BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig11240

Length=788
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009766630.1|  PREDICTED: uncharacterized protein LOC104217966    220   3e-65   Nicotiana sylvestris
ref|XP_006354938.1|  PREDICTED: uncharacterized protein LOC102588271    217   7e-64   Solanum tuberosum [potatoes]
ref|XP_010320361.1|  PREDICTED: uncharacterized protein LOC104647193    213   2e-62   Solanum lycopersicum
ref|XP_009605564.1|  PREDICTED: uncharacterized protein LOC104100103    217   2e-61   
ref|XP_011083789.1|  PREDICTED: uncharacterized protein LOC105166216    201   8e-58   Sesamum indicum [beniseed]
ref|XP_007017377.1|  Uncharacterized protein TCM_033924                 194   2e-55   
gb|EYU36280.1|  hypothetical protein MIMGU_mgv1a007411mg                194   3e-55   Erythranthe guttata [common monkey flower]
gb|KHG04813.1|  Sulfite reductase [NADPH] hemoprotein beta-component    192   1e-54   Gossypium arboreum [tree cotton]
ref|XP_010255103.1|  PREDICTED: uncharacterized protein LOC104595864    191   2e-54   Nelumbo nucifera [Indian lotus]
gb|KJB14548.1|  hypothetical protein B456_002G130600                    188   3e-53   Gossypium raimondii
gb|KCW68783.1|  hypothetical protein EUGRSUZ_F02384                     185   8e-52   Eucalyptus grandis [rose gum]
ref|XP_011074597.1|  PREDICTED: uncharacterized protein LOC105159284    190   2e-51   
ref|XP_012071722.1|  PREDICTED: uncharacterized protein LOC105633697    182   8e-51   
ref|XP_007160813.1|  hypothetical protein PHAVU_001G018600g             181   1e-50   Phaseolus vulgaris [French bean]
ref|XP_011030728.1|  PREDICTED: uncharacterized protein LOC105130...    181   2e-50   Populus euphratica
ref|XP_011030720.1|  PREDICTED: uncharacterized protein LOC105130...    181   3e-50   Populus euphratica
ref|XP_010064740.1|  PREDICTED: uncharacterized protein LOC104451871    184   9e-50   
ref|XP_006375011.1|  hypothetical protein POPTR_0014s03560g             177   4e-49   
ref|XP_002510285.1|  signal peptidase I, putative                       181   2e-48   
gb|AGV54177.1|  signal peptidase I                                      175   3e-48   Phaseolus vulgaris [French bean]
ref|XP_008220883.1|  PREDICTED: uncharacterized protein LOC103320920    179   1e-47   
ref|XP_010541807.1|  PREDICTED: uncharacterized protein LOC104815190    172   4e-47   Tarenaya hassleriana [spider flower]
ref|XP_008378515.1|  PREDICTED: uncharacterized protein LOC103441607    172   4e-47   
gb|AES59509.2|  signal peptidase I, putative                            172   8e-47   Medicago truncatula
ref|XP_003589258.1|  hypothetical protein MTR_1g021180                  172   2e-46   
gb|KHN12749.1|  hypothetical protein glysoja_008712                     169   8e-46   Glycine soja [wild soybean]
ref|XP_009364068.1|  PREDICTED: uncharacterized protein LOC103953991    167   5e-45   Pyrus x bretschneideri [bai li]
ref|XP_003549415.1|  PREDICTED: uncharacterized protein LOC100804093    167   6e-45   Glycine max [soybeans]
ref|XP_004499101.1|  PREDICTED: uncharacterized protein LOC101493524    166   1e-44   Cicer arietinum [garbanzo]
ref|XP_006393531.1|  hypothetical protein EUTSA_v10011550mg             162   2e-43   Eutrema salsugineum [saltwater cress]
ref|XP_010941858.1|  PREDICTED: uncharacterized protein LOC105060006    162   3e-43   Elaeis guineensis
ref|XP_006307471.1|  hypothetical protein CARUB_v10009097mg             160   4e-42   
ref|XP_009365670.1|  PREDICTED: uncharacterized protein LOC103955500    163   4e-42   
ref|XP_002891379.1|  hypothetical protein ARALYDRAFT_473912             159   5e-42   
gb|KHN21021.1|  hypothetical protein glysoja_009329                     156   1e-41   Glycine soja [wild soybean]
ref|XP_010089929.1|  putative thylakoidal processing peptidase 2        160   3e-41   
ref|XP_011654083.1|  PREDICTED: uncharacterized protein LOC105435...    156   4e-41   Cucumis sativus [cucumbers]
ref|XP_011654084.1|  PREDICTED: uncharacterized protein LOC105435...    156   4e-41   Cucumis sativus [cucumbers]
gb|KFK29079.1|  hypothetical protein AALP_AA7G086200                    156   6e-41   Arabis alpina [alpine rockcress]
ref|NP_564503.1|  uncharacterized protein                               154   3e-40   Arabidopsis thaliana [mouse-ear cress]
gb|AAM61120.1|  unknown                                                 154   3e-40   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008452490.1|  PREDICTED: uncharacterized protein LOC103493...    154   9e-40   Cucumis melo [Oriental melon]
ref|XP_008452491.1|  PREDICTED: uncharacterized protein LOC103493...    154   9e-40   Cucumis melo [Oriental melon]
ref|XP_010461568.1|  PREDICTED: uncharacterized protein LOC104742274    152   1e-39   Camelina sativa [gold-of-pleasure]
emb|CDY58083.1|  BnaA10g28600D                                          152   1e-39   Brassica napus [oilseed rape]
ref|XP_009118936.1|  PREDICTED: uncharacterized protein LOC103843915    152   2e-39   Brassica rapa
ref|XP_010500293.1|  PREDICTED: uncharacterized protein LOC104777695    151   3e-39   Camelina sativa [gold-of-pleasure]
ref|XP_010479168.1|  PREDICTED: uncharacterized protein LOC104758062    149   2e-38   Camelina sativa [gold-of-pleasure]
ref|XP_008792705.1|  PREDICTED: uncharacterized protein LOC103709235    149   2e-38   Phoenix dactylifera
emb|CDY20895.1|  BnaC06g01150D                                          148   4e-38   Brassica napus [oilseed rape]
ref|XP_011459929.1|  PREDICTED: uncharacterized protein LOC101290731    149   8e-37   Fragaria vesca subsp. vesca
gb|EPS59742.1|  hypothetical protein M569_15063                         127   2e-30   Genlisea aurea
ref|XP_006651846.1|  PREDICTED: uncharacterized protein LOC102700979    120   5e-28   
ref|NP_001051374.1|  Os03g0765100                                       112   5e-26   
gb|AAP50957.1|  hypothetical protein                                    111   1e-24   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002466398.1|  hypothetical protein SORBIDRAFT_01g007090          110   2e-24   Sorghum bicolor [broomcorn]
ref|XP_004981653.1|  PREDICTED: uncharacterized protein LOC101786169    108   1e-23   Setaria italica
ref|XP_009407427.1|  PREDICTED: uncharacterized protein LOC103990116    107   2e-23   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABF99038.1|  expressed protein                                       103   3e-23   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003558970.1|  PREDICTED: uncharacterized protein LOC100823712    106   4e-23   Brachypodium distachyon [annual false brome]
ref|NP_001143737.1|  uncharacterized protein LOC100276491 precursor     105   1e-22   Zea mays [maize]
ref|XP_011624990.1|  PREDICTED: uncharacterized protein LOC18438315     103   6e-22   Amborella trichopoda
ref|XP_007225638.1|  hypothetical protein PRUPE_ppa008077mg             102   6e-22   
gb|EMS46425.1|  hypothetical protein TRIUR3_01273                     99.8    5e-21   Triticum urartu
dbj|BAK02011.1|  predicted protein                                    99.8    1e-20   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT25813.1|  hypothetical protein F775_05689                       99.0    1e-20   
gb|ADE77539.1|  unknown                                               82.4    2e-14   Picea sitchensis
gb|ERN10146.1|  hypothetical protein AMTR_s00169p00063630             69.7    1e-11   Amborella trichopoda
gb|ERN16417.1|  hypothetical protein AMTR_s00052p00153660             61.6    9e-09   Amborella trichopoda
gb|ABR16617.1|  unknown                                               62.8    7e-08   Picea sitchensis
ref|XP_003589261.1|  hypothetical protein MTR_1g021220                53.5    9e-06   
ref|NP_001130991.1|  uncharacterized protein LOC100192096             54.7    2e-05   
ref|XP_008654278.1|  PREDICTED: uncharacterized protein LOC100192...  54.7    3e-05   
gb|ACG32495.1|  hypothetical protein                                  54.7    3e-05   Zea mays [maize]
ref|XP_004970094.1|  PREDICTED: uncharacterized protein LOC101758677  54.3    4e-05   Setaria italica
ref|XP_012074540.1|  PREDICTED: uncharacterized protein LOC105635994  54.3    5e-05   Jatropha curcas
gb|EYU18363.1|  hypothetical protein MIMGU_mgv1a009928mg              52.0    2e-04   Erythranthe guttata [common monkey flower]
dbj|BAB11418.1|  unnamed protein product                              49.7    3e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010936242.1|  PREDICTED: uncharacterized protein LOC105055914  51.6    3e-04   Elaeis guineensis
emb|CDY51296.1|  BnaA06g23500D                                        51.2    5e-04   Brassica napus [oilseed rape]
ref|XP_009150533.1|  PREDICTED: uncharacterized protein LOC103873874  51.2    5e-04   Brassica rapa
ref|XP_008790404.1|  PREDICTED: uncharacterized protein LOC103707624  50.4    7e-04   Phoenix dactylifera
gb|AGT17294.1|  hypothetical protein SHCRBa_168_J15_R_140             50.4    8e-04   Saccharum hybrid cultivar R570
ref|XP_002964757.1|  hypothetical protein SELMODRAFT_270469           50.1    0.001   



>ref|XP_009766630.1| PREDICTED: uncharacterized protein LOC104217966 [Nicotiana sylvestris]
Length=412

 Score =   220 bits (561),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 122/204 (60%), Positives = 150/204 (74%), Gaps = 4/204 (2%)
 Frame = -2

Query  766  GNAFTNMWSESQSSCLSLLPVRVRGSASVTVYRTKNPDASIRTSFLSRGIVKLLPEKCYM  587
            G  F  +W   QSSC+ LLPV   GSASV  YRT+NP   I T+F+ R I+KLL EKCY 
Sbjct  212  GCEFGYVW---QSSCIPLLPVHASGSASVLAYRTRNPGLRIETAFIPRRIIKLLAEKCYT  268

Query  586  GNVYRKQSSVFDSLSQRVTSLENVLKSFLGGRTNRNTGLGL-KIRIKPSYIFRFQIELER  410
             ++YRK+S   D LSQ++T L  VL+SFLGGRT++   L L K++++   +FRFQ+ELER
Sbjct  269  RHIYRKRSLYSDFLSQKITLLGKVLRSFLGGRTSQIATLDLLKVKVEDLTLFRFQMELER  328

Query  409  NIRSNDTYWSTLGEWRTRPAAERVWFEVVAGIGSGFMKPFTIRKVRPFIEVDslswsslm  230
             I SNDTYW+ LG+WRT+PA ER WFEV A      +KP  I+KVRPFIEVDS SWS+LM
Sbjct  329  GIPSNDTYWTALGQWRTKPAVERSWFEVTARFEEEVLKPRFIKKVRPFIEVDSSSWSNLM  388

Query  229  sniSFTKFPSFLVPPEPLTLDVKW  158
            SN+SFTK  SFLVPPEPLTLDV+W
Sbjct  389  SNMSFTKISSFLVPPEPLTLDVRW  412



>ref|XP_006354938.1| PREDICTED: uncharacterized protein LOC102588271 [Solanum tuberosum]
Length=420

 Score =   217 bits (553),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 118/194 (61%), Positives = 146/194 (75%), Gaps = 1/194 (1%)
 Frame = -2

Query  736  SQSSCLSLLPVRVRGSASVTVYRTKNPDASIRTSFLSRGIVKLLPEKCYMGNVYRKQSSV  557
            SQSSC+ LLPV VRG ASV  Y T+NPD  I T+ +S+  +KLL EKCY  ++YRK S  
Sbjct  227  SQSSCIPLLPVHVRGPASVLAYITRNPDLRIETASVSKRSIKLLSEKCYTRHIYRKWSLY  286

Query  556  FDSLSQRVTSLENVLKSFLGGRTNRNTGLGL-KIRIKPSYIFRFQIELERNIRSNDTYWS  380
             D LSQ++T LE +L+ FLGG+T+      L K+++K   +FRFQ+ELER I++NDTYW+
Sbjct  287  NDFLSQKITLLEKILRRFLGGKTSEIARFNLIKVKVKDLTLFRFQLELERGIQNNDTYWT  346

Query  379  TLGEWRTRPAAERVWFEVVAGIGSGFMKPFTIRKVRPFIEVDslswsslmsniSFTKFPS  200
            TLGEWRTRPA E  WFEV A   +  +KP  I+KVRPFIEVDS SWS+LMSN+SFTK  S
Sbjct  347  TLGEWRTRPAVEHSWFEVTARFEAEILKPRLIKKVRPFIEVDSSSWSNLMSNMSFTKISS  406

Query  199  FLVPPEPLTLDVKW  158
            FLVPPEPLTLDV+W
Sbjct  407  FLVPPEPLTLDVRW  420



>ref|XP_010320361.1| PREDICTED: uncharacterized protein LOC104647193 [Solanum lycopersicum]
Length=423

 Score =   213 bits (542),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 116/193 (60%), Positives = 144/193 (75%), Gaps = 1/193 (1%)
 Frame = -2

Query  733  QSSCLSLLPVRVRGSASVTVYRTKNPDASIRTSFLSRGIVKLLPEKCYMGNVYRKQSSVF  554
            QSSC+ LLPV V+G ASV  Y T+NPD  I T F+SR  +KLL +KCY  ++YRK SS  
Sbjct  231  QSSCIPLLPVHVKGPASVLAYITRNPDLRIETVFVSRRSIKLLSQKCYTRHIYRKWSSYN  290

Query  553  DSLSQRVTSLENVLKSFLGGRTNRNTGLGL-KIRIKPSYIFRFQIELERNIRSNDTYWST  377
            D  SQ++  LE VL+ FLGG+T++     L K+++K   +FRFQ+ELER I++NDTYW+T
Sbjct  291  DFQSQKIALLEKVLRRFLGGKTSQIGRYNLLKVKVKDLTLFRFQLELERGIQNNDTYWTT  350

Query  376  LGEWRTRPAAERVWFEVVAGIGSGFMKPFTIRKVRPFIEVDslswsslmsniSFTKFPSF  197
            LGEWRTRPA E  WFEV A   +  +KP  I+KV PFIEVDS SWS+LMSN+SFTK  SF
Sbjct  351  LGEWRTRPAVEHSWFEVTARFEADILKPRLIKKVSPFIEVDSSSWSNLMSNMSFTKISSF  410

Query  196  LVPPEPLTLDVKW  158
            LVPPEPLTLDV+W
Sbjct  411  LVPPEPLTLDVRW  423



>ref|XP_009605564.1| PREDICTED: uncharacterized protein LOC104100103 [Nicotiana tomentosiformis]
Length=800

 Score =   217 bits (553),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 121/204 (59%), Positives = 151/204 (74%), Gaps = 4/204 (2%)
 Frame = -2

Query  766  GNAFTNMWSESQSSCLSLLPVRVRGSASVTVYRTKNPDASIRTSFLSRGIVKLLPEKCYM  587
            G  F  +W   QSSC+ LLPV   GSASV  Y T+NP   I T+F+SR I+KLL EKCY 
Sbjct  600  GCEFGCVW---QSSCIPLLPVHASGSASVLAYWTRNPGLRIDTAFVSRRIIKLLAEKCYA  656

Query  586  GNVYRKQSSVFDSLSQRVTSLENVLKSFLGGRTNRNTGLGL-KIRIKPSYIFRFQIELER  410
             ++YRK+S   D L+Q++T L  VL+SFLGGRT++   L L K++++   +FRFQ+ELER
Sbjct  657  RHIYRKRSLYSDFLTQKITLLGKVLRSFLGGRTSQIARLDLLKVKVEDLTLFRFQLELER  716

Query  409  NIRSNDTYWSTLGEWRTRPAAERVWFEVVAGIGSGFMKPFTIRKVRPFIEVDslswsslm  230
             I SNDTYW+TLG+WRT+PA ER WFEV A      +KP  I+K+RPFIEVDS SWS+LM
Sbjct  717  GIPSNDTYWTTLGQWRTKPAVERSWFEVTARFEEEVLKPRFIKKIRPFIEVDSSSWSNLM  776

Query  229  sniSFTKFPSFLVPPEPLTLDVKW  158
            SN+SFTK  SFLVPPEPLTLDV+W
Sbjct  777  SNMSFTKISSFLVPPEPLTLDVRW  800



>ref|XP_011083789.1| PREDICTED: uncharacterized protein LOC105166216 [Sesamum indicum]
Length=418

 Score =   201 bits (511),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 118/201 (59%), Positives = 142/201 (71%), Gaps = 8/201 (4%)
 Frame = -2

Query  745  WSESQS----SCLSLLPVRVRGSASVTVYRTKNPDASIRTSFLSRGIVKLLPEKCYMGNV  578
            W+E +S    SC  LLP+R+ GSASV  YR+K   A++RT F SR  ++LLP+KCY+   
Sbjct  221  WNEIESIWPASCTKLLPIRILGSASVVAYRSKK-SAALRTVFSSRNAIELLPDKCYLWPN  279

Query  577  YRKQSSVFDSLSQRVTSLENVLKSFLGGRTNRNTGL-GLKIRIKPSYIFRFQIELERNIR  401
            Y K    F  LS RV     VL SFL  + N N  L   + RI  S I+RFQ+ELERNIR
Sbjct  280  YEKPRQFFSPLSLRVAL--KVLSSFLDEKPNPNVLLRSFRARIGASTIYRFQLELERNIR  337

Query  400  SNDTYWSTLGEWRTRPAAERVWFEVVAGIGSGFMKPFTIRKVRPFIEVDslswsslmsni  221
            SNDTYWSTL +WRTRP  ERVWFEVVA +    +KP  I+KVRPFI++DS+SWSSL+SN+
Sbjct  338  SNDTYWSTLAQWRTRPIVERVWFEVVARLDGEVLKPLVIKKVRPFIDIDSISWSSLLSNL  397

Query  220  SFTKFPSFLVPPEPLTLDVKW  158
            SFTKFPS LVPPE LTLDVKW
Sbjct  398  SFTKFPSILVPPEALTLDVKW  418



>ref|XP_007017377.1| Uncharacterized protein TCM_033924 [Theobroma cacao]
 gb|EOY14602.1| Uncharacterized protein TCM_033924 [Theobroma cacao]
Length=387

 Score =   194 bits (494),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 107/200 (54%), Positives = 135/200 (68%), Gaps = 1/200 (1%)
 Frame = -2

Query  754  TNMWSESQSSCLSLLPVRVRGSASVTVYRTKNPDASIRTSFLSRGIVKLLPEKCYMGNVY  575
            T  W   QS C+ LLPV V GS S+  Y+T+NPDA I   FLS   ++LLPEKCY    Y
Sbjct  188  TGYWPFRQSFCMPLLPVNVLGSVSLVAYQTRNPDAHIEAVFLSSDTIELLPEKCYGDRAY  247

Query  574  RKQSSVFDSLSQRVTSLENVLKSFLGGRTNRNT-GLGLKIRIKPSYIFRFQIELERNIRS  398
             KQS   DS+S R++ L  VL++FLG R N N     L ++ K S I  FQ+ELE+ I  
Sbjct  248  MKQSYPMDSISLRISKLRKVLRTFLGDRDNGNGFSSSLNVKTKASPIIHFQLELEKTIGK  307

Query  397  NDTYWSTLGEWRTRPAAERVWFEVVAGIGSGFMKPFTIRKVRPFIEVDslswsslmsniS  218
            N+T    L EWR++P  ER+WF+V A I +  +KP  I+KVRPF+ VD++SWS+L+SNIS
Sbjct  308  NETVRGMLAEWRSKPTVERLWFDVTARIEAEKLKPLMIKKVRPFVGVDTVSWSNLLSNIS  367

Query  217  FTKFPSFLVPPEPLTLDVKW  158
            FTKFPS LVPPE LTLDVKW
Sbjct  368  FTKFPSILVPPEALTLDVKW  387



>gb|EYU36280.1| hypothetical protein MIMGU_mgv1a007411mg [Erythranthe guttata]
Length=408

 Score =   194 bits (494),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 103/191 (54%), Positives = 136/191 (71%), Gaps = 2/191 (1%)
 Frame = -2

Query  724  CLSLLPVRVRGSASVTVYRTKNPDASIRTSFLSRGIVKLLPEKCYMGNVYRKQSSVFDSL  545
            C +LLP+ + GSASV  Y+++ PD+ I+T+  S   +KLLP+KC++   Y+K   +  SL
Sbjct  218  CTALLPIHIVGSASVVAYKSRRPDSLIQTALTSEDAIKLLPDKCHIQPNYKKPRHLLSSL  277

Query  544  SQRVTSLENVLKSFLGGRT-NRNTGLG-LKIRIKPSYIFRFQIELERNIRSNDTYWSTLG  371
              R+T LE +L+SFL  R  N N  LG LK RI+   +FRF + LER+IR+NDT W+TL 
Sbjct  278  RIRITLLEELLRSFLSDRGGNANVALGSLKTRIRAVNVFRFHLGLERDIRANDTSWTTLA  337

Query  370  EWRTRPAAERVWFEVVAGIGSGFMKPFTIRKVRPFIEVDslswsslmsniSFTKFPSFLV  191
            EWRT+P  ERVWFEVVA I    +KP T++KV P I+ DS SW+S++SN+SFTK PS LV
Sbjct  338  EWRTKPTIERVWFEVVARIEGEVLKPITVKKVGPLIDTDSFSWNSILSNLSFTKLPSVLV  397

Query  190  PPEPLTLDVKW  158
            PPE LTLDVKW
Sbjct  398  PPEALTLDVKW  408



>gb|KHG04813.1| Sulfite reductase [NADPH] hemoprotein beta-component [Gossypium 
arboreum]
Length=388

 Score =   192 bits (488),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 102/194 (53%), Positives = 136/194 (70%), Gaps = 1/194 (1%)
 Frame = -2

Query  736  SQSSCLSLLPVRVRGSASVTVYRTKNPDASIRTSFLSRGIVKLLPEKCYMGNVYRKQSSV  557
            S S C SLLPV V GS S+  + T+NPDA I T F S+  ++LLPEKCY  + Y KQ   
Sbjct  195  SHSFCRSLLPVHVLGSVSLAAFLTRNPDAHIETHFPSKDTIELLPEKCYGSDGYTKQPCP  254

Query  556  FDSLSQRVTSLENVLKSFLGGRTNRNTGLG-LKIRIKPSYIFRFQIELERNIRSNDTYWS  380
             DS+S R+  L+ +L++F+G R N    LG L ++IK S I  FQ+ELE+ I +N++  S
Sbjct  255  IDSISLRIARLQKILRTFIGDRNNEKQFLGSLNVKIKASPIVHFQLELEKEIGNNESVRS  314

Query  379  TLGEWRTRPAAERVWFEVVAGIGSGFMKPFTIRKVRPFIEVDslswsslmsniSFTKFPS  200
             L EWRT+P  ER+WF+V+  +    + P T++KVRPF+ VD++SWS+L+SNISFTKFPS
Sbjct  315  MLAEWRTKPTVERLWFDVMTRVEGDKLNPLTLKKVRPFVSVDTVSWSNLLSNISFTKFPS  374

Query  199  FLVPPEPLTLDVKW  158
             LVPPE LTLDVKW
Sbjct  375  ILVPPEALTLDVKW  388



>ref|XP_010255103.1| PREDICTED: uncharacterized protein LOC104595864 [Nelumbo nucifera]
Length=397

 Score =   191 bits (486),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 105/203 (52%), Positives = 141/203 (69%), Gaps = 1/203 (0%)
 Frame = -2

Query  763  NAFTNMWSESQSSCLSLLPVRVRGSASVTVYRTKNPDASIRTSFLSRGIVKLLPEKCYMG  584
            N     W    S C+ L+P+ + GSAS+  YRT+N +A I T+F SR  ++LLPEKCY  
Sbjct  195  NNRNQFWPFRPSFCMPLVPIHISGSASMVAYRTRNSNAYIETTFPSRDTIELLPEKCYSR  254

Query  583  NVYRKQSSVFDSLSQRVTSLENVLKSFLGGRTNRNTGLG-LKIRIKPSYIFRFQIELERN  407
            + ++KQ+   +SLS RV  LEN+L +FLG R  +++  G +K +I  S + RFQ+ELER+
Sbjct  255  HFHKKQTFPMESLSSRVALLENLLGNFLGDRIFKSSMSGFVKAKIAASTLVRFQLELERD  314

Query  406  IRSNDTYWSTLGEWRTRPAAERVWFEVVAGIGSGFMKPFTIRKVRPFIEVDslswsslms  227
            +R NDT W TL EWRT+P  ERV F V+A + +  +KP  + KV+P+I VDS SWS++MS
Sbjct  315  VRVNDTLWRTLAEWRTKPTVERVQFRVLARVEAERLKPLMVEKVKPYIGVDSASWSNIMS  374

Query  226  niSFTKFPSFLVPPEPLTLDVKW  158
            NISFT FPS LVPPE LTLDVKW
Sbjct  375  NISFTMFPSVLVPPEALTLDVKW  397



>gb|KJB14548.1| hypothetical protein B456_002G130600 [Gossypium raimondii]
Length=388

 Score =   188 bits (478),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 102/197 (52%), Positives = 136/197 (69%), Gaps = 1/197 (1%)
 Frame = -2

Query  745  WSESQSSCLSLLPVRVRGSASVTVYRTKNPDASIRTSFLSRGIVKLLPEKCYMGNVYRKQ  566
            W  S S C SLLPV V GS S++ YRT+NPDA I   F S+  ++LLPEKCY  + Y KQ
Sbjct  192  WPFSHSFCRSLLPVHVLGSVSLSAYRTRNPDAHIEAHFPSKDTIELLPEKCYGIDGYTKQ  251

Query  565  SSVFDSLSQRVTSLENVLKSFLGGRTNRNTGLG-LKIRIKPSYIFRFQIELERNIRSNDT  389
                +S+S R+  L+ +L++FLG R N+   LG L ++ K S I  FQ+ELE+ I +N++
Sbjct  252  PFPIESISLRIARLQKILRTFLGDRNNQKQFLGSLNVKTKASPIVHFQLELEKEIGNNES  311

Query  388  YWSTLGEWRTRPAAERVWFEVVAGIGSGFMKPFTIRKVRPFIEVDslswsslmsniSFTK  209
                L EWRT+P  ER+WF+V+  +    +KP  I+KVRPF+  D++SWS+L+SNISFTK
Sbjct  312  VRGMLAEWRTKPTVERLWFDVMTRVEGDKLKPLLIKKVRPFVSGDTVSWSNLLSNISFTK  371

Query  208  FPSFLVPPEPLTLDVKW  158
            FPS LVPPE LTLDVKW
Sbjct  372  FPSILVPPEALTLDVKW  388



>gb|KCW68783.1| hypothetical protein EUGRSUZ_F02384 [Eucalyptus grandis]
Length=400

 Score =   185 bits (469),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 106/217 (49%), Positives = 138/217 (64%), Gaps = 11/217 (5%)
 Frame = -2

Query  775  LFYGNAF----------TNMWSESQSSCLSLLPVRVRGSASVTVYRTKNPDASIRTSFLS  626
            L YG  F          +  W   QS C  LLP+ V GSAS+  YRT+NP   I T+FLS
Sbjct  183  LLYGPQFNSSGNVTKVKSGFWPYWQSLCTPLLPICVTGSASLIAYRTRNPSTYIETNFLS  242

Query  625  RGIVKLLPEKCYMGNVYRKQSSVFDSLSQRVTSLENVLKSFLGGRTNRNTGLG-LKIRIK  449
             G ++LLPEKCY   +Y++ S   DSLS R+ +LE VL   +G R  +   LG +K +IK
Sbjct  243  TGTIELLPEKCYGNFLYKRPSCPIDSLSSRIATLERVLGGLMGDRMRQYGFLGFVKAKIK  302

Query  448  PSYIFRFQIELERNIRSNDTYWSTLGEWRTRPAAERVWFEVVAGIGSGFMKPFTIRKVRP  269
               + R QI+LERN+  N+T+     +WRTRP  ERVWF+VVA + +  + P  + KVRP
Sbjct  303  AVMVIRLQIQLERNVTGNETHLVKWEQWRTRPTVERVWFQVVARVDAERLTPLIVNKVRP  362

Query  268  FIEVDslswsslmsniSFTKFPSFLVPPEPLTLDVKW  158
            F   D+++WSSL+SNISFTKFPS LVPP+ LTLDVKW
Sbjct  363  FSGADTVAWSSLLSNISFTKFPSILVPPDALTLDVKW  399



>ref|XP_011074597.1| PREDICTED: uncharacterized protein LOC105159284 [Sesamum indicum]
Length=927

 Score =   190 bits (483),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 112/207 (54%), Positives = 137/207 (66%), Gaps = 6/207 (3%)
 Frame = -2

Query  760  AFTNM-WSESQSS----CLSLLPVRVRGSASVTVYRTKNPDASIRTSFLSRGIVKLLPEK  596
            AFT M W+E  S     C +LLPVR+ GSASV  YR + P   I T F SR  +KLLP+K
Sbjct  721  AFTKMKWNEVGSIWPALCTALLPVRILGSASVVAYRDRRPATVILTVFSSRDAIKLLPDK  780

Query  595  CYMGNVYRKQSSVFDSLSQRVTSLENVLKSFLGGRTNRNTGLG-LKIRIKPSYIFRFQIE  419
            CY+   Y K   +   L+ R+  L+ +L+ FL    N N  LG LK R++ S IFRFQ+E
Sbjct  781  CYVRPHYEKPRHLHSPLNTRIGLLDRILRGFLNESGNANAALGSLKARVRGSTIFRFQLE  840

Query  418  LERNIRSNDTYWSTLGEWRTRPAAERVWFEVVAGIGSGFMKPFTIRKVRPFIEVDslsws  239
            +ER+IRSNDTYWS L EWRTRP  ERVWFEVVA I    +KP  I+KVR     DS +WS
Sbjct  841  MERHIRSNDTYWSALAEWRTRPNIERVWFEVVARIEGQVLKPLVIKKVRTLNGTDSFAWS  900

Query  238  slmsniSFTKFPSFLVPPEPLTLDVKW  158
            SL+SN+SFTKFP  L+PP+ LTL VKW
Sbjct  901  SLVSNLSFTKFPPALLPPKALTLGVKW  927



>ref|XP_012071722.1| PREDICTED: uncharacterized protein LOC105633697 [Jatropha curcas]
 gb|KDP38409.1| hypothetical protein JCGZ_04334 [Jatropha curcas]
Length=396

 Score =   182 bits (462),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 100/191 (52%), Positives = 136/191 (71%), Gaps = 3/191 (2%)
 Frame = -2

Query  724  CLSLLPVRVRGSASVTVYRTKNPDASIRTSFLSRGIVKLLPEKCYMGNVYRKQSSVFDSL  545
            C+ L P+ V GSAS+  YRT+N +A + T+ LS+G ++LLP KCY  N Y+  + +  SL
Sbjct  207  CMPLHPIYVNGSASLIAYRTRNSEAPVETTLLSKGTIELLPAKCYTNNAYKNHAQLNPSL  266

Query  544  SQRVTSLENVLKSFLGG--RTNRNTGLGLKIRIKPSYIFRFQIELERNIRSNDTYWSTLG  371
            S ++  L  +L+SFL    R + N+G  L+  +K S IFRFQ++LE+NI SN T    L 
Sbjct  267  SLKINRLGKLLRSFLSDTLRKSWNSGF-LRTTVKASTIFRFQLDLEKNIGSNTTLDGLLE  325

Query  370  EWRTRPAAERVWFEVVAGIGSGFMKPFTIRKVRPFIEVDslswsslmsniSFTKFPSFLV  191
            +WRT+P  ERVWFE++A + +G ++  T +KVRPF++VDS SWS+LMSNISFTKFPS LV
Sbjct  326  DWRTKPTVERVWFEIMARVEAGKLRLITAKKVRPFVQVDSASWSNLMSNISFTKFPSILV  385

Query  190  PPEPLTLDVKW  158
            PPE LTLDVKW
Sbjct  386  PPEALTLDVKW  396



>ref|XP_007160813.1| hypothetical protein PHAVU_001G018600g [Phaseolus vulgaris]
 gb|ESW32807.1| hypothetical protein PHAVU_001G018600g [Phaseolus vulgaris]
Length=384

 Score =   181 bits (460),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 93/200 (47%), Positives = 142/200 (71%), Gaps = 1/200 (1%)
 Frame = -2

Query  754  TNMWSESQSSCLSLLPVRVRGSASVTVYRTKNPDASIRTSFLSRGIVKLLPEKCYMGNVY  575
            +++W    S+C++++P+R+ GSAS+  YR +NP A I T+ +S   +++LPEKCY G ++
Sbjct  185  SDIWPFLHSTCMAVIPIRISGSASLVAYRARNPYAHIATTLISEDAIEMLPEKCYHGRMF  244

Query  574  RKQSSVFDSLSQRVTSLENVLKSFLGGRTNRNTGLG-LKIRIKPSYIFRFQIELERNIRS  398
            +KQ+   DS+S +++ LE VL+S LG +  +    G LK  IK S + +F+IELER+IR+
Sbjct  245  KKQACPLDSVSLKLSMLEKVLRSLLGRKILQGQSFGLLKANIKASAVVKFRIELERDIRN  304

Query  397  NDTYWSTLGEWRTRPAAERVWFEVVAGIGSGFMKPFTIRKVRPFIEVDslswsslmsniS  218
            N T   T+ +WRTRP+ ER WFE++A +    +KP +I+KV+PFIE  S+SW++LMSN+S
Sbjct  305  NVTLNRTIPDWRTRPSFERFWFEILARVEENRLKPLSIKKVKPFIESVSVSWANLMSNMS  364

Query  217  FTKFPSFLVPPEPLTLDVKW  158
            +T      +PPEPLTLDVKW
Sbjct  365  YTMLRPVFLPPEPLTLDVKW  384



>ref|XP_011030728.1| PREDICTED: uncharacterized protein LOC105130079 isoform X2 [Populus 
euphratica]
Length=386

 Score =   181 bits (460),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 107/205 (52%), Positives = 135/205 (66%), Gaps = 6/205 (3%)
 Frame = -2

Query  766  GNAFTNMWSESQSSCLSLLPVRVRGSASVTVYRTKNPDASIRTSFLSRGIVKLLPEKCYM  587
            GN F   +    S C  LLP+R+ GSAS+   +  +PDA I T  LS+  ++L+  KCY 
Sbjct  186  GNGF---YPFGDSICPPLLPIRIIGSASLVANKNWDPDAEIETRMLSKKTIELVSNKCYA  242

Query  586  GNVYRKQSSVFDSLSQRVTSLENVLKSFLGGRTNRNTGLG--LKIRIKPSYIFRFQIELE  413
             NVY+ ++S    LS  +  LE VL+SFLG R  RN GL   L++  K S + RFQ+ELE
Sbjct  243  RNVYKNRASTMHFLSSSIARLEEVLRSFLGDRITRN-GLSSFLRVTAKASTLIRFQLELE  301

Query  412  RNIRSNDTYWSTLGEWRTRPAAERVWFEVVAGIGSGFMKPFTIRKVRPFIEVDslswssl  233
            ++  SN+T    L EWRTRP  ERVWFEV+A +    +KP  ++KVRPFI VDS SWS+L
Sbjct  302  KSFGSNETVQEVLAEWRTRPTVERVWFEVLARVEGEKLKPVIVKKVRPFIAVDSASWSNL  361

Query  232  msniSFTKFPSFLVPPEPLTLDVKW  158
            MSNISFT FPS LVPPE LTLDVKW
Sbjct  362  MSNISFTNFPSVLVPPEALTLDVKW  386



>ref|XP_011030720.1| PREDICTED: uncharacterized protein LOC105130079 isoform X1 [Populus 
euphratica]
Length=398

 Score =   181 bits (459),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 107/205 (52%), Positives = 135/205 (66%), Gaps = 6/205 (3%)
 Frame = -2

Query  766  GNAFTNMWSESQSSCLSLLPVRVRGSASVTVYRTKNPDASIRTSFLSRGIVKLLPEKCYM  587
            GN F   +    S C  LLP+R+ GSAS+   +  +PDA I T  LS+  ++L+  KCY 
Sbjct  198  GNGF---YPFGDSICPPLLPIRIIGSASLVANKNWDPDAEIETRMLSKKTIELVSNKCYA  254

Query  586  GNVYRKQSSVFDSLSQRVTSLENVLKSFLGGRTNRNTGLG--LKIRIKPSYIFRFQIELE  413
             NVY+ ++S    LS  +  LE VL+SFLG R  RN GL   L++  K S + RFQ+ELE
Sbjct  255  RNVYKNRASTMHFLSSSIARLEEVLRSFLGDRITRN-GLSSFLRVTAKASTLIRFQLELE  313

Query  412  RNIRSNDTYWSTLGEWRTRPAAERVWFEVVAGIGSGFMKPFTIRKVRPFIEVDslswssl  233
            ++  SN+T    L EWRTRP  ERVWFEV+A +    +KP  ++KVRPFI VDS SWS+L
Sbjct  314  KSFGSNETVQEVLAEWRTRPTVERVWFEVLARVEGEKLKPVIVKKVRPFIAVDSASWSNL  373

Query  232  msniSFTKFPSFLVPPEPLTLDVKW  158
            MSNISFT FPS LVPPE LTLDVKW
Sbjct  374  MSNISFTNFPSVLVPPEALTLDVKW  398



>ref|XP_010064740.1| PREDICTED: uncharacterized protein LOC104451871 [Eucalyptus grandis]
Length=795

 Score =   184 bits (468),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 106/217 (49%), Positives = 138/217 (64%), Gaps = 11/217 (5%)
 Frame = -2

Query  775  LFYGNAF----------TNMWSESQSSCLSLLPVRVRGSASVTVYRTKNPDASIRTSFLS  626
            L YG  F          +  W   QS C  LLP+ V GSAS+  YRT+NP   I T+FLS
Sbjct  579  LLYGPQFNSSGNVTKVKSGFWPYWQSLCTPLLPICVTGSASLIAYRTRNPSTYIETNFLS  638

Query  625  RGIVKLLPEKCYMGNVYRKQSSVFDSLSQRVTSLENVLKSFLGGRTNRNTGLG-LKIRIK  449
             G ++LLPEKCY   +Y++ S   DSLS R+ +LE VL   +G R  +   LG +K +IK
Sbjct  639  TGTIELLPEKCYGNFLYKRPSCPIDSLSSRIATLERVLGGLMGDRMRQYGFLGFVKAKIK  698

Query  448  PSYIFRFQIELERNIRSNDTYWSTLGEWRTRPAAERVWFEVVAGIGSGFMKPFTIRKVRP  269
               + R QI+LERN+  N+T+     +WRTRP  ERVWF+VVA + +  + P  + KVRP
Sbjct  699  AVMVIRLQIQLERNVTGNETHLVKWEQWRTRPTVERVWFQVVARVDAERLTPLIVNKVRP  758

Query  268  FIEVDslswsslmsniSFTKFPSFLVPPEPLTLDVKW  158
            F   D+++WSSL+SNISFTKFPS LVPP+ LTLDVKW
Sbjct  759  FSGADTVAWSSLLSNISFTKFPSILVPPDALTLDVKW  795



>ref|XP_006375011.1| hypothetical protein POPTR_0014s03560g [Populus trichocarpa]
 gb|ERP52808.1| hypothetical protein POPTR_0014s03560g [Populus trichocarpa]
Length=398

 Score =   177 bits (450),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 106/205 (52%), Positives = 134/205 (65%), Gaps = 6/205 (3%)
 Frame = -2

Query  766  GNAFTNMWSESQSSCLSLLPVRVRGSASVTVYRTKNPDASIRTSFLSRGIVKLLPEKCYM  587
            GN F   +    S C  LLP+R+ GSAS+   +  +PDA I T  LS+  ++L+ +KCY 
Sbjct  198  GNGF---YPFGDSICPPLLPIRIIGSASLVANKNWDPDAEIETRLLSKKTIELVSDKCYD  254

Query  586  GNVYRKQSSVFDSLSQRVTSLENVLKSFLGGRTNRNTGLG--LKIRIKPSYIFRFQIELE  413
             NVY+ ++S    LS  +  LE VL+SFLG R  RN GL   L+   K S + RFQ+ELE
Sbjct  255  RNVYKIRASTMHFLSSSIARLEEVLRSFLGDRITRN-GLSSFLRATAKASTLIRFQLELE  313

Query  412  RNIRSNDTYWSTLGEWRTRPAAERVWFEVVAGIGSGFMKPFTIRKVRPFIEVDslswssl  233
            ++  SN+T      EWRTRP  ERVWFEV+A +    +KP  ++KVRPFI VDS SWS+L
Sbjct  314  KSFGSNETAQEVFAEWRTRPTVERVWFEVIARVEGEKLKPVIVKKVRPFIAVDSASWSNL  373

Query  232  msniSFTKFPSFLVPPEPLTLDVKW  158
            MSNISFT FPS LVPPE LTLDVKW
Sbjct  374  MSNISFTNFPSVLVPPEALTLDVKW  398



>ref|XP_002510285.1| signal peptidase I, putative [Ricinus communis]
 gb|EEF52472.1| signal peptidase I, putative [Ricinus communis]
Length=831

 Score =   181 bits (460),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 99/189 (52%), Positives = 135/189 (71%), Gaps = 2/189 (1%)
 Frame = -2

Query  724  CLSLLPVRVRGSASVTVYRTKNPDASIRTSFLSRGIVKLLPEKCYMGNVYRKQSSVFDSL  545
            C+ LLP+RV GSAS+  Y+T+NPDA + T+ LS G +KLL EKCY  ++Y+ Q+ +   L
Sbjct  645  CMPLLPIRVIGSASLIAYKTRNPDAPVETTLLSEGTIKLLSEKCYSDDLYKNQAQLSHFL  704

Query  544  SQRVTSLENVLKSFLGGRTNRNTGLGLKIRIKPSYIFRFQIELERNIRSNDTYWSTLGEW  365
            S ++  L  +L++FLG +    +G  L+  +K + I RFQ+ELE+NI S+ T    L +W
Sbjct  705  SLKIDRLGKLLRTFLGNQMEL-SGF-LRSNVKAATIIRFQLELEKNIGSSATLHDALEDW  762

Query  364  RTRPAAERVWFEVVAGIGSGFMKPFTIRKVRPFIEVDslswsslmsniSFTKFPSFLVPP  185
            RTRP  ERV+FEV+A +    ++P  ++KVRPFI VDS SWS+LMSN+SFTKFPS LVPP
Sbjct  763  RTRPTIERVYFEVLARVEDEKLRPVVVKKVRPFIAVDSASWSNLMSNLSFTKFPSILVPP  822

Query  184  EPLTLDVKW  158
            E LTLDVKW
Sbjct  823  EALTLDVKW  831



>gb|AGV54177.1| signal peptidase I [Phaseolus vulgaris]
Length=384

 Score =   175 bits (444),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 89/200 (45%), Positives = 141/200 (71%), Gaps = 1/200 (1%)
 Frame = -2

Query  754  TNMWSESQSSCLSLLPVRVRGSASVTVYRTKNPDASIRTSFLSRGIVKLLPEKCYMGNVY  575
            +++W    S+C++++P+R+ GSAS+  YR +NP A I T+ +S   +++LPEKCY G ++
Sbjct  185  SDIWPFLHSTCMAVIPIRISGSASLVAYRARNPYAHIATTLISEDAIEMLPEKCYHGCMF  244

Query  574  RKQSSVFDSLSQRVTSLENVLKSFLGGRTNRNTGLG-LKIRIKPSYIFRFQIELERNIRS  398
            +KQ+   DS+S +++ LE VL+S  G +  +    G LK  IK S + +F+IELER+I +
Sbjct  245  KKQACPLDSVSWKLSRLEKVLRSLFGRKIVQGQSFGLLKANIKASAVVKFRIELERDISN  304

Query  397  NDTYWSTLGEWRTRPAAERVWFEVVAGIGSGFMKPFTIRKVRPFIEVDslswsslmsniS  218
            + T+  T+ +WRTRP+ ER WFE++A +    +KP +I++V+PFIE  S+SW++LMSN+S
Sbjct  305  SVTFNRTIPDWRTRPSFERFWFEILARVEENSLKPLSIKRVKPFIEFVSVSWANLMSNMS  364

Query  217  FTKFPSFLVPPEPLTLDVKW  158
            +T      +PPEPLTLDVKW
Sbjct  365  YTMLRPVFLPPEPLTLDVKW  384



>ref|XP_008220883.1| PREDICTED: uncharacterized protein LOC103320920 [Prunus mume]
Length=816

 Score =   179 bits (454),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 104/205 (51%), Positives = 136/205 (66%), Gaps = 4/205 (2%)
 Frame = -2

Query  766  GNAFTNMWSESQSSCLSLLPVRVRGSASVTVYRTKNPDASIRTSFLSRGIVKLLPEKCYM  587
            G   +  W    S C  L P+RV G A++  Y+T+NPDA I T F+S+ I++ LPEKCY 
Sbjct  614  GKEKSEFWPIWHSYCTPLFPIRVLGPATLVAYKTRNPDAHIETKFMSKEIIEFLPEKCYR  673

Query  586  GNVYRKQSSVFDSLSQRVTSLENVLKSFLGGRTNRNTGLG--LKIRIKPSYIFRFQIELE  413
             + Y+K++   DSL  R++ LE + KSFLG R  R +GL   ++ +IK S + RF++ELE
Sbjct  674  SHAYKKRACPIDSLRSRISMLERIWKSFLGDRI-RQSGLSGFVEGKIKASTVVRFKVELE  732

Query  412  RNIRSNDTYWSTLGEWRTRPAAERVWFEVVAGIGSGFMKPFTIRKVRPFIEVDslswssl  233
            R  R N       G WRTRPA ERVWFEV+A +  G +KP  ++K+RPFI  DS++WSSL
Sbjct  733  REFRRNGALRGKAG-WRTRPAVERVWFEVLARVEFGRVKPLLVKKIRPFIVADSVAWSSL  791

Query  232  msniSFTKFPSFLVPPEPLTLDVKW  158
            MSNISFTK  S LVP E LTLDVKW
Sbjct  792  MSNISFTKSSSVLVPSEALTLDVKW  816



>ref|XP_010541807.1| PREDICTED: uncharacterized protein LOC104815190 [Tarenaya hassleriana]
Length=390

 Score =   172 bits (437),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 100/197 (51%), Positives = 133/197 (68%), Gaps = 3/197 (2%)
 Frame = -2

Query  745  WSESQSSCLSLLPVRVRGSASVTVYRTKNPDASIRTSFLSRGIVKLLPEKCYMGNVYRKQ  566
            WS   S C+ L P+R+ GSAS+  +RT N D+ I+T +LS   ++LLPEKCY    Y + 
Sbjct  196  WSFDSSMCVLLPPIRIVGSASLVAHRTLNADSQIKTLYLSDDTIRLLPEKCYNSRAYLQP  255

Query  565  SSVFDSLSQRVTSLENVLKSFLGGRTNRNTGLG-LKIRIKPSYIFRFQIELERNIRSNDT  389
             S+ D L  ++  LE +L SFLG R+ +   +G +  ++K S + RFQ+E+ER I S  +
Sbjct  256  RSI-DLLGLKIDRLEKLL-SFLGNRSRQIDLMGSMTAKLKASGMLRFQLEIERGIESTKS  313

Query  388  YWSTLGEWRTRPAAERVWFEVVAGIGSGFMKPFTIRKVRPFIEVDslswsslmsniSFTK  209
              +   EWRT+P  ERVWFEV A + +  +KP T+RKV PFIEVD+ +WSSLMSNISFTK
Sbjct  314  LLNKTAEWRTKPKVERVWFEVTAKVEAEKLKPKTVRKVVPFIEVDTEAWSSLMSNISFTK  373

Query  208  FPSFLVPPEPLTLDVKW  158
            FPS LVP E LTLDVKW
Sbjct  374  FPSLLVPQEALTLDVKW  390



>ref|XP_008378515.1| PREDICTED: uncharacterized protein LOC103441607 [Malus domestica]
Length=391

 Score =   172 bits (436),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 102/206 (50%), Positives = 134/206 (65%), Gaps = 14/206 (7%)
 Frame = -2

Query  754  TNMWSESQSSCLSLLPVRVRGSASVTVYRTKNPDASIRTSFLSRGIVKLLPEKCYMGNVY  575
            +  W    S C  L+P+RV G A++  Y+T+N DA I T+F+S+ IV+LLPEKCY    Y
Sbjct  193  SEFWPIGHSYCAPLVPIRVLGPATLVAYKTRNHDAHIETNFISKEIVELLPEKCYRSQAY  252

Query  574  RKQSSVFDSLSQRVTSLENVLKSFLGGRTNRNTGLG-LKIRIKPSYIFRFQIELERNIRS  398
            +K+     SLS R++ LE + K FLG R  +N   G ++ +IK S I RF++ELER  R 
Sbjct  253  KKRPCPIGSLSLRISMLERIWKGFLGDRIRQNHSSGFVEGKIKASTIVRFKVELERVFRR  312

Query  397  NDTYWSTLGE------WRTRPAAERVWFEVVAGIGSGFMKPFTIRKVRPFIEVDslswss  236
                   +GE      WRTRPA ERVWFEV+A +    +KP  ++K+RPF+  DS++WSS
Sbjct  313  -------IGELHEKERWRTRPAVERVWFEVLARVELERVKPLFVKKIRPFVVADSVAWSS  365

Query  235  lmsniSFTKFPSFLVPPEPLTLDVKW  158
            L SNISFTKF S LVPPE LTLDVKW
Sbjct  366  LTSNISFTKFGSVLVPPEALTLDVKW  391



>gb|AES59509.2| signal peptidase I, putative [Medicago truncatula]
Length=397

 Score =   172 bits (435),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 100/205 (49%), Positives = 138/205 (67%), Gaps = 4/205 (2%)
 Frame = -2

Query  766  GNAFTNMWSESQSSCLSLLPVRVRGSASVTVYRTKNPDASIRTSFLSRGIVKLLPEKCYM  587
             N     W   QS C+ L+P+R+ GSAS+  Y  +NP   I T+ +S   V+LLPEKCY 
Sbjct  195  SNQKNEFWPFLQSMCVPLIPIRIIGSASLIAYVARNPYVQIGTALISEDAVELLPEKCYH  254

Query  586  GNVYRKQSSVFDSLSQRVTSLENVLKSFLGGRT--NRNTGLGLKIRIKPSYIFRFQIELE  413
            G V+RKQ+    SL+ R+  LE +L+S LG +   +R +GL +K  IK     +F +ELE
Sbjct  255  GCVFRKQACPVASLNLRLILLEKILRSLLGHKILQDRLSGL-IKANIKAYAGVKFPLELE  313

Query  412  RNIRSNDTYWSTLGEWRTRPAAERVWFEVVAGIGSGFMKPFTIRKVRPFIEVDslswssl  233
            R++ +N T  STL +WRTRP+ ERVWFEV+A +    +KP +I+KV+PFIE DS+SW++L
Sbjct  314  RDVGNNATL-STLPDWRTRPSVERVWFEVMARVEDSRLKPLSIKKVKPFIESDSVSWANL  372

Query  232  msniSFTKFPSFLVPPEPLTLDVKW  158
            MSN+S+TK    L+PPE LTLDVKW
Sbjct  373  MSNLSYTKLRPVLLPPEALTLDVKW  397



>ref|XP_003589258.1| hypothetical protein MTR_1g021180 [Medicago truncatula]
Length=451

 Score =   172 bits (435),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 100/205 (49%), Positives = 138/205 (67%), Gaps = 4/205 (2%)
 Frame = -2

Query  766  GNAFTNMWSESQSSCLSLLPVRVRGSASVTVYRTKNPDASIRTSFLSRGIVKLLPEKCYM  587
             N     W   QS C+ L+P+R+ GSAS+  Y  +NP   I T+ +S   V+LLPEKCY 
Sbjct  231  SNQKNEFWPFLQSMCVPLIPIRIIGSASLIAYVARNPYVQIGTALISEDAVELLPEKCYH  290

Query  586  GNVYRKQSSVFDSLSQRVTSLENVLKSFLGGRT--NRNTGLGLKIRIKPSYIFRFQIELE  413
            G V+RKQ+    SL+ R+  LE +L+S LG +   +R +GL +K  IK     +F +ELE
Sbjct  291  GCVFRKQACPVASLNLRLILLEKILRSLLGHKILQDRLSGL-IKANIKAYAGVKFPLELE  349

Query  412  RNIRSNDTYWSTLGEWRTRPAAERVWFEVVAGIGSGFMKPFTIRKVRPFIEVDslswssl  233
            R++ +N T  STL +WRTRP+ ERVWFEV+A +    +KP +I+KV+PFIE DS+SW++L
Sbjct  350  RDVGNNATL-STLPDWRTRPSVERVWFEVMARVEDSRLKPLSIKKVKPFIESDSVSWANL  408

Query  232  msniSFTKFPSFLVPPEPLTLDVKW  158
            MSN+S+TK    L+PPE LTLDVKW
Sbjct  409  MSNLSYTKLRPVLLPPEALTLDVKW  433



>gb|KHN12749.1| hypothetical protein glysoja_008712 [Glycine soja]
Length=393

 Score =   169 bits (428),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 96/200 (48%), Positives = 139/200 (70%), Gaps = 1/200 (1%)
 Frame = -2

Query  754  TNMWSESQSSCLSLLPVRVRGSASVTVYRTKNPDASIRTSFLSRGIVKLLPEKCYMGNVY  575
            +++W   QS+C++L+P+R+ GSAS+  YR +N  A I T+ +S   ++LLPEKCY G+V+
Sbjct  194  SDLWPFMQSTCMALIPIRISGSASLVAYRARNAYAQIATTLISEDAIELLPEKCYHGHVF  253

Query  574  RKQSSVFDSLSQRVTSLENVLKSFLGGRTNRNTGLG-LKIRIKPSYIFRFQIELERNIRS  398
            RK++   DSLS R++ LE VL+SFL  +  ++   G LK  IK S + +F +ELER+I +
Sbjct  254  RKRACPIDSLSLRLSLLEKVLRSFLDHKILKDQLFGLLKANIKASAVVKFPLELERDISN  313

Query  397  NDTYWSTLGEWRTRPAAERVWFEVVAGIGSGFMKPFTIRKVRPFIEVDslswsslmsniS  218
            N T   T+ +WRTRP  ER WFE++A +    +KP  I++VRPFIE  S+SW++LMSN+S
Sbjct  314  NATLNRTIPDWRTRPGFERFWFEILARVEENKLKPLLIKEVRPFIESVSVSWANLMSNMS  373

Query  217  FTKFPSFLVPPEPLTLDVKW  158
            +TK       PEPLTLDVKW
Sbjct  374  YTKLRPVFFLPEPLTLDVKW  393



>ref|XP_009364068.1| PREDICTED: uncharacterized protein LOC103953991 [Pyrus x bretschneideri]
Length=391

 Score =   167 bits (422),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 97/200 (49%), Positives = 129/200 (65%), Gaps = 2/200 (1%)
 Frame = -2

Query  754  TNMWSESQSSCLSLLPVRVRGSASVTVYRTKNPDASIRTSFLSRGIVKLLPEKCYMGNVY  575
            +  WS   S C  L+P+RV G A +  Y+T+N +A I T+F+S+ IV+LLPEKCY    Y
Sbjct  193  SEFWSIGHSYCAPLVPIRVLGPAKLVAYKTRNHNAHIETNFISKEIVELLPEKCYRSQAY  252

Query  574  RKQSSVFDSLSQRVTSLENVLKSFLGGRTNRNTGLG-LKIRIKPSYIFRFQIELERNIRS  398
            +K+     SLS R++ LE + K FLG R  +N   G ++ +IK S I RF++ELER+ R 
Sbjct  253  KKRPCPIGSLSLRISMLERIWKGFLGDRMRQNRSSGFVEGKIKASTIVRFKVELERDFRR  312

Query  397  NDTYWSTLGEWRTRPAAERVWFEVVAGIGSGFMKPFTIRKVRPFIEVDslswsslmsniS  218
                      WRTRP  ERVWFEV+A +    +KP  ++K+RP +  DS++WSSL SNIS
Sbjct  313  IGALHDK-ERWRTRPTVERVWFEVLARVELERVKPLFVKKIRPLVVADSVAWSSLTSNIS  371

Query  217  FTKFPSFLVPPEPLTLDVKW  158
            FTK   FLVPPE LTLDVKW
Sbjct  372  FTKSGPFLVPPEALTLDVKW  391



>ref|XP_003549415.1| PREDICTED: uncharacterized protein LOC100804093 [Glycine max]
Length=393

 Score =   167 bits (422),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 95/200 (48%), Positives = 139/200 (70%), Gaps = 1/200 (1%)
 Frame = -2

Query  754  TNMWSESQSSCLSLLPVRVRGSASVTVYRTKNPDASIRTSFLSRGIVKLLPEKCYMGNVY  575
            +++W   +S+C++L+P+R+ GSAS+  YR +N  A I T+ +S   ++LLPEKCY G+V+
Sbjct  194  SDLWPFMRSTCMALIPIRISGSASLVAYRARNAYAQIATTLISEDAIELLPEKCYHGHVF  253

Query  574  RKQSSVFDSLSQRVTSLENVLKSFLGGRTNRNTGLG-LKIRIKPSYIFRFQIELERNIRS  398
            RK++   DSLS R++ LE VL+SFL  +  ++   G LK  IK S + +F +ELER+I +
Sbjct  254  RKRACPIDSLSLRLSLLEKVLRSFLDHKILKDQLFGLLKANIKASAVVKFPLELERDISN  313

Query  397  NDTYWSTLGEWRTRPAAERVWFEVVAGIGSGFMKPFTIRKVRPFIEVDslswsslmsniS  218
            N T   T+ +WRTRP  ER WFE++A +    +KP  I++VRPFIE  S+SW++LMSN+S
Sbjct  314  NATLNRTIPDWRTRPGFERFWFEILARVEENKLKPLLIKEVRPFIESVSVSWANLMSNMS  373

Query  217  FTKFPSFLVPPEPLTLDVKW  158
            +TK       PEPLTLDVKW
Sbjct  374  YTKLRPVFFLPEPLTLDVKW  393



>ref|XP_004499101.1| PREDICTED: uncharacterized protein LOC101493524 [Cicer arietinum]
Length=390

 Score =   166 bits (419),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 96/201 (48%), Positives = 137/201 (68%), Gaps = 4/201 (2%)
 Frame = -2

Query  754  TNMWSESQSSCLSLLPVRVRGSASVTVYRTKNPDASIRTSFLSRGIVKLLPEKCYMGNVY  575
            +  W   QS+C+ L+P+ + GSAS+  Y  +NP   I T+ +S   V+LLPEKCY G V+
Sbjct  192  SEFWPFLQSTCVPLIPLNIIGSASLIAYGARNPYTHIGTTLISEDTVELLPEKCYHGRVF  251

Query  574  RKQSSVFDSLSQRVTSLENVLKSFLGGR--TNRNTGLGLKIRIKPSYIFRFQIELERNIR  401
            RK++    SLS R++ LE +L+S LG +   +R +GL +K  IK     +F +ELER++ 
Sbjct  252  RKRACPVASLSLRLSMLEKILRSLLGHKILQDRFSGL-IKANIKAYAAVKFPLELERDVG  310

Query  400  SNDTYWSTLGEWRTRPAAERVWFEVVAGIGSGFMKPFTIRKVRPFIEVDslswsslmsni  221
            +N T  S L +WRTRP+ ERVWFE++A +    +KP  I+KV+PFIE DS+SW++LMSN+
Sbjct  311  NNVTR-SALPDWRTRPSVERVWFEILARVEENRLKPVLIKKVKPFIESDSVSWANLMSNM  369

Query  220  SFTKFPSFLVPPEPLTLDVKW  158
            S+TK    L+PPE LTLDVKW
Sbjct  370  SYTKLRPVLLPPEALTLDVKW  390



>ref|XP_006393531.1| hypothetical protein EUTSA_v10011550mg [Eutrema salsugineum]
 gb|ESQ30817.1| hypothetical protein EUTSA_v10011550mg [Eutrema salsugineum]
Length=398

 Score =   162 bits (411),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 97/204 (48%), Positives = 132/204 (65%), Gaps = 3/204 (1%)
 Frame = -2

Query  763  NAFTNMWSE-SQSSCLSLLPVRVRGSASVTVYRTKNPDASIRTSFLSRGIVKLLPEKCYM  587
            N  + +WS    S C+ L P+++ GSAS+  +RT   D+ I+TS+L+   ++LLPEKCY 
Sbjct  196  NERSCLWSSLGGSVCVPLPPIQIDGSASLVAFRTPYKDSRIKTSYLTNEAIQLLPEKCYH  255

Query  586  -GNVYRKQSSVFDSLSQRVTSLENVLKSFLGGRTNRNTGLGLKIRIKPSYIFRFQIELER  410
              + Y++     D L  ++  LE VL S LG + N  T   +  ++K S + RFQ+E+ER
Sbjct  256  KAHTYKQNHLSTDLLGLKIKKLERVLSS-LGNKGNAETVSSMTAKLKASGMVRFQLEIER  314

Query  409  NIRSNDTYWSTLGEWRTRPAAERVWFEVVAGIGSGFMKPFTIRKVRPFIEVDslswsslm  230
             I SN++  S   EWRT+P  ERVWFEV A +    +K   +RKV PFIEVD+ +WSSLM
Sbjct  315  RIGSNESVTSKRLEWRTKPKIERVWFEVAAKVEGDKLKAVGMRKVVPFIEVDTEAWSSLM  374

Query  229  sniSFTKFPSFLVPPEPLTLDVKW  158
            SN+SFTKFPS LVP E LTLDVKW
Sbjct  375  SNMSFTKFPSILVPQEALTLDVKW  398



>ref|XP_010941858.1| PREDICTED: uncharacterized protein LOC105060006 [Elaeis guineensis]
Length=403

 Score =   162 bits (410),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 99/201 (49%), Positives = 130/201 (65%), Gaps = 3/201 (1%)
 Frame = -2

Query  751  NMWSESQSSCLSLLPVRVRGSASVTVYRTKNPDASIRTSFLSRGIVKLLPEKCYMGNVYR  572
              W+   SSC  +L V V GSASV   R +N  ASI TSF S   ++LL EKCY GN  +
Sbjct  203  QFWAFGYSSCAPILSVHVGGSASVIAVRNRNSLASIETSFKSPDTIELLSEKCYNGNFKQ  262

Query  571  KQSSVFDSLSQRVTSLENVLKSFLGGRTNRNTGLG-LKIRIKPSYIFRFQIELERNIRSN  395
              S +F S+S+R+  LE  L S LG R  ++  +  LK +I  S   +F++ELER+I +N
Sbjct  263  IPSCLFCSISKRLVLLEKALGSVLGNRMFQSESVRFLKAKIMSSTFIKFRLELERDITTN  322

Query  394  DTYWSTLGEWRTRPAAERVWFEVVAGI-GSGFMKPFTIRKV-RPFIEVDslswsslmsni  221
            D  W    EW+T+   ER WFE+VA + G G ++P  I+K+ RPFI  DS +WS+LMSNI
Sbjct  323  DRVWKKTAEWKTKRTVERHWFEIVARVEGEGVLRPMIIKKLKRPFIVADSTAWSNLMSNI  382

Query  220  SFTKFPSFLVPPEPLTLDVKW  158
            SFT+FPS +VPPE LTLDVKW
Sbjct  383  SFTQFPSIVVPPEALTLDVKW  403



>ref|XP_006307471.1| hypothetical protein CARUB_v10009097mg [Capsella rubella]
 gb|EOA40369.1| hypothetical protein CARUB_v10009097mg [Capsella rubella]
Length=454

 Score =   160 bits (405),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 93/192 (48%), Positives = 124/192 (65%), Gaps = 3/192 (2%)
 Frame = -2

Query  730  SSCLSLLPVRVRGSASVTVYRTKNPDASIRTSFLSRGIVKLLPEKCYM-GNVYRKQSSVF  554
            S C  L P+++ GSAS+  +RT+N D+ I+TS+LS   + L  EKCY   + YR+     
Sbjct  265  SVCAPLPPIQIIGSASLVAFRTRNADSQIKTSYLSNEAIHLHAEKCYYKAHTYRQHGFPT  324

Query  553  DSLSQRVTSLENVLKSFLGGRTNRNTGLGLKIRIKPSYIFRFQIELERNIRSNDTYWSTL  374
            D L  ++  LE VL S   G   R T   +  ++KPS + RFQ+E+ER+I  N++  S  
Sbjct  325  DLLGLKINKLEKVLSSL--GNGTRQTVTSVTAKLKPSGMVRFQLEIERSIGKNESVTSKK  382

Query  373  GEWRTRPAAERVWFEVVAGIGSGFMKPFTIRKVRPFIEVDslswsslmsniSFTKFPSFL  194
             EWRT+P  ERVWFEV A +    +K   +RKV PFIEVD+ +WSS+MSN+SFTKFPS L
Sbjct  383  IEWRTKPKIERVWFEVTAKVERDKLKAAGMRKVVPFIEVDTEAWSSMMSNMSFTKFPSLL  442

Query  193  VPPEPLTLDVKW  158
            VP E LTLDVKW
Sbjct  443  VPQEALTLDVKW  454



>ref|XP_009365670.1| PREDICTED: uncharacterized protein LOC103955500 [Pyrus x bretschneideri]
Length=770

 Score =   163 bits (412),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 98/200 (49%), Positives = 129/200 (65%), Gaps = 2/200 (1%)
 Frame = -2

Query  754  TNMWSESQSSCLSLLPVRVRGSASVTVYRTKNPDASIRTSFLSRGIVKLLPEKCYMGNVY  575
            +  W    S C  L+P+RV G A+   Y+T+N  A I T+F+S+ IV+LLPEKCY  + Y
Sbjct  572  SEFWPIGHSYCAPLVPIRVLGPATSVAYKTRNHGAHIETNFISKEIVELLPEKCYRSHAY  631

Query  574  RKQSSVFDSLSQRVTSLENVLKSFLGGRTNRNTGLG-LKIRIKPSYIFRFQIELERNIRS  398
            +K+    DSLS R++ LE + K FLG R  +N   G ++ +IK S I RF++ELE + R 
Sbjct  632  KKRPCPIDSLSLRISMLERIWKGFLGDRIRQNKLSGFVEGKIKASTIVRFRVELELDFRR  691

Query  397  NDTYWSTLGEWRTRPAAERVWFEVVAGIGSGFMKPFTIRKVRPFIEVDslswsslmsniS  218
                    G WRT PA +RVWFEV+A +    +KP  +RK+RPFI  DS++WSSL SNIS
Sbjct  692  VGALHDKEG-WRTMPAVQRVWFEVLARVELRRVKPLFVRKIRPFIVADSVAWSSLTSNIS  750

Query  217  FTKFPSFLVPPEPLTLDVKW  158
            FTK  S L PPE LTLDVKW
Sbjct  751  FTKSGSVLGPPEALTLDVKW  770



>ref|XP_002891379.1| hypothetical protein ARALYDRAFT_473912 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67638.1| hypothetical protein ARALYDRAFT_473912 [Arabidopsis lyrata subsp. 
lyrata]
Length=391

 Score =   159 bits (401),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 92/192 (48%), Positives = 125/192 (65%), Gaps = 3/192 (2%)
 Frame = -2

Query  730  SSCLSLLPVRVRGSASVTVYRTKNPDASIRTSFLSRGIVKLLPEKCY-MGNVYRKQSSVF  554
            S C+ L P+++ GSAS+  +RT N D+ I+TS+LS   +++ P+KCY   + YR+     
Sbjct  202  SVCVPLPPIQILGSASLVAFRTSNTDSQIKTSYLSDEAIQIHPDKCYDKAHTYRQHRFPT  261

Query  553  DSLSQRVTSLENVLKSFLGGRTNRNTGLGLKIRIKPSYIFRFQIELERNIRSNDTYWSTL  374
            D L  ++  LE VL S   G   R T   +  ++K S + RFQ+E+ER+I  N++  S  
Sbjct  262  DLLGLKINKLEKVLSSL--GNGTRQTVSSVTAKLKASGMVRFQLEIERSIGKNESVISKR  319

Query  373  GEWRTRPAAERVWFEVVAGIGSGFMKPFTIRKVRPFIEVDslswsslmsniSFTKFPSFL  194
             EWRT+P  ERVWFE+ A I    +K   +RKV PFIEVD+ +WSSLMSN+SFTKFPS L
Sbjct  320  VEWRTKPKIERVWFEITAKIEGDKLKAVGMRKVVPFIEVDTEAWSSLMSNMSFTKFPSLL  379

Query  193  VPPEPLTLDVKW  158
            VP E LTLDVKW
Sbjct  380  VPQEALTLDVKW  391



>gb|KHN21021.1| hypothetical protein glysoja_009329 [Glycine soja]
Length=306

 Score =   156 bits (394),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 73/166 (44%), Positives = 112/166 (67%), Gaps = 1/166 (1%)
 Frame = -2

Query  754  TNMWSESQSSCLSLLPVRVRGSASVTVYRTKNPDASIRTSFLSRGIVKLLPEKCYMGNVY  575
            +++W    S+C++L+P+R+ GSAS+  YR +N  A I T+ +S   ++LLPEKCY G ++
Sbjct  136  SDLWPFLHSTCMTLIPIRISGSASLVAYRARNSYAHIATTLISEDAIELLPEKCYHGRMF  195

Query  574  RKQSSVFDSLSQRVTSLENVLKSFLGGRTNRNTGLG-LKIRIKPSYIFRFQIELERNIRS  398
            RK++   DSLS R++ LE VL+S L  +  ++   G LK  IK S + +F +ELER++ +
Sbjct  196  RKRACPIDSLSLRLSILEKVLRSLLERKILKDQLFGLLKANIKASAVVKFPLELERDLSN  255

Query  397  NDTYWSTLGEWRTRPAAERVWFEVVAGIGSGFMKPFTIRKVRPFIE  260
            N T   T+ +WRTRP+ ER WFE++A +    +KP  I+KVRPFIE
Sbjct  256  NATLNRTIPDWRTRPSFERFWFEILARVEGNTLKPLLIKKVRPFIE  301



>ref|XP_010089929.1| putative thylakoidal processing peptidase 2 [Morus notabilis]
 gb|EXB38625.1| putative thylakoidal processing peptidase 2 [Morus notabilis]
Length=787

 Score =   160 bits (406),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 92/203 (45%), Positives = 126/203 (62%), Gaps = 3/203 (1%)
 Frame = -2

Query  766  GNAFTNMWSESQSSCLSLLPVRVRGSASVTVYRTKNPDASIRTSFLSRGIVKLLPEKCYM  587
            GN  T  W    S C  L+ ++V GSA++  YRTKNPD  I+T  +S+  ++LL EKCY 
Sbjct  588  GNGKTEFWPIRHSFCGVLVQIQVFGSAALAAYRTKNPDNCIKTKRISKETIELLAEKCYG  647

Query  586  GNVYRKQSSVFDSLSQRVTSLENVLKSFLGGRTNRNTGLGLKIRIKPSYIFRFQIELERN  407
             N+++K++   DSL  R+  LE VL+S+ G R N   GL  + +I    + RFQ+ELE +
Sbjct  648  NNIHKKRNCPVDSLGLRIAMLEKVLRSYFGERLNGTVGL-FRGKISALALIRFQLELEMD  706

Query  406  IRSNDTYWSTLGEWRTRPAAERVWFEVVAGIGSGFMKPFTIRKVRPFIEVDslswsslms  227
             RSNDT  +    WRTRP+ ERVWF+V+A + +  +K    ++  P    D  +  S +S
Sbjct  707  SRSNDTQQAK-ASWRTRPSVERVWFDVLARVEAERLKLLVAKETNPSFVTD-TAGWSNLS  764

Query  226  niSFTKFPSFLVPPEPLTLDVKW  158
            NISFTKFPS LVP E LTLDVKW
Sbjct  765  NISFTKFPSLLVPSEALTLDVKW  787



>ref|XP_011654083.1| PREDICTED: uncharacterized protein LOC105435298 isoform X1 [Cucumis 
sativus]
Length=399

 Score =   156 bits (395),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 89/220 (40%), Positives = 134/220 (61%), Gaps = 14/220 (6%)
 Frame = -2

Query  775  LFYGNAFTNMWSESQSS-------------CLSLLPVRVRGSASVTVYRTKNPDASIRTS  635
            +FY +  + + +E++ S             C  LLP+RV GSA+++ YRT+NPD  IRT 
Sbjct  180  VFYSSDLSKLLNETRRSNGKIRTYPFRLPFCSPLLPLRVLGSATLSAYRTQNPDDYIRTR  239

Query  634  FLSRGIVKLLPEKCYMGNVYRKQSSVFDSLSQRVTSLENVLKSFLGGRTNRNTGLG-LKI  458
            FLS+  ++LLP KCY  N + + S +  SL  +   L+ V + +L     +N  L  +K+
Sbjct  240  FLSKDSIELLPNKCYGRNTHIENSPLLGSLKPQFHMLDTVFQRYLRNWILQNGLLAFVKV  299

Query  457  RIKPSYIFRFQIELERNIRSNDTYWSTLGEWRTRPAAERVWFEVVAGIGSGFMKPFTIRK  278
            +++   + RFQ+ELE    +N + ++ L EWRT+P  ER  FEV+A + +  +KP  ++K
Sbjct  300  KMRACVVVRFQLELENTFGTNSSLYARLAEWRTKPTVERASFEVLARLDTVRLKPLAVKK  359

Query  277  VRPFIEVDslswsslmsniSFTKFPSFLVPPEPLTLDVKW  158
            ++P I  DS  W +L+ NISFTKFPS LV PE LTLDVKW
Sbjct  360  LKPLIVADSTEWRNLLPNISFTKFPSLLVSPEALTLDVKW  399



>ref|XP_011654084.1| PREDICTED: uncharacterized protein LOC105435298 isoform X2 [Cucumis 
sativus]
 gb|KGN55155.1| hypothetical protein Csa_4G638440 [Cucumis sativus]
Length=398

 Score =   156 bits (395),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 89/220 (40%), Positives = 134/220 (61%), Gaps = 14/220 (6%)
 Frame = -2

Query  775  LFYGNAFTNMWSESQSS-------------CLSLLPVRVRGSASVTVYRTKNPDASIRTS  635
            +FY +  + + +E++ S             C  LLP+RV GSA+++ YRT+NPD  IRT 
Sbjct  179  VFYSSDLSKLLNETRRSNGKIRTYPFRLPFCSPLLPLRVLGSATLSAYRTQNPDDYIRTR  238

Query  634  FLSRGIVKLLPEKCYMGNVYRKQSSVFDSLSQRVTSLENVLKSFLGGRTNRNTGLG-LKI  458
            FLS+  ++LLP KCY  N + + S +  SL  +   L+ V + +L     +N  L  +K+
Sbjct  239  FLSKDSIELLPNKCYGRNTHIENSPLLGSLKPQFHMLDTVFQRYLRNWILQNGLLAFVKV  298

Query  457  RIKPSYIFRFQIELERNIRSNDTYWSTLGEWRTRPAAERVWFEVVAGIGSGFMKPFTIRK  278
            +++   + RFQ+ELE    +N + ++ L EWRT+P  ER  FEV+A + +  +KP  ++K
Sbjct  299  KMRACVVVRFQLELENTFGTNSSLYARLAEWRTKPTVERASFEVLARLDTVRLKPLAVKK  358

Query  277  VRPFIEVDslswsslmsniSFTKFPSFLVPPEPLTLDVKW  158
            ++P I  DS  W +L+ NISFTKFPS LV PE LTLDVKW
Sbjct  359  LKPLIVADSTEWRNLLPNISFTKFPSLLVSPEALTLDVKW  398



>gb|KFK29079.1| hypothetical protein AALP_AA7G086200 [Arabis alpina]
Length=390

 Score =   156 bits (394),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 92/198 (46%), Positives = 127/198 (64%), Gaps = 3/198 (2%)
 Frame = -2

Query  748  MWSESQSSCLSLLPVRVRGSASVTVYRTKNPDASIRTSFLSRGIVKLLPEKCYM-GNVYR  572
            +WS   S CL L P+++ GSAS+  +RTK  D+ I+TS+LS   ++LLP+KCY     YR
Sbjct  195  LWSFLDSVCLPLPPIQILGSASLVAFRTKKADSEIKTSYLSNDAIQLLPDKCYSRAPSYR  254

Query  571  KQSSVFDSLSQRVTSLENVLKSFLGGRTNRNTGLGLKIRIKPSYIFRFQIELERNIRSND  392
            +     + L  ++  LE VL S   G  NR     +  ++K S I RFQ+E+ER+  SN+
Sbjct  255  QHRLPTNLLGLKIDKLEKVLNSL--GNGNRQMVSSVTAKLKASSILRFQLEIERSFGSNE  312

Query  391  TYWSTLGEWRTRPAAERVWFEVVAGIGSGFMKPFTIRKVRPFIEVDslswsslmsniSFT  212
            +  S + EWRT+P  ERVWF++ A +    +K   ++KV PFI+VD+ +WSSLMSNISFT
Sbjct  313  SVISKIVEWRTKPKIERVWFDITAKVEGDKLKAVGMKKVLPFIQVDTEAWSSLMSNISFT  372

Query  211  KFPSFLVPPEPLTLDVKW  158
            KFPS L P E LTL VKW
Sbjct  373  KFPSILGPQEALTLGVKW  390



>ref|NP_564503.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAG11422.1|AC015449_4 Unknown protein [Arabidopsis thaliana]
 gb|AAP21272.1| At1g47310 [Arabidopsis thaliana]
 dbj|BAF00222.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE32155.1| uncharacterized protein AT1G47310 [Arabidopsis thaliana]
Length=395

 Score =   154 bits (390),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 94/200 (47%), Positives = 125/200 (63%), Gaps = 3/200 (2%)
 Frame = -2

Query  754  TNMWSESQSSCLSLLPVRVRGSASVTVYRTKNPDASIRTSFLSRGIVKLLPEKCYM-GNV  578
            +++WS   S C+ L P+++ GSAS+  +RT N    I+TS+LS   + L  EKCY   + 
Sbjct  198  SSLWSFWGSVCVPLPPIQIIGSASLVAFRTSNATTQIKTSYLSDEAIHLYAEKCYYKAHT  257

Query  577  YRKQSSVFDSLSQRVTSLENVLKSFLGGRTNRNTGLGLKIRIKPSYIFRFQIELERNIRS  398
            YR+     D L  ++  LE VL S   G   R T   +  ++K S + RFQ+E+ER+I  
Sbjct  258  YRQHRFPNDLLGLKIHKLEKVLNSL--GNGTRQTVSSVTAKLKASGMVRFQLEIERSIGK  315

Query  397  NDTYWSTLGEWRTRPAAERVWFEVVAGIGSGFMKPFTIRKVRPFIEVDslswsslmsniS  218
            N++  S    WRT+P  ERVWFEV A I    +K   +RKV PFIEVD+ +WSSLMSN+S
Sbjct  316  NESVISKKVAWRTKPKIERVWFEVTAKIEGDKLKAVRLRKVVPFIEVDTEAWSSLMSNMS  375

Query  217  FTKFPSFLVPPEPLTLDVKW  158
            FTKFPS LVP E LTLDVKW
Sbjct  376  FTKFPSLLVPQEALTLDVKW  395



>gb|AAM61120.1| unknown [Arabidopsis thaliana]
Length=395

 Score =   154 bits (389),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 94/200 (47%), Positives = 125/200 (63%), Gaps = 3/200 (2%)
 Frame = -2

Query  754  TNMWSESQSSCLSLLPVRVRGSASVTVYRTKNPDASIRTSFLSRGIVKLLPEKCYM-GNV  578
            +++WS   S C+ L P+++ GSAS+  +RT N    I+TS+LS   + L  EKCY   + 
Sbjct  198  SSLWSFWGSVCVPLPPIQIIGSASLVAFRTSNATTQIKTSYLSDEAIHLYAEKCYYKAHT  257

Query  577  YRKQSSVFDSLSQRVTSLENVLKSFLGGRTNRNTGLGLKIRIKPSYIFRFQIELERNIRS  398
            YR+     D L  ++  LE VL S   G   R T   +  ++K S + RFQ+E+ER+I  
Sbjct  258  YRQHRFPNDLLGLKIHKLEKVLNSL--GNGTRQTVSSVTAKLKASGMVRFQLEIERSIGK  315

Query  397  NDTYWSTLGEWRTRPAAERVWFEVVAGIGSGFMKPFTIRKVRPFIEVDslswsslmsniS  218
            N++  S    WRT+P  ERVWFEV A I    +K   +RKV PFIEVD+ +WSSLMSN+S
Sbjct  316  NESVISKKVAWRTKPKIERVWFEVTAKIEGDKLKAVRLRKVVPFIEVDTEAWSSLMSNMS  375

Query  217  FTKFPSFLVPPEPLTLDVKW  158
            FTKFPS LVP E LTLDVKW
Sbjct  376  FTKFPSLLVPQEALTLDVKW  395



>ref|XP_008452490.1| PREDICTED: uncharacterized protein LOC103493507 isoform X1 [Cucumis 
melo]
Length=441

 Score =   154 bits (388),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 84/190 (44%), Positives = 122/190 (64%), Gaps = 1/190 (1%)
 Frame = -2

Query  724  CLSLLPVRVRGSASVTVYRTKNPDASIRTSFLSRGIVKLLPEKCYMGNVYRKQSSVFDSL  545
            C  LLP+RV GSA+++ YRT+NPD  IRT FLS+  ++LLP KCY  N + + S +  SL
Sbjct  252  CSPLLPLRVLGSATLSAYRTRNPDDYIRTRFLSKDSIELLPNKCYGRNTHIENSPLLGSL  311

Query  544  SQRVTSLENVLKSFLGGRTNRNTGLG-LKIRIKPSYIFRFQIELERNIRSNDTYWSTLGE  368
              +   L ++ + +L     +N  L  ++++++ S   RFQ+ELE    +N + ++ L E
Sbjct  312  KPQFHMLNSIFQRYLSNWILQNGLLAFVEVKMRASVFVRFQLELENTFGTNSSLYARLAE  371

Query  367  WRTRPAAERVWFEVVAGIGSGFMKPFTIRKVRPFIEVDslswsslmsniSFTKFPSFLVP  188
            WRT+P  ER  FEV+A +    +KP  ++K++P I  DS  W +L+ NISFTKFPS LV 
Sbjct  372  WRTKPTVERASFEVLARLDPVRLKPLVVKKLKPLIVADSTEWRNLLPNISFTKFPSLLVS  431

Query  187  PEPLTLDVKW  158
            PE LTLDVKW
Sbjct  432  PEALTLDVKW  441



>ref|XP_008452491.1| PREDICTED: uncharacterized protein LOC103493507 isoform X2 [Cucumis 
melo]
Length=440

 Score =   154 bits (388),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 84/190 (44%), Positives = 122/190 (64%), Gaps = 1/190 (1%)
 Frame = -2

Query  724  CLSLLPVRVRGSASVTVYRTKNPDASIRTSFLSRGIVKLLPEKCYMGNVYRKQSSVFDSL  545
            C  LLP+RV GSA+++ YRT+NPD  IRT FLS+  ++LLP KCY  N + + S +  SL
Sbjct  251  CSPLLPLRVLGSATLSAYRTRNPDDYIRTRFLSKDSIELLPNKCYGRNTHIENSPLLGSL  310

Query  544  SQRVTSLENVLKSFLGGRTNRNTGLG-LKIRIKPSYIFRFQIELERNIRSNDTYWSTLGE  368
              +   L ++ + +L     +N  L  ++++++ S   RFQ+ELE    +N + ++ L E
Sbjct  311  KPQFHMLNSIFQRYLSNWILQNGLLAFVEVKMRASVFVRFQLELENTFGTNSSLYARLAE  370

Query  367  WRTRPAAERVWFEVVAGIGSGFMKPFTIRKVRPFIEVDslswsslmsniSFTKFPSFLVP  188
            WRT+P  ER  FEV+A +    +KP  ++K++P I  DS  W +L+ NISFTKFPS LV 
Sbjct  371  WRTKPTVERASFEVLARLDPVRLKPLVVKKLKPLIVADSTEWRNLLPNISFTKFPSLLVS  430

Query  187  PEPLTLDVKW  158
            PE LTLDVKW
Sbjct  431  PEALTLDVKW  440



>ref|XP_010461568.1| PREDICTED: uncharacterized protein LOC104742274 [Camelina sativa]
Length=391

 Score =   152 bits (385),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 94/192 (49%), Positives = 124/192 (65%), Gaps = 4/192 (2%)
 Frame = -2

Query  730  SSCLSLLPVRVRGSASVTVYRTKNPDASIRTSFLSRGIVKLLPEKCYM-GNVYRKQSSVF  554
            S C+ L P+++ GSAS+  +RT N D+ I+TS+LS   + L  EKCY   + YR+     
Sbjct  203  SVCVPLPPIQIVGSASLVAFRTPN-DSQIKTSYLSDEAIHLHAEKCYYKAHTYRQHRFPR  261

Query  553  DSLSQRVTSLENVLKSFLGGRTNRNTGLGLKIRIKPSYIFRFQIELERNIRSNDTYWSTL  374
            D L  ++  LE VL SF  G   R T   +  ++K S + RFQ+E+ER+I  N++  +  
Sbjct  262  DLLGLKIDKLEKVLSSF--GNGTRQTVSSVTAKLKASGMVRFQLEIERSIGRNESVINKR  319

Query  373  GEWRTRPAAERVWFEVVAGIGSGFMKPFTIRKVRPFIEVDslswsslmsniSFTKFPSFL  194
             EWRT+P  ERVWFEV A I    +K   +RKV PFIEVD+ +WSSLMSN+SFTKFPS L
Sbjct  320  VEWRTKPKIERVWFEVTAKIEGDKLKTVGMRKVVPFIEVDTEAWSSLMSNMSFTKFPSLL  379

Query  193  VPPEPLTLDVKW  158
            VP E LTLDVKW
Sbjct  380  VPQEALTLDVKW  391



>emb|CDY58083.1| BnaA10g28600D [Brassica napus]
Length=393

 Score =   152 bits (384),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 90/197 (46%), Positives = 122/197 (62%), Gaps = 2/197 (1%)
 Frame = -2

Query  745  WSESQSSCLSLLPVRVRGSASVTVYRTKNPDASIRTSFLSRGIVKLLPEKCY-MGNVYRK  569
            WS     C+ L P+++ GSAS+  +RT   D+ I+TSFLS   ++LLPEKCY   + Y++
Sbjct  198  WSSLGPLCVPLPPIQIIGSASLVAFRTPEADSQIKTSFLSDETIQLLPEKCYDKAHTYKQ  257

Query  568  QSSVFDSLSQRVTSLENVLKSFLGGRTNRNTGLGLKIRIKPSYIFRFQIELERNIRSNDT  389
                 D L  ++  LE  L S     T +     +  ++K S + RFQ+E+ R I SN++
Sbjct  258  HYLPSDLLGLKIDKLEKALSSLRSNGTAQTVS-SVTAKLKASGMVRFQLEIGRRIGSNES  316

Query  388  YWSTLGEWRTRPAAERVWFEVVAGIGSGFMKPFTIRKVRPFIEVDslswsslmsniSFTK  209
              S   EWRT+P  ERVWFEV A +    +K   +RKV PFIEVD+ +WSS+MSN+SFTK
Sbjct  317  ETSKRAEWRTKPKIERVWFEVKAKVEGDKLKAVGMRKVAPFIEVDTEAWSSMMSNMSFTK  376

Query  208  FPSFLVPPEPLTLDVKW  158
            FPS L P E LTLDVKW
Sbjct  377  FPSILGPQEALTLDVKW  393



>ref|XP_009118936.1| PREDICTED: uncharacterized protein LOC103843915 [Brassica rapa]
Length=393

 Score =   152 bits (383),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 90/197 (46%), Positives = 122/197 (62%), Gaps = 2/197 (1%)
 Frame = -2

Query  745  WSESQSSCLSLLPVRVRGSASVTVYRTKNPDASIRTSFLSRGIVKLLPEKCY-MGNVYRK  569
            WS     C+ L P+++ GSAS+  +RT   D+ I+TSFLS   ++LLPEKCY   + Y++
Sbjct  198  WSSLGPVCVPLPPIQIIGSASLVAFRTPEADSQIKTSFLSDETIQLLPEKCYDKAHTYKQ  257

Query  568  QSSVFDSLSQRVTSLENVLKSFLGGRTNRNTGLGLKIRIKPSYIFRFQIELERNIRSNDT  389
                 D L  ++  LE  L S     T +     +  ++K S + RFQ+E+ R I SN++
Sbjct  258  HYLPSDLLGLKIDKLEKALSSLRSNGTAQTVS-SVTAKLKASGMVRFQLEIGRRIGSNES  316

Query  388  YWSTLGEWRTRPAAERVWFEVVAGIGSGFMKPFTIRKVRPFIEVDslswsslmsniSFTK  209
              S   EWRT+P  ERVWFEV A +    +K   +RKV PFIEVD+ +WSS+MSN+SFTK
Sbjct  317  ETSKRAEWRTKPKIERVWFEVKAKVEGDKLKAVGMRKVVPFIEVDTEAWSSMMSNMSFTK  376

Query  208  FPSFLVPPEPLTLDVKW  158
            FPS L P E LTLDVKW
Sbjct  377  FPSILGPQEALTLDVKW  393



>ref|XP_010500293.1| PREDICTED: uncharacterized protein LOC104777695 [Camelina sativa]
Length=393

 Score =   151 bits (382),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 94/205 (46%), Positives = 129/205 (63%), Gaps = 4/205 (2%)
 Frame = -2

Query  769  YGNAFTNMWSESQSSCLSLLPVRVRGSASVTVYRTKNPDASIRTSFLSRGIVKLLPEKCY  590
            Y    +++ S   S C+ L P+++ GSAS+  ++T N D+ I+TS+LS   + L  EKCY
Sbjct  192  YIKEGSSLLSFQGSVCMPLPPIQIVGSASLVAFKTPN-DSQIKTSYLSDEAIHLHAEKCY  250

Query  589  M-GNVYRKQSSVFDSLSQRVTSLENVLKSFLGGRTNRNTGLGLKIRIKPSYIFRFQIELE  413
               + YR+     D L  ++  LE +L SF  G   R T   +  ++K S + RFQ+E+E
Sbjct  251  YKAHTYRQHRFPTDLLGLKIDKLEKLLSSF--GNGTRQTVSSVTAKLKASGMVRFQLEIE  308

Query  412  RNIRSNDTYWSTLGEWRTRPAAERVWFEVVAGIGSGFMKPFTIRKVRPFIEVDslswssl  233
            R+I  N++  +   EWRT+P  ERVWFEV A I    +K   +RKV PFIEVD+ +WSSL
Sbjct  309  RSIGRNESVINKRVEWRTKPKIERVWFEVTAKIEGDKLKTVGMRKVVPFIEVDTEAWSSL  368

Query  232  msniSFTKFPSFLVPPEPLTLDVKW  158
            MSN+SFTKFPS LVP E LTLDVKW
Sbjct  369  MSNMSFTKFPSLLVPQEALTLDVKW  393



>ref|XP_010479168.1| PREDICTED: uncharacterized protein LOC104758062 [Camelina sativa]
Length=393

 Score =   149 bits (377),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 92/192 (48%), Positives = 123/192 (64%), Gaps = 4/192 (2%)
 Frame = -2

Query  730  SSCLSLLPVRVRGSASVTVYRTKNPDASIRTSFLSRGIVKLLPEKCYM-GNVYRKQSSVF  554
            S C+ L P+++ GSAS+  +RT N D+ I+TS+LS   + L  +KCY   + YR+     
Sbjct  205  SVCVPLPPIQIVGSASLVAFRTPN-DSQIKTSYLSDEAIHLHADKCYYKAHTYRQHRFPT  263

Query  553  DSLSQRVTSLENVLKSFLGGRTNRNTGLGLKIRIKPSYIFRFQIELERNIRSNDTYWSTL  374
            D L  ++  LE VL S   G   R T   +  ++K S + RFQ+E+ER+I  N++  +  
Sbjct  264  DLLGLKIDKLEKVLSSL--GNGTRQTVSSVTAKLKASGMVRFQLEIERSIGRNESVINKR  321

Query  373  GEWRTRPAAERVWFEVVAGIGSGFMKPFTIRKVRPFIEVDslswsslmsniSFTKFPSFL  194
             EWRT+P  ERVWFEV A I    +K   +RKV PFIEVD+ +WSSLMSN+SFTKFPS L
Sbjct  322  VEWRTKPKIERVWFEVTAKIEGDKLKTVGMRKVVPFIEVDTEAWSSLMSNMSFTKFPSLL  381

Query  193  VPPEPLTLDVKW  158
            VP E LTLDVKW
Sbjct  382  VPQEALTLDVKW  393



>ref|XP_008792705.1| PREDICTED: uncharacterized protein LOC103709235 [Phoenix dactylifera]
Length=405

 Score =   149 bits (376),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 92/201 (46%), Positives = 125/201 (62%), Gaps = 3/201 (1%)
 Frame = -2

Query  751  NMWSESQSSCLSLLPVRVRGSASVTVYRTKNPDASIRTSFLSRGIVKLLPEKCYMGNVYR  572
              W+   SSC  LL V V GS SV   R ++  A +  +F S   V+LLPEKCY G+   
Sbjct  205  QFWAFGYSSCAPLLSVLVGGSVSVIAVRNRSSLAPVEAAFRSPDTVELLPEKCYDGHFKS  264

Query  571  KQSSVFDSLSQRVTSLENVLKSFLG-GRTNRNTGLGLKIRIKPSYIFRFQIELERNIRSN  395
              S +F S+S+R+  L+  + S LG G     +   LK +I  S + +F++ELER+I  N
Sbjct  265  TPSCLFCSISKRLVLLDKAVGSLLGDGVFQSGSTRFLKAKIMSSTLVKFRLELERDITKN  324

Query  394  DTYWSTLGEWRTRPAAERVWFEVVAGI-GSGFMKPFTIRKV-RPFIEVDslswsslmsni  221
            D+ W    EW+T+P  ER WFE+VA + G   +KP   +K+ RPFI  DS +WS+LMSN+
Sbjct  325  DSIWKKTAEWKTKPTVERHWFEIVARVDGERGLKPVITKKLKRPFIVADSTAWSNLMSNL  384

Query  220  SFTKFPSFLVPPEPLTLDVKW  158
            SFT+FPS +VPPE LTLDVKW
Sbjct  385  SFTQFPSVVVPPEALTLDVKW  405



>emb|CDY20895.1| BnaC06g01150D [Brassica napus]
Length=390

 Score =   148 bits (374),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 90/199 (45%), Positives = 124/199 (62%), Gaps = 6/199 (3%)
 Frame = -2

Query  745  WSESQSSCLSLLPVRVRGSASVTVYRTKNPDASIRTSFLSRGIVKLLPEKCY-MGNVYRK  569
            WS     C+ L P+++ GSAS+  +RT   D+ I+TS+LS   ++LLPEKCY   + Y++
Sbjct  195  WSSLGPVCVPLPPIQIIGSASLVAFRTPEADSQIKTSYLSDETIQLLPEKCYDKAHTYKQ  254

Query  568  QSSVFDSLSQRVTSLENVLKSFLGGRTN--RNTGLGLKIRIKPSYIFRFQIELERNIRSN  395
                 D L  ++  LE  L S    RTN    T   +  ++K S + RFQ+E+ R I SN
Sbjct  255  HYLPTDLLGLKIDKLEKALSSL---RTNGTAQTVSSVTAKLKASGMVRFQLEIGRRIGSN  311

Query  394  DTYWSTLGEWRTRPAAERVWFEVVAGIGSGFMKPFTIRKVRPFIEVDslswsslmsniSF  215
            ++  S   EWRT+P  ERVWFE+ A +    +K   +RKV PFIEVD+ +WSS+MSN+SF
Sbjct  312  ESESSKRAEWRTKPKIERVWFEIKAKVEGEKLKAVGMRKVVPFIEVDTEAWSSMMSNMSF  371

Query  214  TKFPSFLVPPEPLTLDVKW  158
            T+FPS L P E LTLDVKW
Sbjct  372  TEFPSILGPQEALTLDVKW  390



>ref|XP_011459929.1| PREDICTED: uncharacterized protein LOC101290731 [Fragaria vesca 
subsp. vesca]
Length=789

 Score =   149 bits (375),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 89/206 (43%), Positives = 124/206 (60%), Gaps = 13/206 (6%)
 Frame = -2

Query  754  TNMWSESQSSCLSLLPVRVRGSASVTVYRTKNPDASIRTSFLSRGIVKLLPEKCYMGN-V  578
            +  W    S C SL+P+RV G AS+  YRT+NP A I T F+S+ I++LLPEKC+  +  
Sbjct  586  SEFWPFWHSYCASLVPIRVIGPASLVAYRTRNPAAHIETKFMSKEIIELLPEKCFSSHRT  645

Query  577  YRK----QSSVFDSLSQRVTSLENVLKSFLGGRTNRNTGLGLKIRIKPSYIFRFQIELER  410
            YRK    QSS  DSL  ++T LE + K  +   T     +G++ +IK S I +F+++LER
Sbjct  646  YRKQKQRQSSPIDSLCSKITMLERIWKGKIKAST-----IGIEGKIKASTIVQFKLQLER  700

Query  409  NIRSNDTYWSTLGEWRTRPAAERVWFEVVAGIGSG--FMKPFTIRKVRPFIEVDslswss  236
            + R        +  WRTRP  ERVWFEV+A +      ++P  ++K++PFI  D  +   
Sbjct  701  DFRRRGILRQNIAGWRTRPDVERVWFEVLARVELQRLRLRPILVKKIKPFIIAD-SAEWD  759

Query  235  lmsniSFTKFPSFLVPPEPLTLDVKW  158
              SN+SFTK  S LV PE LTLDVKW
Sbjct  760  NPSNMSFTKSQSILVAPEALTLDVKW  785



>gb|EPS59742.1| hypothetical protein M569_15063, partial [Genlisea aurea]
Length=338

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 78/191 (41%), Positives = 111/191 (58%), Gaps = 8/191 (4%)
 Frame = -2

Query  724  CLSLLPVRVRGSASVTVYRTKNPDASI-RTSFLSR-GIVKLLPEKCYMGNVYRKQSSVFD  551
            C +   + + GSASV+ Y +  P + I RT   S    + LLP+KCY  +  +  S +  
Sbjct  150  CRATPRIHINGSASVSAYTSTRPTSPIIRTQISSSTDAITLLPDKCYDDD--KTTSLLRG  207

Query  550  SLSQRVTSLENVLKSFLGGRTNRNTGLGLKIRIKPSYIFRFQIELERNIRSNDTYWSTLG  371
            S   +   L+ VL +FL        G  +K   + S ++RF++ELER++R ND YW+  G
Sbjct  208  SFGSKFALLKRVLSTFLDDTAATLRGPPIKASARASTVYRFRLELERDVRKNDAYWTAFG  267

Query  370  EWRTRPAAERVWFEVVAGIGSGFMKPFTIRKV---RPFIEVDslswsslmsniSFTKFPS  200
            EWRTRP+ ER WFEV A +  G +KP  +++V    P I+ D    S L+SN+SFTKFPS
Sbjct  268  EWRTRPSVERAWFEVAARVEDGELKPAAVKRVVGLGPVIDAD-RYSSGLVSNVSFTKFPS  326

Query  199  FLVPPEPLTLD  167
             LV PE LTL+
Sbjct  327  LLVAPEALTLE  337



>ref|XP_006651846.1| PREDICTED: uncharacterized protein LOC102700979 [Oryza brachyantha]
Length=419

 Score =   120 bits (302),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 85/209 (41%), Positives = 126/209 (60%), Gaps = 3/209 (1%)
 Frame = -2

Query  775  LFYGNAFTNMWSESQSSCLSLLPVRVRGSASVTVYRTKNPDASIRTSFLSRGIVKLLPEK  596
            L   N  + +W  S ++C  +L V V GS  V V  +    A ++T   S G ++LLPEK
Sbjct  211  LSSNNDLSRIWPLSYATCAPILQVSVVGSVLVVVNESSLLGAQVKTLLRSHGTMELLPEK  270

Query  595  CYMGNVYRKQSS-VFDSLSQRVTSLENVLKSFLGGRTNRNTGLG-LKIRIKPSYIFRFQI  422
            C +    R  S+ VF S+S R+  L+ +LK++   +   N  +  ++ ++    + +F++
Sbjct  271  CGVNVPNRLISACVFCSISSRLPRLDKILKTWFSKKNEDNKSMRFIQAKVTSIPLIKFRL  330

Query  421  ELERNIRSNDTYWSTLGEWRTRPAAERVWFEVVAGIGSGFMKPFTIRKV-RPFIEVDsls  245
            ELER+I   D  W  + EW+T P  +RV  +VVA +  G +K  +++KV RPF  VD+ S
Sbjct  331  ELERDITEEDGLWENISEWKTVPMVQRVTLDVVARVEEGRLKAMSVKKVKRPFPIVDASS  390

Query  244  wsslmsniSFTKFPSFLVPPEPLTLDVKW  158
            WSSL SNISFTKF SF++PPEPLTLDVKW
Sbjct  391  WSSLTSNISFTKFMSFVLPPEPLTLDVKW  419



>ref|NP_001051374.1| Os03g0765100 [Oryza sativa Japonica Group]
 dbj|BAF13288.1| Os03g0765100, partial [Oryza sativa Japonica Group]
Length=221

 Score =   112 bits (280),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 79/212 (37%), Positives = 124/212 (58%), Gaps = 9/212 (4%)
 Frame = -2

Query  781  SGLFYGNAFTNMWSESQSSCLSLLPVRVRGSASVTVYRTKNPDASIRTSFLSRGIVKLLP  602
            S L   N  + +W  S ++C  +L V V GS  + V      ++++     S   V+LL 
Sbjct  15   SLLASNNDPSRIWPLSYATCAPILQVSVVGSVMIVVN-----ESNVLGRRRSHDTVELLS  69

Query  601  EKCYMGNVYRKQS-SVFDSLSQRVTSLENVLKSFLGGRTNRNTGLG-LKIRIKPSYIFRF  428
            EKC +    R  S  VF S+S R+  L+ +LK++   +T  +  +  ++ ++    + +F
Sbjct  70   EKCEVDVANRLISVCVFCSISSRLPRLDKILKTWFSNKTQDSKSMQFIQAKVTSIPLIKF  129

Query  427  QIELERNIRSNDTYWSTLGEWRTRPAAERVWFEVVAGIGS-GFMKPFTIRKVR-PFIEVD  254
            ++ELER+I   D  W  + +W+T P  +RV  +VVA +   G +K  +++KV+ P+  VD
Sbjct  130  RLELERDITEEDGIWENISKWKTVPMVQRVALDVVAKVEEEGRLKAMSVKKVKKPYPVVD  189

Query  253  slswsslmsniSFTKFPSFLVPPEPLTLDVKW  158
            + SWSSL SNISFTKF SF++PPEPLTLDVKW
Sbjct  190  ASSWSSLTSNISFTKFMSFVLPPEPLTLDVKW  221



>gb|AAP50957.1| hypothetical protein [Oryza sativa Japonica Group]
 gb|EEC76235.1| hypothetical protein OsI_13652 [Oryza sativa Indica Group]
 gb|EEE59986.1| hypothetical protein OsJ_12701 [Oryza sativa Japonica Group]
Length=425

 Score =   111 bits (277),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 78/210 (37%), Positives = 123/210 (59%), Gaps = 9/210 (4%)
 Frame = -2

Query  775  LFYGNAFTNMWSESQSSCLSLLPVRVRGSASVTVYRTKNPDASIRTSFLSRGIVKLLPEK  596
            L   N  + +W  S ++C  +L V V GS  + V      ++++     S   V+LL EK
Sbjct  221  LASNNDPSRIWPLSYATCAPILQVSVVGSVMIVVN-----ESNVLGRRRSHDTVELLSEK  275

Query  595  CYMGNVYRKQS-SVFDSLSQRVTSLENVLKSFLGGRTNRNTGLG-LKIRIKPSYIFRFQI  422
            C +    R  S  VF S+S R+  L+ +LK++   +T  +  +  ++ ++    + +F++
Sbjct  276  CEVDVANRLISVCVFCSISSRLPRLDKILKTWFSNKTQDSKSMQFIQAKVTSIPLIKFRL  335

Query  421  ELERNIRSNDTYWSTLGEWRTRPAAERVWFEVVAGIGS-GFMKPFTIRKVR-PFIEVDsl  248
            ELER+I   D  W  + +W+T P  +RV  +VVA +   G +K  +++KV+ P+  VD+ 
Sbjct  336  ELERDITEEDGIWENISKWKTVPMVQRVALDVVAKVEEEGRLKAMSVKKVKKPYPVVDAS  395

Query  247  swsslmsniSFTKFPSFLVPPEPLTLDVKW  158
            SWSSL SNISFTKF SF++PPEPLTLDVKW
Sbjct  396  SWSSLTSNISFTKFMSFVLPPEPLTLDVKW  425



>ref|XP_002466398.1| hypothetical protein SORBIDRAFT_01g007090 [Sorghum bicolor]
 gb|EER93396.1| hypothetical protein SORBIDRAFT_01g007090 [Sorghum bicolor]
Length=438

 Score =   110 bits (275),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 76/212 (36%), Positives = 123/212 (58%), Gaps = 4/212 (2%)
 Frame = -2

Query  781  SGLFYGNAFTNMWSESQSSCLSLLPVRVRGSASVTVYRTKNPDASIRTSFLSRGIVKLLP  602
            S L   +  + +W  S S+C  LL V V GS  + V++T      ++T   S   ++LL 
Sbjct  227  SLLTSNHDLSQIWPLSYSTCAPLLQVSVVGSVIIVVHQTSVSAGHVKTFLRSHNTIELLS  286

Query  601  EKCYMGNVYRKQSS-VFDSLSQRVTSLENVLKSFLGGRTNRNTGLG-LKIRIKPSYIFRF  428
            +KC +    R  S  +F S+S R+  LE +LK++   R + N+ +  ++ ++    + +F
Sbjct  287  DKCKVNTANRLISEFLFSSVSPRLIKLEKILKTWFSKRNHHNSSMHFIEAKVASIPLVKF  346

Query  427  QIELERNIRSNDTYWSTLGEWRTRPAAERVWFEVVAGI-GSGFMKPFTIRKVR-PFIEVD  254
            ++E ER++   D  W  + EW+TRP   RV  +++A +     +K  +++KVR  F  VD
Sbjct  347  RLEFERDVTEEDPIWDDVPEWKTRPMVRRVPVDIIAEVEDDDRLKAISVKKVRRQFPVVD  406

Query  253  slswsslmsniSFTKFPSFLVPPEPLTLDVKW  158
            + +W SL SNISFTKF SF++PPEPL+LDVKW
Sbjct  407  TTTWGSLASNISFTKFLSFILPPEPLSLDVKW  438



>ref|XP_004981653.1| PREDICTED: uncharacterized protein LOC101786169 [Setaria italica]
Length=430

 Score =   108 bits (270),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 75/195 (38%), Positives = 119/195 (61%), Gaps = 4/195 (2%)
 Frame = -2

Query  730  SSCLSLLPVRVRGSASVTVYRTKNPDASIRTSFLSRGIVKLLPEKCYMGNVYRKQSS-VF  554
            ++C  LL V V GS  + V++T      ++T   S   ++LLP+KC +    R  S+ +F
Sbjct  236  TTCAPLLQVGVVGSVVIVVHQTSVSGGHVKTELRSHDTMELLPDKCQVNVSNRLISACLF  295

Query  553  DSLSQRVTSLENVLKSFLGGRTNRNTGLG-LKIRIKPSYIFRFQIELERNIRSNDTYWST  377
             S+S R+  LE +LKS+   R   N+ +  ++ ++    + +F++ELER+I   D  W  
Sbjct  296  CSISPRLIKLERILKSWFSKRNMENSSMHFIEAKVTSIPLVKFRLELERDITEEDPIWKD  355

Query  376  LGEWRTRPAAERVWFEVVAGI-GSGFMKPFTIRKVR-PFIEVDslswsslmsniSFTKFP  203
            + EW+T P  +RV  ++VA +     +K  +++KVR PF  VD+ SW SL SN+SFT+F 
Sbjct  356  VPEWKTLPIVQRVTLDIVARVEDDDRLKAISVKKVRQPFPIVDTTSWGSLTSNVSFTQFM  415

Query  202  SFLVPPEPLTLDVKW  158
            SF++PPEPL+LDVKW
Sbjct  416  SFVLPPEPLSLDVKW  430



>ref|XP_009407427.1| PREDICTED: uncharacterized protein LOC103990116 [Musa acuminata 
subsp. malaccensis]
Length=420

 Score =   107 bits (268),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 82/201 (41%), Positives = 124/201 (62%), Gaps = 5/201 (2%)
 Frame = -2

Query  745  WSESQSSCLSLLPVRVRGSASVTVYRTKNPDASIRTSFLSRGIVKLLPEKCYM-GNVYRK  569
            W    SSC+  L V V GS SV+ +   N    I  +F +   V+LLP KCY  G+V + 
Sbjct  220  WHLGYSSCVPHLSVHVVGSVSVSAHGYDNTVGDIEAAFKTDDTVELLPAKCYSNGHVKQI  279

Query  568  QSSVFDSLSQRVTSLENVLKSFLGGRTNRNTGLGL-KIRIKPSYIFRFQIELERNI-RSN  395
             S  F  +S R++ L+ ++   LG   + +T +   K +I  + + +F+++LER+I  +N
Sbjct  280  SSCSFCFVSSRLSMLDKLVGGLLGNNVSPDTSVRFTKAKITSATVIKFRLQLERDITENN  339

Query  394  DTYWSTLGEWRTRPAAERVWFEVVAGI-GSGFMKPFTIRKV-RPFIEVDslswsslmsni  221
            +     + EW+ +P A + W E++A + G G +KP  ++K+ RP+   DS+S+SSLMSNI
Sbjct  340  NRSLEKVPEWKQKPKAAQSWLEIMARVEGEGRLKPVLVKKLKRPYTIADSISFSSLMSNI  399

Query  220  SFTKFPSFLVPPEPLTLDVKW  158
            SFTKFPSF+VPPE LTLDVKW
Sbjct  400  SFTKFPSFVVPPEALTLDVKW  420



>gb|ABF99038.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAG88426.1| unnamed protein product [Oryza sativa Japonica Group]
Length=175

 Score =   103 bits (257),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 67/161 (42%), Positives = 102/161 (63%), Gaps = 4/161 (2%)
 Frame = -2

Query  628  SRGIVKLLPEKCYMGNVYRKQS-SVFDSLSQRVTSLENVLKSFLGGRTNRNTGLG-LKIR  455
            S   V+LL EKC +    R  S  VF S+S R+  L+ +LK++   +T  +  +  ++ +
Sbjct  15   SHDTVELLSEKCEVDVANRLISVCVFCSISSRLPRLDKILKTWFSNKTQDSKSMQFIQAK  74

Query  454  IKPSYIFRFQIELERNIRSNDTYWSTLGEWRTRPAAERVWFEVVAGIGS-GFMKPFTIRK  278
            +    + +F++ELER+I   D  W  + +W+T P  +RV  +VVA +   G +K  +++K
Sbjct  75   VTSIPLIKFRLELERDITEEDGIWENISKWKTVPMVQRVALDVVAKVEEEGRLKAMSVKK  134

Query  277  VR-PFIEVDslswsslmsniSFTKFPSFLVPPEPLTLDVKW  158
            V+ P+  VD+ SWSSL SNISFTKF SF++PPEPLTLDVKW
Sbjct  135  VKKPYPVVDASSWSSLTSNISFTKFMSFVLPPEPLTLDVKW  175



>ref|XP_003558970.1| PREDICTED: uncharacterized protein LOC100823712 [Brachypodium 
distachyon]
Length=425

 Score =   106 bits (265),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 72/197 (37%), Positives = 117/197 (59%), Gaps = 4/197 (2%)
 Frame = -2

Query  736  SQSSCLSLLPVRVRGSASVTVYRTKNPDASIRTSFLSRGIVKLLPEKCYMGNVYRKQSS-  560
            S+S+C  +L V V GS  +  +       ++R S  S   ++LL +K  +    R  S+ 
Sbjct  229  SRSTCAPILHVSVLGSVIMVAHEIDVSGGAMRPSLSSHDTMELLSDKFEVDMSDRLISAC  288

Query  559  VFDSLSQRVTSLENVLKSFLGGRTNRNTGLG-LKIRIKPSYIFRFQIELERNIRSNDTYW  383
            VF ++S R+  LE +LK++   R   N  +  ++ ++    + +F++ELER+I   D  W
Sbjct  289  VFCAISPRLPKLEKLLKTWFSKRNEFNRSMNFIEAKVSSIPLVKFRLELERDITEEDGIW  348

Query  382  STLGEWRTRPAAERVWFEVVAGI-GSGFMKPFTIRKVR-PFIEVDslswsslmsniSFTK  209
              + EW+T P  +RV  +++A +   G +K  +++KVR PF  VD+ SWSSL SN+SFT 
Sbjct  349  EDVPEWKTLPVVQRVMLDIIARVEEEGRLKAMSVKKVRKPFPIVDATSWSSLTSNVSFTD  408

Query  208  FPSFLVPPEPLTLDVKW  158
            F SF++PP+PL+LDVKW
Sbjct  409  FMSFVLPPDPLSLDVKW  425



>ref|NP_001143737.1| uncharacterized protein LOC100276491 precursor [Zea mays]
 gb|ACF88459.1| unknown [Zea mays]
 gb|ACG34844.1| hypothetical protein [Zea mays]
 gb|AFW67514.1| hypothetical protein ZEAMMB73_563492 [Zea mays]
Length=432

 Score =   105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 75/212 (35%), Positives = 123/212 (58%), Gaps = 4/212 (2%)
 Frame = -2

Query  781  SGLFYGNAFTNMWSESQSSCLSLLPVRVRGSASVTVYRTKNPDASIRTSFLSRGIVKLLP  602
            S L   N  + +W  S S+C  LL V + GS  + V++T      ++T   S   ++LL 
Sbjct  221  SLLASNNDLSQIWPLSYSTCAPLLQVGIVGSVVIVVHQTSVSGGHVKTFLRSHDTIELLS  280

Query  601  EKCYMGNVYRKQSS-VFDSLSQRVTSLENVLKSFLGGRTNRNTGLG-LKIRIKPSYIFRF  428
            +K  +    R  S  +F S+S R+  LE +LK++   R   N+ +  ++ ++    + +F
Sbjct  281  DKYKVHISNRLISEFLFSSISPRLIKLEKILKTWFSKRNQENSSVHFIEAKVTSIPLVKF  340

Query  427  QIELERNIRSNDTYWSTLGEWRTRPAAERVWFEVVAGI-GSGFMKPFTIRKV-RPFIEVD  254
            ++E ER++  +D  W  + EW+TRP  +RV  +++A +     +K  +++KV R F  VD
Sbjct  341  RLEFERDVTEDDPIWEDVPEWKTRPMVQRVPVDIIARVEDDDRLKAISVKKVRRQFPVVD  400

Query  253  slswsslmsniSFTKFPSFLVPPEPLTLDVKW  158
            + +W SL SNISFTKF SF++PPEPL+LDVKW
Sbjct  401  TTTWGSLTSNISFTKFLSFILPPEPLSLDVKW  432



>ref|XP_011624990.1| PREDICTED: uncharacterized protein LOC18438315 [Amborella trichopoda]
Length=400

 Score =   103 bits (256),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 73/199 (37%), Positives = 105/199 (53%), Gaps = 9/199 (5%)
 Frame = -2

Query  727  SCLSLLPVRVRGSASVTVYRTKNPDASIRTSFLSRGIVKLLPE-------KCYMGNVYRK  569
            SC+  L VR+    S+  Y  +N  A +  +F S   + L+ E       K  M      
Sbjct  202  SCMPRLLVRISEPISLIAYGIRNAQAHMNMAFPSNDTLTLMLENGILHWSKSTMRQPIVS  261

Query  568  QSSVFDSLSQRVTSLENVLKSFLGGRTNRNTGLGL-KIRIKPSYIFRFQIELERNIRSND  392
                F  L+ ++  L  +LK  LG R  +   L + ++RI  S + RFQ+EL+R++R   
Sbjct  262  LDPGFLPLNSKLDQLRELLKRLLGERIYKMGKLRISRVRIIASTLVRFQLELKRDMREEL  321

Query  391  TYWSTLGEWRTRPAAERVWFEVVAGIGSG-FMKPFTIRKVRPFIEVDslswsslmsniSF  215
            +       WRTRP  ER WFE+VA    G  +KP  ++++RPF+  DS +WS+LM N S 
Sbjct  322  SDVDASMAWRTRPTLERAWFEIVARAERGEQLKPLILKRLRPFVRADSRAWSNLMGNTSL  381

Query  214  TKFPSFLVPPEPLTLDVKW  158
             +FPS  VP E LTLDVKW
Sbjct  382  ARFPSSHVPSEALTLDVKW  400



>ref|XP_007225638.1| hypothetical protein PRUPE_ppa008077mg [Prunus persica]
 gb|EMJ26837.1| hypothetical protein PRUPE_ppa008077mg [Prunus persica]
Length=346

 Score =   102 bits (255),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 51/122 (42%), Positives = 77/122 (63%), Gaps = 3/122 (2%)
 Frame = -2

Query  766  GNAFTNMWSESQSSCLSLLPVRVRGSASVTVYRTKNPDASIRTSFLSRGIVKLLPEKCYM  587
            G   +  W    S C  L P+RV G A++  Y+T+NPDA I T F+S+ I++ LPEKCY 
Sbjct  217  GKEKSEFWPIWHSYCTPLFPIRVLGPATLVAYKTRNPDAYIETKFMSKEIIEFLPEKCYR  276

Query  586  GNVYRKQSSVFDSLSQRVTSLENVLKSFLGGRTNRNTGLG--LKIRIKPSYIFRFQIELE  413
             + Y+K++   DSL  R++ LE++ KSFLG R  R +GL   ++ +IK S + RF+I++ 
Sbjct  277  SHAYKKRACPIDSLRLRISMLESIWKSFLGDRI-RQSGLSGFVEGKIKASTVVRFKIKVA  335

Query  412  RN  407
            R 
Sbjct  336  RG  337



>gb|EMS46425.1| hypothetical protein TRIUR3_01273 [Triticum urartu]
Length=281

 Score = 99.8 bits (247),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 67/199 (34%), Positives = 113/199 (57%), Gaps = 6/199 (3%)
 Frame = -2

Query  736  SQSSCLSLLPVRVRGSASVTVYRTKNPDASIRTSFLSRG-IVKLLPEKCYMGNVYRK--Q  566
            S S+C  LL +RV GS+   V    N         L+ G  ++LL ++  + ++  +   
Sbjct  83   SHSTCAPLLHMRVVGSSVTIVAHETNVSGGHMKPLLTSGDAIELLSDQSEVNDMSDRLIS  142

Query  565  SSVFDSLSQRVTSLENVLKSFLGGRTNRNTGLGL-KIRIKPSYIFRFQIELERNIRSNDT  389
            +  F S+S R+  LE +LK++   R   N  +   + R+    + +F++ELER+I   D 
Sbjct  143  ACAFCSISPRLPRLEKLLKTWFSERNGFNRTMNFFEARVTSMTLVKFRLELERDITEEDD  202

Query  388  YWSTLGEWRTRPAAERVWFEVVAGI-GSGFMKPFTIRKVRPFIEV-DslswsslmsniSF  215
             W  + EW+T P  +R+  +V+A +   G +K  +++KVR  +++ D+ SWSSL SN+SF
Sbjct  203  MWDDVPEWKTLPVVQRITLDVIARVEEEGRLKAISVKKVRKSLQIADATSWSSLTSNVSF  262

Query  214  TKFPSFLVPPEPLTLDVKW  158
              F S ++PP+PL+LDVKW
Sbjct  263  ADFTSLVLPPDPLSLDVKW  281



>dbj|BAK02011.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=430

 Score = 99.8 bits (247),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 65/199 (33%), Positives = 115/199 (58%), Gaps = 6/199 (3%)
 Frame = -2

Query  736  SQSSCLSLLPVRVRGSA-SVTVYRTKNPDASIRTSFLSRGIVKLLPEKCYMGNVYRK--Q  566
            S S+C  LL +R+ GS+ ++  + T      ++    S   ++LL ++  +  +  +   
Sbjct  232  SHSTCAPLLHMRIVGSSVTIVAHETNVSGGHMKPLLTSDDAIELLSDQAEVNEMSDRLIS  291

Query  565  SSVFDSLSQRVTSLENVLKSFLGGRTNRNTGLGL-KIRIKPSYIFRFQIELERNIRSNDT  389
            + VF S+S ++  LE +LK++   R   N  +   + R+    + +F++ELER+I   D 
Sbjct  292  ACVFCSISPKLPRLEELLKTWFNKRNEFNRTMNFFEARVTSMTLVKFRLELERDITEEDD  351

Query  388  YWSTLGEWRTRPAAERVWFEVVAGI-GSGFMKPFTIRKVRPFIEV-DslswsslmsniSF  215
             W  + EW+T P  +R+  +V+A +   G +K  +++KVR  +E+ D+ SWSSL SN+SF
Sbjct  352  IWDDVPEWKTLPVVQRITLDVIARVEEEGRLKAISVKKVRKSLEIADATSWSSLTSNVSF  411

Query  214  TKFPSFLVPPEPLTLDVKW  158
              F S ++PP+PL+LDVKW
Sbjct  412  ADFTSLVLPPDPLSLDVKW  430



>gb|EMT25813.1| hypothetical protein F775_05689 [Aegilops tauschii]
Length=320

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 65/199 (33%), Positives = 115/199 (58%), Gaps = 6/199 (3%)
 Frame = -2

Query  736  SQSSCLSLLPVRVRGSA-SVTVYRTKNPDASIRTSFLSRGIVKLLPEKCYMGNVYRK--Q  566
            S S+C  LL +RV GS+ ++  + T      ++    S   ++LL ++  + ++  +   
Sbjct  122  SHSTCAPLLHMRVVGSSVTIVAHETNVSGGHMKPLLTSDDAIELLSDQSEVSDMSDRLIS  181

Query  565  SSVFDSLSQRVTSLENVLKSFLGGRTNRNTGLGL-KIRIKPSYIFRFQIELERNIRSNDT  389
            +  F S+S R+  LE +LK++   R   N  +   + R+    + +F++ELER+I   D 
Sbjct  182  ACAFCSVSPRLPRLEKLLKTWFSERNGFNRTMNFFEARVTSMTLVKFRLELERDITEEDD  241

Query  388  YWSTLGEWRTRPAAERVWFEVVAGI-GSGFMKPFTIRKVRPFIEV-DslswsslmsniSF  215
             W  + EW+T P  +R+  +V+A +   G +K  +++KVR  +++ D+ SWSSL SN+SF
Sbjct  242  IWDDVPEWKTLPVVQRITLDVIARVEEEGRLKAISVKKVRKSLQIADATSWSSLTSNVSF  301

Query  214  TKFPSFLVPPEPLTLDVKW  158
              F S ++PP+PL+LDVKW
Sbjct  302  ADFTSLVLPPDPLSLDVKW  320



>gb|ADE77539.1| unknown [Picea sitchensis]
Length=421

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 53/118 (45%), Positives = 78/118 (66%), Gaps = 3/118 (3%)
 Frame = -2

Query  505  FLGGRTNRNTGLGL-KIRIKPSYIFRFQIELERNIRSNDTYWSTL-GEWRTRPAAERVWF  332
            +LG R  R     + +     S   + Q+ELE+ I SND++ S L   WRTRP  +R+ F
Sbjct  305  YLGNRAYREGSFRIIRASATASVFVKIQLELEKKI-SNDSFDSDLWPAWRTRPTVQRLHF  363

Query  331  EVVAGIGSGFMKPFTIRKVRPFIEVDslswsslmsniSFTKFPSFLVPPEPLTLDVKW  158
            EV+A +    +KP  I++++PF++V++ SWS+LMSN+SFT FPS L+P  PLTLDV+W
Sbjct  364  EVLARVEGKKLKPILIKRLKPFVKVETYSWSALMSNVSFTSFPSVLIPCSPLTLDVQW  421



>gb|ERN10146.1| hypothetical protein AMTR_s00169p00063630 [Amborella trichopoda]
Length=115

 Score = 69.7 bits (169),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/73 (51%), Positives = 46/73 (63%), Gaps = 1/73 (1%)
 Frame = +3

Query  156  HHLTSSVRGSGGTRKDGNFVKEMFDIKLLHDSESTSINGRTFLIVNGF-INPDPIPATTS  332
            +HLTS+VR S GT  DGN  KE+F ++LLH  ES   NG     + GF  +P    AT S
Sbjct  25   YHLTSNVRASEGTWLDGNLAKEVFPMRLLHARESALTNGLNLFKIKGFNCSPRSALATIS  84

Query  333  NQTRSAAGLVLHS  371
            NQ RS+ GLVLH+
Sbjct  85   NQARSSVGLVLHA  97



>gb|ERN16417.1| hypothetical protein AMTR_s00052p00153660 [Amborella trichopoda]
Length=103

 Score = 61.6 bits (148),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 43/71 (61%), Gaps = 1/71 (1%)
 Frame = -2

Query  463  KIRIKPSYIFRFQIELERNIRSNDTYWSTLGEWRTRPAAERVWFEVVA-GIGSGFMKPFT  287
            ++RI  S + +F +ELER++R   +       WRTRP  ER WFE+VA   G   +KP  
Sbjct  8    RMRIIASTLMKFHLELERDMREELSDVDASLAWRTRPTLERAWFEIVARAEGGEQLKPLI  67

Query  286  IRKVRPFIEVD  254
            ++K+RPF+  D
Sbjct  68   LKKLRPFVRAD  78



>gb|ABR16617.1| unknown [Picea sitchensis]
Length=427

 Score = 62.8 bits (151),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 50/200 (25%), Positives = 95/200 (48%), Gaps = 19/200 (10%)
 Frame = -2

Query  712  LPVRVRGSASVTVYRTKNPDAS---IRTSFLSRGIVKLLPEKCYMGNVYRKQSSV-----  557
            L +R+ G +S+       PD++   ++   L+ G V+L+  +    +    ++S+     
Sbjct  228  LSLRIVGPSSLVASSISEPDSASNRLKVKRLAPGSVELISRQQQEISPVSIEASIDSQEH  287

Query  556  ----------FDSLSQRVTSLENVLKSFLGGRTNRNTGLGL-KIRIKPSYIFRFQIELER  410
                       +S   ++   + +L+  LG    +     L K R   +   + Q ELER
Sbjct  288  NDMWMWPLPSLNSTHPKLKGFDELLREILGSSAQKEQSFKLLKARAAAATFVKVQFELER  347

Query  409  NIRSNDTYWSTLGEWRTRPAAERVWFEVVAGIGSGFMKPFTIRKVRPFIEVDslswsslm  230
             + S+     T  EWRT+P+ ER+ FE++A +    + P  ++++ P   V++ S  SL 
Sbjct  348  KLGSDMFSSETWPEWRTKPSIERLPFELIAKLEGDKLLPLNLQQIEPVKPVETYSARSLA  407

Query  229  sniSFTKFPSFLVPPEPLTL  170
             N++ +K P  L+PP P+TL
Sbjct  408  GNVTMSKVPIVLLPPSPMTL  427



>ref|XP_003589261.1| hypothetical protein MTR_1g021220 [Medicago truncatula]
 gb|AES59512.1| hypothetical protein MTR_1g021220 [Medicago truncatula]
Length=127

 Score = 53.5 bits (127),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 46/63 (73%), Gaps = 1/63 (2%)
 Frame = -2

Query  364  RTRPAAERVWFEVVAGIGSGFMKPFTIRKVRPFIEVDslswsslmsniSFTKFPSFLVPP  185
            +TRP  ERVWFE+ A I    +KP  I+KV+PFIE D +SW++LMSN+S+TKF   L PP
Sbjct  65   KTRPRVERVWFEIKARIEENRLKPLLIKKVKPFIESDLVSWANLMSNMSYTKFRPIL-PP  123

Query  184  EPL  176
            E L
Sbjct  124  EAL  126



>ref|NP_001130991.1| uncharacterized protein LOC100192096 [Zea mays]
 gb|ACF79408.1| unknown [Zea mays]
Length=277

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 43/168 (26%), Positives = 76/168 (45%), Gaps = 11/168 (7%)
 Frame = -2

Query  736  SQSSCLSLLPVRVRGSASVTVYRTKNPDASIRTSFLSRGIVKLLPEKCYMGNVYRKQSSV  557
            ++S+   LL +RV G  S++   + +P   ++   L+ G V+L  +   +  +   +   
Sbjct  78   ARSNQKPLLSLRVEGPVSLSSTPSMSPKDKLKLKRLAPGQVELSSQAGAIPAITEDEDEP  137

Query  556  FD-------SLSQRVTSL---ENVLKSFLGGRT-NRNTGLGLKIRIKPSYIFRFQIELER  410
             +       SL+    SL   E +L S LG +   + T   LK R       +    +E+
Sbjct  138  HNPGLWPLLSLNGSDGSLQGFEELLASVLGKKAGEKGTFKLLKARASAQTYVKMAFTVEK  197

Query  409  NIRSNDTYWSTLGEWRTRPAAERVWFEVVAGIGSGFMKPFTIRKVRPF  266
             +   D  WS + EW+T+P   R  +EV+A +  G   P  I +V+PF
Sbjct  198  KLAEGDVNWSNIPEWKTKPKRMRAHYEVLARVEEGQAIPERIAQVQPF  245



>ref|XP_008654278.1| PREDICTED: uncharacterized protein LOC100192096 isoform X1 [Zea 
mays]
 gb|ACR38231.1| unknown [Zea mays]
 gb|AFW84955.1| hypothetical protein ZEAMMB73_327303 [Zea mays]
Length=421

 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 43/168 (26%), Positives = 76/168 (45%), Gaps = 11/168 (7%)
 Frame = -2

Query  736  SQSSCLSLLPVRVRGSASVTVYRTKNPDASIRTSFLSRGIVKLLPEKCYMGNVYRKQSSV  557
            ++S+   LL +RV G  S++   + +P   ++   L+ G V+L  +   +  +   +   
Sbjct  222  ARSNQKPLLSLRVEGPVSLSSTPSMSPKDKLKLKRLAPGQVELSSQAGAIPAITEDEDEP  281

Query  556  FD-------SLSQRVTSL---ENVLKSFLGGRT-NRNTGLGLKIRIKPSYIFRFQIELER  410
             +       SL+    SL   E +L S LG +   + T   LK R       +    +E+
Sbjct  282  HNPGLWPLLSLNGSDGSLQGFEELLASVLGKKAGEKGTFKLLKARASAQTYVKMAFTVEK  341

Query  409  NIRSNDTYWSTLGEWRTRPAAERVWFEVVAGIGSGFMKPFTIRKVRPF  266
             +   D  WS + EW+T+P   R  +EV+A +  G   P  I +V+PF
Sbjct  342  KLAEGDVNWSNIPEWKTKPKRMRAHYEVLARVEEGQAIPERIAQVQPF  389



>gb|ACG32495.1| hypothetical protein [Zea mays]
Length=421

 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 43/168 (26%), Positives = 76/168 (45%), Gaps = 11/168 (7%)
 Frame = -2

Query  736  SQSSCLSLLPVRVRGSASVTVYRTKNPDASIRTSFLSRGIVKLLPEKCYMGNVYRKQSSV  557
            ++S+   LL +RV G  S++   + +P   ++   L+ G V+L  +   +  +   +   
Sbjct  222  ARSNQKPLLSLRVEGPVSLSSTPSMSPKDKLKLKRLAPGQVELSSQAGAIPAITEDEDEP  281

Query  556  FD-------SLSQRVTSL---ENVLKSFLGGRT-NRNTGLGLKIRIKPSYIFRFQIELER  410
             +       SL+    SL   E +L S LG +   + T   LK R       +    +E+
Sbjct  282  HNPGLWPLLSLNGSDGSLQGFEELLASVLGKKAGEKGTFKLLKARASAQTYVKMAFTVEK  341

Query  409  NIRSNDTYWSTLGEWRTRPAAERVWFEVVAGIGSGFMKPFTIRKVRPF  266
             +   D  WS + EW+T+P   R  +EV+A +  G   P  I +V+PF
Sbjct  342  KLAEGDVNWSNIPEWKTKPKRMRAHYEVLARVEEGQAIPERIAQVQPF  389



>ref|XP_004970094.1| PREDICTED: uncharacterized protein LOC101758677 [Setaria italica]
Length=421

 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 41/168 (24%), Positives = 74/168 (44%), Gaps = 11/168 (7%)
 Frame = -2

Query  736  SQSSCLSLLPVRVRGSASVTVYRTKNPDASIRTSFLSRGIVKLLPEKCYMGNVYRKQSSV  557
            ++S+   LL +R+ G  S++   +K+P+  ++   L+ G V+L      +  V   +   
Sbjct  222  ARSNQKPLLSLRIEGPTSLSSTPSKSPNDKLKLKRLAPGQVELSSRAGTIPAVTEDEDEP  281

Query  556  FDSLSQRVTSL----------ENVLKSFLGGRTNRNTGLGL-KIRIKPSYIFRFQIELER  410
             ++    + SL          E +L S LG +   N    L K R       +    +E+
Sbjct  282  HNTALWPLLSLNGSDGSLQGFEELLASVLGKKAGENGTFKLVKARASAQTYVKMAFAVEK  341

Query  409  NIRSNDTYWSTLGEWRTRPAAERVWFEVVAGIGSGFMKPFTIRKVRPF  266
             +   +T WS   EW+T+P   R  +EV+A +      P  I +V+PF
Sbjct  342  KLVKGETDWSNFPEWKTKPKNLRAHYEVLARVEGSQAIPERIAQVQPF  389



>ref|XP_012074540.1| PREDICTED: uncharacterized protein LOC105635994 [Jatropha curcas]
 gb|KDP35917.1| hypothetical protein JCGZ_09889 [Jatropha curcas]
Length=432

 Score = 54.3 bits (129),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 32/119 (27%), Positives = 59/119 (50%), Gaps = 1/119 (1%)
 Frame = -2

Query  523  ENVLKSFLGGRTNRNTGLGL-KIRIKPSYIFRFQIELERNIRSNDTYWSTLGEWRTRPAA  347
            E +L + LG R N+     L K  +      +    +E+ ++  D  W    EWRT+P +
Sbjct  314  EKLLAAVLGPRANKKGSFKLLKADVSAQTFVKIGFGVEKKLKEGDFDWQNFPEWRTKPES  373

Query  346  ERVWFEVVAGIGSGFMKPFTIRKVRPFIEVDslswsslmsniSFTKFPSFLVPPEPLTL  170
             R+ FEV+A +    + P  + +V P +  D+++ + L  N++ +K P+   P  P +L
Sbjct  374  VRMHFEVLAKVDGDKVVPERVMQVNPVVVEDTVASNVLQGNVTVSKIPTVHPPSNPFSL  432



>gb|EYU18363.1| hypothetical protein MIMGU_mgv1a009928mg [Erythranthe guttata]
Length=327

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 60/120 (50%), Gaps = 2/120 (2%)
 Frame = -2

Query  523  ENVLKSFLGGRTNRNTGLGL-KIRIKPSYIFRFQIELERNIRSNDTY-WSTLGEWRTRPA  350
            E +L S LG R ++     L K  +      +   ++E+ +R  D   +  L  WRT+P+
Sbjct  208  EQLLSSVLGRRADKAGSFKLLKADVSAQTFTKIGFQVEKKVREGDVIGFEGLPAWRTKPS  267

Query  349  AERVWFEVVAGIGSGFMKPFTIRKVRPFIEVDslswsslmsniSFTKFPSFLVPPEPLTL  170
              R+ FEV+A +    + P  + +V P I  DS++ S L+ N++ +K P    PP P  L
Sbjct  268  TVRMHFEVLAKVDGNKVVPERVVQVNPVIAEDSVAHSVLVGNVTMSKMPLVQQPPNPFAL  327



>dbj|BAB11418.1| unnamed protein product [Arabidopsis thaliana]
Length=163

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/119 (26%), Positives = 56/119 (47%), Gaps = 1/119 (1%)
 Frame = -2

Query  523  ENVLKSFLGGRTNRNTGLG-LKIRIKPSYIFRFQIELERNIRSNDTYWSTLGEWRTRPAA  347
            E +L S LG +         LK ++      +    +E+ ++  D    +  EWRT+P  
Sbjct  45   EKLLTSVLGPKAQEKGSFKVLKAKVAAQTFMKIGFGIEKKLKEADVEGLSFPEWRTKPET  104

Query  346  ERVWFEVVAGIGSGFMKPFTIRKVRPFIEVDslswsslmsniSFTKFPSFLVPPEPLTL  170
             R+ FEV+A +    + P  + +V P    D+++ + +  N++ +K P    PP P TL
Sbjct  105  MRMHFEVLAKVDGENVIPENVMRVDPIPLEDTIAQNVITGNVTMSKLPIIESPPSPFTL  163



>ref|XP_010936242.1| PREDICTED: uncharacterized protein LOC105055914 [Elaeis guineensis]
Length=406

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 55/216 (25%), Positives = 92/216 (43%), Gaps = 13/216 (6%)
 Frame = -2

Query  787  ARSGLFYGNAFTNMWSESQSSCLSLLPVRVRGSASVTVYRTKNPDASIRTSFLSRGIVKL  608
            A S L    A  N    ++   LSL   R+ G  S+T   + +P+  ++   L+ G+V+L
Sbjct  194  ASSLLTIAEALRNAARSNEKPILSL---RIVGPTSLTSSPSMSPNDKLKLKRLAPGLVEL  250

Query  607  LPEK--CYMGNVYRKQS------SVFDSLSQRVTSLENVLKSFLGGRTNRNTGLGL-KIR  455
                      +V   Q       +  +  S  +   E +L S LG +        L K  
Sbjct  251  SSRSVPAVSEDVQASQDPTLWPLTSLNGYSSNLRGFEELLASVLGKKGQEEGSFRLVKAE  310

Query  454  IKPSYIFRFQIELERNIRSNDTYWSTLGEWRTRPAAERVWFEVVAGI-GSGFMKPFTIRK  278
            +      + +  +ER++   +  WS   EW+TRP      FEV+A +  +G + P  I  
Sbjct  311  VAARTYVKMEFSVERSLLDGEVDWSGFPEWKTRPKKAMAHFEVLARVEDNGNVIPERIAA  370

Query  277  VRPFIEVDslswsslmsniSFTKFPSFLVPPEPLTL  170
            V+PF   DS+  S    N+S ++  +   PP+  TL
Sbjct  371  VQPFNVQDSVLGSVQTGNVSMSQVSAAYPPPDYFTL  406



>emb|CDY51296.1| BnaA06g23500D [Brassica napus]
Length=422

 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 33/119 (28%), Positives = 54/119 (45%), Gaps = 1/119 (1%)
 Frame = -2

Query  523  ENVLKSFLGGRTNRNTGLG-LKIRIKPSYIFRFQIELERNIRSNDTYWSTLGEWRTRPAA  347
            E +L S LG +         LK  +      +    +ER +R  D       EWRT+P  
Sbjct  304  EKLLTSVLGPKAQEEGSFKVLKADVAAQTFMKIGFGVERKLREGDLEGLNFPEWRTKPKT  363

Query  346  ERVWFEVVAGIGSGFMKPFTIRKVRPFIEVDslswsslmsniSFTKFPSFLVPPEPLTL  170
             R+ FEV+A +    + P  + +V P    D+++ + +  N++ +K P    PP P TL
Sbjct  364  MRMHFEVLAKVDGDKVVPENVMRVDPIPLEDTVAQNVITGNVTMSKLPIVQPPPSPFTL  422



>ref|XP_009150533.1| PREDICTED: uncharacterized protein LOC103873874 [Brassica rapa]
Length=433

 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 33/119 (28%), Positives = 54/119 (45%), Gaps = 1/119 (1%)
 Frame = -2

Query  523  ENVLKSFLGGRTNRNTGLG-LKIRIKPSYIFRFQIELERNIRSNDTYWSTLGEWRTRPAA  347
            E +L S LG +         LK  +      +    +ER +R  D       EWRT+P  
Sbjct  315  EKLLTSVLGPKAQEEGSFKVLKANVAAQTFMKIGFGVERKLREGDLEGLNFPEWRTKPKT  374

Query  346  ERVWFEVVAGIGSGFMKPFTIRKVRPFIEVDslswsslmsniSFTKFPSFLVPPEPLTL  170
             R+ FEV+A +    + P  + +V P    D+++ + +  N++ +K P    PP P TL
Sbjct  375  MRMHFEVLAKVDGDKVVPENVMRVDPIPLEDTVAQNVITGNVTMSKLPIVQPPPSPFTL  433



>ref|XP_008790404.1| PREDICTED: uncharacterized protein LOC103707624 [Phoenix dactylifera]
Length=406

 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 54/215 (25%), Positives = 93/215 (43%), Gaps = 14/215 (7%)
 Frame = -2

Query  781  SGLF-YGNAFTNMWSESQSSCLSLLPVRVRGSASVTVYRTKNPDASIRTSFLSRGIVKL-  608
            SGL     A  N    ++   LSL   R+ G  S+T   + +P+  ++   L+ G+V+L 
Sbjct  195  SGLLTIAEALLNAARSNEKPILSL---RIVGPTSLTSSPSMSPNEKLKLKRLAPGLVELS  251

Query  607  ---LPEKCYMGNVYRKQS----SVFDSLSQRVTSLENVLKSFLGGRTNRNTGLGL-KIRI  452
               +P         +  +    +  +  S  +   E +L S LG +        L +  +
Sbjct  252  SRSVPAVSEDAQASQNPTLWPLTSLNGSSSNLRGFEELLASVLGKKGQEEGSFRLVRAEV  311

Query  451  KPSYIFRFQIELERNIRSNDTYWSTLGEWRTRPAAERVWFEVVAGI-GSGFMKPFTIRKV  275
                  +    +ER++   +  WS L EW+TRP      FEV+A +  +G + P  I  V
Sbjct  312  AARTYVKMGFSVERSLLDGEVDWSGLPEWKTRPKMAMAHFEVLARVEDNGNVIPERIAAV  371

Query  274  RPFIEVDslswsslmsniSFTKFPSFLVPPEPLTL  170
            +PF   DS+  S    N+S ++  +   PP+  TL
Sbjct  372  QPFNMQDSVLRSVQTGNVSMSQVSAAYPPPDYFTL  406



>gb|AGT17294.1| hypothetical protein SHCRBa_168_J15_R_140 [Saccharum hybrid cultivar 
R570]
Length=422

 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 39/168 (23%), Positives = 72/168 (43%), Gaps = 11/168 (7%)
 Frame = -2

Query  736  SQSSCLSLLPVRVRGSASVTVYRTKNPDASIRTSFLSRGIVKLLPEKCYMGNVYRKQSSV  557
            ++S+   LL +R+ G  S++   + +P   ++   L  G V+L      +  +   +   
Sbjct  223  ARSNQKPLLSLRIEGPTSLSSTPSMSPKDKLKLKRLGPGQVELSSRAGAIPAIADDEDEP  282

Query  556  FDSLSQRVTSL----------ENVLKSFLGGRTNRNTGLGL-KIRIKPSYIFRFQIELER  410
             +S    + SL          E +L S LG +  +     L K R       +    +E+
Sbjct  283  HNSGLWPLLSLNGSDGSLQGFEELLASVLGKKAGKKGTFKLLKARASAQTYVKMAFAVEK  342

Query  409  NIRSNDTYWSTLGEWRTRPAAERVWFEVVAGIGSGFMKPFTIRKVRPF  266
             +   +  WS + EW+T+P   R  +EV+A +  G   P  I +V+PF
Sbjct  343  KLAEGEVNWSNIPEWKTKPKRLRAHYEVLARVEEGQAIPERIAQVQPF  390



>ref|XP_002964757.1| hypothetical protein SELMODRAFT_270469 [Selaginella moellendorffii]
 gb|EFJ33595.1| hypothetical protein SELMODRAFT_270469 [Selaginella moellendorffii]
Length=408

 Score = 50.1 bits (118),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 39/127 (31%), Positives = 60/127 (47%), Gaps = 6/127 (5%)
 Frame = -2

Query  529  SLENVLKSFLGGRTNRNTGLGL-KIRIKPSYIFRFQIELERNIRSNDTYWSTLGEWRTRP  353
            SLE  LK  LG   +R     L + +   +   + + ELE+ +  +D     L EW TRP
Sbjct  285  SLEQALKLLLGPSAHRPGSFSLLRAKAAAAKFVKVEFELEKRLDGDD---DALPEWATRP  341

Query  352  AAERVWFEVVAGIGSGFMKPFTIRKVR--PFIEVDslswsslmsniSFTKFPSFLVPPEP  179
              +R+ FEV++ I    + P ++R +   P     S  + S  +    +   +FL P  P
Sbjct  342  TIQRLQFEVLSKIDGDKVIPMSVRPLETYPSATTASFDFFSGNTTSLESMASTFLPPVSP  401

Query  178  LTLDVKW  158
            LTLDV W
Sbjct  402  LTLDVSW  408



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1586636554460