BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig11204

Length=740
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_002515304.1|  triacylglycerol lipase, putative                   158   1e-40   Ricinus communis
gb|KJB41837.1|  hypothetical protein B456_007G123600                    157   4e-40   Gossypium raimondii
gb|KDO87040.1|  hypothetical protein CISIN_1g004536mg                   156   4e-40   Citrus sinensis [apfelsine]
gb|KDO87039.1|  hypothetical protein CISIN_1g004536mg                   156   5e-40   Citrus sinensis [apfelsine]
ref|XP_006444465.1|  hypothetical protein CICLE_v10018997mg             156   6e-40   Citrus clementina [clementine]
ref|XP_002270132.1|  PREDICTED: uncharacterized protein LOC100267577    155   7e-40   Vitis vinifera
ref|XP_009594997.1|  PREDICTED: uncharacterized protein LOC104091376    155   9e-40   Nicotiana tomentosiformis
emb|CAN73724.1|  hypothetical protein VITISV_016652                     155   1e-39   Vitis vinifera
ref|XP_009788474.1|  PREDICTED: uncharacterized protein LOC104236281    154   4e-39   Nicotiana sylvestris
ref|XP_012082872.1|  PREDICTED: uncharacterized protein LOC105642604    152   2e-38   Jatropha curcas
ref|XP_004229404.1|  PREDICTED: uncharacterized protein LOC101246...    152   2e-38   Solanum lycopersicum
ref|XP_010322462.1|  PREDICTED: uncharacterized protein LOC101246...    152   3e-38   Solanum lycopersicum
ref|XP_006349202.1|  PREDICTED: uncharacterized protein LOC102604741    150   1e-37   Solanum tuberosum [potatoes]
ref|XP_006386721.1|  hypothetical protein POPTR_0002s19900g             149   1e-37   
ref|XP_011042227.1|  PREDICTED: uncharacterized protein LOC105137961    149   2e-37   Populus euphratica
ref|XP_007051072.1|  Alpha/beta-Hydrolases superfamily protein          149   4e-37   
ref|XP_008451496.1|  PREDICTED: uncharacterized protein LOC103492768    148   5e-37   Cucumis melo [Oriental melon]
ref|XP_011659388.1|  PREDICTED: uncharacterized protein LOC101220023    148   7e-37   Cucumis sativus [cucumbers]
gb|KGN45002.1|  hypothetical protein Csa_7G407550                       148   7e-37   Cucumis sativus [cucumbers]
ref|XP_003535965.1|  PREDICTED: uncharacterized protein LOC100786628    147   1e-36   Glycine max [soybeans]
ref|XP_007145162.1|  hypothetical protein PHAVU_007G215600g             146   1e-36   Phaseolus vulgaris [French bean]
ref|XP_009339790.1|  PREDICTED: uncharacterized protein LOC103931984    147   2e-36   Pyrus x bretschneideri [bai li]
ref|XP_010069869.1|  PREDICTED: uncharacterized protein LOC104456712    144   2e-35   Eucalyptus grandis [rose gum]
ref|XP_006418320.1|  hypothetical protein EUTSA_v10006955mg             142   5e-35   
ref|XP_009378693.1|  PREDICTED: uncharacterized protein LOC103967...    141   1e-34   Pyrus x bretschneideri [bai li]
ref|XP_009378692.1|  PREDICTED: uncharacterized protein LOC103967...    141   2e-34   Pyrus x bretschneideri [bai li]
ref|XP_003591428.1|  Lipase                                             140   3e-34   
emb|CDP17086.1|  unnamed protein product                                139   9e-34   Coffea canephora [robusta coffee]
ref|XP_004300465.1|  PREDICTED: uncharacterized protein LOC101303332    139   1e-33   Fragaria vesca subsp. vesca
ref|XP_007200310.1|  hypothetical protein PRUPE_ppa001821mg             139   1e-33   Prunus persica
ref|XP_008235187.1|  PREDICTED: uncharacterized protein LOC103334...    139   1e-33   Prunus mume [ume]
gb|KHF99200.1|  hypothetical protein F383_17206                         138   2e-33   Gossypium arboreum [tree cotton]
ref|XP_010259358.1|  PREDICTED: uncharacterized protein LOC104598821    138   3e-33   Nelumbo nucifera [Indian lotus]
ref|XP_010679351.1|  PREDICTED: uncharacterized protein LOC104894743    137   3e-33   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008781074.1|  PREDICTED: uncharacterized protein LOC103700...    137   3e-33   Phoenix dactylifera
gb|KHN08648.1|  Proteasome subunit alpha type-5                         137   4e-33   Glycine soja [wild soybean]
ref|XP_010268036.1|  PREDICTED: uncharacterized protein LOC104605112    136   8e-33   Nelumbo nucifera [Indian lotus]
ref|XP_011079576.1|  PREDICTED: uncharacterized protein LOC105163...    136   1e-32   Sesamum indicum [beniseed]
ref|XP_011079577.1|  PREDICTED: uncharacterized protein LOC105163...    136   1e-32   Sesamum indicum [beniseed]
ref|XP_011079575.1|  PREDICTED: uncharacterized protein LOC105163...    136   1e-32   Sesamum indicum [beniseed]
ref|XP_010556701.1|  PREDICTED: uncharacterized protein LOC104825944    135   2e-32   Tarenaya hassleriana [spider flower]
ref|XP_008369058.1|  PREDICTED: uncharacterized protein LOC103432...    135   2e-32   
gb|KHN30650.1|  Proteasome subunit alpha type-5                         136   2e-32   Glycine soja [wild soybean]
ref|XP_008386733.1|  PREDICTED: uncharacterized protein LOC103449224    135   3e-32   
ref|XP_008369057.1|  PREDICTED: uncharacterized protein LOC103432...    135   3e-32   
emb|CDY51303.1|  BnaCnng20480D                                          134   3e-32   Brassica napus [oilseed rape]
dbj|BAH20392.1|  AT1G02660                                              132   7e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010474677.1|  PREDICTED: uncharacterized protein LOC104754237    133   1e-31   Camelina sativa [gold-of-pleasure]
ref|XP_010457251.1|  PREDICTED: uncharacterized protein LOC104738747    133   1e-31   Camelina sativa [gold-of-pleasure]
ref|XP_010481144.1|  PREDICTED: uncharacterized protein LOC104759980    132   2e-31   Camelina sativa [gold-of-pleasure]
ref|XP_010921525.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    132   2e-31   
ref|XP_004494932.1|  PREDICTED: uncharacterized protein LOC101493817    132   2e-31   Cicer arietinum [garbanzo]
emb|CBI36930.3|  unnamed protein product                                131   2e-31   Vitis vinifera
gb|AAG10634.1|AC022521_12  Hypothetical protein                         131   3e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007163165.1|  hypothetical protein PHAVU_001G211900g             131   4e-31   Phaseolus vulgaris [French bean]
ref|NP_563660.1|  alpha/beta-Hydrolases superfamily protein             131   4e-31   Arabidopsis thaliana [mouse-ear cress]
gb|AAM98103.1|  At1g02660/T14P4_9                                       130   8e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002892116.1|  lipase class 3 family protein                      130   8e-31   Arabidopsis lyrata subsp. lyrata
ref|XP_010522821.1|  PREDICTED: uncharacterized protein LOC104801300    130   9e-31   Tarenaya hassleriana [spider flower]
gb|EYU46796.1|  hypothetical protein MIMGU_mgv1a002033mg                130   9e-31   Erythranthe guttata [common monkey flower]
ref|XP_003520748.1|  PREDICTED: uncharacterized protein LOC100788786    130   1e-30   Glycine max [soybeans]
ref|XP_010095302.1|  hypothetical protein L484_001911                   130   1e-30   
gb|AAK82508.1|  At1g02660/T14P4_9                                       130   2e-30   Arabidopsis thaliana [mouse-ear cress]
gb|KHN43471.1|  Lipase                                                  129   2e-30   Glycine soja [wild soybean]
ref|XP_006303577.1|  hypothetical protein CARUB_v10011093mg             129   3e-30   Capsella rubella
emb|CDY37466.1|  BnaC08g46040D                                          129   3e-30   Brassica napus [oilseed rape]
ref|XP_002301502.2|  hypothetical protein POPTR_0002s19900g             128   4e-30   
emb|CDY32473.1|  BnaA09g51230D                                          128   7e-30   Brassica napus [oilseed rape]
ref|XP_009118752.1|  PREDICTED: uncharacterized protein LOC103843744    127   8e-30   Brassica rapa
ref|XP_009111236.1|  PREDICTED: uncharacterized protein LOC103836694    125   4e-29   Brassica rapa
ref|XP_009401631.1|  PREDICTED: uncharacterized protein LOC103985608    125   7e-29   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003625952.1|  Triacylglycerol lipase                             124   1e-28   
gb|KJB24401.1|  hypothetical protein B456_004G143700                    124   2e-28   Gossypium raimondii
gb|KHN19225.1|  DNA-directed RNA polymerase III subunit RPC8            122   1e-27   Glycine soja [wild soybean]
ref|XP_010938308.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    120   4e-27   
ref|XP_008786228.1|  PREDICTED: uncharacterized protein LOC103704640    118   2e-26   
ref|XP_010556704.1|  PREDICTED: uncharacterized protein LOC104825945    117   3e-26   Tarenaya hassleriana [spider flower]
gb|KFK42621.1|  hypothetical protein AALP_AA1G019100                    117   5e-26   Arabis alpina [alpine rockcress]
emb|CDY15436.1|  BnaA08g27200D                                          112   1e-24   Brassica napus [oilseed rape]
ref|XP_009382508.1|  PREDICTED: uncharacterized protein LOC103970453    103   3e-21   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011627460.1|  PREDICTED: uncharacterized protein LOC18445098     102   9e-21   
gb|ERN16773.1|  hypothetical protein AMTR_s00057p00060720               102   1e-20   Amborella trichopoda
ref|XP_010559192.1|  PREDICTED: uncharacterized protein LOC104827671  92.8    8e-18   Tarenaya hassleriana [spider flower]
ref|XP_010468944.1|  PREDICTED: uncharacterized protein LOC104749064  91.7    2e-17   Camelina sativa [gold-of-pleasure]
ref|XP_010413272.1|  PREDICTED: uncharacterized protein LOC104699...  91.7    2e-17   Camelina sativa [gold-of-pleasure]
ref|XP_010512645.1|  PREDICTED: uncharacterized protein LOC104788...  91.3    2e-17   Camelina sativa [gold-of-pleasure]
ref|XP_010413273.1|  PREDICTED: uncharacterized protein LOC104699...  91.3    3e-17   
ref|XP_006402367.1|  hypothetical protein EUTSA_v10005837mg           90.9    3e-17   Eutrema salsugineum [saltwater cress]
emb|CDY11429.1|  BnaA09g39950D                                        90.5    4e-17   Brassica napus [oilseed rape]
gb|KFK35428.1|  hypothetical protein AALP_AA5G283200                  90.5    5e-17   Arabis alpina [alpine rockcress]
ref|XP_006292839.1|  hypothetical protein CARUB_v10019099mg           90.5    5e-17   Capsella rubella
ref|XP_002878465.1|  hypothetical protein ARALYDRAFT_486759           90.1    6e-17   
ref|XP_009116919.1|  PREDICTED: uncharacterized protein LOC103842065  89.4    1e-16   Brassica rapa
emb|CDX76645.1|  BnaC08g32310D                                        89.0    1e-16   
emb|CAB83109.1|  putative protein                                     88.6    2e-16   Arabidopsis thaliana [mouse-ear cress]
ref|NP_567131.1|  alpha/beta-Hydrolases superfamily protein           88.2    3e-16   Arabidopsis thaliana [mouse-ear cress]
gb|EPS63237.1|  hypothetical protein M569_11546                       87.0    7e-16   Genlisea aurea
ref|XP_002990898.1|  hypothetical protein SELMODRAFT_132592           80.9    6e-14   
ref|XP_002982750.1|  hypothetical protein SELMODRAFT_117344           80.9    7e-14   
gb|ERN00304.1|  hypothetical protein AMTR_s00107p00100130             73.2    9e-13   Amborella trichopoda
ref|XP_011023199.1|  PREDICTED: uncharacterized protein LOC105124775  76.3    2e-12   Populus euphratica
ref|XP_009599265.1|  PREDICTED: uncharacterized protein LOC104094946  75.5    4e-12   Nicotiana tomentosiformis
ref|XP_009757087.1|  PREDICTED: uncharacterized protein LOC104210001  75.5    4e-12   Nicotiana sylvestris
ref|XP_002301404.2|  hypothetical protein POPTR_0002s17080g           74.7    7e-12   
ref|XP_011621237.1|  PREDICTED: uncharacterized protein LOC18428351   73.2    2e-11   Amborella trichopoda
ref|NP_001148192.1|  triacylglycerol lipase                           73.2    2e-11   Zea mays [maize]
ref|XP_009336804.1|  PREDICTED: uncharacterized protein LOC103929339  72.8    3e-11   
ref|XP_008347164.1|  PREDICTED: uncharacterized protein LOC103410201  72.4    4e-11   
ref|XP_004231212.1|  PREDICTED: uncharacterized protein LOC101245704  72.4    5e-11   Solanum lycopersicum
ref|XP_008362652.1|  PREDICTED: uncharacterized protein LOC103426336  72.0    6e-11   
ref|XP_006339692.1|  PREDICTED: uncharacterized protein LOC102605002  71.2    1e-10   Solanum tuberosum [potatoes]
ref|XP_010913778.1|  PREDICTED: uncharacterized protein LOC105039341  70.9    1e-10   Elaeis guineensis
ref|XP_004967838.1|  PREDICTED: uncharacterized protein LOC101767065  70.5    2e-10   Setaria italica
ref|XP_008388317.1|  PREDICTED: uncharacterized protein LOC103450723  69.3    2e-10   
ref|XP_008233196.1|  PREDICTED: uncharacterized protein LOC103332249  70.1    2e-10   Prunus mume [ume]
ref|XP_007220034.1|  hypothetical protein PRUPE_ppa1027212mg          70.1    3e-10   
ref|XP_012083231.1|  PREDICTED: uncharacterized protein LOC105642864  69.7    3e-10   Jatropha curcas
ref|XP_004306685.1|  PREDICTED: uncharacterized protein LOC101293815  69.7    3e-10   Fragaria vesca subsp. vesca
ref|XP_011093043.1|  PREDICTED: uncharacterized protein LOC105173091  69.7    3e-10   Sesamum indicum [beniseed]
ref|XP_002440651.1|  hypothetical protein SORBIDRAFT_09g004600        69.7    3e-10   
ref|XP_001766893.1|  predicted protein                                68.9    4e-10   
ref|NP_001042614.1|  Os01g0253900                                     68.9    5e-10   
dbj|BAJ85142.1|  predicted protein                                    68.9    5e-10   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDX89128.1|  BnaA04g00580D                                        68.9    5e-10   
ref|XP_009138759.1|  PREDICTED: uncharacterized protein LOC103862815  68.9    5e-10   Brassica rapa
dbj|BAD81066.1|  unknown protein                                      68.9    5e-10   Oryza sativa Japonica Group [Japonica rice]
gb|EMS46877.1|  Lipase                                                68.6    6e-10   Triticum urartu
gb|EAY73336.1|  hypothetical protein OsI_01214                        68.9    6e-10   Oryza sativa Indica Group [Indian rice]
gb|EAZ11278.1|  hypothetical protein OsJ_01132                        68.9    6e-10   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004494809.1|  PREDICTED: uncharacterized protein LOC101506...  68.6    7e-10   
ref|XP_009393084.1|  PREDICTED: uncharacterized protein LOC103978863  68.6    7e-10   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003626565.1|  hypothetical protein MTR_7g117280                68.6    7e-10   Medicago truncatula
ref|XP_004494811.1|  PREDICTED: uncharacterized protein LOC101506...  68.6    7e-10   Cicer arietinum [garbanzo]
gb|KHN43106.1|  hypothetical protein glysoja_001689                   68.6    8e-10   Glycine soja [wild soybean]
gb|EYU38899.1|  hypothetical protein MIMGU_mgv1a002410mg              68.6    8e-10   Erythranthe guttata [common monkey flower]
ref|XP_001757678.1|  predicted protein                                68.6    9e-10   
ref|XP_007051578.1|  Alpha/beta-Hydrolases superfamily protein        68.2    9e-10   
gb|KHN35374.1|  hypothetical protein glysoja_029004                   68.2    9e-10   Glycine soja [wild soybean]
ref|XP_006402456.1|  hypothetical protein EUTSA_v10005828mg           68.2    1e-09   Eutrema salsugineum [saltwater cress]
ref|XP_002523367.1|  triacylglycerol lipase, putative                 68.2    1e-09   
ref|XP_003565598.1|  PREDICTED: uncharacterized protein LOC100836436  67.8    1e-09   Brachypodium distachyon [annual false brome]
ref|XP_010668971.1|  PREDICTED: uncharacterized protein LOC104886129  67.8    1e-09   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002320194.2|  hypothetical protein POPTR_0014s09290g           67.4    2e-09   
ref|XP_010413364.1|  PREDICTED: uncharacterized protein LOC104699719  67.4    2e-09   Camelina sativa [gold-of-pleasure]
ref|XP_008791495.1|  PREDICTED: uncharacterized protein LOC103708378  67.4    2e-09   
ref|XP_011037995.1|  PREDICTED: uncharacterized protein LOC105135020  67.0    2e-09   Populus euphratica
ref|XP_010095782.1|  hypothetical protein L484_017589                 66.6    3e-09   Morus notabilis
ref|XP_010512533.1|  PREDICTED: uncharacterized protein LOC104788472  66.6    3e-09   Camelina sativa [gold-of-pleasure]
ref|XP_004969185.1|  PREDICTED: uncharacterized protein LOC101774889  66.6    3e-09   
ref|NP_191727.2|  lipase class 3 family protein                       66.6    3e-09   Arabidopsis thaliana [mouse-ear cress]
emb|CAB71098.1|  putative protein                                     66.6    3e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002876633.1|  hypothetical protein ARALYDRAFT_486656           66.6    3e-09   
ref|XP_006645720.1|  PREDICTED: uncharacterized protein LOC102715257  66.6    3e-09   
gb|KHF99816.1|  Lipase                                                66.6    3e-09   Gossypium arboreum [tree cotton]
gb|KGN44530.1|  hypothetical protein Csa_7G325710                     66.6    3e-09   Cucumis sativus [cucumbers]
ref|XP_004139735.1|  PREDICTED: uncharacterized protein LOC101208871  66.6    4e-09   Cucumis sativus [cucumbers]
ref|XP_011466435.1|  PREDICTED: uncharacterized protein LOC101303...  66.2    4e-09   Fragaria vesca subsp. vesca
ref|XP_011466434.1|  PREDICTED: uncharacterized protein LOC101303...  65.9    4e-09   Fragaria vesca subsp. vesca
ref|XP_008778442.1|  PREDICTED: uncharacterized protein LOC103698...  66.2    5e-09   Phoenix dactylifera
ref|XP_001777743.1|  predicted protein                                66.2    5e-09   
emb|CAN64332.1|  hypothetical protein VITISV_014668                   65.9    5e-09   Vitis vinifera
ref|XP_010661904.1|  PREDICTED: uncharacterized protein LOC100256908  65.9    5e-09   Vitis vinifera
gb|ADY38373.1|  triacylglycerol lipase 1                              65.9    5e-09   Arachis hypogaea [goober]
ref|XP_010053809.1|  PREDICTED: uncharacterized protein LOC104442170  65.9    5e-09   
emb|CBI40502.3|  unnamed protein product                              65.9    6e-09   Vitis vinifera
ref|XP_008461523.1|  PREDICTED: uncharacterized protein LOC103500094  65.9    6e-09   Cucumis melo [Oriental melon]
ref|XP_002455384.1|  hypothetical protein SORBIDRAFT_03g009750        65.9    6e-09   
ref|XP_010925181.1|  PREDICTED: uncharacterized protein LOC105047792  65.5    6e-09   
emb|CDP08695.1|  unnamed protein product                              65.5    7e-09   Coffea canephora [robusta coffee]
ref|XP_006292392.1|  hypothetical protein CARUB_v10018605mg           65.5    8e-09   Capsella rubella
ref|XP_007208002.1|  hypothetical protein PRUPE_ppa014662mg           65.1    9e-09   
gb|AFW79680.1|  hypothetical protein ZEAMMB73_210781                  65.1    1e-08   
ref|NP_001169446.1|  uncharacterized protein LOC100383317             65.1    1e-08   Zea mays [maize]
emb|CDY43945.1|  BnaC04g21650D                                        64.7    1e-08   Brassica napus [oilseed rape]
ref|XP_010469109.1|  PREDICTED: uncharacterized protein LOC104749219  64.3    2e-08   Camelina sativa [gold-of-pleasure]
ref|XP_007147296.1|  hypothetical protein PHAVU_006G112000g           64.3    2e-08   Phaseolus vulgaris [French bean]
ref|XP_009412375.1|  PREDICTED: uncharacterized protein LOC103993...  63.9    2e-08   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_001756666.1|  predicted protein                                63.9    2e-08   
ref|XP_009412376.1|  PREDICTED: uncharacterized protein LOC103993...  63.9    2e-08   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB49533.1|  hypothetical protein B456_008G124400                  63.5    3e-08   Gossypium raimondii
gb|KHG25824.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase  63.5    4e-08   Gossypium arboreum [tree cotton]
tpg|DAA58548.1|  TPA: hypothetical protein ZEAMMB73_663476            62.8    4e-08   
ref|XP_008673392.1|  PREDICTED: uncharacterized protein LOC100502...  62.8    6e-08   
gb|KJB73117.1|  hypothetical protein B456_011G215900                  62.0    6e-08   Gossypium raimondii
gb|KJB73119.1|  hypothetical protein B456_011G215900                  62.4    7e-08   Gossypium raimondii
tpg|DAA58549.1|  TPA: hypothetical protein ZEAMMB73_663476            62.4    7e-08   
ref|XP_008245443.1|  PREDICTED: uncharacterized protein LOC103343559  62.0    9e-08   Prunus mume [ume]
ref|XP_002455964.1|  hypothetical protein SORBIDRAFT_03g028110        62.0    1e-07   
gb|KJB41502.1|  hypothetical protein B456_007G107600                  58.9    1e-07   Gossypium raimondii
ref|XP_010233458.1|  PREDICTED: uncharacterized protein LOC100845988  62.0    1e-07   
ref|NP_001172466.1|  Os01g0618600                                     60.1    2e-07   
ref|XP_006446427.1|  hypothetical protein CICLE_v10018154mg           60.8    3e-07   Citrus clementina [clementine]
gb|KDO66297.1|  hypothetical protein CISIN_1g036393mg                 60.8    3e-07   Citrus sinensis [apfelsine]
ref|XP_006470405.1|  PREDICTED: uncharacterized protein LOC102614...  60.8    3e-07   Citrus sinensis [apfelsine]
ref|XP_001777284.1|  predicted protein                                60.5    3e-07   
ref|XP_010261536.1|  PREDICTED: uncharacterized protein LOC104600...  60.5    4e-07   Nelumbo nucifera [Indian lotus]
dbj|BAD61517.1|  lipase class 3 family protein-like                   60.1    4e-07   Oryza sativa Japonica Group [Japonica rice]
gb|EEC71102.1|  hypothetical protein OsI_02886                        60.1    4e-07   Oryza sativa Indica Group [Indian rice]
ref|XP_010261535.1|  PREDICTED: uncharacterized protein LOC104600...  60.1    5e-07   
emb|CDM83423.1|  unnamed protein product                              60.1    5e-07   Triticum aestivum [Canadian hard winter wheat]
gb|EAZ12713.1|  hypothetical protein OsJ_02630                        60.1    5e-07   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010523802.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  60.1    5e-07   Tarenaya hassleriana [spider flower]
ref|NP_001159209.1|  uncharacterized protein LOC100304295             58.5    1e-06   
ref|XP_008655146.1|  PREDICTED: uncharacterized protein LOC100304...  58.5    1e-06   
gb|AFW83289.1|  hypothetical protein ZEAMMB73_987353                  58.5    1e-06   
gb|EMS48583.1|  Lipase                                                56.6    6e-06   Triticum urartu
gb|KHN06299.1|  Lipase                                                56.6    7e-06   Glycine soja [wild soybean]
ref|XP_003529894.1|  PREDICTED: uncharacterized protein LOC100796262  56.2    8e-06   Glycine max [soybeans]
ref|XP_007135241.1|  hypothetical protein PHAVU_010G112600g           55.1    2e-05   Phaseolus vulgaris [French bean]
gb|KHG01400.1|  hypothetical protein F383_21677                       51.6    2e-04   Gossypium arboreum [tree cotton]



>ref|XP_002515304.1| triacylglycerol lipase, putative [Ricinus communis]
 gb|EEF47288.1| triacylglycerol lipase, putative [Ricinus communis]
Length=727

 Score =   158 bits (399),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 88/156 (56%), Positives = 115/156 (74%), Gaps = 7/156 (4%)
 Frame = -2

Query  733  PVTDDDDAEKRILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHV  554
            P++D +DAEK + AA++ FLNSPHPLEILSDRSAYGS GTIQRDHDM SYLKSVR +I  
Sbjct  572  PLSDANDAEKLLRAAQSVFLNSPHPLEILSDRSAYGSEGTIQRDHDMNSYLKSVRSVIRQ  631

Query  553  ELSRIRKSKRES----WWPLIVIPGVKAADIFVGR--LVRPTGQGQFTFAGMFHSGKESL  392
            EL+RIRKSKRE+    WW ++   G+    + + R  +    GQ QF F+G+ H+G+ES 
Sbjct  632  ELNRIRKSKRENRRKFWWSILAPRGIAGGGVLMERPLVSNNMGQSQFNFSGVLHTGRESF  691

Query  391  KRFT-VVAAQHMHlflmfllpapllmLRAFNVIIFR  287
            KRF+ +VA+QHMHL ++ L PA LL+L A++VI  R
Sbjct  692  KRFSRLVASQHMHLLVVLLFPARLLLLGAYSVINIR  727



>gb|KJB41837.1| hypothetical protein B456_007G123600 [Gossypium raimondii]
Length=748

 Score =   157 bits (396),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 91/155 (59%), Positives = 113/155 (73%), Gaps = 7/155 (5%)
 Frame = -2

Query  730  VTDDDDAEKRILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHVE  551
            V+D+D  EK +LAA+    NSPHPLEILSDRSAYGS GTIQRDHDM SYLK VR +I  E
Sbjct  594  VSDNDSEEKLLLAAQRVLFNSPHPLEILSDRSAYGSEGTIQRDHDMNSYLKCVRGVIRQE  653

Query  550  LSRIRKSKRES----WWPLIVIPGVKAADIFVGRLVRP--TGQGQFTFAGMFHSGKESLK  389
            L RIRK+KRE     WWPL++   + A  I +GR V     GQ QF FAG+  +G+ESLK
Sbjct  654  LKRIRKTKREQRRKIWWPLVLPHDINAGGIILGRSVATMNAGQDQFNFAGVLQTGRESLK  713

Query  388  RFT-VVAAQHMHlflmfllpapllmLRAFNVIIFR  287
            RF+ +VA+QHMHLF++ LLPA LL++ AF++I  R
Sbjct  714  RFSRLVASQHMHLFVVLLLPAKLLLVGAFSLISLR  748



>gb|KDO87040.1| hypothetical protein CISIN_1g004536mg [Citrus sinensis]
Length=708

 Score =   156 bits (395),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 88/153 (58%), Positives = 115/153 (75%), Gaps = 9/153 (6%)
 Frame = -2

Query  718  DDAEKRILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHVELSRI  539
            D+AEK++ AA+  FLNSPHPLEILSDRSAYGS GTIQRDHDM SYL+SV+ +I +EL+R+
Sbjct  556  DEAEKQLRAAQMVFLNSPHPLEILSDRSAYGSEGTIQRDHDMNSYLRSVQSVIRLELNRM  615

Query  538  RKSKRES----WWPLIVIPGVKAADIFVGRLVRP----TGQGQFTFAGMFHSGKESLKRF  383
            RK+KR+     WWPL++  G  A  I VGR V       GQ QF F+G+ H+G+E+LKRF
Sbjct  616  RKAKRDHRRKFWWPLVLPHGTDAGGIIVGRPVASFNLGMGQDQFNFSGIVHAGRENLKRF  675

Query  382  T-VVAAQHMHlflmfllpapllmLRAFNVIIFR  287
              +VA+QHMHL ++ + PA LL+L A++VI FR
Sbjct  676  GRLVASQHMHLLVVLMFPARLLLLGAYSVINFR  708



>gb|KDO87039.1| hypothetical protein CISIN_1g004536mg [Citrus sinensis]
Length=726

 Score =   156 bits (395),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 88/153 (58%), Positives = 115/153 (75%), Gaps = 9/153 (6%)
 Frame = -2

Query  718  DDAEKRILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHVELSRI  539
            D+AEK++ AA+  FLNSPHPLEILSDRSAYGS GTIQRDHDM SYL+SV+ +I +EL+R+
Sbjct  574  DEAEKQLRAAQMVFLNSPHPLEILSDRSAYGSEGTIQRDHDMNSYLRSVQSVIRLELNRM  633

Query  538  RKSKRES----WWPLIVIPGVKAADIFVGRLVRP----TGQGQFTFAGMFHSGKESLKRF  383
            RK+KR+     WWPL++  G  A  I VGR V       GQ QF F+G+ H+G+E+LKRF
Sbjct  634  RKAKRDHRRKFWWPLVLPHGTDAGGIIVGRPVASFNLGMGQDQFNFSGIVHAGRENLKRF  693

Query  382  T-VVAAQHMHlflmfllpapllmLRAFNVIIFR  287
              +VA+QHMHL ++ + PA LL+L A++VI FR
Sbjct  694  GRLVASQHMHLLVVLMFPARLLLLGAYSVINFR  726



>ref|XP_006444465.1| hypothetical protein CICLE_v10018997mg [Citrus clementina]
 ref|XP_006492312.1| PREDICTED: uncharacterized protein LOC102623993 [Citrus sinensis]
 gb|ESR57705.1| hypothetical protein CICLE_v10018997mg [Citrus clementina]
 gb|KDO87041.1| hypothetical protein CISIN_1g004536mg [Citrus sinensis]
Length=746

 Score =   156 bits (395),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 88/153 (58%), Positives = 115/153 (75%), Gaps = 9/153 (6%)
 Frame = -2

Query  718  DDAEKRILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHVELSRI  539
            D+AEK++ AA+  FLNSPHPLEILSDRSAYGS GTIQRDHDM SYL+SV+ +I +EL+R+
Sbjct  594  DEAEKQLRAAQMVFLNSPHPLEILSDRSAYGSEGTIQRDHDMNSYLRSVQSVIRLELNRM  653

Query  538  RKSKRES----WWPLIVIPGVKAADIFVGRLVRP----TGQGQFTFAGMFHSGKESLKRF  383
            RK+KR+     WWPL++  G  A  I VGR V       GQ QF F+G+ H+G+E+LKRF
Sbjct  654  RKAKRDHRRKFWWPLVLPHGTDAGGIIVGRPVASFNLGMGQDQFNFSGIVHAGRENLKRF  713

Query  382  T-VVAAQHMHlflmfllpapllmLRAFNVIIFR  287
              +VA+QHMHL ++ + PA LL+L A++VI FR
Sbjct  714  GRLVASQHMHLLVVLMFPARLLLLGAYSVINFR  746



>ref|XP_002270132.1| PREDICTED: uncharacterized protein LOC100267577 [Vitis vinifera]
Length=717

 Score =   155 bits (393),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 81/133 (61%), Positives = 99/133 (74%), Gaps = 8/133 (6%)
 Frame = -2

Query  733  PVTDDDDAEKRILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHV  554
            PV+D +DAE+++LAAK  FLNSPHPLEILSD SAYGS GTIQRDHDMKSYL+SVR +I  
Sbjct  562  PVSDANDAERQLLAAKLVFLNSPHPLEILSDSSAYGSDGTIQRDHDMKSYLRSVRSVIRQ  621

Query  553  ELSRIRKSKRES----WWPLIVIPGVKAADIFVGR--LVRPTGQGQFTFAGMFHSGKESL  392
            E + IRK+KRE     WWP IV PG   A + VG   +    GQ QF F+G+  +G+ESL
Sbjct  622  EQNSIRKTKREQRRKVWWP-IVAPGGIHAGVIVGSPMVSNNMGQDQFNFSGILQTGRESL  680

Query  391  KRFT-VVAAQHMH  356
            KRF+ +VA+QHMH
Sbjct  681  KRFSRLVASQHMH  693



>ref|XP_009594997.1| PREDICTED: uncharacterized protein LOC104091376 [Nicotiana tomentosiformis]
Length=743

 Score =   155 bits (393),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 86/133 (65%), Positives = 101/133 (76%), Gaps = 8/133 (6%)
 Frame = -2

Query  733  PVTDDDDAEKRILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHV  554
            PV+   +AEK+I AA++ FLNSPHPLEILSDRSAYGSGGTIQRDHDM SYLKSVR++I  
Sbjct  589  PVSSSTEAEKQIRAAQSVFLNSPHPLEILSDRSAYGSGGTIQRDHDMNSYLKSVRNVIRQ  648

Query  553  ELSRIRKSKRES----WWPLIVIPGVKAADIFVGRLVRP--TGQGQFTFAGMFHSGKESL  392
            EL+ IRK++R+     WWPL+   GV A  I V R V     G GQF FAG+ HSGKESL
Sbjct  649  ELNSIRKARRKQRRRVWWPLVAPSGVNAG-IVVRRHVESGNMGHGQFNFAGILHSGKESL  707

Query  391  KRF-TVVAAQHMH  356
            KRF T+VA+QHMH
Sbjct  708  KRFSTLVASQHMH  720



>emb|CAN73724.1| hypothetical protein VITISV_016652 [Vitis vinifera]
Length=740

 Score =   155 bits (392),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 81/133 (61%), Positives = 99/133 (74%), Gaps = 8/133 (6%)
 Frame = -2

Query  733  PVTDDDDAEKRILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHV  554
            PV+D +DAE+++LAAK  FLNSPHPLEILSD SAYGS GTIQRDHDMKSYL+SVR +I  
Sbjct  562  PVSDANDAERQLLAAKLVFLNSPHPLEILSDSSAYGSDGTIQRDHDMKSYLRSVRSVIRQ  621

Query  553  ELSRIRKSKRES----WWPLIVIPGVKAADIFVGR--LVRPTGQGQFTFAGMFHSGKESL  392
            E + IRK+KRE     WWP IV PG   A + VG   +    GQ QF F+G+  +G+ESL
Sbjct  622  EQNSIRKTKREQRRKVWWP-IVAPGGIHAGVIVGSPMVSNNMGQDQFNFSGILQTGRESL  680

Query  391  KRFT-VVAAQHMH  356
            KRF+ +VA+QHMH
Sbjct  681  KRFSRLVASQHMH  693



>ref|XP_009788474.1| PREDICTED: uncharacterized protein LOC104236281 [Nicotiana sylvestris]
Length=737

 Score =   154 bits (389),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 85/133 (64%), Positives = 101/133 (76%), Gaps = 8/133 (6%)
 Frame = -2

Query  733  PVTDDDDAEKRILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHV  554
            PV+   +AEK+I  A++ FLNSPHPLEILSDRSAYGSGGTIQRDHDM SYLKSVR++I  
Sbjct  583  PVSSSAEAEKQIRVAQSVFLNSPHPLEILSDRSAYGSGGTIQRDHDMNSYLKSVRNVIRQ  642

Query  553  ELSRIRKSKRES----WWPLIVIPGVKAADIFVGRLVRP--TGQGQFTFAGMFHSGKESL  392
            EL+ IRK++R+     WWPL+   GV A  I V R V     G+GQF FAG+ HSGKESL
Sbjct  643  ELNSIRKARRKQRRRVWWPLVAPSGVNAG-IVVRRHVESGNMGRGQFNFAGILHSGKESL  701

Query  391  KRF-TVVAAQHMH  356
            KRF T+VA+QHMH
Sbjct  702  KRFSTLVASQHMH  714



>ref|XP_012082872.1| PREDICTED: uncharacterized protein LOC105642604 [Jatropha curcas]
 gb|KDP28238.1| hypothetical protein JCGZ_14009 [Jatropha curcas]
Length=732

 Score =   152 bits (383),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 85/156 (54%), Positives = 114/156 (73%), Gaps = 7/156 (4%)
 Frame = -2

Query  733  PVTDDDDAEKRILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHV  554
            P++D +D+EK + AA++ FLNSPHPLEILSDRSAYGS GTIQRDHDM SYLKSVR +I  
Sbjct  577  PLSDSNDSEKLLQAAQSVFLNSPHPLEILSDRSAYGSEGTIQRDHDMNSYLKSVRSVIRK  636

Query  553  ELSRIRKSKRES----WWPLIVIPGVKAADIFVGR-LVR-PTGQGQFTFAGMFHSGKESL  392
            EL+++RK++RE     WW L+   G+    I V R LV    GQ QF F+ +  +G+ESL
Sbjct  637  ELNQLRKARREHRRKFWWSLLAPHGINGVGILVERPLVSIKIGQNQFNFSAVLQTGRESL  696

Query  391  KRFT-VVAAQHMHlflmfllpapllmLRAFNVIIFR  287
            KRF+ +VA+QHMHL ++ L PA  L++ A++V+ FR
Sbjct  697  KRFSRLVASQHMHLLVVLLFPARFLLMGAYSVMNFR  732



>ref|XP_004229404.1| PREDICTED: uncharacterized protein LOC101246277 isoform X1 [Solanum 
lycopersicum]
Length=731

 Score =   152 bits (383),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 84/133 (63%), Positives = 100/133 (75%), Gaps = 8/133 (6%)
 Frame = -2

Query  733  PVTDDDDAEKRILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHV  554
            PV+D  +AEK++ AA++ FLNSPHPLEILSDRSAYGSGGT+QRDHDM SYLKSVR++I  
Sbjct  577  PVSDSTEAEKQLQAAQSVFLNSPHPLEILSDRSAYGSGGTVQRDHDMTSYLKSVRNVIRH  636

Query  553  ELSRIRKSKRES----WWPLIVIPGVKAADIFVGRLVR--PTGQGQFTFAGMFHSGKESL  392
            EL+ IRK+KR+     WWPL+   GV A  I V R V     G GQ  FAG+  SGKESL
Sbjct  637  ELNNIRKAKRKQRRRVWWPLVSPSGVNAG-IVVRRYVESGSMGHGQINFAGILQSGKESL  695

Query  391  KRF-TVVAAQHMH  356
            KRF T+VA+QHMH
Sbjct  696  KRFSTLVASQHMH  708



>ref|XP_010322462.1| PREDICTED: uncharacterized protein LOC101246277 isoform X2 [Solanum 
lycopersicum]
Length=730

 Score =   152 bits (383),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 84/133 (63%), Positives = 100/133 (75%), Gaps = 8/133 (6%)
 Frame = -2

Query  733  PVTDDDDAEKRILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHV  554
            PV+D  +AEK++ AA++ FLNSPHPLEILSDRSAYGSGGT+QRDHDM SYLKSVR++I  
Sbjct  576  PVSDSTEAEKQLQAAQSVFLNSPHPLEILSDRSAYGSGGTVQRDHDMTSYLKSVRNVIRH  635

Query  553  ELSRIRKSKRES----WWPLIVIPGVKAADIFVGRLVR--PTGQGQFTFAGMFHSGKESL  392
            EL+ IRK+KR+     WWPL+   GV A  I V R V     G GQ  FAG+  SGKESL
Sbjct  636  ELNNIRKAKRKQRRRVWWPLVSPSGVNAG-IVVRRYVESGSMGHGQINFAGILQSGKESL  694

Query  391  KRF-TVVAAQHMH  356
            KRF T+VA+QHMH
Sbjct  695  KRFSTLVASQHMH  707



>ref|XP_006349202.1| PREDICTED: uncharacterized protein LOC102604741 [Solanum tuberosum]
Length=737

 Score =   150 bits (379),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 84/133 (63%), Positives = 99/133 (74%), Gaps = 8/133 (6%)
 Frame = -2

Query  733  PVTDDDDAEKRILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHV  554
            PV+D  +AEK++ AA+  FLNSPHPLEILSDRSAYGSGGT+QRDHDM SYLKSVR++I  
Sbjct  583  PVSDSTEAEKQLQAAQFVFLNSPHPLEILSDRSAYGSGGTVQRDHDMSSYLKSVRNVIRH  642

Query  553  ELSRIRKSKRES----WWPLIVIPGVKAADIFVGRLVR--PTGQGQFTFAGMFHSGKESL  392
            EL+ IRK+KR+     WWPL+   GV A  I V R V     G GQ  FAG+  SGKESL
Sbjct  643  ELNNIRKAKRKQRRRVWWPLVSPSGVNAG-IVVRRYVESGSMGHGQVNFAGILQSGKESL  701

Query  391  KRF-TVVAAQHMH  356
            KRF T+VA+QHMH
Sbjct  702  KRFSTLVASQHMH  714



>ref|XP_006386721.1| hypothetical protein POPTR_0002s19900g [Populus trichocarpa]
 gb|ERP64518.1| hypothetical protein POPTR_0002s19900g [Populus trichocarpa]
Length=693

 Score =   149 bits (376),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 77/132 (58%), Positives = 96/132 (73%), Gaps = 6/132 (5%)
 Frame = -2

Query  733  PVTDDDDAEKRILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHV  554
            P +D  DAEK++ +A+  FLNSPHPLEIL DRSAYGS GTIQRDHDM SY KSVR++I  
Sbjct  539  PPSDTSDAEKQLRSAQIVFLNSPHPLEILRDRSAYGSEGTIQRDHDMNSYFKSVRNVIRQ  598

Query  553  ELSRIRKSKRE---SWWPLIVIPGVKAADIFVGRLV--RPTGQGQFTFAGMFHSGKESLK  389
            EL+RIRK++R+    +W  IV P    A I VGR V     GQ QF F+G+  +G+ESLK
Sbjct  599  ELNRIRKARRQHRRKFWLSIVAPHGNDASILVGRPVGFMNMGQNQFNFSGILQTGRESLK  658

Query  388  RFT-VVAAQHMH  356
            RF+ +VA+QHMH
Sbjct  659  RFSRLVASQHMH  670



>ref|XP_011042227.1| PREDICTED: uncharacterized protein LOC105137961 [Populus euphratica]
Length=727

 Score =   149 bits (376),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 76/132 (58%), Positives = 97/132 (73%), Gaps = 6/132 (5%)
 Frame = -2

Query  733  PVTDDDDAEKRILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHV  554
            P +D  DAEK++ +A+  FLNSPHPLEIL DRSAYGS GTIQRDHDM SY KSVR++I  
Sbjct  573  PPSDASDAEKQLRSAQIVFLNSPHPLEILRDRSAYGSEGTIQRDHDMNSYFKSVRNVIRQ  632

Query  553  ELSRIRKSKRE---SWWPLIVIPGVKAADIFVGRLV--RPTGQGQFTFAGMFHSGKESLK  389
            EL+RIRK++R+    +W  I+ P      IFVGR V     GQ QF+F+G+  +G+ESLK
Sbjct  633  ELNRIRKARRQHRRKFWLSILAPPGNDTSIFVGRPVGFMNVGQNQFSFSGILQTGRESLK  692

Query  388  RFT-VVAAQHMH  356
            RF+ +VA+QHMH
Sbjct  693  RFSRLVASQHMH  704



>ref|XP_007051072.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
 gb|EOX95229.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
Length=745

 Score =   149 bits (375),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 89/156 (57%), Positives = 111/156 (71%), Gaps = 8/156 (5%)
 Frame = -2

Query  733  PVTDDDDAEKRILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHV  554
            P++D D+ EK + AA   F NSPHPLEILSDR+AYGS GTIQRDHDM SYL SVR +I  
Sbjct  591  PLSDVDNEEKLLQAAWRIFFNSPHPLEILSDRTAYGSEGTIQRDHDMNSYLVSVRGVIRQ  650

Query  553  ELSRIRKSKRES----WWPLIVIPGVKAADIFVGRLVRP--TGQGQFTFAGMFHSGKESL  392
            EL+RIRK+KRE     WWPL++  G+ A  I +GR V     GQ QF   G+  +G+ESL
Sbjct  651  ELNRIRKTKREHRRKVWWPLVLPCGINAG-IILGRPVATINVGQEQFNLVGVLQTGRESL  709

Query  391  KRFT-VVAAQHMHlflmfllpapllmLRAFNVIIFR  287
            KRF  +VA+QHMHL ++ L PA LL+L A++VI FR
Sbjct  710  KRFGRLVASQHMHLLVILLFPAKLLLLGAYSVINFR  745



>ref|XP_008451496.1| PREDICTED: uncharacterized protein LOC103492768 [Cucumis melo]
Length=739

 Score =   148 bits (374),  Expect = 5e-37, Method: Composition-based stats.
 Identities = 77/133 (58%), Positives = 97/133 (73%), Gaps = 8/133 (6%)
 Frame = -2

Query  733  PVTDDDDAEKRILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHV  554
            P +D +DAEK + AA+  FLN+PHPLE LSDRSAYGSGGTIQRDHDM SYLKSVR +I  
Sbjct  587  PQSDANDAEKELRAAQMVFLNTPHPLETLSDRSAYGSGGTIQRDHDMNSYLKSVRGVIRQ  646

Query  553  ELSRIRKSKRES----WWPLIVIPGVKAADIFVGR--LVRPTGQGQFTFAGMFHSGKESL  392
            EL+RIRK++R+     WW L V PG     I VGR  +    GQ QF F+G+  +G+ESL
Sbjct  647  ELNRIRKARRQHRRKVWWAL-VAPGKVDLGIVVGRPSISINLGQDQFNFSGILQTGRESL  705

Query  391  KRFT-VVAAQHMH  356
            +RF+ +VA+QHM+
Sbjct  706  RRFSRLVASQHMN  718



>ref|XP_011659388.1| PREDICTED: uncharacterized protein LOC101220023 [Cucumis sativus]
Length=739

 Score =   148 bits (373),  Expect = 7e-37, Method: Composition-based stats.
 Identities = 79/136 (58%), Positives = 98/136 (72%), Gaps = 14/136 (10%)
 Frame = -2

Query  733  PVTDDDDAEKRILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHV  554
            P +D +DAEK + AA+  FLN+PHPLE LSDRSAYGSGGTIQRDHDM SYLKSVR +I  
Sbjct  587  PQSDANDAEKELRAAQMVFLNTPHPLETLSDRSAYGSGGTIQRDHDMNSYLKSVRGVIRQ  646

Query  553  ELSRIRKSKRES----WWPLIVIPGVKAADIFVGRLVRPT-----GQGQFTFAGMFHSGK  401
            EL+RIRK++R+     WW L V PG     I VG   RPT     GQ QF F+G+  +G+
Sbjct  647  ELNRIRKARRQHRRKVWWAL-VSPGKVDLGIVVG---RPTISINLGQDQFNFSGILQTGR  702

Query  400  ESLKRFT-VVAAQHMH  356
            ESL+RF+ +VA+QHM+
Sbjct  703  ESLRRFSRLVASQHMN  718



>gb|KGN45002.1| hypothetical protein Csa_7G407550 [Cucumis sativus]
Length=749

 Score =   148 bits (373),  Expect = 7e-37, Method: Composition-based stats.
 Identities = 79/136 (58%), Positives = 98/136 (72%), Gaps = 14/136 (10%)
 Frame = -2

Query  733  PVTDDDDAEKRILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHV  554
            P +D +DAEK + AA+  FLN+PHPLE LSDRSAYGSGGTIQRDHDM SYLKSVR +I  
Sbjct  597  PQSDANDAEKELRAAQMVFLNTPHPLETLSDRSAYGSGGTIQRDHDMNSYLKSVRGVIRQ  656

Query  553  ELSRIRKSKRES----WWPLIVIPGVKAADIFVGRLVRPT-----GQGQFTFAGMFHSGK  401
            EL+RIRK++R+     WW L V PG     I VG   RPT     GQ QF F+G+  +G+
Sbjct  657  ELNRIRKARRQHRRKVWWAL-VSPGKVDLGIVVG---RPTISINLGQDQFNFSGILQTGR  712

Query  400  ESLKRFT-VVAAQHMH  356
            ESL+RF+ +VA+QHM+
Sbjct  713  ESLRRFSRLVASQHMN  728



>ref|XP_003535965.1| PREDICTED: uncharacterized protein LOC100786628 [Glycine max]
Length=755

 Score =   147 bits (371),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 75/133 (56%), Positives = 97/133 (73%), Gaps = 8/133 (6%)
 Frame = -2

Query  733  PVTDDDDAEKRILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHV  554
            P+++ DD EKR+ AA+  FLNSPHPLEILSDRSAYGSGG+IQRDHDM SYLKS+R +I  
Sbjct  601  PLSESDDTEKRLRAAQMVFLNSPHPLEILSDRSAYGSGGSIQRDHDMNSYLKSLRTVIRK  660

Query  553  ELSRIRKSKRES----WWPLIVIPGVKAADIFVGR--LVRPTGQGQFTFAGMFHSGKESL  392
            EL++IRK+KRE     WWPL++  G   + I  GR  +    GQ Q  F+ +  +G+ESL
Sbjct  661  ELNQIRKAKREQRRKVWWPLLLSRGADTS-IVAGRSMISINVGQRQSPFSSVIQTGRESL  719

Query  391  KRFT-VVAAQHMH  356
            KRF+ +V +QHMH
Sbjct  720  KRFSRIVTSQHMH  732



>ref|XP_007145162.1| hypothetical protein PHAVU_007G215600g [Phaseolus vulgaris]
 gb|ESW17156.1| hypothetical protein PHAVU_007G215600g [Phaseolus vulgaris]
Length=706

 Score =   146 bits (369),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 75/133 (56%), Positives = 97/133 (73%), Gaps = 8/133 (6%)
 Frame = -2

Query  733  PVTDDDDAEKRILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHV  554
            P ++ ++ +K++ AA+T FLNSPHPLEILSDRSAYGSGG+IQRDHDM SY KSVR +I  
Sbjct  552  PFSESNNTDKQLRAAQTVFLNSPHPLEILSDRSAYGSGGSIQRDHDMNSYFKSVRTVIRQ  611

Query  553  ELSRIRKSKRES----WWPLIVIPGVKAADIFVGR--LVRPTGQGQFTFAGMFHSGKESL  392
            EL +IRKSKRE     WWPL++  G+    I  GR  +    GQ Q +F+GM  +G+ESL
Sbjct  612  ELKQIRKSKREQRRKVWWPLVLPRGMDTR-IVAGRSMISINVGQRQSSFSGMIQTGRESL  670

Query  391  KRFT-VVAAQHMH  356
            KRF+ +V +QHMH
Sbjct  671  KRFSRLVTSQHMH  683



>ref|XP_009339790.1| PREDICTED: uncharacterized protein LOC103931984 [Pyrus x bretschneideri]
Length=748

 Score =   147 bits (370),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 87/157 (55%), Positives = 113/157 (72%), Gaps = 8/157 (5%)
 Frame = -2

Query  733  PVTDDDDAEKRILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHV  554
            P++D  DAEK++ AA+  FL+SPHPLEILSDRSAYGS GTIQRDHD+ SYLKSVR +I  
Sbjct  592  PLSDGSDAEKQLRAAQLVFLSSPHPLEILSDRSAYGSEGTIQRDHDVNSYLKSVRGVIRE  651

Query  553  ELSRIRKSKRES----WWPLIVIPGVKAADIFVGRLVRPTGQG---QFTFAGMFHSGKES  395
            ELS+IRK++R+     WWPLI      A  + VGR V     G   Q  F+G   +GKE+
Sbjct  652  ELSQIRKARRQQGRKVWWPLIAPRSKHAGGVIVGRTVASINLGQEEQLNFSGAVQTGKET  711

Query  394  LKRFT-VVAAQHMHlflmfllpapllmLRAFNVIIFR  287
            LKRF+ +VA +HMHLF++ L+PA LL+L A+++I FR
Sbjct  712  LKRFSRLVAWEHMHLFVVLLVPARLLVLGAYSIISFR  748



>ref|XP_010069869.1| PREDICTED: uncharacterized protein LOC104456712 [Eucalyptus grandis]
 gb|KCW58373.1| hypothetical protein EUGRSUZ_H01057 [Eucalyptus grandis]
Length=761

 Score =   144 bits (362),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 79/130 (61%), Positives = 94/130 (72%), Gaps = 15/130 (12%)
 Frame = -2

Query  712  AEKRILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHVELSRIRK  533
            AEK +LAA+  FLNSPHPLEILSDR+AYGSGGTIQRDHDM SY+KSVR +I  ELS +RK
Sbjct  615  AEKELLAAQKVFLNSPHPLEILSDRAAYGSGGTIQRDHDMNSYVKSVRSVIRQELSHMRK  674

Query  532  SKRES----WWPLIVIPGVKAADIFVG-RLVRPTG-----QGQFTFAGMFHSGKESLKRF  383
            +KRE     WWPLIV  G     I +G  L RP G     + Q  F+G+  +GKESLKRF
Sbjct  675  AKREQRRKFWWPLIVSRG----GINIGLALSRPIGSIGMDREQLNFSGILETGKESLKRF  730

Query  382  T-VVAAQHMH  356
            + +VA+QHMH
Sbjct  731  SRLVASQHMH  740



>ref|XP_006418320.1| hypothetical protein EUTSA_v10006955mg [Eutrema salsugineum]
 gb|ESQ36673.1| hypothetical protein EUTSA_v10006955mg [Eutrema salsugineum]
Length=706

 Score =   142 bits (358),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 83/154 (54%), Positives = 111/154 (72%), Gaps = 9/154 (6%)
 Frame = -2

Query  733  PVTDDDDAEKRILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHV  554
            PV +  + E+R+ AA+T FLN+PHPL+ILSDRSAYGSGGTIQRDHDM SYLKSVR +I  
Sbjct  557  PVNEGSEEEQRLRAAQTVFLNTPHPLDILSDRSAYGSGGTIQRDHDMNSYLKSVRSVIRK  616

Query  553  ELSRIRKSKRES----WWPLIVIPGVKAADIFVGRLVRPTGQGQFTFAGMFHSGKESLKR  386
            E+++IR++KRE     WWP++V     +A I +G   +  GQG   F+GM  +G++SL+R
Sbjct  617  EVNQIRRAKREHRRSLWWPILVARESGSAGIAMGNR-QINGQG---FSGMMKTGRKSLQR  672

Query  385  FT-VVAAQHMHlflmfllpapllmLRAFNVIIFR  287
            F+ +VA+QHM L ++ L P  LL L AFNV  FR
Sbjct  673  FSRLVASQHMPLIVVLLFPVKLLCLGAFNVFSFR  706



>ref|XP_009378693.1| PREDICTED: uncharacterized protein LOC103967158 isoform X2 [Pyrus 
x bretschneideri]
Length=707

 Score =   141 bits (356),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 86/156 (55%), Positives = 117/156 (75%), Gaps = 7/156 (4%)
 Frame = -2

Query  733  PVTDDDDAEKRILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHV  554
            P++D  DAE+++LAA+  FLNSPHPLEILSDRSAYGS GTIQRDHD+ SYLKSVR +I  
Sbjct  552  PLSDGSDAERQLLAAQLVFLNSPHPLEILSDRSAYGSEGTIQRDHDVNSYLKSVRGVIRQ  611

Query  553  ELSRIRKSKRES----WWPLIVIPGVKAADIFVGRLVRPT--GQGQFTFAGMFHSGKESL  392
            EL++IRKS+R+     WWPLI    + A  + VGR +     G+ Q  F+G+  +G+ESL
Sbjct  612  ELNQIRKSRRQQRRKVWWPLIAPRSMHAGGVIVGRTIASINLGKEQLNFSGVLQTGRESL  671

Query  391  KRFT-VVAAQHMHlflmfllpapllmLRAFNVIIFR  287
            KR + +VA++HMHLF++ L+PA LL+L A+++I FR
Sbjct  672  KRLSRLVASRHMHLFVVLLVPARLLVLGAYSIIGFR  707



>ref|XP_009378692.1| PREDICTED: uncharacterized protein LOC103967158 isoform X1 [Pyrus 
x bretschneideri]
Length=751

 Score =   141 bits (355),  Expect = 2e-34, Method: Composition-based stats.
 Identities = 86/156 (55%), Positives = 117/156 (75%), Gaps = 7/156 (4%)
 Frame = -2

Query  733  PVTDDDDAEKRILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHV  554
            P++D  DAE+++LAA+  FLNSPHPLEILSDRSAYGS GTIQRDHD+ SYLKSVR +I  
Sbjct  596  PLSDGSDAERQLLAAQLVFLNSPHPLEILSDRSAYGSEGTIQRDHDVNSYLKSVRGVIRQ  655

Query  553  ELSRIRKSKRES----WWPLIVIPGVKAADIFVGRLVRPT--GQGQFTFAGMFHSGKESL  392
            EL++IRKS+R+     WWPLI    + A  + VGR +     G+ Q  F+G+  +G+ESL
Sbjct  656  ELNQIRKSRRQQRRKVWWPLIAPRSMHAGGVIVGRTIASINLGKEQLNFSGVLQTGRESL  715

Query  391  KRFT-VVAAQHMHlflmfllpapllmLRAFNVIIFR  287
            KR + +VA++HMHLF++ L+PA LL+L A+++I FR
Sbjct  716  KRLSRLVASRHMHLFVVLLVPARLLVLGAYSIIGFR  751



>ref|XP_003591428.1| Lipase [Medicago truncatula]
Length=680

 Score =   140 bits (353),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 75/126 (60%), Positives = 91/126 (72%), Gaps = 8/126 (6%)
 Frame = -2

Query  712  AEKRILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHVELSRIRK  533
              K++ AAK  FLN+PHPLEILS+RSAYGSGGTIQRDHDM SYLK+VR +I  EL++IRK
Sbjct  533  CHKKLRAAKLTFLNTPHPLEILSERSAYGSGGTIQRDHDMNSYLKTVRSVIRQELNQIRK  592

Query  532  SKRES----WWPLIVIPGVKAADIFVGR--LVRPTGQGQFTFAGMFHSGKESLKRFT-VV  374
            S RE     WWPL V+P      I VGR  +    GQ Q  F+GM  +G+ESLKRF+ +V
Sbjct  593  SMREKRRKVWWPL-VLPRRVDTSIVVGRSMVSVSIGQRQSPFSGMMKTGRESLKRFSRLV  651

Query  373  AAQHMH  356
            A+QHMH
Sbjct  652  ASQHMH  657



>emb|CDP17086.1| unnamed protein product [Coffea canephora]
Length=765

 Score =   139 bits (351),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 77/135 (57%), Positives = 97/135 (72%), Gaps = 8/135 (6%)
 Frame = -2

Query  739  RPPVTDDDDAEKRILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHII  560
            R   TD  +AE+++ AA+  FLNSPHPLEILSDR+AYGSGGTIQRDHDM SY +SVR +I
Sbjct  609  RCQATDGSEAERQMQAAQAVFLNSPHPLEILSDRAAYGSGGTIQRDHDMNSYFRSVRRVI  668

Query  559  HVELSRIRKSKRES----WWPLIVIPGVKAADIFVGRLVR--PTGQGQFTFAGMFHSGKE  398
              EL R RK+++E     WWPL+   GV    I +G  V    TG+G F FAG+ H+GKE
Sbjct  669  QEELHRTRKARKERRRKVWWPLVASRGVNPG-IIIGSPVEFITTGKGLFNFAGIIHTGKE  727

Query  397  SLKRFT-VVAAQHMH  356
            S+KRF+ +VA+QHMH
Sbjct  728  SVKRFSRLVASQHMH  742



>ref|XP_004300465.1| PREDICTED: uncharacterized protein LOC101303332 [Fragaria vesca 
subsp. vesca]
Length=722

 Score =   139 bits (349),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 90/154 (58%), Positives = 112/154 (73%), Gaps = 8/154 (5%)
 Frame = -2

Query  730  VTDDDDAEKRILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHVE  551
            ++D +DAEK + AAK  FLNSPHPLEILSDRSAYGS G IQRDHDM SY KSVR +I  E
Sbjct  569  LSDANDAEKLLHAAKLVFLNSPHPLEILSDRSAYGSEGCIQRDHDMNSYFKSVRGVIRQE  628

Query  550  LSRIRKSKRES----WWPLIVIPGVKAADIFVGRLVRPTGQGQF--TFAGMFHSGKESLK  389
            L+ IRK++R+     WWPL+   GV    I VGR      QGQ+   F+GM  SGKESLK
Sbjct  629  LNHIRKARRQQRRKVWWPLVSSRGVDLG-IIVGRPFATMKQGQYQVNFSGMLQSGKESLK  687

Query  388  RFT-VVAAQHMHlflmfllpapllmLRAFNVIIF  290
            RF+ +VA+QHMHLF++ L+PA L++L A++VI F
Sbjct  688  RFSRLVASQHMHLFVVLLVPARLILLGAYSVIGF  721



>ref|XP_007200310.1| hypothetical protein PRUPE_ppa001821mg [Prunus persica]
 gb|EMJ01509.1| hypothetical protein PRUPE_ppa001821mg [Prunus persica]
Length=760

 Score =   139 bits (349),  Expect = 1e-33, Method: Composition-based stats.
 Identities = 76/133 (57%), Positives = 97/133 (73%), Gaps = 8/133 (6%)
 Frame = -2

Query  733  PVTDDDDAEKRILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHV  554
            P++D +DAEK++ AA+  FLNSPHPLEILSDRSAYGS GTIQRDHD+ SYLKSVR +I  
Sbjct  606  PLSDANDAEKQLQAARLVFLNSPHPLEILSDRSAYGSEGTIQRDHDVNSYLKSVREVIRQ  665

Query  553  ELSRIRKSKRES----WWPLIVIPGVKAADIFVGRLVRP--TGQGQFTFAGMFHSGKESL  392
            EL+++RK++R+     WWPL+    V    + VGR V     G  QF F+GM  +GKESL
Sbjct  666  ELNQMRKARRQQRRKVWWPLVAARSVHGG-LIVGRPVASFNMGHEQFNFSGMLQTGKESL  724

Query  391  KRFT-VVAAQHMH  356
            K+F+ +VA QHMH
Sbjct  725  KQFSRLVALQHMH  737



>ref|XP_008235187.1| PREDICTED: uncharacterized protein LOC103334041 isoform X1 [Prunus 
mume]
 ref|XP_008235188.1| PREDICTED: uncharacterized protein LOC103334041 isoform X2 [Prunus 
mume]
Length=762

 Score =   139 bits (349),  Expect = 1e-33, Method: Composition-based stats.
 Identities = 86/156 (55%), Positives = 113/156 (72%), Gaps = 8/156 (5%)
 Frame = -2

Query  733  PVTDDDDAEKRILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHV  554
            P++D  DAEK++  A+  FLNSPHPLEILSDRSAYGS GTIQRDHD+ SYLKSVR +I  
Sbjct  608  PLSDASDAEKQLRDARLVFLNSPHPLEILSDRSAYGSEGTIQRDHDVNSYLKSVREVIRQ  667

Query  553  ELSRIRKSKRES----WWPLIVIPGVKAADIFVGRLVRP--TGQGQFTFAGMFHSGKESL  392
            EL+++RK++R+     WWPL+ +  V    + VGR       G  QF F+GM  +GKESL
Sbjct  668  ELNQMRKARRQQRRKVWWPLVALRSVHGG-VIVGRPEASFNMGHEQFNFSGMLQTGKESL  726

Query  391  KRFT-VVAAQHMHlflmfllpapllmLRAFNVIIFR  287
            KRF+ +VA+QHMHLF++ L+P  LL+L A++VI  R
Sbjct  727  KRFSRLVASQHMHLFVVLLVPVRLLLLGAYSVISLR  762



>gb|KHF99200.1| hypothetical protein F383_17206 [Gossypium arboreum]
Length=737

 Score =   138 bits (347),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 87/156 (56%), Positives = 110/156 (71%), Gaps = 8/156 (5%)
 Frame = -2

Query  733  PVTDDDDAEKRILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHV  554
            P +++D  EK + AA+  F NSPHPL+ILSDRSAYGS GTI RDHDMKSYLK VR II  
Sbjct  583  PFSNEDSEEKLLRAAQRIFFNSPHPLDILSDRSAYGSEGTIIRDHDMKSYLKFVREIIRQ  642

Query  553  ELSRIRKSKRES----WWPLIVIPGVKAADIFVGRLVRPTG--QGQFTFAGMFHSGKESL  392
            E +RIRK+KRE     WW L++  GV A  I +GR +  TG  QGQF  A +  +G+ SL
Sbjct  643  EQNRIRKTKREQRRKDWWSLVLSRGVSAG-IVLGRSITTTGLHQGQFNLAVVLQTGRASL  701

Query  391  KRF-TVVAAQHMHlflmfllpapllmLRAFNVIIFR  287
            KRF  +VA++ MHL ++ LLPA LL+L A++VI FR
Sbjct  702  KRFGKLVASRDMHLLVILLLPAKLLLLGAYHVINFR  737



>ref|XP_010259358.1| PREDICTED: uncharacterized protein LOC104598821 [Nelumbo nucifera]
Length=753

 Score =   138 bits (347),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 76/131 (58%), Positives = 90/131 (69%), Gaps = 12/131 (9%)
 Frame = -2

Query  727  TDDDDAEKRILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHVEL  548
            +D  DAEK + AA   F NSPHPLEILSDRSAYGS GTI RDHDMKSYL+SVR +I  EL
Sbjct  605  SDSIDAEKELRAAHRVFFNSPHPLEILSDRSAYGSDGTIYRDHDMKSYLRSVRGVIRQEL  664

Query  547  SRIRKSK----RESWWPLIVIPGVKAADIFVGRLVRPT--GQGQFTFAGMFHSGKESLKR  386
            +RIRK+K    R  WWPL+V  GV      V   V P   GQ Q  F+G+  +G+ESL R
Sbjct  665  NRIRKAKGEHRRRVWWPLVVPHGV-----IVSGHVAPNNMGQHQVNFSGILRTGRESLNR  719

Query  385  FT-VVAAQHMH  356
            F+ +VA+QHMH
Sbjct  720  FSRLVASQHMH  730



>ref|XP_010679351.1| PREDICTED: uncharacterized protein LOC104894743 [Beta vulgaris 
subsp. vulgaris]
Length=742

 Score =   137 bits (346),  Expect = 3e-33, Method: Composition-based stats.
 Identities = 80/128 (63%), Positives = 93/128 (73%), Gaps = 8/128 (6%)
 Frame = -2

Query  724  DDDDAEKRILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHVELS  545
            D  + EK++ AAK AFLN PHPLEILSDRSAYG+GGTIQRDHDM SYLK VR +I  ELS
Sbjct  595  DASEGEKQLRAAKNAFLNIPHPLEILSDRSAYGNGGTIQRDHDMNSYLKCVRGVIRQELS  654

Query  544  RIRKSKRES----WWPLIVIPGVKAADIFVGRLVRPTGQGQFTFAGMFHSGKESLKRFT-  380
            RIRK++RE     WWPL V P V    I VG +    GQ QF FAG+  +GKES KRF+ 
Sbjct  655  RIRKAERERRRKVWWPL-VTPRVAGTSIVVGPI--NVGQAQFKFAGIVKNGKESFKRFSR  711

Query  379  VVAAQHMH  356
            +VA+QHMH
Sbjct  712  LVASQHMH  719



>ref|XP_008781074.1| PREDICTED: uncharacterized protein LOC103700951 isoform X1 [Phoenix 
dactylifera]
Length=737

 Score =   137 bits (346),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 77/155 (50%), Positives = 109/155 (70%), Gaps = 8/155 (5%)
 Frame = -2

Query  730  VTDDDDAEKRILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHVE  551
            + D DD+ + + AA++AFLN+PHPLEILSDRSAYGS GTI RDHDM SY++SV  +IH E
Sbjct  584  LVDSDDSARLLQAAQSAFLNTPHPLEILSDRSAYGSEGTIYRDHDMNSYMRSVHGVIHQE  643

Query  550  LSRIRKSKRES----WWPLIVIPGVKAADIFVGRLVRPTGQGQ--FTFAGMFHSGKESLK  389
            L  IRK+KRE     WWPL+    +  A++  G+   P+   +  F+FAG+FH G+E+LK
Sbjct  644  LKLIRKAKREQRRQVWWPLVATQDLH-ANMTTGQCAGPSNSSEHHFSFAGVFHGGRETLK  702

Query  388  RFT-VVAAQHMHlflmfllpapllmLRAFNVIIFR  287
            RF  ++A+QH+ + ++ L PA LL+L   ++I FR
Sbjct  703  RFGRLLASQHVQMLVVLLFPARLLLLGTLSIINFR  737



>gb|KHN08648.1| Proteasome subunit alpha type-5 [Glycine soja]
Length=745

 Score =   137 bits (345),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 69/122 (57%), Positives = 90/122 (74%), Gaps = 7/122 (6%)
 Frame = -2

Query  733  PVTDDDDAEKRILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHV  554
            P+++ +D EK++ AA+  FLNSPHPLEILSDRSAYGSGG++QRDHDM SYLKSVR +I  
Sbjct  393  PLSESNDTEKQLRAAQMVFLNSPHPLEILSDRSAYGSGGSVQRDHDMNSYLKSVRTVIRQ  452

Query  553  ELSRIRKSKRES----WWPLIVIPGVKAADIFVGR--LVRPTGQGQFTFAGMFHSGKESL  392
            EL++IRK+KRE     WWPL++  GV  + I  GR  +    GQ Q  F+G+  +G+ESL
Sbjct  453  ELNQIRKAKREQRRKVWWPLLLPRGVDTS-IVAGRSMISINVGQRQSPFSGVIQTGRESL  511

Query  391  KR  386
            KR
Sbjct  512  KR  513



>ref|XP_010268036.1| PREDICTED: uncharacterized protein LOC104605112 [Nelumbo nucifera]
Length=746

 Score =   136 bits (343),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 74/136 (54%), Positives = 94/136 (69%), Gaps = 9/136 (7%)
 Frame = -2

Query  739  RPPVTDDDDAEKRILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHII  560
            + P +   DAEK++ AA+  F NSPHPLEILSDRSAYGS GT+ RDHDM SYL+SVR ++
Sbjct  589  KCPGSGSLDAEKQLRAAQRVFFNSPHPLEILSDRSAYGSDGTVYRDHDMNSYLRSVRGVL  648

Query  559  HVELSRIRKSKRES-----WWPLIVIPGVKAADIFVGRLV--RPTGQGQFTFAGMFHSGK  401
              E  RIRK+KRE      WWPL+   GV  AD  V R V     GQ Q +F+G+  +G+
Sbjct  649  RQEHKRIRKAKRERRRHRMWWPLVAPHGVH-ADTVVSRDVVSNNMGQQQVSFSGVLRTGR  707

Query  400  ESLKRFT-VVAAQHMH  356
            +SLKRF+ +VA+QHMH
Sbjct  708  DSLKRFSRLVASQHMH  723



>ref|XP_011079576.1| PREDICTED: uncharacterized protein LOC105163063 isoform X2 [Sesamum 
indicum]
Length=719

 Score =   136 bits (342),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 80/132 (61%), Positives = 95/132 (72%), Gaps = 9/132 (7%)
 Frame = -2

Query  727  TDDDDAEKRILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHVEL  548
            +D   AEK+I +A   FLNSPHPLEILSDRSAYGSGGTIQRDHDM SYLKS+R +I  EL
Sbjct  566  SDLAKAEKQIQSALAVFLNSPHPLEILSDRSAYGSGGTIQRDHDMNSYLKSIRTVIRQEL  625

Query  547  SRIRKSKRES----WWPLIVIPGVKAADIFVGRLVRP---TGQGQFTFAGMFHSGKESLK  389
            +RIR++KRE     WWPL+   GV A  I V R V      GQGQ  F+GM  +G ESLK
Sbjct  626  NRIRRAKRERRRKVWWPLVTPRGVNAG-IVVSRPVMSGNMMGQGQLNFSGMVQTGTESLK  684

Query  388  RFT-VVAAQHMH  356
            RF+ ++A+QHMH
Sbjct  685  RFSRLIASQHMH  696



>ref|XP_011079577.1| PREDICTED: uncharacterized protein LOC105163063 isoform X3 [Sesamum 
indicum]
Length=718

 Score =   136 bits (342),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 80/132 (61%), Positives = 95/132 (72%), Gaps = 9/132 (7%)
 Frame = -2

Query  727  TDDDDAEKRILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHVEL  548
            +D   AEK+I +A   FLNSPHPLEILSDRSAYGSGGTIQRDHDM SYLKS+R +I  EL
Sbjct  565  SDLAKAEKQIQSALAVFLNSPHPLEILSDRSAYGSGGTIQRDHDMNSYLKSIRTVIRQEL  624

Query  547  SRIRKSKRES----WWPLIVIPGVKAADIFVGRLVRP---TGQGQFTFAGMFHSGKESLK  389
            +RIR++KRE     WWPL+   GV A  I V R V      GQGQ  F+GM  +G ESLK
Sbjct  625  NRIRRAKRERRRKVWWPLVTPRGVNAG-IVVSRPVMSGNMMGQGQLNFSGMVQTGTESLK  683

Query  388  RFT-VVAAQHMH  356
            RF+ ++A+QHMH
Sbjct  684  RFSRLIASQHMH  695



>ref|XP_011079575.1| PREDICTED: uncharacterized protein LOC105163063 isoform X1 [Sesamum 
indicum]
Length=747

 Score =   136 bits (342),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 80/132 (61%), Positives = 95/132 (72%), Gaps = 9/132 (7%)
 Frame = -2

Query  727  TDDDDAEKRILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHVEL  548
            +D   AEK+I +A   FLNSPHPLEILSDRSAYGSGGTIQRDHDM SYLKS+R +I  EL
Sbjct  594  SDLAKAEKQIQSALAVFLNSPHPLEILSDRSAYGSGGTIQRDHDMNSYLKSIRTVIRQEL  653

Query  547  SRIRKSKRES----WWPLIVIPGVKAADIFVGRLVRP---TGQGQFTFAGMFHSGKESLK  389
            +RIR++KRE     WWPL+   GV A  I V R V      GQGQ  F+GM  +G ESLK
Sbjct  654  NRIRRAKRERRRKVWWPLVTPRGVNAG-IVVSRPVMSGNMMGQGQLNFSGMVQTGTESLK  712

Query  388  RFT-VVAAQHMH  356
            RF+ ++A+QHMH
Sbjct  713  RFSRLIASQHMH  724



>ref|XP_010556701.1| PREDICTED: uncharacterized protein LOC104825944 [Tarenaya hassleriana]
 ref|XP_010556702.1| PREDICTED: uncharacterized protein LOC104825944 [Tarenaya hassleriana]
 ref|XP_010556703.1| PREDICTED: uncharacterized protein LOC104825944 [Tarenaya hassleriana]
Length=704

 Score =   135 bits (340),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 72/130 (55%), Positives = 96/130 (74%), Gaps = 12/130 (9%)
 Frame = -2

Query  730  VTDDDDAEKRILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHVE  551
            ++D + AEK++ +A+T FL+SPHPLEILSDRSAYGSGGTIQRDHDM SYLKSVR +I  E
Sbjct  565  ISDIEAAEKQLRSAQTIFLDSPHPLEILSDRSAYGSGGTIQRDHDMNSYLKSVRSVIRKE  624

Query  550  LSRIRKSKRES----WWPLIVIPGVKAADIFVGRLVRPTGQGQFTFAGMFHSGKESLKRF  383
            ++R+RK+KRE     WWP++V       D     + +P   GQ  F+GM  SG+ES++RF
Sbjct  625  VNRVRKAKREQRRSLWWPIMV-----TRDRVNSGMGQPM-NGQ-DFSGMLKSGRESVRRF  677

Query  382  T-VVAAQHMH  356
            + +VA+QHMH
Sbjct  678  SRLVASQHMH  687



>ref|XP_008369058.1| PREDICTED: uncharacterized protein LOC103432636 isoform X2 [Malus 
domestica]
 ref|XP_008345235.1| PREDICTED: uncharacterized protein LOC103408145 isoform X2 [Malus 
domestica]
Length=711

 Score =   135 bits (340),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 75/133 (56%), Positives = 95/133 (71%), Gaps = 7/133 (5%)
 Frame = -2

Query  733  PVTDDDDAEKRILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHV  554
            P++D  DAE+++ AA+  FLNSPHPLEILSDRSAYGS GTIQRDHD+ SYLKSVR +I  
Sbjct  556  PLSDGSDAERQLRAAQLVFLNSPHPLEILSDRSAYGSEGTIQRDHDVNSYLKSVRGVIRQ  615

Query  553  ELSRIRKSKRES----WWPLIVIPGVKAADIFVGRLVRPTG--QGQFTFAGMFHSGKESL  392
            EL++IRKS+R+     WWPLI    V A  + VGR V      + Q  F+G+  +G+ESL
Sbjct  616  ELNQIRKSRRQQRRKVWWPLIAPRSVHAGGVIVGRTVASINLRREQLNFSGVLRTGRESL  675

Query  391  KRFT-VVAAQHMH  356
            KRF  +VA+ HMH
Sbjct  676  KRFGRIVASWHMH  688



>gb|KHN30650.1| Proteasome subunit alpha type-5 [Glycine soja]
Length=953

 Score =   136 bits (342),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 69/122 (57%), Positives = 88/122 (72%), Gaps = 7/122 (6%)
 Frame = -2

Query  733  PVTDDDDAEKRILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHV  554
            P+++ DD EKR+ AA+  FLNSPHPLEILSDRSAYGSGG+IQRDHDM SYLKS+R +I  
Sbjct  601  PLSESDDTEKRLRAAQMVFLNSPHPLEILSDRSAYGSGGSIQRDHDMNSYLKSLRTVIRK  660

Query  553  ELSRIRKSKRES----WWPLIVIPGVKAADIFVGR--LVRPTGQGQFTFAGMFHSGKESL  392
            EL++IRK+KRE     WWPL++  G   + I  GR  +    GQ Q  F+ +  +G+ESL
Sbjct  661  ELNQIRKAKREQRRKVWWPLLLSRGADTS-IVAGRSMISINVGQRQSPFSSVIQTGRESL  719

Query  391  KR  386
            KR
Sbjct  720  KR  721



>ref|XP_008386733.1| PREDICTED: uncharacterized protein LOC103449224 [Malus domestica]
Length=739

 Score =   135 bits (339),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 85/154 (55%), Positives = 111/154 (72%), Gaps = 7/154 (5%)
 Frame = -2

Query  733  PVTDDDDAEKRILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHV  554
            P++D  DAEK++  A+  FLNSPHPLEILSDRSAYGS GTIQRDHD+ SYLKSVR +I  
Sbjct  588  PLSDGSDAEKQLRXAQLVFLNSPHPLEILSDRSAYGSEGTIQRDHDVNSYLKSVRGVIRE  647

Query  553  ELSRIRKSKRES----WWPLIVIPGVKAADIFVGRLVRPTGQGQFTFAGMFHSGKESLKR  386
            ELS+IRK++R+     WWPLI      A  + VG  +    + Q  F+G   +GKESLKR
Sbjct  648  ELSQIRKARRQQRRKVWWPLIAPRSKHAGGVIVG--INLGQEEQLNFSGALQTGKESLKR  705

Query  385  FT-VVAAQHMHlflmfllpapllmLRAFNVIIFR  287
            F+ +VA +HMHLF++ L+PA LL+L A+++I FR
Sbjct  706  FSRLVAWEHMHLFVVLLVPARLLVLGAYSIISFR  739



>ref|XP_008369057.1| PREDICTED: uncharacterized protein LOC103432636 isoform X1 [Malus 
domestica]
 ref|XP_008345234.1| PREDICTED: uncharacterized protein LOC103408145 isoform X1 [Malus 
domestica]
Length=755

 Score =   135 bits (339),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 75/133 (56%), Positives = 95/133 (71%), Gaps = 7/133 (5%)
 Frame = -2

Query  733  PVTDDDDAEKRILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHV  554
            P++D  DAE+++ AA+  FLNSPHPLEILSDRSAYGS GTIQRDHD+ SYLKSVR +I  
Sbjct  600  PLSDGSDAERQLRAAQLVFLNSPHPLEILSDRSAYGSEGTIQRDHDVNSYLKSVRGVIRQ  659

Query  553  ELSRIRKSKRES----WWPLIVIPGVKAADIFVGRLVRPTG--QGQFTFAGMFHSGKESL  392
            EL++IRKS+R+     WWPLI    V A  + VGR V      + Q  F+G+  +G+ESL
Sbjct  660  ELNQIRKSRRQQRRKVWWPLIAPRSVHAGGVIVGRTVASINLRREQLNFSGVLRTGRESL  719

Query  391  KRFT-VVAAQHMH  356
            KRF  +VA+ HMH
Sbjct  720  KRFGRIVASWHMH  732



>emb|CDY51303.1| BnaCnng20480D [Brassica napus]
Length=675

 Score =   134 bits (337),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 79/150 (53%), Positives = 106/150 (71%), Gaps = 11/150 (7%)
 Frame = -2

Query  721  DDDAEKRILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHVELSR  542
            DD+ E+R+ AA+T FLN+PHPL+ILSDRSAYGS GTIQRDHDM SYLK+VR +I  E+S+
Sbjct  532  DDEEEQRLRAAQTVFLNTPHPLDILSDRSAYGSSGTIQRDHDMNSYLKAVRSVIRKEVSQ  591

Query  541  IRKSKRES----WWPLIVIPGVKAADIFVGRLVRPTGQGQFTFAGMFHSGKESLKRFT-V  377
            IR+ KRE     WWP++V    + +    G  +   GQ    F+GM  +G++SL+RF+ +
Sbjct  592  IRRLKREHRRSLWWPILV---ARESGRSSGTAIGNNGQ---DFSGMMKTGRKSLQRFSRL  645

Query  376  VAAQHMHlflmfllpapllmLRAFNVIIFR  287
            VA+QHM L ++ L P  LL L AFNV+ FR
Sbjct  646  VASQHMPLIVVLLFPVKLLFLEAFNVLSFR  675



>dbj|BAH20392.1| AT1G02660 [Arabidopsis thaliana]
Length=550

 Score =   132 bits (332),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 82/157 (52%), Positives = 109/157 (69%), Gaps = 15/157 (10%)
 Frame = -2

Query  736  PPVTDDDDAEKRILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIH  557
            P + D D  E+R+ AA+T FLN+PHPL+ILSDRSAYGS GTIQRDHDM SYLK+VR +I 
Sbjct  402  PDIEDSD--EERLRAAQTVFLNTPHPLDILSDRSAYGSSGTIQRDHDMNSYLKAVRSVIR  459

Query  556  VELSRIRKSKRES----WWPLIVIPGVKAADIFVGRLVRPTGQ--GQFTFAGMFHSGKES  395
             E+++IR++KRE     WWP++V     ++ I V       GQ  GQ  F+GM  +G++S
Sbjct  460  KEVNQIRRAKREHRRSLWWPILVARESGSSGIAVS-----NGQINGQ-DFSGMMQTGRKS  513

Query  394  LKRFT-VVAAQHMHlflmfllpapllmLRAFNVIIFR  287
            L+RF+ +VA+QHM L ++ L P  LL L AFNV  FR
Sbjct  514  LQRFSRLVASQHMPLIVVMLFPVKLLFLGAFNVFSFR  550



>ref|XP_010474677.1| PREDICTED: uncharacterized protein LOC104754237 [Camelina sativa]
Length=726

 Score =   133 bits (334),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 78/157 (50%), Positives = 107/157 (68%), Gaps = 15/157 (10%)
 Frame = -2

Query  733  PVTDDDDAEKRILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHV  554
            P  +D + ++R++AA+T FLN+PHPL+ILSDRSAYGS GTIQRDHDM SYLKSVR +I  
Sbjct  577  PDNEDTEEKQRLVAAQTVFLNTPHPLDILSDRSAYGSSGTIQRDHDMNSYLKSVRSVIRK  636

Query  553  ELSRIRKSKRES----WWPLIVIPGVKAADIFVGRLVRPTGQGQFT---FAGMFHSGKES  395
            E+++IR+ KRE     WWP++V     ++ I +         GQ     F+GM  +G++S
Sbjct  637  EVNQIRREKREHRRSLWWPILVARESGSSGIAI-------SNGQINSQDFSGMMKTGRKS  689

Query  394  LKRFT-VVAAQHMHlflmfllpapllmLRAFNVIIFR  287
            L+RF+ +VA+QHM L ++ L P  LL L AFNV  FR
Sbjct  690  LQRFSRLVASQHMPLIVVMLFPVKLLCLGAFNVFSFR  726



>ref|XP_010457251.1| PREDICTED: uncharacterized protein LOC104738747 [Camelina sativa]
Length=725

 Score =   133 bits (334),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 78/157 (50%), Positives = 107/157 (68%), Gaps = 15/157 (10%)
 Frame = -2

Query  733  PVTDDDDAEKRILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHV  554
            P  +D + ++R++AA+T FLN+PHPL+ILSDRSAYGS GTIQRDHDM SYLKSVR +I  
Sbjct  576  PDNEDTEEKQRLVAAQTVFLNTPHPLDILSDRSAYGSSGTIQRDHDMNSYLKSVRSVIRK  635

Query  553  ELSRIRKSKRES----WWPLIVIPGVKAADIFVGRLVRPTGQGQFT---FAGMFHSGKES  395
            E+++IR+ KRE     WWP++V     ++ I +         GQ     F+GM  +G++S
Sbjct  636  EVNQIRREKREHRRSLWWPILVARESGSSGIAI-------SNGQINSQDFSGMMKTGRKS  688

Query  394  LKRFT-VVAAQHMHlflmfllpapllmLRAFNVIIFR  287
            L+RF+ +VA+QHM L ++ L P  LL L AFNV  FR
Sbjct  689  LQRFSRLVASQHMPLIVVLLFPVKLLCLGAFNVFSFR  725



>ref|XP_010481144.1| PREDICTED: uncharacterized protein LOC104759980 [Camelina sativa]
Length=729

 Score =   132 bits (333),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 78/155 (50%), Positives = 107/155 (69%), Gaps = 11/155 (7%)
 Frame = -2

Query  733  PVTDDDDAEKRILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHV  554
            P  +D + ++R++AA+T FLN+PHPL+ILSDRSAYGS GTIQRDHDM SYLKSVR +I  
Sbjct  580  PDNEDTEEKQRLVAAQTVFLNTPHPLDILSDRSAYGSSGTIQRDHDMNSYLKSVRSVIRK  639

Query  553  ELSRIRKSKRES----WWPLIVIPGVKAADIFVGRLVRPTGQ-GQFTFAGMFHSGKESLK  389
            E+++IR+ KRE     WWP++V     ++ I +       GQ     F+GM  +G++SL+
Sbjct  640  EVNQIRREKREHRRSLWWPILVARESGSSGIAIS-----NGQVNSQDFSGMMKTGRKSLQ  694

Query  388  RFT-VVAAQHMHlflmfllpapllmLRAFNVIIFR  287
            RF+ +VA+QHM L ++ L P  LL L AFNV  FR
Sbjct  695  RFSRLVASQHMPLIVVLLFPVKLLCLGAFNVFSFR  729



>ref|XP_010921525.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC105045061 
[Elaeis guineensis]
Length=741

 Score =   132 bits (333),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 68/132 (52%), Positives = 92/132 (70%), Gaps = 8/132 (6%)
 Frame = -2

Query  730  VTDDDDAEKRILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHVE  551
            + D DD+ + + AAK AFLN+PHPLEILSDRSAYGS GTI RDHD+ SY+ SVR +IH +
Sbjct  588  LLDSDDSARLLQAAKLAFLNTPHPLEILSDRSAYGSEGTIYRDHDVNSYVSSVRGVIHQQ  647

Query  550  LSRIRKSKRES----WWPLIVIPGVKAADIFVGRLVRPTGQGQ--FTFAGMFHSGKESLK  389
            L  IRK+K+E     WWPL+    + A+ I  G+   P+   +  F+FAG+FH G+E+LK
Sbjct  648  LILIRKAKKEQHRLVWWPLVATQDLHAS-IITGQYAEPSDSSEHHFSFAGVFHGGRETLK  706

Query  388  RFT-VVAAQHMH  356
            R   +VA+QH+ 
Sbjct  707  RLGRLVASQHVQ  718



>ref|XP_004494932.1| PREDICTED: uncharacterized protein LOC101493817 [Cicer arietinum]
Length=651

 Score =   132 bits (331),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 83/156 (53%), Positives = 106/156 (68%), Gaps = 8/156 (5%)
 Frame = -2

Query  733  PVTDDDDAEKRILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHV  554
            P+++  D E ++ AA+  FLNSPHPLEILSDRSAYG GGTIQRDHDM SYLKSVR +IH 
Sbjct  497  PLSESSDTENQLQAAQLVFLNSPHPLEILSDRSAYGPGGTIQRDHDMNSYLKSVRTVIHQ  556

Query  553  ELSRIR----KSKRESWWPLIVIPGVKAADIFVGRLVRPTG--QGQFTFAGMFHSGKESL  392
            ELS+IR    + KR+  W L+   G    DI  GR V      Q Q  F+G+  +G+ESL
Sbjct  557  ELSQIRMARKEQKRKVRWSLVARGG-SDLDIVGGRSVVSVRIIQDQPPFSGIMMTGRESL  615

Query  391  KRFT-VVAAQHMHlflmfllpapllmLRAFNVIIFR  287
            KRF+ +VA+QHM +FL+ L PA  L+L  +N+I  R
Sbjct  616  KRFSRLVASQHMQMFLVLLFPARFLLLETYNLISLR  651



>emb|CBI36930.3| unnamed protein product [Vitis vinifera]
Length=620

 Score =   131 bits (330),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 69/127 (54%), Positives = 86/127 (68%), Gaps = 24/127 (19%)
 Frame = -2

Query  733  PVTDDDDAEKRILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHV  554
            PV+D +DAE+++LAAK  FLNSPHPLEILSD SAYGS GTIQRDHDMKSYL+SVR +I  
Sbjct  493  PVSDANDAERQLLAAKLVFLNSPHPLEILSDSSAYGSDGTIQRDHDMKSYLRSVRSVIRQ  552

Query  553  ELSRIRKSKRESWWPLIVIPGVKAADIFVGRLVRPTGQGQFTFAGMFHSGKESLKRFT-V  377
            E + IRK+KRE                          + QF F+G+  +G+ESLKRF+ +
Sbjct  553  EQNSIRKTKREQ-----------------------RRKDQFNFSGILQTGRESLKRFSRL  589

Query  376  VAAQHMH  356
            VA+QHMH
Sbjct  590  VASQHMH  596



>gb|AAG10634.1|AC022521_12 Hypothetical protein [Arabidopsis thaliana]
Length=693

 Score =   131 bits (330),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 82/157 (52%), Positives = 109/157 (69%), Gaps = 15/157 (10%)
 Frame = -2

Query  736  PPVTDDDDAEKRILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIH  557
            P + D D  E+R+ AA+T FLN+PHPL+ILSDRSAYGS GTIQRDHDM SYLK+VR +I 
Sbjct  545  PDIEDSD--EERLRAAQTVFLNTPHPLDILSDRSAYGSSGTIQRDHDMNSYLKAVRSVIR  602

Query  556  VELSRIRKSKRES----WWPLIVIPGVKAADIFVGRLVRPTGQ--GQFTFAGMFHSGKES  395
             E+++IR++KRE     WWP++V     ++ I V       GQ  GQ  F+GM  +G++S
Sbjct  603  KEVNQIRRAKREHRRSLWWPILVARESGSSGIAVS-----NGQINGQ-DFSGMMQTGRKS  656

Query  394  LKRFT-VVAAQHMHlflmfllpapllmLRAFNVIIFR  287
            L+RF+ +VA+QHM L ++ L P  LL L AFNV  FR
Sbjct  657  LQRFSRLVASQHMPLIVVMLFPVKLLFLGAFNVFSFR  693



>ref|XP_007163165.1| hypothetical protein PHAVU_001G211900g [Phaseolus vulgaris]
 gb|ESW35159.1| hypothetical protein PHAVU_001G211900g [Phaseolus vulgaris]
Length=708

 Score =   131 bits (330),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 70/131 (53%), Positives = 91/131 (69%), Gaps = 6/131 (5%)
 Frame = -2

Query  730  VTDDDDAEKRILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHVE  551
            +++  D  K+I AA+  FLNSPHPLEILSDRSAYGSGGTIQRDHDM SYLK VR +I  E
Sbjct  556  LSESSDTLKQIRAAQMVFLNSPHPLEILSDRSAYGSGGTIQRDHDMNSYLKCVRTVIRQE  615

Query  550  LSRIRKSKRES----WWPLIVIPGVKAADIFVGRLVRPTG-QGQFTFAGMFHSGKESLKR  386
            LS+IRK++RE     WWPL++  G  +  +  G ++         +F G+ H+G ESLKR
Sbjct  616  LSQIRKARREQRLKVWWPLVLPCGSGSGAVVGGSMISVNVIHDHLSFFGIIHTGSESLKR  675

Query  385  FT-VVAAQHMH  356
            F+ +VA+QHM 
Sbjct  676  FSRLVASQHMQ  686



>ref|NP_563660.1| alpha/beta-Hydrolases superfamily protein [Arabidopsis thaliana]
 gb|AEE27455.1| alpha/beta-Hydrolases superfamily protein [Arabidopsis thaliana]
Length=713

 Score =   131 bits (330),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 82/157 (52%), Positives = 109/157 (69%), Gaps = 15/157 (10%)
 Frame = -2

Query  736  PPVTDDDDAEKRILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIH  557
            P + D D  E+R+ AA+T FLN+PHPL+ILSDRSAYGS GTIQRDHDM SYLK+VR +I 
Sbjct  565  PDIEDSD--EERLRAAQTVFLNTPHPLDILSDRSAYGSSGTIQRDHDMNSYLKAVRSVIR  622

Query  556  VELSRIRKSKRES----WWPLIVIPGVKAADIFVGRLVRPTGQ--GQFTFAGMFHSGKES  395
             E+++IR++KRE     WWP++V     ++ I V       GQ  GQ  F+GM  +G++S
Sbjct  623  KEVNQIRRAKREHRRSLWWPILVARESGSSGIAVS-----NGQINGQ-DFSGMMQTGRKS  676

Query  394  LKRFT-VVAAQHMHlflmfllpapllmLRAFNVIIFR  287
            L+RF+ +VA+QHM L ++ L P  LL L AFNV  FR
Sbjct  677  LQRFSRLVASQHMPLIVVMLFPVKLLFLGAFNVFSFR  713



>gb|AAM98103.1| At1g02660/T14P4_9 [Arabidopsis thaliana]
Length=713

 Score =   130 bits (328),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 82/157 (52%), Positives = 109/157 (69%), Gaps = 15/157 (10%)
 Frame = -2

Query  736  PPVTDDDDAEKRILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIH  557
            P + D D  E+R+ AA+T FLN+PHPL+ILSDRSAYGS GTIQRDHDM SYLK+VR +I 
Sbjct  565  PDIEDSD--EERLRAAQTVFLNTPHPLDILSDRSAYGSSGTIQRDHDMNSYLKAVRSVIR  622

Query  556  VELSRIRKSKRES----WWPLIVIPGVKAADIFVGRLVRPTGQ--GQFTFAGMFHSGKES  395
             E+++IR++KRE     WWP++V     ++ I V       GQ  GQ  F+GM  +G++S
Sbjct  623  KEVNQIRRAKREHRRSLWWPILVARESGSSVIAVS-----NGQINGQ-DFSGMMQTGRKS  676

Query  394  LKRFT-VVAAQHMHlflmfllpapllmLRAFNVIIFR  287
            L+RF+ +VA+QHM L ++ L P  LL L AFNV  FR
Sbjct  677  LQRFSRLVASQHMPLIVVMLFPVKLLFLGAFNVFSFR  713



>ref|XP_002892116.1| lipase class 3 family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68375.1| lipase class 3 family protein [Arabidopsis lyrata subsp. lyrata]
Length=715

 Score =   130 bits (328),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 77/155 (50%), Positives = 105/155 (68%), Gaps = 15/155 (10%)
 Frame = -2

Query  727  TDDDDAEKRILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHVEL  548
             ++D  E R+ AA+T FLN+PHPL+ILSDRSAYGS GTIQRDHDM SYLK+VR +I  E+
Sbjct  568  NNEDSEEDRLRAAQTVFLNTPHPLDILSDRSAYGSSGTIQRDHDMNSYLKAVRSVIRKEV  627

Query  547  SRIRKSKRES----WWPLIVIPGVKAADIFVGRLVRPTGQGQFT---FAGMFHSGKESLK  389
            ++IR++KRE     WWP++V     ++ I +         GQ     F+GM  +G++SL+
Sbjct  628  NQIRRAKREHRRSLWWPILVARESGSSGIAI-------SNGQINSQDFSGMMQTGRKSLQ  680

Query  388  RFT-VVAAQHMHlflmfllpapllmLRAFNVIIFR  287
            RF+ +VA+QHM L ++ L P  LL L AFNV  FR
Sbjct  681  RFSRLVASQHMPLIVVMLFPVKLLFLGAFNVFSFR  715



>ref|XP_010522821.1| PREDICTED: uncharacterized protein LOC104801300 [Tarenaya hassleriana]
Length=732

 Score =   130 bits (328),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 68/131 (52%), Positives = 94/131 (72%), Gaps = 8/131 (6%)
 Frame = -2

Query  730  VTDDDDAEKRILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHVE  551
            ++D ++A K++ AA+  FLNSPHPLEIL DRSAYGSGGTIQRDHDM SYLKSVR +I  E
Sbjct  588  LSDMEEATKQLRAAQAVFLNSPHPLEILGDRSAYGSGGTIQRDHDMNSYLKSVRSVIRKE  647

Query  550  LSRIRKSKRES----WWPLIVIPGVKAADIFVGRLVRPTGQGQFT-FAGMFHSGKESLKR  386
            ++R+RK++R      WWP++V  G     +  G ++R   Q     F+GM  +G+ES++R
Sbjct  648  VNRLRKARRGQGRSIWWPILV--GQDRDRVNSGIVIRGRQQTNSQDFSGMMKTGRESVRR  705

Query  385  FT-VVAAQHMH  356
            F+ +VA+QHMH
Sbjct  706  FSRLVASQHMH  716



>gb|EYU46796.1| hypothetical protein MIMGU_mgv1a002033mg [Erythranthe guttata]
Length=724

 Score =   130 bits (328),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 73/133 (55%), Positives = 91/133 (68%), Gaps = 10/133 (8%)
 Frame = -2

Query  727  TDDDDAEKRILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHVEL  548
            +D  +A+K+I AA+  FLNSPHPLEILSDRSAYGS GTIQRDHDM SYLKSVR  I  EL
Sbjct  570  SDISEAQKQIQAAQIVFLNSPHPLEILSDRSAYGSQGTIQRDHDMSSYLKSVRSFIRHEL  629

Query  547  ----SRIRKSKRESWWPLIVIPGVKAADIFVGRLVRP----TGQGQFTFAGMFHSGKESL  392
                   R+ +++ WWPL+   GV A  + V R V       GQGQ  F+G+  +G +SL
Sbjct  630  VRTRRARRERRKKIWWPLVAPRGVNAG-LIVTRSVSSGSNMIGQGQLNFSGIIRTGADSL  688

Query  391  KRFT-VVAAQHMH  356
            KRF+ +VA+QHMH
Sbjct  689  KRFSRLVASQHMH  701



>ref|XP_003520748.1| PREDICTED: uncharacterized protein LOC100788786 [Glycine max]
Length=701

 Score =   130 bits (327),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 79/153 (52%), Positives = 105/153 (69%), Gaps = 10/153 (7%)
 Frame = -2

Query  730  VTDDDDAEKRILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHVE  551
            +++  D  K+I  A+  FLN+PHPLEILSDRSAYG GGTIQRDHDM SYLK VR +I  E
Sbjct  554  LSESSDTLKQIYKAQMVFLNTPHPLEILSDRSAYGFGGTIQRDHDMNSYLKCVRTVIRQE  613

Query  550  LSRIRKSKRES----WWPLIVIPGVKAADIFVGRLVRPTGQGQFTFAGMFHSGKESLKRF  383
            L++IRK++RE     WWPL V+P     +I  G ++    Q Q +F+G+   G+ESLKRF
Sbjct  614  LNQIRKARREQRQKVWWPL-VLPRGSDTNIVGGSMI----QDQPSFSGIIQIGRESLKRF  668

Query  382  T-VVAAQHMHlflmfllpapllmLRAFNVIIFR  287
            + +V +QHM LF+  L PA LL++ A N+I  R
Sbjct  669  SRLVRSQHMQLFVALLFPARLLLVGACNLISLR  701



>ref|XP_010095302.1| hypothetical protein L484_001911 [Morus notabilis]
 gb|EXB59331.1| hypothetical protein L484_001911 [Morus notabilis]
Length=725

 Score =   130 bits (327),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 72/132 (55%), Positives = 85/132 (64%), Gaps = 25/132 (19%)
 Frame = -2

Query  733  PVTD-DDDAEKRILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIH  557
            P++D +D AEK++  AK  FLNSPHPLEIL DRSAYGSGGTIQRDHDM SYLK V     
Sbjct  590  PLSDLNDQAEKQLRDAKAVFLNSPHPLEILRDRSAYGSGGTIQRDHDMNSYLKCV-----  644

Query  556  VELSRIRKSKRESWWPLIVIPGVKAADIFVGRLVRP----TGQGQFTFAGMFHSGKESLK  389
                         WWPL+   GV A  I +GR V       GQ QF F+G+  +GKESLK
Sbjct  645  -------------WWPLVAPHGVNAG-IVIGRPVSTGMSNVGQEQFNFSGIVQNGKESLK  690

Query  388  RFT-VVAAQHMH  356
            RF+ +VA+QHMH
Sbjct  691  RFSRLVASQHMH  702



>gb|AAK82508.1| At1g02660/T14P4_9 [Arabidopsis thaliana]
Length=713

 Score =   130 bits (326),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 82/157 (52%), Positives = 108/157 (69%), Gaps = 15/157 (10%)
 Frame = -2

Query  736  PPVTDDDDAEKRILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIH  557
            P + D D  E+R+ AA+T FLN+PHPL+ILSDRSAYGS GTIQRDHDM SYLK VR +I 
Sbjct  565  PDIEDSD--EERLRAAQTVFLNTPHPLDILSDRSAYGSSGTIQRDHDMNSYLKPVRSVIR  622

Query  556  VELSRIRKSKRES----WWPLIVIPGVKAADIFVGRLVRPTGQ--GQFTFAGMFHSGKES  395
             E+++IR++KRE     WWP++V     ++ I V       GQ  GQ  F+GM  +G++S
Sbjct  623  KEVNQIRRAKREHRRSLWWPILVARESGSSVIAVS-----NGQINGQ-DFSGMMQTGRKS  676

Query  394  LKRFT-VVAAQHMHlflmfllpapllmLRAFNVIIFR  287
            L+RF+ +VA+QHM L ++ L P  LL L AFNV  FR
Sbjct  677  LQRFSRLVASQHMPLIVVMLFPVKLLFLGAFNVFSFR  713



>gb|KHN43471.1| Lipase [Glycine soja]
Length=667

 Score =   129 bits (323),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 67/116 (58%), Positives = 85/116 (73%), Gaps = 9/116 (8%)
 Frame = -2

Query  715  DAEKRILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHVELSRIR  536
            D  K+I AA+  FLN+PHPLEILSDRSAYGSGGTIQRDHDM SYLK VR +I  EL++IR
Sbjct  554  DTLKQIHAAQLVFLNTPHPLEILSDRSAYGSGGTIQRDHDMNSYLKCVRTVICQELNQIR  613

Query  535  KSKRE----SWWPLIVIPGVKAADIFVGRLVRPTGQGQFTFAGMFHSGKESLKRFT  380
            K++RE    +WWPL V+P  +  DI  G ++    Q + +F+G+   GKESLKRF+
Sbjct  614  KARREQRRKAWWPL-VLPHGRNTDIVGGSMI----QDRPSFSGIIQIGKESLKRFS  664



>ref|XP_006303577.1| hypothetical protein CARUB_v10011093mg [Capsella rubella]
 gb|EOA36475.1| hypothetical protein CARUB_v10011093mg [Capsella rubella]
Length=716

 Score =   129 bits (324),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 76/157 (48%), Positives = 106/157 (68%), Gaps = 15/157 (10%)
 Frame = -2

Query  733  PVTDDDDAEKRILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHV  554
            P  ++ + ++R+ AA+T FLN+PHPL+ILSDR+AYGS GTIQRDHDM SYLKSVR +I  
Sbjct  567  PDNEESEEKQRLTAAQTVFLNTPHPLDILSDRAAYGSSGTIQRDHDMNSYLKSVRSVIRK  626

Query  553  ELSRIRKSKRES----WWPLIVIPGVKAADIFVGRLVRPTGQGQFT---FAGMFHSGKES  395
            E+++IR+ KRE     WWP++V     ++ I +         GQ     F+GM  +G++S
Sbjct  627  EVNQIRREKREHRRSLWWPILVARESGSSGIGM-------SNGQMNSQDFSGMMKTGRKS  679

Query  394  LKRFT-VVAAQHMHlflmfllpapllmLRAFNVIIFR  287
            L+RF+ +VA+QHM L ++ L P  LL L AFNV  FR
Sbjct  680  LQRFSRLVASQHMPLIVVLLFPVKLLCLGAFNVFSFR  716



>emb|CDY37466.1| BnaC08g46040D [Brassica napus]
Length=679

 Score =   129 bits (323),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 79/153 (52%), Positives = 105/153 (69%), Gaps = 14/153 (9%)
 Frame = -2

Query  730  VTDDDDAEKRILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHVE  551
            +TD+D  E+R  AA+T FLN+PHPL+IL DR+AYGS GTIQRDHDM SYLK+VR +I  E
Sbjct  536  LTDEDTEEER--AAQTLFLNTPHPLDILGDRAAYGSSGTIQRDHDMNSYLKAVRSVIRKE  593

Query  550  LSRIRKSKRES----WWPLIVIPGVKAADIFVGRLVRPTGQGQFTFAGMFHSGKESLKRF  383
            +S+IR+ KRE     WWP++V           GR  R    GQ  F+GM  +G++SL+RF
Sbjct  594  VSQIRREKREHRRSLWWPVLVTRESS------GRSGRQINGGQ-DFSGMMKTGRKSLQRF  646

Query  382  T-VVAAQHMHlflmfllpapllmLRAFNVIIFR  287
            + +VA+QHM L ++ L+P  L+ L AFNV  FR
Sbjct  647  SRLVASQHMPLIVVLLVPVKLMFLGAFNVFSFR  679



>ref|XP_002301502.2| hypothetical protein POPTR_0002s19900g [Populus trichocarpa]
 gb|EEE80775.2| hypothetical protein POPTR_0002s19900g [Populus trichocarpa]
Length=676

 Score =   128 bits (322),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 69/130 (53%), Positives = 87/130 (67%), Gaps = 19/130 (15%)
 Frame = -2

Query  733  PVTDDDDAEKRILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHV  554
            P +D  DAEK++ +A+  FLNSPHPLEIL DRSAYGS GTIQRDHDM SY KSVR++I  
Sbjct  539  PPSDTSDAEKQLRSAQIVFLNSPHPLEILRDRSAYGSEGTIQRDHDMNSYFKSVRNVIRQ  598

Query  553  ELSRIRKSKRE---SWWPLIVIPGVKAADIFVGRLVRPTGQGQFTFAGMFHSGKESLKRF  383
            EL+RIRK++R+    +W  IV P    A I V               G+  +G+ESLKRF
Sbjct  599  ELNRIRKARRQHRRKFWLSIVAPHGNDASILV---------------GILQTGRESLKRF  643

Query  382  T-VVAAQHMH  356
            + +VA+QHMH
Sbjct  644  SRLVASQHMH  653



>emb|CDY32473.1| BnaA09g51230D [Brassica napus]
Length=685

 Score =   128 bits (321),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 76/153 (50%), Positives = 107/153 (70%), Gaps = 13/153 (8%)
 Frame = -2

Query  730  VTDDDDAEKRILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHVE  551
            + +D + E+R+ AA+T FLN+PHPL+IL DR+AYGS GTIQRDHDM SYLK+VR +I  E
Sbjct  541  LLEDAEEEERLRAAQTVFLNTPHPLDILGDRAAYGSSGTIQRDHDMNSYLKAVRSVIRKE  600

Query  550  LSRIRKSKRES----WWPLIVIPGVKAADIFVGRLVRPTGQGQFTFAGMFHSGKESLKRF  383
            +S+IR+ KRE     WWP++V    + +    GR +   GQ    F+GM  +G++SL+RF
Sbjct  601  VSQIRREKREHRRSLWWPILV---ARESSGSSGRQI--NGQ---DFSGMMKTGRKSLQRF  652

Query  382  T-VVAAQHMHlflmfllpapllmLRAFNVIIFR  287
            + +VA+QHM L ++ L+P  L+ L AFNV  FR
Sbjct  653  SRLVASQHMPLIVVLLVPVKLMFLGAFNVFGFR  685



>ref|XP_009118752.1| PREDICTED: uncharacterized protein LOC103843744 [Brassica rapa]
Length=686

 Score =   127 bits (320),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 76/153 (50%), Positives = 107/153 (70%), Gaps = 13/153 (8%)
 Frame = -2

Query  730  VTDDDDAEKRILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHVE  551
            + +D + E+R+ AA+T FLN+PHPL+IL DR+AYGS GTIQRDHDM SYLK+VR +I  E
Sbjct  542  LLEDAEEEERLRAAQTVFLNTPHPLDILGDRAAYGSSGTIQRDHDMNSYLKAVRSVIRKE  601

Query  550  LSRIRKSKRES----WWPLIVIPGVKAADIFVGRLVRPTGQGQFTFAGMFHSGKESLKRF  383
            +S+IR+ KRE     WWP++V    + +    GR +   GQ    F+GM  +G++SL+RF
Sbjct  602  VSQIRREKREHRRSLWWPILV---ARESSGSSGRQI--NGQ---DFSGMMKTGRKSLQRF  653

Query  382  T-VVAAQHMHlflmfllpapllmLRAFNVIIFR  287
            + +VA+QHM L ++ L+P  L+ L AFNV  FR
Sbjct  654  SRLVASQHMPLIVVLLVPVKLMFLGAFNVFGFR  686



>ref|XP_009111236.1| PREDICTED: uncharacterized protein LOC103836694 [Brassica rapa]
Length=664

 Score =   125 bits (314),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 81/155 (52%), Positives = 106/155 (68%), Gaps = 16/155 (10%)
 Frame = -2

Query  724  DDDDAEKRILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHVELS  545
            D+++ E+R+ AA T FLN+PHPL+ILSDRSAYGS GTIQRDHDM SYLK+VR +I  E+S
Sbjct  517  DEEEEEQRLRAAHTVFLNTPHPLDILSDRSAYGSSGTIQRDHDMNSYLKAVRSVIRKEVS  576

Query  544  RIRKSKRES----WWPLIVIPGVKAADIFVGRLVRPT-GQGQFT---FAGMFHSGKESLK  389
            +IR+ KRE     WWP++V           GR      G GQ +   F+GM  +G++SL+
Sbjct  577  QIRRLKREHRRSLWWPILVATE-------SGRTSETAIGNGQISGQDFSGMMKTGRKSLQ  629

Query  388  RFT-VVAAQHMHlflmfllpapllmLRAFNVIIFR  287
            RF+ +VA+QHM L L+ L P  LL L AFNV+ FR
Sbjct  630  RFSRLVASQHMPLILVLLFPVKLLFLEAFNVLSFR  664



>ref|XP_009401631.1| PREDICTED: uncharacterized protein LOC103985608 [Musa acuminata 
subsp. malaccensis]
Length=728

 Score =   125 bits (314),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 68/132 (52%), Positives = 86/132 (65%), Gaps = 8/132 (6%)
 Frame = -2

Query  730  VTDDDDAEKRILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHVE  551
            + D +D E+ + AA  AFLNSPHPLEILSDRSAYGS GT+ RDHD  SYL+SVR +I  E
Sbjct  575  LADSNDTERLLHAATLAFLNSPHPLEILSDRSAYGSEGTVYRDHDTNSYLRSVRGVIRQE  634

Query  550  LSRIRKSKRES----WWPLIVIPGVKAADIFVGRLVRPT--GQGQFTFAGMFHSGKESLK  389
            L  IRK KRE     WWPL+    +    +   R    T   Q  F+FAG+ H G+++LK
Sbjct  635  LKLIRKVKREQRRKIWWPLVATQDMHPR-VVTSRSAGSTISTQRNFSFAGVIHGGRQTLK  693

Query  388  RFT-VVAAQHMH  356
            RF  +VA+QH+H
Sbjct  694  RFGRLVASQHVH  705



>ref|XP_003625952.1| Triacylglycerol lipase [Medicago truncatula]
 gb|AES82170.1| triacylglycerol lipase [Medicago truncatula]
Length=656

 Score =   124 bits (311),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 71/134 (53%), Positives = 90/134 (67%), Gaps = 9/134 (7%)
 Frame = -2

Query  733  PVTDDDDAEKRILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHV  554
            P+++ +D E ++ AAK  FLNSPHPLEILSDRSAYG GG I RDHDM SYLKSVR +I  
Sbjct  511  PLSESNDTENQLKAAKLVFLNSPHPLEILSDRSAYGPGGAIHRDHDMNSYLKSVRTVIRQ  570

Query  553  ELSRIRKS-----KRESWWPLIVIPGVKAADIFVGRLVRPTG--QGQFTFAGMFHSGKES  395
            ELS+IR +     +R+  WPL V   V  ADI  GR +      Q Q  F+G+  +G++S
Sbjct  571  ELSQIRTAARRELRRKVRWPL-VARRVSDADIVGGRSMVSVHIIQDQPPFSGIKQTGRKS  629

Query  394  LKRFT-VVAAQHMH  356
            LKRF  +VA+QHM 
Sbjct  630  LKRFCRLVASQHMQ  643



>gb|KJB24401.1| hypothetical protein B456_004G143700 [Gossypium raimondii]
Length=710

 Score =   124 bits (310),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 64/123 (52%), Positives = 84/123 (68%), Gaps = 7/123 (6%)
 Frame = -2

Query  733  PVTDDDDAEKRILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHV  554
            P +++D  EK +  A+  F NSPHPL+ILSDR+AYGS GTI RDHDMKSYLKS+R +I  
Sbjct  587  PFSNEDSEEKLLRTAQRIFFNSPHPLDILSDRTAYGSEGTIIRDHDMKSYLKSIREVIRQ  646

Query  553  ELSRIRKSKRES----WWPLIVIPGVKAADIFVGRLVRPTG--QGQFTFAGMFHSGKESL  392
            E +RIRK+KRE     WW L++  GV A  I + + +  TG  +GQF  A +  +G+ SL
Sbjct  647  EQNRIRKTKREQRRKDWWSLVLSRGVSAG-IILRKSITTTGLHRGQFNLAIVLQTGRASL  705

Query  391  KRF  383
            KRF
Sbjct  706  KRF  708



>gb|KHN19225.1| DNA-directed RNA polymerase III subunit RPC8 [Glycine soja]
Length=929

 Score =   122 bits (306),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 63/119 (53%), Positives = 82/119 (69%), Gaps = 9/119 (8%)
 Frame = -2

Query  730  VTDDDDAEKRILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHVE  551
            +++  D  K+I  A+  FLN+PHPLEILSDRSAYG GGTIQRDHDM SYLK VR +I  E
Sbjct  554  LSESSDTLKQIYKAQMVFLNTPHPLEILSDRSAYGFGGTIQRDHDMNSYLKCVRTVIRQE  613

Query  550  LSRIRKSKRES----WWPLIVIPGVKAADIFVGRLVRPTGQGQFTFAGMFHSGKESLKR  386
            L++IRK++RE     WWPL V+P     +I  G ++    Q Q +F+G+   G+ESLKR
Sbjct  614  LNQIRKARREQRQKVWWPL-VLPRGSDTNIVGGSMI----QDQPSFSGIIQIGRESLKR  667



>ref|XP_010938308.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC105057406 
[Elaeis guineensis]
Length=722

 Score =   120 bits (300),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 63/130 (48%), Positives = 89/130 (68%), Gaps = 8/130 (6%)
 Frame = -2

Query  730  VTDDDDAEKRILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHVE  551
            + D DD+ + + AA++AF+N PHPLEILS RSAYG  GT+ RDH+M SYL+S R +IH E
Sbjct  572  LLDSDDSARLLQAAQSAFINIPHPLEILSHRSAYGPQGTVYRDHNMNSYLRSFRAVIHQE  631

Query  550  LSRIRKSKRES----WWPLIVIPGVKAADIFVGRLV--RPTGQGQFTFAGMFHSGKESLK  389
            L  IRK+KRE     WWPL+   G+ A+ I  G+      + + +F+FAG+ H GKE++K
Sbjct  632  LQLIRKAKREQRRQVWWPLVAAHGLHAS-IITGQHAGSSTSTEHRFSFAGVLHVGKETVK  690

Query  388  RFT-VVAAQH  362
            +F  + A+QH
Sbjct  691  QFGRLFASQH  700



>ref|XP_008786228.1| PREDICTED: uncharacterized protein LOC103704640 [Phoenix dactylifera]
 ref|XP_008786229.1| PREDICTED: uncharacterized protein LOC103704640 [Phoenix dactylifera]
Length=724

 Score =   118 bits (295),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 70/155 (45%), Positives = 103/155 (66%), Gaps = 8/155 (5%)
 Frame = -2

Query  730  VTDDDDAEKRILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHVE  551
            + D DD+ + + AA   F+N+PHPLEILSDRSAYGS GT+ RDH+M SYL+SVR +I  E
Sbjct  571  LLDSDDSARLLQAAHCVFMNTPHPLEILSDRSAYGSEGTVYRDHNMNSYLRSVRGVIRQE  630

Query  550  LSRIRKSKRES----WWPLIVIPGVKAADIFVGRLV--RPTGQGQFTFAGMFHSGKESLK  389
            L  IRK+KRE     WW L+    + A+ I  G+      + + +F+FAG+ H GKE+LK
Sbjct  631  LKLIRKAKRERRHQVWWSLVATQDLHAS-IITGQHAGSSTSSKHRFSFAGVLHGGKETLK  689

Query  388  RFT-VVAAQHMHlflmfllpapllmLRAFNVIIFR  287
            +F  + A++H+ + ++ L PA +L+LR  ++  FR
Sbjct  690  QFGRLFASRHVQMLVVLLFPARVLLLRTLSIFNFR  724



>ref|XP_010556704.1| PREDICTED: uncharacterized protein LOC104825945 [Tarenaya hassleriana]
Length=718

 Score =   117 bits (294),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 61/129 (47%), Positives = 87/129 (67%), Gaps = 12/129 (9%)
 Frame = -2

Query  727  TDDDDAEKRILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHVEL  548
            +D + AE+++ +A+  FLN+PHPLEILSD+SAYGS GT+ RDHDM SYLKS++ +I  E+
Sbjct  569  SDTEIAEEQLRSAQMVFLNTPHPLEILSDKSAYGSRGTVHRDHDMNSYLKSLKRVIRKEV  628

Query  547  SRIRKSKRES----WWPLIVIPGVKAADIFVGRLVRPTGQGQFTFAGMFHSGKESLKRFT  380
            +R+RK+KRE     WWP++V          V   +R    GQ  F+GM  +G+ES+ RF 
Sbjct  629  NRVRKAKREQRRSLWWPILVFRDR------VNSGIRQQMNGQ-DFSGMVKAGRESVARFN  681

Query  379  -VVAAQHMH  356
             +V + HMH
Sbjct  682  RLVPSHHMH  690



>gb|KFK42621.1| hypothetical protein AALP_AA1G019100 [Arabis alpina]
Length=686

 Score =   117 bits (292),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 73/146 (50%), Positives = 98/146 (67%), Gaps = 13/146 (9%)
 Frame = -2

Query  703  RILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHVELSRIRKSKR  524
            R+ AA + FLN+PHPL+ILSDRSAYGS G+I RDHDM SYLK+VR +I  E+++IRK+KR
Sbjct  547  RLRAAHSVFLNTPHPLDILSDRSAYGSNGSIGRDHDMNSYLKAVRSVIRKEVTQIRKAKR  606

Query  523  ES----WWPLIVIPGVKAADIFVGRLVRPTGQ--GQFTFAGMFHSGKESLKRFT-VVAAQ  365
            E     WWP++V       D          GQ  GQ  F+GM  +G++SL+RF+ +VA+Q
Sbjct  607  EHRQSLWWPILV-----TRDRVSSGNAISNGQINGQ-DFSGMMKTGRKSLQRFSRLVASQ  660

Query  364  HMHlflmfllpapllmLRAFNVIIFR  287
            HM L ++ L P  L+ + AFNV  FR
Sbjct  661  HMPLIVVLLFPVKLMFVGAFNVFSFR  686



>emb|CDY15436.1| BnaA08g27200D [Brassica napus]
Length=622

 Score =   112 bits (280),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 75/147 (51%), Positives = 98/147 (67%), Gaps = 23/147 (16%)
 Frame = -2

Query  724  DDDDAEKRILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHVELS  545
            D+++ E+R+ AA T FLN+PHPL+ILSDRSAYGS GTIQRDHDM SYLK+VR +I  E+S
Sbjct  498  DEEEEEQRLRAAHTVFLNTPHPLDILSDRSAYGSSGTIQRDHDMNSYLKAVRSVIRKEVS  557

Query  544  RIRKSKRESWWPLIVIPGVKAADIFVGRLVRPTGQGQFTFAGMFHSGKESLKRFT-VVAA  368
            +IR+ KRE                      R +  GQ  F+GM  +G++SL+RF+ +VA+
Sbjct  558  QIRRLKREH---------------------RRSLCGQ-DFSGMMKTGRKSLQRFSRLVAS  595

Query  367  QHMHlflmfllpapllmLRAFNVIIFR  287
            QHM L L+ L P  LL L AFNV+ FR
Sbjct  596  QHMPLILVLLFPVKLLFLEAFNVLSFR  622



>ref|XP_009382508.1| PREDICTED: uncharacterized protein LOC103970453 [Musa acuminata 
subsp. malaccensis]
Length=717

 Score =   103 bits (256),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 61/127 (48%), Positives = 80/127 (63%), Gaps = 8/127 (6%)
 Frame = -2

Query  715  DAEKRILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHVELSRIR  536
            D+E+ + AA  AFLNSPHPL+ILSD SAYGS GT+ RDHD  SYL+S+R ++  EL  IR
Sbjct  571  DSERLLQAASLAFLNSPHPLQILSDPSAYGSEGTVYRDHDTNSYLRSIRGVVRQELKLIR  630

Query  535  KSKRES----WWPLIVIPGVKAADIFVGRLVRPTGQGQ--FTFAGMFHSGKESLKRFT-V  377
            K++RE     WWPL+    V    +   R V  T   Q  F+F  + H G  +LKRF  +
Sbjct  631  KARRERRRRMWWPLVATQDVYPT-VVTTRSVGSTNSNQNHFSFVSVLHGGSRTLKRFARL  689

Query  376  VAAQHMH  356
            VA+Q +H
Sbjct  690  VASQRVH  696



>ref|XP_011627460.1| PREDICTED: uncharacterized protein LOC18445098 [Amborella trichopoda]
Length=803

 Score =   102 bits (253),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 59/112 (53%), Positives = 70/112 (63%), Gaps = 9/112 (8%)
 Frame = -2

Query  694  AAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHVELSRIRKSKRE--  521
            AA+ AFLNSPHPLE LSDR AYG+ GTI RDHD  SYLK+VR +I  EL  +RK +RE  
Sbjct  662  AAQKAFLNSPHPLETLSDRGAYGAEGTIYRDHDSNSYLKTVRSVIRQELKSLRKVEREQR  721

Query  520  --SWWPLIVIPGVKAADI---FVGRLVRPT-GQGQFTFAGMFHSGKESLKRF  383
              +WWPLI   G  A  +   F G L R T  + +    G   SG ESL+RF
Sbjct  722  RRAWWPLIA-EGPSATPLGVRFSGCLGRNTKDRARAGLVGAVQSGGESLRRF  772



>gb|ERN16773.1| hypothetical protein AMTR_s00057p00060720 [Amborella trichopoda]
Length=819

 Score =   102 bits (253),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 59/112 (53%), Positives = 70/112 (63%), Gaps = 9/112 (8%)
 Frame = -2

Query  694  AAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHVELSRIRKSKRE--  521
            AA+ AFLNSPHPLE LSDR AYG+ GTI RDHD  SYLK+VR +I  EL  +RK +RE  
Sbjct  678  AAQKAFLNSPHPLETLSDRGAYGAEGTIYRDHDSNSYLKTVRSVIRQELKSLRKVEREQR  737

Query  520  --SWWPLIVIPGVKAADI---FVGRLVRPT-GQGQFTFAGMFHSGKESLKRF  383
              +WWPLI   G  A  +   F G L R T  + +    G   SG ESL+RF
Sbjct  738  RRAWWPLIA-EGPSATPLGVRFSGCLGRNTKDRARAGLVGAVQSGGESLRRF  788



>ref|XP_010559192.1| PREDICTED: uncharacterized protein LOC104827671 [Tarenaya hassleriana]
Length=636

 Score = 92.8 bits (229),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = -2

Query  727  TDDDDAEKRILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHVEL  548
            TD  +AEK + AAK  FLNSPHPLEILSDRSAYGS G I+RDHDM SYLK+++H+I  EL
Sbjct  514  TDTGEAEKELRAAKRMFLNSPHPLEILSDRSAYGSEGIIKRDHDMSSYLKALKHMIRQEL  573

Query  547  SRIR  536
             R++
Sbjct  574  KRMK  577



>ref|XP_010468944.1| PREDICTED: uncharacterized protein LOC104749064 [Camelina sativa]
Length=655

 Score = 91.7 bits (226),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 46/88 (52%), Positives = 61/88 (69%), Gaps = 5/88 (6%)
 Frame = -2

Query  724  DDDDAEKRILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHVELS  545
            + D+ EKR+ AAK  F NSPHPLEILSDR +YGS G I+R+HDM SYLK++RH+I  EL 
Sbjct  525  NTDETEKRLRAAKIVFFNSPHPLEILSDRRSYGSEGKIKRNHDMSSYLKALRHVIRKELK  584

Query  544  RIRKSKRESWWPLIVIPGVKAADIFVGR  461
            +I K++R+ W     I  +    +F GR
Sbjct  585  QI-KAERDHWRRKFFIINI----LFTGR  607



>ref|XP_010413272.1| PREDICTED: uncharacterized protein LOC104699629 isoform X1 [Camelina 
sativa]
Length=651

 Score = 91.7 bits (226),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 46/88 (52%), Positives = 61/88 (69%), Gaps = 5/88 (6%)
 Frame = -2

Query  724  DDDDAEKRILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHVELS  545
            + D+ EKR+ AAK  F NSPHPLEILSDR +YGS G I+R+HDM SYLK++RH+I  EL 
Sbjct  521  NTDETEKRLRAAKIVFFNSPHPLEILSDRRSYGSEGKIKRNHDMSSYLKALRHVIRKELK  580

Query  544  RIRKSKRESWWPLIVIPGVKAADIFVGR  461
            +I K++R+ W     I  +    +F GR
Sbjct  581  QI-KAERDHWRRKFFIINI----LFTGR  603



>ref|XP_010512645.1| PREDICTED: uncharacterized protein LOC104788585 isoform X1 [Camelina 
sativa]
 ref|XP_010512646.1| PREDICTED: uncharacterized protein LOC104788585 isoform X2 [Camelina 
sativa]
Length=656

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 55/70 (79%), Gaps = 1/70 (1%)
 Frame = -2

Query  724  DDDDAEKRILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHVELS  545
            + D+ EKR+ AAK  F NSPHPLEILSDR +YGS G I+R+HDM SYLK++RH+I  EL 
Sbjct  526  NTDETEKRLRAAKIVFFNSPHPLEILSDRRSYGSEGKIKRNHDMSSYLKALRHVIRKELK  585

Query  544  RIRKSKRESW  515
            +I K++R+ W
Sbjct  586  QI-KAERDHW  594



>ref|XP_010413273.1| PREDICTED: uncharacterized protein LOC104699629 isoform X2 [Camelina 
sativa]
Length=651

 Score = 91.3 bits (225),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 55/70 (79%), Gaps = 1/70 (1%)
 Frame = -2

Query  724  DDDDAEKRILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHVELS  545
            + D+ EKR+ AAK  F NSPHPLEILSDR +YGS G I+R+HDM SYLK++RH+I  EL 
Sbjct  521  NTDETEKRLRAAKIVFFNSPHPLEILSDRRSYGSEGKIKRNHDMSSYLKALRHVIRKELK  580

Query  544  RIRKSKRESW  515
            +I K++R+ W
Sbjct  581  QI-KAERDHW  589



>ref|XP_006402367.1| hypothetical protein EUTSA_v10005837mg [Eutrema salsugineum]
 gb|ESQ43820.1| hypothetical protein EUTSA_v10005837mg [Eutrema salsugineum]
Length=636

 Score = 90.9 bits (224),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 49/112 (44%), Positives = 65/112 (58%), Gaps = 25/112 (22%)
 Frame = -2

Query  724  DDDDAEKRILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHVELS  545
            D D+ EK + AAK+ F NSPHPLEILSDR +YGS G I+R+HDM SYLK++RH+I  EL 
Sbjct  507  DTDETEKGLRAAKSVFFNSPHPLEILSDRWSYGSEGKIKRNHDMSSYLKALRHVIRKELK  566

Query  544  RIRKSKRESWWPLIVIPGVKAADIFVGRLVRPTGQGQFTFAGMFHSGKESLK  389
            +I K +R+ W                        Q +F    +  +GK+SLK
Sbjct  567  QI-KGERDQW------------------------QAKFLVVNIIRTGKDSLK  593



>emb|CDY11429.1| BnaA09g39950D [Brassica napus]
Length=628

 Score = 90.5 bits (223),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 43/79 (54%), Positives = 58/79 (73%), Gaps = 1/79 (1%)
 Frame = -2

Query  724  DDDDAEKRILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHVELS  545
            + D+ EK + AAKT F NSPHPLEILSDR +YGS G I+R+HDM SYLK++RH+I  EL 
Sbjct  497  NTDETEKGLRAAKTVFFNSPHPLEILSDRRSYGSEGKIKRNHDMSSYLKALRHVIRKELK  556

Query  544  RIRKSKRESWWPLIVIPGV  488
            +I K++R+ W    +I  +
Sbjct  557  QI-KAERDQWRAKFLIVNI  574



>gb|KFK35428.1| hypothetical protein AALP_AA5G283200 [Arabis alpina]
Length=612

 Score = 90.5 bits (223),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 55/70 (79%), Gaps = 1/70 (1%)
 Frame = -2

Query  724  DDDDAEKRILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHVELS  545
            + D+ EK + AAK  F NSPHPLEILSDRS+YGS G I+R+HDM SYLK++RH+I  EL 
Sbjct  480  NTDETEKGLRAAKRVFFNSPHPLEILSDRSSYGSEGKIKRNHDMSSYLKALRHVIRKELK  539

Query  544  RIRKSKRESW  515
            +I K++R+ W
Sbjct  540  QI-KAERDKW  548



>ref|XP_006292839.1| hypothetical protein CARUB_v10019099mg [Capsella rubella]
 gb|EOA25737.1| hypothetical protein CARUB_v10019099mg [Capsella rubella]
Length=647

 Score = 90.5 bits (223),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 44/88 (50%), Positives = 62/88 (70%), Gaps = 5/88 (6%)
 Frame = -2

Query  724  DDDDAEKRILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHVELS  545
            + D+ EKR+ AAK  F NSPHPLEILSDR +YGS G I+R+HDM SYLK++RH++  EL 
Sbjct  517  NTDETEKRLRAAKIVFFNSPHPLEILSDRRSYGSEGKIKRNHDMSSYLKALRHVVRKELK  576

Query  544  RIRKSKRESWWPLIVIPGVKAADIFVGR  461
            +I K++++ W    +I  +    +F GR
Sbjct  577  QI-KAEQDQWRRKFLIINI----LFSGR  599



>ref|XP_002878465.1| hypothetical protein ARALYDRAFT_486759 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54724.1| hypothetical protein ARALYDRAFT_486759 [Arabidopsis lyrata subsp. 
lyrata]
Length=643

 Score = 90.1 bits (222),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 45/88 (51%), Positives = 61/88 (69%), Gaps = 5/88 (6%)
 Frame = -2

Query  724  DDDDAEKRILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHVELS  545
            + D+ EK + AAK+ F NSPHPLEILSDR +YGS G I+R+HDM SYLK++RH+I  EL 
Sbjct  513  NTDETEKSLRAAKSVFFNSPHPLEILSDRRSYGSEGKIKRNHDMSSYLKALRHVIRKELK  572

Query  544  RIRKSKRESWWPLIVIPGVKAADIFVGR  461
            +I K++R+ W     I  +    +F GR
Sbjct  573  QI-KAERDQWRRKFFIINI----LFTGR  595



>ref|XP_009116919.1| PREDICTED: uncharacterized protein LOC103842065 [Brassica rapa]
Length=630

 Score = 89.4 bits (220),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 55/70 (79%), Gaps = 1/70 (1%)
 Frame = -2

Query  724  DDDDAEKRILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHVELS  545
            + D+ +K + AAKT F NSPHPLEILSDR +YGS G I+R+HDM SYLK++RH+I  EL 
Sbjct  499  NTDETDKGLRAAKTVFFNSPHPLEILSDRRSYGSEGKIKRNHDMSSYLKALRHVIRKELK  558

Query  544  RIRKSKRESW  515
            +I K++R+ W
Sbjct  559  QI-KTERDQW  567



>emb|CDX76645.1| BnaC08g32310D [Brassica napus]
Length=628

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 55/70 (79%), Gaps = 1/70 (1%)
 Frame = -2

Query  724  DDDDAEKRILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHVELS  545
            + D+ +K + AAKT F NSPHPLEILSDR +YGS G I+R+HDM SYLK++RH+I  EL 
Sbjct  497  NTDETDKGLRAAKTVFFNSPHPLEILSDRRSYGSEGKIKRNHDMSSYLKALRHVIRKELK  556

Query  544  RIRKSKRESW  515
            +I K++R+ W
Sbjct  557  QI-KAERDQW  565



>emb|CAB83109.1| putative protein [Arabidopsis thaliana]
Length=619

 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/88 (50%), Positives = 60/88 (68%), Gaps = 5/88 (6%)
 Frame = -2

Query  724  DDDDAEKRILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHVELS  545
            + D+ EK + AAK  F NSPHPLEILSDR +YGS G I+R+HDM SYLK++RH+I  EL 
Sbjct  489  NTDETEKSLRAAKILFFNSPHPLEILSDRRSYGSEGKIKRNHDMSSYLKALRHVIRKELK  548

Query  544  RIRKSKRESWWPLIVIPGVKAADIFVGR  461
            ++ K++R+ W     I  +    +F GR
Sbjct  549  QM-KAERDQWLRKFFIINI----LFSGR  571



>ref|NP_567131.1| alpha/beta-Hydrolases superfamily protein [Arabidopsis thaliana]
 gb|AAL06939.1| AT3g62590/F26K9_20 [Arabidopsis thaliana]
 gb|AAN73302.1| At3g62590/F26K9_20 [Arabidopsis thaliana]
 gb|AEE80367.1| alpha/beta-Hydrolases superfamily protein [Arabidopsis thaliana]
Length=649

 Score = 88.2 bits (217),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 44/88 (50%), Positives = 60/88 (68%), Gaps = 5/88 (6%)
 Frame = -2

Query  724  DDDDAEKRILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHVELS  545
            + D+ EK + AAK  F NSPHPLEILSDR +YGS G I+R+HDM SYLK++RH+I  EL 
Sbjct  519  NTDETEKSLRAAKILFFNSPHPLEILSDRRSYGSEGKIKRNHDMSSYLKALRHVIRKELK  578

Query  544  RIRKSKRESWWPLIVIPGVKAADIFVGR  461
            ++ K++R+ W     I  +    +F GR
Sbjct  579  QM-KAERDQWLRKFFIINI----LFSGR  601



>gb|EPS63237.1| hypothetical protein M569_11546, partial [Genlisea aurea]
Length=589

 Score = 87.0 bits (214),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = -2

Query  733  PVTDDDDAEKRILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHII  560
            P  +  D +K I  A++AF+NSPHPLEILSDRSAYGSGGTI RDHDM +YLKSVR++I
Sbjct  454  PEPEGSDPDKTIHVARSAFMNSPHPLEILSDRSAYGSGGTIHRDHDMITYLKSVRNVI  511



>ref|XP_002990898.1| hypothetical protein SELMODRAFT_132592 [Selaginella moellendorffii]
 gb|EFJ07942.1| hypothetical protein SELMODRAFT_132592 [Selaginella moellendorffii]
Length=578

 Score = 80.9 bits (198),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 41/84 (49%), Positives = 51/84 (61%), Gaps = 4/84 (5%)
 Frame = -2

Query  739  RPPVTDDDDAEKRILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHII  560
            R P   +  ++    AA+ AFLNSPHPLEILSD  AYGS G I RDHD +SY+K +   +
Sbjct  402  RHPREGNCSSKVEFRAAQRAFLNSPHPLEILSDPGAYGSDGAICRDHDPRSYMKCITGAV  461

Query  559  HVELSRIRKSKRES----WWPLIV  500
              E  R R+ KR+     WWPLI 
Sbjct  462  RQEAKRSRRLKRQQRRGLWWPLIT  485



>ref|XP_002982750.1| hypothetical protein SELMODRAFT_117344 [Selaginella moellendorffii]
 gb|EFJ15995.1| hypothetical protein SELMODRAFT_117344 [Selaginella moellendorffii]
Length=629

 Score = 80.9 bits (198),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 41/84 (49%), Positives = 51/84 (61%), Gaps = 4/84 (5%)
 Frame = -2

Query  739  RPPVTDDDDAEKRILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHII  560
            R P   +  ++    AA+ AFLNSPHPLEILSD  AYGS G I RDHD +SY+K +   +
Sbjct  452  RHPGEGNCSSKVEFRAAQRAFLNSPHPLEILSDPGAYGSDGAICRDHDPRSYMKCITGAV  511

Query  559  HVELSRIRKSKRES----WWPLIV  500
              E  R R+ KR+     WWPLI 
Sbjct  512  RQEAKRSRRLKRQQRRGLWWPLIT  535



>gb|ERN00304.1| hypothetical protein AMTR_s00107p00100130 [Amborella trichopoda]
Length=136

 Score = 73.2 bits (178),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 48/72 (67%), Gaps = 4/72 (6%)
 Frame = -2

Query  703  RILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHVELSRIRKSKR  524
            ++ AA   FLN+PHPLE LSD +AYGS G+I RDHD  +YLK++  ++  +  ++R++ R
Sbjct  34   QVQAALRTFLNTPHPLETLSDPTAYGSEGSILRDHDSSNYLKAINAVLRQQTKQMRRTHR  93

Query  523  ----ESWWPLIV  500
                  WWPL+ 
Sbjct  94   LHRCHDWWPLVA  105



>ref|XP_011023199.1| PREDICTED: uncharacterized protein LOC105124775 [Populus euphratica]
Length=707

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 44/69 (64%), Gaps = 2/69 (3%)
 Frame = -2

Query  694  AAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHVELSRIRK--SKRE  521
            +A  AFLN PHPLE LSD  AYGS GTI RDHD  +YLK+V  +I   L  +RK   +R 
Sbjct  614  SAIKAFLNCPHPLETLSDPKAYGSEGTILRDHDSSNYLKAVNKVIRQNLKMVRKVQEQRN  673

Query  520  SWWPLIVIP  494
              WPL+  P
Sbjct  674  QLWPLLASP  682



>ref|XP_009599265.1| PREDICTED: uncharacterized protein LOC104094946 [Nicotiana tomentosiformis]
 ref|XP_009599266.1| PREDICTED: uncharacterized protein LOC104094946 [Nicotiana tomentosiformis]
 ref|XP_009599267.1| PREDICTED: uncharacterized protein LOC104094946 [Nicotiana tomentosiformis]
Length=699

 Score = 75.5 bits (184),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 39/64 (61%), Positives = 47/64 (73%), Gaps = 5/64 (8%)
 Frame = -2

Query  682  AFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIH----VELSRIRKSKRESW  515
            AFLNSPHPLEILSD +AYGSGGTI RDHD  +YLK+V  II     + + R+RK +R   
Sbjct  609  AFLNSPHPLEILSDPTAYGSGGTILRDHDSSNYLKAVNSIIRQRKKLLVRRVRK-QRNII  667

Query  514  WPLI  503
            WPL+
Sbjct  668  WPLL  671



>ref|XP_009757087.1| PREDICTED: uncharacterized protein LOC104210001 [Nicotiana sylvestris]
 ref|XP_009757088.1| PREDICTED: uncharacterized protein LOC104210001 [Nicotiana sylvestris]
 ref|XP_009757090.1| PREDICTED: uncharacterized protein LOC104210001 [Nicotiana sylvestris]
 ref|XP_009757091.1| PREDICTED: uncharacterized protein LOC104210001 [Nicotiana sylvestris]
 ref|XP_009757092.1| PREDICTED: uncharacterized protein LOC104210001 [Nicotiana sylvestris]
Length=703

 Score = 75.5 bits (184),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 39/64 (61%), Positives = 47/64 (73%), Gaps = 5/64 (8%)
 Frame = -2

Query  682  AFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIH----VELSRIRKSKRESW  515
            AFLNSPHPLEILSD +AYGSGGTI RDHD  +YLK+V  II     + + R+RK +R   
Sbjct  613  AFLNSPHPLEILSDPTAYGSGGTILRDHDSSNYLKAVNSIIRQRKKLLVRRVRK-QRNII  671

Query  514  WPLI  503
            WPL+
Sbjct  672  WPLL  675



>ref|XP_002301404.2| hypothetical protein POPTR_0002s17080g [Populus trichocarpa]
 gb|EEE80677.2| hypothetical protein POPTR_0002s17080g [Populus trichocarpa]
Length=666

 Score = 74.7 bits (182),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 43/69 (62%), Gaps = 2/69 (3%)
 Frame = -2

Query  694  AAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHVELSRIRK--SKRE  521
            +A  AFLN PHPLE LSD  AYGS GTI RDHD  +YL +V  +I   L  +RK   +R 
Sbjct  573  SAIKAFLNCPHPLETLSDPKAYGSEGTILRDHDSSNYLNAVNKVIRQNLKMVRKVQEQRN  632

Query  520  SWWPLIVIP  494
              WPL+  P
Sbjct  633  QLWPLLASP  641



>ref|XP_011621237.1| PREDICTED: uncharacterized protein LOC18428351 [Amborella trichopoda]
Length=692

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 48/72 (67%), Gaps = 4/72 (6%)
 Frame = -2

Query  703  RILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHVELSRIRKSKR  524
            ++ AA   FLN+PHPLE LSD +AYGS G+I RDHD  +YLK++  ++  +  ++R++ R
Sbjct  590  QVQAALRTFLNTPHPLETLSDPTAYGSEGSILRDHDSSNYLKAINAVLRQQTKQMRRTHR  649

Query  523  ----ESWWPLIV  500
                  WWPL+ 
Sbjct  650  LHRCHDWWPLVA  661



>ref|NP_001148192.1| triacylglycerol lipase [Zea mays]
 gb|ACG30143.1| triacylglycerol lipase [Zea mays]
Length=690

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 50/85 (59%), Gaps = 0/85 (0%)
 Frame = -2

Query  730  VTDDDDAEKRILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHVE  551
              D   +   + +A +AF NSPHPLEIL D  AYG  GT+ RDHD+ SYL+S+R ++  E
Sbjct  570  TVDSGTSSTALRSALSAFFNSPHPLEILRDAGAYGPKGTVYRDHDVHSYLRSIRAVVRKE  629

Query  550  LSRIRKSKRESWWPLIVIPGVKAAD  476
            +   ++ +R   WP+ V   +   D
Sbjct  630  MRAEKERRRLLRWPIEVYGALATID  654



>ref|XP_009336804.1| PREDICTED: uncharacterized protein LOC103929339 [Pyrus x bretschneideri]
Length=684

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 45/67 (67%), Gaps = 3/67 (4%)
 Frame = -2

Query  685  TAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHVELSR-IRKSKRES--W  515
            T FLNSPHPLE LSD +AYGS GTI RDHD  +YLK+V  ++     R +RK ++E    
Sbjct  593  TTFLNSPHPLETLSDPTAYGSDGTILRDHDSSNYLKAVNEVLRKHTRRAVRKVRKEKNLL  652

Query  514  WPLIVIP  494
            WPL+  P
Sbjct  653  WPLLTSP  659



>ref|XP_008347164.1| PREDICTED: uncharacterized protein LOC103410201 [Malus domestica]
Length=685

 Score = 72.4 bits (176),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 36/68 (53%), Positives = 45/68 (66%), Gaps = 5/68 (7%)
 Frame = -2

Query  685  TAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHII----HVELSRIRKSKRES  518
            T FLNSPHPLE LSD +AYGS GTI RDHD  +YLK+V  ++       + R+RK +R  
Sbjct  594  TTFLNSPHPLETLSDPTAYGSEGTILRDHDSSNYLKAVNEVLRKYTRTVVRRVRK-QRNL  652

Query  517  WWPLIVIP  494
             WPL+  P
Sbjct  653  LWPLLTSP  660



>ref|XP_004231212.1| PREDICTED: uncharacterized protein LOC101245704 [Solanum lycopersicum]
 ref|XP_010326963.1| PREDICTED: uncharacterized protein LOC101245704 [Solanum lycopersicum]
 ref|XP_010326964.1| PREDICTED: uncharacterized protein LOC101245704 [Solanum lycopersicum]
Length=700

 Score = 72.4 bits (176),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 47/63 (75%), Gaps = 5/63 (8%)
 Frame = -2

Query  679  FLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHII--HVEL--SRIRKSKRESWW  512
            FLNSPHPLEILS  +AYGSGGTI RDHD  +YLK+V +II  H +L   R+RK +R   W
Sbjct  611  FLNSPHPLEILSVPTAYGSGGTILRDHDSSNYLKAVNNIIRQHTKLLVRRVRK-QRNLIW  669

Query  511  PLI  503
            PL+
Sbjct  670  PLL  672



>ref|XP_008362652.1| PREDICTED: uncharacterized protein LOC103426336 [Malus domestica]
Length=714

 Score = 72.0 bits (175),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 45/68 (66%), Gaps = 5/68 (7%)
 Frame = -2

Query  685  TAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHII----HVELSRIRKSKRES  518
            T FLNSPHPLE LSD +AYGS GTI RDHD  +YLK+V  ++       + ++RK +R  
Sbjct  623  TTFLNSPHPLETLSDPTAYGSDGTILRDHDSSNYLKAVNQVLRKYTRTAVRKVRK-ERNL  681

Query  517  WWPLIVIP  494
             WPL+  P
Sbjct  682  LWPLLTSP  689



>ref|XP_006339692.1| PREDICTED: uncharacterized protein LOC102605002 [Solanum tuberosum]
Length=699

 Score = 71.2 bits (173),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 46/63 (73%), Gaps = 5/63 (8%)
 Frame = -2

Query  679  FLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIH----VELSRIRKSKRESWW  512
            FLNSPHPLEILS  +AYGSGGTI RDHD  +YLK+V +II     + + R+RK +R   W
Sbjct  610  FLNSPHPLEILSVPTAYGSGGTILRDHDSSNYLKAVNNIIRQRTKLLVRRVRK-QRNLIW  668

Query  511  PLI  503
            PL+
Sbjct  669  PLL  671



>ref|XP_010913778.1| PREDICTED: uncharacterized protein LOC105039341 [Elaeis guineensis]
 ref|XP_010913787.1| PREDICTED: uncharacterized protein LOC105039341 [Elaeis guineensis]
 ref|XP_010913794.1| PREDICTED: uncharacterized protein LOC105039341 [Elaeis guineensis]
Length=714

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 49/73 (67%), Gaps = 4/73 (5%)
 Frame = -2

Query  700  ILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHVEL-SRIRKSKR  524
            +  A  AFLNSPHPLE LSD +AYGS GTI RDHD  +YLK++  ++     S +R+++R
Sbjct  615  VAGALRAFLNSPHPLETLSDPAAYGSDGTILRDHDSSNYLKAMNGLVREHTKSVVRRTRR  674

Query  523  ESW---WPLIVIP  494
            + +   WPL+  P
Sbjct  675  QRFYQLWPLLATP  687



>ref|XP_004967838.1| PREDICTED: uncharacterized protein LOC101767065 [Setaria italica]
Length=703

 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = -2

Query  721  DDDAEKRILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHII  560
            DDD+  ++ +A +AF NSPHPLEIL D  AYG  GT+ RDHD+ SYL+SVR ++
Sbjct  577  DDDSLPQLRSALSAFFNSPHPLEILKDGGAYGPRGTVYRDHDVNSYLRSVRGVV  630



>ref|XP_008388317.1| PREDICTED: uncharacterized protein LOC103450723 [Malus domestica]
Length=325

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 46/68 (68%), Gaps = 5/68 (7%)
 Frame = -2

Query  682  AFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHII----HVELSRIRKSKRESW  515
            AFLNSPHPLE LSD +AYGS GTI RDHD  +YLK++  I+     + + ++RK +R   
Sbjct  246  AFLNSPHPLETLSDPTAYGSEGTILRDHDSDNYLKAINKILRKHTRMVVRKVRK-QRNLL  304

Query  514  WPLIVIPG  491
            WPL+  P 
Sbjct  305  WPLLTSPS  312



>ref|XP_008233196.1| PREDICTED: uncharacterized protein LOC103332249 [Prunus mume]
Length=699

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/68 (53%), Positives = 46/68 (68%), Gaps = 5/68 (7%)
 Frame = -2

Query  682  AFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSV----RHIIHVELSRIRKSKRESW  515
            AFLNSPHPLE LSD +AYGS GTI RDHD  +YLK+V    R  + + + ++RK +R   
Sbjct  609  AFLNSPHPLETLSDPTAYGSEGTILRDHDSSNYLKAVNGVLRQHMRMVVRKVRK-QRNLL  667

Query  514  WPLIVIPG  491
            WPL+  P 
Sbjct  668  WPLLTSPS  675



>ref|XP_007220034.1| hypothetical protein PRUPE_ppa1027212mg, partial [Prunus persica]
 gb|EMJ21233.1| hypothetical protein PRUPE_ppa1027212mg, partial [Prunus persica]
Length=698

 Score = 70.1 bits (170),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 46/68 (68%), Gaps = 5/68 (7%)
 Frame = -2

Query  682  AFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHII----HVELSRIRKSKRESW  515
            AFLNSPHPLE LSD +AYGS GTI RDHD  +YLK+V  ++     + + ++RK +R   
Sbjct  609  AFLNSPHPLETLSDPTAYGSEGTILRDHDSSNYLKAVNGVLRQHTRMVVRKVRK-QRNLL  667

Query  514  WPLIVIPG  491
            WPL+  P 
Sbjct  668  WPLLTSPS  675



>ref|XP_012083231.1| PREDICTED: uncharacterized protein LOC105642864 [Jatropha curcas]
 gb|KDP28502.1| hypothetical protein JCGZ_14273 [Jatropha curcas]
Length=694

 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 44/69 (64%), Gaps = 5/69 (7%)
 Frame = -2

Query  685  TAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHVE----LSRIRKSKRES  518
             AFLN PHPLE LSD +AYGS GTI RDHD  +YLK+V  ++       + R+RK +R  
Sbjct  604  NAFLNCPHPLETLSDPTAYGSEGTILRDHDSSNYLKAVNGVLRQSTKKVIRRVRK-ERNL  662

Query  517  WWPLIVIPG  491
             WPL+  P 
Sbjct  663  LWPLLASPS  671



>ref|XP_004306685.1| PREDICTED: uncharacterized protein LOC101293815 [Fragaria vesca 
subsp. vesca]
 ref|XP_011468941.1| PREDICTED: uncharacterized protein LOC101293815 [Fragaria vesca 
subsp. vesca]
Length=689

 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 53/84 (63%), Gaps = 7/84 (8%)
 Frame = -2

Query  682  AFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHVELSRI-RKSKRES--WW  512
            AFLN+PHPLE LSD +AYGS GTI RDHD  +YLK+V  ++ +   ++ R+++R     W
Sbjct  599  AFLNNPHPLETLSDPTAYGSEGTILRDHDSSNYLKAVNGVLRLHTKKVLRRARRHRSILW  658

Query  511  PLIVIPGVKAAD----IFVGRLVR  452
            PL+  P     +    +  GRLV+
Sbjct  659  PLLTSPSPHTWNHENTLETGRLVK  682



>ref|XP_011093043.1| PREDICTED: uncharacterized protein LOC105173091 [Sesamum indicum]
 ref|XP_011093044.1| PREDICTED: uncharacterized protein LOC105173091 [Sesamum indicum]
Length=673

 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 35/64 (55%), Positives = 43/64 (67%), Gaps = 3/64 (5%)
 Frame = -2

Query  682  AFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHII--HVEL-SRIRKSKRESWW  512
            AFLNSPHP+E LSD +AYGS GTI RDHD  +YLK+V  +I  H  L  R  + +R   W
Sbjct  583  AFLNSPHPIETLSDPTAYGSEGTILRDHDSSNYLKAVNELIRQHTRLVVRKARKQRNQMW  642

Query  511  PLIV  500
            PL+ 
Sbjct  643  PLLT  646



>ref|XP_002440651.1| hypothetical protein SORBIDRAFT_09g004600 [Sorghum bicolor]
 gb|EES19081.1| hypothetical protein SORBIDRAFT_09g004600 [Sorghum bicolor]
Length=667

 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 51/86 (59%), Gaps = 1/86 (1%)
 Frame = -2

Query  730  VTDDDDAEKRILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHVE  551
              D D +   + +A +AF NSPHPLEIL D  AYG  GT+ RDHD+ SYL+S+R ++  E
Sbjct  546  AVDSDTSSSVLRSALSAFFNSPHPLEILRDAGAYGPKGTVYRDHDVHSYLRSIRAVLRKE  605

Query  550  L-SRIRKSKRESWWPLIVIPGVKAAD  476
            + +   + +R   WP+ V   +   D
Sbjct  606  MRAEKERRRRLLRWPIEVYGALATMD  631



>ref|XP_001766893.1| predicted protein [Physcomitrella patens]
 gb|EDQ68295.1| predicted protein, partial [Physcomitrella patens]
Length=478

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 45/63 (71%), Gaps = 1/63 (2%)
 Frame = -2

Query  694  AAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHVELSRIRKSKRESW  515
            +A+ AFLN+PHPL+IL DR++YG  G+I RDHD +SY K+V  ++  EL +  K  R SW
Sbjct  417  SAQRAFLNNPHPLDILRDRTSYGPAGSISRDHDPRSYAKAVNFVLRQELRKTEKRTR-SW  475

Query  514  WPL  506
            + L
Sbjct  476  FRL  478



>ref|NP_001042614.1| Os01g0253900 [Oryza sativa Japonica Group]
 dbj|BAD81065.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF04528.1| Os01g0253900 [Oryza sativa Japonica Group]
Length=596

 Score = 68.9 bits (167),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
 Frame = -2

Query  706  KRILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHVEL  548
            +R+ +A + F NSPHPLEIL D+SAYG  G + RDHD+ SYL+SVR ++  E+
Sbjct  469  RRLRSAMSTFFNSPHPLEILKDKSAYGPKGAVYRDHDVNSYLRSVRAVVRKEV  521



>dbj|BAJ85142.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=522

 Score = 68.9 bits (167),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 39/74 (53%), Positives = 52/74 (70%), Gaps = 5/74 (7%)
 Frame = -2

Query  706  KRILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHVELSRIRKSK  527
            K + +A +AF NSPHPLEIL D  AYG  GT+ RDHD+ SYL+SVR ++  E+ R+R+++
Sbjct  389  KLLQSAVSAFFNSPHPLEILKDGGAYGPKGTVYRDHDVNSYLRSVRGVVRKEVRRLREAE  448

Query  526  RES-----WWPLIV  500
            RE      WWPL V
Sbjct  449  RERWQLLLWWPLAV  462



>emb|CDX89128.1| BnaA04g00580D [Brassica napus]
Length=645

 Score = 68.9 bits (167),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 49/77 (64%), Gaps = 4/77 (5%)
 Frame = -2

Query  721  DDDAEKRILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHVE---  551
            D + E     A   FLN PHPLE LS R+AYGS G++ RDHD K+Y+K+V  +I  +   
Sbjct  545  DKNNEGYSPTALRGFLNRPHPLETLSQRAAYGSEGSVLRDHDSKNYVKAVNGVIRQQTKL  604

Query  550  -LSRIRKSKRESWWPLI  503
             + ++R+ +R + WP++
Sbjct  605  IVRKVRRQRRSTVWPML  621



>ref|XP_009138759.1| PREDICTED: uncharacterized protein LOC103862815 [Brassica rapa]
 ref|XP_009138760.1| PREDICTED: uncharacterized protein LOC103862815 [Brassica rapa]
Length=645

 Score = 68.9 bits (167),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 50/78 (64%), Gaps = 4/78 (5%)
 Frame = -2

Query  721  DDDAEKRILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHII--HVEL  548
            D + E     A   FLN PHPLE LS R+AYGS G++ RDHD K+Y+K+V  +I  H +L
Sbjct  545  DKNNEGYSPTALRGFLNRPHPLETLSQRAAYGSEGSVLRDHDSKNYVKAVNGVIRQHTKL  604

Query  547  --SRIRKSKRESWWPLIV  500
               ++R+ +R + WP++ 
Sbjct  605  IVRKVRRQRRSTVWPVLT  622



>dbj|BAD81066.1| unknown protein [Oryza sativa Japonica Group]
Length=707

 Score = 68.9 bits (167),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
 Frame = -2

Query  706  KRILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHVEL  548
            +R+ +A + F NSPHPLEIL D+SAYG  G + RDHD+ SYL+SVR ++  E+
Sbjct  580  RRLRSAMSTFFNSPHPLEILKDKSAYGPKGAVYRDHDVNSYLRSVRAVVRKEV  632



>gb|EMS46877.1| Lipase [Triticum urartu]
Length=497

 Score = 68.6 bits (166),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 39/74 (53%), Positives = 52/74 (70%), Gaps = 5/74 (7%)
 Frame = -2

Query  706  KRILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHVELSRIRKSK  527
            K + +A +AF NSPHPLEIL D  AYG  GT+ RDHD+ SYL+SVR ++  E+ R+R+++
Sbjct  389  KLLQSAVSAFFNSPHPLEILKDGGAYGPKGTVYRDHDVNSYLRSVRGVVRKEVRRLREAE  448

Query  526  RES-----WWPLIV  500
            RE      WWPL V
Sbjct  449  RERWQLLLWWPLAV  462



>gb|EAY73336.1| hypothetical protein OsI_01214 [Oryza sativa Indica Group]
Length=761

 Score = 68.9 bits (167),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
 Frame = -2

Query  706  KRILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHVEL  548
            +R+ +A + F NSPHPLEIL D+SAYG  G + RDHD+ SYL+SVR ++  E+
Sbjct  634  RRLRSAMSTFFNSPHPLEILKDKSAYGPKGAVYRDHDVNSYLRSVRAVVRKEV  686



>gb|EAZ11278.1| hypothetical protein OsJ_01132 [Oryza sativa Japonica Group]
Length=761

 Score = 68.9 bits (167),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
 Frame = -2

Query  706  KRILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHVEL  548
            +R+ +A + F NSPHPLEIL D+SAYG  G + RDHD+ SYL+SVR ++  E+
Sbjct  634  RRLRSAMSTFFNSPHPLEILKDKSAYGPKGAVYRDHDVNSYLRSVRAVVRKEV  686



>ref|XP_004494809.1| PREDICTED: uncharacterized protein LOC101506393 isoform X1 [Cicer 
arietinum]
 ref|XP_004494810.1| PREDICTED: uncharacterized protein LOC101506393 isoform X2 [Cicer 
arietinum]
Length=732

 Score = 68.6 bits (166),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 43/69 (62%), Gaps = 4/69 (6%)
 Frame = -2

Query  685  TAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHII----HVELSRIRKSKRES  518
            + FLN PHP+E LSD +AYGS GTI RDHD  +YLK+V  I+       + R+RK + + 
Sbjct  640  STFLNQPHPIETLSDPTAYGSEGTILRDHDSSNYLKAVNGILIQHSKTLVGRVRKQRIDE  699

Query  517  WWPLIVIPG  491
             WP +  P 
Sbjct  700  LWPTLTSPS  708



>ref|XP_009393084.1| PREDICTED: uncharacterized protein LOC103978863 [Musa acuminata 
subsp. malaccensis]
Length=689

 Score = 68.6 bits (166),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 45/73 (62%), Gaps = 4/73 (5%)
 Frame = -2

Query  694  AAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHVELSRIRKSKRESW  515
            +A  AF+NSPHPLE LSD  AYGS GTI RDHD  +Y+K++  ++      +R+  R+  
Sbjct  587  SALRAFVNSPHPLETLSDPRAYGSEGTILRDHDCSNYVKALNALLRQHTKSVRRRSRKQQ  646

Query  514  ----WPLIVIPGV  488
                WPL+  PG 
Sbjct  647  FNQRWPLVAGPGT  659



>ref|XP_003626565.1| hypothetical protein MTR_7g117280 [Medicago truncatula]
 gb|AES82783.1| triacylglycerol lipase [Medicago truncatula]
Length=695

 Score = 68.6 bits (166),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 45/69 (65%), Gaps = 4/69 (6%)
 Frame = -2

Query  685  TAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIH----VELSRIRKSKRES  518
            ++FLN PHP+E LSD +AYG+ GTI RDHD  +YLK+V  I+       + R++K + + 
Sbjct  603  SSFLNQPHPIETLSDPTAYGAEGTILRDHDSSNYLKAVNGILRQHSKTLVRRVKKQRIDE  662

Query  517  WWPLIVIPG  491
             WPL+  P 
Sbjct  663  LWPLLTSPS  671



>ref|XP_004494811.1| PREDICTED: uncharacterized protein LOC101506393 isoform X3 [Cicer 
arietinum]
Length=690

 Score = 68.6 bits (166),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 43/69 (62%), Gaps = 4/69 (6%)
 Frame = -2

Query  685  TAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHII----HVELSRIRKSKRES  518
            + FLN PHP+E LSD +AYGS GTI RDHD  +YLK+V  I+       + R+RK + + 
Sbjct  598  STFLNQPHPIETLSDPTAYGSEGTILRDHDSSNYLKAVNGILIQHSKTLVGRVRKQRIDE  657

Query  517  WWPLIVIPG  491
             WP +  P 
Sbjct  658  LWPTLTSPS  666



>gb|KHN43106.1| hypothetical protein glysoja_001689 [Glycine soja]
Length=695

 Score = 68.6 bits (166),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 43/68 (63%), Gaps = 4/68 (6%)
 Frame = -2

Query  682  AFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIH----VELSRIRKSKRESW  515
             FLN PHP++ LSD +AYGS GTI RDHD  +YLK++  ++     + + R+RK +    
Sbjct  604  TFLNQPHPIDTLSDPTAYGSEGTILRDHDSSNYLKAINGVLRKHSKITVGRMRKQRINQL  663

Query  514  WPLIVIPG  491
            WPL+  P 
Sbjct  664  WPLLTSPS  671



>gb|EYU38899.1| hypothetical protein MIMGU_mgv1a002410mg [Erythranthe guttata]
Length=678

 Score = 68.6 bits (166),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 46/77 (60%), Gaps = 3/77 (4%)
 Frame = -2

Query  721  DDDAEKRILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHVE---  551
            DD       +A  AFLNSPHP+E LSD +AYGS GTI RDHD  +YLK+V  +I      
Sbjct  578  DDTKSPLSNSALRAFLNSPHPIETLSDPTAYGSEGTIIRDHDSSNYLKAVNDVIRQRTRI  637

Query  550  LSRIRKSKRESWWPLIV  500
            + R  + +R   WPL+ 
Sbjct  638  VVRKARKQRNQLWPLLT  654



>ref|XP_001757678.1| predicted protein [Physcomitrella patens]
 gb|EDQ77318.1| predicted protein [Physcomitrella patens]
Length=723

 Score = 68.6 bits (166),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = -2

Query  709  EKRILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHII  560
            EK + AA+++FLNSPHPL+I+SD  AYGS G I RDHD +SY +++ HI+
Sbjct  601  EKELRAAESSFLNSPHPLDIMSDPCAYGSDGAISRDHDPRSYRRAMNHIL  650



>ref|XP_007051578.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
 gb|EOX95735.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
Length=703

 Score = 68.2 bits (165),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 45/67 (67%), Gaps = 5/67 (7%)
 Frame = -2

Query  682  AFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHII----HVELSRIRKSKRESW  515
            AFLN PHPL+ LSD +AYGS GTI RDHD  +YLK+V  ++     V++ R R  +R   
Sbjct  613  AFLNCPHPLDTLSDLTAYGSEGTILRDHDSSNYLKAVNGVLRQDKRVDVRRAR-IQRSLL  671

Query  514  WPLIVIP  494
            WPL+V P
Sbjct  672  WPLLVSP  678



>gb|KHN35374.1| hypothetical protein glysoja_029004 [Glycine soja]
Length=700

 Score = 68.2 bits (165),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 43/67 (64%), Gaps = 4/67 (6%)
 Frame = -2

Query  679  FLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIH----VELSRIRKSKRESWW  512
            FLN PHP++ LSD +AYGS GTI RDHD  +YLK++  ++     + + R+RK +    W
Sbjct  610  FLNQPHPIDTLSDPTAYGSEGTILRDHDSSNYLKAINGVLRKHSKIIVGRVRKQRINQLW  669

Query  511  PLIVIPG  491
            PL+  P 
Sbjct  670  PLLTSPS  676



>ref|XP_006402456.1| hypothetical protein EUTSA_v10005828mg [Eutrema salsugineum]
 gb|ESQ43909.1| hypothetical protein EUTSA_v10005828mg [Eutrema salsugineum]
Length=657

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/65 (48%), Positives = 46/65 (71%), Gaps = 4/65 (6%)
 Frame = -2

Query  682  AFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHII--HVEL--SRIRKSKRESW  515
             FLN PHPLE LS R+AYGS G++ RDHD K+Y+K+V  +I  H +L   ++R+ +R + 
Sbjct  570  GFLNRPHPLETLSQRAAYGSEGSVLRDHDSKNYVKAVNGVIRQHTKLIVRKVRRERRATV  629

Query  514  WPLIV  500
            WP++ 
Sbjct  630  WPVLT  634



>ref|XP_002523367.1| triacylglycerol lipase, putative [Ricinus communis]
 gb|EEF39083.1| triacylglycerol lipase, putative [Ricinus communis]
Length=671

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 41/67 (61%), Gaps = 3/67 (4%)
 Frame = -2

Query  685  TAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHVELSRI---RKSKRESW  515
             AFLN PHPLE LSD SAYGS GTI RDHD  +YLK+V  ++      +    + +R   
Sbjct  581  NAFLNCPHPLETLSDPSAYGSEGTILRDHDSSNYLKAVNSVLRQNTKALVLKARKERSLI  640

Query  514  WPLIVIP  494
            WPL+  P
Sbjct  641  WPLLASP  647



>ref|XP_003565598.1| PREDICTED: uncharacterized protein LOC100836436 [Brachypodium 
distachyon]
Length=685

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 37/74 (50%), Positives = 52/74 (70%), Gaps = 5/74 (7%)
 Frame = -2

Query  706  KRILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHVELSRIRKSK  527
            +++ +A +AF NSPHPLEIL D  AYG  G++ RDHD+ SYL+SVR ++  E  R+R+++
Sbjct  556  RQLQSAMSAFFNSPHPLEILKDGGAYGPKGSVYRDHDVNSYLRSVRGVVRKEARRLREAE  615

Query  526  RES-----WWPLIV  500
            RE      WWPL V
Sbjct  616  RERWGLLLWWPLAV  629



>ref|XP_010668971.1| PREDICTED: uncharacterized protein LOC104886129 [Beta vulgaris 
subsp. vulgaris]
Length=690

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 44/66 (67%), Gaps = 5/66 (8%)
 Frame = -2

Query  679  FLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHVELSRI--RKSKRES--WW  512
            FLN+PHPLE LSD  AYGS GTI RDHD  +Y K+V  +I  + ++I  RK KRE    W
Sbjct  602  FLNTPHPLETLSDPKAYGSDGTILRDHDSNNYTKAVNGVIK-QYTKIAFRKVKRERHVIW  660

Query  511  PLIVIP  494
            PLI  P
Sbjct  661  PLIASP  666



>ref|XP_002320194.2| hypothetical protein POPTR_0014s09290g [Populus trichocarpa]
 gb|EEE98509.2| hypothetical protein POPTR_0014s09290g [Populus trichocarpa]
Length=799

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/80 (48%), Positives = 48/80 (60%), Gaps = 6/80 (8%)
 Frame = -2

Query  718  DDAEKRILA-AKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHVELSR  542
            D  + R  A A  AFLN PHPLE LSD +AYGS GTI RDHD  +YLK+V  ++  + S+
Sbjct  588  DKTQHRFAASAIKAFLNCPHPLETLSDPTAYGSEGTILRDHDSSNYLKAVNKVLR-QNSK  646

Query  541  IRKSKRESW----WPLIVIP  494
            +   K   W    WPL+  P
Sbjct  647  MVGWKVHEWGNQLWPLLASP  666



>ref|XP_010413364.1| PREDICTED: uncharacterized protein LOC104699719 [Camelina sativa]
 ref|XP_010413365.1| PREDICTED: uncharacterized protein LOC104699719 [Camelina sativa]
Length=653

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 48/68 (71%), Gaps = 5/68 (7%)
 Frame = -2

Query  682  AFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHII--HVELSRIRKSK--RESW  515
            AFLN PHPLE LS R+AYGS G++ RDHD K+Y+K+V  ++  H +L  +RK++  R S 
Sbjct  570  AFLNCPHPLETLSQRAAYGSEGSVLRDHDSKNYVKAVNGVLRQHTKLI-VRKARIHRRSV  628

Query  514  WPLIVIPG  491
            WP++   G
Sbjct  629  WPVLTSAG  636



>ref|XP_008791495.1| PREDICTED: uncharacterized protein LOC103708378 [Phoenix dactylifera]
Length=716

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 44/69 (64%), Gaps = 4/69 (6%)
 Frame = -2

Query  700  ILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHII--HVE--LSRIRK  533
            +  A  AFLNSPHPLE LSD  AYGS GTI RDHD  +YLK++  ++  H +  L R R+
Sbjct  577  VAGALRAFLNSPHPLETLSDPMAYGSDGTILRDHDSSNYLKAINGLLRQHTKAVLRRTRR  636

Query  532  SKRESWWPL  506
             +    WPL
Sbjct  637  QRFNHLWPL  645



>ref|XP_011037995.1| PREDICTED: uncharacterized protein LOC105135020 [Populus euphratica]
Length=713

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 48/80 (60%), Gaps = 6/80 (8%)
 Frame = -2

Query  718  DDAEKRILA-AKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHVELSR  542
            D  + R  A A   FLN PHPLE LSD +AYGS GTI RDHD  +YLK+V  ++  + S+
Sbjct  610  DKTQHRFAASAIKTFLNCPHPLETLSDPTAYGSEGTILRDHDSSNYLKAVNKVLR-QNSK  668

Query  541  IRKSKRESW----WPLIVIP  494
            +   K + W    WPL+  P
Sbjct  669  MVGWKVQEWGNQLWPLLASP  688



>ref|XP_010095782.1| hypothetical protein L484_017589 [Morus notabilis]
 gb|EXB62202.1| hypothetical protein L484_017589 [Morus notabilis]
Length=690

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 45/67 (67%), Gaps = 4/67 (6%)
 Frame = -2

Query  679  FLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHII--HVELSRIR--KSKRESWW  512
            FLN PHPLE LSD +AYGS GTI RDHD  +YLK+V  ++  H +++  +  +++R   W
Sbjct  599  FLNRPHPLETLSDPTAYGSEGTILRDHDSSNYLKAVNGVLRQHKKMANAQRVRNERNVLW  658

Query  511  PLIVIPG  491
            PL+  P 
Sbjct  659  PLLTSPS  665



>ref|XP_010512533.1| PREDICTED: uncharacterized protein LOC104788472 [Camelina sativa]
Length=653

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 47/65 (72%), Gaps = 5/65 (8%)
 Frame = -2

Query  682  AFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHII--HVELSRIRKSK--RESW  515
            AFLN PHPLE LS R+AYGS G+I RDHD K+Y+K+V  ++  H +L  +RK++  R S 
Sbjct  570  AFLNRPHPLETLSQRAAYGSEGSISRDHDSKNYVKAVNGVLRQHTKLI-VRKARIHRRSV  628

Query  514  WPLIV  500
            WP++ 
Sbjct  629  WPVLT  633



>ref|XP_004969185.1| PREDICTED: uncharacterized protein LOC101774889 [Setaria italica]
Length=561

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 51/94 (54%), Gaps = 16/94 (17%)
 Frame = -2

Query  724  DDDDAEKRILAAKT--AFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHVE  551
            + DDA  R L A    AFLNSPHPLE LSD SAYG+GG I RDH+  +Y +++  +    
Sbjct  455  EPDDAAPRALVASALRAFLNSPHPLETLSDLSAYGAGGAILRDHESSNYFRALSALARAP  514

Query  550  LSRIRKSK-----------RESWWPLI---VIPG  491
              R ++ +           ++ WWP I   VIP 
Sbjct  515  PRRRKQPEIVWQLPGVERLQQYWWPGIAGTVIPA  548



>ref|NP_191727.2| lipase class 3 family protein [Arabidopsis thaliana]
 gb|AAP40434.1| unknown protein [Arabidopsis thaliana]
 dbj|BAF00448.1| hypothetical protein [Arabidopsis thaliana]
 gb|ACI49785.1| At3g61680 [Arabidopsis thaliana]
 gb|AEE80240.1| lipase class 3 family protein [Arabidopsis thaliana]
Length=649

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 48/68 (71%), Gaps = 5/68 (7%)
 Frame = -2

Query  682  AFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHII--HVELSRIRKSK--RESW  515
            AFLN PHPLE LS R+AYGS G++ RDHD K+Y+K+V  ++  H +L  +RK++  R S 
Sbjct  566  AFLNRPHPLETLSQRAAYGSEGSVLRDHDSKNYVKAVNGVLRQHTKLI-VRKARIQRRSV  624

Query  514  WPLIVIPG  491
            WP++   G
Sbjct  625  WPVLTSAG  632



>emb|CAB71098.1| putative protein [Arabidopsis thaliana]
Length=658

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 48/68 (71%), Gaps = 5/68 (7%)
 Frame = -2

Query  682  AFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHII--HVELSRIRKSK--RESW  515
            AFLN PHPLE LS R+AYGS G++ RDHD K+Y+K+V  ++  H +L  +RK++  R S 
Sbjct  575  AFLNRPHPLETLSQRAAYGSEGSVLRDHDSKNYVKAVNGVLRQHTKLI-VRKARIQRRSV  633

Query  514  WPLIVIPG  491
            WP++   G
Sbjct  634  WPVLTSAG  641



>ref|XP_002876633.1| hypothetical protein ARALYDRAFT_486656 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52892.1| hypothetical protein ARALYDRAFT_486656 [Arabidopsis lyrata subsp. 
lyrata]
Length=652

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 48/68 (71%), Gaps = 5/68 (7%)
 Frame = -2

Query  682  AFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHII--HVELSRIRKSK--RESW  515
            AFLN PHPLE LS R+AYGS G++ RDHD K+Y+K+V  ++  H +L  +RK++  R S 
Sbjct  569  AFLNRPHPLETLSQRAAYGSEGSVLRDHDSKNYVKAVNGVLRQHTKLI-VRKARIQRRSV  627

Query  514  WPLIVIPG  491
            WP++   G
Sbjct  628  WPVLTSAG  635



>ref|XP_006645720.1| PREDICTED: uncharacterized protein LOC102715257 [Oryza brachyantha]
Length=545

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = -2

Query  706  KRILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHVE  551
            +++ +A + F NSPHPLEIL D+SAYG  G + RDHD+ SYL+SVR ++  E
Sbjct  470  RQLRSAMSTFFNSPHPLEILRDKSAYGPKGAVYRDHDVNSYLRSVRAVVRKE  521



>gb|KHF99816.1| Lipase [Gossypium arboreum]
Length=696

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 45/70 (64%), Gaps = 2/70 (3%)
 Frame = -2

Query  697  LAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHVELSRIRKSKRES  518
            + A  AFLN PHPL+ L D +AYGS GTI RDHD  +YLK+V  ++ ++    R S+ ++
Sbjct  602  MQALMAFLNCPHPLDTLGDLTAYGSDGTILRDHDSSNYLKAVNGVLRLQKMANRCSRMDT  661

Query  517  --WWPLIVIP  494
               WPL+  P
Sbjct  662  SLLWPLLNSP  671



>gb|KGN44530.1| hypothetical protein Csa_7G325710 [Cucumis sativus]
Length=712

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 47/67 (70%), Gaps = 5/67 (7%)
 Frame = -2

Query  682  AFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHII--HVELS--RIRKSKRESW  515
            AFLN PHPLE LSD +AYGS GTI RDHD   YLK++  ++  H +++  ++R ++R+  
Sbjct  621  AFLNCPHPLETLSDPTAYGSEGTILRDHDSSFYLKALNGVLKQHTKMAVGKVR-NQRKLL  679

Query  514  WPLIVIP  494
            WPL+  P
Sbjct  680  WPLLASP  686



>ref|XP_004139735.1| PREDICTED: uncharacterized protein LOC101208871 [Cucumis sativus]
Length=675

 Score = 66.6 bits (161),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 47/67 (70%), Gaps = 5/67 (7%)
 Frame = -2

Query  682  AFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHII--HVELS--RIRKSKRESW  515
            AFLN PHPLE LSD +AYGS GTI RDHD   YLK++  ++  H +++  ++R ++R+  
Sbjct  584  AFLNCPHPLETLSDPTAYGSEGTILRDHDSSFYLKALNGVLKQHTKMAVGKVR-NQRKLL  642

Query  514  WPLIVIP  494
            WPL+  P
Sbjct  643  WPLLASP  649



>ref|XP_011466435.1| PREDICTED: uncharacterized protein LOC101303729 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=434

 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 45/70 (64%), Gaps = 2/70 (3%)
 Frame = -2

Query  697  LAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHVELSRIRKSKRES  518
            L+    FLNSPHPLE  SD +AYGS GTI RDHD  +YLK++  I+ +    +R +++ S
Sbjct  350  LSVLMDFLNSPHPLETPSDPTAYGSEGTIIRDHDSSNYLKAMNGIVRLNTRILRTARKRS  409

Query  517  --WWPLIVIP  494
               WPL+  P
Sbjct  410  NILWPLLNSP  419



>ref|XP_011466434.1| PREDICTED: uncharacterized protein LOC101303729 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=463

 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 45/70 (64%), Gaps = 2/70 (3%)
 Frame = -2

Query  697  LAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHVELSRIRKSKRES  518
            L+    FLNSPHPLE  SD +AYGS GTI RDHD  +YLK++  I+ +    +R +++ S
Sbjct  379  LSVLMDFLNSPHPLETPSDPTAYGSEGTIIRDHDSSNYLKAMNGIVRLNTRILRTARKRS  438

Query  517  --WWPLIVIP  494
               WPL+  P
Sbjct  439  NILWPLLNSP  448



>ref|XP_008778442.1| PREDICTED: uncharacterized protein LOC103698231 isoform X1 [Phoenix 
dactylifera]
Length=702

 Score = 66.2 bits (160),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 41/65 (63%), Gaps = 4/65 (6%)
 Frame = -2

Query  682  AFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKS----VRHIIHVELSRIRKSKRESW  515
            AFLNSPHPLE LSD +AYGS GTI RDHD  +YLK+    VR      + R R+ +    
Sbjct  621  AFLNSPHPLETLSDPAAYGSDGTILRDHDSSNYLKAMSGLVRQHTKSVVWRTRRQRFHQL  680

Query  514  WPLIV  500
            WPL+ 
Sbjct  681  WPLLT  685



>ref|XP_001777743.1| predicted protein [Physcomitrella patens]
 gb|EDQ57405.1| predicted protein [Physcomitrella patens]
Length=850

 Score = 66.2 bits (160),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 29/46 (63%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = -2

Query  706  KRILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVR  569
            + + +A+ AFLN PHPLEILSDR+AYGS GTI RDHD ++YLK ++
Sbjct  705  RELQSAERAFLNVPHPLEILSDRNAYGSEGTISRDHDCRNYLKVLQ  750



>emb|CAN64332.1| hypothetical protein VITISV_014668 [Vitis vinifera]
Length=681

 Score = 65.9 bits (159),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 48/75 (64%), Gaps = 5/75 (7%)
 Frame = -2

Query  694  AAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHII--HVE--LSRIRKSK  527
            +A  AF+N PHPLE LSD +AYGS GTI RDHD  +YLK+V  ++  H +  L R+R+ +
Sbjct  590  SAIRAFINCPHPLETLSDPTAYGSEGTILRDHDSSNYLKAVNGVLRQHTKTVLRRVRR-Q  648

Query  526  RESWWPLIVIPGVKA  482
                WPL+  P   A
Sbjct  649  GNLMWPLLTSPSPHA  663



>ref|XP_010661904.1| PREDICTED: uncharacterized protein LOC100256908 [Vitis vinifera]
 ref|XP_010661905.1| PREDICTED: uncharacterized protein LOC100256908 [Vitis vinifera]
 ref|XP_010661906.1| PREDICTED: uncharacterized protein LOC100256908 [Vitis vinifera]
Length=680

 Score = 65.9 bits (159),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 48/75 (64%), Gaps = 5/75 (7%)
 Frame = -2

Query  694  AAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHII--HVE--LSRIRKSK  527
            +A  AF+N PHPLE LSD +AYGS GTI RDHD  +YLK+V  ++  H +  L R+R+ +
Sbjct  589  SAIRAFINCPHPLETLSDPTAYGSEGTILRDHDSSNYLKAVNGVLRQHTKTVLRRVRR-Q  647

Query  526  RESWWPLIVIPGVKA  482
                WPL+  P   A
Sbjct  648  GNLMWPLLTSPSPHA  662



>gb|ADY38373.1| triacylglycerol lipase 1 [Arachis hypogaea]
Length=694

 Score = 65.9 bits (159),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 41/68 (60%), Gaps = 4/68 (6%)
 Frame = -2

Query  682  AFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHVE----LSRIRKSKRESW  515
             FLN PHP+E LSD +AYGS GTI RDHD  +YLK V  ++       + ++RK +    
Sbjct  603  TFLNQPHPIETLSDPTAYGSEGTILRDHDSSNYLKVVNGVLRQHSKNIVRQMRKQRINEL  662

Query  514  WPLIVIPG  491
            WPL+  P 
Sbjct  663  WPLLTTPS  670



>ref|XP_010053809.1| PREDICTED: uncharacterized protein LOC104442170 [Eucalyptus grandis]
 ref|XP_010053810.1| PREDICTED: uncharacterized protein LOC104442170 [Eucalyptus grandis]
 gb|KCW78165.1| hypothetical protein EUGRSUZ_D02365 [Eucalyptus grandis]
Length=705

 Score = 65.9 bits (159),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 43/68 (63%), Gaps = 5/68 (7%)
 Frame = -2

Query  682  AFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHVEL----SRIR-KSKRES  518
            AFLN PHPL+ LSD +AYGS GTI RDHD  +YLK++  ++  +      R+R  + R  
Sbjct  613  AFLNCPHPLDTLSDPTAYGSKGTILRDHDSSNYLKAINGVLRQQTRMTDKRVRILTPRNQ  672

Query  517  WWPLIVIP  494
             WPL+  P
Sbjct  673  MWPLLTSP  680



>emb|CBI40502.3| unnamed protein product [Vitis vinifera]
Length=650

 Score = 65.9 bits (159),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 48/75 (64%), Gaps = 5/75 (7%)
 Frame = -2

Query  694  AAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHII--HVE--LSRIRKSK  527
            +A  AF+N PHPLE LSD +AYGS GTI RDHD  +YLK+V  ++  H +  L R+R+ +
Sbjct  564  SAIRAFINCPHPLETLSDPTAYGSEGTILRDHDSSNYLKAVNGVLRQHTKTVLRRVRR-Q  622

Query  526  RESWWPLIVIPGVKA  482
                WPL+  P   A
Sbjct  623  GNLMWPLLTSPSPHA  637



>ref|XP_008461523.1| PREDICTED: uncharacterized protein LOC103500094 [Cucumis melo]
Length=675

 Score = 65.9 bits (159),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 46/67 (69%), Gaps = 5/67 (7%)
 Frame = -2

Query  682  AFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHII--HVEL--SRIRKSKRESW  515
            AFLN PHPLE LSD +AYGS GTI RDHD   YLK++  ++  H ++   ++R ++R+  
Sbjct  584  AFLNCPHPLETLSDPTAYGSEGTILRDHDSSFYLKALNGVLKQHTKMGVGKVR-NQRKLL  642

Query  514  WPLIVIP  494
            WPL+  P
Sbjct  643  WPLLASP  649



>ref|XP_002455384.1| hypothetical protein SORBIDRAFT_03g009750 [Sorghum bicolor]
 gb|EES00504.1| hypothetical protein SORBIDRAFT_03g009750 [Sorghum bicolor]
Length=716

 Score = 65.9 bits (159),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 41/57 (72%), Gaps = 0/57 (0%)
 Frame = -2

Query  730  VTDDDDAEKRILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHII  560
             + D    +++ +A +AF NSPHPLEIL D +AYG  G++ RDHD+ SYL+SVR ++
Sbjct  571  ASGDGSLSQQVRSALSAFFNSPHPLEILKDGAAYGPRGSVYRDHDVNSYLRSVRGVV  627



>ref|XP_010925181.1| PREDICTED: uncharacterized protein LOC105047792 [Elaeis guineensis]
Length=511

 Score = 65.5 bits (158),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 36/91 (40%), Positives = 49/91 (54%), Gaps = 11/91 (12%)
 Frame = -2

Query  700  ILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHVELSRIRKSKRE  521
            +  A  AFLNSPHPLE LSD +AYGS GTI RDHD  +YLK++  ++      + +  R 
Sbjct  420  VAGALRAFLNSPHPLETLSDPTAYGSDGTILRDHDSCNYLKAINGLVRQNTKSVVRRTRR  479

Query  520  S----WWPLIVI-------PGVKAADIFVGR  461
                  WPL          PG+ + ++  GR
Sbjct  480  RRFNHLWPLTTTTTNRMEKPGLVSREVVAGR  510



>emb|CDP08695.1| unnamed protein product [Coffea canephora]
Length=696

 Score = 65.5 bits (158),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 44/61 (72%), Gaps = 1/61 (2%)
 Frame = -2

Query  700  ILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHVELSR-IRKSKR  524
            + +A  AFLN+PHPLE LSD +AYGS GTI RDHD  +YLK+V  +I     + IRK+++
Sbjct  601  VASALRAFLNTPHPLETLSDPTAYGSEGTILRDHDSSNYLKAVNKVIRQHTRQDIRKARK  660

Query  523  E  521
            +
Sbjct  661  Q  661



>ref|XP_006292392.1| hypothetical protein CARUB_v10018605mg [Capsella rubella]
 gb|EOA25290.1| hypothetical protein CARUB_v10018605mg [Capsella rubella]
Length=656

 Score = 65.5 bits (158),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 46/67 (69%), Gaps = 3/67 (4%)
 Frame = -2

Query  682  AFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHII--HVEL-SRIRKSKRESWW  512
            AFLN PHPLE LS R+AYGS G++ RDHD K+Y+K+V  ++  H +L  R  + +R S W
Sbjct  573  AFLNRPHPLETLSQRAAYGSEGSVLRDHDSKNYVKAVNGVLRQHSKLIVRRARIQRRSVW  632

Query  511  PLIVIPG  491
            P++   G
Sbjct  633  PVLTSAG  639



>ref|XP_007208002.1| hypothetical protein PRUPE_ppa014662mg [Prunus persica]
 gb|EMJ09201.1| hypothetical protein PRUPE_ppa014662mg [Prunus persica]
Length=495

 Score = 65.1 bits (157),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 45/67 (67%), Gaps = 5/67 (7%)
 Frame = -2

Query  682  AFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHII----HVELSRIRKSKRESW  515
            AFLNSPHPLE  SD +AYGS GTI RDHD  +YLK++  ++     + + ++RK +R   
Sbjct  417  AFLNSPHPLETFSDPAAYGSEGTILRDHDSCNYLKAMNMVLRQHTRMVVRKVRK-QRNLL  475

Query  514  WPLIVIP  494
            WP++  P
Sbjct  476  WPILTSP  482



>gb|AFW79680.1| hypothetical protein ZEAMMB73_210781 [Zea mays]
Length=734

 Score = 65.1 bits (157),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 50/73 (68%), Gaps = 5/73 (7%)
 Frame = -2

Query  703  RILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHVELSRIRKSKR  524
            ++ +A +AF NSPHPLEIL D +AYG  G++ RDHD+ SYL+SVR ++  E  R R+++R
Sbjct  612  QLRSALSAFFNSPHPLEILKDGAAYGPRGSVYRDHDVNSYLRSVRAVVRKEARRAREAER  671

Query  523  ES-----WWPLIV  500
            E      WWP  V
Sbjct  672  ERWRLLLWWPFGV  684



>ref|NP_001169446.1| uncharacterized protein LOC100383317 [Zea mays]
 gb|ACN33792.1| unknown [Zea mays]
Length=688

 Score = 65.1 bits (157),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 50/73 (68%), Gaps = 5/73 (7%)
 Frame = -2

Query  703  RILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHVELSRIRKSKR  524
            ++ +A +AF NSPHPLEIL D +AYG  G++ RDHD+ SYL+SVR ++  E  R R+++R
Sbjct  566  QLRSALSAFFNSPHPLEILKDGAAYGPRGSVYRDHDVNSYLRSVRAVVRKEARRAREAER  625

Query  523  ES-----WWPLIV  500
            E      WWP  V
Sbjct  626  ERWRLLLWWPFGV  638



>emb|CDY43945.1| BnaC04g21650D [Brassica napus]
Length=644

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 48/77 (62%), Gaps = 3/77 (4%)
 Frame = -2

Query  721  DDDAEKRILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHII--HVEL  548
            D + E     A   FLN PHPLE LS R+AYGS G++ RDHD K+Y+K+V  +I  H +L
Sbjct  545  DKNNEDYSPTALRGFLNRPHPLETLSQRAAYGSEGSVLRDHDSKNYVKAVNGVIRQHTKL  604

Query  547  -SRIRKSKRESWWPLIV  500
              R  + +R + WP++ 
Sbjct  605  IVRKVRRQRSTIWPVLT  621



>ref|XP_010469109.1| PREDICTED: uncharacterized protein LOC104749219 [Camelina sativa]
 ref|XP_010469110.1| PREDICTED: uncharacterized protein LOC104749219 [Camelina sativa]
 ref|XP_010469111.1| PREDICTED: uncharacterized protein LOC104749219 [Camelina sativa]
Length=654

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 42/68 (62%), Gaps = 3/68 (4%)
 Frame = -2

Query  682  AFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHVELSRIRKSKR---ESWW  512
            AFLN PHPLE LS R+AYGS G+I RDHD K+Y+K+V  ++      I +  R    S W
Sbjct  571  AFLNRPHPLETLSQRAAYGSEGSILRDHDSKNYVKAVNGVLRQHTKFIVRKARIHMRSVW  630

Query  511  PLIVIPGV  488
            P++   G 
Sbjct  631  PVLTSAGC  638



>ref|XP_007147296.1| hypothetical protein PHAVU_006G112000g [Phaseolus vulgaris]
 ref|XP_007147297.1| hypothetical protein PHAVU_006G112000g [Phaseolus vulgaris]
 gb|ESW19290.1| hypothetical protein PHAVU_006G112000g [Phaseolus vulgaris]
 gb|ESW19291.1| hypothetical protein PHAVU_006G112000g [Phaseolus vulgaris]
Length=694

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 41/66 (62%), Gaps = 4/66 (6%)
 Frame = -2

Query  679  FLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIH----VELSRIRKSKRESWW  512
            FLN PHP++ LSD +AYGS GTI RDHD  +YLK+V  ++     + + R  K +    W
Sbjct  604  FLNQPHPIDTLSDPTAYGSEGTILRDHDSSNYLKAVNGVLREHSKILVRRASKQRINQLW  663

Query  511  PLIVIP  494
            PL+  P
Sbjct  664  PLLTSP  669



>ref|XP_009412375.1| PREDICTED: uncharacterized protein LOC103993881 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=648

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 50/75 (67%), Gaps = 4/75 (5%)
 Frame = -2

Query  694  AAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHII--HVELS--RIRKSK  527
            +A  AF+NSPHPLE LSD  AYGS GTI RDHD ++Y+K++  ++  H + +  R RK +
Sbjct  569  SALRAFINSPHPLETLSDPMAYGSEGTILRDHDCRNYVKAINGLLRQHTKSARRRSRKHR  628

Query  526  RESWWPLIVIPGVKA  482
            R  WWP + +P   A
Sbjct  629  RNRWWPRLPVPANGA  643



>ref|XP_001756666.1| predicted protein [Physcomitrella patens]
 gb|EDQ78620.1| predicted protein, partial [Physcomitrella patens]
Length=542

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 41/62 (66%), Gaps = 0/62 (0%)
 Frame = -2

Query  706  KRILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHVELSRIRKSK  527
            K + +A+ +FLNSPHPLEILSD ++YGS GTI RDHD   YL ++   +     R R+  
Sbjct  423  KEVRSAERSFLNSPHPLEILSDPASYGSEGTISRDHDAGQYLLAINTALREAFKRWRQQD  482

Query  526  RE  521
            ++
Sbjct  483  KD  484



>ref|XP_009412376.1| PREDICTED: uncharacterized protein LOC103993881 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=639

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 50/75 (67%), Gaps = 4/75 (5%)
 Frame = -2

Query  694  AAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHII--HVELS--RIRKSK  527
            +A  AF+NSPHPLE LSD  AYGS GTI RDHD ++Y+K++  ++  H + +  R RK +
Sbjct  560  SALRAFINSPHPLETLSDPMAYGSEGTILRDHDCRNYVKAINGLLRQHTKSARRRSRKHR  619

Query  526  RESWWPLIVIPGVKA  482
            R  WWP + +P   A
Sbjct  620  RNRWWPRLPVPANGA  634



>gb|KJB49533.1| hypothetical protein B456_008G124400 [Gossypium raimondii]
Length=673

 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 42/72 (58%), Gaps = 6/72 (8%)
 Frame = -2

Query  691  AKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHV------ELSRIRKS  530
            A  AFLN PHPL+ LSD +AYGS GTI RDHD  +YLK++  ++         L+    S
Sbjct  580  ALKAFLNCPHPLDTLSDLTAYGSEGTILRDHDSSNYLKAINGVLRQHKKTVPSLTTRTVS  639

Query  529  KRESWWPLIVIP  494
                 WPL+V P
Sbjct  640  DTSLLWPLLVSP  651



>gb|KHG25824.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Gossypium 
arboreum]
Length=673

 Score = 63.5 bits (153),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 42/72 (58%), Gaps = 6/72 (8%)
 Frame = -2

Query  691  AKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHV------ELSRIRKS  530
            A  AFLN PHPL+ LSD +AYGS GTI RDHD  +YLK++  ++         L+    S
Sbjct  580  ALKAFLNCPHPLDTLSDLTAYGSEGTILRDHDSSNYLKAINGVLRQHKKTVPSLTTRTVS  639

Query  529  KRESWWPLIVIP  494
                 WPL+V P
Sbjct  640  DTSLLWPLLVSP  651



>tpg|DAA58548.1| TPA: hypothetical protein ZEAMMB73_663476 [Zea mays]
Length=361

 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 52/102 (51%), Gaps = 24/102 (24%)
 Frame = -2

Query  724  DDDDAEKR----------ILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKS  575
            D DDA  R          + +A  AFLNSPHPLE LSD SAYG+GG I RDH+  +Y ++
Sbjct  247  DSDDAGLRGGAERPPRALVASALRAFLNSPHPLETLSDLSAYGAGGAILRDHESSNYFRA  306

Query  574  VRHIIHVELSRIRKSK-----------RESWWPLI---VIPG  491
            +  +      R ++ +           ++ WWP I   VIP 
Sbjct  307  LSALARAPPRRRKQPEVVWQLPGVERLQQYWWPGIASTVIPA  348



>ref|XP_008673392.1| PREDICTED: uncharacterized protein LOC100502484 isoform X1 [Zea 
mays]
Length=870

 Score = 62.8 bits (151),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 52/102 (51%), Gaps = 24/102 (24%)
 Frame = -2

Query  724  DDDDAEKR----------ILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKS  575
            D DDA  R          + +A  AFLNSPHPLE LSD SAYG+GG I RDH+  +Y ++
Sbjct  756  DSDDAGLRGGAERPPRALVASALRAFLNSPHPLETLSDLSAYGAGGAILRDHESSNYFRA  815

Query  574  VRHIIHVELSRIRKSK-----------RESWWPLI---VIPG  491
            +  +      R ++ +           ++ WWP I   VIP 
Sbjct  816  LSALARAPPRRRKQPEVVWQLPGVERLQQYWWPGIASTVIPA  857



>gb|KJB73117.1| hypothetical protein B456_011G215900 [Gossypium raimondii]
Length=315

 Score = 62.0 bits (149),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 44/71 (62%), Gaps = 4/71 (6%)
 Frame = -2

Query  694  AAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHI--IHVELSRIRK--SK  527
            AA   FLNSPHPL+ L D  AYG  GT+  +HD  SYLK+++ +  +H+  + + K   K
Sbjct  230  AAINGFLNSPHPLQTLFDGKAYGDDGTVSLNHDSSSYLKAIKGVLRLHIRATIVPKLREK  289

Query  526  RESWWPLIVIP  494
            +   WPL+V P
Sbjct  290  KSLLWPLLVSP  300



>gb|KJB73119.1| hypothetical protein B456_011G215900 [Gossypium raimondii]
Length=416

 Score = 62.4 bits (150),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 44/71 (62%), Gaps = 4/71 (6%)
 Frame = -2

Query  694  AAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHI--IHVELSRIRK--SK  527
            AA   FLNSPHPL+ L D  AYG  GT+  +HD  SYLK+++ +  +H+  + + K   K
Sbjct  331  AAINGFLNSPHPLQTLFDGKAYGDDGTVSLNHDSSSYLKAIKGVLRLHIRATIVPKLREK  390

Query  526  RESWWPLIVIP  494
            +   WPL+V P
Sbjct  391  KSLLWPLLVSP  401



>tpg|DAA58549.1| TPA: hypothetical protein ZEAMMB73_663476 [Zea mays]
Length=677

 Score = 62.4 bits (150),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 38/101 (38%), Positives = 52/101 (51%), Gaps = 24/101 (24%)
 Frame = -2

Query  724  DDDDAEKR----------ILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKS  575
            D DDA  R          + +A  AFLNSPHPLE LSD SAYG+GG I RDH+  +Y ++
Sbjct  563  DSDDAGLRGGAERPPRALVASALRAFLNSPHPLETLSDLSAYGAGGAILRDHESSNYFRA  622

Query  574  VRHIIHVELSRIRKSK-----------RESWWPLI---VIP  494
            +  +      R ++ +           ++ WWP I   VIP
Sbjct  623  LSALARAPPRRRKQPEVVWQLPGVERLQQYWWPGIASTVIP  663



>ref|XP_008245443.1| PREDICTED: uncharacterized protein LOC103343559 [Prunus mume]
Length=572

 Score = 62.0 bits (149),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 44/68 (65%), Gaps = 5/68 (7%)
 Frame = -2

Query  682  AFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHII----HVELSRIRKSKRESW  515
            AFLNSPHPLE  SD +AY S GTI RDHD  +YLK++  ++     + + ++RK +R   
Sbjct  494  AFLNSPHPLETFSDPAAYRSEGTILRDHDSCNYLKAMNMVLRQHTRMVVRKVRK-QRNLL  552

Query  514  WPLIVIPG  491
            WP++  P 
Sbjct  553  WPILTSPS  560



>ref|XP_002455964.1| hypothetical protein SORBIDRAFT_03g028110 [Sorghum bicolor]
 gb|EES01084.1| hypothetical protein SORBIDRAFT_03g028110 [Sorghum bicolor]
Length=687

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/83 (40%), Positives = 47/83 (57%), Gaps = 14/83 (17%)
 Frame = -2

Query  700  ILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHVELSRIRKSK--  527
            + +A  AFLNSPHPLE LSD SAYG+GG I RDH+  +Y +++  +      R ++ +  
Sbjct  591  VASALRAFLNSPHPLETLSDLSAYGAGGAILRDHESSNYFRALSALARAPPRRRKQPEIV  650

Query  526  ---------RESWWPLI---VIP  494
                     ++ WWP I   VIP
Sbjct  651  WQLPGVERLQQYWWPGIAGTVIP  673



>gb|KJB41502.1| hypothetical protein B456_007G107600 [Gossypium raimondii]
Length=130

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -2

Query  700  ILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHII  560
             + A  AFLN PHPL+ LSD +AYGS GTI RDH+  +YLK+V  ++
Sbjct  82   FMQALKAFLNCPHPLDTLSDLTAYGSEGTILRDHNSSNYLKAVNGVL  128



>ref|XP_010233458.1| PREDICTED: uncharacterized protein LOC100845988 [Brachypodium 
distachyon]
Length=660

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 51/81 (63%), Gaps = 5/81 (6%)
 Frame = -2

Query  724  DDDDAEKRILA-AKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHVEL  548
            ++  AE+ ++A A  AFLNSPHPLE LSD SAYGS G I RDH+  +Y +++  +  V  
Sbjct  550  EERAAERPLVASAMRAFLNSPHPLETLSDLSAYGSEGAILRDHESGNYFRALYALSKVP-  608

Query  547  SRIRKSKRESWWPLIVIPGVK  485
             R RK + E  W L   PGV+
Sbjct  609  PRRRKKQPEIVWRL---PGVE  626



>ref|NP_001172466.1| Os01g0618600 [Oryza sativa Japonica Group]
 dbj|BAH91196.1| Os01g0618600 [Oryza sativa Japonica Group]
Length=264

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 45/79 (57%), Gaps = 6/79 (8%)
 Frame = -2

Query  721  DDDAEKRILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHVELSR  542
            +  A   + +A  AFLNSPHPLE LSD SAYGS G I RDH+  +Y +++  +  V   R
Sbjct  160  ERPARHVVASALRAFLNSPHPLETLSDLSAYGSEGAILRDHESSNYFRALNALTRV--PR  217

Query  541  IRKSKRESWWPLIVIPGVK  485
             RK     W     +PGV+
Sbjct  218  RRKQPEIVWQ----LPGVE  232



>ref|XP_006446427.1| hypothetical protein CICLE_v10018154mg [Citrus clementina]
 gb|ESR59667.1| hypothetical protein CICLE_v10018154mg [Citrus clementina]
Length=703

 Score = 60.8 bits (146),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 41/71 (58%), Gaps = 10/71 (14%)
 Frame = -2

Query  679  FLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHII---------HVELSRIRKSK  527
            FLN PHPL  LSD +AYGS GTI RDHD  +YLK+V  ++          + L + RK K
Sbjct  609  FLNWPHPLATLSDPTAYGSDGTILRDHDSSNYLKAVHGVLRQHSRMDHTRMVLCKARKQK  668

Query  526  RESWWPLIVIP  494
                WPL+  P
Sbjct  669  N-MLWPLLTSP  678



>gb|KDO66297.1| hypothetical protein CISIN_1g036393mg [Citrus sinensis]
Length=692

 Score = 60.8 bits (146),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 41/70 (59%), Gaps = 8/70 (11%)
 Frame = -2

Query  679  FLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHII--HVELSRIR------KSKR  524
            FLN PHPL  LSD +AYGS GTI RDHD  +YLK+V  ++  H  +   R      + ++
Sbjct  598  FLNWPHPLATLSDPTAYGSDGTILRDHDSSNYLKAVHGVLRQHSRMDHTRMVFCKARKQK  657

Query  523  ESWWPLIVIP  494
               WPL+  P
Sbjct  658  NMLWPLLTSP  667



>ref|XP_006470405.1| PREDICTED: uncharacterized protein LOC102614506 isoform X1 [Citrus 
sinensis]
 ref|XP_006470406.1| PREDICTED: uncharacterized protein LOC102614506 isoform X2 [Citrus 
sinensis]
 ref|XP_006470407.1| PREDICTED: uncharacterized protein LOC102614506 isoform X3 [Citrus 
sinensis]
Length=699

 Score = 60.8 bits (146),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 41/70 (59%), Gaps = 8/70 (11%)
 Frame = -2

Query  679  FLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHII--HVELSRIR------KSKR  524
            FLN PHPL  LSD +AYGS GTI RDHD  +YLK+V  ++  H  +   R      + ++
Sbjct  605  FLNWPHPLATLSDPTAYGSDGTILRDHDSSNYLKAVHGVLRQHSRMDHTRMVFCKARKQK  664

Query  523  ESWWPLIVIP  494
               WPL+  P
Sbjct  665  NMLWPLLTSP  674



>ref|XP_001777284.1| predicted protein [Physcomitrella patens]
 gb|EDQ57939.1| predicted protein [Physcomitrella patens]
Length=648

 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 77/120 (64%), Gaps = 16/120 (13%)
 Frame = -2

Query  694  AAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHVELSRIRKSKR---  524
            +A+ AFLN+PHPL+IL DRS+YGSGG+I RDHD ++Y K+V +++  EL ++RKS +   
Sbjct  516  SAQRAFLNNPHPLQILRDRSSYGSGGSISRDHDPRNYDKAVNYLLRQELRKLRKSYKTEK  575

Query  523  --ESWWPLIVIPGVKAADIFVGRLVRPTGQGQFTFAGMFH-SGKESLKRFT-VVAAQHMH  356
              + WWP +      A++I V  L++  G      A   H S  + L R++ ++A++H+H
Sbjct  576  RVQIWWPSL------ASEIGV-ELIK--GVLTSKIADSEHRSALDRLSRYSRLIASKHVH  626



>ref|XP_010261536.1| PREDICTED: uncharacterized protein LOC104600342 isoform X2 [Nelumbo 
nucifera]
Length=694

 Score = 60.5 bits (145),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 43/73 (59%), Gaps = 4/73 (5%)
 Frame = -2

Query  700  ILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIH----VELSRIRK  533
            I +A  AFLNSPHPLE LSD  AYGS GTI RDH+  +Y K+V  ++     V + R R 
Sbjct  598  IASALRAFLNSPHPLETLSDPKAYGSEGTILRDHESINYSKAVNGVLRQQTKVVVQRPRT  657

Query  532  SKRESWWPLIVIP  494
             +     PL+  P
Sbjct  658  LRLHHICPLLTTP  670



>dbj|BAD61517.1| lipase class 3 family protein-like [Oryza sativa Japonica Group]
Length=678

 Score = 60.1 bits (144),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 43/77 (56%), Gaps = 10/77 (13%)
 Frame = -2

Query  700  ILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHVELSRIR-----  536
            + +A  AFLNSPHPLE LSD SAYGS G I RDH+  +Y +++  +  V   R +     
Sbjct  581  VASALRAFLNSPHPLETLSDLSAYGSEGAILRDHESSNYFRALNALTRVPRRRKQPEIVW  640

Query  535  -----KSKRESWWPLIV  500
                 +  ++ WWP I 
Sbjct  641  QLPGVERLQQYWWPGIA  657



>gb|EEC71102.1| hypothetical protein OsI_02886 [Oryza sativa Indica Group]
Length=677

 Score = 60.1 bits (144),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 43/77 (56%), Gaps = 10/77 (13%)
 Frame = -2

Query  700  ILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHVELSRIR-----  536
            + +A  AFLNSPHPLE LSD SAYGS G I RDH+  +Y +++  +  V   R +     
Sbjct  580  VASALRAFLNSPHPLETLSDLSAYGSEGAILRDHESSNYFRALNALTRVPRRRKQPEIVW  639

Query  535  -----KSKRESWWPLIV  500
                 +  ++ WWP I 
Sbjct  640  QLPGVERLQQYWWPGIA  656



>ref|XP_010261535.1| PREDICTED: uncharacterized protein LOC104600342 isoform X1 [Nelumbo 
nucifera]
Length=703

 Score = 60.1 bits (144),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 43/73 (59%), Gaps = 4/73 (5%)
 Frame = -2

Query  700  ILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIH----VELSRIRK  533
            I +A  AFLNSPHPLE LSD  AYGS GTI RDH+  +Y K+V  ++     V + R R 
Sbjct  607  IASALRAFLNSPHPLETLSDPKAYGSEGTILRDHESINYSKAVNGVLRQQTKVVVQRPRT  666

Query  532  SKRESWWPLIVIP  494
             +     PL+  P
Sbjct  667  LRLHHICPLLTTP  679



>emb|CDM83423.1| unnamed protein product [Triticum aestivum]
Length=675

 Score = 60.1 bits (144),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 32/83 (39%), Positives = 47/83 (57%), Gaps = 14/83 (17%)
 Frame = -2

Query  700  ILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHVELSRIRKSK--  527
            + +A  AFLNSPHPLE LSD SAYGS G I RDH+  +Y +++  +  V   R ++ +  
Sbjct  579  VASALRAFLNSPHPLETLSDLSAYGSEGAILRDHESGNYFRALYALTKVAPRRRKQPEIV  638

Query  526  ---------RESWWPLI---VIP  494
                     ++ WWP +   V+P
Sbjct  639  WRLPGVERLQQYWWPGVAGTVVP  661



>gb|EAZ12713.1| hypothetical protein OsJ_02630 [Oryza sativa Japonica Group]
Length=575

 Score = 60.1 bits (144),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 43/72 (60%), Gaps = 6/72 (8%)
 Frame = -2

Query  700  ILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHVELSRIRKSKRE  521
            + +A  AFLNSPHPLE LSD SAYGS G I RDH+  +Y +++  +  V   R RK    
Sbjct  478  VASALRAFLNSPHPLETLSDLSAYGSEGAILRDHESSNYFRALNALTRV--PRRRKQPEI  535

Query  520  SWWPLIVIPGVK  485
             W     +PGV+
Sbjct  536  VWQ----LPGVE  543



>ref|XP_010523802.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104802066 
[Tarenaya hassleriana]
Length=649

 Score = 60.1 bits (144),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 41/63 (65%), Gaps = 4/63 (6%)
 Frame = -2

Query  691  AKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHII--HVEL--SRIRKSKR  524
            A  AFLN PHPLE LS   AYGS G++ RDHD  +Y+K+V  ++  H +L   R+RK +R
Sbjct  561  ALRAFLNRPHPLETLSHPGAYGSDGSVLRDHDSSNYVKAVNGVLREHTKLVIRRVRKERR  620

Query  523  ESW  515
              W
Sbjct  621  MMW  623



>ref|NP_001159209.1| uncharacterized protein LOC100304295 [Zea mays]
 gb|ACN25410.1| unknown [Zea mays]
Length=353

 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 46/84 (55%), Gaps = 14/84 (17%)
 Frame = -2

Query  700  ILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHVELSRIRKSK--  527
            + +A  AFL SPHPLE LSD SAYG+GG I RDH+  +Y +++  +      R ++ +  
Sbjct  256  VASALRAFLYSPHPLETLSDLSAYGAGGAILRDHESSNYFRALSALARAPPRRRKQPEIV  315

Query  526  ---------RESWWPLI---VIPG  491
                     ++ WWP I   VIP 
Sbjct  316  WQLPGVERLQQYWWPGIAGTVIPA  339



>ref|XP_008655146.1| PREDICTED: uncharacterized protein LOC100304295 isoform X1 [Zea 
mays]
Length=556

 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 46/84 (55%), Gaps = 14/84 (17%)
 Frame = -2

Query  700  ILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHVELSRIRKSK--  527
            + +A  AFL SPHPLE LSD SAYG+GG I RDH+  +Y +++  +      R ++ +  
Sbjct  459  VASALRAFLYSPHPLETLSDLSAYGAGGAILRDHESSNYFRALSALARAPPRRRKQPEIV  518

Query  526  ---------RESWWPLI---VIPG  491
                     ++ WWP I   VIP 
Sbjct  519  WQLPGVERLQQYWWPGIAGTVIPA  542



>gb|AFW83289.1| hypothetical protein ZEAMMB73_987353 [Zea mays]
Length=645

 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 46/84 (55%), Gaps = 14/84 (17%)
 Frame = -2

Query  700  ILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHVELSRIRKSK--  527
            + +A  AFL SPHPLE LSD SAYG+GG I RDH+  +Y +++  +      R ++ +  
Sbjct  548  VASALRAFLYSPHPLETLSDLSAYGAGGAILRDHESSNYFRALSALARAPPRRRKQPEIV  607

Query  526  ---------RESWWPLI---VIPG  491
                     ++ WWP I   VIP 
Sbjct  608  WQLPGVERLQQYWWPGIAGTVIPA  631



>gb|EMS48583.1| Lipase [Triticum urartu]
Length=345

 Score = 56.6 bits (135),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 34/49 (69%), Gaps = 0/49 (0%)
 Frame = -2

Query  700  ILAAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHV  554
            + +A  AFLNSPHPLE LSD SAYGS G I RDH+  +Y +++  +  V
Sbjct  297  VASALRAFLNSPHPLETLSDLSAYGSEGAILRDHESGNYFRALYALTKV  345



>gb|KHN06299.1| Lipase [Glycine soja]
Length=573

 Score = 56.6 bits (135),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = -2

Query  682  AFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHII  560
            AF N PHP+E LS+  AYGS GT+ RDHD  +YLK+V  + 
Sbjct  507  AFFNQPHPIETLSNPKAYGSDGTVLRDHDCNNYLKAVNGVF  547



>ref|XP_003529894.1| PREDICTED: uncharacterized protein LOC100796262 [Glycine max]
Length=670

 Score = 56.2 bits (134),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = -2

Query  682  AFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHII  560
            AF N PHP+E LS+  AYGS GT+ RDHD  +YLK+V  + 
Sbjct  604  AFFNQPHPIETLSNPKAYGSDGTVLRDHDCNNYLKAVNGVF  644



>ref|XP_007135241.1| hypothetical protein PHAVU_010G112600g [Phaseolus vulgaris]
 gb|ESW07235.1| hypothetical protein PHAVU_010G112600g [Phaseolus vulgaris]
Length=671

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 36/58 (62%), Gaps = 1/58 (2%)
 Frame = -2

Query  682  AFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHVELSRIRKSKRESWWP  509
             FLN PHP+E LS+  AYGS GT+ RDHD  +YL +V  ++  + S+I    R S  P
Sbjct  605  TFLNQPHPIETLSNPKAYGSDGTVLRDHDCNNYLIAVNGVL-AQNSKIVVRTRRSQQP  661



>gb|KHG01400.1| hypothetical protein F383_21677 [Gossypium arboreum]
Length=239

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = -2

Query  694  AAKTAFLNSPHPLEILSDRSAYGSGGTIQRDHDMKSYLKSVRHIIHVELS  545
            AA   FLNSP PL+ L D  AYG  GT+  +HD  SYLK++  ++ + ++
Sbjct  176  AAINGFLNSPRPLQTLFDPKAYGDDGTVSLNHDSSSYLKAINGVLRLHIT  225



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1386214017500