BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig11276

Length=821
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010325101.1|  PREDICTED: phospholipase D alpha 1-like isof...    372   4e-120   Solanum lycopersicum
ref|NP_001289824.1|  uncharacterized protein LOC101257989               372   2e-119   
ref|XP_010325100.1|  PREDICTED: phospholipase D alpha 1-like isof...    372   2e-119   Solanum lycopersicum
ref|XP_011078373.1|  PREDICTED: phospholipase D alpha 1-like            370   2e-118   Sesamum indicum [beniseed]
emb|CAI53943.1|  phospholipase D                                        349   5e-118   Triticum turgidum subsp. durum
ref|XP_006367508.1|  PREDICTED: phospholipase D alpha 1-like isof...    369   6e-118   Solanum tuberosum [potatoes]
ref|XP_009760786.1|  PREDICTED: phospholipase D alpha 1-like            368   8e-118   Nicotiana sylvestris
gb|AFK36876.1|  unknown                                                 348   2e-117   Lotus japonicus
gb|ACL54277.1|  unknown                                                 352   4e-117   Zea mays [maize]
ref|XP_009613360.1|  PREDICTED: phospholipase D alpha 1-like            365   7e-117   Nicotiana tomentosiformis
ref|XP_010250112.1|  PREDICTED: phospholipase D alpha 1                 363   1e-115   
gb|KCW70693.1|  hypothetical protein EUGRSUZ_F03862                     360   6e-115   Eucalyptus grandis [rose gum]
ref|XP_010063458.1|  PREDICTED: phospholipase D alpha 1                 360   2e-114   Eucalyptus grandis [rose gum]
ref|XP_009381115.1|  PREDICTED: phospholipase D alpha 1                 358   6e-114   Musa acuminata subsp. malaccensis [pisang utan]
emb|CAH58644.1|  phospholipase D                                        339   1e-113   Plantago major [cart-track plant]
ref|XP_006367510.1|  PREDICTED: phospholipase D alpha 1-like            356   3e-113   Solanum tuberosum [potatoes]
emb|CDP10414.1|  unnamed protein product                                356   4e-113   Coffea canephora [robusta coffee]
ref|XP_002517625.1|  phopholipase d alpha, putative                     355   1e-112   
gb|AAL16110.1|AF428278_1  AT3g15730/MSJ11_13                            346   1e-112   Arabidopsis thaliana [mouse-ear cress]
gb|AAB37305.1|  phospholipase D                                         354   1e-112   Ricinus communis
sp|Q41142.1|PLDA1_RICCO  RecName: Full=Phospholipase D alpha 1; S...    354   2e-112   Ricinus communis
dbj|BAJ88431.1|  predicted protein                                      347   2e-112   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010254401.1|  PREDICTED: phospholipase D alpha 1-like            354   2e-112   Nelumbo nucifera [Indian lotus]
ref|NP_001267764.1|  phospholipase D alpha 1-like                       353   3e-112   Setaria italica
gb|AIR77173.1|  phospholipase D                                         342   4e-112   Dendrobium hybrid cultivar
gb|ACG63795.1|  phospholipase D alpha                                   353   6e-112   Gossypium raimondii
gb|KJB70612.1|  hypothetical protein B456_011G083000                    352   7e-112   Gossypium raimondii
ref|XP_007023174.1|  Phospholipase D alpha 2 isoform 1                  352   8e-112   
ref|NP_001146559.1|  phospholipase D family protein                     350   1e-111   Zea mays [maize]
gb|KHG06123.1|  Phospholipase D alpha 1                                 352   2e-111   Gossypium arboreum [tree cotton]
gb|ACV70146.1|  phospholipase D                                         352   2e-111   Gossypium arboreum [tree cotton]
dbj|BAA11136.1|  phospholipase D                                        352   2e-111   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010656428.1|  PREDICTED: phospholipase D alpha 1-like            352   2e-111   Vitis vinifera
gb|EEC70024.1|  hypothetical protein OsI_00588                          352   2e-111   Oryza sativa Indica Group [Indian rice]
ref|NP_001042153.1|  Os01g0172400                                       352   2e-111   
gb|ACG63794.1|  phospholipase D alpha                                   352   2e-111   Gossypium arboreum [tree cotton]
ref|XP_008654846.1|  PREDICTED: phospholipase D family protein is...    352   2e-111   Zea mays [maize]
ref|XP_010545768.1|  PREDICTED: phospholipase D alpha 1                 351   3e-111   Tarenaya hassleriana [spider flower]
ref|XP_010487411.1|  PREDICTED: phospholipase D alpha 1 isoform X1      343   4e-111   Camelina sativa [gold-of-pleasure]
gb|ABY50100.1|  phospholipase D                                         343   6e-111   Agropyron mongolicum
ref|XP_007013459.1|  Phospholipase D alpha 1                            350   8e-111   
ref|XP_006406921.1|  hypothetical protein EUTSA_v10020083mg             345   1e-110   
ref|XP_011073436.1|  PREDICTED: phospholipase D alpha 1                 350   1e-110   Sesamum indicum [beniseed]
gb|AGW22212.1|  phospholipase D alpha                                   349   1e-110   Chorispora bungeana
gb|KDO48580.1|  hypothetical protein CISIN_1g004579mg                   347   3e-110   Citrus sinensis [apfelsine]
ref|XP_004303313.1|  PREDICTED: phospholipase D alpha 1                 348   3e-110   Fragaria vesca subsp. vesca
ref|XP_012073195.1|  PREDICTED: phospholipase D alpha 1                 348   4e-110   
ref|XP_010097235.1|  Phospholipase D alpha 1                            348   4e-110   Morus notabilis
emb|CAN76339.1|  hypothetical protein VITISV_014670                     348   4e-110   Vitis vinifera
ref|XP_009799916.1|  PREDICTED: phospholipase D alpha 1                 348   5e-110   Nicotiana sylvestris
gb|ADP23922.1|  phospholipase D alpha                                   348   5e-110   Litchi chinensis [litchi]
gb|AAL48262.2|AF451980_1  phospholipase D2                              348   6e-110   Papaver somniferum
ref|XP_003543677.1|  PREDICTED: phospholipase D alpha 1-like isof...    347   7e-110   Glycine max [soybeans]
ref|XP_006427267.1|  hypothetical protein CICLE_v10024917mg             347   7e-110   Citrus clementina [clementine]
ref|XP_009625689.1|  PREDICTED: phospholipase D alpha 1                 347   8e-110   Nicotiana tomentosiformis
ref|XP_003569355.1|  PREDICTED: phospholipase D alpha 1                 347   8e-110   Brachypodium distachyon [annual false brome]
gb|EMT03624.1|  Phospholipase D alpha 1                                 347   8e-110   
ref|XP_010907269.1|  PREDICTED: phospholipase D alpha 1                 347   9e-110   Elaeis guineensis
emb|CDM81985.1|  unnamed protein product                                347   9e-110   Triticum aestivum [Canadian hard winter wheat]
sp|O04883.1|PLDA1_PIMBR  RecName: Full=Phospholipase D alpha 1; S...    347   1e-109   Spuriopimpinella brachycarpa
gb|ABX83202.2|  phospholipase D                                         347   1e-109   Lolium temulentum
ref|XP_003531710.1|  PREDICTED: phospholipase D alpha 1-like isof...    347   1e-109   
gb|KHN47766.1|  Phospholipase D alpha 1                                 347   1e-109   Glycine soja [wild soybean]
ref|XP_003528334.1|  PREDICTED: phospholipase D alpha 1-like isof...    347   1e-109   
gb|KHN01336.1|  Phospholipase D alpha 1                                 347   1e-109   Glycine soja [wild soybean]
ref|XP_008360327.1|  PREDICTED: LOW QUALITY PROTEIN: phospholipas...    347   2e-109   Malus domestica [apple tree]
gb|AAW83125.1|  phospholipase D alpha                                   347   2e-109   Fragaria x ananassa
ref|NP_188194.1|  phospholipase D alpha 1                               346   2e-109   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002882959.1|  PLDALPHA1                                          346   2e-109   Arabidopsis lyrata subsp. lyrata
ref|XP_006643814.1|  PREDICTED: phospholipase D alpha 1-like            346   2e-109   Oryza brachyantha
ref|NP_001275827.1|  phospholipase D alpha                              346   2e-109   Citrus sinensis [apfelsine]
emb|CDY20149.1|  BnaA01g28530D                                          327   3e-109   Brassica napus [oilseed rape]
ref|XP_006465340.1|  PREDICTED: phospholipase D alpha 1                 346   3e-109   Citrus sinensis [apfelsine]
ref|XP_002282187.3|  PREDICTED: phospholipase D alpha 1-like            346   3e-109   Vitis vinifera
ref|XP_006406922.1|  hypothetical protein EUTSA_v10020083mg             345   4e-109   
gb|ABN13537.2|  phospholipase D                                         345   5e-109   Cucumis sativus [cucumbers]
ref|NP_001267897.1|  phospholipase D alpha                              345   6e-109   Vitis vinifera
sp|P93400.2|PLDA1_TOBAC  RecName: Full=Phospholipase D alpha 1; S...    345   6e-109   Nicotiana tabacum [American tobacco]
ref|XP_011008452.1|  PREDICTED: phospholipase D alpha 1-like            345   6e-109   Populus euphratica
ref|XP_004135845.1|  PREDICTED: phospholipase D alpha 1                 345   6e-109   
ref|XP_007150746.1|  hypothetical protein PHAVU_005G177300g             344   1e-108   Phaseolus vulgaris [French bean]
gb|AHN53202.1|  phospholipase D alpha 1-like protein                    344   2e-108   Cocos nucifera
ref|XP_006385316.1|  phospholipase D family protein                     344   2e-108   
ref|XP_007135745.1|  hypothetical protein PHAVU_010G155000g             343   2e-108   Phaseolus vulgaris [French bean]
ref|XP_010487412.1|  PREDICTED: phospholipase D alpha 1 isoform X2      343   3e-108   Camelina sativa [gold-of-pleasure]
ref|XP_010465563.1|  PREDICTED: phospholipase D alpha 1-like            343   3e-108   Camelina sativa [gold-of-pleasure]
ref|XP_009365415.1|  PREDICTED: phospholipase D alpha 1-like            343   3e-108   Pyrus x bretschneideri [bai li]
ref|XP_006297003.1|  hypothetical protein CARUB_v10012996mg             343   3e-108   Capsella rubella
ref|XP_009348321.1|  PREDICTED: phospholipase D alpha 1                 343   4e-108   Pyrus x bretschneideri [bai li]
gb|AES86616.2|  phospholipase D alpha 1                                 343   4e-108   Medicago truncatula
gb|ADY75750.1|  phospholipase D alpha                                   342   5e-108   Dimocarpus longan [longan]
gb|ABB82551.1|  phospholipase D-alpha                                   342   6e-108   Cucumis melo var. inodorus [casaba melon]
ref|XP_006387081.1|  hypothetical protein POPTR_1923s00200g             323   7e-108   
ref|XP_002299756.1|  phospholipase D family protein                     342   7e-108   Populus trichocarpa [western balsam poplar]
ref|XP_010503392.1|  PREDICTED: phospholipase D alpha 1-like            342   8e-108   Camelina sativa [gold-of-pleasure]
gb|EYU23016.1|  hypothetical protein MIMGU_mgv1a001487mg                342   9e-108   Erythranthe guttata [common monkey flower]
ref|XP_011012164.1|  PREDICTED: phospholipase D alpha 1                 342   9e-108   Populus euphratica
ref|XP_008461111.1|  PREDICTED: phospholipase D alpha 1                 342   1e-107   
gb|AGN71005.1|  phospholipase D1                                        342   1e-107   Brassica napus [oilseed rape]
gb|AAL48261.2|AF451979_1  phospholipase D1                              342   1e-107   Papaver somniferum
ref|XP_008367859.1|  PREDICTED: LOW QUALITY PROTEIN: phospholipas...    333   2e-107   
ref|XP_010322318.1|  PREDICTED: phospholipase PLDa1 isoform X1          340   5e-107   Solanum lycopersicum
ref|NP_001234102.1|  phospholipase PLDa1                                340   5e-107   
ref|XP_008242775.1|  PREDICTED: phospholipase D alpha 1-like            340   5e-107   Prunus mume [ume]
emb|CDO98145.1|  unnamed protein product                                340   6e-107   Coffea canephora [robusta coffee]
ref|XP_008373955.1|  PREDICTED: phospholipase D alpha 1                 340   8e-107   
ref|XP_002524502.1|  phopholipase d alpha, putative                     337   9e-107   
ref|XP_009123823.1|  PREDICTED: phospholipase D alpha 2-like            339   1e-106   Brassica rapa
emb|CDY47540.1|  BnaC03g69220D                                          339   1e-106   Brassica napus [oilseed rape]
emb|CAB43063.1|  phospholipase D1                                       339   1e-106   Craterostigma plantagineum
ref|XP_010687988.1|  PREDICTED: phospholipase D alpha 1-like            339   1e-106   
gb|ABK24520.1|  unknown                                                 330   1e-106   Picea sitchensis
ref|XP_009787006.1|  PREDICTED: phospholipase D alpha 1-like isof...    338   1e-106   Nicotiana sylvestris
ref|XP_007217042.1|  hypothetical protein PRUPE_ppa001519mg             339   1e-106   Prunus persica
ref|XP_009787005.1|  PREDICTED: phospholipase D alpha 1-like isof...    338   2e-106   Nicotiana sylvestris
gb|ACG80607.1|  phospholipase D alpha                                   339   2e-106   Prunus persica
gb|KDP33597.1|  hypothetical protein JCGZ_07168                         321   2e-106   Jatropha curcas
ref|XP_006356207.1|  PREDICTED: phospholipase D alpha 1-like isof...    338   2e-106   Solanum tuberosum [potatoes]
sp|O82549.1|PLDA1_BRAOC  RecName: Full=Phospholipase D alpha 1; S...    338   2e-106   Brassica oleracea var. capitata
ref|XP_008243731.1|  PREDICTED: phospholipase D alpha 1                 338   2e-106   Prunus mume [ume]
ref|XP_008454241.1|  PREDICTED: phospholipase D alpha 1                 338   3e-106   Cucumis melo [Oriental melon]
ref|XP_004287315.1|  PREDICTED: phospholipase D alpha 1-like            338   3e-106   Fragaria vesca subsp. vesca
emb|CDY21865.1|  BnaC01g35830D                                          338   4e-106   Brassica napus [oilseed rape]
sp|P86387.1|PLDA1_CARPA  RecName: Full=Phospholipase D alpha 1; S...    337   7e-106   Carica papaya [mamon]
emb|CDX97705.1|  BnaA05g23740D                                          337   8e-106   
ref|XP_009146200.1|  PREDICTED: phospholipase D alpha 1                 337   8e-106   Brassica rapa
gb|ACL53520.1|  unknown                                                 335   8e-106   Zea mays [maize]
sp|O04865.1|PLDA1_VIGUN  RecName: Full=Phospholipase D alpha 1; S...    337   9e-106   Vigna unguiculata
sp|P55939.2|PLDA2_BRAOC  RecName: Full=Phospholipase D alpha 2; S...    337   1e-105   Brassica oleracea var. capitata
gb|AGV22364.1|  phospholipase D4                                        337   1e-105   Brassica napus [oilseed rape]
ref|NP_001105686.1|  phospholipase D alpha 1                            336   2e-105   Zea mays [maize]
ref|XP_010090252.1|  Phospholipase D alpha 1                            335   2e-105   
dbj|BAE79735.1|  phospholipase D alpha 2                                336   2e-105   Arachis hypogaea [goober]
ref|XP_008673445.1|  PREDICTED: phospholipase D alpha 1 isoform X1      336   2e-105   Zea mays [maize]
gb|AIE90138.1|  phospholipase D1                                        336   2e-105   Brassica napus [oilseed rape]
gb|ACL53693.1|  unknown                                                 336   2e-105   Zea mays [maize]
gb|ACR35730.1|  unknown                                                 336   2e-105   Zea mays [maize]
ref|XP_008673447.1|  PREDICTED: phospholipase D alpha 1 isoform X2      336   2e-105   
ref|XP_009408983.1|  PREDICTED: phospholipase D alpha 1-like            335   2e-105   Musa acuminata subsp. malaccensis [pisang utan]
gb|AGV22363.1|  phospholipase D3                                        335   3e-105   Brassica napus [oilseed rape]
ref|XP_007204652.1|  hypothetical protein PRUPE_ppa001528mg             335   4e-105   Prunus persica
ref|XP_006392903.1|  hypothetical protein EUTSA_v10011246mg             335   4e-105   Eutrema salsugineum [saltwater cress]
ref|XP_009115281.1|  PREDICTED: phospholipase D alpha 2                 335   6e-105   Brassica rapa
ref|XP_012092883.1|  PREDICTED: phospholipase D alpha 1-like            322   7e-105   Jatropha curcas
ref|XP_008385550.1|  PREDICTED: phospholipase D alpha 1-like            334   8e-105   
ref|XP_004486668.1|  PREDICTED: phospholipase D alpha 1-like isof...    334   1e-104   
gb|AAP03643.1|  phopholipase D                                          328   1e-104   Mirabilis jalapa
gb|ABU54776.1|  phospholipase D alpha 1 precursor                       333   1e-104   Helianthus annuus
emb|CDY60551.1|  BnaA05g35700D                                          333   2e-104   Brassica napus [oilseed rape]
gb|EYU21635.1|  hypothetical protein MIMGU_mgv1a001489mg                333   2e-104   Erythranthe guttata [common monkey flower]
ref|XP_006306783.1|  hypothetical protein CARUB_v10008323mg             333   2e-104   
ref|XP_008777837.1|  PREDICTED: phospholipase D alpha 1-like            334   2e-104   Phoenix dactylifera
ref|XP_009619857.1|  PREDICTED: phospholipase D alpha 1                 333   2e-104   
ref|NP_175666.1|  phospholipase D alpha 2                               333   3e-104   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002894388.1|  predicted protein                                  333   4e-104   Arabidopsis lyrata subsp. lyrata
ref|XP_006842069.1|  PREDICTED: phospholipase D alpha 1                 333   4e-104   Amborella trichopoda
ref|XP_009144830.1|  PREDICTED: phospholipase D alpha 2                 332   4e-104   Brassica rapa
gb|AGN71006.1|  phospholipase D2                                        332   4e-104   Brassica napus [oilseed rape]
gb|AAC49274.1|  phospholipase D                                         332   5e-104   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010462102.1|  PREDICTED: phospholipase D alpha 2                 332   6e-104   Camelina sativa [gold-of-pleasure]
ref|XP_010500864.1|  PREDICTED: phospholipase D alpha 2-like isof...    332   7e-104   Camelina sativa [gold-of-pleasure]
ref|XP_008792036.1|  PREDICTED: phospholipase D alpha 1                 332   7e-104   Phoenix dactylifera
ref|XP_010500868.1|  PREDICTED: phospholipase D alpha 2-like isof...    332   8e-104   Camelina sativa [gold-of-pleasure]
ref|XP_012078796.1|  PREDICTED: phospholipase D alpha 1-like isof...    332   8e-104   
ref|XP_012078795.1|  PREDICTED: phospholipase D alpha 1-like isof...    332   8e-104   
gb|KJB68102.1|  hypothetical protein B456_010G225600                    332   9e-104   Gossypium raimondii
ref|XP_010479770.1|  PREDICTED: phospholipase D alpha 2-like            332   1e-103   Camelina sativa [gold-of-pleasure]
ref|XP_002443625.1|  hypothetical protein SORBIDRAFT_08g022520          332   1e-103   Sorghum bicolor [broomcorn]
ref|XP_010925209.1|  PREDICTED: phospholipase D alpha 1-like            331   1e-103   Elaeis guineensis
ref|XP_012078794.1|  PREDICTED: phospholipase D alpha 1-like isof...    331   1e-103   Jatropha curcas
ref|XP_011081358.1|  PREDICTED: phospholipase D alpha 1                 331   1e-103   Sesamum indicum [beniseed]
gb|EPS65578.1|  hypothetical protein M569_09194                         331   2e-103   Genlisea aurea
ref|XP_007150745.1|  hypothetical protein PHAVU_005G177200g             330   3e-103   Phaseolus vulgaris [French bean]
emb|CAB43062.1|  phospholipase D2                                       330   4e-103   Craterostigma plantagineum
ref|XP_009368855.1|  PREDICTED: phospholipase D alpha 1-like            328   1e-102   Pyrus x bretschneideri [bai li]
ref|XP_011039694.1|  PREDICTED: phospholipase D alpha 1-like            327   4e-102   Populus euphratica
dbj|BAJ93878.1|  predicted protein                                      326   5e-102   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002325225.2|  hypothetical protein POPTR_0018s13110g             327   6e-102   Populus trichocarpa [western balsam poplar]
ref|XP_006364210.1|  PREDICTED: phospholipase D alpha 1-like isof...    327   7e-102   Solanum tuberosum [potatoes]
ref|NP_001234863.1|  phospholipase PLDa2                                327   7e-102   
ref|XP_006364211.1|  PREDICTED: phospholipase D alpha 1-like isof...    326   8e-102   
ref|XP_010691149.1|  PREDICTED: phospholipase D alpha 1-like            326   9e-102   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008805616.1|  PREDICTED: phospholipase D alpha 1-like            326   1e-101   Phoenix dactylifera
ref|XP_009364028.1|  PREDICTED: phospholipase D alpha 1-like            325   3e-101   Pyrus x bretschneideri [bai li]
ref|XP_010923204.1|  PREDICTED: phospholipase D alpha 1-like            326   3e-101   Elaeis guineensis
ref|XP_009407292.1|  PREDICTED: phospholipase D alpha 1-like            325   3e-101   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006654096.1|  PREDICTED: phospholipase D alpha 1-like            325   4e-101   Oryza brachyantha
ref|XP_003597894.1|  Phospholipase D alpha                              323   1e-100   Medicago truncatula
gb|KHN22450.1|  Phospholipase D alpha 1                                 318   1e-100   Glycine soja [wild soybean]
ref|XP_003568837.1|  PREDICTED: phospholipase D alpha 1-like            323   2e-100   
gb|EMT24153.1|  Phospholipase D alpha 1                                 325   2e-100   
ref|XP_004235964.1|  PREDICTED: phospholipase D alpha 1                 322   4e-100   Solanum lycopersicum
ref|XP_009758055.1|  PREDICTED: phospholipase D alpha 1-like            321   9e-100   Nicotiana sylvestris
ref|XP_012076577.1|  PREDICTED: phospholipase D alpha 1-like isof...    320   1e-99    
ref|XP_012076566.1|  PREDICTED: phospholipase D alpha 1-like isof...    320   1e-99    
ref|XP_012076576.1|  PREDICTED: phospholipase D alpha 1-like isof...    320   2e-99    
ref|XP_012076575.1|  PREDICTED: phospholipase D alpha 1-like isof...    320   2e-99    
gb|AAU44332.1|  hypothetical protein                                    320   2e-99    Oryza sativa Japonica Group [Japonica rice]
ref|XP_012076574.1|  PREDICTED: phospholipase D alpha 1-like isof...    320   3e-99    
ref|XP_012076565.1|  PREDICTED: phospholipase D alpha 1-like isof...    320   3e-99    
ref|XP_012076573.1|  PREDICTED: phospholipase D alpha 1-like isof...    320   3e-99    Jatropha curcas
ref|XP_012076563.1|  PREDICTED: phospholipase D alpha 1-like isof...    320   3e-99    Jatropha curcas
ref|XP_011017763.1|  PREDICTED: phospholipase D alpha 1-like            319   7e-99    Populus euphratica
sp|Q70EW5.2|PLDA1_CYNCA  RecName: Full=Phospholipase D alpha 1; S...    318   9e-99    Cynara cardunculus [cardoon]
ref|XP_008649399.1|  PREDICTED: phospholipase D alpha 1-like            318   2e-98    Zea mays [maize]
ref|XP_009401723.1|  PREDICTED: phospholipase D alpha 1-like isof...    317   2e-98    
ref|XP_004506968.1|  PREDICTED: phospholipase D alpha 1-like            317   2e-98    
gb|EYU24646.1|  hypothetical protein MIMGU_mgv1a001477mg                317   4e-98    Erythranthe guttata [common monkey flower]
ref|XP_009401714.1|  PREDICTED: phospholipase D alpha 1-like isof...    317   4e-98    
ref|XP_009614730.1|  PREDICTED: phospholipase D alpha 1 {ECO:0000...    316   8e-98    Nicotiana tomentosiformis
gb|EMS46811.1|  Phospholipase D alpha 2                                 313   9e-98    Triticum urartu
gb|AFW77332.1|  phospholipase D family protein                          318   1e-97    
ref|XP_002308663.2|  hypothetical protein POPTR_0006s27000g             315   1e-97    
ref|XP_008219493.1|  PREDICTED: phospholipase D alpha 1-like            314   3e-97    Prunus mume [ume]
dbj|BAJ94103.1|  predicted protein                                      315   3e-97    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004152203.1|  PREDICTED: phospholipase D alpha 1                 314   3e-97    Cucumis sativus [cucumbers]
dbj|BAJ85695.1|  predicted protein                                      315   4e-97    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008394090.1|  PREDICTED: phospholipase D alpha 1-like isof...    313   1e-96    
ref|XP_003563661.1|  PREDICTED: phospholipase D alpha 2-like            313   1e-96    Brachypodium distachyon [annual false brome]
ref|XP_007225238.1|  hypothetical protein PRUPE_ppa001818mg             311   1e-96    
ref|XP_009355736.1|  PREDICTED: phospholipase D alpha 1-like            313   1e-96    
emb|CBI21040.3|  unnamed protein product                                311   2e-96    Vitis vinifera
ref|XP_010648662.1|  PREDICTED: phospholipase D alpha 1-like            311   9e-96    Vitis vinifera
ref|XP_011070230.1|  PREDICTED: LOW QUALITY PROTEIN: phospholipas...    311   1e-95    Sesamum indicum [beniseed]
ref|XP_002515518.1|  phopholipase d alpha, putative                     310   1e-95    Ricinus communis
ref|XP_011649822.1|  PREDICTED: phospholipase D alpha 1-like            309   4e-95    Cucumis sativus [cucumbers]
gb|EMT32202.1|  Phospholipase D alpha 2                                 309   4e-95    
ref|XP_008445210.1|  PREDICTED: phospholipase D alpha 1-like            309   5e-95    Cucumis melo [Oriental melon]
gb|EMT15739.1|  Phospholipase D alpha 2                                 306   1e-94    
ref|XP_006656220.1|  PREDICTED: phospholipase D alpha 2-like            308   1e-94    Oryza brachyantha
ref|XP_006350007.1|  PREDICTED: phospholipase D alpha 1-like            308   1e-94    Solanum tuberosum [potatoes]
gb|EEC80931.1|  hypothetical protein OsI_23625                          306   4e-94    Oryza sativa Indica Group [Indian rice]
gb|AFW87187.1|  phospholipase D family protein                          304   5e-94    
ref|NP_001058017.1|  Os06g0604400                                       305   8e-94    
gb|KJB55001.1|  hypothetical protein B456_009G057800                    305   2e-93    Gossypium raimondii
ref|XP_004251821.1|  PREDICTED: phospholipase D alpha 1-like            305   2e-93    Solanum lycopersicum
ref|NP_001146242.1|  uncharacterized protein LOC100279815               304   3e-93    Zea mays [maize]
ref|XP_004965943.1|  PREDICTED: phospholipase D alpha 2-like            302   1e-92    Setaria italica
ref|XP_002437251.1|  hypothetical protein SORBIDRAFT_10g023630          302   2e-92    Sorghum bicolor [broomcorn]
ref|XP_010101275.1|  Phospholipase D alpha 1                            300   8e-92    
dbj|BAA19466.1|  phospholipase D                                        300   2e-91    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010048204.1|  PREDICTED: phospholipase D alpha 1-like            300   2e-91    Eucalyptus grandis [rose gum]
gb|AAF78755.1|AF271357_1  phospholipase D                               299   3e-91    Oryza sativa Indica Group [Indian rice]
ref|NP_001058016.1|  Os06g0604300                                       299   4e-91    
ref|XP_010696306.1|  PREDICTED: phospholipase D alpha 1-like            297   1e-90    Beta vulgaris subsp. vulgaris [field beet]
gb|EYU32345.1|  hypothetical protein MIMGU_mgv1a001383mg                297   2e-90    Erythranthe guttata [common monkey flower]
ref|XP_004501330.1|  PREDICTED: phospholipase D alpha 1-like isof...    297   2e-90    Cicer arietinum [garbanzo]
ref|XP_004501331.1|  PREDICTED: phospholipase D alpha 1-like isof...    296   2e-90    Cicer arietinum [garbanzo]
ref|XP_007011867.1|  Phospholipase D alpha 1                            295   1e-89    
ref|XP_006657112.1|  PREDICTED: phospholipase D alpha 2-like            293   2e-89    
ref|XP_010541603.1|  PREDICTED: phospholipase D zeta                    293   3e-89    Tarenaya hassleriana [spider flower]
ref|XP_002451299.1|  hypothetical protein SORBIDRAFT_05g027210          293   6e-89    Sorghum bicolor [broomcorn]
ref|XP_007011869.1|  Phospholipase D alpha 2 isoform 2                  290   3e-88    
gb|KJB07619.1|  hypothetical protein B456_001G0333002                   290   4e-88    Gossypium raimondii
ref|XP_007011868.1|  Phospholipase D alpha 2 isoform 1                  290   6e-88    
emb|CDX88175.1|  BnaA06g27660D                                          288   8e-88    
ref|XP_011459180.1|  PREDICTED: phospholipase D alpha 1-like            289   1e-87    Fragaria vesca subsp. vesca
gb|EPS60466.1|  hypothetical protein M569_14336                         288   1e-87    Genlisea aurea
ref|XP_006656219.1|  PREDICTED: phospholipase D alpha 2-like            289   2e-87    Oryza brachyantha
ref|XP_001762942.1|  predicted protein                                  288   2e-87    
gb|AAF78754.1|AF271356_1  phospholipase D                               288   3e-87    Oryza sativa Indica Group [Indian rice]
ref|XP_009151064.1|  PREDICTED: phospholipase D zeta                    288   3e-87    Brassica rapa
ref|NP_001058015.1|  Os06g0604200                                       288   3e-87    
gb|KCW82853.1|  hypothetical protein EUGRSUZ_C04222                     288   3e-87    Eucalyptus grandis [rose gum]
emb|CBI28205.3|  unnamed protein product                                283   4e-87    Vitis vinifera
ref|XP_010050012.1|  PREDICTED: phospholipase D alpha 1-like            288   4e-87    
ref|XP_006657113.1|  PREDICTED: phospholipase D alpha 2-like            288   5e-87    Oryza brachyantha
gb|EPS71739.1|  hypothetical protein M569_03019                         286   1e-86    Genlisea aurea
ref|XP_007137028.1|  hypothetical protein PHAVU_009G093500g             285   4e-86    Phaseolus vulgaris [French bean]
ref|XP_006394787.1|  hypothetical protein EUTSA_v10003665mg             285   5e-86    
ref|XP_002972515.1|  hypothetical protein SELMODRAFT_441825             285   6e-86    Selaginella moellendorffii
ref|XP_006394788.1|  hypothetical protein EUTSA_v10003659mg             284   8e-86    Eutrema salsugineum [saltwater cress]
ref|XP_006450437.1|  hypothetical protein CICLE_v10010712mg             284   1e-85    
dbj|BAE79734.1|  phospholipase D alpha 1                                283   2e-85    Arachis hypogaea [goober]
ref|XP_003603403.1|  Phospholipase D alpha                              283   3e-85    Medicago truncatula
gb|EMT22155.1|  Phospholipase D alpha 2                                 281   3e-85    
emb|CBI28204.3|  unnamed protein product                                280   4e-85    Vitis vinifera
ref|XP_004984144.1|  PREDICTED: phospholipase D alpha 1-like isof...    283   4e-85    Setaria italica
ref|XP_004984142.1|  PREDICTED: phospholipase D alpha 1-like isof...    283   4e-85    Setaria italica
ref|XP_004984143.1|  PREDICTED: phospholipase D alpha 1-like isof...    283   5e-85    
ref|XP_004984141.1|  PREDICTED: phospholipase D alpha 1-like isof...    283   5e-85    
emb|CDY70643.1|  BnaAnng34490D                                          265   5e-85    
ref|XP_002992572.1|  hypothetical protein SELMODRAFT_186850             282   5e-85    
ref|XP_009129965.1|  PREDICTED: phospholipase D zeta-like               282   6e-85    
ref|XP_004501328.1|  PREDICTED: phospholipase D alpha 1-like isof...    281   9e-85    
emb|CDP13512.1|  unnamed protein product                                281   1e-84    
emb|CDY05490.1|  BnaA02g32010D                                          281   1e-84    
ref|XP_010493792.1|  PREDICTED: phospholipase D zeta                    281   2e-84    
emb|CDY05351.1|  BnaC02g40590D                                          281   2e-84    
emb|CDX80505.1|  BnaC07g29390D                                          280   2e-84    
ref|XP_010454864.1|  PREDICTED: phospholipase D zeta-like               280   3e-84    
gb|KDO61728.1|  hypothetical protein CISIN_1g003523mg                   280   5e-84    
dbj|BAK02630.1|  predicted protein                                      280   5e-84    
ref|XP_006483709.1|  PREDICTED: phospholipase D alpha 1-like            280   6e-84    
gb|AAP50498.1|  phospholipase D                                         279   7e-84    
ref|NP_197919.1|  phospholipase D alpha 3                               279   1e-83    
gb|KHN07080.1|  Phospholipase D alpha 1                                 278   1e-83    
ref|XP_003603407.1|  Phospholipase D alpha                              279   1e-83    
gb|EMS68435.1|  Phospholipase D alpha 2                                 278   2e-83    
ref|XP_006581357.1|  PREDICTED: phospholipase D alpha 1-like            278   2e-83    
emb|CDP13510.1|  unnamed protein product                                278   2e-83    
gb|EMT22156.1|  Phospholipase D alpha 2                                 275   1e-82    
ref|XP_002874254.1|  predicted protein                                  275   3e-82    
ref|XP_010228543.1|  PREDICTED: phospholipase D alpha 1-like isof...    273   6e-82    
ref|XP_010228542.1|  PREDICTED: phospholipase D alpha 1-like isof...    274   9e-82    
ref|XP_002964421.1|  hypothetical protein SELMODRAFT_82084              273   2e-81    
ref|XP_006287080.1|  hypothetical protein CARUB_v10000238mg             272   2e-81    
gb|AFX67027.1|  phospholipase D                                         253   3e-81    
gb|EMT19808.1|  Phospholipase D alpha 2                                 271   7e-81    
ref|XP_002967619.1|  hypothetical protein SELMODRAFT_231070             270   2e-80    
gb|EMS67798.1|  Phospholipase D alpha 2                                 268   3e-80    
ref|XP_006581358.1|  PREDICTED: phospholipase D alpha 1-like            269   4e-80    
ref|XP_007137026.1|  hypothetical protein PHAVU_009G093400g             266   2e-79    
tpg|DAA45665.1|  TPA: phospholipase D family protein                    267   2e-79    
ref|XP_008673230.1|  PREDICTED: phospholipase D family protein is...    268   2e-79    
ref|XP_008673211.1|  PREDICTED: phospholipase D family protein is...    268   2e-79    
ref|XP_002974536.1|  hypothetical protein SELMODRAFT_267774             266   4e-79    
ref|XP_007137027.1|  hypothetical protein PHAVU_009G093400g             266   4e-79    
ref|XP_002963233.1|  hypothetical protein SELMODRAFT_165923             266   4e-79    
emb|CBI36315.3|  unnamed protein product                                248   5e-79    
gb|EMS68436.1|  Phospholipase D alpha 2                                 266   5e-79    
ref|XP_004979743.1|  PREDICTED: phospholipase D alpha 2-like            265   2e-78    
ref|XP_001767482.1|  predicted protein                                  264   5e-78    
gb|EAY90307.1|  hypothetical protein OsI_11882                          263   1e-77    
ref|XP_006650158.1|  PREDICTED: phospholipase D alpha 1-like            261   5e-77    
ref|NP_001050281.1|  Os03g0391400                                       248   2e-75    
ref|XP_008650412.1|  PREDICTED: phospholipase D alpha 1-like            251   5e-74    
gb|AGH68505.1|  phospholipase D1 alpha                                  233   1e-73    
gb|EEE59186.1|  hypothetical protein OsJ_11122                          248   3e-72    
gb|AAR87276.1|  putative phospholipase D                                248   4e-72    
ref|XP_001753756.1|  predicted protein                                  243   1e-70    
ref|XP_008660012.1|  PREDICTED: phospholipase D alpha 1-like            243   1e-70    
ref|XP_001753255.1|  predicted protein                                  241   9e-70    
ref|XP_010100114.1|  Phospholipase D delta                              236   1e-69    
ref|XP_006660110.1|  PREDICTED: phospholipase D alpha 2-like            233   5e-69    
ref|XP_006387106.1|  hypothetical protein POPTR_1837s00200g             224   2e-68    
gb|AFK40898.1|  unknown                                                 223   2e-68    
ref|XP_001773645.1|  predicted protein                                  238   2e-68    
ref|NP_001051849.1|  Os03g0840800                                       232   4e-68    
ref|XP_009803791.1|  PREDICTED: phospholipase D beta 1-like             223   7e-68    
ref|XP_009601452.1|  PREDICTED: phospholipase D beta 1-like             223   7e-68    
ref|XP_008378989.1|  PREDICTED: phospholipase D gamma 1-like            221   8e-68    
ref|XP_011628580.1|  PREDICTED: phospholipase D delta isoform X6        234   5e-67    
ref|XP_001755745.1|  predicted protein                                  234   5e-67    
gb|KDO43538.1|  hypothetical protein CISIN_1g0454781mg                  219   6e-67    
ref|XP_006858490.1|  PREDICTED: phospholipase D delta isoform X1        234   6e-67    
ref|XP_011628576.1|  PREDICTED: phospholipase D delta isoform X2        234   7e-67    
ref|XP_009776941.1|  PREDICTED: phospholipase D delta-like              233   1e-66    
ref|XP_007136128.1|  hypothetical protein PHAVU_009G020200g             233   1e-66    
gb|KDO38449.1|  hypothetical protein CISIN_1g002960mg                   227   2e-66    
emb|CAN71413.1|  hypothetical protein VITISV_029215                     228   2e-66    
gb|KHN33827.1|  Phospholipase D delta                                   230   3e-66    
dbj|BAC98682.1|  putative phospholipase D alpha 1                       231   3e-66    
ref|XP_003576533.1|  PREDICTED: phospholipase D alpha 1-like            231   3e-66    
ref|XP_009602808.1|  PREDICTED: phospholipase D delta-like              232   3e-66    
gb|AFK37886.1|  unknown                                                 217   3e-66    
ref|XP_008232842.1|  PREDICTED: phospholipase D beta 1                  233   4e-66    
gb|ABR17779.1|  unknown                                                 231   4e-66    
gb|AAT77001.1|  phospholipase D                                         231   4e-66    
ref|XP_009381793.1|  PREDICTED: phospholipase D alpha 1-like            231   5e-66    
ref|NP_001061758.2|  Os08g0401800                                       231   5e-66    
gb|AAF78756.1|AF271358_1  phospholipase D                               231   5e-66    
ref|XP_009620056.1|  PREDICTED: phospholipase D delta-like              231   5e-66    
gb|EEC76498.1|  hypothetical protein OsI_14257                          231   6e-66    
ref|XP_011628577.1|  PREDICTED: phospholipase D delta isoform X3        231   8e-66    
gb|EEC83543.1|  hypothetical protein OsI_29158                          230   9e-66    
gb|KJB07745.1|  hypothetical protein B456_001G042400                    215   1e-65    
ref|XP_002462392.1|  hypothetical protein SORBIDRAFT_02g024910          230   1e-65    
ref|XP_003523254.1|  PREDICTED: phospholipase D delta-like              230   1e-65    
ref|XP_008810306.1|  PREDICTED: phospholipase D alpha 1-like            230   1e-65    
ref|XP_010535133.1|  PREDICTED: phospholipase D alpha 1-like isof...    215   1e-65    
ref|XP_008670198.1|  PREDICTED: phospholipase D alpha 1-like isof...    229   2e-65    
ref|XP_007218907.1|  hypothetical protein PRUPE_ppa000580mg             231   2e-65    
ref|XP_008348788.1|  PREDICTED: phospholipase D beta 1-like             229   2e-65    
ref|XP_011628579.1|  PREDICTED: phospholipase D delta isoform X5        229   2e-65    
ref|XP_008670197.1|  PREDICTED: phospholipase D alpha 1-like isof...    229   2e-65    
emb|CDX90066.1|  BnaA10g00160D                                          229   3e-65    
ref|XP_009377897.1|  PREDICTED: phospholipase D beta 1-like isofo...    228   3e-65    
gb|EAZ09131.1|  hypothetical protein OsI_31401                          229   3e-65    
gb|AAB63542.2|  phospholipase D                                         229   4e-65    
ref|XP_009377896.1|  PREDICTED: phospholipase D beta 1-like isofo...    228   4e-65    
dbj|BAK05685.1|  predicted protein                                      228   5e-65    
emb|CDY15144.1|  BnaC05g00230D                                          229   5e-65    
ref|XP_009119747.1|  PREDICTED: phospholipase D beta 1                  229   5e-65    
ref|XP_010506009.1|  PREDICTED: phospholipase D beta 1 isoform X1       227   5e-65    
ref|XP_011463799.1|  PREDICTED: phospholipase D gamma 1-like            228   6e-65    
gb|AAN40512.1|  phospholipase D beta 1 isoform 1b-2                     223   6e-65    
emb|CBI29771.3|  unnamed protein product                                228   6e-65    
ref|XP_006418468.1|  hypothetical protein EUTSA_v10006647mg             229   6e-65    
ref|XP_006425355.1|  hypothetical protein CICLE_v10024876mg             228   7e-65    
ref|XP_010658068.1|  PREDICTED: phospholipase D delta-like isofor...    228   7e-65    
ref|XP_002266693.2|  PREDICTED: phospholipase D delta-like isofor...    228   8e-65    
ref|XP_008238759.1|  PREDICTED: phospholipase D beta 1-like             228   8e-65    
gb|EMT32687.1|  Phospholipase D alpha 1                                 223   1e-64    
ref|XP_009410696.1|  PREDICTED: phospholipase D delta-like              228   1e-64    
ref|XP_002872960.1|  PLDBETA2                                           228   1e-64    
ref|XP_010942074.1|  PREDICTED: phospholipase D alpha 1-like            227   1e-64    
ref|XP_007211141.1|  hypothetical protein PRUPE_ppa026639mg             227   1e-64    
ref|XP_010315479.1|  PREDICTED: phospholipase D delta-like              228   1e-64    
ref|XP_010508631.1|  PREDICTED: phospholipase D beta 1 isoform X2       229   1e-64    
ref|XP_002881817.1|  phospholipase D beta 1                             229   1e-64    
gb|AAL78825.1|AF414566_2  phospholipase D nu-2                          217   1e-64    
gb|KDO38440.1|  hypothetical protein CISIN_1g002960mg                   227   1e-64    
ref|XP_006467032.1|  PREDICTED: phospholipase D delta-like              227   2e-64    
ref|XP_010523062.1|  PREDICTED: phospholipase D beta 1                  228   2e-64    
ref|XP_002301946.1|  hypothetical protein POPTR_0002s01750g             226   2e-64    
ref|XP_006349430.1|  PREDICTED: phospholipase D delta-like              227   2e-64    
ref|NP_565963.2|  phospholipase D beta 1                                228   3e-64    
ref|XP_006295936.1|  hypothetical protein CARUB_v10025073mg             228   3e-64    
ref|XP_010228187.1|  PREDICTED: phospholipase D delta-like isofor...    221   3e-64    
ref|XP_010255578.1|  PREDICTED: phospholipase D beta 2-like isofo...    228   3e-64    
ref|XP_010272594.1|  PREDICTED: phospholipase D beta 1-like             226   3e-64    
ref|XP_009350598.1|  PREDICTED: phospholipase D gamma 1-like            228   3e-64    
ref|XP_010068094.1|  PREDICTED: phospholipase D delta-like              212   3e-64    
ref|XP_010255577.1|  PREDICTED: phospholipase D beta 2-like isofo...    228   3e-64    
ref|XP_004500903.1|  PREDICTED: phospholipase D delta-like isofor...    226   4e-64    
ref|XP_008802877.1|  PREDICTED: phospholipase D delta-like              226   4e-64    
ref|XP_011628578.1|  PREDICTED: phospholipase D delta isoform X4        226   4e-64    
ref|XP_007227049.1|  hypothetical protein PRUPE_ppa001322mg             226   4e-64    
gb|EAZ44767.1|  hypothetical protein OsJ_29399                          225   4e-64    
ref|XP_010692336.1|  PREDICTED: phospholipase D gamma 1                 228   4e-64    
ref|XP_010266062.1|  PREDICTED: phospholipase D delta-like              226   4e-64    
ref|XP_008375890.1|  PREDICTED: phospholipase D gamma 1-like            227   5e-64    
ref|XP_004956847.1|  PREDICTED: phospholipase D alpha 1-like            225   5e-64    
ref|XP_009796632.1|  PREDICTED: phospholipase D delta-like              225   5e-64    
ref|XP_007040091.1|  Phospholipase D beta 1                             225   6e-64    
ref|XP_011034954.1|  PREDICTED: phospholipase D delta-like              225   6e-64    
emb|CDP07339.1|  unnamed protein product                                221   7e-64    
ref|XP_008670361.1|  PREDICTED: phospholipase D delta-like              212   8e-64    
ref|NP_001063203.1|  Os09g0421300                                       224   9e-64    
ref|XP_010520828.1|  PREDICTED: phospholipase D delta-like              225   9e-64    
gb|KCW77623.1|  hypothetical protein EUGRSUZ_D01933                     225   9e-64    
ref|NP_001234108.1|  phospholipase PLDb2                                225   1e-63    
gb|KDO43387.1|  hypothetical protein CISIN_1g0011261mg                  217   1e-63    
ref|XP_010053353.1|  PREDICTED: phospholipase D beta 1-like             225   1e-63    
gb|KDO43385.1|  hypothetical protein CISIN_1g0011261mg                  217   1e-63    
ref|XP_010517711.1|  PREDICTED: phospholipase D beta 1-like             225   1e-63    
gb|KDO43386.1|  hypothetical protein CISIN_1g0011261mg                  217   1e-63    
gb|AAC49656.2|  phospholipase D                                         224   2e-63    
emb|CDY13283.1|  BnaC09g23730D                                          214   2e-63    
ref|XP_004986130.1|  PREDICTED: phospholipase D delta-like              224   2e-63    
ref|XP_011463800.1|  PREDICTED: uncharacterized protein LOC101313411    228   2e-63    
ref|XP_006828836.1|  PREDICTED: phospholipase D delta                   224   3e-63    
ref|XP_008670093.1|  PREDICTED: phospholipase D delta-like isofor...    219   3e-63    
gb|KFK30609.1|  hypothetical protein AALP_AA6G003800                    225   3e-63    
ref|XP_008811755.1|  PREDICTED: LOW QUALITY PROTEIN: phospholipas...    223   3e-63    
ref|XP_006661243.1|  PREDICTED: phospholipase D alpha 1-like            221   3e-63    
emb|CDP08909.1|  unnamed protein product                                225   3e-63    
ref|XP_010272588.1|  PREDICTED: phospholipase D gamma 1-like            225   3e-63    
ref|XP_010266912.1|  PREDICTED: phospholipase D delta                   223   3e-63    
gb|KHN35993.1|  Phospholipase D delta                                   222   4e-63    
ref|XP_010686080.1|  PREDICTED: phospholipase D epsilon                 222   4e-63    
ref|XP_004145051.1|  PREDICTED: phospholipase D gamma 1-like            224   4e-63    
ref|XP_004298731.1|  PREDICTED: phospholipase D beta 1-like             223   4e-63    
ref|XP_004956882.1|  PREDICTED: phospholipase D delta-like isofor...    218   4e-63    
gb|ADM21349.1|  phospholipase D                                         223   5e-63    
ref|XP_010683033.1|  PREDICTED: phospholipase D delta                   223   5e-63    
ref|XP_008218590.1|  PREDICTED: phospholipase D delta-like              223   5e-63    
gb|AAD43343.1|AF159139_1  phospholipase D                               223   6e-63    
ref|XP_008357632.1|  PREDICTED: phospholipase D delta-like              223   6e-63    
ref|XP_008776523.1|  PREDICTED: phospholipase D beta 1-like             215   6e-63    
ref|XP_011463798.1|  PREDICTED: phospholipase D gamma 1-like isof...    223   6e-63    
ref|XP_008460150.1|  PREDICTED: phospholipase D beta 2-like             224   7e-63    
ref|XP_011099892.1|  PREDICTED: phospholipase D delta                   222   8e-63    
ref|XP_010323957.1|  PREDICTED: phospholipase PLDb2 isoform X1          224   8e-63    
ref|XP_006341816.1|  PREDICTED: phospholipase D delta-like isofor...    222   8e-63    
ref|XP_002874728.1|  PLDGAMMA1                                          222   8e-63    
pir||T01547  probable phospholipase D (EC 3.1.4.4) A_IG005I10.13 ...    222   9e-63 
emb|CBI34767.3|  unnamed protein product                                222   9e-63    
ref|XP_008448951.1|  PREDICTED: phospholipase D beta 1-like             222   9e-63    
ref|XP_002275783.1|  PREDICTED: phospholipase D beta 1-like             222   1e-62    
ref|XP_001782222.1|  predicted protein                                  222   1e-62    
ref|XP_003516537.1|  PREDICTED: phospholipase D delta-like isofor...    222   1e-62    
gb|EYU30820.1|  hypothetical protein MIMGU_mgv1a001201mg                222   1e-62    
ref|XP_012083503.1|  PREDICTED: phospholipase D beta 2                  224   1e-62    
ref|XP_010262168.1|  PREDICTED: phospholipase D epsilon                 221   1e-62    
ref|XP_006857964.1|  PREDICTED: phospholipase D gamma 1                 223   1e-62    
gb|AEF58504.1|  phospholipase D delta                                   222   1e-62    
ref|NP_567160.1|  phospholipase D beta 2                                222   1e-62    
ref|XP_009337116.1|  PREDICTED: phospholipase D delta-like              219   1e-62    
ref|XP_009355262.1|  PREDICTED: phospholipase D delta-like              221   2e-62    
gb|KHG08188.1|  Phospholipase D beta 1 -like protein                    221   2e-62    
ref|XP_012073715.1|  PREDICTED: phospholipase D delta-like isofor...    221   2e-62    
ref|XP_004300742.1|  PREDICTED: phospholipase D gamma 1-like isof...    221   2e-62    
ref|XP_008445312.1|  PREDICTED: phospholipase D delta-like              221   2e-62    
gb|KDP36869.1|  hypothetical protein JCGZ_08160                         221   2e-62    
ref|XP_011003096.1|  PREDICTED: phospholipase D delta-like              221   2e-62    
ref|XP_012073716.1|  PREDICTED: phospholipase D delta-like isofor...    221   2e-62    
ref|XP_003557320.1|  PREDICTED: phospholipase D delta-like isofor...    221   2e-62    
ref|XP_006339497.1|  PREDICTED: phospholipase D beta 1-like             223   2e-62    
ref|XP_007051965.1|  Phospholipase D beta 1 isoform 1                   223   2e-62    
gb|KCW56571.1|  hypothetical protein EUGRSUZ_I02303                     220   2e-62    
gb|KCW72878.1|  hypothetical protein EUGRSUZ_E01326                     221   2e-62    
gb|KHN20136.1|  Phospholipase D delta                                   218   2e-62    
gb|KHN06490.1|  Phospholipase D delta                                   220   2e-62    
ref|XP_003636420.1|  Phospholipase D epsilon                            220   2e-62    
gb|AEI99558.1|  phospholipase D delta                                   221   3e-62    
emb|CDP09827.1|  unnamed protein product                                221   3e-62    
ref|XP_009128478.1|  PREDICTED: phospholipase D beta 2 isoform X2       220   3e-62    
ref|XP_010695892.1|  PREDICTED: phospholipase D alpha 1-like            206   3e-62    



>ref|XP_010325101.1| PREDICTED: phospholipase D alpha 1-like isoform X2 [Solanum lycopersicum]
Length=723

 Score =   372 bits (955),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 169/211 (80%), Positives = 192/211 (91%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMYTDI+QALKAKGI+ANPKDYLSFFCLGNRETKK  EYEPSE P+ D+DY +AQE
Sbjct  506  RTMKMMYTDIIQALKAKGIVANPKDYLSFFCLGNRETKKTGEYEPSESPEPDSDYQKAQE  565

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVHAKMMIVDDEYII+GSANINQRSMDGARDSEIAMGAYQP HL A++PARGQV
Sbjct  566  ARRFMIYVHAKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGAYQPFHLYAKEPARGQV  625

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFRMALWYEHLGMLDN F QPES+EC+ KVN+I +  W++YS E+L  D+P HLL+YPI
Sbjct  626  HGFRMALWYEHLGMLDNSFLQPESVECIRKVNKIGDKYWDMYSSESLVHDLPGHLLTYPI  685

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            G+TENG+VTE+PG + FPDTKAP+LGTKSNF
Sbjct  686  GITENGEVTEIPGVECFPDTKAPILGTKSNF  716



>ref|NP_001289824.1| uncharacterized protein LOC101257989 [Solanum lycopersicum]
 gb|AAG48162.1|AF154425_1 phospholipase D [Solanum lycopersicum]
Length=807

 Score =   372 bits (956),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 169/211 (80%), Positives = 192/211 (91%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMYTDI+QALKAKGI+ANPKDYLSFFCLGNRETKK  EYEPSE P+ D+DY +AQE
Sbjct  590  RTMKMMYTDIIQALKAKGIVANPKDYLSFFCLGNRETKKTGEYEPSESPEPDSDYQKAQE  649

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVHAKMMIVDDEYII+GSANINQRSMDGARDSEIAMGAYQP HL A++PARGQV
Sbjct  650  ARRFMIYVHAKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGAYQPFHLYAKEPARGQV  709

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFRMALWYEHLGMLDN F QPES+EC+ KVN+I +  W++YS E+L  D+P HLL+YPI
Sbjct  710  HGFRMALWYEHLGMLDNSFLQPESVECIRKVNKIGDKYWDMYSSESLVHDLPGHLLTYPI  769

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            G+TENG+VTE+PG + FPDTKAP+LGTKSNF
Sbjct  770  GITENGEVTEIPGVECFPDTKAPILGTKSNF  800



>ref|XP_010325100.1| PREDICTED: phospholipase D alpha 1-like isoform X1 [Solanum lycopersicum]
Length=807

 Score =   372 bits (955),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 169/211 (80%), Positives = 192/211 (91%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMYTDI+QALKAKGI+ANPKDYLSFFCLGNRETKK  EYEPSE P+ D+DY +AQE
Sbjct  590  RTMKMMYTDIIQALKAKGIVANPKDYLSFFCLGNRETKKTGEYEPSESPEPDSDYQKAQE  649

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVHAKMMIVDDEYII+GSANINQRSMDGARDSEIAMGAYQP HL A++PARGQV
Sbjct  650  ARRFMIYVHAKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGAYQPFHLYAKEPARGQV  709

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFRMALWYEHLGMLDN F QPES+EC+ KVN+I +  W++YS E+L  D+P HLL+YPI
Sbjct  710  HGFRMALWYEHLGMLDNSFLQPESVECIRKVNKIGDKYWDMYSSESLVHDLPGHLLTYPI  769

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            G+TENG+VTE+PG + FPDTKAP+LGTKSNF
Sbjct  770  GITENGEVTEIPGVECFPDTKAPILGTKSNF  800



>ref|XP_011078373.1| PREDICTED: phospholipase D alpha 1-like [Sesamum indicum]
Length=808

 Score =   370 bits (950),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 168/211 (80%), Positives = 190/211 (90%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMY DIV+ALKAKGI+ANPKDYL+FFCLGNRE K+  EY+PSEKPD DTDY+RAQE
Sbjct  591  RTMEMMYRDIVEALKAKGIVANPKDYLTFFCLGNREVKRSGEYQPSEKPDPDTDYARAQE  650

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARR MIYVHAKMMIVDDEYII+GSANINQRSMDGARDSEIAMGAYQP+HLS +QPARGQ+
Sbjct  651  ARRGMIYVHAKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGAYQPYHLSCKQPARGQI  710

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFRMALWYEH+GMLDNCF  PE +EC+ KVNQIAE NW+LY+ E LERD+P HLLSYPI
Sbjct  711  HGFRMALWYEHMGMLDNCFCHPERLECIQKVNQIAETNWDLYTREVLERDLPGHLLSYPI  770

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            GV+ +G VTELPG +NFPDTKA VLG+ + F
Sbjct  771  GVSSDGTVTELPGTENFPDTKARVLGSVAEF  801



>emb|CAI53943.1| phospholipase D [Triticum turgidum subsp. durum]
Length=221

 Score =   349 bits (896),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 159/211 (75%), Positives = 186/211 (88%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMYTDI QAL+AKGI ANPK+YL+FFCLGNRE K+  EYEP E+P+ DTDY RAQE
Sbjct  4    RTMEMMYTDITQALEAKGIEANPKEYLTFFCLGNREVKQDGEYEPQEQPEPDTDYVRAQE  63

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVH KMMIVDDEYII+GSANINQRSMDGARDSEIAMGAYQP+HL+ R+PARGQ+
Sbjct  64   ARRFMIYVHTKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGAYQPYHLANREPARGQI  123

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFRMALWYEHLGMLD+ F +PES+ECV KVN+IAE  W++YS + LE+D+P HLLSYPI
Sbjct  124  HGFRMALWYEHLGMLDDVFQRPESVECVQKVNRIAEKYWDIYSSDDLEQDLPGHLLSYPI  183

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            GV  +G VTELPG + FPDT+A +LG KS++
Sbjct  184  GVASDGVVTELPGMEFFPDTRARILGAKSDY  214



>ref|XP_006367508.1| PREDICTED: phospholipase D alpha 1-like isoform X1 [Solanum tuberosum]
 ref|XP_006367509.1| PREDICTED: phospholipase D alpha 1-like isoform X2 [Solanum tuberosum]
Length=807

 Score =   369 bits (946),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 168/211 (80%), Positives = 190/211 (90%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMYTDI+QALKAKGI+ANPKDYLSFFCLGNRETKK  EYEPSE P+ D+DY +AQE
Sbjct  590  RTMKMMYTDIIQALKAKGIVANPKDYLSFFCLGNRETKKTGEYEPSESPEPDSDYQKAQE  649

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVHAKMMIVDDEYII+GSANINQRSMDGARDSEIAMGAYQP HL  ++PARGQV
Sbjct  650  ARRFMIYVHAKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGAYQPFHLCVKEPARGQV  709

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFRMALWYEHLGMLDN F QPES+EC+ KVN+I +  W++YS E+L  D+P HLL+YPI
Sbjct  710  HGFRMALWYEHLGMLDNSFLQPESVECIRKVNKIGDKYWDMYSSESLIHDLPGHLLTYPI  769

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            G+TENG+VT +PG + FPDTKAPVLGTKSNF
Sbjct  770  GITENGEVTGIPGVECFPDTKAPVLGTKSNF  800



>ref|XP_009760786.1| PREDICTED: phospholipase D alpha 1-like [Nicotiana sylvestris]
Length=807

 Score =   368 bits (945),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 171/211 (81%), Positives = 190/211 (90%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMYTDI+QALK KGIIANPK+YLSFFCLGNRETKKG EYEPSE P+ D+DYSRAQE
Sbjct  590  RTMRMMYTDIIQALKVKGIIANPKEYLSFFCLGNRETKKGGEYEPSETPEPDSDYSRAQE  649

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVHAKMMIVDDEYII+GSANINQRSMDGARDSEIAMGAYQP HLS ++PARGQV
Sbjct  650  ARRFMIYVHAKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGAYQPFHLSVKEPARGQV  709

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFRMALWYEHLG+LDN F  PES EC+ KVNQ+A+  W+LYS E+L  D+P HLL+YPI
Sbjct  710  HGFRMALWYEHLGLLDNSFLYPESPECIRKVNQVADKYWDLYSSESLVHDLPGHLLTYPI  769

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
             VTENG+VTELPG + FPDTKA VLGTKS+F
Sbjct  770  AVTENGEVTELPGTEYFPDTKARVLGTKSDF  800



>gb|AFK36876.1| unknown [Lotus japonicus]
Length=238

 Score =   348 bits (894),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 160/211 (76%), Positives = 186/211 (88%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RT++MMY DI+QAL+AKGI  +P++YL+FFCLGNRE KK  EYEPSE+P+ D+DYSRAQE
Sbjct  21   RTLEMMYKDIIQALRAKGIEEDPRNYLTFFCLGNREVKKQGEYEPSEQPEPDSDYSRAQE  80

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVH KMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQP+HL+ARQPARGQ+
Sbjct  81   ARRFMIYVHTKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPYHLAARQPARGQI  140

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFRM+LWYEHLGMLD+ F  PE+ ECV KVNQIA+  W+LYS E+LE D+P HLL YPI
Sbjct  141  HGFRMSLWYEHLGMLDDSFNNPENEECVRKVNQIADKYWDLYSSESLEHDLPGHLLRYPI  200

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            GV+  G VTELPGF+ FPDTKA VLG K+++
Sbjct  201  GVSGEGDVTELPGFEFFPDTKARVLGGKADY  231



>gb|ACL54277.1| unknown [Zea mays]
Length=357

 Score =   352 bits (903),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 162/211 (77%), Positives = 185/211 (88%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM MMYTDI QAL+A GI ANPKDYL+FFCLGNRE K+  EY+P E P+  TDY RAQE
Sbjct  140  RTMDMMYTDITQALEANGIQANPKDYLTFFCLGNREVKQEGEYQPEEHPEPGTDYIRAQE  199

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVHAKMMIVDDEYII+GSANINQRSMDGARDSEIAMGAYQP+HL+ RQPARGQ+
Sbjct  200  ARRFMIYVHAKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGAYQPYHLATRQPARGQI  259

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFRM+LWYEHLGMLD+ F +PES+ECV KVN+IAE  W+LYS + LE+D+P HLLSYPI
Sbjct  260  HGFRMSLWYEHLGMLDDVFQRPESVECVQKVNKIAEKYWDLYSSDDLEQDLPGHLLSYPI  319

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            GVT +G VTELPG +NFPDT+A VLG KS++
Sbjct  320  GVTADGTVTELPGMENFPDTRARVLGNKSDY  350



>ref|XP_009613360.1| PREDICTED: phospholipase D alpha 1-like [Nicotiana tomentosiformis]
Length=807

 Score =   365 bits (938),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 170/211 (81%), Positives = 189/211 (90%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMYTDI+QALK KGI+ANP++YLSFFCLGNRETKKG EYEPSE P+  +DYSRAQE
Sbjct  590  RTMRMMYTDIIQALKVKGIVANPREYLSFFCLGNRETKKGGEYEPSETPEPGSDYSRAQE  649

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVHAKMMIVDDEYII+GSANINQRSMDGARDSEIAMGAYQP HLS ++PARGQV
Sbjct  650  ARRFMIYVHAKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGAYQPFHLSVKEPARGQV  709

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFRMALWYEHLGMLDN F  PES EC+ KVNQ+A+  W+LYS E+L  D+P HLL+YPI
Sbjct  710  HGFRMALWYEHLGMLDNSFLYPESPECIRKVNQVADKYWDLYSSESLVHDLPGHLLTYPI  769

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
             VTENG+VTELPG Q FPDTKA VLGTKS+F
Sbjct  770  DVTENGEVTELPGTQYFPDTKARVLGTKSDF  800



>ref|XP_010250112.1| PREDICTED: phospholipase D alpha 1 [Nelumbo nucifera]
Length=815

 Score =   363 bits (931),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 163/211 (77%), Positives = 192/211 (91%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMYT+++QAL+AKG+ A+P+DYL+FFCLGNRE KK  EYEPSE+P+++TDYSRAQ+
Sbjct  598  RTMEMMYTNVIQALQAKGVEADPRDYLTFFCLGNREVKKSGEYEPSEQPEDNTDYSRAQQ  657

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVH KMMIVDDEYII+GSANINQRSMDGARDSEIAMGAYQP+HL+ RQPARGQ+
Sbjct  658  ARRFMIYVHTKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGAYQPYHLATRQPARGQI  717

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFRMALWYEHLGMLD+CF  PES+ CV KVNQIA+  W+LYS ETL+RD+P HLL YPI
Sbjct  718  HGFRMALWYEHLGMLDDCFLHPESVACVHKVNQIADKYWDLYSSETLDRDLPGHLLRYPI  777

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
             VTENG+VTELPG Q+FPDT+A VLGTK+ +
Sbjct  778  AVTENGEVTELPGTQHFPDTEALVLGTKAEY  808



>gb|KCW70693.1| hypothetical protein EUGRSUZ_F03862 [Eucalyptus grandis]
Length=773

 Score =   360 bits (923),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 161/211 (76%), Positives = 188/211 (89%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMY DI+QAL+AKGI  +P++YL+FFCLGNRE K+  EYEPSEKP+ D+DY RAQE
Sbjct  556  RTMEMMYKDIIQALQAKGIEEDPRNYLTFFCLGNREVKRSGEYEPSEKPEPDSDYLRAQE  615

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVHAKMMIVDDEYII+GSANINQRSMDGARDSEIAMGAYQ HHL+ R+PARGQ+
Sbjct  616  ARRFMIYVHAKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGAYQAHHLATREPARGQI  675

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFRMALWYEHLGMLD+ F QPE  EC+ +VNQIAE  W+LYS ETLERD+P HLL YP+
Sbjct  676  HGFRMALWYEHLGMLDDSFLQPEGEECIRRVNQIAEKYWDLYSSETLERDLPGHLLRYPV  735

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            GV  +G +TELPGF++FPDTKAP+LGTKS++
Sbjct  736  GVASDGVITELPGFEHFPDTKAPILGTKSDY  766



>ref|XP_010063458.1| PREDICTED: phospholipase D alpha 1 [Eucalyptus grandis]
Length=805

 Score =   360 bits (923),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 161/211 (76%), Positives = 188/211 (89%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMY DI+QAL+AKGI  +P++YL+FFCLGNRE K+  EYEPSEKP+ D+DY RAQE
Sbjct  588  RTMEMMYKDIIQALQAKGIEEDPRNYLTFFCLGNREVKRSGEYEPSEKPEPDSDYLRAQE  647

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVHAKMMIVDDEYII+GSANINQRSMDGARDSEIAMGAYQ HHL+ R+PARGQ+
Sbjct  648  ARRFMIYVHAKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGAYQAHHLATREPARGQI  707

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFRMALWYEHLGMLD+ F QPE  EC+ +VNQIAE  W+LYS ETLERD+P HLL YP+
Sbjct  708  HGFRMALWYEHLGMLDDSFLQPEGEECIRRVNQIAEKYWDLYSSETLERDLPGHLLRYPV  767

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            GV  +G +TELPGF++FPDTKAP+LGTKS++
Sbjct  768  GVASDGVITELPGFEHFPDTKAPILGTKSDY  798



>ref|XP_009381115.1| PREDICTED: phospholipase D alpha 1 [Musa acuminata subsp. malaccensis]
Length=812

 Score =   358 bits (919),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 164/211 (78%), Positives = 187/211 (89%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMYTDIVQAL+AKGI ANPKDYL+FFCLGNRE KK  EYEP E P  DTDYSRAQE
Sbjct  595  RTMEMMYTDIVQALQAKGIEANPKDYLTFFCLGNREVKKSGEYEPLEHPQPDTDYSRAQE  654

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVH KMMIVDDEYII+GSANINQRSMDG+RDSEIAMGAYQP+HLS R+PARGQ+
Sbjct  655  ARRFMIYVHTKMMIVDDEYIIIGSANINQRSMDGSRDSEIAMGAYQPYHLSTREPARGQI  714

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFR+ALWYEHLGMLD+ F  PES++CV KVN+IA+  W+LYS ETL+RD+P HLL+YPI
Sbjct  715  HGFRLALWYEHLGMLDDVFLHPESLQCVQKVNRIADKYWDLYSSETLDRDLPGHLLTYPI  774

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            GVT +G VTELPG + FPDT+A VLG KS++
Sbjct  775  GVTSDGMVTELPGMEFFPDTRARVLGAKSDY  805



>emb|CAH58644.1| phospholipase D [Plantago major]
Length=250

 Score =   339 bits (870),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 152/211 (72%), Positives = 181/211 (86%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMY D++QA +A+GI  +P+ YL+FFC+GNRE KK  EYEPS++P+ D+DY RAQ 
Sbjct  33   RTMEMMYKDVIQAFQARGIQDDPRKYLTFFCVGNREVKKSGEYEPSQQPEPDSDYGRAQA  92

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQP+HL+ARQPARG +
Sbjct  93   ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPYHLAARQPARGDI  152

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFRM+LWYEHLGMLD+ F +PES ECV KVN IA+  W+L++ E LERD+P HLL YP+
Sbjct  153  HGFRMSLWYEHLGMLDDSFVRPESEECVQKVNTIADRYWDLFAAEELERDLPGHLLRYPV  212

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
             V+  G +TELPG + FPDTKA VLGTKS+F
Sbjct  213  AVSSEGTITELPGQEFFPDTKARVLGTKSDF  243



>ref|XP_006367510.1| PREDICTED: phospholipase D alpha 1-like [Solanum tuberosum]
Length=807

 Score =   356 bits (914),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 163/211 (77%), Positives = 187/211 (89%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTMQMMYTDI+QALK KGI+ANPK+YLSFFCLGNRETKK  EYEPSE P+ ++ Y +AQE
Sbjct  590  RTMQMMYTDIIQALKVKGIMANPKEYLSFFCLGNRETKKRGEYEPSETPEPNSGYHKAQE  649

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVH+KMMIVDDEYII+GSANINQRSMDGARDSEIAMGAYQP HL  ++PARGQV
Sbjct  650  ARRFMIYVHSKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGAYQPFHLCVKEPARGQV  709

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFRMALWYEHLGMLDN F QPES+EC+ KVN+I +  W++YS   L  D+P HLL+YPI
Sbjct  710  HGFRMALWYEHLGMLDNRFLQPESVECIRKVNKIGDKYWDMYSSGNLIHDLPGHLLTYPI  769

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            G+TENG++TELPG + FPDTKAPVLGTKSN+
Sbjct  770  GITENGEITELPGVECFPDTKAPVLGTKSNY  800



>emb|CDP10414.1| unnamed protein product [Coffea canephora]
Length=807

 Score =   356 bits (913),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 163/211 (77%), Positives = 187/211 (89%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMY D+ QAL AKGI ANPKDYL+FFC+GNRETKK  EYEPSE P+ D+DYSRAQ+
Sbjct  590  RTMEMMYRDVAQALHAKGIEANPKDYLTFFCVGNRETKKRGEYEPSEHPEPDSDYSRAQQ  649

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVHAKMMIVDDEYII+GSANINQRSMDGARDSEIAMGAYQP+HLS RQPARGQ+
Sbjct  650  ARRFMIYVHAKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGAYQPYHLSIRQPARGQI  709

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFRMALWYEHLGMLDN F  PE++EC+ KVNQ+A+  W+LYS ETL  D+P HLL+YPI
Sbjct  710  HGFRMALWYEHLGMLDNRFLHPENVECIRKVNQMADKYWDLYSSETLGHDLPGHLLTYPI  769

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            GVT  G+VT+LPGF+ FPDTK  VLGTK+++
Sbjct  770  GVTAAGEVTQLPGFEYFPDTKGKVLGTKADY  800



>ref|XP_002517625.1| phopholipase d alpha, putative [Ricinus communis]
 gb|EEF44789.1| phopholipase d alpha, putative [Ricinus communis]
Length=808

 Score =   355 bits (910),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 165/211 (78%), Positives = 181/211 (86%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMY DIVQALKA GII +P++YL+FFCLGNRE KK  EYEP+EKP+ DTDY RAQE
Sbjct  591  RTMEMMYKDIVQALKANGIIEDPRNYLTFFCLGNREVKKSGEYEPAEKPEPDTDYIRAQE  650

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVH KMMIVDDEYII+GSANINQRSMDGARDSEIAMGAYQPHHLS RQPARGQ+
Sbjct  651  ARRFMIYVHTKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGAYQPHHLSTRQPARGQI  710

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFRM+LWYEHLGMLD  F  PES ECV KVNQ+AE  W+LYS ETLE D+P HLL YPI
Sbjct  711  HGFRMSLWYEHLGMLDESFLNPESEECVRKVNQMAEKYWDLYSSETLEHDLPGHLLRYPI  770

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            GV   G VTELPG + FPDTKA VLG KS++
Sbjct  771  GVASEGDVTELPGTEFFPDTKARVLGAKSDY  801



>gb|AAL16110.1|AF428278_1 AT3g15730/MSJ11_13 [Arabidopsis thaliana]
 gb|AAO23591.1| At3g15730/MSJ11_13 [Arabidopsis thaliana]
Length=523

 Score =   346 bits (888),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 154/211 (73%), Positives = 181/211 (86%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMY D++QAL+A+G+  +P++YL+FFCLGNRE KK  EYEP+EKPD DTDY RAQE
Sbjct  306  RTMEMMYKDVIQALRAQGLEEDPRNYLTFFCLGNREVKKDGEYEPAEKPDPDTDYMRAQE  365

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVH KMMIVDDEYII+GSANINQRSMDGARDSEIAMG YQPHHLS RQPARGQ+
Sbjct  366  ARRFMIYVHTKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGGYQPHHLSHRQPARGQI  425

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFRM+LWYEHLGMLD  F  P S+EC+ KVN+I++  W+ YS E+LE D+P HLL YPI
Sbjct  426  HGFRMSLWYEHLGMLDETFLDPSSLECIEKVNRISDKYWDFYSSESLEHDLPGHLLRYPI  485

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            GV   G +TELPGF+ FPDTKA +LGTKS++
Sbjct  486  GVASEGDITELPGFEFFPDTKARILGTKSDY  516



>gb|AAB37305.1| phospholipase D [Ricinus communis]
Length=808

 Score =   354 bits (909),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 165/211 (78%), Positives = 181/211 (86%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMY DIVQALKA GII +P++YL+FFCLGNRE KK  EYEP+EKP+ DTDY RAQE
Sbjct  591  RTMEMMYKDIVQALKANGIIEDPRNYLTFFCLGNREVKKSGEYEPAEKPEPDTDYIRAQE  650

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVH KMMIVDDEYII+GSANINQRSMDGARDSEIAMGAYQPHHLS RQPARGQ+
Sbjct  651  ARRFMIYVHTKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGAYQPHHLSTRQPARGQI  710

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFRM+LWYEHLGMLD  F  PES ECV KVNQ+AE  W+LYS ETLE D+P HLL YPI
Sbjct  711  HGFRMSLWYEHLGMLDESFLNPESEECVRKVNQMAEKYWDLYSSETLEHDLPGHLLRYPI  770

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            GV   G VTELPG + FPDTKA VLG KS++
Sbjct  771  GVASEGDVTELPGTEFFPDTKARVLGAKSDY  801



>sp|Q41142.1|PLDA1_RICCO RecName: Full=Phospholipase D alpha 1; Short=PLD 1; AltName: 
Full=Choline phosphatase 1; AltName: Full=Phosphatidylcholine-hydrolyzing 
phospholipase D 1; Flags: Precursor [Ricinus communis]
 gb|AAB04095.1| phospholipase D [Ricinus communis]
Length=808

 Score =   354 bits (909),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 165/211 (78%), Positives = 181/211 (86%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMY DIVQALKA GII +P++YL+FFCLGNRE KK  EYEP+EKP+ DTDY RAQE
Sbjct  591  RTMEMMYKDIVQALKANGIIEDPRNYLTFFCLGNREVKKSGEYEPAEKPEPDTDYIRAQE  650

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVH KMMIVDDEYII+GSANINQRSMDGARDSEIAMGAYQPHHLS RQPARGQ+
Sbjct  651  ARRFMIYVHTKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGAYQPHHLSTRQPARGQI  710

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFRM+LWYEHLGMLD  F  PES ECV KVNQ+AE  W+LYS ETLE D+P HLL YPI
Sbjct  711  HGFRMSLWYEHLGMLDESFLNPESEECVRKVNQMAEKYWDLYSSETLEHDLPGHLLRYPI  770

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            GV   G VTELPG + FPDTKA VLG KS++
Sbjct  771  GVASEGDVTELPGTEFFPDTKARVLGAKSDY  801



>dbj|BAJ88431.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=560

 Score =   347 bits (890),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 159/211 (75%), Positives = 186/211 (88%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMYTDI QAL+AKGI ANPK+YL+FFCLGNRE K+  EYEP E+P+ DT Y RAQE
Sbjct  343  RTMEMMYTDITQALEAKGIEANPKEYLTFFCLGNREVKQDGEYEPQEQPEPDTHYIRAQE  402

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVH KMMIVDDEYII+GSANINQRSMDGARDSEIAMGAYQP+HL+ R+PARGQ+
Sbjct  403  ARRFMIYVHTKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGAYQPYHLANREPARGQI  462

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFRMALWYEHLGMLD+ F +PES+ECV KVN+IA+  W+LYS + LE+D+P HLLSYPI
Sbjct  463  HGFRMALWYEHLGMLDDVFQRPESVECVQKVNRIADKYWDLYSSDDLEQDLPGHLLSYPI  522

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            GV  +G VTELPG + FPDT+A +LGTKS++
Sbjct  523  GVANDGVVTELPGMEFFPDTRARILGTKSDY  553



>ref|XP_010254401.1| PREDICTED: phospholipase D alpha 1-like [Nelumbo nucifera]
 ref|XP_010254402.1| PREDICTED: phospholipase D alpha 1-like [Nelumbo nucifera]
Length=802

 Score =   354 bits (908),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 159/211 (75%), Positives = 188/211 (89%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMY D++Q L AKGI A+P+DYL+FFCLGNRE KK  EY+PSE+P+ DTDYSRAQ+
Sbjct  585  RTMEMMYADVIQXLHAKGIEADPRDYLTFFCLGNREVKKSGEYQPSEEPEADTDYSRAQQ  644

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVH KMMIVDDEYII+GSANINQRSMDGARDSEIAMGA+QP+HL+ RQPARGQ+
Sbjct  645  ARRFMIYVHTKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGAFQPYHLATRQPARGQI  704

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFRMALWYEH+GMLDN F QPES+ECV KVN++A+  W LYS + LE+D+P HLL YPI
Sbjct  705  HGFRMALWYEHIGMLDNSFLQPESVECVHKVNRMADKYWELYSSDILEQDLPGHLLRYPI  764

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
             VTENG++TELPG ++FPDTKA VLGTKS++
Sbjct  765  AVTENGEITELPGTEHFPDTKARVLGTKSDY  795



>ref|NP_001267764.1| phospholipase D alpha 1-like [Setaria italica]
 gb|ADK60917.1| phospholipase D alpha 1 [Setaria italica]
Length=811

 Score =   353 bits (907),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 163/211 (77%), Positives = 185/211 (88%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMYTDI QAL+AK I ANPKDYL+FFCLGNRE K+  EYEP E+P+ DTDYSRAQE
Sbjct  594  RTMEMMYTDITQALRAKEIEANPKDYLTFFCLGNREVKQEGEYEPGEQPEPDTDYSRAQE  653

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVH KMMIVDDEYII+GSANINQRSMDGARDSEIAMGAYQP+HL+ RQPARGQ+
Sbjct  654  ARRFMIYVHTKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGAYQPYHLATRQPARGQI  713

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFRMALWYEHLGMLD+ F  PESMECV KVN+IAE  W+LYS + LE+D+P HLLSYP+
Sbjct  714  HGFRMALWYEHLGMLDDVFQHPESMECVQKVNKIAEKYWDLYSSDDLEQDLPGHLLSYPM  773

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            GV   G VTELPG + FPDT+A +LGTKS++
Sbjct  774  GVDSEGNVTELPGMEFFPDTRARILGTKSDY  804



>gb|AIR77173.1| phospholipase D, partial [Dendrobium hybrid cultivar]
Length=411

 Score =   342 bits (876),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 156/211 (74%), Positives = 182/211 (86%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMYTD+  AL+AKGI ANPKD L+FFCLGNRE +K  EY P E+P  DTDY RAQ+
Sbjct  194  RTMEMMYTDVTLALQAKGIEANPKDCLTFFCLGNREVQKSGEYTPEEQPQPDTDYYRAQQ  253

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVHAKM IVDDEYIIVGSANINQRSMDGARDSEIAMGAYQP +L  R+PARGQ+
Sbjct  254  ARRFMIYVHAKMKIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPTYLLDREPARGQI  313

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFRM+LWYEHLGMLD+ F  PES+ECV KVN+IAE  W++YS ETLERD+P HLLSYP+
Sbjct  314  HGFRMSLWYEHLGMLDDVFLHPESLECVQKVNRIAEKYWDIYSSETLERDLPGHLLSYPV  373

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            GVT  G++ ELPGF+ FPDTKA +LG+K+++
Sbjct  374  GVTNEGEINELPGFEFFPDTKARILGSKADY  404



>gb|ACG63795.1| phospholipase D alpha [Gossypium raimondii]
 gb|ACG70839.1| phospholipase D alpha [Gossypium raimondii]
 gb|ACV70145.1| phospholipase D [Gossypium raimondii]
 gb|ADD83101.1| PLDalpha [Gossypium hirsutum]
 gb|ADD83102.1| PLDalpha [Gossypium hirsutum]
 gb|ADD83103.1| PLDalpha isoform 1 [Gossypium hirsutum]
 gb|ADD83105.1| PLDalpha isoform 2 [Gossypium hirsutum]
 gb|KJB70610.1| hypothetical protein B456_011G083000 [Gossypium raimondii]
 gb|KJB70614.1| hypothetical protein B456_011G083000 [Gossypium raimondii]
Length=807

 Score =   353 bits (905),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 161/211 (76%), Positives = 185/211 (88%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM MMY D++QAL+AKG   NP++YL+FFCLGNRE KK  EYEPSE+PD DTDY+RAQE
Sbjct  590  RTMDMMYKDVIQALRAKGSDENPRNYLTFFCLGNREVKKSGEYEPSERPDPDTDYARAQE  649

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVHAKMMIVDDEYII+GSANINQRSMDGARDSEIAMGAYQP+HLS R+PARGQV
Sbjct  650  ARRFMIYVHAKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGAYQPYHLSLREPARGQV  709

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFR++LWYEHLGMLD+ F  PES ECV KVNQ+A+  W+LYS E+LERD+P HLL YPI
Sbjct  710  HGFRLSLWYEHLGMLDDTFLAPESEECVRKVNQVADKYWDLYSSESLERDLPGHLLRYPI  769

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            GV+ +G VTELPG + FPDTKA VLG KS++
Sbjct  770  GVSSDGSVTELPGIEFFPDTKARVLGAKSDY  800



>gb|KJB70612.1| hypothetical protein B456_011G083000 [Gossypium raimondii]
 gb|KJB70613.1| hypothetical protein B456_011G083000 [Gossypium raimondii]
 gb|KJB70615.1| hypothetical protein B456_011G083000 [Gossypium raimondii]
Length=795

 Score =   352 bits (904),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 161/211 (76%), Positives = 185/211 (88%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM MMY D++QAL+AKG   NP++YL+FFCLGNRE KK  EYEPSE+PD DTDY+RAQE
Sbjct  578  RTMDMMYKDVIQALRAKGSDENPRNYLTFFCLGNREVKKSGEYEPSERPDPDTDYARAQE  637

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVHAKMMIVDDEYII+GSANINQRSMDGARDSEIAMGAYQP+HLS R+PARGQV
Sbjct  638  ARRFMIYVHAKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGAYQPYHLSLREPARGQV  697

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFR++LWYEHLGMLD+ F  PES ECV KVNQ+A+  W+LYS E+LERD+P HLL YPI
Sbjct  698  HGFRLSLWYEHLGMLDDTFLAPESEECVRKVNQVADKYWDLYSSESLERDLPGHLLRYPI  757

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            GV+ +G VTELPG + FPDTKA VLG KS++
Sbjct  758  GVSSDGSVTELPGIEFFPDTKARVLGAKSDY  788



>ref|XP_007023174.1| Phospholipase D alpha 2 isoform 1 [Theobroma cacao]
 ref|XP_007023175.1| Phospholipase D alpha 2 isoform 1 [Theobroma cacao]
 gb|EOY25796.1| Phospholipase D alpha 2 isoform 1 [Theobroma cacao]
 gb|EOY25797.1| Phospholipase D alpha 2 isoform 1 [Theobroma cacao]
Length=809

 Score =   352 bits (904),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 163/211 (77%), Positives = 184/211 (87%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM MMY+DI+ AL+ KG   +P++YL+FFCLGNRE K G EYEPSEKP+ DTDY+RAQE
Sbjct  592  RTMDMMYSDIINALRDKGSEEDPRNYLTFFCLGNREVKNGGEYEPSEKPEPDTDYARAQE  651

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVHAKMMIVDDEYII+GSANINQRSMDGARDSEIAMGAYQP+HLS RQPARGQV
Sbjct  652  ARRFMIYVHAKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGAYQPYHLSVRQPARGQV  711

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFRMALWYEHLGMLD+ F  PES ECV KVNQIA+  W+LYS E+LERD+P HLL YPI
Sbjct  712  HGFRMALWYEHLGMLDDTFLFPESEECVRKVNQIADKYWDLYSSESLERDLPGHLLRYPI  771

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            G++  G VTELPGF+ FPDTKA VLG KS++
Sbjct  772  GISSEGTVTELPGFEFFPDTKARVLGAKSDY  802



>ref|NP_001146559.1| phospholipase D family protein [Zea mays]
 gb|ACN26583.1| unknown [Zea mays]
 gb|AFW80164.1| phospholipase D family protein [Zea mays]
Length=743

 Score =   350 bits (899),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 162/211 (77%), Positives = 185/211 (88%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM MMYTDI QAL+A GI ANPKDYL+FFCLGNRE K+  EY+P E P+  TDY RAQE
Sbjct  526  RTMDMMYTDITQALEANGIQANPKDYLTFFCLGNREVKQEGEYQPEEHPEPGTDYIRAQE  585

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVHAKMMIVDDEYII+GSANINQRSMDGARDSEIAMGAYQP+HL+ RQPARGQ+
Sbjct  586  ARRFMIYVHAKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGAYQPYHLATRQPARGQI  645

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFRM+LWYEHLGMLD+ F +PES+ECV KVN+IAE  W+LYS + LE+D+P HLLSYPI
Sbjct  646  HGFRMSLWYEHLGMLDDVFQRPESVECVQKVNKIAEKYWDLYSSDDLEQDLPGHLLSYPI  705

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            GVT +G VTELPG +NFPDT+A VLG KS++
Sbjct  706  GVTADGTVTELPGMENFPDTRARVLGNKSDY  736



>gb|KHG06123.1| Phospholipase D alpha 1 [Gossypium arboreum]
Length=807

 Score =   352 bits (902),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 161/211 (76%), Positives = 185/211 (88%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM MMY D++QAL+AKG   NP++YL+FFCLGNRE KK  EYEPSE+PD DTDY+RAQE
Sbjct  590  RTMDMMYKDVIQALRAKGSDENPRNYLTFFCLGNREVKKSGEYEPSERPDPDTDYARAQE  649

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVHAKMMIVDDEYII+GSANINQRSMDGARDSEIAMGAYQP+HLS R+PARGQV
Sbjct  650  ARRFMIYVHAKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGAYQPYHLSLREPARGQV  709

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFR++LWYEHLGMLD+ F  PES ECV KVNQ+A+  W+LYS E+LERD+P HLL YPI
Sbjct  710  HGFRLSLWYEHLGMLDDTFLAPESEECVRKVNQVADKYWDLYSSESLERDLPGHLLRYPI  769

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            GV+ +G VTELPG + FPDTKA VLG KS++
Sbjct  770  GVSSDGSVTELPGAEFFPDTKARVLGAKSDY  800



>gb|ACV70146.1| phospholipase D [Gossypium arboreum]
Length=807

 Score =   352 bits (902),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 161/211 (76%), Positives = 185/211 (88%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM MMY D++QAL+AKG   NP++YL+FFCLGNRE KK  EYEPSE+PD DTDY+RAQE
Sbjct  590  RTMDMMYKDVIQALRAKGSDENPRNYLTFFCLGNREVKKSGEYEPSERPDPDTDYARAQE  649

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVHAKMMIVDDEYII+GSANINQRSMDGARDSEIAMGAYQP+HLS R+PARGQV
Sbjct  650  ARRFMIYVHAKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGAYQPYHLSLREPARGQV  709

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFR++LWYEHLGMLD+ F  PES ECV KVNQ+A+  W+LYS E+LERD+P HLL YPI
Sbjct  710  HGFRLSLWYEHLGMLDDTFLAPESEECVRKVNQVADKYWDLYSSESLERDLPGHLLRYPI  769

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            GV+ +G VTELPG + FPDTKA VLG KS++
Sbjct  770  GVSSDGSVTELPGAEFFPDTKARVLGAKSDY  800



>dbj|BAA11136.1| phospholipase D [Oryza sativa Japonica Group]
 dbj|BAA19467.1| phospholipase D [Oryza sativa Japonica Group]
Length=812

 Score =   352 bits (902),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 159/211 (75%), Positives = 186/211 (88%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMYTDI +AL+AKGI ANPKDYL+FFCLGNRE K+  EY+P E+P+ DTDYSRAQE
Sbjct  595  RTMEMMYTDITEALQAKGIEANPKDYLTFFCLGNREVKQAGEYQPEEQPEADTDYSRAQE  654

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVH KMMIVDDEYII+GSANINQRSMDGARDSEIAMG YQP+HL+ RQPARGQ+
Sbjct  655  ARRFMIYVHTKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGGYQPYHLATRQPARGQI  714

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFRMALWYEHLGMLD+ F +PES+ECV KVN+IAE  W++YS + L++D+P HLLSYPI
Sbjct  715  HGFRMALWYEHLGMLDDVFQRPESLECVQKVNRIAEKYWDMYSSDDLQQDLPGHLLSYPI  774

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            GV  +G VTELPG + FPDT+A VLG KS++
Sbjct  775  GVASDGVVTELPGMEYFPDTRARVLGAKSDY  805



>ref|XP_010656428.1| PREDICTED: phospholipase D alpha 1-like [Vitis vinifera]
Length=814

 Score =   352 bits (902),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 158/211 (75%), Positives = 187/211 (89%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMY DI QAL +KG+ ANPKDYL+FFCLGNRE K+  EYEP E PD+DT+Y RAQ+
Sbjct  597  RTMEMMYNDIAQALHSKGLQANPKDYLAFFCLGNREKKRHGEYEPPESPDHDTNYHRAQQ  656

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            +RRFMIYVHAKMMIVDDEYII GSANINQRSMDGARDSEIAMGAYQP+HL+++QPARG +
Sbjct  657  SRRFMIYVHAKMMIVDDEYIITGSANINQRSMDGARDSEIAMGAYQPYHLASKQPARGHI  716

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFRMALWYEHLG+LDN F QPES++C+ KVNQ+AE NWNLY+ E ++ D+P HLLSYPI
Sbjct  717  HGFRMALWYEHLGLLDNSFLQPESLDCIQKVNQMAERNWNLYTSERMDHDLPGHLLSYPI  776

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
             VT++G+VTELPG + FPDTKAPVLG+KS +
Sbjct  777  CVTDSGEVTELPGSEFFPDTKAPVLGSKSEY  807



>gb|EEC70024.1| hypothetical protein OsI_00588 [Oryza sativa Indica Group]
Length=812

 Score =   352 bits (902),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 159/211 (75%), Positives = 186/211 (88%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMYTDI +AL+AKGI ANPKDYL+FFCLGNRE K+  EY+P E+P+ DTDYSRAQE
Sbjct  595  RTMEMMYTDITEALQAKGIEANPKDYLTFFCLGNREVKQAGEYQPEEQPEADTDYSRAQE  654

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVH KMMIVDDEYII+GSANINQRSMDGARDSEIAMG YQP+HL+ RQPARGQ+
Sbjct  655  ARRFMIYVHTKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGGYQPYHLATRQPARGQI  714

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFRMALWYEHLGMLD+ F +PES+ECV KVN+IAE  W++YS + L++D+P HLLSYPI
Sbjct  715  HGFRMALWYEHLGMLDDVFQRPESLECVQKVNRIAEKYWDMYSSDDLQQDLPGHLLSYPI  774

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            GV  +G VTELPG + FPDT+A VLG KS++
Sbjct  775  GVASDGVVTELPGMEYFPDTRARVLGAKSDY  805



>ref|NP_001042153.1| Os01g0172400 [Oryza sativa Japonica Group]
 sp|Q43007.2|PLDA1_ORYSJ RecName: Full=Phospholipase D alpha 1; Short=PLD alpha 1; AltName: 
Full=Choline phosphatase 1; AltName: Full=Phosphatidylcholine-hydrolyzing 
phospholipase D 1; Flags: Precursor [Oryza 
sativa Japonica Group]
 dbj|BAF04067.1| Os01g0172400 [Oryza sativa Japonica Group]
 gb|EEE53959.1| hypothetical protein OsJ_00559 [Oryza sativa Japonica Group]
Length=812

 Score =   352 bits (902),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 159/211 (75%), Positives = 186/211 (88%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMYTDI +AL+AKGI ANPKDYL+FFCLGNRE K+  EY+P E+P+ DTDYSRAQE
Sbjct  595  RTMEMMYTDITEALQAKGIEANPKDYLTFFCLGNREVKQAGEYQPEEQPEADTDYSRAQE  654

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVH KMMIVDDEYII+GSANINQRSMDGARDSEIAMG YQP+HL+ RQPARGQ+
Sbjct  655  ARRFMIYVHTKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGGYQPYHLATRQPARGQI  714

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFRMALWYEHLGMLD+ F +PES+ECV KVN+IAE  W++YS + L++D+P HLLSYPI
Sbjct  715  HGFRMALWYEHLGMLDDVFQRPESLECVQKVNRIAEKYWDMYSSDDLQQDLPGHLLSYPI  774

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            GV  +G VTELPG + FPDT+A VLG KS++
Sbjct  775  GVASDGVVTELPGMEYFPDTRARVLGAKSDY  805



>gb|ACG63794.1| phospholipase D alpha [Gossypium arboreum]
 gb|ACG70840.1| phospholipase D alpha [Gossypium arboreum]
 gb|ADD83098.1| PLDalpha isoform 2 [Gossypium hirsutum]
 gb|ADD83099.1| PLDalpha [Gossypium hirsutum]
 gb|ADD83100.1| PLDalpha [Gossypium hirsutum]
 gb|ADD83104.1| PLDalpha isoform 1 [Gossypium hirsutum]
Length=807

 Score =   352 bits (902),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 161/211 (76%), Positives = 185/211 (88%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM MMY D++QAL+AKG   NP++YL+FFCLGNRE KK  EYEPSE+PD DTDY+RAQE
Sbjct  590  RTMDMMYKDVIQALRAKGSDENPRNYLTFFCLGNREVKKSGEYEPSERPDPDTDYARAQE  649

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVHAKMMIVDDEYII+GSANINQRSMDGARDSEIAMGAYQP+HLS R+PARGQV
Sbjct  650  ARRFMIYVHAKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGAYQPYHLSLREPARGQV  709

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFR++LWYEHLGMLD+ F  PES ECV KVNQ+A+  W+LYS E+LERD+P HLL YPI
Sbjct  710  HGFRLSLWYEHLGMLDDTFLAPESEECVRKVNQVADKYWDLYSSESLERDLPGHLLRYPI  769

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            GV+ +G VTELPG + FPDTKA VLG KS++
Sbjct  770  GVSSDGSVTELPGAEFFPDTKARVLGAKSDY  800



>ref|XP_008654846.1| PREDICTED: phospholipase D family protein isoform X1 [Zea mays]
 ref|XP_008654847.1| PREDICTED: phospholipase D family protein isoform X1 [Zea mays]
 gb|AFW80165.1| phospholipase D family protein [Zea mays]
Length=812

 Score =   352 bits (902),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 162/211 (77%), Positives = 185/211 (88%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM MMYTDI QAL+A GI ANPKDYL+FFCLGNRE K+  EY+P E P+  TDY RAQE
Sbjct  595  RTMDMMYTDITQALEANGIQANPKDYLTFFCLGNREVKQEGEYQPEEHPEPGTDYIRAQE  654

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVHAKMMIVDDEYII+GSANINQRSMDGARDSEIAMGAYQP+HL+ RQPARGQ+
Sbjct  655  ARRFMIYVHAKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGAYQPYHLATRQPARGQI  714

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFRM+LWYEHLGMLD+ F +PES+ECV KVN+IAE  W+LYS + LE+D+P HLLSYPI
Sbjct  715  HGFRMSLWYEHLGMLDDVFQRPESVECVQKVNKIAEKYWDLYSSDDLEQDLPGHLLSYPI  774

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            GVT +G VTELPG +NFPDT+A VLG KS++
Sbjct  775  GVTADGTVTELPGMENFPDTRARVLGNKSDY  805



>ref|XP_010545768.1| PREDICTED: phospholipase D alpha 1 [Tarenaya hassleriana]
Length=810

 Score =   351 bits (901),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 160/211 (76%), Positives = 182/211 (86%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMYTDI+QAL++KG+  +P++YL+FFCLGNRE KK  EYEPSEKPD DTDY RAQE
Sbjct  593  RTMEMMYTDIIQALRSKGLEEDPRNYLTFFCLGNREVKKEGEYEPSEKPDPDTDYIRAQE  652

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVH KMMIVDDEYII+GSANINQRSMDGARDSEIAMG YQP+HLS RQPARGQ+
Sbjct  653  ARRFMIYVHTKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGGYQPYHLSTRQPARGQI  712

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFRM+LWYEHLGMLD  F  P SMECV KVN++A+  W+LYS E LE D+P HLL YPI
Sbjct  713  HGFRMSLWYEHLGMLDETFLDPSSMECVQKVNRVADKYWDLYSSEALEHDLPGHLLRYPI  772

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            GV+  G VTELPGF+ FPDTKA VLG KS++
Sbjct  773  GVSSEGNVTELPGFEFFPDTKARVLGAKSDY  803



>ref|XP_010487411.1| PREDICTED: phospholipase D alpha 1 isoform X1 [Camelina sativa]
Length=559

 Score =   343 bits (881),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 154/211 (73%), Positives = 181/211 (86%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMY D++QAL+A+G+  +P++YL+FFCLGNRE KK  EYEP+E+PD D+ Y RAQE
Sbjct  342  RTMEMMYKDVIQALRAQGLEEDPRNYLTFFCLGNREVKKEGEYEPAERPDPDSSYMRAQE  401

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVH KMMIVDDEY+IVGSANINQRSMDGARDSEIAMG YQPHHLS RQPARGQV
Sbjct  402  ARRFMIYVHTKMMIVDDEYVIVGSANINQRSMDGARDSEIAMGGYQPHHLSHRQPARGQV  461

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFRM+LWYEHLGMLD  F  P S+EC+ KVN+IA+  W+ YS E+LE D+P HLL YPI
Sbjct  462  HGFRMSLWYEHLGMLDETFLDPSSLECIEKVNRIADKYWDFYSSESLEHDLPGHLLRYPI  521

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            GV+  G VTELPGF+ FPDTKA +LGTKS++
Sbjct  522  GVSGEGDVTELPGFEFFPDTKARILGTKSDY  552



>gb|ABY50100.1| phospholipase D [Agropyron mongolicum]
Length=570

 Score =   343 bits (881),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 157/211 (74%), Positives = 184/211 (87%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMYTDI QAL+AKGI ANPK+YL+FFCLGNRE K+  EYEP E+P+ DTDY R QE
Sbjct  353  RTMEMMYTDITQALEAKGIEANPKEYLTFFCLGNREVKQDGEYEPQEQPEPDTDYVRFQE  412

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRF IYVH KMMIVDDEYII+GSANINQRSMDGARDSEIAMGAYQP+HL+ R+PARGQ+
Sbjct  413  ARRFRIYVHTKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGAYQPYHLANREPARGQI  472

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFRMALWYEHLGMLD+ F +PES+ECV KVN+IAE  W++YS + LE+D+P HLLSYPI
Sbjct  473  HGFRMALWYEHLGMLDDVFQRPESVECVQKVNRIAEKYWDIYSSDDLEQDLPGHLLSYPI  532

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            GV  +G VTELPG + FPDT+A +LG KS++
Sbjct  533  GVASDGVVTELPGMEFFPDTRARILGAKSDY  563



>ref|XP_007013459.1| Phospholipase D alpha 1 [Theobroma cacao]
 gb|EOY31078.1| Phospholipase D alpha 1 [Theobroma cacao]
Length=806

 Score =   350 bits (898),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 157/209 (75%), Positives = 188/209 (90%), Gaps = 0/209 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMYTD+VQAL+AKG+ ANPKDYL+FFCLGNRE     EYEPSE+P++DTDYSR+Q+
Sbjct  589  RTMEMMYTDVVQALQAKGLEANPKDYLTFFCLGNRERITSGEYEPSERPEHDTDYSRSQQ  648

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            +RRFMIYVHAKMMIVDDEYII+GSANINQRSMDGARD+EIAMGAYQP+HL+ R+PARGQ+
Sbjct  649  SRRFMIYVHAKMMIVDDEYIIIGSANINQRSMDGARDTEIAMGAYQPYHLATREPARGQI  708

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HG RMALWYEHLG LDNCF QPES+ECV KVNQ A++ W+LYS +T + ++P HLLSYPI
Sbjct  709  HGLRMALWYEHLGKLDNCFLQPESLECVRKVNQTADDYWDLYSCDTSDHELPGHLLSYPI  768

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKS  193
             VT NG+VTE+PG ++FPDTKA VLG+K+
Sbjct  769  RVTHNGEVTEIPGLEHFPDTKARVLGSKN  797



>ref|XP_006406921.1| hypothetical protein EUTSA_v10020083mg [Eutrema salsugineum]
 gb|ESQ48374.1| hypothetical protein EUTSA_v10020083mg [Eutrema salsugineum]
Length=652

 Score =   345 bits (886),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 153/211 (73%), Positives = 183/211 (87%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMY D++QAL+A+G+  +P++YL+FFCLGNRE KK  EYEP+E+PD D+DY RAQE
Sbjct  435  RTMEMMYKDVIQALRAQGLEEDPRNYLTFFCLGNREVKKEGEYEPAERPDPDSDYMRAQE  494

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVH+KMMIVDDEYII+GSANINQRSMDGARDSEIAMG YQPHHLS RQPARGQ+
Sbjct  495  ARRFMIYVHSKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGGYQPHHLSHRQPARGQI  554

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFRM+LWYEHLGMLD  F  P S+EC+ KVN+I++  W+LYS E+LE D+P HLL YPI
Sbjct  555  HGFRMSLWYEHLGMLDETFLDPSSLECIEKVNRISDKYWDLYSSESLEHDLPGHLLRYPI  614

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            GV   G +TELPGF+ FPDTKA +LGTKS++
Sbjct  615  GVASEGDITELPGFEFFPDTKARILGTKSDY  645



>ref|XP_011073436.1| PREDICTED: phospholipase D alpha 1 [Sesamum indicum]
 ref|XP_011073437.1| PREDICTED: phospholipase D alpha 1 [Sesamum indicum]
Length=808

 Score =   350 bits (897),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 157/211 (74%), Positives = 186/211 (88%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMY D+VQAL+AKGI  +P++YL+FFCLGNRE KK  EYEPSE+P+ D+DY +AQE
Sbjct  591  RTMEMMYKDVVQALRAKGIEEDPRNYLTFFCLGNREVKKSGEYEPSEQPEPDSDYQKAQE  650

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQP+HL+ RQPARGQ+
Sbjct  651  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPYHLATRQPARGQI  710

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFRMALWYEHLGMLDN F +PES ECV KVN+IA+  W+LY+ E LERD+P HLL YP+
Sbjct  711  HGFRMALWYEHLGMLDNTFIRPESEECVAKVNEIADRYWDLYASEELERDLPGHLLRYPV  770

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            G+   G++TELPG + FPDTKA +LG+KS++
Sbjct  771  GIASEGEITELPGTEFFPDTKARILGSKSDY  801



>gb|AGW22212.1| phospholipase D alpha [Chorispora bungeana]
Length=809

 Score =   349 bits (896),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 158/211 (75%), Positives = 182/211 (86%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMY DI+QALKA+G+  +P++YL+FFCLGNRE KK  EYEPSE+PD DTDY RAQE
Sbjct  592  RTMEMMYKDIIQALKAQGLEEDPRNYLTFFCLGNREVKKDGEYEPSERPDPDTDYMRAQE  651

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVH KMMIVDDEYII+GSANINQRSMDGARDSEIAMG YQPHHLS RQPARGQ+
Sbjct  652  ARRFMIYVHTKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGGYQPHHLSHRQPARGQI  711

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFRM+LWYEHLGMLD  F  P S+EC+ KVN+I++  W+LYS E+LE D+P HLL YPI
Sbjct  712  HGFRMSLWYEHLGMLDETFLDPPSLECIEKVNRISDKYWDLYSSESLENDLPGHLLRYPI  771

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            GV   G VTELPGF+ FPDTKA +LGTKS++
Sbjct  772  GVASEGDVTELPGFEFFPDTKARILGTKSDY  802



>gb|KDO48580.1| hypothetical protein CISIN_1g004579mg [Citrus sinensis]
Length=744

 Score =   347 bits (890),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 158/211 (75%), Positives = 185/211 (88%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM MMY D+VQAL+AKGI+ +P++YL+FFCLGNRE K+  EYEP+E+P++D+DY RAQE
Sbjct  527  RTMDMMYKDVVQALRAKGIMEDPRNYLTFFCLGNREVKRSGEYEPAERPEDDSDYLRAQE  586

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVHAKMMIVDDEYII+GSANINQRSM+GARD+EIAMG YQP+HLS R PARGQ+
Sbjct  587  ARRFMIYVHAKMMIVDDEYIIIGSANINQRSMEGARDTEIAMGGYQPYHLSTRVPARGQI  646

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFRM+LWYEHLGMLD+ F QPES ECV KVNQIAE  W+LYS E+LE D+P HLL YPI
Sbjct  647  HGFRMSLWYEHLGMLDDTFLQPESSECVKKVNQIAERYWDLYSSESLEHDLPGHLLRYPI  706

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            GV+  G VTELPG + FPDTKA VLGTKS++
Sbjct  707  GVSGEGDVTELPGTEFFPDTKARVLGTKSDY  737



>ref|XP_004303313.1| PREDICTED: phospholipase D alpha 1 [Fragaria vesca subsp. vesca]
Length=810

 Score =   348 bits (893),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 158/211 (75%), Positives = 181/211 (86%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMY DI +AL   G+  +P++YL+FFCLGNRE KK  EYEPSE P+ D+DY RAQE
Sbjct  593  RTMEMMYKDIKEALDKHGVEEDPRNYLTFFCLGNREVKKDGEYEPSEAPEADSDYIRAQE  652

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVH KMMIVDDEYII+GSANINQRSMDGARDSEIAMGAYQPHHLS R+PARGQ+
Sbjct  653  ARRFMIYVHTKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGAYQPHHLSVREPARGQI  712

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFRMALWYEHLGMLD  F QPES+EC+ KVNQIA+  W+LYS ETLE D+P HLL YP+
Sbjct  713  HGFRMALWYEHLGMLDETFLQPESVECIKKVNQIADKYWDLYSSETLEHDLPGHLLRYPV  772

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            GVT  G+VTELPGF+ FPDTKA VLG +S++
Sbjct  773  GVTSEGEVTELPGFEFFPDTKARVLGARSDY  803



>ref|XP_012073195.1| PREDICTED: phospholipase D alpha 1 [Jatropha curcas]
 gb|ADA72022.1| phospholipase D [Jatropha curcas]
 gb|KDP37092.1| hypothetical protein JCGZ_06148 [Jatropha curcas]
Length=808

 Score =   348 bits (893),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 159/211 (75%), Positives = 184/211 (87%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RT++MMY DIVQAL+AKGI  +P++YL+FFC+GNRE K+  EYEPSEKP++DTDY RAQ 
Sbjct  591  RTVEMMYKDIVQALRAKGIEEDPRNYLTFFCIGNREVKRSGEYEPSEKPESDTDYERAQS  650

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVH+KMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQP+HLS RQPARG++
Sbjct  651  ARRFMIYVHSKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPYHLSTRQPARGEI  710

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFRMALWYEHLGMLD+ F  PE+ +CV KVNQ+AE  W+LYS ETLE D+P HLL YPI
Sbjct  711  HGFRMALWYEHLGMLDDSFLNPENEQCVRKVNQVAEKYWDLYSSETLEHDLPGHLLRYPI  770

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            G+T  G VTELPG + FPDTKA VLG KS++
Sbjct  771  GITSEGDVTELPGTEFFPDTKARVLGAKSDY  801



>ref|XP_010097235.1| Phospholipase D alpha 1 [Morus notabilis]
 gb|EXB67302.1| Phospholipase D alpha 1 [Morus notabilis]
Length=808

 Score =   348 bits (893),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 160/211 (76%), Positives = 182/211 (86%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMY DI+QALKA+GI+ +P++YL+FFCLGNRE KK  EYEPSEKPD DTDY RAQ 
Sbjct  591  RTMEMMYKDIIQALKARGIVEDPRNYLTFFCLGNREVKKPGEYEPSEKPDEDTDYIRAQA  650

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVH KMMIVDDEYII+GSANINQRSM+GARD+EIAMGAYQP HLS R+ ARGQV
Sbjct  651  ARRFMIYVHTKMMIVDDEYIIIGSANINQRSMEGARDTEIAMGAYQPCHLSTRESARGQV  710

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFR+ALWYEHLGMLD  F +PES ECV KVN+IA+  W+LYS ETLE D+P HLL YPI
Sbjct  711  HGFRLALWYEHLGMLDESFLEPESKECVQKVNRIADKYWDLYSNETLEHDLPGHLLRYPI  770

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            GV   G +TELPGF+ FPDTKA VLGTKS++
Sbjct  771  GVASEGDITELPGFEFFPDTKARVLGTKSDY  801



>emb|CAN76339.1| hypothetical protein VITISV_014670 [Vitis vinifera]
Length=801

 Score =   348 bits (892),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 157/211 (74%), Positives = 185/211 (88%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMY DI QAL +KG+ ANPKDYL+FFCLGNRE K+  EYEP E PD+DT+Y RAQ+
Sbjct  584  RTMEMMYNDIAQALHSKGLQANPKDYLAFFCLGNREKKRHGEYEPPESPDHDTNYHRAQQ  643

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            +RRFMIYVHAKMMIVDDEYII GSANINQRSMDGARDSEIAMGAYQP+HL+++QPARG +
Sbjct  644  SRRFMIYVHAKMMIVDDEYIITGSANINQRSMDGARDSEIAMGAYQPYHLASKQPARGHI  703

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFR ALWYEHLG+LDN F QPES +C+ KVNQ+AE NWNLY+ E ++ D+P HLLSYPI
Sbjct  704  HGFRXALWYEHLGLLDNSFLQPESXDCIQKVNQMAERNWNLYTSERMDHDLPGHLLSYPI  763

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
             VT++G+VTELPG + FPDTKAPVLG+KS +
Sbjct  764  CVTDSGEVTELPGSEFFPDTKAPVLGSKSEY  794



>ref|XP_009799916.1| PREDICTED: phospholipase D alpha 1 [Nicotiana sylvestris]
 ref|XP_009799917.1| PREDICTED: phospholipase D alpha 1 [Nicotiana sylvestris]
Length=808

 Score =   348 bits (892),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 160/211 (76%), Positives = 182/211 (86%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMY  IVQAL AKGI  +P++YL+FFC+GNRE KK  EYEPSE P+ D+DY RAQE
Sbjct  591  RTMEMMYKHIVQALNAKGIEEDPRNYLTFFCIGNREVKKSGEYEPSETPEPDSDYMRAQE  650

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVH+KMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHL+ R+PARGQ+
Sbjct  651  ARRFMIYVHSKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLATREPARGQI  710

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFRMALWYEHLGMLD  F  PES ECV KVN++A+  W+LYS E+LERD+P HLL YPI
Sbjct  711  HGFRMALWYEHLGMLDETFLHPESEECVTKVNRMADKYWDLYSSESLERDLPGHLLRYPI  770

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            GV   G VTELPG ++FPDTKA VLGTKS++
Sbjct  771  GVASEGDVTELPGTEHFPDTKARVLGTKSDY  801



>gb|ADP23922.1| phospholipase D alpha [Litchi chinensis]
Length=800

 Score =   348 bits (892),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 159/211 (75%), Positives = 182/211 (86%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM MMY D+VQAL+AKG   +P++YL+FFCLGNRE K   EYEPSE P+ D+DY RAQE
Sbjct  583  RTMDMMYKDVVQALRAKGSTEDPRNYLTFFCLGNREVKMSGEYEPSETPEPDSDYIRAQE  642

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVH KMMIVDDEYII+GSANINQRSMDGARDSEIAMG YQP+HLS RQPARGQ+
Sbjct  643  ARRFMIYVHTKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGGYQPYHLSTRQPARGQI  702

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFRMALWYEHLGML+  F QP+S+ECV KVNQIA+  W+LYS E+LERD+P HLL YPI
Sbjct  703  HGFRMALWYEHLGMLNETFLQPDSLECVQKVNQIADKYWDLYSSESLERDLPGHLLRYPI  762

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            G++ +G VTELPG Q FPDTKA VLGTKS++
Sbjct  763  GISSDGDVTELPGAQFFPDTKARVLGTKSDY  793



>gb|AAL48262.2|AF451980_1 phospholipase D2 [Papaver somniferum]
 gb|AAL48264.2|AF451982_1 phospholipase D2 [Papaver somniferum]
Length=813

 Score =   348 bits (892),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 160/211 (76%), Positives = 180/211 (85%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RT  MMY DI QALKAKGI+A+P+DYL+FFCLGNRE KK  EY PSE PD DTDYSRAQE
Sbjct  596  RTWDMMYADITQALKAKGIVADPRDYLTFFCLGNREVKKEGEYVPSETPDPDTDYSRAQE  655

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVH KMMIVDDEYII+GSANIN+RSM+GARDSEIAMG YQPHHL+ R+PA GQ+
Sbjct  656  ARRFMIYVHTKMMIVDDEYIIIGSANINERSMNGARDSEIAMGGYQPHHLAHREPATGQI  715

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFRMALWYEHLGMLD  F  P S ECV KVN+IA+  W+LYS ++LERD+P HLL YPI
Sbjct  716  HGFRMALWYEHLGMLDEVFLHPNSEECVQKVNRIADKYWDLYSSDSLERDLPGHLLRYPI  775

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            G+TENG VTELPG + FPDTKA VLG KS++
Sbjct  776  GITENGDVTELPGHEFFPDTKARVLGAKSDY  806



>ref|XP_003543677.1| PREDICTED: phospholipase D alpha 1-like isoform X1 [Glycine max]
 ref|XP_006595164.1| PREDICTED: phospholipase D alpha 1-like isoform X2 [Glycine max]
 gb|KHN44174.1| Phospholipase D alpha 1 [Glycine soja]
Length=807

 Score =   347 bits (891),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 159/211 (75%), Positives = 182/211 (86%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM MMY D+VQAL+AKGI+ NP++YL+FFCLGNRE KK  EYEP E+PD DTDY RAQE
Sbjct  590  RTMDMMYKDVVQALRAKGIVENPRNYLTFFCLGNREVKKQGEYEPPERPDPDTDYIRAQE  649

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQP HL+ARQPARGQ+
Sbjct  650  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPFHLAARQPARGQI  709

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFRM+LWYEHLG+L + F  PE+ EC+ KVNQIA+  W++YS E+LE D+P HLL YPI
Sbjct  710  HGFRMSLWYEHLGLLHDSFLHPENEECIKKVNQIADKYWDIYSSESLEHDLPGHLLRYPI  769

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            GV+  G VTELPGF+ FPDTKA VLG K ++
Sbjct  770  GVSNEGVVTELPGFEFFPDTKARVLGDKVDY  800



>ref|XP_006427267.1| hypothetical protein CICLE_v10024917mg [Citrus clementina]
 gb|ESR40507.1| hypothetical protein CICLE_v10024917mg [Citrus clementina]
Length=802

 Score =   347 bits (891),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 158/211 (75%), Positives = 185/211 (88%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM MMY D+VQAL+AKGI+ +P++YL+FFCLGNRE K+  EYEP+E+P++D+DY RAQE
Sbjct  585  RTMDMMYKDVVQALRAKGIMEDPRNYLTFFCLGNREVKRSGEYEPAERPEDDSDYLRAQE  644

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVHAKMMIVDDEYII+GSANINQRSM+GARD+EIAMG YQP+HLS R PARGQ+
Sbjct  645  ARRFMIYVHAKMMIVDDEYIIIGSANINQRSMEGARDTEIAMGGYQPYHLSTRVPARGQI  704

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFRM+LWYEHLGMLD+ F QPES ECV KVNQIAE  W+LYS E+LE D+P HLL YPI
Sbjct  705  HGFRMSLWYEHLGMLDDTFLQPESSECVKKVNQIAERYWDLYSSESLEHDLPGHLLRYPI  764

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            GV+  G VTELPG + FPDTKA VLGTKS++
Sbjct  765  GVSGEGDVTELPGTEFFPDTKARVLGTKSDY  795



>ref|XP_009625689.1| PREDICTED: phospholipase D alpha 1 [Nicotiana tomentosiformis]
 ref|XP_009625690.1| PREDICTED: phospholipase D alpha 1 [Nicotiana tomentosiformis]
 ref|XP_009625691.1| PREDICTED: phospholipase D alpha 1 [Nicotiana tomentosiformis]
 ref|XP_009625692.1| PREDICTED: phospholipase D alpha 1 [Nicotiana tomentosiformis]
Length=808

 Score =   347 bits (891),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 160/211 (76%), Positives = 182/211 (86%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMY  IVQAL AKGI  +P++YL+FFC+GNRE KK  EYEPSE P+ D+DY RAQE
Sbjct  591  RTMEMMYKHIVQALNAKGIEEDPRNYLTFFCIGNREVKKSGEYEPSETPEPDSDYIRAQE  650

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVH+KMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHL+ R+PARGQ+
Sbjct  651  ARRFMIYVHSKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLATREPARGQI  710

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFRMALWYEHLGMLD  F  PES ECV KVN++A+  W+LYS E+LERD+P HLL YPI
Sbjct  711  HGFRMALWYEHLGMLDETFLHPESEECVSKVNRMADKYWDLYSSESLERDLPGHLLRYPI  770

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            GV   G VTELPG ++FPDTKA VLGTKS++
Sbjct  771  GVASEGDVTELPGAEHFPDTKARVLGTKSDY  801



>ref|XP_003569355.1| PREDICTED: phospholipase D alpha 1 [Brachypodium distachyon]
Length=811

 Score =   347 bits (891),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 159/211 (75%), Positives = 185/211 (88%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM MMYTDIVQAL+AKGI ANPK+YL+FFCLGNRE K+  EYEP E+P+ DTDY RAQE
Sbjct  594  RTMDMMYTDIVQALQAKGIEANPKEYLTFFCLGNREVKQDGEYEPQEQPEPDTDYVRAQE  653

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVH KM+IVDDEYII+GSANINQRSMDGARDSEIAMGAYQP+HL+ RQPARGQ+
Sbjct  654  ARRFMIYVHTKMIIVDDEYIIIGSANINQRSMDGARDSEIAMGAYQPYHLATRQPARGQI  713

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFRMALWYEHLGMLD+ F  PES ECV KVN+IA+  W++YS + L++D+P HLLSYPI
Sbjct  714  HGFRMALWYEHLGMLDDVFQHPESPECVQKVNKIADKYWDIYSSDDLQQDLPGHLLSYPI  773

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            GV+ +G VTELPG + FPDT+A VLG KS++
Sbjct  774  GVSSDGVVTELPGMEFFPDTRARVLGAKSDY  804



>gb|EMT03624.1| Phospholipase D alpha 1 [Aegilops tauschii]
Length=812

 Score =   347 bits (891),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 158/211 (75%), Positives = 187/211 (89%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMYTDI QAL+AKGI ANPK+YL+FFCLGNRE K+  EYEP E+P+ DTDY RAQE
Sbjct  595  RTMEMMYTDITQALEAKGIEANPKEYLTFFCLGNREVKQDGEYEPQEQPEPDTDYVRAQE  654

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVH KMMIVDDEYII+GSANINQRSMDGARDSEIAMGAYQP+HL+ R+PARGQ+
Sbjct  655  ARRFMIYVHTKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGAYQPYHLANREPARGQI  714

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFRMALWYEHLGMLD+ F +PES++CV KVN+IA+  W++YS + LE+D+P HLLSYPI
Sbjct  715  HGFRMALWYEHLGMLDDVFQRPESVDCVQKVNRIADKYWDMYSSDDLEQDLPGHLLSYPI  774

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            GV  +G VTELPG + FPDT+A +LGTKS++
Sbjct  775  GVASDGVVTELPGMEFFPDTRARILGTKSDY  805



>ref|XP_010907269.1| PREDICTED: phospholipase D alpha 1 [Elaeis guineensis]
 ref|XP_010907270.1| PREDICTED: phospholipase D alpha 1 [Elaeis guineensis]
Length=813

 Score =   347 bits (891),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 159/211 (75%), Positives = 186/211 (88%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMYTDI+ AL+AKGI ANPKDYL+FFCLGNRE KKG EYEP E+P+ DTDYSRAQ+
Sbjct  596  RTMEMMYTDIILALQAKGIEANPKDYLTFFCLGNREVKKGGEYEPEEQPEADTDYSRAQQ  655

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVH KMMIVDDEYII+GSANINQRSMDGARDSEIAMGAYQP +LS R  ARG++
Sbjct  656  ARRFMIYVHTKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGAYQPFYLSTRGLARGRI  715

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFRMALWYEHLGMLD+ F  PES+ECV KVN+IA+  W+LYS + L+RD+P HLLSYPI
Sbjct  716  HGFRMALWYEHLGMLDDAFLHPESVECVQKVNRIADKYWDLYSSDNLDRDLPGHLLSYPI  775

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            GV+ +G +TELPG + FPDT+A VLGTK+++
Sbjct  776  GVSSDGVITELPGMEFFPDTRARVLGTKADY  806



>emb|CDM81985.1| unnamed protein product [Triticum aestivum]
Length=812

 Score =   347 bits (891),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 158/211 (75%), Positives = 186/211 (88%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMYTDI QAL+AKGI ANPK+YL+FFCLGNRE K+  EYEP E+P+ DTDY RAQE
Sbjct  595  RTMEMMYTDITQALEAKGIEANPKEYLTFFCLGNREVKQDGEYEPQEQPEPDTDYVRAQE  654

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVH KMMIVDDEYII+GSANINQRSMDGARDSEIAMGAYQP+HL+ R+PARGQ+
Sbjct  655  ARRFMIYVHTKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGAYQPYHLANREPARGQI  714

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFRMALWYEHLGMLD+ F +PES+ECV KVN+IA+  W++YS + LE+D+P HLLSYPI
Sbjct  715  HGFRMALWYEHLGMLDDVFQRPESVECVQKVNRIADKYWDIYSSDDLEQDLPGHLLSYPI  774

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            GV  +G VTELPG + FPDT+A +LG KS++
Sbjct  775  GVASDGVVTELPGMEFFPDTRARILGAKSDY  805



>sp|O04883.1|PLDA1_PIMBR RecName: Full=Phospholipase D alpha 1; Short=PLD alpha 1; AltName: 
Full=Choline phosphatase 1; AltName: Full=Phosphatidylcholine-hydrolyzing 
phospholipase D 1 [Spuriopimpinella brachycarpa]
 gb|AAB70463.1| phospholipase D [Spuriopimpinella brachycarpa]
Length=808

 Score =   347 bits (890),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 158/211 (75%), Positives = 182/211 (86%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMY DI+QAL+A GI  +P++YL+FFCLGNRE K+  EYEPSEKPD DTDYSRAQE
Sbjct  591  RTMEMMYKDIIQALQANGIEEDPRNYLTFFCLGNREVKRDGEYEPSEKPDPDTDYSRAQE  650

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            +RRFMIYVHAKMMIVDDEYII+GSANINQRSMDGA+DSEIAMGAYQPHHL+ R+PARGQ+
Sbjct  651  SRRFMIYVHAKMMIVDDEYIIIGSANINQRSMDGAKDSEIAMGAYQPHHLATREPARGQI  710

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFRM+LWYEHLGMLD+  A PES++CV KVN +A+  W+LYS ETLE D+P HLL YPI
Sbjct  711  HGFRMSLWYEHLGMLDDTLALPESVDCVQKVNTVADKYWDLYSSETLENDLPGHLLRYPI  770

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
             V   G VTELPG + FPDTKA VLG KS+F
Sbjct  771  AVASEGNVTELPGTEFFPDTKARVLGAKSDF  801



>gb|ABX83202.2| phospholipase D [Lolium temulentum]
Length=811

 Score =   347 bits (890),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 158/211 (75%), Positives = 183/211 (87%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMYTDI QAL+AKGI ANPKDYL+FFCLGNRE K+  EYEP E+P+ DTDY RA E
Sbjct  594  RTMEMMYTDITQALQAKGIEANPKDYLTFFCLGNREVKQEGEYEPQEQPEPDTDYIRAHE  653

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVH KMMIVDDEYII+GSANINQRSMDGARDSEIAMGA+QP+HL+ RQPARGQ+
Sbjct  654  ARRFMIYVHTKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGAFQPYHLATRQPARGQI  713

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFRMALWYEHLGMLD+ F  PES EC+ KVN+IAE  W++YS + LE+D+P HLLSYPI
Sbjct  714  HGFRMALWYEHLGMLDDLFQHPESPECIQKVNKIAEKYWDIYSSDDLEQDLPGHLLSYPI  773

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            GV  +G VTELPG + FPDT+A +LG KS++
Sbjct  774  GVASDGLVTELPGMEFFPDTRARILGAKSDY  804



>ref|XP_003531710.1| PREDICTED: phospholipase D alpha 1-like isoform X1 [Glycine max]
 ref|XP_006585630.1| PREDICTED: phospholipase D alpha 1-like isoform X2 [Glycine max]
Length=809

 Score =   347 bits (890),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 158/211 (75%), Positives = 183/211 (87%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMY DI+QAL+AKGI  +P++YL+FFCLGNRE KK  EYEPSE+PD D+DY RAQE
Sbjct  592  RTMEMMYKDIIQALRAKGIDEDPRNYLTFFCLGNREVKKPGEYEPSEQPDPDSDYQRAQE  651

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVH KMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQP+HL+ RQPARGQ+
Sbjct  652  ARRFMIYVHTKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPYHLATRQPARGQI  711

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFRM+LWYEHLGML + F QPES EC+ KVNQ+A+  W+LYS E+LE D+P HLL YPI
Sbjct  712  HGFRMSLWYEHLGMLHDSFLQPESDECINKVNQVADKYWDLYSNESLEHDLPGHLLRYPI  771

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            GV   G VTELPGF+ FPDTKA +LG K+++
Sbjct  772  GVASEGDVTELPGFEFFPDTKARILGGKADY  802



>gb|KHN47766.1| Phospholipase D alpha 1 [Glycine soja]
Length=809

 Score =   347 bits (890),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 158/211 (75%), Positives = 183/211 (87%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMY DI+QAL+AKGI  +P++YL+FFCLGNRE KK  EYEPSE+PD D+DY RAQE
Sbjct  592  RTMEMMYKDIIQALRAKGIDEDPRNYLTFFCLGNREVKKPGEYEPSEQPDPDSDYQRAQE  651

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVH KMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQP+HL+ RQPARGQ+
Sbjct  652  ARRFMIYVHTKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPYHLATRQPARGQI  711

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFRM+LWYEHLGML + F QPES EC+ KVNQ+A+  W+LYS E+LE D+P HLL YPI
Sbjct  712  HGFRMSLWYEHLGMLHDSFLQPESDECINKVNQVADKYWDLYSNESLEHDLPGHLLRYPI  771

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            GV   G VTELPGF+ FPDTKA +LG K+++
Sbjct  772  GVASEGDVTELPGFEFFPDTKARILGGKADY  802



>ref|XP_003528334.1| PREDICTED: phospholipase D alpha 1-like isoform X1 [Glycine max]
 ref|XP_006583126.1| PREDICTED: phospholipase D alpha 1-like isoform X2 [Glycine max]
Length=809

 Score =   347 bits (889),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 157/211 (74%), Positives = 183/211 (87%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMY DI+QAL+AKGI  +P++YL+FFCLGNRE KK  EYEPSE+PD D+DY RAQE
Sbjct  592  RTMEMMYRDIIQALRAKGIEEDPRNYLTFFCLGNREVKKPGEYEPSEQPDPDSDYQRAQE  651

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVH KMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQP+HL+ RQPARGQ+
Sbjct  652  ARRFMIYVHTKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPYHLATRQPARGQI  711

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFRM+LWYEHLGML + F QPES EC+ KVNQ+A+  W+LYS E+LE D+P HLL YPI
Sbjct  712  HGFRMSLWYEHLGMLHDSFLQPESEECINKVNQVADKYWDLYSSESLEHDLPGHLLRYPI  771

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            G+   G VTELPGF+ FPDTKA +LG K+++
Sbjct  772  GIASEGDVTELPGFEFFPDTKARILGGKADY  802



>gb|KHN01336.1| Phospholipase D alpha 1 [Glycine soja]
Length=809

 Score =   347 bits (889),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 157/211 (74%), Positives = 183/211 (87%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMY DI+QAL+AKGI  +P++YL+FFCLGNRE KK  EYEPSE+PD D+DY RAQE
Sbjct  592  RTMEMMYRDIIQALRAKGIEEDPRNYLTFFCLGNREVKKPGEYEPSEQPDPDSDYQRAQE  651

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVH KMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQP+HL+ RQPARGQ+
Sbjct  652  ARRFMIYVHTKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPYHLATRQPARGQI  711

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFRM+LWYEHLGML + F QPES EC+ KVNQ+A+  W+LYS E+LE D+P HLL YPI
Sbjct  712  HGFRMSLWYEHLGMLHDSFLQPESEECINKVNQVADKYWDLYSSESLEHDLPGHLLRYPI  771

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            G+   G VTELPGF+ FPDTKA +LG K+++
Sbjct  772  GIASEGDVTELPGFEFFPDTKARILGGKADY  802



>ref|XP_008360327.1| PREDICTED: LOW QUALITY PROTEIN: phospholipase D alpha 1-like 
[Malus domestica]
Length=810

 Score =   347 bits (889),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 159/211 (75%), Positives = 180/211 (85%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM MMY+DI  AL A+G+  +P+ YL+FFCLGNRE KK  EYEPSE P+ D+DY RAQE
Sbjct  593  RTMNMMYSDIKSALDAQGLEEDPRSYLTFFCLGNREAKKLGEYEPSETPEADSDYQRAQE  652

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVH KMMIVDDEYII+GSANINQRSMDGARDSEIAMGAYQP+HLS R+PARGQ+
Sbjct  653  ARRFMIYVHTKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGAYQPYHLSVREPARGQI  712

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFRMALWYEHLGMLD  F QPES+EC+ KVNQIA+  W+LYS ETLE D+P HLL YPI
Sbjct  713  HGFRMALWYEHLGMLDEVFLQPESIECISKVNQIADKYWDLYSSETLEHDLPGHLLRYPI  772

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            GVT  G VTELPGF+ FPDTKA +LG KS++
Sbjct  773  GVTSEGAVTELPGFEFFPDTKARILGAKSDY  803



>gb|AAW83125.1| phospholipase D alpha [Fragaria x ananassa]
Length=810

 Score =   347 bits (889),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 159/211 (75%), Positives = 180/211 (85%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMY DI QAL   G+  +P++YL+FFCLGNRE KK  EYEPSE P+ D+DY RAQE
Sbjct  593  RTMEMMYKDIKQALDKHGVEEDPRNYLTFFCLGNREVKKDGEYEPSEAPEADSDYIRAQE  652

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVH KMMIVDDEYII+GSANINQRSMDGARDSEIAMGAYQPHHLS R+PARGQ+
Sbjct  653  ARRFMIYVHTKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGAYQPHHLSVREPARGQI  712

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFRMALWYE LGMLD  F QPES+EC+ KVNQIA+  W+LYS ETLE D+P HLL YP+
Sbjct  713  HGFRMALWYEPLGMLDETFLQPESVECIKKVNQIADKYWDLYSSETLEHDLPGHLLRYPV  772

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            GVT  G+VTELPGF+ FPDTKA VLG KS++
Sbjct  773  GVTSEGEVTELPGFEFFPDTKARVLGAKSDY  803



>ref|NP_188194.1| phospholipase D alpha 1 [Arabidopsis thaliana]
 sp|Q38882.2|PLDA1_ARATH RecName: Full=Phospholipase D alpha 1; Short=AtPLDalpha1; Short=PLD 
alpha 1; AltName: Full=Choline phosphatase 1; AltName: 
Full=PLDalpha; AltName: Full=Phosphatidylcholine-hydrolyzing 
phospholipase D 1 [Arabidopsis thaliana]
 dbj|BAB02304.1| phospholipase D [Arabidopsis thaliana]
 dbj|BAE98964.1| phospholipase D [Arabidopsis thaliana]
 gb|AEE75720.1| phospholipase D alpha 1 [Arabidopsis thaliana]
Length=810

 Score =   346 bits (888),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 154/211 (73%), Positives = 181/211 (86%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMY D++QAL+A+G+  +P++YL+FFCLGNRE KK  EYEP+EKPD DTDY RAQE
Sbjct  593  RTMEMMYKDVIQALRAQGLEEDPRNYLTFFCLGNREVKKDGEYEPAEKPDPDTDYMRAQE  652

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVH KMMIVDDEYII+GSANINQRSMDGARDSEIAMG YQPHHLS RQPARGQ+
Sbjct  653  ARRFMIYVHTKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGGYQPHHLSHRQPARGQI  712

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFRM+LWYEHLGMLD  F  P S+EC+ KVN+I++  W+ YS E+LE D+P HLL YPI
Sbjct  713  HGFRMSLWYEHLGMLDETFLDPSSLECIEKVNRISDKYWDFYSSESLEHDLPGHLLRYPI  772

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            GV   G +TELPGF+ FPDTKA +LGTKS++
Sbjct  773  GVASEGDITELPGFEFFPDTKARILGTKSDY  803



>ref|XP_002882959.1| PLDALPHA1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59218.1| PLDALPHA1 [Arabidopsis lyrata subsp. lyrata]
Length=810

 Score =   346 bits (888),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 154/211 (73%), Positives = 181/211 (86%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMY D++QAL+A+G+  +P++YL+FFCLGNRE KK  EYEP+EKPD DTDY RAQE
Sbjct  593  RTMEMMYKDVIQALRAQGLEEDPRNYLTFFCLGNREVKKDGEYEPAEKPDPDTDYMRAQE  652

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVH KMMIVDDEYII+GSANINQRSMDGARDSEIAMG YQPHHLS RQPARGQ+
Sbjct  653  ARRFMIYVHTKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGGYQPHHLSHRQPARGQI  712

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFRM+LWYEHLGMLD  F  P S+EC+ KVN+I++  W+ YS E+LE D+P HLL YPI
Sbjct  713  HGFRMSLWYEHLGMLDETFLDPSSLECIEKVNRISDKYWDFYSSESLEHDLPGHLLRYPI  772

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            GV   G +TELPGF+ FPDTKA +LGTKS++
Sbjct  773  GVASEGDITELPGFEFFPDTKARILGTKSDY  803



>ref|XP_006643814.1| PREDICTED: phospholipase D alpha 1-like [Oryza brachyantha]
Length=812

 Score =   346 bits (888),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 154/211 (73%), Positives = 186/211 (88%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMYTDI++AL+AKGI ANPKDYL+FFCLGNRE K+  EY+P E+P+ D+DY RAQE
Sbjct  595  RTMEMMYTDIIEALQAKGIEANPKDYLTFFCLGNREIKQSGEYQPEEQPEADSDYIRAQE  654

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVH KMMIVDDEYII+GSANINQRSMDGARDSEIAMG YQP+HL+ RQPARGQ+
Sbjct  655  ARRFMIYVHTKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGGYQPYHLATRQPARGQI  714

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFRMALWYEHLGMLD+ F +PES+ECV +VN IA+  W++YS + L++D+P HLLSYP+
Sbjct  715  HGFRMALWYEHLGMLDDVFQRPESLECVQRVNAIADKYWDMYSSDDLQQDLPGHLLSYPV  774

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            G+  +G VTELPG + FPDT+A VLGTKS++
Sbjct  775  GIASDGVVTELPGMEFFPDTRARVLGTKSDY  805



>ref|NP_001275827.1| phospholipase D alpha [Citrus sinensis]
 gb|ACA49723.1| phospholipase D alpha [Citrus sinensis]
Length=802

 Score =   346 bits (887),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 157/211 (74%), Positives = 185/211 (88%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM MMY D+VQAL+AKGI+ +P++YL+FFCLGNRE K+  EYEP+E+P++D+D+ RAQE
Sbjct  585  RTMDMMYKDVVQALRAKGIMEDPRNYLTFFCLGNREVKRSGEYEPAERPEDDSDFLRAQE  644

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVHAKMMIVDDEYII+GSANINQRSM+GARD+EIAMG YQP+HLS R PARGQ+
Sbjct  645  ARRFMIYVHAKMMIVDDEYIIIGSANINQRSMEGARDTEIAMGGYQPYHLSTRVPARGQI  704

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFRM+LWYEHLGMLD+ F QPES ECV KVNQIAE  W+LYS E+LE D+P HLL YPI
Sbjct  705  HGFRMSLWYEHLGMLDDTFLQPESSECVKKVNQIAERYWDLYSSESLEHDLPGHLLRYPI  764

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            GV+  G VTELPG + FPDTKA VLGTKS++
Sbjct  765  GVSGEGDVTELPGTEFFPDTKARVLGTKSDY  795



>emb|CDY20149.1| BnaA01g28530D [Brassica napus]
Length=213

 Score =   327 bits (838),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 147/206 (71%), Positives = 172/206 (83%), Gaps = 0/206 (0%)
 Frame = -3

Query  804  MYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQEARRFM  625
            MY D+ QAL+A+G+  +P++YL+ FCLGNRE KK  EYEP+E+PD DTDY RAQEARRFM
Sbjct  1    MYKDVTQALRAQGLEEDPRNYLTLFCLGNREVKKEGEYEPAERPDPDTDYMRAQEARRFM  60

Query  624  IYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHGFRM  445
            IYVH+KMMIVDDEYIIVGSANINQRSMDGARDSEIAMG YQPHHLS RQPARGQVHGFRM
Sbjct  61   IYVHSKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGGYQPHHLSHRQPARGQVHGFRM  120

Query  444  ALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGVTEN  265
            +LWYEHLGMLD  F  P S+EC+ KVN+IA+  W+ YS E+LE D+P HLL YPI V   
Sbjct  121  SLWYEHLGMLDETFLDPSSLECIEKVNRIADKYWDFYSSESLEHDLPGHLLRYPISVDNE  180

Query  264  GQVTELPGFQNFPDTKAPVLGTKSNF  187
            G ++ELPGF+ FPDTKA +LG K ++
Sbjct  181  GNISELPGFEFFPDTKARILGNKVDY  206



>ref|XP_006465340.1| PREDICTED: phospholipase D alpha 1 [Citrus sinensis]
Length=802

 Score =   346 bits (887),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 157/211 (74%), Positives = 185/211 (88%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM MMY D+VQAL+AKGI+ +P++YL+FFCLGNRE K+  EYEP+E+P++D+D+ RAQE
Sbjct  585  RTMDMMYKDVVQALRAKGIMEDPRNYLTFFCLGNREVKRSGEYEPAERPEDDSDFLRAQE  644

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVHAKMMIVDDEYII+GSANINQRSM+GARD+EIAMG YQP+HLS R PARGQ+
Sbjct  645  ARRFMIYVHAKMMIVDDEYIIIGSANINQRSMEGARDTEIAMGGYQPYHLSTRVPARGQI  704

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFRM+LWYEHLGMLD+ F QPES ECV KVNQIAE  W+LYS E+LE D+P HLL YPI
Sbjct  705  HGFRMSLWYEHLGMLDDTFLQPESSECVKKVNQIAERYWDLYSSESLEHDLPGHLLRYPI  764

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            GV+  G VTELPG + FPDTKA VLGTKS++
Sbjct  765  GVSGEGDVTELPGTEFFPDTKARVLGTKSDY  795



>ref|XP_002282187.3| PREDICTED: phospholipase D alpha 1-like [Vitis vinifera]
 ref|XP_010656427.1| PREDICTED: phospholipase D alpha 1-like [Vitis vinifera]
Length=814

 Score =   346 bits (887),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 156/211 (74%), Positives = 184/211 (87%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMY DI QAL AKG+ ANPKDYL+FFCLGNRE+K   EYEP E PD+DTDY RAQ+
Sbjct  597  RTMEMMYNDIAQALHAKGLKANPKDYLTFFCLGNRESKTIGEYEPPESPDHDTDYYRAQQ  656

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            +RRFMIYVHAKMMIVDDEYI++GSANINQRSMDGARDSEIAMG YQP+HL+ +QPARGQ+
Sbjct  657  SRRFMIYVHAKMMIVDDEYIVIGSANINQRSMDGARDSEIAMGGYQPYHLATKQPARGQI  716

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFRMALWYEHLG++DN F QPES++C+ KVN+IAE NWNLYS E  + D+P HLLSYPI
Sbjct  717  HGFRMALWYEHLGLVDNSFLQPESLDCIQKVNKIAERNWNLYSSERTDDDLPGHLLSYPI  776

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
             VT+ G+V E+PG + FPDTKA VLG+KS++
Sbjct  777  CVTDTGEVKEVPGSEFFPDTKAQVLGSKSDY  807



>ref|XP_006406922.1| hypothetical protein EUTSA_v10020083mg [Eutrema salsugineum]
 ref|XP_006406923.1| hypothetical protein EUTSA_v10020083mg [Eutrema salsugineum]
 gb|ESQ48375.1| hypothetical protein EUTSA_v10020083mg [Eutrema salsugineum]
 gb|ESQ48376.1| hypothetical protein EUTSA_v10020083mg [Eutrema salsugineum]
Length=810

 Score =   345 bits (886),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 153/211 (73%), Positives = 183/211 (87%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMY D++QAL+A+G+  +P++YL+FFCLGNRE KK  EYEP+E+PD D+DY RAQE
Sbjct  593  RTMEMMYKDVIQALRAQGLEEDPRNYLTFFCLGNREVKKEGEYEPAERPDPDSDYMRAQE  652

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVH+KMMIVDDEYII+GSANINQRSMDGARDSEIAMG YQPHHLS RQPARGQ+
Sbjct  653  ARRFMIYVHSKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGGYQPHHLSHRQPARGQI  712

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFRM+LWYEHLGMLD  F  P S+EC+ KVN+I++  W+LYS E+LE D+P HLL YPI
Sbjct  713  HGFRMSLWYEHLGMLDETFLDPSSLECIEKVNRISDKYWDLYSSESLEHDLPGHLLRYPI  772

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            GV   G +TELPGF+ FPDTKA +LGTKS++
Sbjct  773  GVASEGDITELPGFEFFPDTKARILGTKSDY  803



>gb|ABN13537.2| phospholipase D [Cucumis sativus]
Length=808

 Score =   345 bits (885),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 155/211 (73%), Positives = 185/211 (88%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RT++MMY D+++AL+ +GI  +P++YL+FFCLGNRE K+  EYEPSE P+ D+DY RAQ+
Sbjct  591  RTLEMMYKDVIEALRDQGIEEDPRNYLTFFCLGNREVKRSGEYEPSEAPEEDSDYLRAQQ  650

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVH KMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQP+HLSA +PARGQV
Sbjct  651  ARRFMIYVHTKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPYHLSAHEPARGQV  710

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFRMALWYEHLGMLD  F +PES ECV KVN+IA+  W++YS E+LERD+P HLL YPI
Sbjct  711  HGFRMALWYEHLGMLDETFLRPESEECVAKVNRIADKYWDMYSSESLERDLPGHLLRYPI  770

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            G+T  G+VTELPGF+ FPDTKA +LGTKS++
Sbjct  771  GITSEGEVTELPGFECFPDTKARILGTKSDY  801



>ref|NP_001267897.1| phospholipase D alpha [Vitis vinifera]
 gb|ABC59316.1| phospholipase D alpha [Vitis vinifera]
Length=809

 Score =   345 bits (885),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 159/211 (75%), Positives = 181/211 (86%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMY DI++AL  KGI  +P++YL+FFCLGNRE KK  EYEPSE P+ DTDYSRAQE
Sbjct  592  RTMEMMYKDIIKALADKGIEDDPRNYLTFFCLGNREVKKSGEYEPSEHPEPDTDYSRAQE  651

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVHAKMMIVDDEYII+GSANINQRSMDGARDSEIAMG YQP+HL++RQPARGQ+
Sbjct  652  ARRFMIYVHAKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGGYQPYHLASRQPARGQI  711

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFRM+LWYEHLGMLD  F QPES EC+ KVNQIAE  W+LY+ ETLE D+P HLL YPI
Sbjct  712  HGFRMSLWYEHLGMLDESFLQPESKECIQKVNQIAEKYWDLYASETLEHDLPGHLLRYPI  771

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
             V+  G +TELPG + FPDTKA VLGTKS +
Sbjct  772  AVSCGGDITELPGAEFFPDTKARVLGTKSEY  802



>sp|P93400.2|PLDA1_TOBAC RecName: Full=Phospholipase D alpha 1; Short=PLD alpha 1; AltName: 
Full=Choline phosphatase 1; AltName: Full=Phosphatidylcholine-hydrolyzing 
phospholipase D 1 [Nicotiana tabacum]
 emb|CAB06620.1| phospholipase D [Nicotiana tabacum]
Length=808

 Score =   345 bits (885),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 159/211 (75%), Positives = 181/211 (86%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMY  IVQAL AKGI  +P++YL+FFC+GNRE KK   YEPSE P+ D+DY RAQE
Sbjct  591  RTMEMMYKHIVQALNAKGIEEDPRNYLTFFCIGNREVKKSGAYEPSETPEPDSDYIRAQE  650

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVH+KMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHL+ R+PARGQ+
Sbjct  651  ARRFMIYVHSKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLATREPARGQI  710

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFRMALWYEHLGMLD  F  PES ECV KVN++A+  W+LYS E+LERD+P HLL YPI
Sbjct  711  HGFRMALWYEHLGMLDETFLHPESEECVSKVNRMADKYWDLYSSESLERDLPGHLLRYPI  770

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            GV   G VTELPG ++FPDTKA VLGTKS++
Sbjct  771  GVASEGDVTELPGAEHFPDTKARVLGTKSDY  801



>ref|XP_011008452.1| PREDICTED: phospholipase D alpha 1-like [Populus euphratica]
 ref|XP_011008453.1| PREDICTED: phospholipase D alpha 1-like [Populus euphratica]
Length=808

 Score =   345 bits (885),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 156/211 (74%), Positives = 181/211 (86%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RT+ MMY D+++AL+AKG+  +P++YL+FFCLGNRE KK  EYEP+EKP+ D+DY RAQE
Sbjct  591  RTLDMMYKDVIEALRAKGLDEDPRNYLTFFCLGNREVKKSGEYEPAEKPEPDSDYIRAQE  650

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVHAKMMIVDDEYII+GSANINQRSMDGARDSEIAMG YQP+HL+ RQPARGQ+
Sbjct  651  ARRFMIYVHAKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGGYQPYHLATRQPARGQI  710

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFR+ LWYEHLGMLD+ F  PES ECV KVNQI +  W+LYS ETLE D+P HLL YPI
Sbjct  711  HGFRLGLWYEHLGMLDDTFLHPESEECVTKVNQITDKYWDLYSSETLEHDLPGHLLRYPI  770

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            GV+  G VTELPG + FPDTKA VLGTKS+F
Sbjct  771  GVSSEGNVTELPGTEFFPDTKARVLGTKSDF  801



>ref|XP_004135845.1| PREDICTED: phospholipase D alpha 1 [Cucumis sativus]
 gb|KGN45278.1| hypothetical protein Csa_7G432600 [Cucumis sativus]
Length=808

 Score =   345 bits (885),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 155/211 (73%), Positives = 185/211 (88%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RT++MMY D+++AL+ +GI  +P++YL+FFCLGNRE K+  EYEPSE P+ D+DY RAQ+
Sbjct  591  RTLEMMYKDVIEALRDQGIEEDPRNYLTFFCLGNREVKRSGEYEPSEAPEEDSDYLRAQQ  650

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVH KMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQP+HLSA +PARGQV
Sbjct  651  ARRFMIYVHTKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPYHLSAHEPARGQV  710

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFRMALWYEHLGMLD  F +PES ECV KVN+IA+  W++YS E+LERD+P HLL YPI
Sbjct  711  HGFRMALWYEHLGMLDETFLRPESEECVAKVNRIADKYWDMYSSESLERDLPGHLLRYPI  770

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            G+T  G+VTELPGF+ FPDTKA +LGTKS++
Sbjct  771  GITSEGEVTELPGFECFPDTKARILGTKSDY  801



>ref|XP_007150746.1| hypothetical protein PHAVU_005G177300g [Phaseolus vulgaris]
 gb|ESW22740.1| hypothetical protein PHAVU_005G177300g [Phaseolus vulgaris]
Length=807

 Score =   344 bits (883),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 160/211 (76%), Positives = 180/211 (85%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM MMY D+VQAL+AKGI  NP++YL+FFCLGNRE KK  EYEPSE+PD+DTDY RAQE
Sbjct  590  RTMDMMYKDVVQALRAKGIEENPRNYLTFFCLGNREVKKEGEYEPSERPDSDTDYIRAQE  649

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQP+HL   QPARGQ+
Sbjct  650  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPYHLITSQPARGQI  709

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFRM+LWYEHLGML + F  PES EC+ KVNQIA   W+LYS E+LE D+P HLL YP+
Sbjct  710  HGFRMSLWYEHLGMLHDSFLYPESTECIGKVNQIANKYWDLYSSESLEHDLPGHLLRYPV  769

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            GV+  G VTELPGF+ FPDTKA VLG K ++
Sbjct  770  GVSSEGIVTELPGFEFFPDTKARVLGDKVDY  800



>gb|AHN53202.1| phospholipase D alpha 1-like protein [Cocos nucifera]
Length=813

 Score =   344 bits (882),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 157/211 (74%), Positives = 185/211 (88%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMY DI+ AL+AKGI ANPKDYL+FFCLGNRE KK  EYEP E+P+ +TDYSRAQ+
Sbjct  596  RTMEMMYADIILALQAKGIEANPKDYLTFFCLGNREVKKSGEYEPEEQPEANTDYSRAQQ  655

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVHAKMMIVDDEYII+GSANINQRSMDGARDSEIAMGAYQP +LS R PARG++
Sbjct  656  ARRFMIYVHAKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGAYQPFYLSTRGPARGRI  715

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFRMALWYEHLGMLD+ F  PES+ECV KVN+IA+  W+LYS + L+RD+P HLLSYPI
Sbjct  716  HGFRMALWYEHLGMLDDAFLHPESVECVQKVNRIADKYWDLYSSDNLDRDLPGHLLSYPI  775

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            GV+ +G +TELPG + FPDT+A  LGTK+++
Sbjct  776  GVSSDGVITELPGMEFFPDTRARPLGTKTDY  806



>ref|XP_006385316.1| phospholipase D family protein [Populus trichocarpa]
 gb|ERP63113.1| phospholipase D family protein [Populus trichocarpa]
Length=808

 Score =   344 bits (882),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 155/211 (73%), Positives = 181/211 (86%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RT++MMY D+++AL+AKG+  +P++YL+FFCLGNRE KK  EYEPSEKP+ D+DY RAQE
Sbjct  591  RTLEMMYKDVIEALRAKGLEEDPRNYLTFFCLGNREVKKSGEYEPSEKPEPDSDYIRAQE  650

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVHAKMMIVDDEYII+GSANINQRSMDGARDSEIAMG YQP+HL+ RQPARGQ+
Sbjct  651  ARRFMIYVHAKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGGYQPYHLATRQPARGQI  710

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFR+ LWYEHLGMLD+ F  PES ECV KVNQI +  W+LYS ETLE D+P HLL YPI
Sbjct  711  HGFRLGLWYEHLGMLDDTFLHPESEECVTKVNQITDKYWDLYSSETLEHDLPGHLLRYPI  770

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            GV+  G VTELPG + FPDTKA VLG KS++
Sbjct  771  GVSSEGNVTELPGTEFFPDTKARVLGAKSDY  801



>ref|XP_007135745.1| hypothetical protein PHAVU_010G155000g [Phaseolus vulgaris]
 gb|ESW07739.1| hypothetical protein PHAVU_010G155000g [Phaseolus vulgaris]
Length=809

 Score =   343 bits (881),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 153/211 (73%), Positives = 183/211 (87%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMY DI+QAL+AKG   +P++YL+FFCLGNRE KK  E+EPSEKPD D+DY RAQE
Sbjct  592  RTMEMMYKDIIQALRAKGSEEDPRNYLTFFCLGNREVKKSGEFEPSEKPDPDSDYQRAQE  651

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVH KMMIVDDEYII+GSANINQRSMDG+RDSEIAMGAYQP+HL+ +QPARGQV
Sbjct  652  ARRFMIYVHTKMMIVDDEYIIIGSANINQRSMDGSRDSEIAMGAYQPYHLATQQPARGQV  711

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFR++LWYEHLGML + F +PES EC+ KVNQ+A+  W+LYS E+LERD+P HLL YPI
Sbjct  712  HGFRLSLWYEHLGMLHDSFLKPESEECITKVNQVADKYWDLYSSESLERDLPGHLLRYPI  771

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            GV   G VT+LPGF+ FPDTKA +LG K+++
Sbjct  772  GVASEGDVTQLPGFEFFPDTKARILGAKADY  802



>ref|XP_010487412.1| PREDICTED: phospholipase D alpha 1 isoform X2 [Camelina sativa]
Length=810

 Score =   343 bits (880),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 154/211 (73%), Positives = 181/211 (86%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMY D++QAL+A+G+  +P++YL+FFCLGNRE KK  EYEP+E+PD D+ Y RAQE
Sbjct  593  RTMEMMYKDVIQALRAQGLEEDPRNYLTFFCLGNREVKKEGEYEPAERPDPDSSYMRAQE  652

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVH KMMIVDDEY+IVGSANINQRSMDGARDSEIAMG YQPHHLS RQPARGQV
Sbjct  653  ARRFMIYVHTKMMIVDDEYVIVGSANINQRSMDGARDSEIAMGGYQPHHLSHRQPARGQV  712

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFRM+LWYEHLGMLD  F  P S+EC+ KVN+IA+  W+ YS E+LE D+P HLL YPI
Sbjct  713  HGFRMSLWYEHLGMLDETFLDPSSLECIEKVNRIADKYWDFYSSESLEHDLPGHLLRYPI  772

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            GV+  G VTELPGF+ FPDTKA +LGTKS++
Sbjct  773  GVSGEGDVTELPGFEFFPDTKARILGTKSDY  803



>ref|XP_010465563.1| PREDICTED: phospholipase D alpha 1-like [Camelina sativa]
Length=810

 Score =   343 bits (880),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 154/211 (73%), Positives = 181/211 (86%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMY D++QAL+A+G+  +P++YL+FFCLGNRE KK  EYEP+E+PD D+ Y RAQE
Sbjct  593  RTMEMMYKDVIQALRAQGLEEDPRNYLTFFCLGNREVKKEGEYEPAERPDPDSSYMRAQE  652

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVH KMMIVDDEY+IVGSANINQRSMDGARDSEIAMG YQPHHLS RQPARGQV
Sbjct  653  ARRFMIYVHTKMMIVDDEYVIVGSANINQRSMDGARDSEIAMGGYQPHHLSHRQPARGQV  712

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFRM+LWYEHLGMLD  F  P S+EC+ KVN+IA+  W+ YS E+LE D+P HLL YPI
Sbjct  713  HGFRMSLWYEHLGMLDETFLDPSSLECIEKVNRIADKYWDFYSSESLEHDLPGHLLRYPI  772

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            GV+  G VTELPGF+ FPDTKA +LGTKS++
Sbjct  773  GVSGEGDVTELPGFEFFPDTKARILGTKSDY  803



>ref|XP_009365415.1| PREDICTED: phospholipase D alpha 1-like [Pyrus x bretschneideri]
Length=816

 Score =   343 bits (880),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 156/211 (74%), Positives = 179/211 (85%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM MMY DI +AL A+G+  +P+ YL+FFCLGNRE KK  EYEPSE P+ D+DY RAQE
Sbjct  599  RTMNMMYADIKRALDAQGLEEDPRTYLTFFCLGNREVKKPGEYEPSETPEADSDYQRAQE  658

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVH KMMIVDDEYII+GSANINQRSMDGARDSEIAMGAYQP+HLS R+PARGQ+
Sbjct  659  ARRFMIYVHTKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGAYQPYHLSVREPARGQI  718

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFRMALWYEH+GMLD  F QPES+EC+ KVNQIA+  W+LYS ETLE D+P HLL YP+
Sbjct  719  HGFRMALWYEHMGMLDEAFLQPESVECISKVNQIADKYWDLYSSETLEHDLPGHLLRYPV  778

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            GVT  G V ELPGF+ FPDTKA +LG KS++
Sbjct  779  GVTSEGVVVELPGFEFFPDTKARILGAKSDY  809



>ref|XP_006297003.1| hypothetical protein CARUB_v10012996mg [Capsella rubella]
 gb|EOA29901.1| hypothetical protein CARUB_v10012996mg [Capsella rubella]
Length=810

 Score =   343 bits (880),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 153/211 (73%), Positives = 180/211 (85%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMY D++QAL+A+G+  +P++YL+FFCLGNRE KK  EYEP+E+PD D+DY RAQE
Sbjct  593  RTMEMMYKDVIQALRAQGLEEDPRNYLTFFCLGNREVKKEGEYEPAERPDADSDYMRAQE  652

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVH KMMIVDDEYII+GSANINQRSMDGARDSEIAMG YQPHHLS RQPARGQ+
Sbjct  653  ARRFMIYVHTKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGGYQPHHLSHRQPARGQI  712

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFRM+LWYEHLGMLD  F  P S+EC+ KVN+I+E  W+ YS ETLE D+P HLL YPI
Sbjct  713  HGFRMSLWYEHLGMLDETFLDPSSLECIEKVNRISEKYWDFYSSETLEHDLPGHLLRYPI  772

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            GV   G +TELPG + FPDTKA +LGTKS++
Sbjct  773  GVASEGDITELPGTEFFPDTKARILGTKSDY  803



>ref|XP_009348321.1| PREDICTED: phospholipase D alpha 1 [Pyrus x bretschneideri]
Length=810

 Score =   343 bits (880),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 156/211 (74%), Positives = 179/211 (85%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM MMY DI +AL A+G+  +P+ YL+FFCLGNRE KK  EYEPSE P+ D+DY RAQE
Sbjct  593  RTMNMMYADIKRALDAQGLEEDPRTYLTFFCLGNREVKKPGEYEPSETPEADSDYQRAQE  652

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVH KMMIVDDEYII+GSANINQRSMDGARDSEIAMGAYQP+HLS R+PARGQ+
Sbjct  653  ARRFMIYVHTKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGAYQPYHLSVREPARGQI  712

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFRMALWYEH+GMLD  F QPES+EC+ KVNQIA+  W+LYS ETLE D+P HLL YP+
Sbjct  713  HGFRMALWYEHMGMLDEAFLQPESVECISKVNQIADKYWDLYSSETLEHDLPGHLLRYPV  772

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            GVT  G V ELPGF+ FPDTKA +LG KS++
Sbjct  773  GVTSEGVVAELPGFEFFPDTKARILGAKSDY  803



>gb|AES86616.2| phospholipase D alpha 1 [Medicago truncatula]
Length=808

 Score =   343 bits (879),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 157/211 (74%), Positives = 182/211 (86%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMY DIV AL+AKGI  +P++YL+FFCLGNRE KK  EYEPSE+P+ D+DY RAQ+
Sbjct  591  RTMEMMYKDIVLALRAKGIEEDPRNYLTFFCLGNREVKKQGEYEPSEQPEPDSDYERAQQ  650

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVH KMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQP+HL+ARQPARGQV
Sbjct  651  ARRFMIYVHTKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPYHLAARQPARGQV  710

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFRMALWYEHLGML + F  PES EC+ KVNQIA+  W+LYS ++LE D+P HLL YPI
Sbjct  711  HGFRMALWYEHLGMLHDSFLHPESQECIRKVNQIADKYWDLYSNDSLEHDLPGHLLRYPI  770

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            GV   G VT+LPGF+ FPDTKA +LG K+++
Sbjct  771  GVASEGDVTQLPGFEFFPDTKARILGGKADY  801



>gb|ADY75750.1| phospholipase D alpha [Dimocarpus longan]
Length=800

 Score =   342 bits (878),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 156/211 (74%), Positives = 180/211 (85%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM MMY D+VQAL+AKG   +P++YL+FFCLGNRE K   EYEPSE P+ D+DY +AQE
Sbjct  583  RTMDMMYKDVVQALRAKGSTEDPRNYLTFFCLGNREVKMSGEYEPSETPEPDSDYIKAQE  642

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVH KMMIVDDEYII+GSANINQRSMDGARDSEIAMG YQP+HLS RQPARGQ+
Sbjct  643  ARRFMIYVHTKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGGYQPYHLSTRQPARGQI  702

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFRMALWYEHLGM    F QPES+ECV KVNQIA+  W+LYS E+LERD+P HLL YPI
Sbjct  703  HGFRMALWYEHLGMFSENFLQPESLECVRKVNQIADKYWDLYSSESLERDLPGHLLRYPI  762

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            G++ +G VTELPG + FPDTKA +LGTKS++
Sbjct  763  GISGDGDVTELPGTEFFPDTKARILGTKSDY  793



>gb|ABB82551.1| phospholipase D-alpha [Cucumis melo var. inodorus]
Length=808

 Score =   342 bits (878),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 152/211 (72%), Positives = 185/211 (88%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RT++MMY D+++AL+ +G   +P++YL+FFCLGNRE K+  EYEPSE P+ D+DY RAQ+
Sbjct  591  RTLEMMYKDVIEALREQGSEEDPRNYLTFFCLGNREVKRSGEYEPSEAPEEDSDYLRAQQ  650

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVH KMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQP+HLSAR+PARGQV
Sbjct  651  ARRFMIYVHTKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPYHLSAREPARGQV  710

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFRMALWYEHLGMLD  F +PES EC+ KVN+IA+  W++YS E+LERD+P HLL YP+
Sbjct  711  HGFRMALWYEHLGMLDETFLRPESEECIAKVNRIADKYWDMYSSESLERDLPGHLLRYPV  770

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            G++  G+VTELPGF+ FPDTKA +LGTKS++
Sbjct  771  GISSEGEVTELPGFEFFPDTKARILGTKSDY  801



>ref|XP_006387081.1| hypothetical protein POPTR_1923s00200g [Populus trichocarpa]
 gb|ERP45995.1| hypothetical protein POPTR_1923s00200g [Populus trichocarpa]
Length=216

 Score =   323 bits (829),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 147/209 (70%), Positives = 174/209 (83%), Gaps = 0/209 (0%)
 Frame = -3

Query  813  MQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQEAR  634
            M+MMY+DI +AL+ KG+ ANPKDYL+FFCLG  E +   EY PSE+P++++DYSRAQ+AR
Sbjct  1    MEMMYSDIAEALQDKGLEANPKDYLTFFCLGKHEREMPGEYVPSERPEHNSDYSRAQKAR  60

Query  633  RFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHG  454
            RFMIYVHAKMMIVDDEYII GSANINQRSMDG RD+EIAMGAYQP+HL+  QPARGQ+HG
Sbjct  61   RFMIYVHAKMMIVDDEYIITGSANINQRSMDGGRDTEIAMGAYQPYHLATNQPARGQIHG  120

Query  453  FRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGV  274
            FRM+LWYEHLG LD+ F  PES+ECV KVN IAE NW LYS E L+ D+P HLL+YPIGV
Sbjct  121  FRMSLWYEHLGQLDDTFCHPESLECVRKVNHIAEKNWQLYSSEVLDDDLPGHLLAYPIGV  180

Query  273  TENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            T NG++TEL G + FP TKA V G+KS  
Sbjct  181  TSNGELTELQGTEFFPGTKARVFGSKSEL  209



>ref|XP_002299756.1| phospholipase D family protein [Populus trichocarpa]
 gb|EEE84561.1| phospholipase D family protein [Populus trichocarpa]
Length=808

 Score =   342 bits (878),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 154/211 (73%), Positives = 182/211 (86%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM MMY D++QAL+AKG+  +P++YL+FFCLGNRE KK  EYEPSEKP+ D+DY RAQE
Sbjct  591  RTMDMMYKDVIQALRAKGLEEDPRNYLTFFCLGNREVKKSGEYEPSEKPEPDSDYIRAQE  650

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVHAKMMIVDDEYII+GSANINQRSMDGARDSEIAMG YQP+HL+ RQPARGQ+
Sbjct  651  ARRFMIYVHAKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGGYQPYHLATRQPARGQI  710

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFR+ LWYEHLGMLD+ F +PE+ +C+ KVNQIA+  W+LYS ETLE D+P HLL YPI
Sbjct  711  HGFRLGLWYEHLGMLDDTFLKPENEDCIRKVNQIADKYWDLYSSETLEGDLPGHLLRYPI  770

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            G++  G VTELPG + FPDTKA VLG KS++
Sbjct  771  GISSEGNVTELPGTEYFPDTKARVLGAKSDY  801



>ref|XP_010503392.1| PREDICTED: phospholipase D alpha 1-like [Camelina sativa]
Length=810

 Score =   342 bits (878),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 153/211 (73%), Positives = 181/211 (86%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMY D++QAL+++G+  +P++YL+FFCLGNRE KK  EYEP+E+PD D+ Y RAQE
Sbjct  593  RTMEMMYKDVIQALRSQGLEEDPRNYLTFFCLGNREVKKEGEYEPAERPDPDSSYMRAQE  652

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVH KMMIVDDEY+IVGSANINQRSMDGARDSEIAMG YQPHHLS RQPARGQV
Sbjct  653  ARRFMIYVHTKMMIVDDEYVIVGSANINQRSMDGARDSEIAMGGYQPHHLSHRQPARGQV  712

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFRM+LWYEHLGMLD  F  P S+EC+ KVN+IA+  W+ YS E+LE D+P HLL YPI
Sbjct  713  HGFRMSLWYEHLGMLDETFLDPSSLECIEKVNRIADKYWDFYSSESLEHDLPGHLLRYPI  772

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            GV+  G VTELPGF+ FPDTKA +LGTKS++
Sbjct  773  GVSGEGDVTELPGFEFFPDTKARILGTKSDY  803



>gb|EYU23016.1| hypothetical protein MIMGU_mgv1a001487mg [Erythranthe guttata]
Length=810

 Score =   342 bits (877),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 153/211 (73%), Positives = 185/211 (88%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMYTDIV+AL+AKGI+A+PKDYL+FFCLGNRE KK +EYEP EKPD++TDYSRAQ+
Sbjct  593  RTMEMMYTDIVEALRAKGIVADPKDYLTFFCLGNREVKKSNEYEPPEKPDSNTDYSRAQQ  652

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARR MIYVHAKMMIVDDEYII+GSANINQRSMDGARDSEIAMGAYQP+HLS   PARG++
Sbjct  653  ARRGMIYVHAKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGAYQPYHLSFTSPARGEI  712

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            +G RMALWYEH+G+LD+ F  P S+EC+ +VN+I + NW+LY+ E LE+D+P HLLSYPI
Sbjct  713  YGLRMALWYEHMGLLDDSFCHPHSIECIQRVNKIGQKNWDLYTKEDLEKDLPGHLLSYPI  772

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            GV+  G VTELPG + FPDTKA VLG+ + +
Sbjct  773  GVSSEGTVTELPGMEYFPDTKARVLGSVAEY  803



>ref|XP_011012164.1| PREDICTED: phospholipase D alpha 1 [Populus euphratica]
Length=808

 Score =   342 bits (877),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 154/211 (73%), Positives = 183/211 (87%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM MMY D++QAL+AKG+  +P++YL+FFCLGNRE KK  EYEP+EKP+ D+DY RAQE
Sbjct  591  RTMDMMYNDVIQALRAKGLEEDPRNYLTFFCLGNREVKKSGEYEPAEKPEPDSDYIRAQE  650

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVHAKMMIVDDEYII+GSANINQRSMDGARDSEIAMG YQP+HL+ RQPARGQ+
Sbjct  651  ARRFMIYVHAKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGGYQPYHLATRQPARGQI  710

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFR+ LWYEHLGMLD+ F +PE+ +CV KVNQIA+  W+LYS ETLE D+P HLL YPI
Sbjct  711  HGFRLGLWYEHLGMLDDTFLKPENEDCVRKVNQIADKYWDLYSSETLEGDLPGHLLRYPI  770

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            G++ +G VTELPG + FPDTKA VLG KS++
Sbjct  771  GISSDGNVTELPGTEFFPDTKARVLGAKSDY  801



>ref|XP_008461111.1| PREDICTED: phospholipase D alpha 1 [Cucumis melo]
Length=833

 Score =   342 bits (878),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 152/211 (72%), Positives = 185/211 (88%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RT++MMY D+++AL+ +G   +P++YL+FFCLGNRE K+  EYEPSE P+ D+DY RAQ+
Sbjct  616  RTLEMMYKDVIEALREQGSEEDPRNYLTFFCLGNREVKRSGEYEPSEAPEEDSDYLRAQQ  675

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVH KMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQP+HLSAR+PARGQV
Sbjct  676  ARRFMIYVHTKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPYHLSAREPARGQV  735

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFRMALWYEHLGMLD  F +PES EC+ KVN+IA+  W++YS E+LERD+P HLL YP+
Sbjct  736  HGFRMALWYEHLGMLDETFLRPESEECIAKVNRIADKYWDMYSSESLERDLPGHLLRYPV  795

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            G++  G+VTELPGF+ FPDTKA +LGTKS++
Sbjct  796  GISSEGEVTELPGFEFFPDTKARILGTKSDY  826



>gb|AGN71005.1| phospholipase D1 [Brassica napus]
Length=810

 Score =   342 bits (876),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 153/211 (73%), Positives = 180/211 (85%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTMQMMY DIVQAL+A+G+  +P++YL+FFCLGNRE KK  EYEP+E+PD D+ Y +AQE
Sbjct  593  RTMQMMYKDIVQALRAQGLEEDPRNYLTFFCLGNREVKKEGEYEPAERPDADSSYMKAQE  652

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVH KMMIVDDEYII+GSANINQRSMDGARDSEIAMG YQPHHLS RQPARGQ+
Sbjct  653  ARRFMIYVHTKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGGYQPHHLSHRQPARGQI  712

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFRM+LWYEHLGMLD  F  P S+EC+ KVN+I++  W+LYS E+LE D+P HLL YP+
Sbjct  713  HGFRMSLWYEHLGMLDETFLDPSSVECIEKVNRISDKYWDLYSSESLEHDLPGHLLRYPV  772

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            GV   G VTE PGF+ FPDTKA +LGTKS++
Sbjct  773  GVDAEGDVTEFPGFEFFPDTKARILGTKSDY  803



>gb|AAL48261.2|AF451979_1 phospholipase D1 [Papaver somniferum]
 gb|AAL48263.2|AF451981_1 phospholipase D1 [Papaver somniferum]
Length=813

 Score =   342 bits (877),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 157/211 (74%), Positives = 178/211 (84%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RT  MMY DI QALKAKG++A+P+DYL+FFCLGNRE KK  EY PSE PD DTDYSRAQ 
Sbjct  596  RTWDMMYADITQALKAKGLVADPRDYLTFFCLGNREVKKEGEYVPSETPDPDTDYSRAQA  655

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVH KMMIVDDEYII+GSANIN+RSM+GARDSEIAMG YQPHHL+ R+PA GQ+
Sbjct  656  ARRFMIYVHTKMMIVDDEYIIIGSANINERSMNGARDSEIAMGGYQPHHLAHREPATGQI  715

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFRMALWYEHLGMLD  F  P S ECV KVN+IA+  W+LYS ++LERD+P HLL YPI
Sbjct  716  HGFRMALWYEHLGMLDEVFLHPNSEECVQKVNRIADKYWDLYSSDSLERDLPGHLLRYPI  775

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            G+TENG VT LPG + FPDTKA VLG KS++
Sbjct  776  GITENGDVTALPGHEFFPDTKARVLGGKSDY  806



>ref|XP_008367859.1| PREDICTED: LOW QUALITY PROTEIN: phospholipase D alpha 1-like 
[Malus domestica]
Length=530

 Score =   333 bits (854),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 153/210 (73%), Positives = 181/210 (86%), Gaps = 0/210 (0%)
 Frame = -3

Query  816  TMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQEA  637
            TM MMY DIVQ LK KGI ANPKDYL+FFCLGN E K   EYEP EKP++ +DYSRAQ+A
Sbjct  314  TMDMMYRDIVQTLKVKGIEANPKDYLAFFCLGNHEKKLPGEYEPPEKPEHGSDYSRAQQA  373

Query  636  RRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQVH  457
            RRFMIYVHAK+MIVDDEYII+GSANINQRSMDGARDSEIAMGA QP+HLS  +PARGQ+H
Sbjct  374  RRFMIYVHAKVMIVDDEYIIIGSANINQRSMDGARDSEIAMGACQPYHLSTGKPARGQIH  433

Query  456  GFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIG  277
            G RM+LWYEHLG+LD+ F +P ++EC+ KVNQIA+ +W+LYS +TL+ D+P HLLSYPI 
Sbjct  434  GLRMSLWYEHLGLLDDIFLEPXNVECIRKVNQIADQHWDLYSCDTLDGDLPGHLLSYPIA  493

Query  276  VTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            VTENG+VTELPG + FPDTKA +LG+KS+ 
Sbjct  494  VTENGEVTELPGTEFFPDTKARILGSKSDL  523



>ref|XP_010322318.1| PREDICTED: phospholipase PLDa1 isoform X1 [Solanum lycopersicum]
 ref|XP_010322320.1| PREDICTED: phospholipase PLDa1 isoform X1 [Solanum lycopersicum]
 ref|XP_010322321.1| PREDICTED: phospholipase PLDa1 isoform X1 [Solanum lycopersicum]
 gb|AAF17557.1|AF201661_1 phospholipase D alpha [Solanum lycopersicum]
Length=809

 Score =   340 bits (872),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 158/211 (75%), Positives = 180/211 (85%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMY  IVQA+ AKGI  +P++YL+FFC+GNRE KK  EYEPSE P+ D++Y RAQE
Sbjct  592  RTMEMMYKCIVQAMNAKGIEEDPRNYLTFFCIGNREVKKSGEYEPSESPEPDSNYMRAQE  651

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVH+KMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQP+HL+  +PARGQV
Sbjct  652  ARRFMIYVHSKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPYHLATSKPARGQV  711

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFRMALWYEHLGMLD  F  PES ECV KVNQIA+  W+LYS E+LERD+P HLL YPI
Sbjct  712  HGFRMALWYEHLGMLDETFQHPESEECVRKVNQIADKYWDLYSSESLERDLPGHLLRYPI  771

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            GV   G +TELPG + FPDTKA VLGTKS++
Sbjct  772  GVASEGDITELPGHEFFPDTKARVLGTKSDY  802



>ref|NP_001234102.1| phospholipase PLDa1 [Solanum lycopersicum]
 gb|AAG45485.1| phospholipase PLDa1 [Solanum lycopersicum]
Length=809

 Score =   340 bits (872),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 158/211 (75%), Positives = 180/211 (85%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMY  IVQA+ AKGI  +P++YL+FFC+GNRE KK  EYEPSE P+ D++Y RAQE
Sbjct  592  RTMEMMYKCIVQAMNAKGIEEDPRNYLTFFCIGNREVKKSGEYEPSESPEPDSNYMRAQE  651

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVH+KMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQP+HL+  +PARGQV
Sbjct  652  ARRFMIYVHSKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPYHLATSKPARGQV  711

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFRMALWYEHLGMLD  F  PES ECV KVNQIA+  W+LYS E+LERD+P HLL YPI
Sbjct  712  HGFRMALWYEHLGMLDETFQHPESEECVRKVNQIADKYWDLYSSESLERDLPGHLLRYPI  771

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            GV   G +TELPG + FPDTKA VLGTKS++
Sbjct  772  GVASEGDITELPGHEFFPDTKARVLGTKSDY  802



>ref|XP_008242775.1| PREDICTED: phospholipase D alpha 1-like [Prunus mume]
Length=807

 Score =   340 bits (872),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 156/211 (74%), Positives = 185/211 (88%), Gaps = 1/211 (0%)
 Frame = -3

Query  816  TMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQEA  637
            TM+MMY DIVQAL+AKG+ ANP+DYL+FFCLGNRE K+  EYEP EKP++DTDYSRAQ+A
Sbjct  590  TMEMMYKDIVQALQAKGLEANPRDYLTFFCLGNREKKRSGEYEPPEKPEHDTDYSRAQQA  649

Query  636  RRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQVH  457
            RRFMIYVHAK+MIVDDEYII+GSANINQRSMDGARD+EIAMGAYQPHHLS R  ARGQ+H
Sbjct  650  RRFMIYVHAKVMIVDDEYIIIGSANINQRSMDGARDTEIAMGAYQPHHLSTRGAARGQIH  709

Query  456  GFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIG  277
            G R+ALWYEHLG+LD+ F +PES++C+ KVNQIAE +W+L+S ETL+ D+P HLLSYPI 
Sbjct  710  GLRLALWYEHLGLLDDTFLEPESVKCIRKVNQIAEKHWDLFSCETLDGDLPGHLLSYPIR  769

Query  276  V-TENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            V   NG++TELPG + FPDTKA VLG+KS  
Sbjct  770  VAAANGEITELPGTEFFPDTKARVLGSKSEL  800



>emb|CDO98145.1| unnamed protein product [Coffea canephora]
Length=809

 Score =   340 bits (871),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 152/211 (72%), Positives = 182/211 (86%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMY DI++AL+ KG+  +P++YL+FFCLGNRE K+  EYEPSE+P+ D+DY RAQE
Sbjct  592  RTMEMMYKDIIKALRDKGLEEDPRNYLTFFCLGNREVKRSGEYEPSEQPEPDSDYIRAQE  651

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVH KMMIVDDEYII+GSANINQRSMDG+RDSEIAMGAYQP+HL+ RQPARGQ+
Sbjct  652  ARRFMIYVHTKMMIVDDEYIIIGSANINQRSMDGSRDSEIAMGAYQPYHLATRQPARGQI  711

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFRM+LWYEHLGMLD+ F  PES EC+ KVNQ AE  W+LY+ E++ERD+P HLL YPI
Sbjct  712  HGFRMSLWYEHLGMLDDTFLHPESEECIAKVNQAAEKYWDLYASESVERDLPGHLLRYPI  771

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            GV   G VTELPG + FPDTKA +LGTKS++
Sbjct  772  GVAGEGDVTELPGMEFFPDTKARILGTKSDY  802



>ref|XP_008373955.1| PREDICTED: phospholipase D alpha 1 [Malus domestica]
Length=810

 Score =   340 bits (871),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 154/211 (73%), Positives = 178/211 (84%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM MMY D+ +AL A+G+  +P+ YL+FFCLGNRE KK  EYEPSE P+ D+DY RAQ 
Sbjct  593  RTMNMMYADVKRALDAQGLEEDPRTYLTFFCLGNREVKKPGEYEPSETPEADSDYQRAQA  652

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVHAKMMIVDDEYII+GSANINQRSMDGARDSEIAMGAYQP+HLS R+PARGQ+
Sbjct  653  ARRFMIYVHAKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGAYQPYHLSVREPARGQI  712

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFRMALWYEHLGMLD  F QPE +EC+ KVNQIA+  W+LYS ETLE D+P HLL YP+
Sbjct  713  HGFRMALWYEHLGMLDEAFLQPERIECISKVNQIADKYWDLYSSETLEHDLPGHLLRYPV  772

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            G+T  G V ELPGF+ FPDTKA +LG KS++
Sbjct  773  GITSEGVVDELPGFEFFPDTKARILGAKSDY  803



>ref|XP_002524502.1| phopholipase d alpha, putative [Ricinus communis]
 gb|EEF37942.1| phopholipase d alpha, putative [Ricinus communis]
Length=725

 Score =   337 bits (865),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 152/211 (72%), Positives = 180/211 (85%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            +TM+MMY++I +AL+AK + +NPKDYLSFFCLGNRET+K  EY P EKP+++TDY RAQE
Sbjct  508  KTMEMMYSEIAEALQAKELDSNPKDYLSFFCLGNRETEKSGEYSPPEKPEHNTDYRRAQE  567

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVHAKMMIVDDEYII+GSANINQRSMDGARDSEIAMGAYQP+HLS RQ ARGQ+
Sbjct  568  ARRFMIYVHAKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGAYQPYHLSTRQAARGQI  627

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HG RM+LWYEHLG LD+ F  PE++ECV KVNQIA   W+LY+ E LE D+P HLL+YPI
Sbjct  628  HGLRMSLWYEHLGKLDDSFYHPETLECVRKVNQIATKYWDLYASENLEHDLPGHLLTYPI  687

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            GV  NG++TELPG + FPDTKA + G+KS  
Sbjct  688  GVDSNGKITELPGIEFFPDTKAKIFGSKSEL  718



>ref|XP_009123823.1| PREDICTED: phospholipase D alpha 2-like [Brassica rapa]
Length=812

 Score =   339 bits (870),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 151/211 (72%), Positives = 179/211 (85%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMY D+++AL+ KG+  +P+DYL+FFCLGNRE KK  EYEP+EKP+ D+DY RAQE
Sbjct  595  RTMEMMYKDVIKALREKGLEEDPRDYLTFFCLGNREVKKDGEYEPTEKPEPDSDYIRAQE  654

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVH KMMIVDDEYII+GSANINQRSMDGARDSEIAMG YQP+HLS RQPARGQ+
Sbjct  655  ARRFMIYVHTKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGGYQPYHLSVRQPARGQI  714

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFRM+LWYEHLGMLD  F  P S ECV KVN++A+  W+LYS E+LE D+P HLL YPI
Sbjct  715  HGFRMSLWYEHLGMLDETFLDPSSQECVKKVNRVADKYWDLYSSESLEHDLPGHLLRYPI  774

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            G+   G +TELPG + FPDTKA +LGTKS++
Sbjct  775  GIASQGDITELPGCECFPDTKARILGTKSDY  805



>emb|CDY47540.1| BnaC03g69220D [Brassica napus]
Length=812

 Score =   339 bits (870),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 151/211 (72%), Positives = 179/211 (85%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMY D+++AL+ KG+  +P+DYL+FFCLGNRE KK  EYEP+EKP+ D+DY RAQE
Sbjct  595  RTMEMMYKDVIKALREKGLEEDPRDYLTFFCLGNREVKKDGEYEPTEKPEPDSDYIRAQE  654

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVH KMMIVDDEYII+GSANINQRSMDGARDSEIAMG YQP+HLS RQPARGQ+
Sbjct  655  ARRFMIYVHTKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGGYQPYHLSVRQPARGQI  714

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFRM+LWYEHLGMLD  F  P S ECV KVN++A+  W+LYS E+LE D+P HLL YPI
Sbjct  715  HGFRMSLWYEHLGMLDETFLDPSSQECVKKVNRVADKYWDLYSSESLEHDLPGHLLRYPI  774

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            G+   G +TELPG + FPDTKA +LGTKS++
Sbjct  775  GIASQGDITELPGCECFPDTKARILGTKSDY  805



>emb|CAB43063.1| phospholipase D1 [Craterostigma plantagineum]
Length=807

 Score =   339 bits (869),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 154/211 (73%), Positives = 183/211 (87%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM MMY D+VQAL+AKGI  +P++YL+FFCLGNRE KK  EYEPSE+P+ D+DY +AQE
Sbjct  590  RTMDMMYKDVVQALQAKGIEEDPRNYLTFFCLGNREVKKSGEYEPSEQPEPDSDYLKAQE  649

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVHAKMMIVDDEYII+GSANINQRSMDGARDSEIAMGAYQP+HL+ R  ARGQ+
Sbjct  650  ARRFMIYVHAKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGAYQPYHLNTRNRARGQI  709

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFRMALWYEHLGMLD  F +P+S ECV KVN +A+  W+LY+ E LE+D+P HLL YPI
Sbjct  710  HGFRMALWYEHLGMLDETFLEPDSEECVRKVNHVADKYWDLYASEELEKDLPGHLLRYPI  769

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            G++ +G+VTELPG + FPDTKA VLGTKS++
Sbjct  770  GISSDGEVTELPGTEFFPDTKARVLGTKSDY  800



>ref|XP_010687988.1| PREDICTED: phospholipase D alpha 1-like [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010687989.1| PREDICTED: phospholipase D alpha 1-like [Beta vulgaris subsp. 
vulgaris]
Length=806

 Score =   339 bits (869),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 155/210 (74%), Positives = 184/210 (88%), Gaps = 1/210 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMYTD++QAL+A+GI A+P+DYL+FFCLGNRE KK  +YEP++ P+ +TDYSRAQE
Sbjct  588  RTMEMMYTDVIQALRAQGIEADPRDYLTFFCLGNREIKKPGDYEPADSPEPNTDYSRAQE  647

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSAR-QPARGQ  463
            ARRFMIYVHAKMMIVDDEYIIVGSANIN+RSM+GARDSEIAMGAYQP+H+ +R +PARGQ
Sbjct  648  ARRFMIYVHAKMMIVDDEYIIVGSANINERSMNGARDSEIAMGAYQPYHICSRNEPARGQ  707

Query  462  VHGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYP  283
            VHGFRM+LWYEHLGMLDN F +PES+ECV KVNQ A   W+LY+ E LE D+P HLL YP
Sbjct  708  VHGFRMSLWYEHLGMLDNAFLEPESLECVRKVNQTATKYWDLYTSEALEYDLPGHLLKYP  767

Query  282  IGVTENGQVTELPGFQNFPDTKAPVLGTKS  193
            I +TE G+V ELPG+  FPDTKA V+GTKS
Sbjct  768  ISITEEGEVVELPGWDCFPDTKARVIGTKS  797



>gb|ABK24520.1| unknown [Picea sitchensis]
Length=482

 Score =   330 bits (845),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 150/212 (71%), Positives = 179/212 (84%), Gaps = 1/212 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGII-ANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQ  643
            RTM+MMYTDI QAL+AK I  A+P+DYL+FFCL NRE KK  EY P  +P+ D+DY RAQ
Sbjct  264  RTMEMMYTDIAQALRAKQIYDADPRDYLTFFCLANREVKKNGEYMPQVEPEEDSDYKRAQ  323

Query  642  EARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQ  463
            + RRFMIYVHAKMMIVDDEYI++GSANINQRSMDGARDSEIAMGAYQP HL+  +PARGQ
Sbjct  324  QNRRFMIYVHAKMMIVDDEYILIGSANINQRSMDGARDSEIAMGAYQPFHLAVNEPARGQ  383

Query  462  VHGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYP  283
            +HGFRM+LWYEH GMLDN F QPE+++C+ KVN+IAE  W+LYS E+LERD+P HLL YP
Sbjct  384  IHGFRMSLWYEHTGMLDNLFLQPENVQCIRKVNKIAERYWDLYSSESLERDLPGHLLMYP  443

Query  282  IGVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            +G+T  G+VTELPG + FPDTKA + GTKS+ 
Sbjct  444  VGITNEGEVTELPGSEFFPDTKARIFGTKSDL  475



>ref|XP_009787006.1| PREDICTED: phospholipase D alpha 1-like isoform X2 [Nicotiana 
sylvestris]
Length=762

 Score =   338 bits (866),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 156/213 (73%), Positives = 183/213 (86%), Gaps = 2/213 (1%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMY  I QA++ KGI  +P++YL+FFC+GNRE KK  EYEPSEKP+ D+DY RAQE
Sbjct  543  RTMEMMYKHIFQAIRDKGIDDHPRNYLTFFCIGNRELKKTGEYEPSEKPEPDSDYERAQE  602

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVH+KMMIVDDEYIIVGSANINQRSMDGARDSEIA+GAYQPHHL+ RQPARGQV
Sbjct  603  ARRFMIYVHSKMMIVDDEYIIVGSANINQRSMDGARDSEIAIGAYQPHHLTTRQPARGQV  662

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFRMALWYEH+GMLD+ F  PES ECV KVNQIA+  W+LY+ E+LE D+P HLL YP+
Sbjct  663  HGFRMALWYEHMGMLDDTFQHPESEECVRKVNQIADKYWDLYTSESLENDLPGHLLRYPV  722

Query  279  GVTENGQVTELPGFQN--FPDTKAPVLGTKSNF  187
            G+T NG +T+LPG  N  FPDTKA V+GTKS++
Sbjct  723  GLTNNGDITDLPGNGNEFFPDTKARVVGTKSDY  755



>ref|XP_007217042.1| hypothetical protein PRUPE_ppa001519mg [Prunus persica]
 gb|EMJ18241.1| hypothetical protein PRUPE_ppa001519mg [Prunus persica]
Length=810

 Score =   339 bits (869),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 155/211 (73%), Positives = 179/211 (85%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM MMY+DI  + K +GI  +P++YL+FFCLGNRE KK  EYEPSE+P+ D+DY RAQE
Sbjct  593  RTMDMMYSDIFNSFKERGIEEDPRNYLTFFCLGNREVKKPGEYEPSERPEPDSDYIRAQE  652

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVH KMMIVDDEYII+GSANINQRSMDGARDSEIAMGAYQP+HLS R+PARGQ+
Sbjct  653  ARRFMIYVHTKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGAYQPYHLSVREPARGQI  712

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFRMALWYEHLGMLD  F QPES+ECV KVNQIA+  W+LYS E+L  D+P HLL YPI
Sbjct  713  HGFRMALWYEHLGMLDEKFLQPESVECVTKVNQIADKYWDLYSSESLNHDLPGHLLRYPI  772

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            G++  G VTELPG + FPDTKA VLG KS++
Sbjct  773  GISSEGTVTELPGCEFFPDTKARVLGAKSDY  803



>ref|XP_009787005.1| PREDICTED: phospholipase D alpha 1-like isoform X1 [Nicotiana 
sylvestris]
Length=790

 Score =   338 bits (868),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 156/213 (73%), Positives = 183/213 (86%), Gaps = 2/213 (1%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMY  I QA++ KGI  +P++YL+FFC+GNRE KK  EYEPSEKP+ D+DY RAQE
Sbjct  571  RTMEMMYKHIFQAIRDKGIDDHPRNYLTFFCIGNRELKKTGEYEPSEKPEPDSDYERAQE  630

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVH+KMMIVDDEYIIVGSANINQRSMDGARDSEIA+GAYQPHHL+ RQPARGQV
Sbjct  631  ARRFMIYVHSKMMIVDDEYIIVGSANINQRSMDGARDSEIAIGAYQPHHLTTRQPARGQV  690

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFRMALWYEH+GMLD+ F  PES ECV KVNQIA+  W+LY+ E+LE D+P HLL YP+
Sbjct  691  HGFRMALWYEHMGMLDDTFQHPESEECVRKVNQIADKYWDLYTSESLENDLPGHLLRYPV  750

Query  279  GVTENGQVTELPGFQN--FPDTKAPVLGTKSNF  187
            G+T NG +T+LPG  N  FPDTKA V+GTKS++
Sbjct  751  GLTNNGDITDLPGNGNEFFPDTKARVVGTKSDY  783



>gb|ACG80607.1| phospholipase D alpha [Prunus persica]
Length=810

 Score =   339 bits (869),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 155/211 (73%), Positives = 179/211 (85%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM MMY+DI  + K +GI  +P++YL+FFCLGNRE KK  EYEPSE+P+ D+DY RAQE
Sbjct  593  RTMDMMYSDIFNSFKERGIEEDPRNYLTFFCLGNREVKKPGEYEPSERPEPDSDYIRAQE  652

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVH KMMIVDDEYII+GSANINQRSMDGARDSEIAMGAYQP+HLS R+PARGQ+
Sbjct  653  ARRFMIYVHTKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGAYQPYHLSVREPARGQI  712

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFRMALWYEHLGMLD  F QPES+ECV KVNQIA+  W+LYS E+L  D+P HLL YPI
Sbjct  713  HGFRMALWYEHLGMLDEKFLQPESVECVTKVNQIADKYWDLYSSESLNHDLPGHLLRYPI  772

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            G++  G VTELPG + FPDTKA VLG KS++
Sbjct  773  GISSEGTVTELPGCEFFPDTKARVLGAKSDY  803



>gb|KDP33597.1| hypothetical protein JCGZ_07168 [Jatropha curcas]
Length=238

 Score =   321 bits (822),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 148/211 (70%), Positives = 173/211 (82%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMY DI +ALK  GI ANP++YLSFFCLGNRETKK  EY P E P+ D+DYSRAQ+
Sbjct  21   RTMEMMYYDITEALKRNGIKANPREYLSFFCLGNRETKKIGEYAPPETPEPDSDYSRAQQ  80

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVHAKMMIVDDEYII+GSANINQRSMDGARDSEIAMGA+QPHHL+  QPARGQ+
Sbjct  81   ARRFMIYVHAKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGAFQPHHLATAQPARGQI  140

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            +GFR+ALWYEHLG+L+  F  PES EC+  VN+IA+  W  YS E  ++D+  HLL YPI
Sbjct  141  YGFRLALWYEHLGLLEPSFQYPESEECIQLVNKIADELWESYSSEVFDQDLIGHLLRYPI  200

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
             +T NG VT LPGF++FPDTKA +LG  S F
Sbjct  201  EITNNGTVTTLPGFEHFPDTKARILGNISEF  231



>ref|XP_006356207.1| PREDICTED: phospholipase D alpha 1-like isoform X1 [Solanum tuberosum]
 ref|XP_006356208.1| PREDICTED: phospholipase D alpha 1-like isoform X2 [Solanum tuberosum]
 ref|XP_006356209.1| PREDICTED: phospholipase D alpha 1-like isoform X3 [Solanum tuberosum]
Length=809

 Score =   338 bits (868),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 157/211 (74%), Positives = 179/211 (85%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMY  IVQA+ AKGI  +P++YL+FFC+GNRE KK  EYEPSE P+ D++Y RAQE
Sbjct  592  RTMEMMYKYIVQAMNAKGIEEDPRNYLTFFCIGNREVKKSGEYEPSESPEPDSNYMRAQE  651

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVH+KMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQP+HL   +PARGQV
Sbjct  652  ARRFMIYVHSKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPYHLVTSEPARGQV  711

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFRMALWYEHLGMLD  F  PES ECV KVNQIA+  W++YS E+LERD+P HLL YPI
Sbjct  712  HGFRMALWYEHLGMLDETFQHPESEECVRKVNQIADKYWDMYSSESLERDLPGHLLRYPI  771

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            GV   G +TELPG + FPDTKA VLGTKS++
Sbjct  772  GVASEGDITELPGHEFFPDTKARVLGTKSDY  802



>sp|O82549.1|PLDA1_BRAOC RecName: Full=Phospholipase D alpha 1; Short=PLD 1; AltName: 
Full=Choline phosphatase 1; AltName: Full=Phosphatidylcholine-hydrolyzing 
phospholipase D 1; Flags: Precursor [Brassica 
oleracea var. capitata]
 gb|AAC78487.1| phospholipase D1 [Brassica oleracea var. capitata]
 gb|AAD17208.1| phospholipase D1 [Brassica oleracea var. capitata]
 emb|CDY30108.1| BnaC05g37540D [Brassica napus]
Length=810

 Score =   338 bits (868),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 152/211 (72%), Positives = 179/211 (85%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTMQMMY DIVQAL+A+G+  +P++YL+FFCLGNRE KK  EYEP+E+PD D+ Y +AQE
Sbjct  593  RTMQMMYKDIVQALRAQGLEEDPRNYLTFFCLGNREVKKEGEYEPAERPDADSSYMKAQE  652

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVH KMMIVDDEYII+GSANINQRSMDGARDSEIAMG YQPHHLS RQPARGQ+
Sbjct  653  ARRFMIYVHTKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGGYQPHHLSHRQPARGQI  712

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFRM+LWYEHLGMLD  F  P S+EC+ KVN+I++  W+LYS E+LE D+P HLL YP+
Sbjct  713  HGFRMSLWYEHLGMLDETFLDPSSVECIEKVNRISDKYWDLYSSESLEHDLPGHLLRYPV  772

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
             V   G VTE PGF+ FPDTKA +LGTKS++
Sbjct  773  DVDGEGDVTEFPGFEFFPDTKARILGTKSDY  803



>ref|XP_008243731.1| PREDICTED: phospholipase D alpha 1 [Prunus mume]
 ref|XP_008243732.1| PREDICTED: phospholipase D alpha 1 [Prunus mume]
 ref|XP_008243733.1| PREDICTED: phospholipase D alpha 1 [Prunus mume]
Length=810

 Score =   338 bits (867),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 155/211 (73%), Positives = 179/211 (85%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM MMY+DI  + K +GI  +P++YL+FFCLGNRE KK  EYEPSE+P+ D+DY RAQE
Sbjct  593  RTMDMMYSDIFNSFKEQGIEEDPRNYLTFFCLGNREVKKPGEYEPSERPEPDSDYIRAQE  652

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVH KMMIVDDEYII+GSANINQRSMDGARDSEIAMGAYQP+HLS R+PARGQ+
Sbjct  653  ARRFMIYVHTKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGAYQPYHLSVREPARGQI  712

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFRMALWYEHLGMLD  F QPES+ECV KVNQIA+  W+LYS E+L  D+P HLL YPI
Sbjct  713  HGFRMALWYEHLGMLDEKFLQPESVECVTKVNQIADKYWDLYSSESLNHDLPGHLLRYPI  772

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            G++  G VTELPG + FPDTKA VLG KS++
Sbjct  773  GISSEGTVTELPGCEFFPDTKARVLGAKSDY  803



>ref|XP_008454241.1| PREDICTED: phospholipase D alpha 1 [Cucumis melo]
 gb|ABS86615.1| phospholipase D alpha [Cucumis melo var. inodorus]
Length=807

 Score =   338 bits (867),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 154/211 (73%), Positives = 181/211 (86%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMY DIV AL+A G+  +P++YL+FFC+GNRE KK  EYEPSE PD ++DY RAQ+
Sbjct  590  RTMEMMYKDIVLALRANGVEEDPRNYLTFFCVGNREVKKPGEYEPSESPDENSDYLRAQQ  649

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            +RRFMIYVH+KMMIVDDEYIIVGSANINQRSMDGARDSEIAMG YQP+HLSAR+PARGQ+
Sbjct  650  SRRFMIYVHSKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGGYQPYHLSAREPARGQI  709

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFR+ALWYEHLG+L   F  PES+ECV  VNQ+A+  W+LYS ET +RD+P HLL YPI
Sbjct  710  HGFRLALWYEHLGLLHQSFLFPESIECVKTVNQLADKYWDLYSSETFDRDLPGHLLRYPI  769

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
             V+ +GQVTELPGFQ FPDTKA VLG KSN+
Sbjct  770  AVSADGQVTELPGFQFFPDTKARVLGNKSNY  800



>ref|XP_004287315.1| PREDICTED: phospholipase D alpha 1-like [Fragaria vesca subsp. 
vesca]
Length=809

 Score =   338 bits (867),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 156/210 (74%), Positives = 178/210 (85%), Gaps = 0/210 (0%)
 Frame = -3

Query  816  TMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQEA  637
            TM+MMY DI QALK K + ANPK+YL+FFCLGNRE K+  EYEP EKP N T+YSRAQ++
Sbjct  593  TMEMMYKDITQALKNKSLDANPKEYLTFFCLGNREKKRSGEYEPLEKPGNGTNYSRAQQS  652

Query  636  RRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQVH  457
            RRFMIYVHAK MIVDDEYII+GSANINQRSMDGARD+EIAMGAYQP+HLS   PARGQ+H
Sbjct  653  RRFMIYVHAKCMIVDDEYIIIGSANINQRSMDGARDTEIAMGAYQPYHLSTNVPARGQIH  712

Query  456  GFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIG  277
            G RMALWYEHLG+LDN F +PES+ECV KVNQIAE  W LY+ ETLE D+P HLL YP+ 
Sbjct  713  GLRMALWYEHLGLLDNTFLEPESVECVTKVNQIAEKLWKLYTSETLEGDLPGHLLPYPVK  772

Query  276  VTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            +TENG VTELPG + FPDTKA VLGT+S+ 
Sbjct  773  ITENGDVTELPGVEFFPDTKAKVLGTRSDL  802



>emb|CDY21865.1| BnaC01g35830D [Brassica napus]
Length=812

 Score =   338 bits (866),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 152/211 (72%), Positives = 178/211 (84%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RT++MMY D+ QAL+A+G+  +P++YL+FFCLGNRE KK  EYEP+E+PD DTDY RAQE
Sbjct  595  RTLEMMYKDVSQALRAQGLEEDPRNYLTFFCLGNREVKKEGEYEPAERPDPDTDYMRAQE  654

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVH+KMMIVDDEYIIVGSANINQRSMDGARDSEIAMG YQPHHLS RQPARGQV
Sbjct  655  ARRFMIYVHSKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGGYQPHHLSHRQPARGQV  714

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFRM+LWYEHLGMLD  F  P S+EC+ KVN+IA+  W+ YS E+LE D+P HLL YPI
Sbjct  715  HGFRMSLWYEHLGMLDQTFLDPSSLECIEKVNRIADKYWDFYSSESLEHDLPGHLLRYPI  774

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
             V   G +TELPGF+ FPDTKA +LG K ++
Sbjct  775  SVDNEGNITELPGFEFFPDTKARILGNKVDY  805



>sp|P86387.1|PLDA1_CARPA RecName: Full=Phospholipase D alpha 1; Short=CpPLD1; AltName: 
Full=Choline phosphatase 1; AltName: Full=Phosphatidylcholine-hydrolyzing 
phospholipase D 1 [Carica papaya]
Length=808

 Score =   337 bits (864),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 154/211 (73%), Positives = 181/211 (86%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMY DI+QAL+AK    +P++YL+FFCLGNRE KK  EYEPSE+P++D+DY RAQE
Sbjct  591  RTMEMMYKDIIQALRAKDREEDPRNYLTFFCLGNREVKKSGEYEPSERPEDDSDYIRAQE  650

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVH KMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQP+HL+  QPARGQ+
Sbjct  651  ARRFMIYVHTKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPYHLTINQPARGQI  710

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFRMALWYEHLGMLD+ F +PE++ECV KVN++A   W+LY+ E LE D+P HLL YPI
Sbjct  711  HGFRMALWYEHLGMLDDTFLEPENIECVQKVNRVAGKYWDLYASELLEHDLPGHLLRYPI  770

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            GV+  G VTELPG + FPDTKA VLG KS++
Sbjct  771  GVSSEGDVTELPGTEFFPDTKARVLGAKSDY  801



>emb|CDX97705.1| BnaA05g23740D [Brassica napus]
Length=810

 Score =   337 bits (864),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 152/211 (72%), Positives = 178/211 (84%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTMQMMY DIVQAL+A+G+  +P++YL+FFCLGNRE KK  EYEP+E+PD D+ Y RAQE
Sbjct  593  RTMQMMYKDIVQALRAQGLEEDPRNYLTFFCLGNREVKKEGEYEPAERPDADSSYMRAQE  652

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVH KMMIVDDEYII+GSANINQRSMDGARDSEIAMG YQPH LS RQPARGQ+
Sbjct  653  ARRFMIYVHTKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGGYQPHQLSHRQPARGQI  712

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFRM+LWYEHLGMLD  F  P S+EC+ KVN+I++  W+LYS E+LE D+P HLL YP+
Sbjct  713  HGFRMSLWYEHLGMLDETFLDPSSVECIEKVNRISDKYWDLYSSESLEHDLPGHLLRYPV  772

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
             V   G VTE PGF+ FPDTKA +LGTKS++
Sbjct  773  DVDAEGDVTEFPGFEFFPDTKARILGTKSDY  803



>ref|XP_009146200.1| PREDICTED: phospholipase D alpha 1 [Brassica rapa]
Length=810

 Score =   337 bits (864),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 152/211 (72%), Positives = 178/211 (84%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTMQMMY DIVQAL+A+G+  +P++YL+FFCLGNRE KK  EYEP+E+PD D+ Y RAQE
Sbjct  593  RTMQMMYKDIVQALRAQGLEEDPRNYLTFFCLGNREVKKEGEYEPAERPDADSSYMRAQE  652

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVH KMMIVDDEYII+GSANINQRSMDGARDSEIAMG YQPH LS RQPARGQ+
Sbjct  653  ARRFMIYVHTKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGGYQPHQLSHRQPARGQI  712

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFRM+LWYEHLGMLD  F  P S+EC+ KVN+I++  W+LYS E+LE D+P HLL YP+
Sbjct  713  HGFRMSLWYEHLGMLDETFLDPSSVECIEKVNRISDKYWDLYSSESLEHDLPGHLLRYPV  772

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
             V   G VTE PGF+ FPDTKA +LGTKS++
Sbjct  773  DVDAEGDVTEFPGFEFFPDTKARILGTKSDY  803



>gb|ACL53520.1| unknown [Zea mays]
Length=743

 Score =   335 bits (859),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 161/211 (76%), Positives = 186/211 (88%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMYTDI QAL+A GI ANPKDYL+FFCLGNRE K+  EYEP E P+ DTDY RAQE
Sbjct  526  RTMEMMYTDIAQALEANGIEANPKDYLTFFCLGNREVKQEGEYEPEEHPEPDTDYIRAQE  585

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVH KMMIVDDEYII+GSANINQRSMDGARDSEIAMGAYQP+HL+ RQPARGQ+
Sbjct  586  ARRFMIYVHTKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGAYQPYHLATRQPARGQI  645

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFRM+LWYEHLGML++ F +PES+ECV KVN++AE  W+LYS + LE+D+P HLLSYPI
Sbjct  646  HGFRMSLWYEHLGMLEDVFQRPESVECVQKVNEVAEKYWDLYSSDDLEQDLPGHLLSYPI  705

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            GVT +G VTELPG +NFPDT+A VLG KS++
Sbjct  706  GVTADGSVTELPGMENFPDTRARVLGNKSDY  736



>sp|O04865.1|PLDA1_VIGUN RecName: Full=Phospholipase D alpha 1; Short=PLD alpha 1; AltName: 
Full=Choline phosphatase 1; AltName: Full=Phosphatidylcholine-hydrolyzing 
phospholipase D 1 [Vigna unguiculata]
 gb|AAB51392.1| phospholipase D [Vigna unguiculata]
Length=809

 Score =   337 bits (863),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 152/211 (72%), Positives = 182/211 (86%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RT++MMY D+VQAL+AKG   +P++YL+FFCLGNRE KK  EYEP+E+P+ D+DY RAQE
Sbjct  592  RTIEMMYKDVVQALRAKGSDEDPRNYLTFFCLGNREVKKSGEYEPAEQPEPDSDYQRAQE  651

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVH KMMIVDDEYII+GSANINQRSMDGARDSEIAMG YQP+HL+  QPARGQV
Sbjct  652  ARRFMIYVHTKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGGYQPYHLANTQPARGQV  711

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            +GFRM+LWYEHLGML + F +PES EC+ KVNQIA+  W+LYS E+LERD+P HLL YPI
Sbjct  712  YGFRMSLWYEHLGMLHDTFQRPESEECINKVNQIADKYWDLYSSESLERDLPGHLLRYPI  771

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            GV   G+VTELPGF+ FPDTKA +LG K+++
Sbjct  772  GVASEGEVTELPGFEFFPDTKARILGAKADY  802



>sp|P55939.2|PLDA2_BRAOC RecName: Full=Phospholipase D alpha 2; Short=PLD 2; AltName: 
Full=Choline phosphatase 2; AltName: Full=Phosphatidylcholine-hydrolyzing 
phospholipase D 2; Flags: Precursor [Brassica 
oleracea var. capitata]
 gb|AAC78486.1| phospholipase D2 [Brassica oleracea var. capitata]
 gb|AAC79125.1| phospholipase D [Brassica oleracea var. capitata]
 gb|AAD17209.1| phospholipase D2 [Brassica oleracea var. capitata]
Length=812

 Score =   337 bits (863),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 151/211 (72%), Positives = 178/211 (84%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RT++MMY D+ QAL+A+G+  +P++YL+FFCLGNRE KK  EYEP+E+PD DTDY RAQE
Sbjct  595  RTLEMMYKDVTQALRAQGLEEDPRNYLTFFCLGNREVKKEGEYEPAERPDPDTDYMRAQE  654

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVH+KMMIVDDEYIIVGSANINQRSMDGARDSEIAMG YQPHHLS RQPARGQV
Sbjct  655  ARRFMIYVHSKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGGYQPHHLSHRQPARGQV  714

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFRM+LWYEHLGMLD  F  P S+EC+ KVN+IA+  W+ YS E+LE D+P HLL YPI
Sbjct  715  HGFRMSLWYEHLGMLDETFLDPSSLECIEKVNRIADKYWDFYSSESLEHDLPGHLLRYPI  774

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
             V   G +TELPGF+ FPD+KA +LG K ++
Sbjct  775  SVDNEGNITELPGFEFFPDSKARILGNKVDY  805



>gb|AGV22364.1| phospholipase D4 [Brassica napus]
Length=812

 Score =   337 bits (863),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 151/211 (72%), Positives = 178/211 (84%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RT++MMY D+ QAL+A+G+  +P++YL+FFCLGNRE KK  EYEP+E+PD DTDY RAQE
Sbjct  595  RTLEMMYKDVTQALRAQGLEEDPRNYLTFFCLGNREVKKEGEYEPAERPDPDTDYMRAQE  654

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVH+KMMIVDDEYIIVGSANINQRSMDGARDSEIAMG YQPHHLS RQPARGQV
Sbjct  655  ARRFMIYVHSKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGGYQPHHLSHRQPARGQV  714

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFRM+LWYEHLGMLD  F  P S+EC+ KVN+IA+  W+ YS E+LE D+P HLL YPI
Sbjct  715  HGFRMSLWYEHLGMLDETFLDPSSLECIEKVNRIADKYWDFYSSESLEHDLPGHLLRYPI  774

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
             V   G ++ELPGF+ FPDTKA +LG K ++
Sbjct  775  SVDNEGNISELPGFEFFPDTKARILGNKVDY  805



>ref|NP_001105686.1| phospholipase D alpha 1 [Zea mays]
 sp|Q43270.1|PLDA1_MAIZE RecName: Full=Phospholipase D alpha 1; Short=PLD alpha 1; AltName: 
Full=Choline phosphatase 1; AltName: Full=Phosphatidylcholine-hydrolyzing 
phospholipase D 1 [Zea mays]
 dbj|BAA11135.1| phospholipase D [Zea mays]
Length=812

 Score =   336 bits (862),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 161/211 (76%), Positives = 186/211 (88%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMYTDI QAL+A GI ANPKDYL+FFCLGNRE K+  EYEP E P+ DTDY RAQE
Sbjct  595  RTMEMMYTDIAQALEANGIEANPKDYLTFFCLGNREVKQEGEYEPEEHPEPDTDYIRAQE  654

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVH KMMIVDDEYII+GSANINQRSMDGARDSEIAMGAYQP+HL+ RQPARGQ+
Sbjct  655  ARRFMIYVHTKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGAYQPYHLATRQPARGQI  714

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFRM+LWYEHLGML++ F +PES+ECV KVN++AE  W+LYS + LE+D+P HLLSYPI
Sbjct  715  HGFRMSLWYEHLGMLEDVFQRPESVECVQKVNEVAEKYWDLYSSDDLEQDLPGHLLSYPI  774

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            GVT +G VTELPG +NFPDT+A VLG KS++
Sbjct  775  GVTADGSVTELPGMENFPDTRARVLGNKSDY  805



>ref|XP_010090252.1| Phospholipase D alpha 1 [Morus notabilis]
 gb|EXB39153.1| Phospholipase D alpha 1 [Morus notabilis]
Length=788

 Score =   335 bits (860),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 155/210 (74%), Positives = 180/210 (86%), Gaps = 0/210 (0%)
 Frame = -3

Query  816  TMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQEA  637
            TM+MMY D++QAL AKG+ ANPKDYL+FFCLGNRE KK  EYEP EKP++ +DYSRAQ+ 
Sbjct  572  TMEMMYKDVLQALHAKGLDANPKDYLAFFCLGNREMKKHGEYEPPEKPEHGSDYSRAQQY  631

Query  636  RRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQVH  457
            R+FMIYVHAKMMIVDDEYII+GSANINQRSMDGARD+EIAMGAYQPH LS  +PARGQ+H
Sbjct  632  RKFMIYVHAKMMIVDDEYIIIGSANINQRSMDGARDTEIAMGAYQPHRLSTTEPARGQIH  691

Query  456  GFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIG  277
            G R+ALWYEH+G LD  F +PES+ECV KVNQIAENNW+LYS ET + D+P+HLLSYPI 
Sbjct  692  GHRLALWYEHMGKLDGIFLKPESVECVRKVNQIAENNWDLYSCETFDDDLPSHLLSYPIR  751

Query  276  VTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            V ENG+VT LP  + FPDTKA VLG+KS  
Sbjct  752  VNENGEVTTLPNTEYFPDTKARVLGSKSEI  781



>dbj|BAE79735.1| phospholipase D alpha 2 [Arachis hypogaea]
 dbj|BAE79737.1| phospholipase D alpha 2 [Arachis hypogaea]
Length=807

 Score =   336 bits (861),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 151/211 (72%), Positives = 183/211 (87%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMY DIV+AL AKGI+ +P++YL+FFCLGNRE KK  EYEPSE+PD D+DY +AQE
Sbjct  590  RTMEMMYKDIVEALNAKGIVEDPRNYLTFFCLGNREVKKPGEYEPSERPDPDSDYIKAQE  649

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
             RRFMIYVHAKMMIVDDEYII+GSANINQRSMDGARDSEIAMGAYQP++LSAR+ ARGQ+
Sbjct  650  NRRFMIYVHAKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGAYQPYYLSARELARGQI  709

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFR+ALWYEHLGM+   F QPES EC+  VNQ+A+  W+LYS E+L+ D+P HLL YP+
Sbjct  710  HGFRLALWYEHLGMIRESFLQPESEECIKMVNQVADKYWDLYSSESLDHDLPGHLLRYPV  769

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            G++ +G VTELPGF+ FPDTK  VLGTK+++
Sbjct  770  GISGDGTVTELPGFEFFPDTKGRVLGTKTDY  800



>ref|XP_008673445.1| PREDICTED: phospholipase D alpha 1 isoform X1 [Zea mays]
 ref|XP_008673446.1| PREDICTED: phospholipase D alpha 1 isoform X1 [Zea mays]
 gb|ACN25900.1| unknown [Zea mays]
 gb|ACN27927.1| unknown [Zea mays]
 gb|ACN28359.1| unknown [Zea mays]
 gb|ACN29073.1| unknown [Zea mays]
 tpg|DAA53244.1| TPA: phospholipase D family protein [Zea mays]
Length=812

 Score =   336 bits (861),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 161/211 (76%), Positives = 186/211 (88%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMYTDI QAL+A GI ANPKDYL+FFCLGNRE K+  EYEP E P+ DTDY RAQE
Sbjct  595  RTMEMMYTDIAQALEANGIEANPKDYLTFFCLGNREVKQEGEYEPEEHPEPDTDYIRAQE  654

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVH KMMIVDDEYII+GSANINQRSMDGARDSEIAMGAYQP+HL+ RQPARGQ+
Sbjct  655  ARRFMIYVHTKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGAYQPYHLATRQPARGQI  714

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFRM+LWYEHLGML++ F +PES+ECV KVN++AE  W+LYS + LE+D+P HLLSYPI
Sbjct  715  HGFRMSLWYEHLGMLEDVFQRPESVECVQKVNEVAEKYWDLYSSDDLEQDLPGHLLSYPI  774

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            GVT +G VTELPG +NFPDT+A VLG KS++
Sbjct  775  GVTADGSVTELPGMENFPDTRARVLGNKSDY  805



>gb|AIE90138.1| phospholipase D1, partial [Brassica napus]
Length=810

 Score =   336 bits (861),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 151/211 (72%), Positives = 178/211 (84%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTMQMMY DIVQAL+A+G+  +P++YL+FFCLGNRE KK  EYEP+E+PD D+ Y +AQE
Sbjct  593  RTMQMMYKDIVQALRAQGLEEDPRNYLTFFCLGNREVKKEREYEPAERPDADSSYMKAQE  652

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVH KMMIVDDEYII+GSANINQRSMDGARDSEIAMG YQPHHLS RQPARGQ+
Sbjct  653  ARRFMIYVHTKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGGYQPHHLSHRQPARGQI  712

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFRM+LWYEHLGMLD  F  P S+EC+ KVN+I++  W+LYS E+LE D+P HLL YP+
Sbjct  713  HGFRMSLWYEHLGMLDETFLDPSSVECIEKVNRISDKYWDLYSSESLEHDLPGHLLRYPV  772

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
             V     VTE PGF+ FPDTKA +LGTKS++
Sbjct  773  DVDGESDVTEFPGFEFFPDTKARILGTKSDY  803



>gb|ACL53693.1| unknown [Zea mays]
Length=812

 Score =   336 bits (861),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 161/211 (76%), Positives = 186/211 (88%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMYTDI QAL+A GI ANPKDYL+FFCLGNRE K+  EYEP E P+ DTDY RAQE
Sbjct  595  RTMEMMYTDIAQALEANGIEANPKDYLTFFCLGNREVKQEGEYEPEEHPEPDTDYIRAQE  654

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVH KMMIVDDEYII+GSANINQRSMDGARDSEIAMGAYQP+HL+ RQPARGQ+
Sbjct  655  ARRFMIYVHTKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGAYQPYHLATRQPARGQI  714

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFRM+LWYEHLGML++ F +PES+ECV KVN++AE  W+LYS + LE+D+P HLLSYPI
Sbjct  715  HGFRMSLWYEHLGMLEDVFQRPESVECVQKVNEVAEKYWDLYSSDDLEQDLPGHLLSYPI  774

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            GVT +G VTELPG +NFPDT+A VLG KS++
Sbjct  775  GVTADGSVTELPGMENFPDTRARVLGNKSDY  805



>gb|ACR35730.1| unknown [Zea mays]
Length=812

 Score =   336 bits (861),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 161/211 (76%), Positives = 186/211 (88%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMYTDI QAL+A GI ANPKDYL+FFCLGNRE K+  EYEP E P+ DTDY RAQE
Sbjct  595  RTMEMMYTDIAQALEANGIEANPKDYLTFFCLGNREVKQEGEYEPEEHPEPDTDYIRAQE  654

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVH KMMIVDDEYII+GSANINQRSMDGARDSEIAMGAYQP+HL+ RQPARGQ+
Sbjct  655  ARRFMIYVHTKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGAYQPYHLATRQPARGQI  714

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFRM+LWYEHLGML++ F +PES+ECV KVN++AE  W+LYS + LE+D+P HLLSYPI
Sbjct  715  HGFRMSLWYEHLGMLEDVFQRPESVECVQKVNEVAEKYWDLYSSDDLEQDLPGHLLSYPI  774

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            GVT +G VTELPG +NFPDT+A VLG KS++
Sbjct  775  GVTADGSVTELPGMENFPDTRARVLGNKSDY  805



>ref|XP_008673447.1| PREDICTED: phospholipase D alpha 1 isoform X2 [Zea mays]
Length=810

 Score =   336 bits (861),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 161/211 (76%), Positives = 186/211 (88%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMYTDI QAL+A GI ANPKDYL+FFCLGNRE K+  EYEP E P+ DTDY RAQE
Sbjct  593  RTMEMMYTDIAQALEANGIEANPKDYLTFFCLGNREVKQEGEYEPEEHPEPDTDYIRAQE  652

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVH KMMIVDDEYII+GSANINQRSMDGARDSEIAMGAYQP+HL+ RQPARGQ+
Sbjct  653  ARRFMIYVHTKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGAYQPYHLATRQPARGQI  712

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFRM+LWYEHLGML++ F +PES+ECV KVN++AE  W+LYS + LE+D+P HLLSYPI
Sbjct  713  HGFRMSLWYEHLGMLEDVFQRPESVECVQKVNEVAEKYWDLYSSDDLEQDLPGHLLSYPI  772

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            GVT +G VTELPG +NFPDT+A VLG KS++
Sbjct  773  GVTADGSVTELPGMENFPDTRARVLGNKSDY  803



>ref|XP_009408983.1| PREDICTED: phospholipase D alpha 1-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009408984.1| PREDICTED: phospholipase D alpha 1-like [Musa acuminata subsp. 
malaccensis]
Length=809

 Score =   335 bits (860),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 161/211 (76%), Positives = 187/211 (89%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMYTD++QAL+AKGI ANPKDYL+FFCLGNRE KK  EYEP E+P+ DT+YS+AQE
Sbjct  592  RTMEMMYTDVIQALQAKGIEANPKDYLTFFCLGNREVKKSGEYEPEEQPEQDTNYSKAQE  651

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVH KMMIVDDEYII+GSANINQRSMDG+RDSEIAMGAYQP+HLS R+PARGQ+
Sbjct  652  ARRFMIYVHTKMMIVDDEYIIIGSANINQRSMDGSRDSEIAMGAYQPYHLSTREPARGQI  711

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFR+ALWYEHLGMLD+ F QPES ECV KVN+IA+  W+LYS + LE D+P HLLSYPI
Sbjct  712  HGFRLALWYEHLGMLDDAFLQPESSECVQKVNRIADKYWDLYSSDDLEHDLPGHLLSYPI  771

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            GV+  G+VTELPG + FPDTKA VLG KS++
Sbjct  772  GVSAEGEVTELPGTEFFPDTKARVLGAKSDY  802



>gb|AGV22363.1| phospholipase D3 [Brassica napus]
Length=810

 Score =   335 bits (860),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 151/211 (72%), Positives = 178/211 (84%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTMQMMY DIVQAL+A+G+  +P++YL+FFCLGNRE KK  EYEP+E+PD D+ Y +AQE
Sbjct  593  RTMQMMYKDIVQALRAQGLEEDPRNYLTFFCLGNREVKKEGEYEPAERPDADSSYMKAQE  652

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVH KM IVDDEYII+GSANINQRSMDGARDSEIAMG YQPHHLS RQPARGQ+
Sbjct  653  ARRFMIYVHTKMTIVDDEYIIIGSANINQRSMDGARDSEIAMGGYQPHHLSHRQPARGQI  712

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFRM+LWYEHLGMLD  F  P S+EC+ KVN+I++  W+LYS E+LE D+P HLL YP+
Sbjct  713  HGFRMSLWYEHLGMLDETFLDPSSVECIEKVNRISDKYWDLYSSESLEHDLPGHLLRYPV  772

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
             V   G VTE PGF+ FPDTKA +LGTKS++
Sbjct  773  DVDCEGDVTEFPGFEFFPDTKARILGTKSDY  803



>ref|XP_007204652.1| hypothetical protein PRUPE_ppa001528mg [Prunus persica]
 gb|EMJ05851.1| hypothetical protein PRUPE_ppa001528mg [Prunus persica]
Length=807

 Score =   335 bits (859),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 154/211 (73%), Positives = 185/211 (88%), Gaps = 1/211 (0%)
 Frame = -3

Query  816  TMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQEA  637
            TM+MMY DIVQAL+AKG+ AN +DYL+FFCLGNRE K+  EYEP EKP++DTDYSRAQ+A
Sbjct  590  TMEMMYKDIVQALQAKGLEANARDYLTFFCLGNREKKRSGEYEPPEKPEHDTDYSRAQQA  649

Query  636  RRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQVH  457
            RRFMIYVHAK+MIVDDEYII+GSANINQRSMDGARD+EIAMGAYQP+HLS R+ ARGQ+H
Sbjct  650  RRFMIYVHAKVMIVDDEYIIIGSANINQRSMDGARDTEIAMGAYQPYHLSTREAARGQIH  709

Query  456  GFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIG  277
            G R+ALWYEHLG+LD+ F +PES++C+ KVNQIAE +W+L+S ETL+ D+P HLLSYPI 
Sbjct  710  GLRLALWYEHLGLLDDTFLEPESVKCIRKVNQIAEKHWDLFSCETLDGDLPGHLLSYPIR  769

Query  276  V-TENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            V   NG++TELPG + FPDTKA VLG+KS  
Sbjct  770  VAAANGEITELPGTEFFPDTKARVLGSKSEL  800



>ref|XP_006392903.1| hypothetical protein EUTSA_v10011246mg [Eutrema salsugineum]
 gb|ESQ30189.1| hypothetical protein EUTSA_v10011246mg [Eutrema salsugineum]
Length=813

 Score =   335 bits (859),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 152/212 (72%), Positives = 179/212 (84%), Gaps = 1/212 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIA-NPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQ  643
            RTM+MMY D+++AL+ KG+   +P+DYL+FFCLGNRE KK  EY PSEKP+ DTDY RAQ
Sbjct  595  RTMEMMYKDVIEALREKGLEEEDPRDYLTFFCLGNREVKKDGEYVPSEKPEPDTDYIRAQ  654

Query  642  EARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQ  463
            EARRFMIYVH KMMIVDDEYII+GSANINQRSMDGARDSEIAMG YQP+HLS RQPARGQ
Sbjct  655  EARRFMIYVHTKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGGYQPYHLSTRQPARGQ  714

Query  462  VHGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYP  283
            +HGFRM+LWYEHLGMLD  F  P S EC+ KVN++A+  W+LYS E+LE D+P HLL YP
Sbjct  715  IHGFRMSLWYEHLGMLDETFLNPSSQECIKKVNRVADMYWDLYSSESLEHDLPGHLLRYP  774

Query  282  IGVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            IGV+  G +TELPGF+ FPDTKA +LG KS++
Sbjct  775  IGVSSQGDITELPGFEFFPDTKARILGAKSDY  806



>ref|XP_009115281.1| PREDICTED: phospholipase D alpha 2 [Brassica rapa]
Length=812

 Score =   335 bits (858),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 150/211 (71%), Positives = 177/211 (84%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RT++MMY D+ QAL+A+G+  +P++YL+ FCLGNRE KK  EYEP+E+PD DTDY RAQE
Sbjct  595  RTLEMMYKDVTQALRAQGLEEDPRNYLTLFCLGNREVKKEGEYEPAERPDPDTDYMRAQE  654

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVH+KMMIVDDEYIIVGSANINQRSMDGARDSEIAMG YQPHHLS RQPARGQV
Sbjct  655  ARRFMIYVHSKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGGYQPHHLSHRQPARGQV  714

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFRM+LWYEHLGMLD  F  P S+EC+ KVN+IA+  W+ YS E+LE D+P HLL YPI
Sbjct  715  HGFRMSLWYEHLGMLDETFLDPSSLECIEKVNRIADKYWDFYSSESLEHDLPGHLLRYPI  774

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
             V   G ++ELPGF+ FPDTKA +LG K ++
Sbjct  775  SVDNEGNISELPGFEFFPDTKARILGNKVDY  805



>ref|XP_012092883.1| PREDICTED: phospholipase D alpha 1-like, partial [Jatropha curcas]
Length=379

 Score =   322 bits (825),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 148/211 (70%), Positives = 173/211 (82%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMY DI +ALK  GI ANP++YLSFFCLGNRETKK  EY P E P+ D+DYSRAQ+
Sbjct  162  RTMEMMYYDITEALKRNGIKANPREYLSFFCLGNRETKKIGEYAPPETPEPDSDYSRAQQ  221

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVHAKMMIVDDEYII+GSANINQRSMDGARDSEIAMGA+QPHHL+  QPARGQ+
Sbjct  222  ARRFMIYVHAKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGAFQPHHLATAQPARGQI  281

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            +GFR+ALWYEHLG+L+  F  PES EC+  VN+IA+  W  YS E  ++D+  HLL YPI
Sbjct  282  YGFRLALWYEHLGLLEPSFQYPESEECIQLVNKIADELWESYSSEVFDQDLIGHLLRYPI  341

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
             +T NG VT LPGF++FPDTKA +LG  S F
Sbjct  342  EITNNGTVTTLPGFEHFPDTKARILGNISEF  372



>ref|XP_008385550.1| PREDICTED: phospholipase D alpha 1-like [Malus domestica]
Length=809

 Score =   334 bits (857),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 154/210 (73%), Positives = 182/210 (87%), Gaps = 0/210 (0%)
 Frame = -3

Query  816  TMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQEA  637
            TM MMY DIV ALKAKGI ANPKDYL+FFCLGNRE K   EYEP EKP++ +DY RAQ+A
Sbjct  593  TMDMMYRDIVXALKAKGIEANPKDYLAFFCLGNREKKLPGEYEPPEKPEHGSDYXRAQQA  652

Query  636  RRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQVH  457
            RRFMIYVHAK+MIVDDEYII+GSANINQRSMDGARDSEIAMGAYQP+HLS  +PARGQ+H
Sbjct  653  RRFMIYVHAKLMIVDDEYIIIGSANINQRSMDGARDSEIAMGAYQPYHLSTGKPARGQIH  712

Query  456  GFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIG  277
            G RM+LWYEHLG+LD+ F +PE++EC  KVNQIA+ +W+LYS +TL+ D+P HLLSYPI 
Sbjct  713  GLRMSLWYEHLGLLDDTFLEPENVECFRKVNQIADQHWDLYSCDTLDGDLPGHLLSYPIA  772

Query  276  VTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
             TE+G+VTELPG + FPDTKA +LG+KS+ 
Sbjct  773  XTEDGEVTELPGTEFFPDTKARILGSKSDL  802



>ref|XP_004486668.1| PREDICTED: phospholipase D alpha 1-like isoform X1 [Cicer arietinum]
 ref|XP_004486669.1| PREDICTED: phospholipase D alpha 1-like isoform X2 [Cicer arietinum]
 ref|XP_004486670.1| PREDICTED: phospholipase D alpha 1-like isoform X3 [Cicer arietinum]
Length=809

 Score =   334 bits (856),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 153/211 (73%), Positives = 178/211 (84%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM MMY D+++AL AKGI  +P++YL+FFCLGNRE  K  EY P+EKP+ DTDY RAQE
Sbjct  592  RTMDMMYKDVIEALAAKGIEEDPRNYLTFFCLGNREVVKEGEYVPTEKPEPDTDYMRAQE  651

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQP+HL+ RQPARGQ+
Sbjct  652  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPYHLANRQPARGQI  711

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFRM+LWYEHLGML + F  PE+ +C+ KVNQI +  W+LYS ETLE D+P HLL YPI
Sbjct  712  HGFRMSLWYEHLGMLHDSFLHPETEDCIRKVNQIGDKYWDLYSSETLEHDLPGHLLRYPI  771

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            G++  G VTELPGF+ FPDTKA VLG K ++
Sbjct  772  GISGEGNVTELPGFEFFPDTKARVLGEKVDY  802



>gb|AAP03643.1| phopholipase D [Mirabilis jalapa]
Length=578

 Score =   328 bits (840),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 150/212 (71%), Positives = 179/212 (84%), Gaps = 1/212 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM MMY D++ AL+ KGI  +P++YL+FFCL NRE KK  EYEP+E+P+ D+DY +AQ+
Sbjct  360  RTMSMMYKDVIAALQDKGIEEDPRNYLTFFCLANREVKKDGEYEPAEQPEPDSDYEKAQQ  419

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSAR-QPARGQ  463
             RRFMIYVH+KMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQP+HL+ R QPA+GQ
Sbjct  420  NRRFMIYVHSKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPYHLATRNQPAQGQ  479

Query  462  VHGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYP  283
            +HGFRMALWYEHLGMLD  F QP S+ECV KVN  A+  W+LYS E+LE D+P HLL YP
Sbjct  480  IHGFRMALWYEHLGMLDELFNQPASVECVEKVNHAADRYWDLYSSESLEEDLPGHLLRYP  539

Query  282  IGVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            IGV+  G++TELPGF+ FPDT A VLGTKS++
Sbjct  540  IGVSSEGEITELPGFECFPDTNAKVLGTKSDY  571



>gb|ABU54776.1| phospholipase D alpha 1 precursor [Helianthus annuus]
Length=810

 Score =   333 bits (855),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 155/212 (73%), Positives = 180/212 (85%), Gaps = 1/212 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMY DIV+AL+A+G+  +P+DYL+FFCLGNRE KK  EYEPSE+PD D+DY +AQ 
Sbjct  592  RTMEMMYKDIVRALEAEGLQDDPRDYLTFFCLGNREVKKSGEYEPSERPDPDSDYEKAQA  651

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSAR-QPARGQ  463
            ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQP+HLS R +PARGQ
Sbjct  652  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPYHLSTRSEPARGQ  711

Query  462  VHGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYP  283
            +HGFRMALWYEHLGMLD+ F  PES ECV KVN +A+  W+L++ E LE+D+P HLL YP
Sbjct  712  IHGFRMALWYEHLGMLDDTFQNPESTECVKKVNHMADKYWDLFASENLEQDLPGHLLRYP  771

Query  282  IGVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            IGV   G VTELPG + FPDTKA VLG K ++
Sbjct  772  IGVASEGNVTELPGTEFFPDTKARVLGGKVDY  803



>emb|CDY60551.1| BnaA05g35700D [Brassica napus]
Length=812

 Score =   333 bits (855),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 152/212 (72%), Positives = 178/212 (84%), Gaps = 1/212 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIA-NPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQ  643
            RTM+MMY D+++AL+ KG+   +P+DYL+FFCLGNRETKK  EY PSEKP+ D+DY RAQ
Sbjct  594  RTMEMMYKDVIKALRDKGLEGEDPRDYLTFFCLGNRETKKDGEYVPSEKPEPDSDYMRAQ  653

Query  642  EARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQ  463
            EARRFMIYVH KMMIVDDEYII+GSANINQRSMDGARDSEIAMG YQP+HLS RQPARG 
Sbjct  654  EARRFMIYVHTKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGGYQPYHLSIRQPARGH  713

Query  462  VHGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYP  283
            +HGFRM+LWYEHLGMLD  F  P S ECV KVN+IA+  W+LYS E+LE D+P HLL YP
Sbjct  714  IHGFRMSLWYEHLGMLDETFLDPSSQECVQKVNRIADKYWDLYSSESLEHDLPGHLLRYP  773

Query  282  IGVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            IG+   G +TELPG + FPDTKA +LGTKS++
Sbjct  774  IGIASQGDITELPGCECFPDTKARILGTKSDY  805



>gb|EYU21635.1| hypothetical protein MIMGU_mgv1a001489mg [Erythranthe guttata]
 gb|EYU21636.1| hypothetical protein MIMGU_mgv1a001489mg [Erythranthe guttata]
Length=809

 Score =   333 bits (855),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 153/211 (73%), Positives = 176/211 (83%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMY DI++AL AKGI  +P++YL+FFCLGNRE KK  EYEPSE PD DTDY  AQ 
Sbjct  592  RTMEMMYKDIIEALNAKGIEEDPRNYLTFFCLGNREVKKSGEYEPSETPDPDTDYQMAQA  651

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVHAKMMIVDDEYIIVGSANINQRS+DGARDSEIAMGAYQPHHL+  +PA GQV
Sbjct  652  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSLDGARDSEIAMGAYQPHHLATHEPAMGQV  711

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFRMALWYEHLGMLD+ F  PES ECV KVN IA+  W+LY+ + LERD+P HLL YP+
Sbjct  712  HGFRMALWYEHLGMLDDTFLHPESEECVSKVNGIADKYWDLYASDELERDLPGHLLRYPV  771

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
             ++  G +TELPG + FPDTKA VLG KS++
Sbjct  772  ALSSEGVITELPGMEFFPDTKARVLGAKSDY  802



>ref|XP_006306783.1| hypothetical protein CARUB_v10008323mg, partial [Capsella rubella]
 gb|EOA39681.1| hypothetical protein CARUB_v10008323mg, partial [Capsella rubella]
Length=813

 Score =   333 bits (855),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 150/212 (71%), Positives = 178/212 (84%), Gaps = 1/212 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIA-NPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQ  643
            RTM+MMY D+++AL+ KG+   +P+DYL+FFCLGNRE KK  EY+PSEKP+ DTDY RAQ
Sbjct  595  RTMEMMYKDVIKALREKGLEGEDPRDYLTFFCLGNREVKKDGEYQPSEKPEPDTDYIRAQ  654

Query  642  EARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQ  463
            EARRFMIYVH KMMIVDDEYII+GSANINQRSMDGARDSEIAMG YQP+HLS RQPARGQ
Sbjct  655  EARRFMIYVHTKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGGYQPYHLSTRQPARGQ  714

Query  462  VHGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYP  283
            +HGFRM+LWYEHLGMLD  F  P S EC+ KVN++A+  W+LYS E+LE D+P HLL YP
Sbjct  715  IHGFRMSLWYEHLGMLDETFLDPSSQECIQKVNRVADKYWDLYSSESLEHDLPGHLLRYP  774

Query  282  IGVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            IG+   G +TELPG + FPDTKA +LG KS++
Sbjct  775  IGIASEGNITELPGCEFFPDTKARILGVKSDY  806



>ref|XP_008777837.1| PREDICTED: phospholipase D alpha 1-like [Phoenix dactylifera]
Length=859

 Score =   334 bits (857),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 150/211 (71%), Positives = 184/211 (87%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMY DI +AL+AKG+ ANPKDYLSFFCLGNRE  KG EY+  E P+ DTDY+RAQ+
Sbjct  642  RTMEMMYADIAEALQAKGLRANPKDYLSFFCLGNREVNKGGEYQAEEHPEPDTDYNRAQQ  701

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVHAKMMIVDDEY+I+GSANINQRSMDG RDSEIAMGAYQP++L+ RQP +GQ+
Sbjct  702  ARRFMIYVHAKMMIVDDEYVIIGSANINQRSMDGGRDSEIAMGAYQPNYLATRQPVKGQI  761

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFR+ALWYEHLGMLD+ F +P+S+EC+ KVN+IAE NW LY+ + L  D+P+HLLSYP+
Sbjct  762  HGFRLALWYEHLGMLDDTFLRPQSIECMRKVNKIAERNWGLYTSDMLVSDLPSHLLSYPL  821

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            GVTE+G++ EL G + FPDT+A VLGTKS++
Sbjct  822  GVTEDGEMMELHGMEFFPDTRARVLGTKSDY  852



>ref|XP_009619857.1| PREDICTED: phospholipase D alpha 1 [Nicotiana tomentosiformis]
Length=810

 Score =   333 bits (854),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 153/213 (72%), Positives = 181/213 (85%), Gaps = 2/213 (1%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMY  I QA++ KG   +P++YL+FFC+GNRE KK  EYEPSEKP+ D+DY RAQE
Sbjct  591  RTMEMMYKHIFQAIRDKGTDDHPRNYLTFFCIGNREMKKSGEYEPSEKPEPDSDYERAQE  650

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVH+KMMIVDDEYIIVGSANINQRSMDGARDSEIA+GAYQPHHL+  QPARGQV
Sbjct  651  ARRFMIYVHSKMMIVDDEYIIVGSANINQRSMDGARDSEIAIGAYQPHHLTTSQPARGQV  710

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFRMALWYEH+GMLD+ F  PES ECV KVNQIA+  W+LY+ E+L+ D+P HLL YP+
Sbjct  711  HGFRMALWYEHMGMLDDTFQHPESEECVKKVNQIADKYWDLYTSESLDSDLPGHLLRYPV  770

Query  279  GVTENGQVTELPGFQN--FPDTKAPVLGTKSNF  187
            G+T NG +T+LPG  N  FPDTKA V+GTKS++
Sbjct  771  GLTNNGDITDLPGDGNEFFPDTKAKVVGTKSDY  803



>ref|NP_175666.1| phospholipase D alpha 2 [Arabidopsis thaliana]
 sp|Q9SSQ9.1|PLDA2_ARATH RecName: Full=Phospholipase D alpha 2; Short=AtPLDalpha2; Short=PLD 
alpha 2; AltName: Full=Choline phosphatase 2; AltName: 
Full=Phosphatidylcholine-hydrolyzing phospholipase D 2 [Arabidopsis 
thaliana]
 gb|AAD55607.1|AC008016_17 Similar to gb|AF090445 phospholipase D1 from Brassica oleacea 
[Arabidopsis thaliana]
 gb|AEE32825.1| phospholipase D alpha 2 [Arabidopsis thaliana]
Length=810

 Score =   333 bits (853),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 150/212 (71%), Positives = 177/212 (83%), Gaps = 1/212 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIA-NPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQ  643
            RTM+MMY D+++AL+  G+   +P+DYL+FFCLGNRE KK  EYEPSEKP+ DTDY RAQ
Sbjct  592  RTMEMMYKDVIKALRENGLEGEDPRDYLTFFCLGNREVKKDGEYEPSEKPEPDTDYIRAQ  651

Query  642  EARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQ  463
            EARRFMIYVH KMMIVDDEYII+GSANINQRSMDGARDSEIAMG YQP+HLS RQPARGQ
Sbjct  652  EARRFMIYVHTKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGGYQPYHLSTRQPARGQ  711

Query  462  VHGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYP  283
            +HGFRM+LWYEHLGMLD  F  P S EC+ KVN++A+  W+LYS E+LE D+P HLL YP
Sbjct  712  IHGFRMSLWYEHLGMLDETFLDPSSQECIQKVNRVADKYWDLYSSESLEHDLPGHLLRYP  771

Query  282  IGVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            IG+   G +TELPG + FPDTKA +LG KS++
Sbjct  772  IGIASEGNITELPGCEFFPDTKARILGVKSDY  803



>ref|XP_002894388.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70647.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=810

 Score =   333 bits (853),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 150/212 (71%), Positives = 177/212 (83%), Gaps = 1/212 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIA-NPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQ  643
            RTM+MMY D+++AL+  G+   +P+DYL+FFCLGNRE KK  EYEPSEKP+ DTDY RAQ
Sbjct  592  RTMEMMYKDVIKALRETGLEGEDPRDYLTFFCLGNREVKKDGEYEPSEKPEPDTDYIRAQ  651

Query  642  EARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQ  463
            EARRFMIYVH KMMIVDDEYII+GSANINQRSMDGARDSEIAMG YQP+HLS RQPARGQ
Sbjct  652  EARRFMIYVHTKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGGYQPYHLSTRQPARGQ  711

Query  462  VHGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYP  283
            +HGFRM+LWYEHLGMLD  F  P S EC+ KVN++A+  W+LYS E+LE D+P HLL YP
Sbjct  712  IHGFRMSLWYEHLGMLDETFLDPSSQECIQKVNRVADKYWDLYSSESLEHDLPGHLLRYP  771

Query  282  IGVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            IG+   G +TELPG + FPDTKA +LG KS++
Sbjct  772  IGIASEGNITELPGCEFFPDTKARILGAKSDY  803



>ref|XP_006842069.1| PREDICTED: phospholipase D alpha 1 [Amborella trichopoda]
 gb|ERN03744.1| hypothetical protein AMTR_s00078p00051300 [Amborella trichopoda]
Length=815

 Score =   333 bits (853),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 147/212 (69%), Positives = 186/212 (88%), Gaps = 1/212 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RT++MMY+DI  A+KAK + A+PKDYL+FFC+ NRE K+  EY P E+P+ DTDY RAQ+
Sbjct  597  RTLEMMYSDIALAIKAKQLDASPKDYLTFFCIANREVKRSGEYAPQEQPEPDTDYERAQK  656

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSAR-QPARGQ  463
            ARRFMIYVH+KMMIVDDEYIIVGSANINQRSMDGARDSEIAMGA+QP+HL+ R QPARGQ
Sbjct  657  ARRFMIYVHSKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAFQPYHLATRGQPARGQ  716

Query  462  VHGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYP  283
            +HGFRMALWYEH+GMLDN F  P+S++C+ K+N++A+  W+LYS ++L+RD+P HLL+YP
Sbjct  717  IHGFRMALWYEHMGMLDNVFLDPKSVDCIRKLNKVADKYWDLYSSDSLDRDLPGHLLTYP  776

Query  282  IGVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            +G+T +G VTELPGF+ FPDTKA +LGTKS++
Sbjct  777  VGITNDGYVTELPGFEFFPDTKARILGTKSDY  808



>ref|XP_009144830.1| PREDICTED: phospholipase D alpha 2 [Brassica rapa]
Length=812

 Score =   332 bits (852),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 151/212 (71%), Positives = 178/212 (84%), Gaps = 1/212 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIA-NPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQ  643
            RTM+MMY D+++AL+ KG+   +P+DYL+FFCLGNRETKK  EY PSEKP+ D+DY RAQ
Sbjct  594  RTMEMMYKDVIKALRDKGLEGEDPRDYLTFFCLGNRETKKDGEYVPSEKPEPDSDYMRAQ  653

Query  642  EARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQ  463
            EARRFMIYVH KMMIVDDEYII+GSANINQRSMDGARDSEIAMG YQP+HLS RQPARG 
Sbjct  654  EARRFMIYVHTKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGGYQPYHLSIRQPARGH  713

Query  462  VHGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYP  283
            +HGFRM+LWYEHLGMLD  F  P S ECV KVN+IA+  W+LY+ E+LE D+P HLL YP
Sbjct  714  IHGFRMSLWYEHLGMLDETFLDPSSQECVQKVNRIADKYWDLYASESLEHDLPGHLLRYP  773

Query  282  IGVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            IG+   G +TELPG + FPDTKA +LGTKS++
Sbjct  774  IGIASQGDITELPGCECFPDTKARILGTKSDY  805



>gb|AGN71006.1| phospholipase D2 [Brassica napus]
Length=812

 Score =   332 bits (852),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 150/211 (71%), Positives = 176/211 (83%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RT++MMY D+ QAL+A+G+  +P++YL+ FCLGNRE KK  EYE +E+PD DTDY RAQE
Sbjct  595  RTLEMMYKDVTQALRAQGLEEDPRNYLTLFCLGNREVKKEGEYELAERPDPDTDYMRAQE  654

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVH+KMMIVDDEYIIVGSANINQRSMDGARDSEIAMG YQPHHLS RQPARGQV
Sbjct  655  ARRFMIYVHSKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGGYQPHHLSHRQPARGQV  714

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFRM+LWYEHLGMLD  F  P S+EC+ KVN+IA+  WN YS E+LE D+P HLL YPI
Sbjct  715  HGFRMSLWYEHLGMLDETFLDPSSLECIEKVNRIADKYWNFYSSESLEHDLPGHLLRYPI  774

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
             V   G ++ELPGF+ FPDTKA +LG K ++
Sbjct  775  SVDNEGNISELPGFEFFPDTKARILGNKVDY  805



>gb|AAC49274.1| phospholipase D [Arabidopsis thaliana]
Length=809

 Score =   332 bits (851),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 151/211 (72%), Positives = 175/211 (83%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMY D++QALK      +P++YL+FFCLGNRE KK  EYEP+EKPD DTDY RAQE
Sbjct  592  RTMEMMYKDVIQALKGLEGPEDPRNYLTFFCLGNREVKKDGEYEPAEKPDPDTDYMRAQE  651

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVH KMMIVDDEYII+GSANINQRSMDGARDSEIAMG YQPHHLS RQPARGQ+
Sbjct  652  ARRFMIYVHTKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGGYQPHHLSHRQPARGQI  711

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFRM+LWYEHLGMLD  F  P+  E + KVN+I++  W+ YS E+LE D+P HLL YPI
Sbjct  712  HGFRMSLWYEHLGMLDETFLDPKLSESIEKVNRISDKYWDFYSSESLEHDLPGHLLRYPI  771

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            GV   G +TELPGF+ FPDTKA +LGTKS++
Sbjct  772  GVASEGDITELPGFEFFPDTKARILGTKSDY  802



>ref|XP_010462102.1| PREDICTED: phospholipase D alpha 2 [Camelina sativa]
 ref|XP_010462103.1| PREDICTED: phospholipase D alpha 2 [Camelina sativa]
 ref|XP_010462104.1| PREDICTED: phospholipase D alpha 2 [Camelina sativa]
Length=810

 Score =   332 bits (851),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 149/212 (70%), Positives = 178/212 (84%), Gaps = 1/212 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIA-NPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQ  643
            RTM+MMY D+++AL+ KG+   +P+DYL+FFCLGNRE KK  EY PSEKP+ DTDY RAQ
Sbjct  592  RTMEMMYKDVIKALREKGLEGEDPRDYLTFFCLGNREVKKDGEYVPSEKPEPDTDYMRAQ  651

Query  642  EARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQ  463
            EARRFMIYVH KMMIVDDEYII+GSANINQRSMDGARDSEIAMG YQP+HLS RQPARGQ
Sbjct  652  EARRFMIYVHTKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGGYQPYHLSTRQPARGQ  711

Query  462  VHGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYP  283
            +HGFRM+LWYEHLGMLD  F +P S EC+ KVN++A+  W+LY+ E+LE D+P HLL YP
Sbjct  712  IHGFRMSLWYEHLGMLDETFLEPSSQECIQKVNRVADKYWDLYASESLEHDLPGHLLRYP  771

Query  282  IGVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            IG+   G +TELPG + FPDTKA +LG KS++
Sbjct  772  IGIASEGNITELPGCEFFPDTKARILGVKSDY  803



>ref|XP_010500864.1| PREDICTED: phospholipase D alpha 2-like isoform X1 [Camelina 
sativa]
 ref|XP_010500866.1| PREDICTED: phospholipase D alpha 2-like isoform X1 [Camelina 
sativa]
 ref|XP_010500867.1| PREDICTED: phospholipase D alpha 2-like isoform X1 [Camelina 
sativa]
Length=811

 Score =   332 bits (851),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 149/212 (70%), Positives = 178/212 (84%), Gaps = 1/212 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIA-NPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQ  643
            RTM+MMY D+++AL+ KG+   +P+DYL+FFCLGNRE KK  EY PSEKP+ DTDY RAQ
Sbjct  593  RTMEMMYKDVIKALREKGLEGEDPRDYLTFFCLGNREVKKDGEYVPSEKPEPDTDYIRAQ  652

Query  642  EARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQ  463
            EARRFMIYVH KMMIVDDEYII+GSANINQRSMDGARDSEIAMG YQP+HLS RQPARGQ
Sbjct  653  EARRFMIYVHTKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGGYQPYHLSTRQPARGQ  712

Query  462  VHGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYP  283
            +HGFRM+LWYEHLGMLD  F +P S EC+ KVN++A+  W+LY+ E+LE D+P HLL YP
Sbjct  713  IHGFRMSLWYEHLGMLDETFLEPSSQECIQKVNRVADKYWDLYASESLEHDLPGHLLRYP  772

Query  282  IGVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            IG+   G +TELPG + FPDTKA +LG KS++
Sbjct  773  IGIASEGNITELPGCEFFPDTKARILGVKSDY  804



>ref|XP_008792036.1| PREDICTED: phospholipase D alpha 1 [Phoenix dactylifera]
 ref|XP_008792037.1| PREDICTED: phospholipase D alpha 1 [Phoenix dactylifera]
Length=813

 Score =   332 bits (851),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 158/211 (75%), Positives = 187/211 (89%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMYTDI+QAL+AKGI ANPKDYL+FFCLGNRE KK  EYEP E+P+ DTDYSRAQ+
Sbjct  596  RTMEMMYTDIIQALQAKGIEANPKDYLTFFCLGNREVKKSGEYEPEEQPEPDTDYSRAQQ  655

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVH KMMIVDDEYII+GSANINQRSMDGARDSEIAMGAYQP +LS R+PARG++
Sbjct  656  ARRFMIYVHTKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGAYQPCYLSTREPARGRI  715

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFR+ALWYEHLGMLD+ F  PES+ECV KVN+ A+  W+LYS + L+RD+P HLLSYPI
Sbjct  716  HGFRLALWYEHLGMLDDVFRHPESVECVQKVNRTADKYWDLYSSDNLDRDLPGHLLSYPI  775

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            GV+ +G +TELPG + FPDT+A VLGTK+++
Sbjct  776  GVSSDGAITELPGMEYFPDTRARVLGTKTDY  806



>ref|XP_010500868.1| PREDICTED: phospholipase D alpha 2-like isoform X2 [Camelina 
sativa]
Length=811

 Score =   332 bits (850),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 149/212 (70%), Positives = 178/212 (84%), Gaps = 1/212 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIA-NPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQ  643
            RTM+MMY D+++AL+ KG+   +P+DYL+FFCLGNRE KK  EY PSEKP+ DTDY RAQ
Sbjct  593  RTMEMMYKDVIKALREKGLEGEDPRDYLTFFCLGNREVKKDGEYVPSEKPEPDTDYIRAQ  652

Query  642  EARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQ  463
            EARRFMIYVH KMMIVDDEYII+GSANINQRSMDGARDSEIAMG YQP+HLS RQPARGQ
Sbjct  653  EARRFMIYVHTKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGGYQPYHLSTRQPARGQ  712

Query  462  VHGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYP  283
            +HGFRM+LWYEHLGMLD  F +P S EC+ KVN++A+  W+LY+ E+LE D+P HLL YP
Sbjct  713  IHGFRMSLWYEHLGMLDETFLEPSSRECIQKVNRVADKYWDLYASESLEHDLPGHLLRYP  772

Query  282  IGVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            IG+   G +TELPG + FPDTKA +LG KS++
Sbjct  773  IGIASEGNITELPGCEFFPDTKARILGVKSDY  804



>ref|XP_012078796.1| PREDICTED: phospholipase D alpha 1-like isoform X3 [Jatropha 
curcas]
Length=807

 Score =   332 bits (850),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 152/213 (71%), Positives = 182/213 (85%), Gaps = 2/213 (1%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMY+DI +AL AKG+ +NPKDYLSFFCLGNRETKK  E+EP EKP++D++YSRAQE
Sbjct  588  RTMEMMYSDIAEALHAKGLDSNPKDYLSFFCLGNRETKKTGEHEPPEKPEHDSNYSRAQE  647

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQ--PARG  466
            ARRFMIYVHAKMMIVDDEYII+GSANINQRSMDGARD+EIAMGAYQPH+L+  +   ARG
Sbjct  648  ARRFMIYVHAKMMIVDDEYIIIGSANINQRSMDGARDTEIAMGAYQPHYLATNEQAAARG  707

Query  465  QVHGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSY  286
            QVHG RM+LWYEHLGMLD+ F+QPE++ECV KVN IA   W+LY+ + L  D+P HLL+Y
Sbjct  708  QVHGLRMSLWYEHLGMLDDSFSQPETLECVRKVNLIASKYWDLYTSDNLVHDLPGHLLTY  767

Query  285  PIGVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            PIGVT NG++ E+PG + FPDTKA V G+KS  
Sbjct  768  PIGVTHNGELIEIPGAEFFPDTKAHVFGSKSEL  800



>ref|XP_012078795.1| PREDICTED: phospholipase D alpha 1-like isoform X2 [Jatropha 
curcas]
Length=808

 Score =   332 bits (850),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 152/213 (71%), Positives = 182/213 (85%), Gaps = 2/213 (1%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMY+DI +AL AKG+ +NPKDYLSFFCLGNRETKK  E+EP EKP++D++YSRAQE
Sbjct  589  RTMEMMYSDIAEALHAKGLDSNPKDYLSFFCLGNRETKKTGEHEPPEKPEHDSNYSRAQE  648

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQ--PARG  466
            ARRFMIYVHAKMMIVDDEYII+GSANINQRSMDGARD+EIAMGAYQPH+L+  +   ARG
Sbjct  649  ARRFMIYVHAKMMIVDDEYIIIGSANINQRSMDGARDTEIAMGAYQPHYLATNEQAAARG  708

Query  465  QVHGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSY  286
            QVHG RM+LWYEHLGMLD+ F+QPE++ECV KVN IA   W+LY+ + L  D+P HLL+Y
Sbjct  709  QVHGLRMSLWYEHLGMLDDSFSQPETLECVRKVNLIASKYWDLYTSDNLVHDLPGHLLTY  768

Query  285  PIGVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            PIGVT NG++ E+PG + FPDTKA V G+KS  
Sbjct  769  PIGVTHNGELIEIPGAEFFPDTKAHVFGSKSEL  801



>gb|KJB68102.1| hypothetical protein B456_010G225600 [Gossypium raimondii]
Length=805

 Score =   332 bits (850),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 149/211 (71%), Positives = 182/211 (86%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM MMY +I QALK++G   +P++YL+FFCLGNRE KKG EYEP+E P+ D++++RAQE
Sbjct  588  RTMNMMYKEIAQALKSEGRDEDPRNYLTFFCLGNREMKKGGEYEPTETPEPDSNHARAQE  647

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVH KMM+VDDEYII+GSANINQRSMDGARDSEIAMGAYQP+HLS RQPARGQV
Sbjct  648  ARRFMIYVHTKMMLVDDEYIIIGSANINQRSMDGARDSEIAMGAYQPYHLSIRQPARGQV  707

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFR+ALWYEHLGML N F  PES ECV KVNQ+A+  W+L+S + L++D+P HLLSYPI
Sbjct  708  HGFRLALWYEHLGMLHNSFLTPESKECVKKVNQLADKYWDLFSKDDLDQDLPGHLLSYPI  767

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
             ++ +G V+ELP F+NFPDTKA +LG KS++
Sbjct  768  AISNDGNVSELPNFENFPDTKARILGAKSDY  798



>ref|XP_010479770.1| PREDICTED: phospholipase D alpha 2-like [Camelina sativa]
 ref|XP_010479771.1| PREDICTED: phospholipase D alpha 2-like [Camelina sativa]
 ref|XP_010479772.1| PREDICTED: phospholipase D alpha 2-like [Camelina sativa]
Length=810

 Score =   332 bits (850),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 148/212 (70%), Positives = 178/212 (84%), Gaps = 1/212 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIA-NPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQ  643
            RTM+MMY D+++AL+ KG+   +P+DYL+FFCLGNRE KK  EY P+EKP+ DTDY RAQ
Sbjct  592  RTMEMMYKDVIKALREKGLQGEDPRDYLTFFCLGNREVKKDGEYVPTEKPEPDTDYIRAQ  651

Query  642  EARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQ  463
            EARRFMIYVH KMMIVDDEYII+GSANINQRSMDGARDSEIAMG YQP+HLS RQPARGQ
Sbjct  652  EARRFMIYVHTKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGGYQPYHLSTRQPARGQ  711

Query  462  VHGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYP  283
            +HGFRM+LWYEHLGMLD  F +P S EC+ KVN++A+  W+LY+ E+LE D+P HLL YP
Sbjct  712  IHGFRMSLWYEHLGMLDETFLEPSSQECIQKVNRVADKYWDLYASESLEHDLPGHLLRYP  771

Query  282  IGVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            IG+   G +TELPG + FPDTKA +LG KS++
Sbjct  772  IGIASEGNITELPGCEFFPDTKARILGVKSDY  803



>ref|XP_002443625.1| hypothetical protein SORBIDRAFT_08g022520 [Sorghum bicolor]
 gb|EES17463.1| hypothetical protein SORBIDRAFT_08g022520 [Sorghum bicolor]
Length=813

 Score =   332 bits (850),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 160/211 (76%), Positives = 183/211 (87%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMYTDI QAL AKGI ANPKDYL+FFCLGNRE K+  EYEP E P+ DTDY RAQE
Sbjct  596  RTMEMMYTDITQALHAKGIEANPKDYLTFFCLGNREVKQEGEYEPEEHPEPDTDYIRAQE  655

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            +RRFMIYVH+KMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQP+HL+ +QPARGQ+
Sbjct  656  SRRFMIYVHSKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPYHLATKQPARGQI  715

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFRM+LWYEHLGMLD+ F  PESMECV KVN+IA+  W+LY+ + LE+D+P HLLSYPI
Sbjct  716  HGFRMSLWYEHLGMLDDVFQHPESMECVQKVNRIADKYWDLYTSDDLEQDLPGHLLSYPI  775

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            GVT +G VT LPG  NFPDT+A VLG K+ +
Sbjct  776  GVTADGTVTALPGMDNFPDTRARVLGNKTIY  806



>ref|XP_010925209.1| PREDICTED: phospholipase D alpha 1-like [Elaeis guineensis]
 ref|XP_010925210.1| PREDICTED: phospholipase D alpha 1-like [Elaeis guineensis]
 ref|XP_010925211.1| PREDICTED: phospholipase D alpha 1-like [Elaeis guineensis]
Length=810

 Score =   331 bits (849),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 157/211 (74%), Positives = 188/211 (89%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMYTDI++ALKAKGI ANPKDYL+FFCLGNRE KK  EYEP E+P+ DTDYSRAQ+
Sbjct  593  RTMEMMYTDIIEALKAKGIEANPKDYLTFFCLGNREVKKSGEYEPEEQPEPDTDYSRAQQ  652

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVH+KMMIVDDEYII+GSANINQRSMDGARDSEIAMGAYQP +LS R+P RGQ+
Sbjct  653  ARRFMIYVHSKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGAYQPCYLSTREPPRGQI  712

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFR+ALWYEHLGM+D+ F +PES+ECV KVN++A+  W LYSG++ +RD+P HLLSYPI
Sbjct  713  HGFRLALWYEHLGMVDDVFLRPESVECVRKVNKVADQYWGLYSGDSPDRDLPGHLLSYPI  772

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            GV+  G +TELPG + FPDT+A VLGTK+++
Sbjct  773  GVSSAGAITELPGTEYFPDTRARVLGTKTDY  803



>ref|XP_012078794.1| PREDICTED: phospholipase D alpha 1-like isoform X1 [Jatropha 
curcas]
 gb|KDP32412.1| hypothetical protein JCGZ_13337 [Jatropha curcas]
Length=810

 Score =   331 bits (849),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 152/213 (71%), Positives = 182/213 (85%), Gaps = 2/213 (1%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMY+DI +AL AKG+ +NPKDYLSFFCLGNRETKK  E+EP EKP++D++YSRAQE
Sbjct  591  RTMEMMYSDIAEALHAKGLDSNPKDYLSFFCLGNRETKKTGEHEPPEKPEHDSNYSRAQE  650

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQ--PARG  466
            ARRFMIYVHAKMMIVDDEYII+GSANINQRSMDGARD+EIAMGAYQPH+L+  +   ARG
Sbjct  651  ARRFMIYVHAKMMIVDDEYIIIGSANINQRSMDGARDTEIAMGAYQPHYLATNEQAAARG  710

Query  465  QVHGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSY  286
            QVHG RM+LWYEHLGMLD+ F+QPE++ECV KVN IA   W+LY+ + L  D+P HLL+Y
Sbjct  711  QVHGLRMSLWYEHLGMLDDSFSQPETLECVRKVNLIASKYWDLYTSDNLVHDLPGHLLTY  770

Query  285  PIGVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            PIGVT NG++ E+PG + FPDTKA V G+KS  
Sbjct  771  PIGVTHNGELIEIPGAEFFPDTKAHVFGSKSEL  803



>ref|XP_011081358.1| PREDICTED: phospholipase D alpha 1 [Sesamum indicum]
Length=807

 Score =   331 bits (849),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 148/211 (70%), Positives = 181/211 (86%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RT++MMY D+VQAL AKGI  +P++YL+FFCLGNRE K+  EYEPSE P+ D+DY+ AQ+
Sbjct  590  RTIEMMYKDVVQALSAKGIEEDPRNYLTFFCLGNREVKRSGEYEPSETPEADSDYAEAQK  649

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVH+KMMIVDDEYIIVGSANINQRSMDGARDSEIAMG YQP+HL+ R+PARGQV
Sbjct  650  ARRFMIYVHSKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGGYQPYHLATRRPARGQV  709

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFRMALWYEHLGMLD+ F QP+S +CV KVN++A+  W+LY+ + L+ D+P HLL YPI
Sbjct  710  HGFRMALWYEHLGMLDDSFVQPQSEQCVRKVNEMADKYWDLYASDQLQSDLPGHLLRYPI  769

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            G+  +G VTELPG + FPDTKA +LG KS++
Sbjct  770  GIASSGAVTELPGQEFFPDTKARILGAKSDY  800



>gb|EPS65578.1| hypothetical protein M569_09194 [Genlisea aurea]
Length=808

 Score =   331 bits (848),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 150/212 (71%), Positives = 181/212 (85%), Gaps = 1/212 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMY D++QAL+A+GI  +P++YL+FFCLGNRE ++  +YEP+EKP+ D++Y +AQ 
Sbjct  590  RTMEMMYKDVIQALQAQGIEEDPRNYLTFFCLGNREARREGDYEPAEKPEPDSNYEKAQA  649

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSAR-QPARGQ  463
            ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLS R  PARG 
Sbjct  650  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSTRSHPARGH  709

Query  462  VHGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYP  283
            +HGFR+ALWYEHLGMLD  FA+PES ECV KVN++A+  W+LY+ + LERD+P HLL YP
Sbjct  710  IHGFRLALWYEHLGMLDGSFARPESEECVRKVNEMADKYWDLYASDELERDLPGHLLRYP  769

Query  282  IGVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            + V   G VTELPG + FPDTKA VLGTKS++
Sbjct  770  VAVASEGDVTELPGMEFFPDTKARVLGTKSDY  801



>ref|XP_007150745.1| hypothetical protein PHAVU_005G177200g [Phaseolus vulgaris]
 gb|ESW22739.1| hypothetical protein PHAVU_005G177200g [Phaseolus vulgaris]
Length=808

 Score =   330 bits (846),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 148/211 (70%), Positives = 177/211 (84%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM MMY D+V ALKAKG+  +P++YL+FFCLGNRE KK  EYEP E+PD DTDY RAQE
Sbjct  591  RTMDMMYKDVVGALKAKGVEEDPRNYLTFFCLGNREVKKEGEYEPPERPDPDTDYLRAQE  650

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            +RRFMIYVHAKMMIVDDEYII+GSANINQRSMDG RD+EIAMGAYQP+HL  R+PARG++
Sbjct  651  SRRFMIYVHAKMMIVDDEYIIIGSANINQRSMDGGRDTEIAMGAYQPYHLGGRKPARGEI  710

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFRM+LWYEH+GMLD  F  PES ECV K+N++ +  W+LY+ E LE+D+P HLL YPI
Sbjct  711  HGFRMSLWYEHVGMLDESFLHPESEECVKKINEMGDKYWDLYTTEPLEQDLPGHLLRYPI  770

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
             V+  G VT+L GF+ FPDTKAPVLG KS++
Sbjct  771  AVSGEGSVTQLKGFEFFPDTKAPVLGVKSDY  801



>emb|CAB43062.1| phospholipase D2 [Craterostigma plantagineum]
Length=807

 Score =   330 bits (846),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 151/211 (72%), Positives = 179/211 (85%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM MMY D+VQAL+AKGI  +P++YL+FFCLGNRE KKG EYEP+E+P+ D+DY RAQ+
Sbjct  590  RTMDMMYKDVVQALRAKGIEEDPRNYLTFFCLGNREVKKGGEYEPTEQPEPDSDYLRAQQ  649

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVHAK+MIVDDEYII+GSANINQRSMDGARDSEIAMGAYQP+HL+ R  ARGQ+
Sbjct  650  ARRFMIYVHAKLMIVDDEYIIIGSANINQRSMDGARDSEIAMGAYQPYHLNTRNRARGQI  709

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFRMALWYEHLGMLD  F +PE+ ECV KVN+IA+  W LY+ E LE D+P HLL YP+
Sbjct  710  HGFRMALWYEHLGMLDEAFLEPENEECVRKVNEIADRYWELYASEELENDLPGHLLRYPV  769

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
             +  +G VTELPG + FPDTKA VLG KS++
Sbjct  770  EIAGDGGVTELPGAEFFPDTKARVLGAKSDY  800



>ref|XP_009368855.1| PREDICTED: phospholipase D alpha 1-like [Pyrus x bretschneideri]
Length=808

 Score =   328 bits (842),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 150/209 (72%), Positives = 181/209 (87%), Gaps = 0/209 (0%)
 Frame = -3

Query  813  MQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQEAR  634
            M MMY DIVQ LK KG+ ANPKDYL+FF LGN E K   EYEP EKP++ +DYSRAQ+AR
Sbjct  593  MDMMYRDIVQTLKVKGVEANPKDYLAFFSLGNHEKKLPGEYEPPEKPEHGSDYSRAQQAR  652

Query  633  RFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQVHG  454
            RFMIYVHAK+MIVDDEYII+GSANINQRSMDGARDSEIAMGAYQP+HLS  +PARGQ+HG
Sbjct  653  RFMIYVHAKVMIVDDEYIIIGSANINQRSMDGARDSEIAMGAYQPYHLSTGKPARGQIHG  712

Query  453  FRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIGV  274
             RM+LWYEHLG+L++ F +P+++EC+ KVNQIA+ +W+LYS +TL+ D+P HLLSYPI V
Sbjct  713  LRMSLWYEHLGLLNDIFLEPQNVECIRKVNQIADQHWDLYSCDTLDGDLPGHLLSYPIAV  772

Query  273  TENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            TENG+VTELPG + FPDTKA +LG+KS+ 
Sbjct  773  TENGEVTELPGTEFFPDTKARILGSKSDL  801



>ref|XP_011039694.1| PREDICTED: phospholipase D alpha 1-like [Populus euphratica]
 ref|XP_011039695.1| PREDICTED: phospholipase D alpha 1-like [Populus euphratica]
Length=820

 Score =   327 bits (839),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 152/212 (72%), Positives = 180/212 (85%), Gaps = 1/212 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM MMY+DI +AL+ KG+  +P++YL+FFCLGNRETKK  EYEPSE P+ DTDYSRAQ+
Sbjct  602  RTMDMMYSDIAEALEKKGLKTDPREYLAFFCLGNRETKKTGEYEPSEAPEPDTDYSRAQQ  661

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVHAKMMIVDDEYII+GSANINQRSMDG+RDSEIAMG YQP HL+  QPARGQ+
Sbjct  662  ARRFMIYVHAKMMIVDDEYIIIGSANINQRSMDGSRDSEIAMGGYQPRHLATSQPARGQI  721

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            +GFRMALW+EHLGMLD+ F  PES++C+ KVNQ+A +NW  Y+ ETLE+D+ +HLL YPI
Sbjct  722  YGFRMALWHEHLGMLDSSFEHPESVQCIQKVNQVANDNWEKYTSETLEQDLMSHLLRYPI  781

Query  279  GVTENGQVTELPGFQN-FPDTKAPVLGTKSNF  187
             V  NG VT LPG  N FPDTKA VLGTKS++
Sbjct  782  QVGNNGIVTTLPGAVNHFPDTKANVLGTKSDY  813



>dbj|BAJ93878.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=783

 Score =   326 bits (836),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 149/211 (71%), Positives = 179/211 (85%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMYTDI QA++AKGI A PKDYL+FFCLGNRE KK  EY+P E+ + D+DY +AQ+
Sbjct  566  RTMEMMYTDIAQAIQAKGIDAKPKDYLTFFCLGNREAKKSGEYQPPEQAEPDSDYLKAQQ  625

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
             RRFMIYVH KMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQP HL+  +PARGQV
Sbjct  626  NRRFMIYVHTKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPCHLATSRPARGQV  685

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFRMALWYEHLGM+D  F +PES+ECV KVN +A+  W+LY+G+  ERD+P HLL+YP+
Sbjct  686  HGFRMALWYEHLGMVDEAFQRPESLECVHKVNAMADRYWDLYAGDGPERDLPGHLLTYPV  745

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
             VT +G VT+LPG + FPDT+A +LG KS++
Sbjct  746  SVTGDGSVTQLPGVEFFPDTEARILGAKSDY  776



>ref|XP_002325225.2| hypothetical protein POPTR_0018s13110g [Populus trichocarpa]
 gb|EEF03790.2| hypothetical protein POPTR_0018s13110g [Populus trichocarpa]
Length=808

 Score =   327 bits (837),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 148/211 (70%), Positives = 177/211 (84%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMY+DI +AL+ KG+ ANPKDYL+FFCLG  E +   EY PSE+P++++DYSRAQ+
Sbjct  591  RTMEMMYSDIAEALQDKGVEANPKDYLTFFCLGKHEREMPGEYVPSERPEHNSDYSRAQK  650

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIY+HAKMMIVDDEYII GSANINQRSMDG RD+EIAMGAYQP+HL+  QPARGQ+
Sbjct  651  ARRFMIYIHAKMMIVDDEYIITGSANINQRSMDGGRDTEIAMGAYQPYHLATNQPARGQI  710

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFRM+LWYEHLG LD+ F  PES+ECV KVN IAE NW+LYS E L+ D+P HLL+YPI
Sbjct  711  HGFRMSLWYEHLGQLDDTFCHPESLECVRKVNHIAEKNWHLYSSEVLDDDLPGHLLAYPI  770

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            GVT NG++TEL G + FP TKA V G+KS  
Sbjct  771  GVTSNGELTELQGTEFFPGTKARVFGSKSEL  801



>ref|XP_006364210.1| PREDICTED: phospholipase D alpha 1-like isoform X1 [Solanum tuberosum]
Length=811

 Score =   327 bits (837),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 151/214 (71%), Positives = 184/214 (86%), Gaps = 3/214 (1%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMY  I QA++ +G+  +P++YL+FFC+GNRE KK  EYEPS+KP++DTDY RAQE
Sbjct  591  RTMEMMYKHIFQAIRDQGLDDHPRNYLTFFCIGNREVKKSGEYEPSDKPESDTDYERAQE  650

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHL-SARQPARGQ  463
            ARRFMIYVH+KMMIVDDEYIIVGSANINQRSMDGARDSEIA+GAYQPH+L ++RQPARGQ
Sbjct  651  ARRFMIYVHSKMMIVDDEYIIVGSANINQRSMDGARDSEIAIGAYQPHNLTTSRQPARGQ  710

Query  462  VHGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYP  283
            VHGFRMALWYEH+GMLD+ F  PES +CV KVN+IA+  W+LY+ E LE D+P HLL YP
Sbjct  711  VHGFRMALWYEHMGMLDDTFQHPESEDCVRKVNEIADKYWDLYTSERLETDLPGHLLRYP  770

Query  282  IGVTENGQVTELPGFQN--FPDTKAPVLGTKSNF  187
            IG+T +G++T+LPG  N  FPDTKA V+GTKS+ 
Sbjct  771  IGLTNDGEITDLPGNGNEYFPDTKAKVVGTKSDL  804



>ref|NP_001234863.1| phospholipase PLDa2 [Solanum lycopersicum]
 gb|AAG45486.1| phospholipase PLDa2 [Solanum lycopersicum]
Length=806

 Score =   327 bits (837),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 160/211 (76%), Positives = 183/211 (87%), Gaps = 1/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTMQMMYTDI+QALK KGI+ANPK+YLSFFCLGNRETKK  EYEP E P+ ++ Y +AQE
Sbjct  590  RTMQMMYTDIIQALKVKGIVANPKEYLSFFCLGNRETKKRGEYEPCEPPEPNSGYHKAQE  649

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVH+KMMIVDDEYII+GSANINQRSMDGARDSEIAMGAYQP HL  ++PARGQV
Sbjct  650  ARRFMIYVHSKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGAYQPFHLCVKEPARGQV  709

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFRMALWYEHLGMLD+ F QPES+EC+ KVN+I    W++YS E L  D+P HLL+YPI
Sbjct  710  HGFRMALWYEHLGMLDDRFLQPESVECIRKVNKIGAKYWDMYSSERLIHDLPGHLLTYPI  769

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            G+TE G++TELPG + FPDT APVLGT SNF
Sbjct  770  GITEIGEITELPG-RMFPDTMAPVLGTISNF  799



>ref|XP_006364211.1| PREDICTED: phospholipase D alpha 1-like isoform X2 [Solanum tuberosum]
Length=805

 Score =   326 bits (836),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 151/214 (71%), Positives = 184/214 (86%), Gaps = 3/214 (1%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMY  I QA++ +G+  +P++YL+FFC+GNRE KK  EYEPS+KP++DTDY RAQE
Sbjct  585  RTMEMMYKHIFQAIRDQGLDDHPRNYLTFFCIGNREVKKSGEYEPSDKPESDTDYERAQE  644

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHL-SARQPARGQ  463
            ARRFMIYVH+KMMIVDDEYIIVGSANINQRSMDGARDSEIA+GAYQPH+L ++RQPARGQ
Sbjct  645  ARRFMIYVHSKMMIVDDEYIIVGSANINQRSMDGARDSEIAIGAYQPHNLTTSRQPARGQ  704

Query  462  VHGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYP  283
            VHGFRMALWYEH+GMLD+ F  PES +CV KVN+IA+  W+LY+ E LE D+P HLL YP
Sbjct  705  VHGFRMALWYEHMGMLDDTFQHPESEDCVRKVNEIADKYWDLYTSERLETDLPGHLLRYP  764

Query  282  IGVTENGQVTELPGFQN--FPDTKAPVLGTKSNF  187
            IG+T +G++T+LPG  N  FPDTKA V+GTKS+ 
Sbjct  765  IGLTNDGEITDLPGNGNEYFPDTKAKVVGTKSDL  798



>ref|XP_010691149.1| PREDICTED: phospholipase D alpha 1-like [Beta vulgaris subsp. 
vulgaris]
Length=809

 Score =   326 bits (836),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 152/212 (72%), Positives = 178/212 (84%), Gaps = 1/212 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM MMY DI+ AL+AKG   +P++YL+FFCL NRE KK  EYEPSE+P+ D+DY RAQ+
Sbjct  591  RTMTMMYKDIITALRAKGSDEDPRNYLTFFCLANREVKKDGEYEPSEQPEPDSDYERAQQ  650

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSAR-QPARGQ  463
             RRFMIYVH+KMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHL  R Q A+GQ
Sbjct  651  NRRFMIYVHSKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLVTRNQRAQGQ  710

Query  462  VHGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYP  283
            +HGFRMALWYEHLGMLD+ F +PES +C  KVN+ A+  W+LYS E+LERD+P HLL YP
Sbjct  711  IHGFRMALWYEHLGMLDDSFKRPESSDCAEKVNRSADKYWDLYSSESLERDLPGHLLRYP  770

Query  282  IGVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            IGV+  G V+ELPGF+ FPDTKA VLG KS++
Sbjct  771  IGVSSEGDVSELPGFEFFPDTKARVLGVKSDY  802



>ref|XP_008805616.1| PREDICTED: phospholipase D alpha 1-like [Phoenix dactylifera]
 ref|XP_008805617.1| PREDICTED: phospholipase D alpha 1-like [Phoenix dactylifera]
Length=810

 Score =   326 bits (836),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 155/211 (73%), Positives = 185/211 (88%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMYTDI++AL+AKGI ANPKDYL+FFC+GNRE KK  EYEP E P+ DTDY RAQ+
Sbjct  593  RTMEMMYTDIIEALRAKGIEANPKDYLTFFCIGNREVKKSGEYEPEEHPEPDTDYIRAQQ  652

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVH+KMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQP +LSAR+PARGQ+
Sbjct  653  ARRFMIYVHSKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPCYLSAREPARGQI  712

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFR+ALWYEHLGMLD+ F  PES+ECV KVN++A+  W LYS +  +RD+P HLL+YPI
Sbjct  713  HGFRLALWYEHLGMLDDVFLHPESVECVRKVNKVADQYWALYSSDNPDRDLPGHLLAYPI  772

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            GV+ +G +TELPG + FPDT+A VLGT +++
Sbjct  773  GVSSDGAITELPGMEFFPDTRARVLGTNTDY  803



>ref|XP_009364028.1| PREDICTED: phospholipase D alpha 1-like [Pyrus x bretschneideri]
Length=807

 Score =   325 bits (833),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 160/210 (76%), Positives = 184/210 (88%), Gaps = 0/210 (0%)
 Frame = -3

Query  816  TMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQEA  637
            TM MMY DIVQALKAKGI ANPKDYL+FFCLGNRE K   EYEP EKP+  +DYSRAQ+A
Sbjct  591  TMDMMYRDIVQALKAKGIEANPKDYLAFFCLGNREKKLPGEYEPPEKPEPGSDYSRAQQA  650

Query  636  RRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQVH  457
            RRFMIYVHAKMMIVDDEYII+GSANINQRSMDGARDSEIAMGAYQP+HLS  +PARGQ+H
Sbjct  651  RRFMIYVHAKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGAYQPYHLSTGKPARGQIH  710

Query  456  GFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIG  277
            G RM+LWYEHLG+LD+ F +PES+EC  KVNQIAE +W+LYS +TL+ D+P HLLSYPI 
Sbjct  711  GLRMSLWYEHLGLLDDTFLEPESVECFRKVNQIAEQHWDLYSCDTLDGDLPGHLLSYPIA  770

Query  276  VTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            VTE+G+VTELPG + FPDTKA +LG+KS+ 
Sbjct  771  VTEDGEVTELPGTEFFPDTKARILGSKSDL  800



>ref|XP_010923204.1| PREDICTED: phospholipase D alpha 1-like [Elaeis guineensis]
Length=859

 Score =   326 bits (836),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 148/211 (70%), Positives = 183/211 (87%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMYTDI +AL AKG+ ANPKDYLSFFCLGNRE  KGDEY+  E P+ +TDY+RAQ+
Sbjct  642  RTMEMMYTDIAEALHAKGLQANPKDYLSFFCLGNREVNKGDEYQAEEHPEPNTDYNRAQQ  701

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVHAKMMIVDDEYII+GSANINQRSMDG RDSEIAMGAYQP++L++RQ A+GQ+
Sbjct  702  ARRFMIYVHAKMMIVDDEYIIIGSANINQRSMDGGRDSEIAMGAYQPYYLASRQLAKGQI  761

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFR+ALW+EHLG+ D+ F QP+++ C+ KVN+IAE NW LY+ + L  D+P+HLLSYP+
Sbjct  762  HGFRLALWHEHLGVFDDTFLQPQNVGCMQKVNKIAERNWRLYTSDMLVSDLPSHLLSYPL  821

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
             VTE+G++ EL G + FPDTKA VLGTKS++
Sbjct  822  EVTEDGEIMELDGMEFFPDTKARVLGTKSDY  852



>ref|XP_009407292.1| PREDICTED: phospholipase D alpha 1-like [Musa acuminata subsp. 
malaccensis]
Length=815

 Score =   325 bits (833),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 147/211 (70%), Positives = 177/211 (84%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMYTD+ QAL+AKG+ ANP++YL+FFCLGNRE K+  E+EP E P  DT+Y R+QE
Sbjct  598  RTMEMMYTDVAQALRAKGVEANPEEYLNFFCLGNREVKRSGEHEPREHPKPDTNYMRSQE  657

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVH+K+MIVDDEYII GSANINQRSMDG RDSEI MGAYQP+HLS  +PARGQ+
Sbjct  658  ARRFMIYVHSKLMIVDDEYIICGSANINQRSMDGGRDSEIVMGAYQPYHLSTTEPARGQI  717

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFRMALWYEHLG+LD+ F  PES+ CV KVN IAE  W+L++GE  + D+P HLL YPI
Sbjct  718  HGFRMALWYEHLGVLDDDFLHPESLHCVQKVNNIAELYWDLFTGERQDGDLPGHLLPYPI  777

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            GVT +G +T+LPGF+ FPDT+  VLGTKS +
Sbjct  778  GVTYDGSITQLPGFEFFPDTRGRVLGTKSAY  808



>ref|XP_006654096.1| PREDICTED: phospholipase D alpha 1-like [Oryza brachyantha]
Length=818

 Score =   325 bits (832),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 149/212 (70%), Positives = 180/212 (85%), Gaps = 1/212 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMYTDI QA++AKGI A+PKDYL+FFCLGNRE K   EYEP E+ + DT Y +AQ+
Sbjct  600  RTMEMMYTDIAQAIQAKGIDADPKDYLTFFCLGNREAKAAGEYEPPEQAEPDTGYFKAQQ  659

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSAR-QPARGQ  463
             RRFMIYVH KMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHL+A  +PARGQ
Sbjct  660  NRRFMIYVHTKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLAAAGRPARGQ  719

Query  462  VHGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYP  283
            VHGFRMALWYEHLG +D+ F +PES++CV KVN +A+  W+LY+G+  ERD+P HLL+YP
Sbjct  720  VHGFRMALWYEHLGTVDDAFQRPESVDCVRKVNAMAKRCWDLYAGDGPERDLPGHLLTYP  779

Query  282  IGVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            +GV  +G +T+LPG + FPDT+A VLG KS++
Sbjct  780  VGVASDGTITQLPGVEFFPDTEARVLGAKSDY  811



>ref|XP_003597894.1| Phospholipase D alpha [Medicago truncatula]
 gb|ABD28731.1| C2; Peptidase, cysteine peptidase active site [Medicago truncatula]
 gb|AES68145.1| phospholipase D alpha 1 [Medicago truncatula]
Length=809

 Score =   323 bits (829),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 158/211 (75%), Positives = 178/211 (84%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM MMY DI++AL AKG+  NP+DYL+FFCLGNRE  K  EYEP E+P+ D+DY RAQE
Sbjct  592  RTMDMMYKDIIEALNAKGLEENPRDYLTFFCLGNREVVKQGEYEPPERPEPDSDYMRAQE  651

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQP+HL+ RQPARGQ+
Sbjct  652  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPYHLANRQPARGQI  711

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFRM+LWYEHLGML   F  PES EC+ KVNQIA+  W+LYS ETLE D+P HLL YPI
Sbjct  712  HGFRMSLWYEHLGMLQETFLHPESEECIRKVNQIADKYWDLYSSETLEHDLPGHLLRYPI  771

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            GV+  G VTELPGF+ FPDTKA VLG K ++
Sbjct  772  GVSSEGNVTELPGFEFFPDTKARVLGGKVDY  802



>gb|KHN22450.1| Phospholipase D alpha 1 [Glycine soja]
Length=608

 Score =   318 bits (814),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 144/211 (68%), Positives = 173/211 (82%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM MMY D+V ALK KGI  +P +YL+FFCL NRE KK  EY P E+PD  TDY RAQ 
Sbjct  391  RTMDMMYKDVVGALKGKGIEEDPLNYLTFFCLVNRELKKEGEYVPPERPDPHTDYMRAQV  450

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            +RRFMIYVHAKMMIVDDEYII+GSANINQRSMDGARDSE+AMGAYQP+HL+ +QPARGQ+
Sbjct  451  SRRFMIYVHAKMMIVDDEYIIIGSANINQRSMDGARDSEVAMGAYQPYHLATKQPARGQI  510

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFRM+LWYEHLG+L + F  PES EC+ KVNQIA+  W+LY+ E LE+D+P HLL YP+
Sbjct  511  HGFRMSLWYEHLGLLHDSFLHPESEECIEKVNQIADKYWDLYTTEPLEQDLPGHLLRYPV  570

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
             ++  G VT+L  F+ FPDTKAP+LG KS++
Sbjct  571  AISSQGNVTQLQAFEFFPDTKAPILGAKSDY  601



>ref|XP_003568837.1| PREDICTED: phospholipase D alpha 1-like [Brachypodium distachyon]
Length=822

 Score =   323 bits (829),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 149/212 (70%), Positives = 179/212 (84%), Gaps = 1/212 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMYTDI QA++AKGI A PKDYL+FFCLGNRE KK  EY P E+ + D+DY +AQ+
Sbjct  604  RTMEMMYTDIAQAIQAKGIDAKPKDYLTFFCLGNREAKKAGEYSPPEEAEPDSDYLKAQQ  663

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
             RRFMIYVH K MIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQP HL+A +PARGQV
Sbjct  664  NRRFMIYVHTKSMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPGHLAATRPARGQV  723

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGET-LERDMPAHLLSYP  283
            HGFRMALWYEHLGM+D  F +PES+ECV KVN +A+  W+LY+G+   +RD+P HLL+YP
Sbjct  724  HGFRMALWYEHLGMVDEAFQRPESLECVHKVNAMADRYWDLYAGDDGADRDLPGHLLTYP  783

Query  282  IGVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            +GVT +G VT+LPG + FPDT+A +LG KS++
Sbjct  784  VGVTADGAVTQLPGVEFFPDTQARILGAKSDY  815



>gb|EMT24153.1| Phospholipase D alpha 1 [Aegilops tauschii]
Length=906

 Score =   325 bits (832),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 148/211 (70%), Positives = 177/211 (84%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMY+DI QA++AKGI A PKDYL+FFCLGNRE KK  EYEP E+ + D+DY +AQ+
Sbjct  544  RTMEMMYSDIAQAIQAKGIDAKPKDYLTFFCLGNREAKKSGEYEPPEQAEPDSDYLKAQQ  603

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
             RRFMIYVH KMMIVDDEYIIVGSANINQRSMDGARDSEIAMG YQP HL+  +PARGQV
Sbjct  604  NRRFMIYVHTKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGGYQPGHLATSRPARGQV  663

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFRMALWYEHLGM+D  F +PES+ECV KVN +AE  W+LY+ +  ERD+P HLL+YP+
Sbjct  664  HGFRMALWYEHLGMMDEAFQRPESLECVHKVNAMAERYWDLYAADGPERDLPGHLLTYPV  723

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
             VT +G VT+LPG + FPDT+A +LG KS++
Sbjct  724  SVTGDGSVTQLPGVEFFPDTEARILGGKSDY  754



>ref|XP_004235964.1| PREDICTED: phospholipase D alpha 1 [Solanum lycopersicum]
Length=811

 Score =   322 bits (825),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 149/214 (70%), Positives = 180/214 (84%), Gaps = 3/214 (1%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMY  I + L+  GI  +P++YL+FFC+GNRE KK  EYEPS +P++DTDY RAQE
Sbjct  591  RTMEMMYKHIFKTLRDAGIDDHPRNYLTFFCIGNREVKKSGEYEPSHEPESDTDYRRAQE  650

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSA-RQPARGQ  463
            ARRFMIYVH+KMMIVDDEYIIVGSANINQRSMDGARDSEIA+GAYQPH+LS  RQPARGQ
Sbjct  651  ARRFMIYVHSKMMIVDDEYIIVGSANINQRSMDGARDSEIAIGAYQPHNLSTNRQPARGQ  710

Query  462  VHGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYP  283
            +HGFRMALWYEH+GMLD+ F  PES +CV KVN IA+  W+LY+ E+LE D+P HLL YP
Sbjct  711  IHGFRMALWYEHMGMLDDTFQHPESEDCVRKVNGIADKYWDLYTSESLETDLPGHLLRYP  770

Query  282  IGVTENGQVTELPGFQN--FPDTKAPVLGTKSNF  187
            +G+T +G++T+LPG  N  FPDTKA V+GTKS+ 
Sbjct  771  VGLTNDGEITDLPGNGNEYFPDTKAKVIGTKSDL  804



>ref|XP_009758055.1| PREDICTED: phospholipase D alpha 1-like [Nicotiana sylvestris]
 ref|XP_009758056.1| PREDICTED: phospholipase D alpha 1-like [Nicotiana sylvestris]
Length=820

 Score =   321 bits (823),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 148/212 (70%), Positives = 175/212 (83%), Gaps = 1/212 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGII-ANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQ  643
            RTM+MMYTDI  AL+AKGI  A+P+DYL+FFCLGNRE +K  EY+P EKPD DTDYSRAQ
Sbjct  602  RTMEMMYTDICNALQAKGITNADPRDYLTFFCLGNREVEKPGEYKPPEKPDPDTDYSRAQ  661

Query  642  EARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQ  463
            E RRFMIYVH+KMMIVDDEYII+GSANINQRSMDGARDSEIAMG YQP+HL+A QP RG+
Sbjct  662  EFRRFMIYVHSKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGGYQPYHLAANQPPRGK  721

Query  462  VHGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYP  283
            ++GFRMALW EHL   D+ F  P S+ECV KVN +A+ +W LYS +T + D+P HLLSYP
Sbjct  722  IYGFRMALWCEHLNYADDSFVDPTSLECVRKVNGMADESWKLYSSDTFDLDLPGHLLSYP  781

Query  282  IGVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            I ++  GQ+T +PGF+ FPDTKA VLGTKS  
Sbjct  782  INISNTGQITAIPGFKFFPDTKASVLGTKSQL  813



>ref|XP_012076577.1| PREDICTED: phospholipase D alpha 1-like isoform X5 [Jatropha 
curcas]
Length=792

 Score =   320 bits (821),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 148/211 (70%), Positives = 173/211 (82%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMY DI +ALK  GI ANP++YLSFFCLGNRETKK  EY P E P+ D+DYSRAQ+
Sbjct  575  RTMEMMYYDITEALKRNGIKANPREYLSFFCLGNRETKKIGEYAPPETPEPDSDYSRAQQ  634

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVHAKMMIVDDEYII+GSANINQRSMDGARDSEIAMGA+QPHHL+  QPARGQ+
Sbjct  635  ARRFMIYVHAKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGAFQPHHLATAQPARGQI  694

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            +GFR+ALWYEHLG+L+  F  PES EC+  VN+IA+  W  YS E  ++D+  HLL YPI
Sbjct  695  YGFRLALWYEHLGLLEPSFQYPESEECIQLVNKIADELWESYSSEVFDQDLIGHLLRYPI  754

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
             +T NG VT LPGF++FPDTKA +LG  S F
Sbjct  755  EITNNGTVTTLPGFEHFPDTKARILGNISEF  785



>ref|XP_012076566.1| PREDICTED: phospholipase D alpha 1-like isoform X3 [Jatropha 
curcas]
Length=792

 Score =   320 bits (820),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 148/211 (70%), Positives = 173/211 (82%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMY DI +ALK  GI ANP++YLSFFCLGNRETKK  EY P E P+ D+DYSRAQ+
Sbjct  575  RTMEMMYYDITEALKRNGIKANPREYLSFFCLGNRETKKIGEYAPPETPEPDSDYSRAQQ  634

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVHAKMMIVDDEYII+GSANINQRSMDGARDSEIAMGA+QPHHL+  QPARGQ+
Sbjct  635  ARRFMIYVHAKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGAFQPHHLATAQPARGQI  694

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            +GFR+ALWYEHLG+L+  F  PES EC+  VN+IA+  W  YS E  ++D+  HLL YPI
Sbjct  695  YGFRLALWYEHLGLLEPSFQYPESEECIQLVNKIADELWESYSSEVFDQDLIGHLLRYPI  754

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
             +T NG VT LPGF++FPDTKA +LG  S F
Sbjct  755  EITNNGTVTTLPGFEHFPDTKARILGNISEF  785



>ref|XP_012076576.1| PREDICTED: phospholipase D alpha 1-like isoform X4 [Jatropha 
curcas]
Length=796

 Score =   320 bits (820),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 148/211 (70%), Positives = 173/211 (82%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMY DI +ALK  GI ANP++YLSFFCLGNRETKK  EY P E P+ D+DYSRAQ+
Sbjct  579  RTMEMMYYDITEALKRNGIKANPREYLSFFCLGNRETKKIGEYAPPETPEPDSDYSRAQQ  638

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVHAKMMIVDDEYII+GSANINQRSMDGARDSEIAMGA+QPHHL+  QPARGQ+
Sbjct  639  ARRFMIYVHAKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGAFQPHHLATAQPARGQI  698

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            +GFR+ALWYEHLG+L+  F  PES EC+  VN+IA+  W  YS E  ++D+  HLL YPI
Sbjct  699  YGFRLALWYEHLGLLEPSFQYPESEECIQLVNKIADELWESYSSEVFDQDLIGHLLRYPI  758

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
             +T NG VT LPGF++FPDTKA +LG  S F
Sbjct  759  EITNNGTVTTLPGFEHFPDTKARILGNISEF  789



>ref|XP_012076575.1| PREDICTED: phospholipase D alpha 1-like isoform X3 [Jatropha 
curcas]
Length=799

 Score =   320 bits (820),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 148/211 (70%), Positives = 173/211 (82%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMY DI +ALK  GI ANP++YLSFFCLGNRETKK  EY P E P+ D+DYSRAQ+
Sbjct  582  RTMEMMYYDITEALKRNGIKANPREYLSFFCLGNRETKKIGEYAPPETPEPDSDYSRAQQ  641

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVHAKMMIVDDEYII+GSANINQRSMDGARDSEIAMGA+QPHHL+  QPARGQ+
Sbjct  642  ARRFMIYVHAKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGAFQPHHLATAQPARGQI  701

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            +GFR+ALWYEHLG+L+  F  PES EC+  VN+IA+  W  YS E  ++D+  HLL YPI
Sbjct  702  YGFRLALWYEHLGLLEPSFQYPESEECIQLVNKIADELWESYSSEVFDQDLIGHLLRYPI  761

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
             +T NG VT LPGF++FPDTKA +LG  S F
Sbjct  762  EITNNGTVTTLPGFEHFPDTKARILGNISEF  792



>gb|AAU44332.1| hypothetical protein [Oryza sativa Japonica Group]
 gb|EAY96710.1| hypothetical protein OsI_18631 [Oryza sativa Indica Group]
 dbj|BAH00843.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE62492.1| hypothetical protein OsJ_17289 [Oryza sativa Japonica Group]
Length=824

 Score =   320 bits (821),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 147/212 (69%), Positives = 177/212 (83%), Gaps = 1/212 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMYTDI  A++AKGI A+PKDYL+FFCLGNRE K   EYEP E+ + DT Y  AQ+
Sbjct  606  RTMEMMYTDIAHAIQAKGIDADPKDYLTFFCLGNREAKSAGEYEPPEQAEPDTGYFHAQQ  665

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSAR-QPARGQ  463
             RRFMIYVH KMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHL+A  +PARGQ
Sbjct  666  NRRFMIYVHTKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLAAAGRPARGQ  725

Query  462  VHGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYP  283
            VHGFRMALWYEHLG +D  F +PES++CV KVN +A+  W+LY+G+  ERD+P HLL+YP
Sbjct  726  VHGFRMALWYEHLGTVDEAFQRPESLDCVRKVNAMADRCWDLYAGDGPERDLPGHLLTYP  785

Query  282  IGVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            +GV  +G +T+LPG + FPDT+A +LG KS++
Sbjct  786  VGVAGDGTITQLPGVEFFPDTQARILGAKSDY  817



>ref|XP_012076574.1| PREDICTED: phospholipase D alpha 1-like isoform X2 [Jatropha 
curcas]
Length=816

 Score =   320 bits (820),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 148/211 (70%), Positives = 173/211 (82%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMY DI +ALK  GI ANP++YLSFFCLGNRETKK  EY P E P+ D+DYSRAQ+
Sbjct  599  RTMEMMYYDITEALKRNGIKANPREYLSFFCLGNRETKKIGEYAPPETPEPDSDYSRAQQ  658

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVHAKMMIVDDEYII+GSANINQRSMDGARDSEIAMGA+QPHHL+  QPARGQ+
Sbjct  659  ARRFMIYVHAKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGAFQPHHLATAQPARGQI  718

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            +GFR+ALWYEHLG+L+  F  PES EC+  VN+IA+  W  YS E  ++D+  HLL YPI
Sbjct  719  YGFRLALWYEHLGLLEPSFQYPESEECIQLVNKIADELWESYSSEVFDQDLIGHLLRYPI  778

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
             +T NG VT LPGF++FPDTKA +LG  S F
Sbjct  779  EITNNGTVTTLPGFEHFPDTKARILGNISEF  809



>ref|XP_012076565.1| PREDICTED: phospholipase D alpha 1-like isoform X2 [Jatropha 
curcas]
Length=816

 Score =   320 bits (820),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 148/211 (70%), Positives = 173/211 (82%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMY DI +ALK  GI ANP++YLSFFCLGNRETKK  EY P E P+ D+DYSRAQ+
Sbjct  599  RTMEMMYYDITEALKRNGIKANPREYLSFFCLGNRETKKIGEYAPPETPEPDSDYSRAQQ  658

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVHAKMMIVDDEYII+GSANINQRSMDGARDSEIAMGA+QPHHL+  QPARGQ+
Sbjct  659  ARRFMIYVHAKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGAFQPHHLATAQPARGQI  718

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            +GFR+ALWYEHLG+L+  F  PES EC+  VN+IA+  W  YS E  ++D+  HLL YPI
Sbjct  719  YGFRLALWYEHLGLLEPSFQYPESEECIQLVNKIADELWESYSSEVFDQDLIGHLLRYPI  778

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
             +T NG VT LPGF++FPDTKA +LG  S F
Sbjct  779  EITNNGTVTTLPGFEHFPDTKARILGNISEF  809



>ref|XP_012076573.1| PREDICTED: phospholipase D alpha 1-like isoform X1 [Jatropha 
curcas]
Length=816

 Score =   320 bits (820),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 148/211 (70%), Positives = 173/211 (82%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMY DI +ALK  GI ANP++YLSFFCLGNRETKK  EY P E P+ D+DYSRAQ+
Sbjct  599  RTMEMMYYDITEALKRNGIKANPREYLSFFCLGNRETKKIGEYAPPETPEPDSDYSRAQQ  658

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVHAKMMIVDDEYII+GSANINQRSMDGARDSEIAMGA+QPHHL+  QPARGQ+
Sbjct  659  ARRFMIYVHAKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGAFQPHHLATAQPARGQI  718

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            +GFR+ALWYEHLG+L+  F  PES EC+  VN+IA+  W  YS E  ++D+  HLL YPI
Sbjct  719  YGFRLALWYEHLGLLEPSFQYPESEECIQLVNKIADELWESYSSEVFDQDLIGHLLRYPI  778

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
             +T NG VT LPGF++FPDTKA +LG  S F
Sbjct  779  EITNNGTVTTLPGFEHFPDTKARILGNISEF  809



>ref|XP_012076563.1| PREDICTED: phospholipase D alpha 1-like isoform X1 [Jatropha 
curcas]
 gb|KDP33596.1| hypothetical protein JCGZ_07167 [Jatropha curcas]
Length=816

 Score =   320 bits (819),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 148/211 (70%), Positives = 173/211 (82%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMY DI +ALK  GI ANP++YLSFFCLGNRETKK  EY P E P+ D+DYSRAQ+
Sbjct  599  RTMEMMYYDITEALKRNGIKANPREYLSFFCLGNRETKKIGEYAPPETPEPDSDYSRAQQ  658

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVHAKMMIVDDEYII+GSANINQRSMDGARDSEIAMGA+QPHHL+  QPARGQ+
Sbjct  659  ARRFMIYVHAKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGAFQPHHLATAQPARGQI  718

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            +GFR+ALWYEHLG+L+  F  PES EC+  VN+IA+  W  YS E  ++D+  HLL YPI
Sbjct  719  YGFRLALWYEHLGLLEPSFQYPESEECIQLVNKIADELWESYSSEVFDQDLIGHLLRYPI  778

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
             +T NG VT LPGF++FPDTKA +LG  S F
Sbjct  779  EITNNGTVTTLPGFEHFPDTKARILGNISEF  809



>ref|XP_011017763.1| PREDICTED: phospholipase D alpha 1-like [Populus euphratica]
 ref|XP_011017764.1| PREDICTED: phospholipase D alpha 1-like [Populus euphratica]
Length=831

 Score =   319 bits (818),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 145/210 (69%), Positives = 175/210 (83%), Gaps = 0/210 (0%)
 Frame = -3

Query  816  TMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQEA  637
            TM+MMY+DI +AL+ KG+ ANPKDYL+FFCLG  E +   EY PSE+P++++DYSRAQ+A
Sbjct  615  TMEMMYSDIAEALQDKGLEANPKDYLTFFCLGKHEREMPGEYVPSERPEHNSDYSRAQKA  674

Query  636  RRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQVH  457
            RRFMIYVHAKMMIVDDEYII GSANINQRSMDG RD+EIA GAYQP+HL+  QPARGQ+H
Sbjct  675  RRFMIYVHAKMMIVDDEYIITGSANINQRSMDGGRDTEIATGAYQPYHLATNQPARGQIH  734

Query  456  GFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPIG  277
            GFRM+LW+EHLG LD+ F  PES+ECV KVN +AE NW+LYS E L+ D+P HLL+YPIG
Sbjct  735  GFRMSLWHEHLGQLDDTFCHPESLECVRKVNHMAEKNWHLYSSEVLDDDLPGHLLAYPIG  794

Query  276  VTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            VT NG++TEL G + FP TKA V G+KS  
Sbjct  795  VTSNGELTELQGTEFFPGTKARVFGSKSEL  824



>sp|Q70EW5.2|PLDA1_CYNCA RecName: Full=Phospholipase D alpha 1; Short=PLD 1; AltName: 
Full=Choline phosphatase 1; AltName: Full=Phosphatidylcholine-hydrolyzing 
phospholipase D 1 [Cynara cardunculus]
 emb|CAE47482.2| phospholipase D alpha [Cynara cardunculus]
Length=808

 Score =   318 bits (816),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 144/211 (68%), Positives = 175/211 (83%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMY DIV AL+ KG+  +P++YL+FFCLGNRE KK  EYEP+E P+ D+ Y  AQE
Sbjct  591  RTMEMMYKDIVDALQDKGLDDDPREYLTFFCLGNREAKKSGEYEPTEAPEPDSGYLHAQE  650

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
             RRFMIYVH+KMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQP+HL+ + PARG V
Sbjct  651  NRRFMIYVHSKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPYHLATQTPARGHV  710

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFRMALWYEHLGMLD+ F +PE+ +CV K N++A+  W+LY+ E L+RD+P HLL YP+
Sbjct  711  HGFRMALWYEHLGMLDDSFERPENKDCVNKANEMADKCWDLYASEDLDRDLPGHLLRYPV  770

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            GVT  G +TELPG + FPDT A +LG KS++
Sbjct  771  GVTRKGDITELPGTECFPDTSARILGAKSDY  801



>ref|XP_008649399.1| PREDICTED: phospholipase D alpha 1-like [Zea mays]
 ref|XP_008649400.1| PREDICTED: phospholipase D alpha 1-like [Zea mays]
Length=821

 Score =   318 bits (814),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 145/212 (68%), Positives = 179/212 (84%), Gaps = 1/212 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMYTDI QA++AKGI ANP+DYL+FFCLGNRE KK  EY P+E+ + DT Y +AQ+
Sbjct  603  RTMEMMYTDIAQAIQAKGIDANPRDYLTFFCLGNREAKKPGEYVPTEEAEPDTGYIKAQQ  662

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHL-SARQPARGQ  463
             RRFMIYVH KMM+VDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHL +A +PARGQ
Sbjct  663  NRRFMIYVHTKMMMVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLAAASRPARGQ  722

Query  462  VHGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYP  283
            VHGFRM+LWYEHLG +D+ F +P+S+EC+ KVN +A+  W+LY+G+  ERD+P HLL+YP
Sbjct  723  VHGFRMSLWYEHLGAVDDAFTRPDSVECIRKVNAMADRYWDLYAGDGPERDLPGHLLTYP  782

Query  282  IGVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            + V  +G V +LPG + FPDT+A VLG KS++
Sbjct  783  VAVGTDGSVNQLPGMEFFPDTQARVLGAKSDY  814



>ref|XP_009401723.1| PREDICTED: phospholipase D alpha 1-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=781

 Score =   317 bits (811),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 148/213 (69%), Positives = 178/213 (84%), Gaps = 2/213 (1%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKG-DEYEPSEKPDNDTDYSRAQ  643
            RTM+MMYTDI QAL+AKGI A+PKDYLSFFCLGNRE +K   EY+P E+P+ DTDYSRAQ
Sbjct  562  RTMEMMYTDITQALRAKGIRADPKDYLSFFCLGNREGRKWPGEYQPEERPEPDTDYSRAQ  621

Query  642  EARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSAR-QPARG  466
            +ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDG RDSEIAMGAYQP HL++  Q ARG
Sbjct  622  QARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGGRDSEIAMGAYQPSHLASEWQAARG  681

Query  465  QVHGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSY  286
            QVHGFR+ALW+EH+G +D+ F +P+S ECV  VN +A+ NW+LY+ E L  D+P HLL+Y
Sbjct  682  QVHGFRLALWFEHMGTVDDVFLRPQSAECVRMVNMVAKRNWDLYASEALFDDLPGHLLNY  741

Query  285  PIGVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            PI + ++G +T LPG + FPDTKA VLG +S +
Sbjct  742  PIDIADDGNITALPGSEVFPDTKARVLGRRSEY  774



>ref|XP_004506968.1| PREDICTED: phospholipase D alpha 1-like [Cicer arietinum]
Length=793

 Score =   317 bits (812),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 148/211 (70%), Positives = 169/211 (80%), Gaps = 15/211 (7%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMY DIVQAL+AKGI  +P+ YL+FFCLGNRE K               DY RAQ+
Sbjct  591  RTMEMMYKDIVQALRAKGIEEDPRKYLTFFCLGNREVK---------------DYERAQQ  635

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVH KMMIVDDEYII+GSANINQRSMDGARDSEIAMGAYQP+HL+ RQPARGQV
Sbjct  636  ARRFMIYVHTKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGAYQPYHLATRQPARGQV  695

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFRM+LWYEHLGMLD  F  PES EC+ KVNQIA+  W+LYS E+LE D+P HLL YP+
Sbjct  696  HGFRMSLWYEHLGMLDESFLHPESEECIDKVNQIADKYWDLYSNESLEHDLPGHLLRYPV  755

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            GV   G VTELPGF+ FPDTKA +LG K+++
Sbjct  756  GVASEGDVTELPGFEFFPDTKARILGAKADY  786



>gb|EYU24646.1| hypothetical protein MIMGU_mgv1a001477mg [Erythranthe guttata]
Length=812

 Score =   317 bits (812),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 150/214 (70%), Positives = 180/214 (84%), Gaps = 3/214 (1%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGI-IANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQ  643
            RTMQMMY DIV AL+AKG+   +P++YL+FFCLGNRE KK  EYEP+EKP+ D+DY +AQ
Sbjct  592  RTMQMMYKDIVLALRAKGMEDEDPRNYLTFFCLGNREVKKSGEYEPAEKPEPDSDYLKAQ  651

Query  642  EARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSA-RQPARG  466
            EARRFMIYVH+KMMIVDDEYIIVGSANINQRSMDG+RDSEIAMG YQP+HL+  R PARG
Sbjct  652  EARRFMIYVHSKMMIVDDEYIIVGSANINQRSMDGSRDSEIAMGGYQPYHLAGPRGPARG  711

Query  465  QVHGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSY  286
             VHGFRMALWYEH+GMLD+ F  P+S +C  KVN I +  W+LYSG+ LERD+P HLL Y
Sbjct  712  GVHGFRMALWYEHMGMLDDSFLHPQSEKCARKVNDIGDKYWDLYSGDELERDLPGHLLRY  771

Query  285  PIGVT-ENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            PIG++  +G+V+ELPG + FPDTKA VLG KS++
Sbjct  772  PIGISGASGEVSELPGHEFFPDTKARVLGAKSDY  805



>ref|XP_009401714.1| PREDICTED: phospholipase D alpha 1-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=821

 Score =   317 bits (812),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 148/213 (69%), Positives = 178/213 (84%), Gaps = 2/213 (1%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKG-DEYEPSEKPDNDTDYSRAQ  643
            RTM+MMYTDI QAL+AKGI A+PKDYLSFFCLGNRE +K   EY+P E+P+ DTDYSRAQ
Sbjct  602  RTMEMMYTDITQALRAKGIRADPKDYLSFFCLGNREGRKWPGEYQPEERPEPDTDYSRAQ  661

Query  642  EARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSAR-QPARG  466
            +ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDG RDSEIAMGAYQP HL++  Q ARG
Sbjct  662  QARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGGRDSEIAMGAYQPSHLASEWQAARG  721

Query  465  QVHGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSY  286
            QVHGFR+ALW+EH+G +D+ F +P+S ECV  VN +A+ NW+LY+ E L  D+P HLL+Y
Sbjct  722  QVHGFRLALWFEHMGTVDDVFLRPQSAECVRMVNMVAKRNWDLYASEALFDDLPGHLLNY  781

Query  285  PIGVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            PI + ++G +T LPG + FPDTKA VLG +S +
Sbjct  782  PIDIADDGNITALPGSEVFPDTKARVLGRRSEY  814



>ref|XP_009614730.1| PREDICTED: phospholipase D alpha 1 {ECO:0000250|UniProtKB:Q41142}-like 
[Nicotiana tomentosiformis]
Length=820

 Score =   316 bits (810),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 145/212 (68%), Positives = 175/212 (83%), Gaps = 1/212 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGII-ANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQ  643
            RTM+MMYTDI  ALKAKGII A+P+DYL+FFCLGNRE +K  EY+PSEKPD DTDY+RAQ
Sbjct  602  RTMEMMYTDICNALKAKGIINADPRDYLTFFCLGNREVEKPGEYKPSEKPDPDTDYARAQ  661

Query  642  EARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQ  463
            E RRFMIYVH+KMMIVDDEYII+GSANINQRSMDGARDSEIA+G YQP+HL+A Q  RG+
Sbjct  662  EFRRFMIYVHSKMMIVDDEYIIIGSANINQRSMDGARDSEIAIGGYQPYHLAANQLPRGK  721

Query  462  VHGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYP  283
            ++GFRMALW EHL   D+ F  P S+ECV KVN +A+ +W +YS +T + D+P HLL YP
Sbjct  722  IYGFRMALWCEHLNYADDSFVDPTSLECVRKVNGMADESWRIYSSDTFDFDLPGHLLRYP  781

Query  282  IGVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            + ++  GQ+T +PGF+ FPDTKA VLGTKS  
Sbjct  782  VNISNTGQITAIPGFKFFPDTKASVLGTKSQL  813



>gb|EMS46811.1| Phospholipase D alpha 2 [Triticum urartu]
Length=684

 Score =   313 bits (801),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 148/211 (70%), Positives = 173/211 (82%), Gaps = 1/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM MMY DI  ALKAKGI A+PKDYL+FFCLGNRE K+  EYEP+++P   + Y RAQ 
Sbjct  466  RTMDMMYYDISIALKAKGIDASPKDYLTFFCLGNREVKRSGEYEPADRPLPGSAYERAQN  525

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSAR-QPARGQ  463
            ARRFMIYVH+KMMIVDDEYIIVGSANINQRSMDG RDSEIAMGA+QPHHL+A+ Q ARGQ
Sbjct  526  ARRFMIYVHSKMMIVDDEYIIVGSANINQRSMDGGRDSEIAMGAFQPHHLNAKGQVARGQ  585

Query  462  VHGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYP  283
            VHGFRM+LWYEHLGML N F  P S ECV +VN++A+  W+LY+ + L  D+P HLL+YP
Sbjct  586  VHGFRMSLWYEHLGMLHNDFVNPGSRECVQRVNKMADKYWDLYASDELNDDLPGHLLTYP  645

Query  282  IGVTENGQVTELPGFQNFPDTKAPVLGTKSN  190
            + VT++G VTELPG + FPDT APVLG KS 
Sbjct  646  VAVTKDGTVTELPGARCFPDTAAPVLGIKSK  676



>gb|AFW77332.1| phospholipase D family protein [Zea mays]
Length=925

 Score =   318 bits (814),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 145/212 (68%), Positives = 179/212 (84%), Gaps = 1/212 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMYTDI QA++AKGI ANP+DYL+FFCLGNRE KK  EY P+E+ + DT Y +AQ+
Sbjct  707  RTMEMMYTDIAQAIQAKGIDANPRDYLTFFCLGNREAKKPGEYVPTEEAEPDTGYIKAQQ  766

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHL-SARQPARGQ  463
             RRFMIYVH KMM+VDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHL +A +PARGQ
Sbjct  767  NRRFMIYVHTKMMMVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLAAASRPARGQ  826

Query  462  VHGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYP  283
            VHGFRM+LWYEHLG +D+ F +P+S+EC+ KVN +A+  W+LY+G+  ERD+P HLL+YP
Sbjct  827  VHGFRMSLWYEHLGAVDDAFTRPDSVECIRKVNAMADRYWDLYAGDGPERDLPGHLLTYP  886

Query  282  IGVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            + V  +G V +LPG + FPDT+A VLG KS++
Sbjct  887  VAVGTDGSVNQLPGMEFFPDTQARVLGAKSDY  918



>ref|XP_002308663.2| hypothetical protein POPTR_0006s27000g [Populus trichocarpa]
 gb|EEE92186.2| hypothetical protein POPTR_0006s27000g [Populus trichocarpa]
Length=771

 Score =   315 bits (806),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 149/211 (71%), Positives = 176/211 (83%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM MMY+DI +AL  KG+  +P++YL+FFCLGNRETKK  EY P E+P+ DTDYSRA++
Sbjct  554  RTMDMMYSDITEALVKKGLNTDPREYLAFFCLGNRETKKIGEYAPPEEPEPDTDYSRARQ  613

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVHAKMMIVDDEYII+GSANINQRSMDG+RDSEIAMG YQPHHL+  QPARGQ+
Sbjct  614  ARRFMIYVHAKMMIVDDEYIIIGSANINQRSMDGSRDSEIAMGGYQPHHLATSQPARGQI  673

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            +GFRMALWYEHLGMLD  F  PES++C+  VNQ+A  NW  Y+ ETLE+D+ +HLL YPI
Sbjct  674  YGFRMALWYEHLGMLDPSFQHPESVQCIQLVNQVANENWEKYASETLEQDLMSHLLRYPI  733

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
             V  NG VT LPG  +FPDTKA VLGTKS++
Sbjct  734  QVGNNGIVTTLPGVNHFPDTKANVLGTKSDY  764



>ref|XP_008219493.1| PREDICTED: phospholipase D alpha 1-like [Prunus mume]
Length=806

 Score =   314 bits (805),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 139/211 (66%), Positives = 175/211 (83%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMYTDI +AL+ +G   +PKDYL+FFCLGNR+ +K  EY+P E P+ DTDY RAQ+
Sbjct  589  RTMEMMYTDISEALQRRGSNEHPKDYLTFFCLGNRQMEKDGEYKPPETPEPDTDYKRAQQ  648

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVH+KMMIVDDEYII+GSANINQRSMDG+RDSEIAMGA+QP HL+   PARGQ+
Sbjct  649  ARRFMIYVHSKMMIVDDEYIIIGSANINQRSMDGSRDSEIAMGAFQPEHLATTDPARGQI  708

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            + FR++LW+EHL + DN FA PES+ECV +VNQIA+ NW+LYS  TL +D+P HLL YP+
Sbjct  709  YAFRLSLWFEHLRVPDNSFAHPESLECVRRVNQIAQKNWDLYSSATLHQDLPGHLLRYPV  768

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
             V++ G +T LPGF++FPDTKA + G KS +
Sbjct  769  EVSKTGDLTTLPGFEHFPDTKARIFGNKSEY  799



>dbj|BAJ94103.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=820

 Score =   315 bits (806),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 147/211 (70%), Positives = 175/211 (83%), Gaps = 1/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM MMY DI  AL+AKGI A+PKDYL+FFCLGNRE K+  EYEP+++P   + Y RAQ 
Sbjct  602  RTMDMMYHDIAIALEAKGIDASPKDYLTFFCLGNREVKRSGEYEPADRPLPGSAYERAQN  661

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSAR-QPARGQ  463
            ARRFMIYVH+KMMIVDDEYIIVGSANINQRSMDG RDSEIAMGA+QPHHL+A+ Q ARGQ
Sbjct  662  ARRFMIYVHSKMMIVDDEYIIVGSANINQRSMDGGRDSEIAMGAFQPHHLNAKGQVARGQ  721

Query  462  VHGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYP  283
            VHGFRM+LWYEHLGML N F  P S+ECV +VN++A+  W+LY+ + L  D+P HLL+YP
Sbjct  722  VHGFRMSLWYEHLGMLHNDFVSPGSLECVQRVNKMADKYWDLYASDELNDDLPGHLLTYP  781

Query  282  IGVTENGQVTELPGFQNFPDTKAPVLGTKSN  190
            + VT++G VTELPG + FPDT+APVLG KS 
Sbjct  782  VAVTKDGTVTELPGARCFPDTQAPVLGIKSK  812



>ref|XP_004152203.1| PREDICTED: phospholipase D alpha 1 [Cucumis sativus]
 gb|KGN52888.1| hypothetical protein Csa_4G004970 [Cucumis sativus]
Length=807

 Score =   314 bits (805),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 152/211 (72%), Positives = 179/211 (85%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMY DIV AL+A GI  +P++YL+FFC+GNRE KK  EYEPSE P+ ++DY RAQ+
Sbjct  590  RTMEMMYKDIVLALRANGIEEDPRNYLTFFCVGNREVKKPGEYEPSESPEENSDYLRAQQ  649

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            +RRFMIY+H+KMMIVDDEYIIVGSANINQRSMDGARDSEIAMG YQP+HLS R+PARGQ+
Sbjct  650  SRRFMIYIHSKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGGYQPYHLSTREPARGQI  709

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            HGFR+ALWYEHLG+L   F  PES+ECV  VNQ+AE  W+LYS ET + D+P HLL YPI
Sbjct  710  HGFRLALWYEHLGLLHQSFLFPESIECVKSVNQLAEKYWDLYSSETFDHDLPGHLLRYPI  769

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
             V+ +GQVTELPGFQ FPDTKA VLG KSN+
Sbjct  770  AVSADGQVTELPGFQFFPDTKARVLGNKSNY  800



>dbj|BAJ85695.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96017.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ87850.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=820

 Score =   315 bits (806),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 147/211 (70%), Positives = 175/211 (83%), Gaps = 1/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM MMY DI  AL+AKGI A+PKDYL+FFCLGNRE K+  EYEP+++P   + Y RAQ 
Sbjct  602  RTMDMMYHDIAIALEAKGIDASPKDYLTFFCLGNREVKRSGEYEPADRPLPGSAYERAQN  661

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSAR-QPARGQ  463
            ARRFMIYVH+KMMIVDDEYIIVGSANINQRSMDG RDSEIAMGA+QPHHL+A+ Q ARGQ
Sbjct  662  ARRFMIYVHSKMMIVDDEYIIVGSANINQRSMDGGRDSEIAMGAFQPHHLNAKGQVARGQ  721

Query  462  VHGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYP  283
            VHGFRM+LWYEHLGML N F  P S+ECV +VN++A+  W+LY+ + L  D+P HLL+YP
Sbjct  722  VHGFRMSLWYEHLGMLHNDFVSPGSLECVQRVNKMADKYWDLYASDELNDDLPGHLLTYP  781

Query  282  IGVTENGQVTELPGFQNFPDTKAPVLGTKSN  190
            + VT++G VTELPG + FPDT+APVLG KS 
Sbjct  782  VAVTKDGTVTELPGARCFPDTQAPVLGIKSK  812



>ref|XP_008394090.1| PREDICTED: phospholipase D alpha 1-like isoform X1 [Malus domestica]
Length=810

 Score =   313 bits (801),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 141/211 (67%), Positives = 175/211 (83%), Gaps = 1/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMYTDI +AL+ KG  ANP+DYL+FFCLGNRE +   EY+P E P+ DTDY RAQ+
Sbjct  594  RTMEMMYTDISEALQKKGSNANPRDYLTFFCLGNREREMDGEYKPPETPEPDTDYKRAQK  653

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVH+KMMI DDEYII+GSANINQRSMDGARDSEIA+GA+QP+HL+++ PA+GQ+
Sbjct  654  ARRFMIYVHSKMMIXDDEYIIIGSANINQRSMDGARDSEIAIGAFQPNHLASKIPAKGQI  713

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            H FR+ALWYEHL + D+ F  PES+EC+ +VNQIAE NW  YS +T++ D+P HLL YPI
Sbjct  714  HAFRLALWYEHLKVPDDSFVHPESLECIRRVNQIAERNWEFYSSDTID-DIPGHLLHYPI  772

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
             V+ NG +T LPGF+ FPDTKA V G KS++
Sbjct  773  AVSNNGALTTLPGFEYFPDTKARVFGAKSDY  803



>ref|XP_003563661.1| PREDICTED: phospholipase D alpha 2-like [Brachypodium distachyon]
Length=823

 Score =   313 bits (802),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 144/212 (68%), Positives = 176/212 (83%), Gaps = 1/212 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM MMY DI  AL+ K I ANPKDYL+FFCLGNRE K+  EYEP+E+P   +DY RAQ+
Sbjct  605  RTMDMMYHDIAVALEGKRIDANPKDYLTFFCLGNREVKRSGEYEPAEQPMEGSDYERAQK  664

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSAR-QPARGQ  463
            ARR+M+YVH+KMMIVDDEYIIVGSANINQRSMDG RDSEIAMGA+QPHHL+   Q ARGQ
Sbjct  665  ARRYMVYVHSKMMIVDDEYIIVGSANINQRSMDGGRDSEIAMGAFQPHHLNTEDQVARGQ  724

Query  462  VHGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYP  283
            +HGFRM+LWYEHLGML + F +P S+ECV +VN++A+  W+LY+ + L  D+P HLL+YP
Sbjct  725  IHGFRMSLWYEHLGMLHDDFLKPGSLECVQRVNKMADKYWDLYASDELNDDLPGHLLTYP  784

Query  282  IGVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            + VT++G VTELPG + FPDT+APVLG KSN+
Sbjct  785  VAVTKDGIVTELPGMKCFPDTQAPVLGMKSNY  816



>ref|XP_007225238.1| hypothetical protein PRUPE_ppa001818mg [Prunus persica]
 gb|EMJ26437.1| hypothetical protein PRUPE_ppa001818mg [Prunus persica]
Length=761

 Score =   311 bits (798),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 138/211 (65%), Positives = 175/211 (83%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMYTDI +AL+ +G   +PKDYL+FFCLGNR+ +K  EY+P E P+ DTDY RAQ+
Sbjct  544  RTMEMMYTDISEALQRRGSNEHPKDYLTFFCLGNRQMEKDGEYKPPETPEPDTDYRRAQQ  603

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVH+KMMIVDDEYII+GSANINQRSMDG+RDSEIAMGA+QP HL+   PARGQ+
Sbjct  604  ARRFMIYVHSKMMIVDDEYIILGSANINQRSMDGSRDSEIAMGAFQPEHLATTDPARGQI  663

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            + FR++LW+EHL + DN F  PES+ECV +VNQIAE +W+LYS +TL +D+P HLL YP+
Sbjct  664  YAFRLSLWFEHLRVPDNSFLHPESLECVRRVNQIAEKHWDLYSSDTLHQDLPGHLLRYPV  723

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
             V++ G +T LPGF++FPDTKA + G KS +
Sbjct  724  EVSKTGDLTTLPGFEHFPDTKARIFGNKSEY  754



>ref|XP_009355736.1| PREDICTED: phospholipase D alpha 1-like [Pyrus x bretschneideri]
Length=807

 Score =   313 bits (801),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 144/211 (68%), Positives = 175/211 (83%), Gaps = 1/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMYTDI +AL+ KG  ANPKDYL+FFCLGNRE +   EY+P E P+ DTDY RAQE
Sbjct  591  RTMEMMYTDISEALQKKGSNANPKDYLTFFCLGNRELEMDGEYKPPETPEPDTDYKRAQE  650

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
            ARRFMIYVH+KMMIVDDEYII+GSANINQRSMDGARDSEIA+GA+QP+HL++  PARGQ+
Sbjct  651  ARRFMIYVHSKMMIVDDEYIIIGSANINQRSMDGARDSEIAIGAFQPNHLASTIPARGQI  710

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            + FR+ALWYEHL ++D+ F  PES+EC+ +VNQIAE NW  YS +T+  D+  HLL YPI
Sbjct  711  YAFRLALWYEHLKVVDDSFLHPESLECIRRVNQIAEGNWEFYSSDTI-YDITGHLLHYPI  769

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
             V+ NG +T LPGF+ FPDTKA V GTKS++
Sbjct  770  VVSNNGALTTLPGFEYFPDTKARVFGTKSDY  800



>emb|CBI21040.3| unnamed protein product [Vitis vinifera]
Length=752

 Score =   311 bits (797),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 146/212 (69%), Positives = 169/212 (80%), Gaps = 1/212 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMYTDIVQAL+A+GI ANP+DYL+FFCLGNRE    DEY+P EKP   +DY RAQ+
Sbjct  534  RTMEMMYTDIVQALQARGIHANPRDYLTFFCLGNRELINADEYKPKEKPAEGSDYMRAQQ  593

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQP-ARGQ  463
            +RRFMIYVH+KMMIVDDEYII+GSANINQRSMDG RD+EIAMG YQPHHL+A +   RG 
Sbjct  594  SRRFMIYVHSKMMIVDDEYIIIGSANINQRSMDGGRDTEIAMGGYQPHHLAATEEGGRGA  653

Query  462  VHGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYP  283
            +HGFR+ALWYEHLG  D  F  PES+ECV  VN+ AE NW  YS +TL  D+P HLLSYP
Sbjct  654  IHGFRLALWYEHLGGHDASFLHPESVECVRVVNESAERNWRAYSSDTLVADLPGHLLSYP  713

Query  282  IGVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            + V +NG VT LP  + FPDTKA VLGT S F
Sbjct  714  VQVNQNGTVTALPETEFFPDTKARVLGTVSEF  745



>ref|XP_010648662.1| PREDICTED: phospholipase D alpha 1-like [Vitis vinifera]
Length=825

 Score =   311 bits (796),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 146/212 (69%), Positives = 169/212 (80%), Gaps = 1/212 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMYTDIVQAL+A+GI ANP+DYL+FFCLGNRE    DEY+P EKP   +DY RAQ+
Sbjct  607  RTMEMMYTDIVQALQARGIHANPRDYLTFFCLGNRELINADEYKPKEKPAEGSDYMRAQQ  666

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQP-ARGQ  463
            +RRFMIYVH+KMMIVDDEYII+GSANINQRSMDG RD+EIAMG YQPHHL+A +   RG 
Sbjct  667  SRRFMIYVHSKMMIVDDEYIIIGSANINQRSMDGGRDTEIAMGGYQPHHLAATEEGGRGA  726

Query  462  VHGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYP  283
            +HGFR+ALWYEHLG  D  F  PES+ECV  VN+ AE NW  YS +TL  D+P HLLSYP
Sbjct  727  IHGFRLALWYEHLGGHDASFLHPESVECVRVVNESAERNWRAYSSDTLVADLPGHLLSYP  786

Query  282  IGVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            + V +NG VT LP  + FPDTKA VLGT S F
Sbjct  787  VQVNQNGTVTALPETEFFPDTKARVLGTVSEF  818



>ref|XP_011070230.1| PREDICTED: LOW QUALITY PROTEIN: phospholipase D alpha 1-like 
[Sesamum indicum]
Length=819

 Score =   311 bits (796),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 145/212 (68%), Positives = 172/212 (81%), Gaps = 2/212 (1%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGII-ANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQ  643
            RT++MMYTDI  A+KAKG+   +P+DYL+FFCLGNRE K   EY P EKPD DTDYSRAQ
Sbjct  600  RTIEMMYTDIYNAIKAKGLSNVDPRDYLTFFCLGNREIKSPGEYTPPEKPDPDTDYSRAQ  659

Query  642  EARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLS-ARQPARG  466
            ++RRFMIYVH+KMMIVDDEYII+GSANINQRSMDG RDSEIAMG +QPHHL+ +  PARG
Sbjct  660  QSRRFMIYVHSKMMIVDDEYIIIGSANINQRSMDGGRDSEIAMGGFQPHHLANSGAPARG  719

Query  465  QVHGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSY  286
            Q+ G RMALW EHL   ++ F QPES+ECV  VN IA+ NW +YS ET + D+P HLLSY
Sbjct  720  QIFGLRMALWCEHLLREEDVFLQPESLECVRTVNTIADENWKIYSSETFKEDLPGHLLSY  779

Query  285  PIGVTENGQVTELPGFQNFPDTKAPVLGTKSN  190
            PI ++ NG ++ LPGF+ FPDTKA VLGTKSN
Sbjct  780  PIRISNNGDISALPGFEFFPDTKARVLGTKSN  811



>ref|XP_002515518.1| phopholipase d alpha, putative [Ricinus communis]
 gb|EEF46967.1| phopholipase d alpha, putative [Ricinus communis]
Length=817

 Score =   310 bits (794),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 144/212 (68%), Positives = 175/212 (83%), Gaps = 1/212 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMY+DI +ALK  GI A+P++YLSFFCLGNRE KK +EY PSE P+ D+DY+RAQ 
Sbjct  599  RTMEMMYSDIAEALKRNGIQAHPREYLSFFCLGNREAKKTEEYAPSEIPEPDSDYARAQL  658

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQ-PARGQ  463
            ARRFMIYVH+KMMIVDDEYII+GSANINQRSMDGARD+EIAMGA+QPHHL+ +Q PARGQ
Sbjct  659  ARRFMIYVHSKMMIVDDEYIIIGSANINQRSMDGARDTEIAMGAFQPHHLATQQNPARGQ  718

Query  462  VHGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYP  283
            + GFR+ALWYEHLG L+  F  PES  C+ ++NQIA++ W  Y+ ETL++D   HLL YP
Sbjct  719  ICGFRLALWYEHLGFLELSFQHPESSNCIKRLNQIADDLWESYASETLDQDFVGHLLRYP  778

Query  282  IGVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            I V  NG VT LPG ++FPDTKA +LG KS+F
Sbjct  779  IEVDSNGTVTTLPGTEHFPDTKARILGAKSDF  810



>ref|XP_011649822.1| PREDICTED: phospholipase D alpha 1-like [Cucumis sativus]
 ref|XP_011649823.1| PREDICTED: phospholipase D alpha 1-like [Cucumis sativus]
 gb|KGN62948.1| hypothetical protein Csa_2G381740 [Cucumis sativus]
Length=814

 Score =   309 bits (791),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 140/211 (66%), Positives = 171/211 (81%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RT+ MMYTDI QAL+ KG+ ANP+DYL+FFCLGNRE K+  EY P EKP+ ++DY+RAQE
Sbjct  597  RTLDMMYTDIAQALRKKGLDANPRDYLTFFCLGNREKKRTGEYIPPEKPEPNSDYARAQE  656

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
             RRFMIYVH+KMMIVDDEYII+GSANINQRSMDG RDSEIAMGA+QP HL++ +PARGQ+
Sbjct  657  HRRFMIYVHSKMMIVDDEYIIIGSANINQRSMDGGRDSEIAMGAFQPRHLASSEPARGQI  716

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            +GFR+ALWYEHLG+ D  F  PES +C+  VN++A+ NW  YS +T + D+P HLLSYPI
Sbjct  717  YGFRVALWYEHLGLFDKVFHNPESEDCIQFVNKLAQENWQFYSDDTYDGDLPGHLLSYPI  776

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
             V  NG V+ LP F+ FPDTKA VLG  S +
Sbjct  777  QVGPNGSVSALPKFEFFPDTKARVLGQLSEY  807



>gb|EMT32202.1| Phospholipase D alpha 2 [Aegilops tauschii]
Length=820

 Score =   309 bits (791),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 145/211 (69%), Positives = 172/211 (82%), Gaps = 1/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM MMY DI  AL+AKGI A+PKDYL+FFCLGNRE K+  EYEP+++P   + Y +AQ 
Sbjct  602  RTMDMMYYDIAIALQAKGIDASPKDYLTFFCLGNREAKRSGEYEPADRPLPGSGYEKAQN  661

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSAR-QPARGQ  463
            ARRFMIYVH+KMMIVDDEYIIVGSANINQRSMDG RDSEIAMGA+QPHHL+ + Q ARGQ
Sbjct  662  ARRFMIYVHSKMMIVDDEYIIVGSANINQRSMDGGRDSEIAMGAFQPHHLNTKGQVARGQ  721

Query  462  VHGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYP  283
            VHGFRM+LWYEHLGML N F  P S ECV +VN++A+  W+LY+ + L  D+P HLL+YP
Sbjct  722  VHGFRMSLWYEHLGMLHNDFLNPGSRECVQRVNKMADKYWDLYASDELNDDLPGHLLTYP  781

Query  282  IGVTENGQVTELPGFQNFPDTKAPVLGTKSN  190
            + VT++G VTELPG + FPDT APVLG KS 
Sbjct  782  VAVTKDGTVTELPGARCFPDTAAPVLGIKSK  812



>ref|XP_008445210.1| PREDICTED: phospholipase D alpha 1-like [Cucumis melo]
Length=814

 Score =   309 bits (791),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 140/211 (66%), Positives = 171/211 (81%), Gaps = 0/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RT+ MMYTDI QAL+ KG+ ANP+DYL+FFCLGNRE K+  EY P EKP+ ++DY+RAQE
Sbjct  597  RTLDMMYTDISQALRKKGLDANPRDYLTFFCLGNREKKRTGEYIPPEKPEPNSDYARAQE  656

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
             RRFMIYVH+KMMIVDDEYII+GSANINQRSMDG RDSEIAMGA+QP HL++ +PARGQ+
Sbjct  657  HRRFMIYVHSKMMIVDDEYIIIGSANINQRSMDGGRDSEIAMGAFQPRHLASSEPARGQI  716

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
            +GFR+ALWYEHLG+ D  F  PES +C+  VN++A+ NW  YS +T + D+P HLLSYPI
Sbjct  717  YGFRVALWYEHLGLFDKVFHNPESEDCIQFVNKLAQENWQFYSDDTYDGDLPGHLLSYPI  776

Query  279  GVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
             V  NG V+ LP F+ FPDTKA VLG  S +
Sbjct  777  QVGPNGSVSALPKFEFFPDTKARVLGQLSEY  807



>gb|EMT15739.1| Phospholipase D alpha 2 [Aegilops tauschii]
Length=755

 Score =   306 bits (784),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 143/212 (67%), Positives = 171/212 (81%), Gaps = 1/212 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM MMY DI  AL+A GI ANPKDYL+FFCLGNRE K+  EYEP+++P   + Y RAQ 
Sbjct  537  RTMDMMYYDIAIALEANGIDANPKDYLTFFCLGNREVKRSGEYEPADRPLPGSPYERAQN  596

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSAR-QPARGQ  463
            ARRFMIYVH+KMMIVDDEYIIVGSANINQRSMDG RDSEIAMGA+QPHHL+A+ Q ARGQ
Sbjct  597  ARRFMIYVHSKMMIVDDEYIIVGSANINQRSMDGGRDSEIAMGAFQPHHLNAKGQVARGQ  656

Query  462  VHGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYP  283
            VHGFRM+LWYEHLGML + F  P S+ECV +VN++A+  W+LY+ + L  D+P HLL+YP
Sbjct  657  VHGFRMSLWYEHLGMLHDDFLNPGSLECVQRVNKMADKYWDLYASDELNDDLPGHLLTYP  716

Query  282  IGVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            + VT+ G VTELP  + FPDT+ PVLG K+  
Sbjct  717  VAVTKEGAVTELPRAKYFPDTETPVLGVKAKL  748



>ref|XP_006656220.1| PREDICTED: phospholipase D alpha 2-like [Oryza brachyantha]
Length=820

 Score =   308 bits (788),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 143/212 (67%), Positives = 174/212 (82%), Gaps = 1/212 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMY DI  AL+AK I A P+DYL+FFCLGNRE     EYEP+ +P + TDY++AQ+
Sbjct  603  RTMEMMYNDIAVALEAKKIDAEPRDYLTFFCLGNREVNMSGEYEPAGRPLDGTDYAKAQK  662

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHL-SARQPARGQ  463
            ARRFMIYVH+KMMIVDDEYIIVGSANINQRSMDG RDSEIAMGA+QP HL ++ Q ARGQ
Sbjct  663  ARRFMIYVHSKMMIVDDEYIIVGSANINQRSMDGGRDSEIAMGAFQPCHLNTSGQVARGQ  722

Query  462  VHGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYP  283
            VHGFRM+LWYEHLGML + F  PES+ECV +VN++A+  W+LY+G+ L+ D+P HLL+YP
Sbjct  723  VHGFRMSLWYEHLGMLHDEFLSPESLECVQRVNRMADKYWDLYTGDELDGDLPGHLLAYP  782

Query  282  IGVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            + VT  G VTELPG + FPDT+AP +GTK N 
Sbjct  783  VCVTREGTVTELPGARFFPDTQAPAIGTKGNL  814



>ref|XP_006350007.1| PREDICTED: phospholipase D alpha 1-like [Solanum tuberosum]
Length=819

 Score =   308 bits (788),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 140/212 (66%), Positives = 173/212 (82%), Gaps = 1/212 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKG-IIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQ  643
            RTM+MMYTDI  ALKAKG   A+P++YL+FFCLGNRE +K  EY+P +KP  DT+Y+RAQ
Sbjct  601  RTMEMMYTDICNALKAKGNTTADPREYLTFFCLGNREVEKLGEYKPPQKPVPDTNYARAQ  660

Query  642  EARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQ  463
            E RRFMIYVH+K+MIVDDEYII+GSANINQRSMDGARDSEIAMG YQP+HL++ QP RG+
Sbjct  661  EFRRFMIYVHSKLMIVDDEYIIIGSANINQRSMDGARDSEIAMGGYQPYHLASNQPPRGK  720

Query  462  VHGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYP  283
            ++GFRM+LW EHL   D+ FA P S+ECV KVN +AE +W LYS +T + D+P HLL YP
Sbjct  721  IYGFRMSLWCEHLNYADDSFADPSSLECVRKVNGMAEESWKLYSSDTFDLDLPGHLLRYP  780

Query  282  IGVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            I ++  GQ+T LPGF+ FPDTKA +LG KS +
Sbjct  781  IDISNTGQITTLPGFKFFPDTKAAILGNKSQY  812



>gb|EEC80931.1| hypothetical protein OsI_23625 [Oryza sativa Indica Group]
Length=802

 Score =   306 bits (784),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 142/212 (67%), Positives = 175/212 (83%), Gaps = 1/212 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMY DI  AL+AK I A+P+DYL+FFCLGNRE K   EYEP+ +P + TDY++AQ+
Sbjct  585  RTMEMMYYDIAVALEAKRINADPRDYLTFFCLGNREVKLNGEYEPAGRPLDGTDYAKAQK  644

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQ-PARGQ  463
            ARRFMIYVH+KMMIVDDEYIIVGSANINQRSMDG RDSEIAMGA+QP HL+ +   ARGQ
Sbjct  645  ARRFMIYVHSKMMIVDDEYIIVGSANINQRSMDGGRDSEIAMGAFQPCHLNTKGLVARGQ  704

Query  462  VHGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYP  283
            +HGFRM+LWYEHLGML + F  PES+ECV +VN++A+  W+LY+ + L  D+P HLL+YP
Sbjct  705  IHGFRMSLWYEHLGMLHDNFLNPESLECVQRVNKMADKYWDLYASDELNDDLPGHLLTYP  764

Query  282  IGVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            + VT+ G VTELPG + FPDT+APV+GTK N 
Sbjct  765  VRVTKEGTVTELPGAKFFPDTQAPVIGTKGNL  796



>gb|AFW87187.1| phospholipase D family protein [Zea mays]
Length=729

 Score =   304 bits (779),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 145/212 (68%), Positives = 172/212 (81%), Gaps = 1/212 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMY DI  AL+AK I  +P+DYL+FFCLGNRE K   EYEPS +P + TDY+RAQ 
Sbjct  512  RTMEMMYNDISVALEAKRIDRDPRDYLTFFCLGNREVKMDGEYEPSGRPLDGTDYARAQN  571

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSAR-QPARGQ  463
            ARRFMIYVH+KMMIVDDEYIIVGSANINQRSMDG RDSEIAMGAYQP HL+ + Q ARGQ
Sbjct  572  ARRFMIYVHSKMMIVDDEYIIVGSANINQRSMDGGRDSEIAMGAYQPCHLNTKGQVARGQ  631

Query  462  VHGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYP  283
            VHGFRM+LWYEHLGML + F  P S+ECV +VNQ+A+  W+LY+G++L+ D+P HLL YP
Sbjct  632  VHGFRMSLWYEHLGMLHDDFLNPGSLECVRRVNQMADRYWDLYAGDSLDADLPGHLLRYP  691

Query  282  IGVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            + VT+ G VTELPG + FPDT+A VLG  S  
Sbjct  692  VTVTKEGTVTELPGAKFFPDTQALVLGALSKL  723



>ref|NP_001058017.1| Os06g0604400 [Oryza sativa Japonica Group]
 sp|P93844.2|PLDA2_ORYSJ RecName: Full=Phospholipase D alpha 2; Short=PLD alpha 2; AltName: 
Full=Choline phosphatase 2; AltName: Full=Phosphatidylcholine-hydrolyzing 
phospholipase D 2 [Oryza sativa Japonica 
Group]
 dbj|BAD35531.1| Phospholipase D alpha 2 [Oryza sativa Japonica Group]
 dbj|BAF19931.1| Os06g0604400 [Oryza sativa Japonica Group]
 gb|EEE65982.1| hypothetical protein OsJ_21907 [Oryza sativa Japonica Group]
Length=817

 Score =   305 bits (782),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 142/212 (67%), Positives = 175/212 (83%), Gaps = 1/212 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMY DI  AL+AK I A+P+DYL+FFCLGNRE K   EYEP+ +P + TDY++AQ+
Sbjct  600  RTMEMMYYDIAVALEAKRINADPRDYLTFFCLGNREVKLNGEYEPAGRPLDGTDYAKAQK  659

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQ-PARGQ  463
            ARRFMIYVH+KMMIVDDEYIIVGSANINQRSMDG RDSEIAMGA+QP HL+ +   ARGQ
Sbjct  660  ARRFMIYVHSKMMIVDDEYIIVGSANINQRSMDGGRDSEIAMGAFQPCHLNTKGLVARGQ  719

Query  462  VHGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYP  283
            +HGFRM+LWYEHLGML + F  PES+ECV +VN++A+  W+LY+ + L  D+P HLL+YP
Sbjct  720  IHGFRMSLWYEHLGMLHDNFLNPESLECVQRVNKMADKYWDLYASDELNDDLPGHLLTYP  779

Query  282  IGVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            + VT+ G VTELPG + FPDT+APV+GTK N 
Sbjct  780  VRVTKEGTVTELPGAKFFPDTQAPVIGTKGNL  811



>gb|KJB55001.1| hypothetical protein B456_009G057800 [Gossypium raimondii]
Length=817

 Score =   305 bits (780),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 141/212 (67%), Positives = 172/212 (81%), Gaps = 4/212 (2%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETK-KGDEYEPSEKPDNDTDYSRAQ  643
            RT+QMMY D+ QAL  +G   NP+DYL+FFCLGNRE + K  EY P+EKPD ++DY RAQ
Sbjct  602  RTIQMMYRDVAQALHNEG---NPRDYLTFFCLGNREKENKSGEYLPNEKPDPNSDYGRAQ  658

Query  642  EARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQ  463
            ++RRFMIYVH+KMMIVDDEYII+GSANIN+RSM G+RDSEIAMGA+QP+HL+ +QP RGQ
Sbjct  659  QSRRFMIYVHSKMMIVDDEYIIIGSANINERSMAGSRDSEIAMGAFQPYHLATKQPVRGQ  718

Query  462  VHGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYP  283
            ++G RMALW EHLG   + FA PE+ +C+ +VN IAE NW LYS ETLE D+P HLL YP
Sbjct  719  IYGLRMALWKEHLGQRHDSFATPETEKCIQEVNSIAERNWVLYSSETLEEDLPGHLLRYP  778

Query  282  IGVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            I V E+G V+ LPG +NFPDT APVLG+KSN 
Sbjct  779  INVGEDGSVSSLPGAENFPDTNAPVLGSKSNI  810



>ref|XP_004251821.1| PREDICTED: phospholipase D alpha 1-like [Solanum lycopersicum]
Length=820

 Score =   305 bits (780),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 142/213 (67%), Positives = 173/213 (81%), Gaps = 2/213 (1%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGII-ANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQ  643
            RTM+MMYTDI  ALKAKG   A+P++YL+FFCLGNRE +K  EY+P +KP  DT+Y+RAQ
Sbjct  601  RTMEMMYTDICNALKAKGNTNADPREYLTFFCLGNREVEKPGEYKPPQKPVPDTNYARAQ  660

Query  642  EARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQ  463
            E RRFMIYVH+KMMIVDDEYII+GSANINQRSMDGARDSEIAMG YQP+HL++ QP RG+
Sbjct  661  EFRRFMIYVHSKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGGYQPYHLASNQPPRGK  720

Query  462  VHGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYP  283
            ++GFRM+LW EHL   D+ FA P S+ECV KVN +A+ +W LYS +T + D+P HLL YP
Sbjct  721  IYGFRMSLWCEHLNYADDSFADPSSLECVRKVNGMADESWKLYSNDTFDIDLPGHLLRYP  780

Query  282  IGVTEN-GQVTELPGFQNFPDTKAPVLGTKSNF  187
            I +  N GQ+T LPGF+ FPDTKA +LG KS F
Sbjct  781  IDINSNTGQITTLPGFKFFPDTKAAILGNKSQF  813



>ref|NP_001146242.1| uncharacterized protein LOC100279815 [Zea mays]
 gb|ACL53544.1| unknown [Zea mays]
 gb|AFW87188.1| phospholipase D family protein [Zea mays]
Length=816

 Score =   304 bits (778),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 145/212 (68%), Positives = 172/212 (81%), Gaps = 1/212 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMY DI  AL+AK I  +P+DYL+FFCLGNRE K   EYEPS +P + TDY+RAQ 
Sbjct  599  RTMEMMYNDISVALEAKRIDRDPRDYLTFFCLGNREVKMDGEYEPSGRPLDGTDYARAQN  658

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSAR-QPARGQ  463
            ARRFMIYVH+KMMIVDDEYIIVGSANINQRSMDG RDSEIAMGAYQP HL+ + Q ARGQ
Sbjct  659  ARRFMIYVHSKMMIVDDEYIIVGSANINQRSMDGGRDSEIAMGAYQPCHLNTKGQVARGQ  718

Query  462  VHGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYP  283
            VHGFRM+LWYEHLGML + F  P S+ECV +VNQ+A+  W+LY+G++L+ D+P HLL YP
Sbjct  719  VHGFRMSLWYEHLGMLHDDFLNPGSLECVRRVNQMADRYWDLYAGDSLDADLPGHLLRYP  778

Query  282  IGVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            + VT+ G VTELPG + FPDT+A VLG  S  
Sbjct  779  VTVTKEGTVTELPGAKFFPDTQALVLGALSKL  810



>ref|XP_004965943.1| PREDICTED: phospholipase D alpha 2-like [Setaria italica]
Length=818

 Score =   302 bits (774),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 144/211 (68%), Positives = 173/211 (82%), Gaps = 1/211 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMY DI  AL+AK I ANP+DYL+FFCLGNRE K   EYEP+ +P + +DY+RAQ 
Sbjct  600  RTMEMMYYDISIALEAKRIDANPRDYLTFFCLGNREVKMSGEYEPAGRPLDGSDYARAQN  659

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSAR-QPARGQ  463
            ARRFMIYVH+KMMIVDDEYIIVGSANINQRSMDG RDSEIAMGA+QP HL+ + Q ARGQ
Sbjct  660  ARRFMIYVHSKMMIVDDEYIIVGSANINQRSMDGGRDSEIAMGAFQPCHLNTKGQVARGQ  719

Query  462  VHGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYP  283
            VHGFRM+LWYEHLGML + F  P ++ECV +VN++A+  W+LY+ + L+ D+P HLL YP
Sbjct  720  VHGFRMSLWYEHLGMLHDDFLNPGNLECVQRVNKMADKYWDLYASDYLDADLPGHLLRYP  779

Query  282  IGVTENGQVTELPGFQNFPDTKAPVLGTKSN  190
            I VT+ G VTELPG + FPDT+A VLG KSN
Sbjct  780  INVTKEGTVTELPGAKYFPDTQATVLGMKSN  810



>ref|XP_002437251.1| hypothetical protein SORBIDRAFT_10g023630 [Sorghum bicolor]
 gb|EER88618.1| hypothetical protein SORBIDRAFT_10g023630 [Sorghum bicolor]
Length=816

 Score =   302 bits (773),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 144/212 (68%), Positives = 170/212 (80%), Gaps = 1/212 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM MMY DI  AL+AK I  NP+DYL+FFCLGNRE K   EYEPS +P + TDY+RAQ 
Sbjct  599  RTMDMMYNDISVALEAKRIDRNPRDYLTFFCLGNREVKMSGEYEPSGRPLDGTDYARAQN  658

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSAR-QPARGQ  463
            ARRFMIYVH+KMMIVDDEYIIVGSANINQRSMDG RDSEIAMGAYQP HL+ + Q ARGQ
Sbjct  659  ARRFMIYVHSKMMIVDDEYIIVGSANINQRSMDGGRDSEIAMGAYQPCHLNTKGQVARGQ  718

Query  462  VHGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYP  283
            VHGFRM+LWYEHLG+L + F  P S+ECV +VNQ+A+  W+LY+ ++L+ D+P HLL YP
Sbjct  719  VHGFRMSLWYEHLGVLHDDFLNPGSLECVQRVNQMADKYWDLYASDSLDADLPGHLLRYP  778

Query  282  IGVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            + VT+ G VTELPG + FPDT+A VLG    F
Sbjct  779  VTVTKEGTVTELPGAKFFPDTQALVLGALGKF  810



>ref|XP_010101275.1| Phospholipase D alpha 1 [Morus notabilis]
 gb|EXB88210.1| Phospholipase D alpha 1 [Morus notabilis]
Length=794

 Score =   300 bits (767),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 136/214 (64%), Positives = 173/214 (81%), Gaps = 3/214 (1%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKG-DEYEPSEKPDNDTDYSRAQ  643
            RT++MMYTDI QAL+ +G+  +P+DYL+FFCLGNRE      EY P E+PD ++DYSRAQ
Sbjct  574  RTIEMMYTDIAQALQRQGLDEDPRDYLTFFCLGNREEPGNLTEYRPPERPDPNSDYSRAQ  633

Query  642  EARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQ  463
            +ARRFMIYVH+KMMIVDDEYII+GSANINQRSMDGARDSEIAMGA+QPHH+++++PARGQ
Sbjct  634  QARRFMIYVHSKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGAFQPHHVASKEPARGQ  693

Query  462  VHGFRMALWYEHLGML--DNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLS  289
            ++GFRMALW EHL +    + F  PE++EC+ +VNQIA+ NW  Y  +T   D+P HLL 
Sbjct  694  IYGFRMALWREHLSVFLEKSTFNHPETVECIQRVNQIAQRNWERYCSDTFNGDLPGHLLR  753

Query  288  YPIGVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            YPI V++ G +T LPGF+ FPD KA VLG KS++
Sbjct  754  YPIEVSKTGAITTLPGFEFFPDNKAKVLGEKSDY  787



>dbj|BAA19466.1| phospholipase D [Oryza sativa Japonica Group]
Length=818

 Score =   300 bits (767),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 140/212 (66%), Positives = 173/212 (82%), Gaps = 1/212 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMY DI  AL+AK I A+P+DYL+FFCLGNRE K   EYEP+ +P + TDY++AQ+
Sbjct  601  RTMEMMYYDIAVALEAKRINADPRDYLTFFCLGNREVKLNGEYEPAGRPLDGTDYAKAQK  660

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQ-PARGQ  463
            ARRFMIYVH+KMMIVDDEYIIVGSANINQR MDG  DSEIAMGA+QP HL+ +   ARGQ
Sbjct  661  ARRFMIYVHSKMMIVDDEYIIVGSANINQRPMDGEGDSEIAMGAFQPCHLNTKGLVARGQ  720

Query  462  VHGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYP  283
            +HGFRM+LWYEHLGML + F  PES+ECV +VN++A+  W+LY+ + L  D+P HLL+YP
Sbjct  721  IHGFRMSLWYEHLGMLHDNFLNPESLECVQRVNKMADKYWDLYASDELNDDLPGHLLTYP  780

Query  282  IGVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            + VT+ G VTELPG + FPDT+APV+GTK N 
Sbjct  781  VRVTKEGTVTELPGAKFFPDTQAPVIGTKGNL  812



>ref|XP_010048204.1| PREDICTED: phospholipase D alpha 1-like [Eucalyptus grandis]
 gb|KCW80385.1| hypothetical protein EUGRSUZ_C01746 [Eucalyptus grandis]
Length=831

 Score =   300 bits (767),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 139/212 (66%), Positives = 169/212 (80%), Gaps = 1/212 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMYTDIV AL+ KG+ ANP+DYL+FFCLGNRE ++G E  P EKP  D+DYSRAQ+
Sbjct  613  RTMEMMYTDIVHALRKKGVAANPRDYLAFFCLGNREARRGGEPVPEEKPAPDSDYSRAQQ  672

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPA-RGQ  463
            ARRFMIYVH+KMMIVDDEYIIVGSANIN+RSM+GARD+EIAMGA+QP HL+    + RGQ
Sbjct  673  ARRFMIYVHSKMMIVDDEYIIVGSANINERSMEGARDTEIAMGAFQPEHLATPDVSPRGQ  732

Query  462  VHGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYP  283
            ++GFRM+LW+EHLG  +   A PES+ C+ ++N  AE  W+ Y+ E    D+PAHLL YP
Sbjct  733  IYGFRMSLWHEHLGHTEEVHAHPESLHCIRQMNARAEACWDRYTDEEFGGDLPAHLLRYP  792

Query  282  IGVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            I V ENG V  LPGF+ FPDTKAPVLG KS+ 
Sbjct  793  IDVAENGAVKPLPGFKQFPDTKAPVLGAKSDI  824



>gb|AAF78755.1|AF271357_1 phospholipase D [Oryza sativa Indica Group]
 gb|EAZ01590.1| hypothetical protein OsI_23624 [Oryza sativa Indica Group]
Length=842

 Score =   299 bits (766),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 140/212 (66%), Positives = 170/212 (80%), Gaps = 2/212 (1%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMY DI  ALKA    A+P+DYL+FFCLGNRE K   EY P+ +PD DTDY++AQ 
Sbjct  621  RTMEMMYYDIAVALKANHSDADPRDYLTFFCLGNREAKSHGEYVPAHRPDQDTDYAKAQN  680

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSAR-QPARGQ  463
            ARRFMIYVH+KMMIVDDEYIIVGSANINQRSMDG RDSEIAMGA+QPHHL+   Q ARGQ
Sbjct  681  ARRFMIYVHSKMMIVDDEYIIVGSANINQRSMDGGRDSEIAMGAFQPHHLNVNGQAARGQ  740

Query  462  VHGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYP  283
            +HGFRM+LWYEHLGML + F  P S+ECV +VN +A+ +W LY+GE L  D+P HLL+YP
Sbjct  741  IHGFRMSLWYEHLGMLHDDFVHPGSLECVRRVNAMADRHWQLYAGEELHGDLPGHLLTYP  800

Query  282  IGVTEN-GQVTELPGFQNFPDTKAPVLGTKSN  190
            + V ++ G VT LPG + FPDT+A V+GT ++
Sbjct  801  VAVEKDGGAVTALPGAEFFPDTEAKVIGTLAS  832



>ref|NP_001058016.1| Os06g0604300 [Oryza sativa Japonica Group]
 dbj|BAD35530.1| phospholipase D [Oryza sativa Japonica Group]
 dbj|BAF19930.1| Os06g0604300 [Oryza sativa Japonica Group]
 gb|EAZ37574.1| hypothetical protein OsJ_21906 [Oryza sativa Japonica Group]
Length=842

 Score =   299 bits (765),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 140/212 (66%), Positives = 170/212 (80%), Gaps = 2/212 (1%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMY DI  ALKA    A+P+DYL+FFCLGNRE K   EY P+ +PD DTDY++AQ 
Sbjct  621  RTMEMMYYDIAVALKANHSDADPRDYLTFFCLGNREAKSHGEYVPAHRPDQDTDYAKAQN  680

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSAR-QPARGQ  463
            ARRFMIYVH+KMMIVDDEYIIVGSANINQRSMDG RDSEIAMGA+QPHHL+   Q ARGQ
Sbjct  681  ARRFMIYVHSKMMIVDDEYIIVGSANINQRSMDGGRDSEIAMGAFQPHHLNVNGQAARGQ  740

Query  462  VHGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYP  283
            +HGFRM+LWYEHLGML + F  P S+ECV +VN +A+ +W LY+GE L  D+P HLL+YP
Sbjct  741  IHGFRMSLWYEHLGMLHDDFVHPGSLECVRRVNAMADRHWQLYAGEELHGDLPGHLLTYP  800

Query  282  IGVTEN-GQVTELPGFQNFPDTKAPVLGTKSN  190
            + V ++ G VT LPG + FPDT+A V+GT ++
Sbjct  801  VAVEKDGGAVTALPGAEFFPDTEAKVIGTLAS  832



>ref|XP_010696306.1| PREDICTED: phospholipase D alpha 1-like [Beta vulgaris subsp. 
vulgaris]
Length=823

 Score =   297 bits (761),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 138/212 (65%), Positives = 167/212 (79%), Gaps = 1/212 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMY DI  A+++K I A+PKDYLSFFCLGNRE  K  EYEP+EKP +D++Y++AQ 
Sbjct  605  RTMEMMYADIAAAIQSKQINAHPKDYLSFFCLGNREVLKPGEYEPTEKPGSDSNYAKAQH  664

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSARQPARGQV  460
             RRFMIYVHAKMMIVDDEYII+GSANINQRSMDG RD+EIAMGAYQP H+S    A+GQ+
Sbjct  665  NRRFMIYVHAKMMIVDDEYIIIGSANINQRSMDGGRDTEIAMGAYQPQHISGSLSAKGQI  724

Query  459  HGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYPI  280
             GFRMALWYEHL  L   F  PES+EC+ +VN++AE+NWN+Y+ E  ++D+P HLL YPI
Sbjct  725  FGFRMALWYEHLHQLHESFLYPESLECMQRVNKLAEDNWNMYASEVFDQDLPGHLLRYPI  784

Query  279  GVTENGQVTELPGFQN-FPDTKAPVLGTKSNF  187
             VT  G VT L   +  FPDTKA +LGTKS  
Sbjct  785  EVTNFGHVTSLSDIEKFFPDTKAHILGTKSEL  816



>gb|EYU32345.1| hypothetical protein MIMGU_mgv1a001383mg [Erythranthe guttata]
Length=828

 Score =   297 bits (760),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 139/213 (65%), Positives = 168/213 (79%), Gaps = 2/213 (1%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGI-IANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQ  643
            RTM+MMYTDI  ALKAKG+   +P++YL+FFCLGNRE +   EY P+EKP  DTDY RAQ
Sbjct  609  RTMEMMYTDIANALKAKGVGNVDPREYLTFFCLGNREIETPGEYIPTEKPAPDTDYGRAQ  668

Query  642  EARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHL-SARQPARG  466
            ++RRFMIYVH+KMMIVDDEYIIVGSANINQRSMDG RDSEIAMG +QPHHL +   PA+G
Sbjct  669  KSRRFMIYVHSKMMIVDDEYIIVGSANINQRSMDGGRDSEIAMGGFQPHHLVNGNMPAKG  728

Query  465  QVHGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSY  286
            Q+ G RMALW EHL   D+ F +PE++ECV  VN I + NW LYS E    D+P HLLSY
Sbjct  729  QIFGLRMALWCEHLLREDDTFLRPENIECVRNVNAIGDENWKLYSSEKFVEDLPGHLLSY  788

Query  285  PIGVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            PI V+ +G++  +PGF+ FPDTKA VLGTKS++
Sbjct  789  PISVSSSGEINAIPGFEFFPDTKAKVLGTKSDY  821



>ref|XP_004501330.1| PREDICTED: phospholipase D alpha 1-like isoform X1 [Cicer arietinum]
Length=836

 Score =   297 bits (760),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 137/215 (64%), Positives = 175/215 (81%), Gaps = 4/215 (2%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMY+DI +AL+ KGI ANP+DYL+FFCLGNRE KK +EY P+E P+  TDYSRAQ 
Sbjct  615  RTMEMMYSDIAEALRRKGIRANPRDYLTFFCLGNREGKKDNEYTPTEAPEPGTDYSRAQN  674

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSA-RQPARGQ  463
            +RRFMIYVHAKMMIVDDEYII+GSANINQRSMDGARD+EIA+GA+QP H+S+  +P +GQ
Sbjct  675  SRRFMIYVHAKMMIVDDEYIIIGSANINQRSMDGARDTEIAIGAFQPQHISSYNKPPKGQ  734

Query  462  VHGFRMALWYEHLGMLDN--CFAQPESMECVLKVNQIAENNWNLYSGETLERDMP-AHLL  292
            ++GFR ALWYEHLG L +  CF  PES++C+  VN++A+ NW++YS +T +  +P  HL+
Sbjct  735  IYGFRRALWYEHLGDLGDTSCFDNPESLKCIKLVNRLADTNWDIYSDDTFDEYIPFQHLM  794

Query  291  SYPIGVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
             YPI V  NG +T LPGF  FPDTKA +LG+K+ +
Sbjct  795  RYPIRVANNGDITTLPGFVYFPDTKARILGSKTEY  829



>ref|XP_004501331.1| PREDICTED: phospholipase D alpha 1-like isoform X2 [Cicer arietinum]
Length=833

 Score =   296 bits (759),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 137/215 (64%), Positives = 175/215 (81%), Gaps = 4/215 (2%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMY+DI +AL+ KGI ANP+DYL+FFCLGNRE KK +EY P+E P+  TDYSRAQ 
Sbjct  612  RTMEMMYSDIAEALRRKGIRANPRDYLTFFCLGNREGKKDNEYTPTEAPEPGTDYSRAQN  671

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSA-RQPARGQ  463
            +RRFMIYVHAKMMIVDDEYII+GSANINQRSMDGARD+EIA+GA+QP H+S+  +P +GQ
Sbjct  672  SRRFMIYVHAKMMIVDDEYIIIGSANINQRSMDGARDTEIAIGAFQPQHISSYNKPPKGQ  731

Query  462  VHGFRMALWYEHLGMLDN--CFAQPESMECVLKVNQIAENNWNLYSGETLERDMP-AHLL  292
            ++GFR ALWYEHLG L +  CF  PES++C+  VN++A+ NW++YS +T +  +P  HL+
Sbjct  732  IYGFRRALWYEHLGDLGDTSCFDNPESLKCIKLVNRLADTNWDIYSDDTFDEYIPFQHLM  791

Query  291  SYPIGVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
             YPI V  NG +T LPGF  FPDTKA +LG+K+ +
Sbjct  792  RYPIRVANNGDITTLPGFVYFPDTKARILGSKTEY  826



>ref|XP_007011867.1| Phospholipase D alpha 1 [Theobroma cacao]
 gb|EOY29486.1| Phospholipase D alpha 1 [Theobroma cacao]
Length=824

 Score =   295 bits (755),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 130/210 (62%), Positives = 174/210 (83%), Gaps = 1/210 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RTM+MMY+D+ +AL+ KG+ A+P++YL+FFCLGN+ETKK  EY P+E+PD ++DY+RAQ+
Sbjct  599  RTMEMMYSDVTEALQRKGLDADPREYLTFFCLGNKETKKAGEYVPTEQPDPNSDYARAQQ  658

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHL-SARQPARGQ  463
            ARRFMIYVH+KMMIVDDEYII+GSANINQRSMDG RDSEIAMGA+QPHHL +  + A GQ
Sbjct  659  ARRFMIYVHSKMMIVDDEYIIIGSANINQRSMDGGRDSEIAMGAFQPHHLDTPFRRAGGQ  718

Query  462  VHGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYP  283
            ++GFRMALW+EHLG +++ F  PES++CV  +N IA+  W +Y+ ++ E+D+P HLL YP
Sbjct  719  IYGFRMALWHEHLGHIESGFQFPESLQCVRAINSIADKLWGMYASDSPEQDLPGHLLRYP  778

Query  282  IGVTENGQVTELPGFQNFPDTKAPVLGTKS  193
            I ++  G +T +P  + FPDTKAPVL TK+
Sbjct  779  IQISSTGGITAMPNMEFFPDTKAPVLATKA  808



>ref|XP_006657112.1| PREDICTED: phospholipase D alpha 2-like [Oryza brachyantha]
Length=768

 Score =   293 bits (750),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 137/212 (65%), Positives = 166/212 (78%), Gaps = 1/212 (0%)
 Frame = -3

Query  819  RTMQMMYTDIVQALKAKGIIANPKDYLSFFCLGNRETKKGDEYEPSEKPDNDTDYSRAQE  640
            RT+QMMY DI  ALKAK   A+P+DYL+FFCLGNRE +   EY P+  P   T Y++AQ+
Sbjct  548  RTIQMMYDDIAGALKAKNSDADPRDYLTFFCLGNREVQSNGEYVPAHHPREGTQYAKAQK  607

Query  639  ARRFMIYVHAKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLSAR-QPARGQ  463
            ARRFMIYVH+KMMIVDDEYIIVGSANINQRSMDG RD+EIAMGA+QP HL+   Q ARGQ
Sbjct  608  ARRFMIYVHSKMMIVDDEYIIVGSANINQRSMDGGRDTEIAMGAFQPRHLNIDGQAARGQ  667

Query  462  VHGFRMALWYEHLGMLDNCFAQPESMECVLKVNQIAENNWNLYSGETLERDMPAHLLSYP  283
            VHGFRM+LWYEHLGML + F +PES+ECV +VN +A  +W LY+ E L  D+  HLL+YP
Sbjct  668  VHGFRMSLWYEHLGMLHDDFLRPESLECVRRVNGMAATHWELYAREELHEDLEGHLLTYP  727

Query  282  IGVTENGQVTELPGFQNFPDTKAPVLGTKSNF  187
            I V ++G V+ LPG + FPDT+APVLG K+  
Sbjct  728  IAVAKDGAVSSLPGVKFFPDTEAPVLGKKATL  759



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1738401790104