| PREDICTED: putative bifunctional UDP-N-acetylglucosamine transferase 
and deubiquitinase ALG13 [Takifugu rubripes]
Length=164

 Score =   136 bits (343),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 72/164 (44%), Positives = 106/164 (65%), Gaps = 2/164 (1%)
 Frame = -2

Query  690  RIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPALD  511
            + VFVTVGTT FD L+ ++ + E  + L ++GY  +++Q+G+G+ +PT  +  + S  L+
Sbjct  2    KTVFVTVGTTKFDQLIESITSPENVQILKDRGYERLVLQVGKGSVLPTADSCPHIS--LE  59

Query  510  YFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELADR  331
             + F SSIA+ ++ + LVISHAG+GS  ETL  GKPL+VVVN+ LMDNHQ ELA +L   
Sbjct  60   AYRFKSSIAEDIERSDLVISHAGAGSCLETLGAGKPLLVVVNDTLMDNHQLELARQLYVD  119

Query  330  KHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGF  199
             HL     +TL +T+  MDL  + P+ PG  K  A  ++  LG 
Sbjct  120  SHLLYCTCRTLTETLRTMDLSVLRPFLPGQPKLFANFLDRALGL  163



>ref|XP_005799535.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog isoform X1 [Xiphophorus maculatus]
Length=164

 Score =   135 bits (340),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 71/163 (44%), Positives = 102/163 (63%), Gaps = 2/163 (1%)
 Frame = -2

Query  690  RIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPALD  511
            + VFVTVG+T FD L+ +V ++E  + L  +GY  +++Q+G+G+ +P   A      +++
Sbjct  2    KTVFVTVGSTRFDELIESVTSSEATQVLKFRGYERLVLQVGKGSLLP--DADSCAHLSVE  59

Query  510  YFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELADR  331
             F F  SIA+ +K A LVISHAG+GS  E L  GKPL+VVVN+ LMDNHQ ELA +L   
Sbjct  60   AFRFKDSIAEDMKQADLVISHAGAGSCLEALGAGKPLLVVVNDKLMDNHQLELARQLHMD  119

Query  330  KHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLG  202
             HL      TL +T+ +MDL  + P+ PG  K  A  ++  LG
Sbjct  120  HHLLYCTCSTLTETLKNMDLSVLQPFPPGQPKNFANFLDKALG  162



>ref|XP_008866975.1| hypothetical protein H310_04416 [Aphanomyces invadans]
 gb|ETW04019.1| hypothetical protein H310_04416 [Aphanomyces invadans]
Length=1470

 Score =   145 bits (366),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 79/180 (44%), Positives = 111/180 (62%), Gaps = 3/180 (2%)
 Frame = -2

Query  753   WVSVKIVYFHMGDGGANGADKRIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQ  574
             W ++ I +F  GD       K++VFVTVGTTCFD ++ AVDT EV   L +KGY +I+ Q
Sbjct  1282  WKAI-IAFFSTGDVPPTTMPKKMVFVTVGTTCFDEMIAAVDTDEVHAILKQKGYDEILFQ  1340

Query  573   MGRGTYVPTKSASENGSPALDYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIV  394
             +GRGT+ P   A  N +    ++ F+ +    ++ ASLV+SHAG+GSI +TL   K LIV
Sbjct  1341  IGRGTHEPRVIA--NDTFTTSFYRFNPAYKDDIRRASLVLSHAGAGSIMDTLVERKHLIV  1398

Query  393   VVNEDLMDNHQSELAEELADRKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLIN  214
             + N  LMDNHQ ELA  LA+R HL       L  T+A +DL+++VPY   D +    L++
Sbjct  1399  IPNTQLMDNHQEELAGALAERHHLVATTCSLLASTLASVDLKTLVPYPEVDEEAFPSLVD  1458



>ref|XP_008419042.1| PREDICTED: putative bifunctional UDP-N-acetylglucosamine transferase 
and deubiquitinase ALG13 [Poecilia reticulata]
Length=164

 Score =   134 bits (338),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 71/163 (44%), Positives = 100/163 (61%), Gaps = 2/163 (1%)
 Frame = -2

Query  690  RIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPALD  511
            + VFVTVGTT FD L+ +V ++E  + L  +GY  +++Q+G+G+ +P   A      ++ 
Sbjct  2    KTVFVTVGTTRFDELIESVTSSEATQVLKFRGYERLVLQVGKGSLLP--DADSCAHLSVQ  59

Query  510  YFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELADR  331
             F F  SI + +K A LVISHAG+GS  E L  GKPL+VVVN+ LMDNHQ ELA +L   
Sbjct  60   AFRFKDSITEDMKQADLVISHAGAGSCLEALGAGKPLLVVVNDKLMDNHQLELARQLHMD  119

Query  330  KHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLG  202
             HL      TL +T+ +MDL  + P+ PG  K  A  ++  LG
Sbjct  120  HHLLYCTCSTLIETLKNMDLSVLQPFPPGQPKNFANFLDKALG  162



>ref|XP_001603451.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog [Nasonia vitripennis]
Length=167

 Score =   135 bits (339),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 72/165 (44%), Positives = 105/165 (64%), Gaps = 2/165 (1%)
 Frame = -2

Query  693  KRIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPAL  514
            KRI FVTVGTT FD L+  V   +V KEL +KGY ++++Q+G+ T +        G   +
Sbjct  4    KRI-FVTVGTTKFDELIKTVTNNDVLKELNDKGYNELVLQIGK-TDIEPDCTPRCGFSRI  61

Query  513  DYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELAD  334
            + F  S S+ + ++SA L+ISHAG+GS  E L+L KPLIVV N+ LM+NHQ ELAE+L  
Sbjct  62   EAFKLSPSLHEAMESADLIISHAGAGSCLEALELAKPLIVVTNDLLMNNHQLELAEQLYK  121

Query  333  RKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGF  199
              HL+ +  + L   I  MDL  + P+Q  ++K +A +I+  +GF
Sbjct  122  NGHLYYSNCKNLAGLIKSMDLSKLKPFQGDNSKEIANVIDEIMGF  166



>ref|XP_007211172.1| hypothetical protein PRUPE_ppb021125mg [Prunus persica]
 gb|EMJ12371.1| hypothetical protein PRUPE_ppb021125mg [Prunus persica]
Length=86

 Score =   132 bits (332),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 64/85 (75%), Positives = 76/85 (89%), Gaps = 1/85 (1%)
 Frame = -2

Query  444  GSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELADRKHLFCARPQTLYQTIADMDLES  265
            GS S+FETL+LGKPLIVVVNEDLMDNHQSELAEELA+RKHL+ ARPQTL +TIA+M+L+ 
Sbjct  3    GSRSMFETLRLGKPLIVVVNEDLMDNHQSELAEELAERKHLYYARPQTLCRTIANMNLDY  62

Query  264  VVPYQPGDAKPVAKLINSHLGFPEE  190
            ++PY PGDA PVAKLIN  LGF ++
Sbjct  63   LIPY-PGDATPVAKLINRFLGFSDD  86



>ref|XP_005527465.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog [Pseudopodoces humilis]
Length=165

 Score =   134 bits (338),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 72/163 (44%), Positives = 104/163 (64%), Gaps = 3/163 (2%)
 Frame = -2

Query  684  VFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPALDYF  505
            VFVTVGTT FD L+ A  +    + L  +GY  +++Q+GRG+ +P      + + A++ F
Sbjct  4    VFVTVGTTSFDELIAAAGSPPALQALQSRGYQKLVLQVGRGS-LPQAQPCSSSAVAVEVF  62

Query  504  TFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEEL-ADRK  328
             F  S+A+ L+ A LVISHAG+GS  ETL+ GKPLIVV+N+ LMDNHQ ELA++L  D  
Sbjct  63   RFKDSLAEELQRADLVISHAGAGSCLETLEKGKPLIVVINDKLMDNHQLELAKQLHRDGC  122

Query  327  HLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGF  199
             L+C    TL +T+  MDL ++ P+ PG  +  A  ++  LG 
Sbjct  123  VLYC-NCSTLVETLQSMDLSALKPFPPGQPEKFASFLDKVLGL  164



>ref|XP_005723101.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog [Pundamilia nyererei]
 ref|XP_005913364.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog [Haplochromis burtoni]
 ref|XP_006781346.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog [Neolamprologus brichardi]
Length=164

 Score =   134 bits (336),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 71/164 (43%), Positives = 100/164 (61%), Gaps = 2/164 (1%)
 Frame = -2

Query  690  RIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPALD  511
            + VFVTVGTT FD L+ ++ ++E  + L  +GY  +++Q+GRG+ +P  +A       L+
Sbjct  2    KTVFVTVGTTSFDELIESITSSEATQALKARGYERLVLQVGRGSVLP--AADSCPHIRLE  59

Query  510  YFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELADR  331
             F F +SIA+ +  A LVISHAG+GS  E L  GK L+VVVN+ LMDNHQ ELA +L   
Sbjct  60   AFRFKNSIAEDISQADLVISHAGAGSCLEALGAGKSLLVVVNDKLMDNHQLELARQLHID  119

Query  330  KHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGF  199
             HL      TL +T+  MDL  + P+ PG  K  A  ++  LG 
Sbjct  120  SHLLYCTCSTLTETLRTMDLSVLQPFPPGQPKKFADFMDKALGI  163



>ref|XP_002603195.1| hypothetical protein BRAFLDRAFT_115464 [Branchiostoma floridae]
 gb|EEN59206.1| hypothetical protein BRAFLDRAFT_115464 [Branchiostoma floridae]
Length=168

 Score =   134 bits (336),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 71/164 (43%), Positives = 100/164 (61%), Gaps = 2/164 (1%)
 Frame = -2

Query  693  KRIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPAL  514
            ++ VFVTVGTT FD L+  V ++   K L + GYT +++Q+GRG Y P   A       L
Sbjct  5    EKCVFVTVGTTSFDPLIELVSSSSFCKLLEDLGYTRLLLQIGRGQYEP--EAFVRPGFRL  62

Query  513  DYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELAD  334
            +YF F  +IA+ ++ A LVISHAG+GS  ETL  GKPL+VV+NE LM+NHQ ELA +L  
Sbjct  63   EYFRFKDTIAEDIQGAGLVISHAGAGSCLETLGAGKPLVVVINETLMNNHQLELANQLYK  122

Query  333  RKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLG  202
              HL+ A    L   + DMD+  +  + PG  +  A  ++  +G
Sbjct  123  DGHLYYATCSNLRHLLKDMDISKLKTFPPGQPEKFAAFLDKVMG  166



>ref|XP_003444657.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog [Oreochromis niloticus]
Length=164

 Score =   133 bits (335),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 71/164 (43%), Positives = 100/164 (61%), Gaps = 2/164 (1%)
 Frame = -2

Query  690  RIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPALD  511
            + VFVTVGTT FD L+ ++ ++E  + L  +GY  +++Q+GRG+  P  +A       L+
Sbjct  2    KTVFVTVGTTSFDELIESITSSEATQALKARGYEHLVLQVGRGSVFP--AADSCPHIRLE  59

Query  510  YFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELADR  331
             F F +SIA+ +  A LVISHAG+GS  E L  GK L+VVVN+ LMDNHQ ELA++L   
Sbjct  60   AFRFKNSIAEDISQADLVISHAGAGSCLEALGAGKSLLVVVNDKLMDNHQLELAKQLHID  119

Query  330  KHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGF  199
             HL      TL +T+  MDL  + P+ PG  K  A  ++  LG 
Sbjct  120  SHLLYCTCSTLTETLRTMDLSVLQPFPPGQPKKFADFMDKALGI  163



>ref|NP_001084877.1| ALG13, UDP-N-acetylglucosaminyltransferase subunit [Xenopus laevis]
 gb|AAH70860.1| MGC84616 protein [Xenopus laevis]
Length=165

 Score =   133 bits (335),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 73/163 (45%), Positives = 99/163 (61%), Gaps = 2/163 (1%)
 Frame = -2

Query  690  RIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPALD  511
            + VFVTVGTT FD L++ V   E    L   GY  +++Q+GRGT  P  S + +    L+
Sbjct  3    KTVFVTVGTTSFDHLISCVSAEETVTILKGLGYNRLVLQIGRGTIEPAPSCTSD--FLLE  60

Query  510  YFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELADR  331
            +F +  S+ + +KSA LVISHAG+GS  ETL  GKPLIVV+NE LM NHQ ELA++L   
Sbjct  61   FFRYKESLEEDIKSADLVISHAGAGSCLETLGEGKPLIVVINEQLMSNHQIELAKQLYKD  120

Query  330  KHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLG  202
             HLF     TL  T+  MDL S+  + PG  +  A  ++  +G
Sbjct  121  GHLFYCTCSTLGNTLQKMDLSSLKCFSPGRPENFATFLDKIVG  163



>ref|XP_004545661.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog [Maylandia zebra]
Length=164

 Score =   133 bits (334),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 71/164 (43%), Positives = 100/164 (61%), Gaps = 2/164 (1%)
 Frame = -2

Query  690  RIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPALD  511
            + VFVTVGTT FD L+ ++ ++E  + L  +GY  +++Q+GRG+ +P  +A       L+
Sbjct  2    KTVFVTVGTTSFDELIESITSSEATQALKVRGYERLVLQVGRGSVLP--AADSCPHIRLE  59

Query  510  YFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELADR  331
             F F +SIA+ +  A LVISHAG+GS  E L  GK L+VVVN+ LMDNHQ ELA +L   
Sbjct  60   AFRFKNSIAEDISQADLVISHAGAGSCLEALGAGKSLLVVVNDKLMDNHQLELARQLHID  119

Query  330  KHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGF  199
             HL      TL +T+  MDL  + P+ PG  K  A  ++  LG 
Sbjct  120  SHLLYCTCSTLTETLRTMDLSVLQPFPPGQPKKFADFMDKALGI  163



>ref|XP_008325117.1| PREDICTED: putative bifunctional UDP-N-acetylglucosamine transferase 
and deubiquitinase ALG13 [Cynoglossus semilaevis]
Length=164

 Score =   133 bits (334),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 70/163 (43%), Positives = 100/163 (61%), Gaps = 2/163 (1%)
 Frame = -2

Query  690  RIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPALD  511
            + VFVTVGTT FD L+  V T+E  + +  +GY  +++Q+GRG+ +P  +A       L+
Sbjct  2    KTVFVTVGTTSFDELIETVTTSETVQAIKARGYERLVLQVGRGSVLP--AADSCPHITLE  59

Query  510  YFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELADR  331
             F F  SIA+ +K A LVISHAG+GS  E +  GK L+VVVN+ LM+NHQ ELA+ L   
Sbjct  60   AFRFKDSIAEDVKQADLVISHAGAGSCLEAMGAGKSLLVVVNDKLMNNHQLELAQRLHQD  119

Query  330  KHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLG  202
             HL      TL +T+  MDL  + P+ PG  +  A  +++ LG
Sbjct  120  SHLLYCTCSTLTETLRTMDLSVLQPFLPGQPEKFANFLDNALG  162



>ref|XP_003081472.1| glycosyltransferase 28 domain containing 1 (ISS) [Ostreococcus 
tauri]
 emb|CAL55994.1| Glycosyl transferase, family 28, C-terminal [Ostreococcus tauri]
Length=173

 Score =   132 bits (333),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 72/159 (45%), Positives = 101/159 (64%), Gaps = 5/159 (3%)
 Frame = -2

Query  684  VFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPALDYF  505
            VFVTVGTT FDAL+ A+D+    K L ++G+T++ +Q+GRGTY PT +    G+  +   
Sbjct  11   VFVTVGTTSFDALIEALDSERTVKVLEQRGFTELTLQIGRGTYAPT-TLRTRGAFKVRVV  69

Query  504  TFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELADRKH  325
             +  SI + +  A LVISHAG+GS+FETL+ G PL+VVVNE LMDNHQ ELAEELA+R  
Sbjct  70   EYLPSIEREIARAGLVISHAGAGSVFETLRSGTPLLVVVNERLMDNHQVELAEELAERGC  129

Query  324  LFCARPQTLYQTIADMDLE----SVVPYQPGDAKPVAKL  220
            L       ++  I  ++L+    +   Y PG+     +L
Sbjct  130  LRWCVADGIFGAIEALELDGSGFARKAYDPGECSIKERL  168



>ref|XP_008558491.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog [Microplitis demolitor]
Length=168

 Score =   132 bits (331),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 70/162 (43%), Positives = 97/162 (60%), Gaps = 1/162 (1%)
 Frame = -2

Query  684  VFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPALDYF  505
            +FVTVGTT FD L+  V   ++  EL ++GY+ +I+Q+G    +P       G   ++ F
Sbjct  7    IFVTVGTTKFDKLIETVMKDDILMELNKRGYSYLILQIGNTNLMP-DCTPRCGFNNIEMF  65

Query  504  TFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELADRKH  325
                SI +Y+KSA L+ISHAG+GS  E L+  KPLIVV N+ LMDNHQSELAE+L   KH
Sbjct  66   NLKPSINEYMKSADLIISHAGAGSCLEALEANKPLIVVTNDLLMDNHQSELAEQLHKDKH  125

Query  324  LFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGF  199
            LF     TL Q    M L  +  +    +  +AK+I+  +GF
Sbjct  126  LFQCTCDTLLQVCKTMHLSQLEKFVDDKSPKIAKIIDDIMGF  167



>ref|XP_010344639.1| PREDICTED: putative bifunctional UDP-N-acetylglucosamine transferase 
and deubiquitinase ALG13 isoform X7 [Saimiri boliviensis 
boliviensis]
Length=165

 Score =   131 bits (330),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 69/164 (42%), Positives = 102/164 (62%), Gaps = 2/164 (1%)
 Frame = -2

Query  690  RIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPALD  511
            + VFVTVGTT FD L+  V   +  +++   GY+ +I+Q+GRGT VP   ++E  S  LD
Sbjct  2    KCVFVTVGTTSFDDLIACVSAPDSLQKIESLGYSRLILQIGRGTVVPEPFSTE--SFTLD  59

Query  510  YFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELADR  331
             + +  S+ + ++ A LVISHAG+GS  ETL+ GKPL+VV+NE LM+NHQ ELA++L   
Sbjct  60   VYRYKDSVKEDIQKADLVISHAGAGSCLETLEKGKPLVVVINEKLMNNHQLELAKQLHKE  119

Query  330  KHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGF  199
             HLF     TL   +  MDL ++  Y PG  +  +  ++  +G 
Sbjct  120  GHLFYCTCSTLPGLLQSMDLSTLKCYPPGQPEKFSAFLDKVVGL  163



>ref|XP_008302280.1| PREDICTED: putative bifunctional UDP-N-acetylglucosamine transferase 
and deubiquitinase ALG13 [Stegastes partitus]
Length=164

 Score =   131 bits (330),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 67/164 (41%), Positives = 101/164 (62%), Gaps = 2/164 (1%)
 Frame = -2

Query  690  RIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPALD  511
            + VFVTVGTT FD L+  + ++E  + L  +GY  +++Q+GRG  +P   +  N    L+
Sbjct  2    KTVFVTVGTTSFDELIETIISSEATQALKARGYGRLVLQVGRGALLPDADSCPN--IRLE  59

Query  510  YFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELADR  331
             F + +S+A+ ++ A L+ISHAG+GS  E L  GKPL+VVVN+ LM+NHQ ELA++L   
Sbjct  60   AFRYKNSLAEDIEQADLIISHAGAGSCLEALGAGKPLLVVVNDKLMNNHQLELAKQLHVD  119

Query  330  KHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGF  199
             HL      TL +T+  MDL  + P+ PG  +  A  ++  LG 
Sbjct  120  SHLLYCTCSTLTETLRTMDLSVLRPFLPGQPQNFANFLDKALGI  163



>ref|XP_009828073.1| hypothetical protein H257_05053 [Aphanomyces astaci]
 gb|ETV82404.1| hypothetical protein H257_05053 [Aphanomyces astaci]
Length=171

 Score =   132 bits (331),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 74/167 (44%), Positives = 101/167 (60%), Gaps = 3/167 (2%)
 Frame = -2

Query  690  RIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPALD  511
            ++VFVTVGTT FD +V AVD  EVR  L EKGY  I+ Q+GRGTY P    + NG+ +  
Sbjct  4    KMVFVTVGTTSFDDMVVAVDADEVRTILKEKGYDKILFQIGRGTYEPR---ALNGTLSTS  60

Query  510  YFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELADR  331
            ++ F+++    ++ ASLVISHAG+GSI +TL   K LIV+ N  LMDNHQ ELA  LA+R
Sbjct  61   FYRFNAAYKDDIRRASLVISHAGAGSIMDTLVERKHLIVIPNSQLMDNHQEELAGALAER  120

Query  330  KHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGFPEE  190
             HL       L   +  +DL ++ PY   D       ++S +  P+ 
Sbjct  121  HHLVATTCTLLASCLKAVDLNTLEPYPDVDEAAFPSFVDSVVHPPQH  167



>ref|XP_003262257.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog isoform 6 [Nomascus leucogenys]
Length=165

 Score =   131 bits (330),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 70/164 (43%), Positives = 101/164 (62%), Gaps = 2/164 (1%)
 Frame = -2

Query  690  RIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPALD  511
            + VFVTVGTT FD L+  V   +  +++   GY  +I+Q+GRGT VP   ++E  S  LD
Sbjct  2    KCVFVTVGTTSFDDLIACVSAPDSLQKIESLGYNRLILQIGRGTVVPEPFSTE--SFTLD  59

Query  510  YFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELADR  331
             + +  S+ + ++ A LVISHAG+GS  ETL+ GKPLIVV+NE LM+NHQ ELA++L   
Sbjct  60   VYRYKDSLKEDIQKADLVISHAGAGSCLETLEKGKPLIVVINEKLMNNHQLELAKQLHKE  119

Query  330  KHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGF  199
             HLF     TL   +  MDL ++  Y PG  +  +  ++  +G 
Sbjct  120  GHLFYCTCSTLPGLLQSMDLSTLKCYPPGQPEKFSAFLDKVVGL  163



>emb|CAG09783.1| unnamed protein product, partial [Tetraodon nigroviridis]
Length=164

 Score =   131 bits (330),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 70/164 (43%), Positives = 102/164 (62%), Gaps = 2/164 (1%)
 Frame = -2

Query  690  RIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPALD  511
            + VFVTVGTT FD L+ ++ +    + L ++GY  +++Q+G+G+ +P   +  + S  L+
Sbjct  2    KTVFVTVGTTRFDELIESITSPVNVQVLKDRGYERLVLQVGQGSLLPAADSCPHIS--LE  59

Query  510  YFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELADR  331
             + F  SIA  ++ A LVISHAG+GS  ETL  GKPL+VVVN+ LMDNHQ ELA +L   
Sbjct  60   AYRFKGSIADDIEQADLVISHAGAGSCLETLGAGKPLLVVVNDTLMDNHQLELARQLHMD  119

Query  330  KHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGF  199
             HL     +TL +T+  MDL  + P+ PG  K  A  ++  LG 
Sbjct  120  SHLLYCTCRTLTETLRTMDLSVLRPFSPGQPKLFASFLDRALGL  163



>ref|XP_009233449.1| PREDICTED: putative bifunctional UDP-N-acetylglucosamine transferase 
and deubiquitinase ALG13 isoform X1 [Pongo abelii]
Length=165

 Score =   131 bits (329),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 70/164 (43%), Positives = 101/164 (62%), Gaps = 2/164 (1%)
 Frame = -2

Query  690  RIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPALD  511
            + VFVTVGTT FD L+  V   +  +++   GY  +I+Q+GRGT VP   ++E  S  LD
Sbjct  2    KCVFVTVGTTSFDDLIACVSAPDSLQKIESLGYNRLILQIGRGTVVPEPFSTE--SFTLD  59

Query  510  YFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELADR  331
             + +  S+ + ++ A LVISHAG+GS  ETL+ GKPLIVV+NE LM+NHQ ELA++L   
Sbjct  60   VYRYKDSLKEDIQKADLVISHAGAGSCLETLEKGKPLIVVINEKLMNNHQLELAKQLHTE  119

Query  330  KHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGF  199
             HLF     TL   +  MDL ++  Y PG  +  +  ++  +G 
Sbjct  120  GHLFYCTCSTLPGLLQSMDLSTLKCYPPGQPEKFSAFLDKVVGL  163



>gb|AIC57126.1| ALG13, partial [synthetic construct]
Length=165

 Score =   131 bits (329),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 69/164 (42%), Positives = 101/164 (62%), Gaps = 2/164 (1%)
 Frame = -2

Query  690  RIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPALD  511
            + VFVTVGTT FD L+  V   +  +++   GY  +I+Q+GRGT VP   ++E  S  LD
Sbjct  2    KCVFVTVGTTSFDDLIACVSAPDSLQKIESLGYNRLILQIGRGTVVPEPFSTE--SFTLD  59

Query  510  YFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELADR  331
             + +  S+ + ++ A LVISHAG+GS  ETL+ GKPL+VV+NE LM+NHQ ELA++L   
Sbjct  60   VYRYKDSLKEDIQKADLVISHAGAGSCLETLEKGKPLVVVINEKLMNNHQLELAKQLHKE  119

Query  330  KHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGF  199
             HLF     TL   +  MDL ++  Y PG  +  +  ++  +G 
Sbjct  120  GHLFYCTCSTLPGLLQSMDLSTLKCYPPGQPEKFSAFLDKVVGL  163



>ref|XP_011501018.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog [Ceratosolen solmsi marchali]
 ref|XP_011501019.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog [Ceratosolen solmsi marchali]
Length=168

 Score =   131 bits (329),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 71/167 (43%), Positives = 111/167 (66%), Gaps = 4/167 (2%)
 Frame = -2

Query  696  DKRIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPA  517
            +KRI+ VTVGTT FD L+N + T EV +EL  +GY ++I+Q+G+  + P  S S  G   
Sbjct  2    NKRIL-VTVGTTKFDELINTITTNEVLQELNNQGYNELILQIGKTNFQPNCS-SRCGFNN  59

Query  516  LDYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELA  337
            +  F  +SS+ + +KSA L+ISHAG+GS  E L+L KPLI+++N+ LM NHQ ELA++L 
Sbjct  60   IKAFHLNSSLHEVMKSADLIISHAGAGSCLEALELLKPLIIIINDHLMSNHQLELAKQLY  119

Query  336  DRKHLFCARPQTLYQTIADMDLESVVPYQPGD-AKPVAKLINSHLGF  199
               +L+ +  + L + I  ++L  + PY PGD +K +A +I+  +G+
Sbjct  120  KLGYLYYSNCKGLLKLIQIVNLSKLKPY-PGDKSKDIASIIDKIMGY  165



>ref|NP_060936.1| putative bifunctional UDP-N-acetylglucosamine transferase and 
deubiquitinase ALG13 isoform 2 [Homo sapiens]
 gb|AAF67644.1|AF220051_1 uncharacterized hematopoietic stem/progenitor cells protein MDS031 
[Homo sapiens]
 gb|AAH05336.1| Asparagine-linked glycosylation 13 homolog (S. cerevisiae) [Homo 
sapiens]
 gb|EAX02635.1| glycosyltransferase 28 domain containing 1, isoform CRA_b [Homo 
sapiens]
 dbj|BAG35162.1| unnamed protein product [Homo sapiens]
Length=165

 Score =   130 bits (328),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 69/164 (42%), Positives = 101/164 (62%), Gaps = 2/164 (1%)
 Frame = -2

Query  690  RIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPALD  511
            + VFVTVGTT FD L+  V   +  +++   GY  +I+Q+GRGT VP   ++E  S  LD
Sbjct  2    KCVFVTVGTTSFDDLIACVSAPDSLQKIESLGYNRLILQIGRGTVVPEPFSTE--SFTLD  59

Query  510  YFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELADR  331
             + +  S+ + ++ A LVISHAG+GS  ETL+ GKPL+VV+NE LM+NHQ ELA++L   
Sbjct  60   VYRYKDSLKEDIQKADLVISHAGAGSCLETLEKGKPLVVVINEKLMNNHQLELAKQLHKE  119

Query  330  KHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGF  199
             HLF     TL   +  MDL ++  Y PG  +  +  ++  +G 
Sbjct  120  GHLFYCTCSTLPGLLQSMDLSTLKCYPPGQPEKFSAFLDKVVGL  163



>ref|XP_006136610.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog isoform X1 [Pelodiscus sinensis]
 ref|XP_006136611.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog isoform X2 [Pelodiscus sinensis]
Length=163

 Score =   130 bits (328),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 71/164 (43%), Positives = 102/164 (62%), Gaps = 7/164 (4%)
 Frame = -2

Query  684  VFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPA--LD  511
            VFVTVGTTCF+ L+  V   E  + L   GY+ +++Q+G G   PT   +    PA  L+
Sbjct  4    VFVTVGTTCFEELIAVVSAPETIQILQSLGYSRLVLQVGGGA-APTPLRT----PAFTLE  58

Query  510  YFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELADR  331
             F F  S+A+  + A LVISHAG+G+  ETL+ GKPL+VV+NE LM+NHQ ELA +L   
Sbjct  59   VFRFRESLAEEFQRADLVISHAGAGTCLETLEKGKPLLVVINEKLMNNHQLELARQLYKD  118

Query  330  KHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGF  199
            +HLF     TL +++  +DL ++ P+ PG  +  A  ++S  GF
Sbjct  119  EHLFYCTCSTLLESLKSIDLSTLKPFPPGQPEKFAAFLDSITGF  162



>ref|XP_006632919.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog [Lepisosteus oculatus]
Length=164

 Score =   130 bits (328),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 69/162 (43%), Positives = 97/162 (60%), Gaps = 2/162 (1%)
 Frame = -2

Query  684  VFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPALDYF  505
            VFVTVGTT FD L+  V + +  + L   GY+ +++Q+GRG+  P  +A       L  F
Sbjct  4    VFVTVGTTSFDELIACVSSEDAVQALRALGYSRLVLQIGRGSVRPDSAACPG--IELRVF  61

Query  504  TFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELADRKH  325
             +  SIA+ ++SA LV+SHAG+GS  ETL  GKPL+VVVN+ LM NHQ ELA +L    H
Sbjct  62   RYKDSIAEEIRSADLVVSHAGAGSCLETLGAGKPLLVVVNDGLMSNHQLELARQLHREGH  121

Query  324  LFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGF  199
            L      TL +T+  MDL +++P  PG     A  ++  +G 
Sbjct  122  LHYCTCSTLVETLRTMDLSALMPLLPGQPGKFASFLDRAVGL  163



>ref|XP_313491.3| AGAP003699-PA [Anopheles gambiae str. PEST]
 gb|EAA08794.3| AGAP003699-PA [Anopheles gambiae str. PEST]
Length=170

 Score =   130 bits (328),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 69/162 (43%), Positives = 99/162 (61%), Gaps = 0/162 (0%)
 Frame = -2

Query  684  VFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPALDYF  505
            VFVTVGTT F+AL+ AV +  V ++L + G T + +Q G+G     + A  + +  L  +
Sbjct  9    VFVTVGTTEFEALIRAVTSTAVLEQLAKLGCTALTIQFGKGEAPDVELAQRHTTIRLSAY  68

Query  504  TFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELADRKH  325
               SSI   +  A LVISHAG+GS  E L+ GKPLIVVVNE LM+NHQ+ELAE L+  ++
Sbjct  69   GLKSSIGDDISQADLVISHAGAGSCLEVLEAGKPLIVVVNETLMNNHQTELAERLSRDRN  128

Query  324  LFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGF  199
            LF   P TL +T+A+ D  ++    PG        +++ +GF
Sbjct  129  LFYCTPNTLLETLAESDFSTLEKLAPGALDSFVNQLDAFMGF  170



>ref|XP_004886173.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog isoform X1 [Heterocephalus glaber]
 ref|XP_004861481.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog isoform X3 [Heterocephalus glaber]
Length=166

 Score =   130 bits (327),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 68/164 (41%), Positives = 98/164 (60%), Gaps = 2/164 (1%)
 Frame = -2

Query  690  RIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPALD  511
            + VFVTVGTT FD L+  +   E  +     GY+ + +Q+GRGT VP   ++E  S  LD
Sbjct  3    KCVFVTVGTTSFDELIERMSAQESLRIFKSLGYSRLTLQIGRGTVVPEPFSTE--SFTLD  60

Query  510  YFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELADR  331
             + +  S+ + L+ A LVISHAG+GS  ETL+ GKPL+VVVNE LM+NHQ +LA++L   
Sbjct  61   VYRYKDSLQEDLQRADLVISHAGAGSCLETLEKGKPLVVVVNEKLMNNHQLQLAKQLHKE  120

Query  330  KHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGF  199
             H FC     L   +  MDL ++  Y PG  +  +  ++  +G 
Sbjct  121  GHFFCCTCSMLPGLLQSMDLSTLKCYPPGQPEKFSAFLDKVVGL  164



>ref|XP_003317684.1| PREDICTED: putative bifunctional UDP-N-acetylglucosamine transferase 
and deubiquitinase ALG13 isoform X8 [Pan troglodytes]
Length=165

 Score =   130 bits (327),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 69/164 (42%), Positives = 101/164 (62%), Gaps = 2/164 (1%)
 Frame = -2

Query  690  RIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPALD  511
            + VFVTVGTT FD L+  V   +  +++   GY  +I+Q+GRGT VP   ++E  S  LD
Sbjct  2    KCVFVTVGTTSFDDLIARVSAPDSLQKIESLGYNRLILQIGRGTVVPEPFSTE--SFTLD  59

Query  510  YFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELADR  331
             + +  S+ + ++ A LVISHAG+GS  ETL+ GKPL+VV+NE LM+NHQ ELA++L   
Sbjct  60   VYRYKDSLKEDIQKADLVISHAGAGSCLETLEKGKPLVVVINEKLMNNHQLELAKQLHKE  119

Query  330  KHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGF  199
             HLF     TL   +  MDL ++  Y PG  +  +  ++  +G 
Sbjct  120  GHLFYCTCSTLPGLLQSMDLSTLKCYPPGQPEKFSAFLDKVVGL  163



>ref|XP_313489.1| AGAP003697-PA [Anopheles gambiae str. PEST]
 gb|EAA08791.1| AGAP003697-PA [Anopheles gambiae str. PEST]
Length=170

 Score =   130 bits (326),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 69/162 (43%), Positives = 98/162 (60%), Gaps = 0/162 (0%)
 Frame = -2

Query  684  VFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPALDYF  505
            VFVTVGTT F+AL+ AV +  V ++L + G T + +Q G+G     + A  + +  L  +
Sbjct  9    VFVTVGTTEFEALIRAVTSTAVLEQLAKLGCTALTIQFGKGEAPDVELAQRHTTIRLSAY  68

Query  504  TFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELADRKH  325
               SSI   +  A LVISHAG+GS  E L+ GKPLIVVVNE LM+NHQ+ELAE L+  ++
Sbjct  69   GLKSSIGDDISQADLVISHAGAGSCLEVLEAGKPLIVVVNETLMNNHQTELAERLSRDRN  128

Query  324  LFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGF  199
            LF   P TL +T+A+ D   +    PG        +++ +GF
Sbjct  129  LFYCTPNTLLETLAESDFSKLEKLAPGALDSFVNQLDAFMGF  170



>ref|XP_003918197.1| PREDICTED: putative bifunctional UDP-N-acetylglucosamine transferase 
and deubiquitinase ALG13 isoform X9 [Papio anubis]
Length=165

 Score =   129 bits (325),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 68/164 (41%), Positives = 100/164 (61%), Gaps = 2/164 (1%)
 Frame = -2

Query  690  RIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPALD  511
            + VFVTVGTT FD L+  V   +  +++   GY  +I+Q+GRGT VP   ++E  S  LD
Sbjct  2    KCVFVTVGTTSFDDLIACVSAPDSLQKIESLGYNRLILQIGRGTVVPEPFSTE--SFTLD  59

Query  510  YFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELADR  331
             + +  S+ + ++ A LVISHAG+GS  E L+ GKPL+VV+NE LM+NHQ ELA++L   
Sbjct  60   VYRYKDSLKEDIQKADLVISHAGAGSCLEALEKGKPLVVVINEKLMNNHQLELAKQLQKE  119

Query  330  KHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGF  199
             HLF     TL   +  MDL ++  Y PG  +  +  ++  +G 
Sbjct  120  GHLFYCTCSTLPGLLQSMDLSTLKCYPPGQPEKFSAFLDKVVGL  163



>ref|XP_009047433.1| hypothetical protein LOTGIDRAFT_205122 [Lottia gigantea]
 gb|ESP01848.1| hypothetical protein LOTGIDRAFT_205122 [Lottia gigantea]
Length=169

 Score =   129 bits (325),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 70/167 (42%), Positives = 111/167 (66%), Gaps = 4/167 (2%)
 Frame = -2

Query  699  ADKRIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSP  520
            +DK+ VFVTVGTT FD L++ V +++  + L + GYT++++Q+G GT  P     +N   
Sbjct  2    SDKK-VFVTVGTTQFDELIHHVSSSQTVEVLKKLGYTELMLQIGNGTE-PDIPDVKNFD-  58

Query  519  ALDYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEEL  340
             ++Y+ F +S+ + +++ASLVISHAGSGSI + L   KPL+VV+NE LMDNHQ E+AE+ 
Sbjct  59   -IEYYQFKNSLEEDIQTASLVISHAGSGSIMDVLGAKKPLLVVINEKLMDNHQYEVAEKF  117

Query  339  ADRKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGF  199
            AD  +L+      L +T+  ++   + PY PGD    A ++++ +GF
Sbjct  118  ADVGYLYYCTTSKLVETLESVNFTDLKPYVPGDPYKFASVLDNIMGF  164



>ref|XP_004640078.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog isoform X1 [Octodon degus]
Length=165

 Score =   129 bits (325),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 72/165 (44%), Positives = 101/165 (61%), Gaps = 8/165 (5%)
 Frame = -2

Query  684  VFVTVGTTCFDALVNAV---DTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPAL  514
            VFVTVGTT FD L+  V   D+  + K L   GY+ + +Q+GRGT VP   ++E  S  L
Sbjct  4    VFVTVGTTSFDELITCVSAEDSVRIFKSL---GYSQLTLQIGRGTVVPEAFSAE--SFTL  58

Query  513  DYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELAD  334
            D + +  S+ + L+ A LVISHAG+GS  ETL+ GKPL+VV+NE LM+NHQ ELA++L  
Sbjct  59   DVYRYKDSLQEDLQEADLVISHAGAGSCLETLEKGKPLVVVINEKLMNNHQLELAKQLHQ  118

Query  333  RKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGF  199
              HLF     TL   +  MDL ++  Y PG  +  +  ++  +G 
Sbjct  119  EGHLFYCTCSTLPGLLQSMDLSTLKCYPPGQPEKFSAFLDKVVGL  163



>ref|XP_005323400.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog isoform X2 [Ictidomys tridecemlineatus]
Length=167

 Score =   129 bits (325),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 73/167 (44%), Positives = 103/167 (62%), Gaps = 8/167 (5%)
 Frame = -2

Query  690  RIVFVTVGTTCFD---ALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSP  520
            + +FVTVGTT FD   A V+A D+ ++ K L   GY  +I+Q+GRGT VP   ++E  S 
Sbjct  2    KCLFVTVGTTSFDDLIACVSAHDSLQIIKSL---GYNRLILQIGRGTVVPKPFSTE--SF  56

Query  519  ALDYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEEL  340
             LD + +  S+ + L+ A LVISHAG+GS  ETL+ GKPL+VV+NE LM+NHQ ELA +L
Sbjct  57   TLDVYRYKESLKEDLQKADLVISHAGAGSCLETLEKGKPLVVVINEKLMNNHQLELARKL  116

Query  339  ADRKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGF  199
                HLF     TL   +  MDL ++  Y PG  +  +  ++  +G 
Sbjct  117  HKEGHLFYCTCSTLPGLLQSMDLSTLKCYPPGQPEKFSAFLDKVVGL  163



>ref|XP_004606352.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog [Sorex araneus]
Length=165

 Score =   129 bits (324),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 68/166 (41%), Positives = 100/166 (60%), Gaps = 2/166 (1%)
 Frame = -2

Query  690  RIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPALD  511
            + VFVTVGTT FD L+  V   +  +     GY  +++Q+GRGT VP  +A + GS  LD
Sbjct  2    KCVFVTVGTTSFDELITCVSARDTLQIFESLGYNRLVLQIGRGTVVP--AAVQTGSFTLD  59

Query  510  YFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELADR  331
             + +  S+ + L+ A LVISHAG+GS  ETL+  KPL+VV+NE LM+NHQ ELA++L   
Sbjct  60   VYRYKDSLKEDLQKADLVISHAGAGSCLETLENRKPLVVVINEKLMNNHQLELAKQLYKD  119

Query  330  KHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGFPE  193
             HLF     TL   +  MDL ++  + PG  +  +  ++  +G  +
Sbjct  120  GHLFYCTCSTLPGLLQSMDLSTLKCFPPGQPEKFSAFLDKVVGLKK  165



>ref|XP_011839878.1| PREDICTED: putative bifunctional UDP-N-acetylglucosamine transferase 
and deubiquitinase ALG13 isoform X4 [Mandrillus leucophaeus]
 ref|XP_011943080.1| PREDICTED: putative bifunctional UDP-N-acetylglucosamine transferase 
and deubiquitinase ALG13 isoform X6 [Cercocebus atys]
Length=165

 Score =   129 bits (323),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 68/164 (41%), Positives = 100/164 (61%), Gaps = 2/164 (1%)
 Frame = -2

Query  690  RIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPALD  511
            + VFVTVGTT FD L+  V   +  +++   GY  +I+Q+GRGT VP   ++E  S  LD
Sbjct  2    KCVFVTVGTTSFDDLIACVSAPDSLQKIESLGYNRLILQIGRGTVVPEPFSTE--SFTLD  59

Query  510  YFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELADR  331
             + +  S+ + ++ A LVISHAG+GS  E L+ GKPL+VV+NE LM+NHQ ELA++L   
Sbjct  60   VYRYKDSLKEDIQKADLVISHAGAGSCLEALEKGKPLVVVINEKLMNNHQLELAKQLHKE  119

Query  330  KHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGF  199
             HLF     TL   +  MDL ++  Y PG  +  +  ++  +G 
Sbjct  120  GHLFYCTCSTLPGLLQSMDLSTLKCYPPGQPEKFSAFLDKVVGL  163



>ref|NP_001017108.1| ALG13, UDP-N-acetylglucosaminyltransferase subunit [Xenopus (Silurana) 
tropicalis]
 gb|AAI60420.1| hypothetical protein LOC549862 [Xenopus (Silurana) tropicalis]
 gb|AAI68793.1| hypothetical protein LOC549862 [Xenopus (Silurana) tropicalis]
Length=165

 Score =   129 bits (323),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 69/163 (42%), Positives = 99/163 (61%), Gaps = 2/163 (1%)
 Frame = -2

Query  690  RIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPALD  511
            + VFVTVGTT FD L++ V   E  + L   GY  +I+Q+GRGT  P    + +    L+
Sbjct  3    KTVFVTVGTTSFDDLISCVSAKETVRILKGLGYNRLILQIGRGTIEPAPCCTSD--FLLE  60

Query  510  YFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELADR  331
            +F +  S+ + +KSA LVISHAG+GS  ETL  GKPLIVV+NE LM NHQ ELA++L   
Sbjct  61   FFRYKDSLVEDIKSADLVISHAGAGSCLETLGEGKPLIVVINEQLMSNHQIELAKQLYKD  120

Query  330  KHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLG  202
             HL+     T+  T+  M+L ++  + PG  +  A  ++  +G
Sbjct  121  GHLYYCTCSTIGNTLQTMNLSALKNFSPGKPENFAAFLDKVVG  163



>ref|XP_005594452.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog isoform X14 [Macaca fascicularis]
 ref|XP_011754480.1| PREDICTED: putative bifunctional UDP-N-acetylglucosamine transferase 
and deubiquitinase ALG13 isoform X9 [Macaca nemestrina]
 gb|EHH31003.1| hypothetical protein EGK_20833 [Macaca mulatta]
Length=165

 Score =   129 bits (323),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 68/164 (41%), Positives = 100/164 (61%), Gaps = 2/164 (1%)
 Frame = -2

Query  690  RIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPALD  511
            + VFVTVGTT FD L+  V   +  +++   GY  +I+Q+GRGT VP   ++E  S  LD
Sbjct  2    KCVFVTVGTTSFDDLIACVSAPDSLQKIESLGYNRLILQIGRGTVVPEPFSTE--SFTLD  59

Query  510  YFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELADR  331
             + +  S+ + ++ A LVISHAG+GS  E L+ GKPL+VV+NE LM+NHQ ELA++L   
Sbjct  60   VYRYKDSLREDIQKADLVISHAGAGSCLEALEKGKPLVVVINEKLMNNHQLELAKQLHKE  119

Query  330  KHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGF  199
             HLF     TL   +  MDL ++  Y PG  +  +  ++  +G 
Sbjct  120  GHLFYCTCSTLPGLLQSMDLSTLKCYPPGQPEKFSAFLDKVVGL  163



>ref|XP_004064768.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog [Gorilla gorilla gorilla]
Length=165

 Score =   129 bits (323),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 68/164 (41%), Positives = 100/164 (61%), Gaps = 2/164 (1%)
 Frame = -2

Query  690  RIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPALD  511
            + VFVTVGTT FD L+  V   +  +++   GY  +I+Q+GRGT VP   ++E  S  LD
Sbjct  2    KCVFVTVGTTSFDDLIACVSAPDSLQKIESLGYNRLILQIGRGTVVPEPFSTE--SFTLD  59

Query  510  YFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELADR  331
             + +  S+ + ++ A LVISHAG+GS  ETL+ GKPL+VV+NE LM+NHQ ELA++L   
Sbjct  60   VYRYKDSLKEDIQKADLVISHAGAGSCLETLEKGKPLVVVINEKLMNNHQLELAKQLHKE  119

Query  330  KHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGF  199
             HLF      L   +  MDL ++  Y PG  +  +  ++  +G 
Sbjct  120  GHLFYCTCSMLPGLLQSMDLSTLKCYPPGQPEKFSAFLDKVVGL  163



>ref|XP_004379839.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog isoform 2 [Trichechus manatus latirostris]
Length=165

 Score =   128 bits (322),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 71/167 (43%), Positives = 105/167 (63%), Gaps = 8/167 (5%)
 Frame = -2

Query  690  RIVFVTVGTTCFD---ALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSP  520
            + +FVTVGTT FD   A V+A D+ ++ K L   GY+ +++Q+GRGT VP   ++E  S 
Sbjct  2    KCLFVTVGTTSFDDLIACVSAQDSLQIIKSL---GYSRLVLQIGRGTVVPEPFSTE--SF  56

Query  519  ALDYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEEL  340
             LD + +  S+ + L+ A LVISHAG+GS  ETL+ GKPL+VV+NE LM+NHQ ELA++L
Sbjct  57   TLDVYRYKDSLKEDLQKADLVISHAGAGSCLETLEKGKPLVVVINEKLMNNHQLELAKQL  116

Query  339  ADRKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGF  199
                HLF     TL   +  MDL ++  + PG  +  +  ++  +G 
Sbjct  117  HKEGHLFYCTCSTLPGLLQSMDLSTLKCFPPGQPEKFSTFLDKVVGL  163



>ref|XP_007990792.1| PREDICTED: putative bifunctional UDP-N-acetylglucosamine transferase 
and deubiquitinase ALG13 isoform X8 [Chlorocebus sabaeus]
Length=165

 Score =   128 bits (322),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 68/164 (41%), Positives = 99/164 (60%), Gaps = 2/164 (1%)
 Frame = -2

Query  690  RIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPALD  511
            + VFVTVGTT FD L+  V   +  +++   GY  +I+Q+GRGT VP   ++E  S  LD
Sbjct  2    KCVFVTVGTTSFDDLIACVSAPDSLQKIESLGYNRLILQIGRGTVVPEPFSTE--SFTLD  59

Query  510  YFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELADR  331
             + +  S+ + +  A LVISHAG+GS  E L+ GKPL+VV+NE LM+NHQ ELA++L   
Sbjct  60   VYRYKDSLKEDIHKADLVISHAGAGSCLEALEKGKPLVVVINEKLMNNHQLELAKQLHKE  119

Query  330  KHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGF  199
             HLF     TL   +  MDL ++  Y PG  +  +  ++  +G 
Sbjct  120  GHLFYCTCSTLPGLLQSMDLSTLKCYPPGQPEKFSAFLDKVVGL  163



>ref|XP_001420067.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
 gb|ABO98360.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
Length=134

 Score =   127 bits (319),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 65/132 (49%), Positives = 87/132 (66%), Gaps = 1/132 (1%)
 Frame = -2

Query  681  FVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPALDYFT  502
            FVTVGTT FDAL  A+D   +   L  KG+T + +Q+GRG Y P + A+      ++   
Sbjct  1    FVTVGTTSFDALARAMDDPRIVDALVRKGFTGLTMQIGRGAYRPRRIANARAFD-VEIVD  59

Query  501  FSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELADRKHL  322
            +  SI + +  A+LVISHAG+GS+FETL+  +PL+VVVNE LMDNHQ ELAEEL +RK L
Sbjct  60   YLPSIDREIARAALVISHAGAGSVFETLRARRPLLVVVNETLMDNHQRELAEELGERKCL  119

Query  321  FCARPQTLYQTI  286
                P+ L + I
Sbjct  120  RWCVPEGLLEAI  131



>ref|XP_011349728.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog [Cerapachys biroi]
 ref|XP_011349729.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog [Cerapachys biroi]
 gb|EZA47434.1| UDP-N-acetylglucosamine transferase subunit ALG13-like protein 
[Cerapachys biroi]
Length=167

 Score =   128 bits (321),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 71/164 (43%), Positives = 98/164 (60%), Gaps = 1/164 (1%)
 Frame = -2

Query  690  RIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPALD  511
            + VFVTVGTT FD L+  V + EV + L    Y  +I+Q+G     P  S    G   ++
Sbjct  4    KTVFVTVGTTKFDNLITTVLSREVLEALSAHNYKHLILQIGSSGLEPDCSP-RCGFHKIE  62

Query  510  YFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELADR  331
             F  S SI +Y++SA LVISHAG+GS+ E L+  K LIVV+N+ LMDNHQ ELAE+L   
Sbjct  63   TFKLSPSIGEYMQSADLVISHAGAGSVLEALENRKHLIVVINDLLMDNHQVELAEQLCKD  122

Query  330  KHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGF  199
            +HL+    Q L  T+  MDL  + P+    +K +A  I+  +GF
Sbjct  123  EHLYYCTCQNLLHTVQTMDLAKLKPFVSDKSKNIAGFIDEIMGF  166



>ref|NP_796104.2| glycosyltransferase 28 domain containing 1-like [Mus musculus]
 dbj|BAC27032.1| unnamed protein product [Mus musculus]
 gb|AAI21824.1| Glycosyltransferase 28 domain containing 2 [Mus musculus]
 gb|EDL15392.1| mCG145726 [Mus musculus]
Length=165

 Score =   128 bits (321),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 71/165 (43%), Positives = 102/165 (62%), Gaps = 8/165 (5%)
 Frame = -2

Query  684  VFVTVGTTCFDALVNAV---DTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPAL  514
            VFVTVGTT FD L+  V   D+ ++ K L   GY  +++Q+GRGT VP   ++E  S  L
Sbjct  4    VFVTVGTTSFDDLIARVVAHDSVQILKNL---GYNQLVLQIGRGTVVPEPFSTE--SFTL  58

Query  513  DYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELAD  334
            D + +  S+ + L+ A LVISHAG+GS  E+L+ GKPL+VVVNE LM+NHQ ELA++L  
Sbjct  59   DVYRYKDSLKEDLQQADLVISHAGAGSCLESLEKGKPLVVVVNEKLMNNHQFELAKQLHK  118

Query  333  RKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGF  199
              HLF      L + +  MDL ++  Y PG  +  +  ++  +G 
Sbjct  119  EGHLFYCTCSMLPELLQSMDLSTLKCYPPGQPEKFSAFLDKVVGL  163



>ref|XP_010369656.1| PREDICTED: putative bifunctional UDP-N-acetylglucosamine transferase 
and deubiquitinase ALG13 isoform X4 [Rhinopithecus roxellana]
Length=165

 Score =   128 bits (321),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 68/164 (41%), Positives = 99/164 (60%), Gaps = 2/164 (1%)
 Frame = -2

Query  690  RIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPALD  511
            + VFVTVGTT FD L+  V   +  +++   GY  +I+Q+GRGT VP   ++E  S  LD
Sbjct  2    KCVFVTVGTTSFDDLIACVSAPDSLQKIESLGYNRLILQIGRGTVVPEPFSTE--SFTLD  59

Query  510  YFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELADR  331
             + +  S+ + +  A LVISHAG+GS  E L+ GKPL+VV+NE LM+NHQ ELA++L   
Sbjct  60   VYRYKDSLKEDIGKADLVISHAGAGSCLEALEKGKPLVVVINEKLMNNHQLELAKQLHKE  119

Query  330  KHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGF  199
             HLF     TL   +  MDL ++  Y PG  +  +  ++  +G 
Sbjct  120  GHLFYCTCSTLPGLLQSMDLSTLKCYPPGQPEKFSAFLDKVVGL  163



>ref|XP_011576549.1| PREDICTED: putative bifunctional UDP-N-acetylglucosamine transferase 
and deubiquitinase ALG13 [Aquila chrysaetos canadensis]
Length=1165

 Score =   137 bits (346),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 76/166 (46%), Positives = 103/166 (62%), Gaps = 6/166 (4%)
 Frame = -2

Query  690  RIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPAL-  514
            + VFVTVGTT FD L+  V +    + L  +GY  +++Q+GRG   P    +  GSPAL 
Sbjct  2    KSVFVTVGTTSFDDLIATVCSPAALQVLQSRGYQKLVLQVGRGELKP----ALRGSPALA  57

Query  513  -DYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELA  337
             + F F  S+A+ L+ A LVISHAG+GS  ETL+ GKPLIVV NE LMDNHQ ELA++L 
Sbjct  58   VEAFRFKDSLAEDLRRADLVISHAGAGSCLETLEEGKPLIVVTNEKLMDNHQLELAKQLH  117

Query  336  DRKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGF  199
               H+      TL +T+  MDL ++ PY PG  +  A  ++  +GF
Sbjct  118  RDGHVLYCNCSTLVETLQSMDLSTLKPYPPGQPEKFALFLDKVVGF  163



>ref|XP_011808928.1| PREDICTED: putative bifunctional UDP-N-acetylglucosamine transferase 
and deubiquitinase ALG13 isoform X4 [Colobus angolensis 
palliatus]
Length=165

 Score =   128 bits (321),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 67/164 (41%), Positives = 99/164 (60%), Gaps = 2/164 (1%)
 Frame = -2

Query  690  RIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPALD  511
            + VFVTVGTT FD  +  V   +  +++   GY  +I+Q+GRGT VP   ++E  S  LD
Sbjct  2    KCVFVTVGTTSFDDFIACVSAPDSLQKIESLGYNRLILQIGRGTVVPEPFSTE--SFTLD  59

Query  510  YFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELADR  331
             + +  S+ + ++ A LVISHAG+GS  E L+ GKPL+VV+NE LM+NHQ ELA++L   
Sbjct  60   VYRYKDSLKEDIRKADLVISHAGAGSCLEALEKGKPLVVVINEKLMNNHQLELAKQLHKE  119

Query  330  KHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGF  199
             HLF     TL   +  MDL ++  Y PG  +  +  ++  +G 
Sbjct  120  GHLFYCTCSTLPGLLQSMDLSTLKCYPPGQPEKFSAFLDKVVGL  163



>ref|XP_007613018.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog isoform X1 [Cricetulus griseus]
 gb|ERE65171.1| putative UDP-N-acetylglucosamine transferase subunit ALG13 like 
protein [Cricetulus griseus]
Length=165

 Score =   127 bits (320),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 72/164 (44%), Positives = 101/164 (62%), Gaps = 8/164 (5%)
 Frame = -2

Query  681  FVTVGTTCFDALVNAV---DTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPALD  511
            FVTVGTT FD LV  V   D+ ++ K L   GY  +++Q+GRGT VP   +S+  S  LD
Sbjct  5    FVTVGTTSFDELVACVVANDSLQILKSL---GYNRLVLQIGRGTVVPESFSSD--SFTLD  59

Query  510  YFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELADR  331
             + +  S+ + L+ A LVISHAG+GS  E+L+ GKPL+VVVNE LM+NHQ ELA++L   
Sbjct  60   VYRYKDSLKEDLQQADLVISHAGAGSCLESLEKGKPLVVVVNEKLMNNHQFELAKQLHKE  119

Query  330  KHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGF  199
             HLF     TL   +  MDL ++  Y PG  +  +  ++  +G 
Sbjct  120  GHLFYCTCSTLPGLLQSMDLSTLKCYPPGQPEKFSAFLDKVVGL  163



>dbj|BAC26271.1| unnamed protein product [Mus musculus]
Length=165

 Score =   127 bits (320),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 71/165 (43%), Positives = 102/165 (62%), Gaps = 8/165 (5%)
 Frame = -2

Query  684  VFVTVGTTCFDALVNAV---DTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPAL  514
            VFVTVGTT FD L+  V   D+ ++ K L   GY  +++Q+GRGT VP   ++E  S  L
Sbjct  4    VFVTVGTTSFDDLIARVVAHDSVQILKNL---GYNQLVLQIGRGTVVPEPFSTE--SFTL  58

Query  513  DYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELAD  334
            D + +  S+ + L+ A LVISHAG+GS  E+L+ GKPL+VVVNE LM+NHQ ELA++L  
Sbjct  59   DVYRYKDSLKEDLQQADLVISHAGAGSCLESLEKGKPLVVVVNEKLMNNHQFELAKQLHR  118

Query  333  RKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGF  199
              HLF      L + +  MDL ++  Y PG  +  +  ++  +G 
Sbjct  119  EGHLFYCTCSMLPELLQSMDLSTLKCYPPGQPEKFSAFLDKVVGL  163



>gb|KDO26416.1| hypothetical protein SPRG_08219 [Saprolegnia parasitica CBS 223.65]
Length=166

 Score =   127 bits (320),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 74/164 (45%), Positives = 99/164 (60%), Gaps = 3/164 (2%)
 Frame = -2

Query  684  VFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPALDYF  505
            VFVTVGTT FDALV A+DT  V   L   GYT ++ Q+GRG+Y P  SA E       Y 
Sbjct  4    VFVTVGTTSFDALVAALDTPAVYATLAAAGYTQVVFQIGRGSYEP--SAIEAPVRVTSY-  60

Query  504  TFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELADRKH  325
             ++++    + ++SLVISHAG+G+I + L   K LIVV N  LMDNHQ+ELA  LADR+H
Sbjct  61   RYNAAYKADIVASSLVISHAGAGTIMDVLHERKHLIVVPNTQLMDNHQTELATALADRRH  120

Query  324  LFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGFPE  193
            L  A    L   +A M  + +VPY P D     +L+++ +  P 
Sbjct  121  LLQAAVAELPTLLATMKWDDMVPYPPVDEDAFPRLVDATMLGPH  164



>gb|AAI19773.1| Glycosyltransferase 28 domain containing 2 [Mus musculus]
Length=165

 Score =   127 bits (320),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 71/165 (43%), Positives = 102/165 (62%), Gaps = 8/165 (5%)
 Frame = -2

Query  684  VFVTVGTTCFDALVNAV---DTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPAL  514
            VFVTVGTT FD L+  V   D+ ++ K L   GY  +++Q+GRGT VP   ++E  S  L
Sbjct  4    VFVTVGTTSFDDLIARVVAHDSVQILKNL---GYNQLVLQIGRGTVVPEPFSTE--SFTL  58

Query  513  DYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELAD  334
            D + +  S+ + L+ A LVISHAG+GS  E+L+ GKPL+VVVNE LM+NHQ ELA++L  
Sbjct  59   DVYRYKDSLKEDLQQAYLVISHAGAGSCLESLEKGKPLVVVVNEKLMNNHQFELAKQLHK  118

Query  333  RKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGF  199
              HLF      L + +  MDL ++  Y PG  +  +  ++  +G 
Sbjct  119  EGHLFYCTCSMLPELLQSMDLSTLKCYPPGQPEKFSAFLDKVVGL  163



>ref|XP_008066706.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog [Tarsius syrichta]
Length=167

 Score =   127 bits (319),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 73/167 (44%), Positives = 103/167 (62%), Gaps = 8/167 (5%)
 Frame = -2

Query  690  RIVFVTVGTTCFD---ALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSP  520
            + VFVTVGTT FD   A V+A D+ ++ K L   GY  +I+Q+GRGT VP   ++E  S 
Sbjct  2    KCVFVTVGTTSFDDLIACVSARDSLQIIKSL---GYDRLILQIGRGTVVPEPFSTE--SF  56

Query  519  ALDYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEEL  340
             LD + +  S+ + L+ A LVISHAG+GS  ETL+  KPL+VV+NE LM+NHQ ELA++L
Sbjct  57   TLDVYRYKDSLKEDLQKADLVISHAGAGSCLETLEKRKPLVVVINEKLMNNHQLELAKQL  116

Query  339  ADRKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGF  199
                HLF     TL   +  MDL ++  Y PG  +  +  ++  +G 
Sbjct  117  HKEGHLFYCTCSTLPGLLQSMDLSTLKCYPPGQPEKFSAFLDKVVGL  163



>ref|XP_004710113.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog [Echinops telfairi]
Length=165

 Score =   127 bits (319),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 71/167 (43%), Positives = 104/167 (62%), Gaps = 8/167 (5%)
 Frame = -2

Query  690  RIVFVTVGTTCFD---ALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSP  520
            + +FVTVGTT FD   A V+A D+ E+ + L   GY  +++Q+GRG+ VP   ++E  S 
Sbjct  2    KCLFVTVGTTSFDELIACVSAPDSLEIFRNL---GYGRLVLQVGRGSLVPEALSTE--SL  56

Query  519  ALDYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEEL  340
            AL+ + +  S+   L+ A LVISHAG+GS  ETL+ GKPLIVV+NE LM+NHQ ELA++L
Sbjct  57   ALEVYRYKKSLEDDLRRADLVISHAGAGSCLETLEKGKPLIVVINEKLMNNHQLELAKQL  116

Query  339  ADRKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGF  199
                HLF     TL   +  MDL ++  + PG  +  +  ++  +G 
Sbjct  117  HKEGHLFYCTCSTLPGLLQSMDLSTLKCFPPGQPEKFSAFLDKVVGL  163



>ref|XP_011142325.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog [Harpegnathos saltator]
 gb|EFN82693.1| UDP-N-acetylglucosamine transferase subunit ALG13-like protein 
[Harpegnathos saltator]
Length=167

 Score =   127 bits (319),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 69/164 (42%), Positives = 101/164 (62%), Gaps = 1/164 (1%)
 Frame = -2

Query  690  RIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPALD  511
            + VFVTVGTT FD L+ AV    V + L  + Y  +I+Q+G  +  P    +  G  +++
Sbjct  4    KTVFVTVGTTKFDDLITAVLNPAVLEALSARDYRHLILQIGNSSIEP-DCIARCGFHSIE  62

Query  510  YFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELADR  331
             F  S SI KY++SA LVISHAG+GS+ E L+  K LIVV+N+ LMDNHQ ELA++L + 
Sbjct  63   SFKLSPSIGKYMQSADLVISHAGAGSVLEALENCKHLIVVINDLLMDNHQVELAKQLHND  122

Query  330  KHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGF  199
            +HL+    Q L +T+  MDL  + P+    +  +A  I+  +GF
Sbjct  123  EHLYHCICQDLLRTVRTMDLAKLKPFVNNKSANIANFIDKIMGF  166



>ref|XP_003035996.1| glycosyltransferase family 1 protein [Schizophyllum commune H4-8]
 gb|EFJ01094.1| glycosyltransferase family 1 protein [Schizophyllum commune H4-8]
Length=172

 Score =   127 bits (318),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 68/171 (40%), Positives = 99/171 (58%), Gaps = 8/171 (5%)
 Frame = -2

Query  687  IVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPAL--  514
            + FVTVG+T FDALV AV    V   L  KGY  ++VQ G  T+  +    E        
Sbjct  2    LAFVTVGSTKFDALVQAVCNDAVLDALQAKGYNHLVVQAGNSTFEHSSRLHEAAISVRTR  61

Query  513  ------DYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSEL  352
                  +Y+ F  S+ +  + A LVISHAGSG+I + L++ KPL++V N  L+DNHQ EL
Sbjct  62   SHGIEQEYYKFKPSLREDYERADLVISHAGSGTILDVLRIPKPLVIVPNPTLLDNHQQEL  121

Query  351  AEELADRKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGF  199
            A+ L  ++HL  + P+TL + IA  D  S+VP+ P D    A++++  +GF
Sbjct  122  ADVLEQQRHLVASTPETLARDIASFDATSLVPFPPFDGSRFARILDEEMGF  172



>ref|XP_002711985.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog isoform X1 [Oryctolagus cuniculus]
Length=165

 Score =   127 bits (318),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 72/167 (43%), Positives = 104/167 (62%), Gaps = 8/167 (5%)
 Frame = -2

Query  690  RIVFVTVGTTCFD---ALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSP  520
            + VFVTVGTT FD   A V+A D+ ++ K L   GY  +I+Q+GRGT  P   ++E  S 
Sbjct  2    KCVFVTVGTTSFDDLIACVSAHDSLQIIKSL---GYDRLILQIGRGTVAPEPFSTE--SF  56

Query  519  ALDYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEEL  340
             LD + +  S+ + L+ A LVISHAG+GS  ETL+ GKPL+VV+NE LM+NHQ ELA++L
Sbjct  57   TLDVYRYKDSLKEDLEKADLVISHAGAGSCLETLEKGKPLVVVINEKLMNNHQLELAKQL  116

Query  339  ADRKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGF  199
                +LF     TL   +  MDL ++  Y PG ++  +  ++  +G 
Sbjct  117  HKEGYLFYCTCSTLPGLLQSMDLSTLKCYPPGQSEKFSAFLDKVVGL  163



>ref|XP_011167336.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog [Solenopsis invicta]
 gb|EFZ13179.1| hypothetical protein SINV_00761, partial [Solenopsis invicta]
Length=168

 Score =   126 bits (317),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 70/165 (42%), Positives = 96/165 (58%), Gaps = 1/165 (1%)
 Frame = -2

Query  693  KRIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPAL  514
             + VFVTVGTT FD L+  V +  V + L    Y  +I+Q+G     P  +A   G   +
Sbjct  4    NKTVFVTVGTTKFDDLITTVLSQTVLEALSAHNYKHLILQIGNSNLEPDCTA-RYGFDKI  62

Query  513  DYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELAD  334
            + F  S SI +Y++ A LVISHAG+GS+ E L+  K LIVV+N+ LMDNHQ ELAE+L  
Sbjct  63   ETFRLSPSIGEYMQLADLVISHAGAGSVLEALEKRKHLIVVINDLLMDNHQIELAEQLYK  122

Query  333  RKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGF  199
             +HL+    Q L  TI  MDL  + P+    +  +A  IN  +GF
Sbjct  123  DEHLYYCTCQNLLNTIQTMDLAKLKPFTNDKSADIANFINKIMGF  167



>ref|XP_420312.4| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog [Gallus gallus]
Length=1186

 Score =   135 bits (340),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 74/166 (45%), Positives = 102/166 (61%), Gaps = 6/166 (4%)
 Frame = -2

Query  690  RIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPAL-  514
            + VFVTVGTT FD L+ AV +    + L  +G   +++Q+GRG   P   A + G PA  
Sbjct  2    KTVFVTVGTTSFDELIAAVSSPAAEQVLRSRGCRQLVLQIGRGALQP---APQYG-PAFV  57

Query  513  -DYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELA  337
             D F F  S+A+ L+ A LVISHAG+GS  ETL+ GKPL+VV+NE LMDNHQ ELA +L 
Sbjct  58   RDVFRFKESLAEDLRRADLVISHAGAGSCLETLEEGKPLLVVINEKLMDNHQLELARQLH  117

Query  336  DRKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGF  199
               H+      TL +T+  MDL ++ P+ PG  +  A  ++  +GF
Sbjct  118  KDGHVLYCNCSTLVETLQSMDLSTLKPFPPGQPEKFALFLDKVVGF  163



>ref|NP_080523.2| putative bifunctional UDP-N-acetylglucosamine transferase and 
deubiquitinase ALG13 [Mus musculus]
 dbj|BAB25504.1| unnamed protein product [Mus musculus]
 dbj|BAC40750.1| unnamed protein product [Mus musculus]
 gb|EDL14725.1| mCG8132, isoform CRA_c [Mus musculus]
 gb|AAI37693.1| Asparagine-linked glycosylation 13 homolog (S. cerevisiae) [Mus 
musculus]
Length=165

 Score =   126 bits (316),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 70/161 (43%), Positives = 97/161 (60%), Gaps = 2/161 (1%)
 Frame = -2

Query  681  FVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPALDYFT  502
            FVTVGTT FD LV  V   +  + L   GY  +++Q+GRGT VP    +E  S  LD + 
Sbjct  5    FVTVGTTSFDELVARVVANDCVQILESLGYNHLVLQVGRGTVVPKPFRTE--SFTLDVYR  62

Query  501  FSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELADRKHL  322
            +  S+ + L+ A LVISHAG+GS  E+L+ GKPL+VVVNE LM+NHQ ELA++L    HL
Sbjct  63   YKDSLKEDLQQADLVISHAGAGSCLESLEKGKPLVVVVNEKLMNNHQFELAKQLHKEGHL  122

Query  321  FCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGF  199
            F     TL   +  MDL ++  Y PG  +  +  ++  +G 
Sbjct  123  FYCTCSTLPGLLQSMDLSTLKCYPPGQPEKFSAFLDKVVGL  163



>ref|XP_003467615.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog isoform 1 [Cavia porcellus]
Length=165

 Score =   125 bits (315),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 68/162 (42%), Positives = 97/162 (60%), Gaps = 2/162 (1%)
 Frame = -2

Query  684  VFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPALDYF  505
            VFVTVGTT FD L+  V   E        GY+ + +Q+GRGT VP   ++E  +  L+ +
Sbjct  4    VFVTVGTTSFDELITRVSAEETLHIFKSLGYSRLTLQIGRGTVVPEPFSAECFT--LEVY  61

Query  504  TFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELADRKH  325
             +  S+ + L+ A LVISHAG+GS  ETL+ GKPL+VV+NE LM+NHQ ELA+EL    +
Sbjct  62   RYKDSLQEDLQRADLVISHAGAGSCLETLEKGKPLVVVINEKLMNNHQLELAKELHKEGY  121

Query  324  LFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGF  199
            LF     TL   +  MD+ ++  Y PG  +  +  +N  +G 
Sbjct  122  LFYCTCSTLPGLLQSMDISTLKCYPPGQPEKFSAFLNKVVGL  163



>ref|XP_010401658.1| PREDICTED: putative bifunctional UDP-N-acetylglucosamine transferase 
and deubiquitinase ALG13 [Corvus cornix cornix]
Length=937

 Score =   134 bits (338),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 75/165 (45%), Positives = 108/165 (65%), Gaps = 5/165 (3%)
 Frame = -2

Query  690  RIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPALD  511
            + VFVTVGTT FD L+ A  +    K L  +GY  +++Q+GRG+ +P  S+S   + A++
Sbjct  2    KSVFVTVGTTSFDELIAAAGSPPALKALQSRGYQKLVLQVGRGS-LPQPSSSP--AVAVE  58

Query  510  YFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEEL-AD  334
             F F  S+A+ L+SA LVISHAG+GS  ETL+ GKPLIVV+N+ LMDNHQ ELA++L  D
Sbjct  59   VFRFKDSLAEDLQSADLVISHAGAGSCLETLEKGKPLIVVINDKLMDNHQLELAKQLHKD  118

Query  333  RKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGF  199
               L+C+   TL +T+  MDL ++ P+ PG  +  A  ++   G 
Sbjct  119  DCVLYCSC-STLVETLQSMDLSALKPFPPGQPEKFASFLDKVFGL  162



>dbj|BAB29554.1| unnamed protein product [Mus musculus]
Length=165

 Score =   125 bits (315),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 70/161 (43%), Positives = 97/161 (60%), Gaps = 2/161 (1%)
 Frame = -2

Query  681  FVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPALDYFT  502
            FVTVGTT FD LV  V   +  + L   GY  +++Q+GRGT VP    +E  S  LD + 
Sbjct  5    FVTVGTTSFDELVARVVANDCVQILESLGYNHLVLQVGRGTVVPKPFRTE--SFTLDVYR  62

Query  501  FSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELADRKHL  322
            +  S+ + L+ A LVISHAG+GS  E+L+ GKPL+VVVNE LM+NHQ ELA++L    HL
Sbjct  63   YKDSLKEDLQQADLVISHAGAGSCLESLEKGKPLVVVVNEKLMNNHQFELAKQLHKEGHL  122

Query  321  FCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGF  199
            F     TL   +  MDL ++  Y PG  +  +  ++  +G 
Sbjct  123  FYCTCSTLPGLLQSMDLSTLKCYPPGHPEKFSAFLDKVVGL  163



>emb|CBJ31146.1| beta(1,4)-N-acetylglucosaminyltransferase [Ectocarpus siliculosus]
Length=172

 Score =   125 bits (315),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 69/164 (42%), Positives = 99/164 (60%), Gaps = 7/164 (4%)
 Frame = -2

Query  684  VFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPALD--  511
            VFVTVGTT FD+LV AVD A V   L  KG+T + VQ+G G +VP+    +    ALD  
Sbjct  5    VFVTVGTTKFDSLVQAVDNAVVLSSLCSKGFTSLTVQIGHGQHVPSFPVDQT---ALDCR  61

Query  510  YFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELADR  331
            ++ F  ++ + +  A +V+SHAG+GS+ E L LGK L+VVVN  LMDNHQ ELA+ LA R
Sbjct  62   WYRFKQTLHEDMARADVVVSHAGAGSVMEALGLGKALVVVVNRALMDNHQEELADALAQR  121

Query  330  KHLFCARPQTLYQTIADMD--LESVVPYQPGDAKPVAKLINSHL  205
             +L    P+ L   + ++D    +  PY P   +  A +++  +
Sbjct  122  NYLRATTPEGLAGALVELDDSPSARRPYPPAKPEAFAAIVDEEM  165



>gb|KIM62082.1| glycosyltransferase family 1 protein [Scleroderma citrinum Foug 
A]
Length=167

 Score =   125 bits (314),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 73/168 (43%), Positives = 101/168 (60%), Gaps = 8/168 (5%)
 Frame = -2

Query  687  IVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQ-----MGRGTYVPTKSASENGS  523
            +VFVTVG+T FDALV AV + EV   L +KGY+ I++Q     +GRG    T   S+   
Sbjct  2    LVFVTVGSTRFDALVQAVLSEEVLDVLHKKGYSQIVLQRGDSTLGRGDGTMTLGKSD---  58

Query  522  PALDYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEE  343
              ++ +TF  SI   ++ ASLVISHAGSG+I + L+ GKP+IVV N  L+DNHQ ELA +
Sbjct  59   IEVETWTFKPSIEMDIRRASLVISHAGSGTILDVLRQGKPMIVVPNPTLLDNHQDELASK  118

Query  342  LADRKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGF  199
            L D  HL       L +TI   D  ++VP+   D     +LI+  +G+
Sbjct  119  LDDLGHLRATPVNNLAKTIETFDPSTLVPFPQFDGSKFRRLIDEEMGY  166



>ref|XP_007873839.1| hypothetical protein PNEG_01866 [Pneumocystis murina B123]
 gb|EMR09678.1| hypothetical protein PNEG_01866 [Pneumocystis murina B123]
Length=168

 Score =   125 bits (313),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 63/167 (38%), Positives = 101/167 (60%), Gaps = 1/167 (1%)
 Frame = -2

Query  699  ADKRIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSP  520
             + + V VTVG+T FDAL+  +    V+  L  +G++ I+VQ G+   +  +    NG  
Sbjct  2    VENKTVLVTVGSTRFDALILNIQKKSVQNALISQGFSKIVVQYGKSEDIFNQWEPINGME  61

Query  519  ALDYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEEL  340
             +  F++S  I +  + +SL+ISHAGSGSI E L+L K LIVVVNE LMDNHQ EL + +
Sbjct  62   -VSGFSYSKDIEEEFQKSSLIISHAGSGSIIEALELKKQLIVVVNETLMDNHQKELTQIM  120

Query  339  ADRKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGF  199
             D+K+L  + P+ L   I D++ + + P+   +     K++++ +GF
Sbjct  121  TDQKYLISSTPENLLYAIQDLNKKELQPFLFSNEPTFQKILDNQMGF  167



>ref|XP_009013587.1| hypothetical protein HELRODRAFT_75054 [Helobdella robusta]
 gb|ESO08657.1| hypothetical protein HELRODRAFT_75054 [Helobdella robusta]
Length=169

 Score =   125 bits (314),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 70/164 (43%), Positives = 98/164 (60%), Gaps = 7/164 (4%)
 Frame = -2

Query  690  RIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGR-----GTYVPTKSASENG  526
            R VF TVGTT FD LVN V   +  K L + GYT + VQ+G      G  +P  +  +  
Sbjct  2    RKVFCTVGTTRFDQLVNTVLHIDTLKALKKLGYTQLDVQIGSYQGGDGDSLPNINHLD--  59

Query  525  SPALDYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAE  346
              A++ F +  SIA+Y++ ASLVISHAG+GS  E L   +PLIVV+NEDLMDNHQ ELA+
Sbjct  60   RFAVECFRYKDSIAEYIRDASLVISHAGAGSCLEVLDNHRPLIVVINEDLMDNHQIELAQ  119

Query  345  ELADRKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLIN  214
            +L D  H+F    +TL +T+   ++  +  ++ GD       +N
Sbjct  120  QLQDDGHVFMCMCRTLVETLTQKNINDLKEFREGDPNLFVSFLN  163



>ref|XP_003342343.2| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog isoform X1 [Monodelphis domestica]
Length=178

 Score =   125 bits (314),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 68/162 (42%), Positives = 98/162 (60%), Gaps = 2/162 (1%)
 Frame = -2

Query  684  VFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPALDYF  505
            VFVTVGTT FD LV  V +    + L   GY  +++Q+G+G  VP   AS   S  L  +
Sbjct  17   VFVTVGTTSFDELVACVSSRATLQILRRLGYRKLVLQIGKGRVVPDSFASTTFS--LIVY  74

Query  504  TFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELADRKH  325
             + +S+ + +K A L+ISHAG+GS  E L+ GKPL+VVVNE LMDNHQ ELA +L    +
Sbjct  75   RYKNSLKEDIKRADLIISHAGAGSCLEALEEGKPLVVVVNEKLMDNHQLELARQLHKEGY  134

Query  324  LFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGF  199
            LF     TL + +  +DL S+  + PG  +  ++ ++  +GF
Sbjct  135  LFYCSCSTLLELLRSVDLSSLRRFPPGKPEMFSEFLDKVVGF  176



>gb|KFB52685.1| AGAP003697-PA-like protein [Anopheles sinensis]
Length=171

 Score =   125 bits (314),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 68/162 (42%), Positives = 95/162 (59%), Gaps = 0/162 (0%)
 Frame = -2

Query  684  VFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPALDYF  505
            VFVTVGTT FD LV AV + +V ++L   G   + +Q G+G     ++A++  + ++  +
Sbjct  9    VFVTVGTTQFDELVRAVISNDVLEQLVNLGCETLTIQFGKGLEPDLRNANQRTTISITGY  68

Query  504  TFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELADRKH  325
            +  S+IA  +  A LVISHAG+GS  E L+ GK LIVVVNE LMDNHQ+ELAE L   K 
Sbjct  69   SLKSNIADDISKADLVISHAGAGSCIEVLEAGKALIVVVNETLMDNHQTELAERLNKEKC  128

Query  324  LFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGF  199
            LF   P TL  T+ + D   +    PG        ++  +GF
Sbjct  129  LFYCTPDTLQSTLVESDFSQLQSLAPGALDSFVDHLDKFMGF  170



>ref|NP_001013973.1| UDP-N-acetylglucosamine transferase subunit ALG13 homolog [Rattus 
norvegicus]
 sp|Q5I0K7.1|ALG13_RAT RecName: Full=UDP-N-acetylglucosamine transferase subunit ALG13 
homolog; AltName: Full=Glycosyltransferase 28 domain-containing 
protein 1 [Rattus norvegicus]
 gb|AAH88233.1| Asparagine-linked glycosylation 13 homolog (S. cerevisiae) [Rattus 
norvegicus]
 gb|EDL85188.1| rCG23145, isoform CRA_b [Rattus norvegicus]
Length=165

 Score =   125 bits (313),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 71/164 (43%), Positives = 100/164 (61%), Gaps = 8/164 (5%)
 Frame = -2

Query  681  FVTVGTTCFDALVNAV---DTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPALD  511
            FVTVGTT FD LV  V   DT ++ K L   GY  +++Q+GRGT VP   ++E  +  LD
Sbjct  5    FVTVGTTSFDDLVARVVANDTVQILKSL---GYNHLVLQIGRGTVVPEPFSTEPFT--LD  59

Query  510  YFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELADR  331
             + +  S+ + L+ A LVISHAG+GS  E+L+ GKPL+VVVNE LM+NHQ ELA++L   
Sbjct  60   VYRYKESLKEDLQQADLVISHAGAGSCLESLEKGKPLVVVVNEKLMNNHQFELAKQLHKE  119

Query  330  KHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGF  199
             HLF      L   +  MDL ++  Y PG  +  +  ++  +G 
Sbjct  120  GHLFYCTCSMLPGLLQSMDLSTLKCYPPGQPEKFSAFLDKVVGL  163



>ref|XP_010713738.1| PREDICTED: putative bifunctional UDP-N-acetylglucosamine transferase 
and deubiquitinase ALG13 [Meleagris gallopavo]
Length=1055

 Score =   134 bits (337),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 74/166 (45%), Positives = 103/166 (62%), Gaps = 6/166 (4%)
 Frame = -2

Query  690  RIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPAL-  514
            + VFVTVGTT FD L+ AV +    + L  +G   +++Q+GRG   P   A ++G PA  
Sbjct  2    KSVFVTVGTTSFDELIAAVSSPAAEQVLRSRGCRQLVLQIGRGALQP---APQHG-PAFV  57

Query  513  -DYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELA  337
             + F F  S+A+ L+SA LVISHAG+GS  ETL+ GKPL+VV+NE LMDNHQ ELA +L 
Sbjct  58   REVFRFKESLAEDLRSADLVISHAGAGSCLETLEEGKPLLVVINEKLMDNHQLELARQLH  117

Query  336  DRKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGF  199
               H+      TL +T+  MDL ++ P+ PG  +  A  ++   GF
Sbjct  118  KDGHVLYCNCSTLVETLQSMDLATLKPFLPGQPEKFALFLDKVAGF  163



>ref|XP_004440556.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog [Ceratotherium simum simum]
Length=165

 Score =   124 bits (312),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 72/167 (43%), Positives = 102/167 (61%), Gaps = 8/167 (5%)
 Frame = -2

Query  690  RIVFVTVGTTCFD---ALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSP  520
            + VFVTVGTT FD   A V+A DT ++ K L   GY  +++Q+GRG  VP   ++E  S 
Sbjct  2    KCVFVTVGTTSFDDLIACVSAHDTLQIIKCL---GYNRLVLQIGRGKVVPEPFSTE--SF  56

Query  519  ALDYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEEL  340
             LD + +  S+ + L+ A LVISHAG+GS  ETL+  KPL+VVVNE LM+NHQ ELA++L
Sbjct  57   TLDVYRYKDSLKEDLQKADLVISHAGAGSCLETLEKRKPLVVVVNEKLMNNHQLELAKQL  116

Query  339  ADRKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGF  199
                HLF     TL   +  MDL ++  + PG  +  +  ++  +G 
Sbjct  117  QKDGHLFSCTCSTLPGLLQSMDLSTLKCFPPGQPEKFSAFLDKVVGL  163



>ref|XP_004092542.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog [Nomascus leucogenys]
Length=171

 Score =   125 bits (313),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 70/170 (41%), Positives = 100/170 (59%), Gaps = 8/170 (5%)
 Frame = -2

Query  690  RIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPALD  511
            + VFVTVGTT FD L+  V   +  +++   GY  +I+Q+GRGT VP   ++E  S  LD
Sbjct  2    KCVFVTVGTTSFDDLIACVSAPDSLQKIESLGYNRLILQIGRGTVVPEPFSTE--SFTLD  59

Query  510  YFTFSSSIAKYLKSASLVISHAG------SGSIFETLQLGKPLIVVVNEDLMDNHQSELA  349
             + +  S+ + ++ A LVISHAG       GS  ETL+ GKPLIVV+NE LM+NHQ ELA
Sbjct  60   VYRYKDSLKEDIQKADLVISHAGKGALESQGSCLETLEKGKPLIVVINEKLMNNHQLELA  119

Query  348  EELADRKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGF  199
            ++L    HLF     TL   +  MDL ++  Y PG  +  +  ++  +G 
Sbjct  120  KQLHKEGHLFYCTCSTLPGLLQSMDLSTLKCYPPGQPEKFSAFLDKVVGL  169



>emb|CDS08315.1| hypothetical protein LRAMOSA02263 [Absidia idahoensis var. thermophila]
Length=167

 Score =   124 bits (312),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 68/164 (41%), Positives = 96/164 (59%), Gaps = 2/164 (1%)
 Frame = -2

Query  684  VFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASE--NGSPALD  511
            VFVTVG+T FD LV+ V TA     L   GY+ I+VQ G    V +++ S+  N S  + 
Sbjct  3    VFVTVGSTGFDELVDVVTTASFLSALKSLGYSSIVVQYGSSEKVYSRNVSQLPNDSITMQ  62

Query  510  YFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELADR  331
             +T+ SSI   +K ASL+ISHAGSGS+ + L+L K LIVV N  LMDNHQ ELA+ +  +
Sbjct  63   GYTYKSSIDDDMKRASLIISHAGSGSMLQALRLHKRLIVVSNTSLMDNHQVELAQAMQQK  122

Query  330  KHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGF  199
             +  C+ P  L   I D     + P+     +   +L++ H+GF
Sbjct  123  NYCCCSDPNGLVDAIRDASTREMAPFPNPATEAFTELLDHHMGF  166



>ref|XP_005087553.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog [Mesocricetus auratus]
Length=181

 Score =   125 bits (313),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 72/179 (40%), Positives = 107/179 (60%), Gaps = 7/179 (4%)
 Frame = -2

Query  681  FVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPALDYFT  502
             VTVGTT FD L+ +V T +  + L   GY  +++Q+GRGT VP   +S+  S  LD + 
Sbjct  5    LVTVGTTSFDDLIESVVTNDSLRILKSLGYKRLVLQIGRGTLVPESFSSD--SFTLDVYR  62

Query  501  FSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELADRKHL  322
            +  S  + L+ A LVISHAG+GS  E+L+ GKPL+V VNE LM+NHQ ELA++L +  HL
Sbjct  63   YKDSFKEDLQQADLVISHAGAGSCLESLEKGKPLVVDVNEKLMNNHQFELAKQLHNEGHL  122

Query  321  FCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGFPEE*SDDGSKNHLRVKVD  145
            F     TL   +  MDL ++  Y PG  +  +  ++  +G  +E     + N L++ V+
Sbjct  123  FYCTCSTLPGLLQSMDLSTLKCYPPGQPEIFSAFLDKVVGLQKE-----TLNTLKIPVN  176



>ref|XP_008608779.1| hypothetical protein SDRG_04869 [Saprolegnia diclina VS20]
 gb|EQC37846.1| hypothetical protein SDRG_04869 [Saprolegnia diclina VS20]
Length=166

 Score =   124 bits (311),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 73/164 (45%), Positives = 98/164 (60%), Gaps = 3/164 (2%)
 Frame = -2

Query  684  VFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPALDYF  505
            VFVTVGTT FDALV A+DT  V   L   GYT ++ Q+GRG+Y P  SA E       Y 
Sbjct  4    VFVTVGTTSFDALVAALDTPAVYATLAAAGYTQVVFQIGRGSYEP--SAIEAPVRVTSY-  60

Query  504  TFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELADRKH  325
             ++++    +++ASLVISHAG+G+I + L   K LIVV N  LMDNHQ+ELA  LADR+H
Sbjct  61   RYNAAYKADIEAASLVISHAGAGTIMDVLHERKHLIVVPNTQLMDNHQTELASALADRRH  120

Query  324  LFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGFPE  193
            L  A    L   +A M  +++ PY   D     +L++  +  P 
Sbjct  121  LLQAALAELPTLLATMKWDNIEPYPQVDEDAFPRLVDDMMLGPH  164



>ref|XP_002429801.1| UDP-N-acetylglucosamine transferase subunit Alg13, putative [Pediculus 
humanus corporis]
 gb|EEB17063.1| UDP-N-acetylglucosamine transferase subunit Alg13, putative [Pediculus 
humanus corporis]
Length=168

 Score =   124 bits (311),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 67/166 (40%), Positives = 100/166 (60%), Gaps = 4/166 (2%)
 Frame = -2

Query  690  RIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPALD  511
            +I+F TVGTT FD L+  +    V + L EKGY+ +I+Q+G G   P    +      L 
Sbjct  4    KIIFATVGTTKFDLLIQKLTEKTVLEALKEKGYSTLILQIGGGDITPDLENANQIGINLT  63

Query  510  YFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELADR  331
            YF + +SI K +  A LVISHAG+G+  E L+  KPLIVV+NE+LM+NHQ ELA++L+  
Sbjct  64   YFKYKNSIKKDILKADLVISHAGAGTCLEVLEAEKPLIVVINENLMNNHQKELADQLSSD  123

Query  330  KHLFCARPQTLYQTIADMDLESV--VPYQPGDAKPVAKLINSHLGF  199
             +L      TLY+T+  M+L  +  +P    +  P+   +N+ +GF
Sbjct  124  GYLLSCTCDTLYETVKKMNLSRLKKMPRVNPNIFPIY--LNNLMGF  167



>ref|XP_007535904.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog [Erinaceus europaeus]
Length=165

 Score =   124 bits (311),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 70/169 (41%), Positives = 103/169 (61%), Gaps = 8/169 (5%)
 Frame = -2

Query  690  RIVFVTVGTTCFD---ALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSP  520
            + VFVTVGTT FD   A V+A D+ ++ K+L   GY  +++Q+GRG  VP   ++E  S 
Sbjct  2    KCVFVTVGTTSFDDLIACVSAYDSLQIIKKL---GYNRLVLQIGRGKVVPESFSTE--SF  56

Query  519  ALDYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEEL  340
             LD + +  S+   L+ A LVISHAG+GS  ETL+  KPL+VV+NE LM+NHQ ELA++L
Sbjct  57   TLDVYRYKDSLKDDLQKADLVISHAGAGSCLETLENRKPLVVVINEKLMNNHQLELAKQL  116

Query  339  ADRKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGFPE  193
                HLF     TL   +  MDL ++  + PG  +  +  ++  +G  +
Sbjct  117  HKDGHLFYCTCSTLPGLLQSMDLSTLKCFTPGQPEKFSAFLDKVVGLKK  165



>ref|XP_011839877.1| PREDICTED: putative bifunctional UDP-N-acetylglucosamine transferase 
and deubiquitinase ALG13 isoform X3 [Mandrillus leucophaeus]
Length=167

 Score =   124 bits (311),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 68/166 (41%), Positives = 100/166 (60%), Gaps = 4/166 (2%)
 Frame = -2

Query  690  RIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPALD  511
            + VFVTVGTT FD L+  V   +  +++   GY  +I+Q+GRGT VP   ++E  S  LD
Sbjct  2    KCVFVTVGTTSFDDLIACVSAPDSLQKIESLGYNRLILQIGRGTVVPEPFSTE--SFTLD  59

Query  510  YFTFSSSIAKYLKSASLVISHAG--SGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELA  337
             + +  S+ + ++ A LVISHAG  +GS  E L+ GKPL+VV+NE LM+NHQ ELA++L 
Sbjct  60   VYRYKDSLKEDIQKADLVISHAGKGAGSCLEALEKGKPLVVVINEKLMNNHQLELAKQLH  119

Query  336  DRKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGF  199
               HLF     TL   +  MDL ++  Y PG  +  +  ++  +G 
Sbjct  120  KEGHLFYCTCSTLPGLLQSMDLSTLKCYPPGQPEKFSAFLDKVVGL  165



>ref|XP_012064457.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog [Atta cephalotes]
Length=170

 Score =   124 bits (311),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 69/167 (41%), Positives = 97/167 (58%), Gaps = 1/167 (1%)
 Frame = -2

Query  699  ADKRIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSP  520
            +DK+ VFVTVGTT FD L+  V    V + L  + Y  +I+Q+G     P  +A   G  
Sbjct  4    SDKKTVFVTVGTTKFDDLITTVLNRAVLEALSARNYRHLILQIGNSKLEPDCTA-RYGFH  62

Query  519  ALDYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEEL  340
             ++ F  S SI +YL+ A LVISHAG+GS+ E L+  K LIVV N+ LMDNHQ ELAE+L
Sbjct  63   KIEIFRLSPSIGEYLQLADLVISHAGAGSVLEALERRKHLIVVTNDLLMDNHQIELAEQL  122

Query  339  ADRKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGF  199
               +HL+    + L   I  MD   + P+   ++  +A  I+  +GF
Sbjct  123  YKDEHLYYCTCKNLLHVIQTMDFAKLKPFINDNSADIANFIDKVMGF  169



>ref|XP_780873.2| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog isoform X1 [Strongylocentrotus purpuratus]
 ref|XP_003724659.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog isoform X2 [Strongylocentrotus purpuratus]
Length=168

 Score =   124 bits (311),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 67/163 (41%), Positives = 96/163 (59%), Gaps = 2/163 (1%)
 Frame = -2

Query  690  RIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPALD  511
            +IVFVTVGTT FDAL+  + + +    L   GY+ +I+Q+GRG   P +    +    L+
Sbjct  6    KIVFVTVGTTSFDALIEEISSDKTLTILKRLGYSKVILQIGRGNIEPQQINQPDF--CLE  63

Query  510  YFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELADR  331
             + +  SIA+ + +A LVISHAG+GS  ETL   KPL+VV+NE LM NHQ ELA++L   
Sbjct  64   AYRYKDSIAEDIYNADLVISHAGAGSCLETLGARKPLLVVINELLMGNHQLELADQLCKD  123

Query  330  KHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLG  202
            +HLF   P  L   +  MD   + P+ P D    +  ++  LG
Sbjct  124  EHLFHTTPSKLAHDLETMDFSLLKPFPPCDPSNFSSFLDKALG  166



>gb|EPQ20339.1| UDP-N-acetylglucosamine transferase subunit ALG13 like protein 
[Myotis brandtii]
Length=165

 Score =   124 bits (310),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 67/164 (41%), Positives = 99/164 (60%), Gaps = 2/164 (1%)
 Frame = -2

Query  690  RIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPALD  511
            + VFVTVGTT FD L+  V   +  + +   GY  +I+Q+GRG +VP   ++E  S  LD
Sbjct  2    KCVFVTVGTTSFDDLIACVLAPDCLQIIKTLGYNRLILQIGRGKFVPEPFSTE--SFTLD  59

Query  510  YFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELADR  331
             + +  S+ + L+ A LVISHAG+GS  ETL+  KPL+VV+NE LM+NHQ ELA++L   
Sbjct  60   VYRYKDSLKEDLEEADLVISHAGAGSCLETLEKRKPLVVVINEKLMNNHQLELAKQLHKD  119

Query  330  KHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGF  199
             HLF     TL   +  MDL ++  + PG  +  +  ++  +G 
Sbjct  120  GHLFYCTCSTLPGLLQSMDLSTLKCFPPGQPEKFSAFLDKVVGL  163



>ref|XP_005404699.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog isoform X9 [Chinchilla lanigera]
Length=165

 Score =   124 bits (310),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 67/162 (41%), Positives = 96/162 (59%), Gaps = 2/162 (1%)
 Frame = -2

Query  684  VFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPALDYF  505
            VFVTVG+T FD L+  V   E        GY+ + +Q+GRG  VP   +++  S  LD +
Sbjct  4    VFVTVGSTSFDELITRVSAEESLHIFRSLGYSQLTLQIGRGAVVPEPFSAD--SFTLDVY  61

Query  504  TFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELADRKH  325
             +  S+ + L+ A LVISHAG+GS  ETL+ GKPL+VV+NE LM+NHQ ELA++L    H
Sbjct  62   RYKDSLREDLERADLVISHAGAGSCLETLEKGKPLVVVINEKLMNNHQLELAKQLHKEGH  121

Query  324  LFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGF  199
            LF     TL   +  MDL ++  Y PG  +  +  ++  +G 
Sbjct  122  LFYCTCSTLPGLLQSMDLSTLKCYPPGQPEKFSAFLDKVVGL  163



>ref|XP_011264081.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog [Camponotus floridanus]
 gb|EFN62973.1| UDP-N-acetylglucosamine transferase subunit ALG13-like protein 
[Camponotus floridanus]
Length=167

 Score =   124 bits (310),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 68/164 (41%), Positives = 97/164 (59%), Gaps = 1/164 (1%)
 Frame = -2

Query  690  RIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPALD  511
            + VFVTVGTT FD L+  V + EV + L  + Y  +I+Q+G     P  +A   G   ++
Sbjct  4    KTVFVTVGTTKFDNLITTVLSREVLEALSARNYRHLILQIGNSNLEPDCTA-RYGFDKIE  62

Query  510  YFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELADR  331
             F  S SI KY++SA LVISHAG+GS+ E L+  K LIVV+N+ LMDNHQ ELAE+L   
Sbjct  63   TFKLSPSIGKYMQSADLVISHAGAGSVLEALEKRKHLIVVINDLLMDNHQIELAEQLYKD  122

Query  330  KHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGF  199
            ++L+    Q L   +  MD   + P+    +  +A  I+  +GF
Sbjct  123  EYLYYCTCQNLLYIVQTMDFTKLKPFINDKSADIANFIDKIMGF  166



>ref|XP_001833706.1| glycosyltransferase 28 [Coprinopsis cinerea okayama7#130]
 gb|EAU88251.1| glycosyltransferase 28 [Coprinopsis cinerea okayama7#130]
Length=171

 Score =   124 bits (310),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 69/168 (41%), Positives = 99/168 (59%), Gaps = 6/168 (4%)
 Frame = -2

Query  684  VFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSAS------ENGS  523
            VFVTVG+T FDALV  V T EV   L ++GY++I+VQ G   +    S        + GS
Sbjct  3    VFVTVGSTKFDALVQKVLTDEVLSALKKRGYSEIVVQCGNSFFAGHDSVGDVEHVVQRGS  62

Query  522  PALDYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEE  343
              +  + F  S+ +  + A LVISHAGSG+I + L+ GKP+IVV N  L+ NHQ ELA+ 
Sbjct  63   VTVTIWKFKPSLEEEYEKADLVISHAGSGTILDVLRRGKPMIVVPNPTLLHNHQQELADA  122

Query  342  LADRKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGF  199
            LAD+ HL  +    L Q I + +  ++VP+   D    AK+++  +GF
Sbjct  123  LADQGHLKASNVHGLAQAIEEFETSALVPFPQFDGTRFAKILDETMGF  170



>ref|XP_006889992.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog [Elephantulus edwardii]
Length=165

 Score =   123 bits (309),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 68/167 (41%), Positives = 104/167 (62%), Gaps = 8/167 (5%)
 Frame = -2

Query  690  RIVFVTVGTTCFDALVNAV---DTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSP  520
            + +FVTVGTT FD L+ +V   D+ ++ K L   GY+ +++Q+GRGT VP   +S+  S 
Sbjct  2    KCLFVTVGTTSFDDLIASVLAPDSLQIIKSL---GYSRLVLQIGRGTVVPKPFSSD--SF  56

Query  519  ALDYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEEL  340
             L+ + +  S+ + L+ A LVISHAG+GS  ETL+ GKPL+VV+NE LM+NHQ ELA++L
Sbjct  57   TLEVYRYKDSLQEDLQRADLVISHAGAGSCLETLEKGKPLVVVINEKLMNNHQLELAKQL  116

Query  339  ADRKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGF  199
                HLF      L   +  MDL ++  + PG  +  +  ++  +G 
Sbjct  117  YKEGHLFYCTCSMLPGLLQSMDLSTLKCFPPGQPEKFSAFLDKVVGL  163



>ref|XP_003391987.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog, partial [Amphimedon queenslandica]
Length=134

 Score =   122 bits (306),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 62/127 (49%), Positives = 82/127 (65%), Gaps = 3/127 (2%)
 Frame = -2

Query  693  KRIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPA-  517
            K+ V V VGTT F+ L+ AV     +K LF KGYT + +Q+G G Y P  S S +G    
Sbjct  3    KKSVLVVVGTTKFEDLIKAVSEKRFQKLLFSKGYTHLSIQIGHGEYTPADSESGSGREEG  62

Query  516  --LDYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEE  343
              +D+F F  ++A  +  ASL+ISH GSG+IFE+L L K L+VV+NE LM+NHQ+ELA  
Sbjct  63   LIVDWFRFKPTLANDMTEASLIISHGGSGTIFESLSLRKALVVVINETLMNNHQTELASR  122

Query  342  LADRKHL  322
            LA   HL
Sbjct  123  LAKDGHL  129



>gb|ETN63472.1| UDP-N-acetyl glucosamine transferase subunit alg13 [Anopheles 
darlingi]
Length=171

 Score =   123 bits (308),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 67/164 (41%), Positives = 93/164 (57%), Gaps = 0/164 (0%)
 Frame = -2

Query  690  RIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPALD  511
            R VFVTVGTT F+ LV +V + EV ++L   G   + +Q G+G+        +     L 
Sbjct  7    RNVFVTVGTTQFEELVGSVLSTEVLQQLETLGCETLTIQRGKGSTPDLPDIQKRTKIRLA  66

Query  510  YFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELADR  331
             +    +I   +K A LVISHAG+GS  E L+ G+PL+VVVNE LM+NHQ+ELAE L+  
Sbjct  67   CYDLKPTIGDDIKQADLVISHAGAGSCIEALEAGRPLVVVVNESLMNNHQTELAERLSRD  126

Query  330  KHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGF  199
             HLF   P +L QT+A+ D   +    PG        +N  +GF
Sbjct  127  DHLFYCTPSSLQQTLAEADFGRLRKLGPGSLDGFVDHLNKFMGF  170



>ref|XP_011808927.1| PREDICTED: putative bifunctional UDP-N-acetylglucosamine transferase 
and deubiquitinase ALG13 isoform X3 [Colobus angolensis 
palliatus]
Length=167

 Score =   123 bits (308),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 67/166 (40%), Positives = 99/166 (60%), Gaps = 4/166 (2%)
 Frame = -2

Query  690  RIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPALD  511
            + VFVTVGTT FD  +  V   +  +++   GY  +I+Q+GRGT VP   ++E  S  LD
Sbjct  2    KCVFVTVGTTSFDDFIACVSAPDSLQKIESLGYNRLILQIGRGTVVPEPFSTE--SFTLD  59

Query  510  YFTFSSSIAKYLKSASLVISHAG--SGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELA  337
             + +  S+ + ++ A LVISHAG  +GS  E L+ GKPL+VV+NE LM+NHQ ELA++L 
Sbjct  60   VYRYKDSLKEDIRKADLVISHAGKGAGSCLEALEKGKPLVVVINEKLMNNHQLELAKQLH  119

Query  336  DRKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGF  199
               HLF     TL   +  MDL ++  Y PG  +  +  ++  +G 
Sbjct  120  KEGHLFYCTCSTLPGLLQSMDLSTLKCYPPGQPEKFSAFLDKVVGL  165



>gb|ELU04680.1| hypothetical protein CAPTEDRAFT_198131 [Capitella teleta]
Length=169

 Score =   123 bits (308),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 60/166 (36%), Positives = 102/166 (61%), Gaps = 1/166 (1%)
 Frame = -2

Query  696  DKRIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPA  517
            D++ VF+TVGTT F+ L+N V+ +++   L E GY+ ++VQ GRG   P +  +  G   
Sbjct  4    DEKRVFLTVGTTAFNELINTVNQSDICNVLKELGYSRLLVQKGRGQVDPKQPENIEGF-R  62

Query  516  LDYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELA  337
            ++++ +  S+   ++ A L+ISHAG+G+  E L + KPL+VV+NE+LM NHQ ELA+ L 
Sbjct  63   VEHYQYKESLHDDMQEADLIISHAGAGTCLEVLNMQKPLVVVINEELMGNHQLELAKRLQ  122

Query  336  DRKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGF  199
               HLF    + L   + ++D+ S+ P++ G  +  A  ++  +G 
Sbjct  123  SDSHLFYTTCKDLPDLLRNLDISSLKPFETGRPEKFASFLDKAMGI  168



>gb|KFM67090.1| UDP-N-acetylglucosamine transferase subunit ALG13-like protein, 
partial [Stegodyphus mimosarum]
Length=161

 Score =   122 bits (307),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 64/145 (44%), Positives = 91/145 (63%), Gaps = 5/145 (3%)
 Frame = -2

Query  684  VFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPALDYF  505
            VFVTVG+T FD L+ +V ++++   +  KG+  II Q+GRG+ +P  S        +++F
Sbjct  3    VFVTVGSTSFDNLIRSVSSSDILNLVASKGFEKIIFQIGRGSVIPETSTI----IEIEWF  58

Query  504  TFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELADRKH  325
             F   I  Y+K+ASLV+ H G+G+I E+L   KPLI V+NE LMDNHQ ELA +LA   +
Sbjct  59   RFKDDITDYIKNASLVVGHGGAGTILESLINRKPLISVLNETLMDNHQGELANQLAKEGY  118

Query  324  LFCARPQTLYQTIADMDLES-VVPY  253
            L C    TLY T+ D   +  +VPY
Sbjct  119  LKCCTCATLYNTLRDYFADKYLVPY  143



>ref|XP_007439408.1| PREDICTED: putative bifunctional UDP-N-acetylglucosamine transferase 
and deubiquitinase ALG13 [Python bivittatus]
Length=1078

 Score =   131 bits (330),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 67/163 (41%), Positives = 101/163 (62%), Gaps = 2/163 (1%)
 Frame = -2

Query  690  RIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPALD  511
            +  FVTVGTT FD L+ AV   E  + L + GY  +++Q+GRG   P   ++   +  L+
Sbjct  2    KSAFVTVGTTSFDDLITAVTATEATQALQDLGYNRLVLQVGRGKECPASFSTATFT--LE  59

Query  510  YFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELADR  331
             F F +S+++ ++ A LVISHAG+GS  E L+ GKPL+VV+N+ LMDNHQ ELA +L   
Sbjct  60   AFRFKNSLSEDVERADLVISHAGAGSCLEVLEAGKPLLVVINDKLMDNHQLELARQLHRD  119

Query  330  KHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLG  202
             HLF    +TL + +  MDL ++ P+ PG  +  A  ++  +G
Sbjct  120  GHLFYCTSRTLVEMLRSMDLSTLKPFPPGQPEKFAAFLDKVIG  162



>ref|XP_011054909.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog [Acromyrmex echinatior]
Length=173

 Score =   122 bits (306),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 68/167 (41%), Positives = 97/167 (58%), Gaps = 1/167 (1%)
 Frame = -2

Query  699  ADKRIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSP  520
            +DK+ VFVTVGTT FD L+  V +  V + L  + Y  +I+Q+G     P  +A   G  
Sbjct  7    SDKKTVFVTVGTTKFDDLITTVLSRAVLEALSARNYGHLILQIGNSKLEPDCTA-RYGFH  65

Query  519  ALDYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEEL  340
             ++ F  S SI +YL+   LVISHAG+GS+ E L+  K LIVV N+ LMDNHQ ELAE+L
Sbjct  66   KIEIFRISPSIGEYLQLTDLVISHAGAGSVLEALERRKHLIVVTNDLLMDNHQIELAEQL  125

Query  339  ADRKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGF  199
               +HL+    + L   I  MD   + P+   ++  +A  I+  +GF
Sbjct  126  YKDEHLYYCTCKNLLHIIQTMDFAKLKPFTNDNSVDIANFIDKVMGF  172



>ref|XP_001893586.1| glycosyltransferase 28 domain containing 1 [Brugia malayi]
 emb|CDP98266.1| Protein BM-HPO-17 [Brugia malayi]
Length=164

 Score =   121 bits (304),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 63/161 (39%), Positives = 96/161 (60%), Gaps = 2/161 (1%)
 Frame = -2

Query  681  FVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPALDYFT  502
            FVTVG+T FDAL+  V   +  + L E G TD+++QMG+G  +  +  +  G   ++Y+ 
Sbjct  4    FVTVGSTEFDALIRVVVERKFLESLKEIGITDLLIQMGKGK-IELEKGNHYGI-NINYYR  61

Query  501  FSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELADRKHL  322
            +   I + +  A LVI HAG+G+  E L+  KPL+VVVNE+LM+NHQ ELA+ L +  H+
Sbjct  62   YKDDILQDIAEADLVIGHAGAGTCLEVLRYKKPLVVVVNEELMNNHQWELADRLQELGHI  121

Query  321  FCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGF  199
            FC RP  L + I   ++    P+   D   +A +I  H+G 
Sbjct  122  FCTRPNDLAEVIKSPEIFKRRPFAGPDYSNLANIILRHIGI  162



>ref|XP_004659178.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog [Jaculus jaculus]
Length=167

 Score =   121 bits (304),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 66/165 (40%), Positives = 102/165 (62%), Gaps = 4/165 (2%)
 Frame = -2

Query  690  RIVFVTVGTTCFDALVNAVDTAEVRKELFEK-GYTDIIVQMGRGTYVPTKSASENGSPAL  514
            +  FVTVGTT FD L+ +V T +   ++F+  GYT +++Q+GRG  +P    +E  S  L
Sbjct  2    KCAFVTVGTTSFDELIASVST-DASVQIFKNLGYTRLVLQIGRGKVIPEPINTE--SFIL  58

Query  513  DYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELAD  334
            + + + +S+ + L+ A LVISHAG+GS  ETL+ GKPL+VV+NE LM+NHQ ELA++L  
Sbjct  59   EVYRYKNSLKEDLQRADLVISHAGAGSCLETLEKGKPLVVVINEKLMNNHQLELAKQLHK  118

Query  333  RKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGF  199
              +LF      L   +  MDL ++  Y PG  +  +  ++  +G 
Sbjct  119  EGNLFYCTCSMLPGLLQSMDLSTLKSYAPGQPEKFSAFLDKVVGL  163



>ref|XP_011647069.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog [Pogonomyrmex barbatus]
Length=167

 Score =   121 bits (303),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 67/162 (41%), Positives = 94/162 (58%), Gaps = 1/162 (1%)
 Frame = -2

Query  684  VFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPALDYF  505
            VFVTVGTT FD L+  V +  + + L  + Y  +I+Q+G     P  +A   G   ++ F
Sbjct  6    VFVTVGTTKFDDLITTVLSPAILEALSARNYKRLILQIGNSNLEPDCTA-RCGFQKIEIF  64

Query  504  TFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELADRKH  325
              S SI +Y++ A+LVISHAG+GS+ E L+  K LIVV N  LMDNHQ ELAE+L   +H
Sbjct  65   KLSPSIGEYMQLANLVISHAGAGSVLEALEYHKHLIVVTNNLLMDNHQIELAEQLYKDEH  124

Query  324  LFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGF  199
            L+    Q L   I  MDL  + P+    +  +A  I+  +GF
Sbjct  125  LYHCTCQNLLHIIQTMDLTRLKPFVNDKSTDIANFIDKIMGF  166



>ref|XP_008168290.1| PREDICTED: putative bifunctional UDP-N-acetylglucosamine transferase 
and deubiquitinase ALG13 [Chrysemys picta bellii]
Length=1027

 Score =   129 bits (325),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 68/164 (41%), Positives = 101/164 (62%), Gaps = 2/164 (1%)
 Frame = -2

Query  690  RIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPALD  511
            +  FVTVGTT F+ L+ AV   E  + L   GY  +++Q+GRG   P +  +   +  L+
Sbjct  2    KSAFVTVGTTSFEELIAAVTAPETLQVLRSLGYGRLVLQVGRGAAAPARFRT--AAFTLE  59

Query  510  YFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELADR  331
             F F  S+A+ L+ A LVISHAG+G+  ETL+ GKPL+VVVNE LM+NHQ ELA +L   
Sbjct  60   VFRFKESLAEELERADLVISHAGAGTCLETLEKGKPLLVVVNEKLMNNHQLELARQLYRD  119

Query  330  KHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGF  199
             HLF     TL +++  ++L ++ P+ PG  +  A  ++  +GF
Sbjct  120  GHLFYCTCSTLLESLKSINLSTLKPFPPGQPEKFAAFLDRVIGF  163



>gb|EJW78168.1| UDP-N-acetyl glucosamine transferase subunit alg13 [Wuchereria 
bancrofti]
Length=163

 Score =   120 bits (302),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 63/160 (39%), Positives = 95/160 (59%), Gaps = 2/160 (1%)
 Frame = -2

Query  681  FVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPALDYFT  502
            FVTVG+T FDAL++ V   +  + L E G TD+++QMGRG  +  +  +  G   ++Y+ 
Sbjct  4    FVTVGSTEFDALIHVVVGRKFLESLKEIGITDLLIQMGRGK-IELEKGNHYGI-NINYYR  61

Query  501  FSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELADRKHL  322
            +   I + +  A LVI H G+G+  E L+  KP +VVVNE+LM+NHQ ELAE L +  H+
Sbjct  62   YKDDILQDIAEADLVIGHGGAGTCLEVLRYKKPFVVVVNEELMNNHQWELAERLHELGHI  121

Query  321  FCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLG  202
            FC RP  L + I   ++    P+   D   +A +I  H+G
Sbjct  122  FCTRPNDLAEVIRSPEIFKRRPFAGPDYSNLANVILRHIG  161



>ref|XP_011708353.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog [Wasmannia auropunctata]
 ref|XP_011708354.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog [Wasmannia auropunctata]
 ref|XP_011708355.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog [Wasmannia auropunctata]
 ref|XP_011708356.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog [Wasmannia auropunctata]
Length=167

 Score =   120 bits (301),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 68/164 (41%), Positives = 95/164 (58%), Gaps = 1/164 (1%)
 Frame = -2

Query  690  RIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPALD  511
            + VFVTVGTT FD L+  V +  V + L  + Y  +I+Q+G     P  +A   G   ++
Sbjct  4    KTVFVTVGTTKFDDLITTVLSRAVLEALSARNYKRLILQIGNSNLEPDCTA-RYGFHKIE  62

Query  510  YFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELADR  331
             F  S SI +YL+ A LVISHAG+GS+ E L+  K LIVV N+ LMDNHQ ELAE+L   
Sbjct  63   TFGLSPSIGEYLQLADLVISHAGAGSVLEALEKRKHLIVVTNDLLMDNHQIELAEQLYKD  122

Query  330  KHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGF  199
            +HL+    + L   I  MDL  + P+    +  +A  I+  +GF
Sbjct  123  EHLYYCTCRNLLHVIETMDLSKLKPFTNDKSADIANFIDKVIGF  166



>ref|XP_001862584.1| UDP-N-acetyl glucosamine transferase subunit alg13 [Culex quinquefasciatus]
 gb|EDS37222.1| UDP-N-acetyl glucosamine transferase subunit alg13 [Culex quinquefasciatus]
Length=170

 Score =   120 bits (301),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 69/164 (42%), Positives = 98/164 (60%), Gaps = 4/164 (2%)
 Frame = -2

Query  684  VFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPALD--  511
            VFVTVGTT F+ L+N V +  V  +L   G   +++Q+GRG + P  + S  G P +D  
Sbjct  9    VFVTVGTTQFEDLINMVTSEPVVTQLRRMGCRKLMLQVGRGKH-PALAKSMCG-PDIDVR  66

Query  510  YFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELADR  331
            ++   SSIA+ ++ A LVISHAG+GS  E L   KPL+VVVNE LMDNHQ+ELAE+L+  
Sbjct  67   FYDLKSSIAEDIRQADLVISHAGAGSCIEVLGAEKPLVVVVNERLMDNHQTELAEQLSKE  126

Query  330  KHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGF  199
             +L    P TL  T+   D   +  + PG        +++ +GF
Sbjct  127  GYLLYCTPTTLATTLEGSDFGQLKQFPPGSVADFISYLDAFMGF  170



>ref|XP_002402326.1| glycosyltransferase, putative [Ixodes scapularis]
 gb|EEC09516.1| glycosyltransferase, putative [Ixodes scapularis]
Length=164

 Score =   120 bits (301),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 63/164 (38%), Positives = 99/164 (60%), Gaps = 3/164 (2%)
 Frame = -2

Query  690  RIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPALD  511
            + VFVTVGTT FD L++ + +++V   L  +GYT I++Q+G+G      S  E   P+++
Sbjct  2    KTVFVTVGTTSFDDLIDTIISSDVLNVLKSQGYTKILLQVGKGNTPKVDSYVE---PSVE  58

Query  510  YFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELADR  331
             + F  SI + +  ASLVISHAG+GSI + L+ GK LI VVNE L+ NHQSELA +L   
Sbjct  59   SYNFKDSITRDINEASLVISHAGAGSILQALRAGKKLIAVVNESLLSNHQSELASQLHKE  118

Query  330  KHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGF  199
             +L C     L +T+ +M+   +  +   +     +L++  +G+
Sbjct  119  GYLLCCTCGELQKTLEEMEPSRLRTFPEANLSRFPQLLDGIMGW  162



>ref|XP_007893130.1| PREDICTED: putative bifunctional UDP-N-acetylglucosamine transferase 
and deubiquitinase ALG13 [Callorhinchus milii]
Length=1078

 Score =   128 bits (322),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 73/162 (45%), Positives = 96/162 (59%), Gaps = 2/162 (1%)
 Frame = -2

Query  684  VFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPALDYF  505
            VFVTVGTT FD L+  V +  V + L   G   + +Q+GRG+  P   A    S  LD F
Sbjct  4    VFVTVGTTSFDQLIECVSSDAVTRILQTLGCRKLTLQVGRGSVEP--KAFTGPSFTLDVF  61

Query  504  TFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELADRKH  325
             F  SIA+ ++SA LVISHAG+GS  E L  GKPLIVV+NE+LMDNHQ ELA+ L    H
Sbjct  62   RFKESIAEDIQSAGLVISHAGAGSCLEALGAGKPLIVVINENLMDNHQLELAKRLHRDGH  121

Query  324  LFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGF  199
            L      TL +T+  +D  S+ P+ PG  +  A  ++  +G 
Sbjct  122  LLYCTCSTLPETLRSLDFASLEPFPPGHPEKFANFVDRIVGL  163



>ref|XP_008117428.1| PREDICTED: putative bifunctional UDP-N-acetylglucosamine transferase 
and deubiquitinase ALG13 [Anolis carolinensis]
Length=1135

 Score =   129 bits (323),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 67/163 (41%), Positives = 102/163 (63%), Gaps = 2/163 (1%)
 Frame = -2

Query  690  RIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPALD  511
            +  FVTVGTT FD LV A+   +  K L + GY  +++Q+GRG+  P   ++   +  L+
Sbjct  2    KSAFVTVGTTSFDDLVAAIAAPKAVKVLQDLGYRKLVLQVGRGSVCPDPFSTNTFT--LE  59

Query  510  YFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELADR  331
             F F +S+ + +++A LVISHAG+GS  E L+ GKPL+VVVN+ LMDNHQ ELA +L   
Sbjct  60   VFRFKNSLTEEVQAADLVISHAGAGSCLEVLEAGKPLLVVVNDKLMDNHQLELARQLHRD  119

Query  330  KHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLG  202
             HLF    + L +T+  MDL ++ P+  G  +  A+ ++  +G
Sbjct  120  GHLFYCSSRDLVETLRSMDLSTLKPFPRGQPEKFAEFLDKAIG  162



>ref|XP_003262258.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog isoform 7 [Nomascus leucogenys]
Length=133

 Score =   119 bits (298),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 61/124 (49%), Positives = 84/124 (68%), Gaps = 2/124 (2%)
 Frame = -2

Query  690  RIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPALD  511
            + VFVTVGTT FD L+  V   +  +++   GY  +I+Q+GRGT VP   ++E  S  LD
Sbjct  2    KCVFVTVGTTSFDDLIACVSAPDSLQKIESLGYNRLILQIGRGTVVPEPFSTE--SFTLD  59

Query  510  YFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELADR  331
             + +  S+ + ++ A LVISHAG+GS  ETL+ GKPLIVV+NE LM+NHQ ELA++L   
Sbjct  60   VYRYKDSLKEDIQKADLVISHAGAGSCLETLEKGKPLIVVINEKLMNNHQLELAKQLHKE  119

Query  330  KHLF  319
             HLF
Sbjct  120  GHLF  123



>ref|XP_010344641.1| PREDICTED: putative bifunctional UDP-N-acetylglucosamine transferase 
and deubiquitinase ALG13 isoform X9 [Saimiri boliviensis 
boliviensis]
Length=133

 Score =   119 bits (297),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 60/124 (48%), Positives = 85/124 (69%), Gaps = 2/124 (2%)
 Frame = -2

Query  690  RIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPALD  511
            + VFVTVGTT FD L+  V   +  +++   GY+ +I+Q+GRGT VP   ++E  S  LD
Sbjct  2    KCVFVTVGTTSFDDLIACVSAPDSLQKIESLGYSRLILQIGRGTVVPEPFSTE--SFTLD  59

Query  510  YFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELADR  331
             + +  S+ + ++ A LVISHAG+GS  ETL+ GKPL+VV+NE LM+NHQ ELA++L   
Sbjct  60   VYRYKDSVKEDIQKADLVISHAGAGSCLETLEKGKPLVVVINEKLMNNHQLELAKQLHKE  119

Query  330  KHLF  319
             HLF
Sbjct  120  GHLF  123



>ref|XP_007300992.1| glycosyltransferase family 1 protein [Stereum hirsutum FP-91666 
SS1]
 gb|EIM89907.1| glycosyltransferase family 1 protein [Stereum hirsutum FP-91666 
SS1]
Length=173

 Score =   120 bits (300),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 66/170 (39%), Positives = 97/170 (57%), Gaps = 8/170 (5%)
 Frame = -2

Query  684  VFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSP-----  520
            VFVTVG+T FD+L+ +V + +V      KGYTDI+VQ G     P+     N +      
Sbjct  3    VFVTVGSTKFDSLIQSVLSDDVLHAFNAKGYTDIVVQCGNSQLDPSSGLVTNETAWTLER  62

Query  519  ---ALDYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELA  349
                LD + F  S+ +    A LV+SHAGSG+I + L+  K LIVV N  L+DNHQ ELA
Sbjct  63   DGIRLDMWRFKPSLEEEYNGADLVVSHAGSGTILDVLRKSKALIVVPNPTLLDNHQEELA  122

Query  348  EELADRKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGF  199
            + LAD  HL  +  + L +TI ++D+ ++ P+   D     +L++  +GF
Sbjct  123  KALADLGHLKASNIRELARTIRELDISTIKPFPAFDGSRFRRLLDEEMGF  172



>gb|KIK94304.1| glycosyltransferase family 1 protein [Paxillus rubicundulus Ve08.2h10]
Length=172

 Score =   120 bits (300),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 68/170 (40%), Positives = 95/170 (56%), Gaps = 7/170 (4%)
 Frame = -2

Query  687  IVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGR-------GTYVPTKSASEN  529
            +VFVTVG+T FD+LV A  +  V   L  KGYT +I+Q G        G +         
Sbjct  2    LVFVTVGSTKFDSLVQAAISELVIAALRNKGYTQVILQRGNSDLTTDGGGFGQDPLTIRK  61

Query  528  GSPALDYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELA  349
                ++ + F  SI   ++ A LVISHAGSG+I + L+ GKPLIVV N  L+DNHQ ELA
Sbjct  62   DGMEVETWKFKPSIQNDIERADLVISHAGSGTILDVLRSGKPLIVVPNPTLLDNHQEELA  121

Query  348  EELADRKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGF  199
             EL++  HL       L +TIA  D  +++P+ P D     +L++  +GF
Sbjct  122  SELSNLGHLRATSTHDLAETIASFDPGTLIPFPPFDGSKFRRLVDEEMGF  171



>emb|CCJ30335.1| unnamed protein product [Pneumocystis jirovecii]
Length=135

 Score =   119 bits (297),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 61/130 (47%), Positives = 85/130 (65%), Gaps = 1/130 (1%)
 Frame = -2

Query  693  KRIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPAL  514
            ++ VFVTVG+T FDAL++++   EV+K L   G++ I+VQ G    +     S  G   +
Sbjct  4    EKTVFVTVGSTRFDALISSIQQKEVQKALIAHGFSKILVQYGNSQNIFNNWESVEG-LKV  62

Query  513  DYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELAD  334
            + F +S  I K  K + L+ISHAGSGSI E L+L K LIVVVNE LMDNHQ EL EE++ 
Sbjct  63   NGFDYSKDIEKAFKESDLIISHAGSGSIIEALELKKQLIVVVNETLMDNHQIELTEEMSR  122

Query  333  RKHLFCARPQ  304
            +K+L  + P+
Sbjct  123  QKYLISSTPK  132



>ref|XP_009233451.1| PREDICTED: putative bifunctional UDP-N-acetylglucosamine transferase 
and deubiquitinase ALG13 isoform X3 [Pongo abelii]
Length=133

 Score =   119 bits (297),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 61/124 (49%), Positives = 84/124 (68%), Gaps = 2/124 (2%)
 Frame = -2

Query  690  RIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPALD  511
            + VFVTVGTT FD L+  V   +  +++   GY  +I+Q+GRGT VP   ++E  S  LD
Sbjct  2    KCVFVTVGTTSFDDLIACVSAPDSLQKIESLGYNRLILQIGRGTVVPEPFSTE--SFTLD  59

Query  510  YFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELADR  331
             + +  S+ + ++ A LVISHAG+GS  ETL+ GKPLIVV+NE LM+NHQ ELA++L   
Sbjct  60   VYRYKDSLKEDIQKADLVISHAGAGSCLETLEKGKPLIVVINEKLMNNHQLELAKQLHTE  119

Query  330  KHLF  319
             HLF
Sbjct  120  GHLF  123



>gb|KIK59811.1| glycosyltransferase family 1 protein [Gymnopus luxurians FD-317 
M1]
Length=171

 Score =   120 bits (300),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 68/169 (40%), Positives = 95/169 (56%), Gaps = 6/169 (4%)
 Frame = -2

Query  687  IVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENG------  526
            + F+TVG+T FDALV  V ++ V   L  KGY  ++VQ G   +      + +G      
Sbjct  2    LAFITVGSTRFDALVQTVFSSTVLSSLSNKGYARLVVQCGNSEFPYKDRVAVDGLHLNKD  61

Query  525  SPALDYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAE  346
               ++ + F  S+      A LVISHAGSG+I + L++ KPLIV+ N  L+DNHQ ELAE
Sbjct  62   GVQIECWKFKPSLQTEYAKADLVISHAGSGTIVDVLRMDKPLIVIPNPTLLDNHQQELAE  121

Query  345  ELADRKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGF  199
             L +  HL  A  +TL QTI D+D  S+V + P D      LI+  +GF
Sbjct  122  ALGELGHLKVATIETLSQTILDLDSSSLVKFPPFDGSRFRDLIDKEMGF  170



>gb|KIK49304.1| glycosyltransferase family 1 protein [Suillus luteus UH-Slu-Lm8-n1]
Length=170

 Score =   119 bits (299),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 70/168 (42%), Positives = 96/168 (57%), Gaps = 5/168 (3%)
 Frame = -2

Query  687  IVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGS-----  523
            +VFVTVG+T FDALV A  +  V   L + GY  +++Q G  T    +   E+ +     
Sbjct  2    LVFVTVGSTRFDALVEAAISEPVLSTLRDTGYDHLVLQRGNSTIESEEFKGESCTMRRHG  61

Query  522  PALDYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEE  343
              ++ + F SSI    + A LVISHAGSG+I + L+LGKPLIVV N  L+DNHQ ELA  
Sbjct  62   VEIEIWRFKSSIQAECEQADLVISHAGSGTILDVLRLGKPLIVVPNPTLLDNHQEELASA  121

Query  342  LADRKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGF  199
            L    HL     Q L  TIA  +  ++VP+ P D    +KL++  +GF
Sbjct  122  LQILGHLKATSIQDLASTIASFEPHNLVPFPPFDGIKFSKLVDEEMGF  169



>ref|NP_001161857.1| putative bifunctional UDP-N-acetylglucosamine transferase and 
deubiquitinase ALG13 isoform 4 [Homo sapiens]
 ref|XP_004064769.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog [Gorilla gorilla gorilla]
Length=133

 Score =   118 bits (296),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 60/124 (48%), Positives = 84/124 (68%), Gaps = 2/124 (2%)
 Frame = -2

Query  690  RIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPALD  511
            + VFVTVGTT FD L+  V   +  +++   GY  +I+Q+GRGT VP   ++E  S  LD
Sbjct  2    KCVFVTVGTTSFDDLIACVSAPDSLQKIESLGYNRLILQIGRGTVVPEPFSTE--SFTLD  59

Query  510  YFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELADR  331
             + +  S+ + ++ A LVISHAG+GS  ETL+ GKPL+VV+NE LM+NHQ ELA++L   
Sbjct  60   VYRYKDSLKEDIQKADLVISHAGAGSCLETLEKGKPLVVVINEKLMNNHQLELAKQLHKE  119

Query  330  KHLF  319
             HLF
Sbjct  120  GHLF  123



>ref|XP_004886174.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog isoform X2 [Heterocephalus glaber]
 ref|XP_004861482.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog isoform X4 [Heterocephalus glaber]
Length=134

 Score =   118 bits (296),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 60/126 (48%), Positives = 82/126 (65%), Gaps = 2/126 (2%)
 Frame = -2

Query  690  RIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPALD  511
            + VFVTVGTT FD L+  +   E  +     GY+ + +Q+GRGT VP   ++E  S  LD
Sbjct  3    KCVFVTVGTTSFDELIERMSAQESLRIFKSLGYSRLTLQIGRGTVVPEPFSTE--SFTLD  60

Query  510  YFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELADR  331
             + +  S+ + L+ A LVISHAG+GS  ETL+ GKPL+VVVNE LM+NHQ +LA++L   
Sbjct  61   VYRYKDSLQEDLQRADLVISHAGAGSCLETLEKGKPLVVVVNEKLMNNHQLQLAKQLHKE  120

Query  330  KHLFCA  313
             H FC 
Sbjct  121  GHFFCC  126



>gb|KII88584.1| glycosyltransferase family 1 protein [Plicaturopsis crispa FD-325 
SS-3]
Length=171

 Score =   119 bits (299),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 68/169 (40%), Positives = 99/169 (59%), Gaps = 6/169 (4%)
 Frame = -2

Query  687  IVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSA-SENGSPALD  511
            + FVTVG+T FDALVNAV +  V   L  KGY  ++VQ G   +     A SE+ S + D
Sbjct  2    LAFVTVGSTKFDALVNAVLSTPVISSLRAKGYVHLVVQCGNSNFDAADLAVSEDLSSSKD  61

Query  510  -----YFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAE  346
                  + F  ++ +  + A LVISHAGSG+I + L+LGKPLIVV N  L+DNHQ +LA 
Sbjct  62   GVDIQLWRFKPTLKEEYERADLVISHAGSGTILDVLRLGKPLIVVPNPTLLDNHQEDLAS  121

Query  345  ELADRKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGF  199
             L+   HL  +    L Q I ++D+  ++P+ P D+     L++  +G+
Sbjct  122  SLSTLGHLKASTVDELPQKIRELDVSLIIPFPPLDSNKFRNLLDEEMGY  170



>ref|XP_004340683.1| glycosyltransferase family 28 Cterminal domain containing protein 
[Acanthamoeba castellanii str. Neff]
 gb|ELR18641.1| glycosyltransferase family 28 Cterminal domain containing protein 
[Acanthamoeba castellanii str. Neff]
Length=179

 Score =   119 bits (299),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 69/174 (40%), Positives = 98/174 (56%), Gaps = 6/174 (3%)
 Frame = -2

Query  717  DGGANGAD-KRIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMG-RGTYVPT-  547
            D GA+  + K +V VTVG+T F+ L+  VD+A   + +  +GY  ++VQ G    + P  
Sbjct  5    DEGASAVEGKSVVLVTVGSTKFEDLLEVVDSAAFVEAVVARGYEALVVQYGPHAAHAPLH  64

Query  546  --KSASENGSPALDYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLM  373
              + A E+G  A   F  SSS A  L  A+LVISHAGSG+I E L +GK ++VVVN+ LM
Sbjct  65   LPRLAKEHGL-AYQAFAMSSSFASVLAQAALVISHAGSGTILEGLSIGKKMVVVVNDKLM  123

Query  372  DNHQSELAEELADRKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINS  211
            DNHQ E+A  +   KH+F   P  L   +   D + + P  P D    A  ++S
Sbjct  124  DNHQMEIASVMGQAKHVFDTTPNQLLALLGQADFDQLRPLPPPDTSAFAHFVDS  177



>ref|XP_011866108.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog [Vollenhovia emeryi]
Length=172

 Score =   119 bits (298),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 67/165 (41%), Positives = 98/165 (59%), Gaps = 1/165 (1%)
 Frame = -2

Query  693  KRIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPAL  514
            ++ VFVTVGTT FD L+  V +  V + L  + Y  +I+Q G     P  +A   G   +
Sbjct  8    EKTVFVTVGTTKFDELITTVLSRTVLEALSARDYKHLILQTGNTNLKPDCTA-RYGFRKI  66

Query  513  DYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELAD  334
            + F  S SI +Y++ A LVISHAG+GS+ E L+  K LIVV+N+ LMDNHQ+ELAE+L  
Sbjct  67   ETFGLSPSIGEYMQLADLVISHAGAGSVLEALENHKHLIVVINDLLMDNHQTELAEQLYK  126

Query  333  RKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGF  199
             +HL+    + L + I  MDL  + P+    +  +A  I+  +GF
Sbjct  127  DEHLYYCTCRDLPRVIQTMDLTKLKPFVDDKSADIANFIDKVMGF  171



>ref|XP_004685774.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog [Condylura cristata]
Length=165

 Score =   119 bits (297),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 65/164 (40%), Positives = 98/164 (60%), Gaps = 2/164 (1%)
 Frame = -2

Query  690  RIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPALD  511
            + +FVTVGTT FD L+  +   +  + +   GY  +++Q+GRG+ VP    +E  S  LD
Sbjct  2    KCLFVTVGTTSFDDLIARITAHDSLQIIQSLGYNRLVLQVGRGSVVPEPFRTE--SFTLD  59

Query  510  YFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELADR  331
             + +  S+ + L+ A LVISHAG+GS  ETL+  KPLIVV+NE LM+NHQ ELA++L   
Sbjct  60   VYRYKDSLKEDLEKADLVISHAGAGSCLETLEKRKPLIVVINEKLMNNHQLELAKQLYKD  119

Query  330  KHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGF  199
             HLF     TL   +  MDL ++  + PG  +  +  ++  +G 
Sbjct  120  GHLFYCTCSTLPGMLQSMDLSTLKCFPPGQPEKFSAFLDIVVGL  163



>ref|XP_005372154.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog [Microtus ochrogaster]
Length=1085

 Score =   127 bits (319),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 73/167 (44%), Positives = 101/167 (60%), Gaps = 8/167 (5%)
 Frame = -2

Query  690  RIVFVTVGTTCFDALVNAV---DTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSP  520
            +  FVTVGTT FD LV +V   D  E+ K L   GY  +++Q+GRGT VP    +E  S 
Sbjct  2    KRAFVTVGTTSFDDLVASVAAPDCVEILKSL---GYNQLVLQIGRGTVVPEPFRTE--SF  56

Query  519  ALDYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEEL  340
             LD + +  S+ + L+ A LVISHAG+GS  E+L+ GKPL+VVVNE LM+NHQ ELA++L
Sbjct  57   TLDVYRYKDSLKEDLQEADLVISHAGAGSCLESLEKGKPLVVVVNEKLMNNHQFELAKQL  116

Query  339  ADRKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGF  199
                HLF     TL   +  MDL ++  Y PG  +  +  ++  +G 
Sbjct  117  HKEGHLFYCTCSTLPGLLQSMDLSTLKCYPPGQPEKFSAFLDKVVGL  163



>ref|XP_003317688.1| PREDICTED: putative bifunctional UDP-N-acetylglucosamine transferase 
and deubiquitinase ALG13 isoform X9 [Pan troglodytes]
Length=133

 Score =   117 bits (294),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 60/124 (48%), Positives = 84/124 (68%), Gaps = 2/124 (2%)
 Frame = -2

Query  690  RIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPALD  511
            + VFVTVGTT FD L+  V   +  +++   GY  +I+Q+GRGT VP   ++E  S  LD
Sbjct  2    KCVFVTVGTTSFDDLIARVSAPDSLQKIESLGYNRLILQIGRGTVVPEPFSTE--SFTLD  59

Query  510  YFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELADR  331
             + +  S+ + ++ A LVISHAG+GS  ETL+ GKPL+VV+NE LM+NHQ ELA++L   
Sbjct  60   VYRYKDSLKEDIQKADLVISHAGAGSCLETLEKGKPLVVVINEKLMNNHQLELAKQLHKE  119

Query  330  KHLF  319
             HLF
Sbjct  120  GHLF  123



>ref|XP_011420111.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog [Crassostrea gigas]
 gb|EKC33531.1| UDP-N-acetylglucosamine transferase subunit ALG13-like protein 
[Crassostrea gigas]
Length=172

 Score =   119 bits (297),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 66/159 (42%), Positives = 94/159 (59%), Gaps = 7/159 (4%)
 Frame = -2

Query  684  VFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPALDY-  508
            VFVTVGTT F+ L + V ++ V K L   GY  ++VQ+GRG     +  S +  P ++  
Sbjct  12   VFVTVGTTQFEKLTDYVCSSAVLKTLANLGYRKVVVQIGRG-----RDPSIDTVPGIEVE  66

Query  507  -FTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELADR  331
             +    SI + ++ ASLVISHAG+GS  ETL   KPL+VV+N+DLM+NHQ ELA +L   
Sbjct  67   VYRLKPSITEDIRQASLVISHAGAGSCLETLAANKPLLVVINDDLMNNHQLELAYQLNKD  126

Query  330  KHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLIN  214
             HLF     TL  T+  +D  S+ P+ PG      + ++
Sbjct  127  GHLFYCTVSTLVDTLHSVDFSSLKPFPPGQPHKFGQFMD  165



>ref|XP_006136612.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog isoform X3 [Pelodiscus sinensis]
Length=150

 Score =   118 bits (295),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 68/164 (41%), Positives = 95/164 (58%), Gaps = 20/164 (12%)
 Frame = -2

Query  684  VFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPA--LD  511
            VFVTVGTTCF+ L+  V   E              +Q+G G   PT   +    PA  L+
Sbjct  4    VFVTVGTTCFEELIAVVSAPET-------------IQVGGGA-APTPLRT----PAFTLE  45

Query  510  YFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELADR  331
             F F  S+A+  + A LVISHAG+G+  ETL+ GKPL+VV+NE LM+NHQ ELA +L   
Sbjct  46   VFRFRESLAEEFQRADLVISHAGAGTCLETLEKGKPLLVVINEKLMNNHQLELARQLYKD  105

Query  330  KHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGF  199
            +HLF     TL +++  +DL ++ P+ PG  +  A  ++S  GF
Sbjct  106  EHLFYCTCSTLLESLKSIDLSTLKPFPPGQPEKFAAFLDSITGF  149



>ref|XP_001663412.1| AAEL013240-PA [Aedes aegypti]
 gb|EAT34523.1| AAEL013240-PA [Aedes aegypti]
Length=170

 Score =   118 bits (296),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 64/162 (40%), Positives = 96/162 (59%), Gaps = 0/162 (0%)
 Frame = -2

Query  684  VFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPALDYF  505
            VFVTVGTT F+ L++ V  + V  EL   G   +++Q+GRG               + ++
Sbjct  9    VFVTVGTTQFEDLIDTVTDSPVVAELRRMGCRKLVLQIGRGRNPQIIKEVFGNDIEVRFY  68

Query  504  TFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELADRKH  325
               +SIA+ ++ A LVISHAG+GS  E L   KPL+VVVNE LMDNHQ+ELA++L+   +
Sbjct  69   DLKASIAEDIQQADLVISHAGAGSCIEVLGAEKPLVVVVNEKLMDNHQTELADQLSKEGY  128

Query  324  LFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGF  199
            L    P TL QT+A+ +L  +  + PG  +     +++ +GF
Sbjct  129  LKYCTPSTLAQTLAESNLGQLKKFPPGSVQDFISYLDAFMGF  170



>ref|XP_003145497.1| glycosyltransferase 28 domain containing 1 [Loa loa]
 gb|EFO18573.1| glycosyltransferase 28 domain containing 1 [Loa loa]
Length=165

 Score =   118 bits (296),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 63/163 (39%), Positives = 95/163 (58%), Gaps = 2/163 (1%)
 Frame = -2

Query  681  FVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPALDYFT  502
            FVTVG+T FD L+ AV   +  + L + G TD+++Q+GRG  V  K  +  G   ++Y+ 
Sbjct  4    FVTVGSTEFDGLIRAVVERKCLESLNQIGITDLLIQIGRGK-VQLKKGNRCGV-NINYYR  61

Query  501  FSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELADRKHL  322
            +   I + +  A LVI HAG+G+  E L+  KP +VVVNE+LM+NHQ ELAE L +  H+
Sbjct  62   YKDDILQDITGADLVIGHAGAGTCLEVLRCQKPFVVVVNEELMNNHQWELAERLHELGHI  121

Query  321  FCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGFPE  193
            FC +P  L + I   ++    P+   D   +A  I  H+G  +
Sbjct  122  FCTKPNDLAEIIRLPEILKRKPFAGPDYSILANTILRHMGIDD  164



>ref|XP_004640079.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog isoform X2 [Octodon degus]
Length=133

 Score =   117 bits (292),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 63/125 (50%), Positives = 84/125 (67%), Gaps = 8/125 (6%)
 Frame = -2

Query  684  VFVTVGTTCFDALVNAV---DTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPAL  514
            VFVTVGTT FD L+  V   D+  + K L   GY+ + +Q+GRGT VP   ++E  S  L
Sbjct  4    VFVTVGTTSFDELITCVSAEDSVRIFKSL---GYSQLTLQIGRGTVVPEAFSAE--SFTL  58

Query  513  DYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELAD  334
            D + +  S+ + L+ A LVISHAG+GS  ETL+ GKPL+VV+NE LM+NHQ ELA++L  
Sbjct  59   DVYRYKDSLQEDLQEADLVISHAGAGSCLETLEKGKPLVVVINEKLMNNHQLELAKQLHQ  118

Query  333  RKHLF  319
              HLF
Sbjct  119  EGHLF  123



>gb|ERG83634.1| udp-n-acetylglucosamine transferase subunit alg13-like protein 
[Ascaris suum]
Length=173

 Score =   118 bits (295),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 62/158 (39%), Positives = 91/158 (58%), Gaps = 7/158 (4%)
 Frame = -2

Query  681  FVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKS------ASENGSP  520
            FVTVG+T FDAL+ AV + E    L ++G T +I+Q G GT+ P         A  NG P
Sbjct  4    FVTVGSTQFDALIEAVCSKEAIGALRKRGITQVILQTGTGTFRPADCEWRQDVALVNGMP  63

Query  519  ALDYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEEL  340
             L +++F + I+  ++ A ++I+HAG+G+  E L+  K +  VVNE+LMDNHQ EL E L
Sbjct  64   -LHFYSFKNDISGDMRRAEIIIAHAGAGTCLEALRCSKVVFAVVNEELMDNHQRELGERL  122

Query  339  ADRKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVA  226
            A+  HL C  P  L   +  +D+  + P+   D    A
Sbjct  123  AELGHLVCTTPTQLVSALETVDVSRLKPFVLHDVMAAA  160



>ref|XP_004281595.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog [Orcinus orca]
Length=165

 Score =   117 bits (294),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 64/164 (39%), Positives = 96/164 (59%), Gaps = 2/164 (1%)
 Frame = -2

Query  690  RIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPALD  511
            + VFVTVGTT FD L+  V   +  + +   GY  +++Q+GRG  VP   ++E  S  LD
Sbjct  2    KCVFVTVGTTSFDDLIACVSAPDSLQIIQSLGYNRLVLQIGRGKVVPEPFSTE--SFILD  59

Query  510  YFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELADR  331
             + +  S+ + L+ A LVISH+G+GS  ETL+  KPLIVV+NE LM+NHQ ELA++L   
Sbjct  60   VYRYKDSLKEDLQKADLVISHSGAGSCLETLEERKPLIVVINEKLMNNHQLELAKQLHKD  119

Query  330  KHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGF  199
             HLF      L   +  MD  ++  + PG  +  +  ++  +G 
Sbjct  120  GHLFYCTCSMLPGLLQSMDFSTLKCFPPGQPEKFSAFLDKVVGL  163



>gb|KIJ16891.1| glycosyltransferase family 1 protein [Paxillus involutus ATCC 
200175]
Length=172

 Score =   117 bits (294),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 68/170 (40%), Positives = 92/170 (54%), Gaps = 7/170 (4%)
 Frame = -2

Query  687  IVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSAS-------EN  529
            +VFVTVG+T FDALV A  +  V   L  K YT +++Q G          S         
Sbjct  2    LVFVTVGSTKFDALVQAAISEPVLAALRNKRYTQVVLQRGNSDLATDGDGSGQDPLTIRK  61

Query  528  GSPALDYFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELA  349
             S  ++ + F  SI   ++ A LVISHAGSG+I + L+ GKPLIVV N  L+DNHQ ELA
Sbjct  62   DSMEVETWKFKPSIQNDIERADLVISHAGSGTILDVLRSGKPLIVVPNATLLDNHQEELA  121

Query  348  EELADRKHLFCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGF  199
             +LAD  HL       L  TIA  D  +++P+   D     +L++  +GF
Sbjct  122  SKLADLGHLRATSTHELAATIASFDPGTLIPFPSFDGSKFRRLVDEEMGF  171



>ref|XP_011839880.1| PREDICTED: putative bifunctional UDP-N-acetylglucosamine transferase 
and deubiquitinase ALG13 isoform X6 [Mandrillus leucophaeus]
 ref|XP_011943081.1| PREDICTED: putative bifunctional UDP-N-acetylglucosamine transferase 
and deubiquitinase ALG13 isoform X7 [Cercocebus atys]
Length=133

 Score =   116 bits (291),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 59/124 (48%), Positives = 83/124 (67%), Gaps = 2/124 (2%)
 Frame = -2

Query  690  RIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPALD  511
            + VFVTVGTT FD L+  V   +  +++   GY  +I+Q+GRGT VP   ++E  S  LD
Sbjct  2    KCVFVTVGTTSFDDLIACVSAPDSLQKIESLGYNRLILQIGRGTVVPEPFSTE--SFTLD  59

Query  510  YFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELADR  331
             + +  S+ + ++ A LVISHAG+GS  E L+ GKPL+VV+NE LM+NHQ ELA++L   
Sbjct  60   VYRYKDSLKEDIQKADLVISHAGAGSCLEALEKGKPLVVVINEKLMNNHQLELAKQLHKE  119

Query  330  KHLF  319
             HLF
Sbjct  120  GHLF  123



>gb|EJU05656.1| glycosyltransferase family 1 protein [Dacryopinax sp. DJM-731 
SS1]
Length=164

 Score =   117 bits (293),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 63/161 (39%), Positives = 94/161 (58%), Gaps = 2/161 (1%)
 Frame = -2

Query  681  FVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPALDYFT  502
            FVTVG+T F  L+ AV   +  K L   GY  ++VQ G     P K +++  S  +D + 
Sbjct  5    FVTVGSTKFTPLIKAVVFDDCLKALKRAGYDTLVVQCGNSDVEPGKWSAQGVS--VDVWR  62

Query  501  FSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELADRKHL  322
            F+ SI  ++++A LVISHAGSG+I + L+ GKPLI V N  LMDNHQ+ELA  L+ + +L
Sbjct  63   FAPSIQSFVETAGLVISHAGSGTILDVLRAGKPLIAVPNTSLMDNHQAELANALSKQGYL  122

Query  321  FCARPQTLYQTIADMDLESVVPYQPGDAKPVAKLINSHLGF  199
              + P+TL Q IA      + P+   D      +++  +G+
Sbjct  123  TASTPETLPQVIAAFSPNHLAPFPAFDGSKFLNIVDEEMGY  163



>ref|XP_002130123.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog [Ciona intestinalis]
Length=162

 Score =   117 bits (292),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 69/146 (47%), Positives = 87/146 (60%), Gaps = 8/146 (5%)
 Frame = -2

Query  684  VFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASEN-GSPALDY  508
            +FVTVGTT FD L   + +  V+K L  +GY  + +Q GRG     K   EN  SP+   
Sbjct  3    IFVTVGTTSFDELTETITSKPVQKVLQSQGYDKVTIQYGRG-----KHEVENIKSPSYSV  57

Query  507  --FTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELAD  334
              F +  SIA+ + SA LVISHAG+GS  E L   KPL+VVVNE LMDNHQ ELA +L  
Sbjct  58   VGFRYKDSIAEDIASADLVISHAGAGSCLEVLGANKPLLVVVNEMLMDNHQIELATQLYR  117

Query  333  RKHLFCARPQTLYQTIADMDLESVVP  256
              HLF     TL +T+  MDL ++ P
Sbjct  118  DGHLFYCTCSTLLETLKSMDLSALKP  143



>ref|XP_005594453.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG13 
homolog isoform X15 [Macaca fascicularis]
 ref|XP_011754481.1| PREDICTED: putative bifunctional UDP-N-acetylglucosamine transferase 
and deubiquitinase ALG13 isoform X10 [Macaca nemestrina]
Length=133

 Score =   116 bits (290),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 59/124 (48%), Positives = 83/124 (67%), Gaps = 2/124 (2%)
 Frame = -2

Query  690  RIVFVTVGTTCFDALVNAVDTAEVRKELFEKGYTDIIVQMGRGTYVPTKSASENGSPALD  511
            + VFVTVGTT FD L+  V   +  +++   GY  +I+Q+GRGT VP   ++E  S  LD
Sbjct  2    KCVFVTVGTTSFDDLIACVSAPDSLQKIESLGYNRLILQIGRGTVVPEPFSTE--SFTLD  59

Query  510  YFTFSSSIAKYLKSASLVISHAGSGSIFETLQLGKPLIVVVNEDLMDNHQSELAEELADR  331
             + +  S+ + ++ A LVISHAG+GS  E L+ GKPL+VV+NE LM+NHQ ELA++L   
Sbjct  60   VYRYKDSLREDIQKADLVISHAGAGSCLEALEKGKPLVVVINEKLMNNHQLELAKQLHKE  119

Query  330  KHLF  319
             HLF
Sbjct  120  GHLF  123



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1977341620752