BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig11199

Length=964
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010324035.1|  PREDICTED: probable protein phosphatase 2C 6...    328   2e-106   
ref|XP_006342335.1|  PREDICTED: probable protein phosphatase 2C 6...    330   5e-106   Solanum tuberosum [potatoes]
ref|XP_006342331.1|  PREDICTED: probable protein phosphatase 2C 6...    330   2e-105   Solanum tuberosum [potatoes]
ref|XP_006342334.1|  PREDICTED: probable protein phosphatase 2C 6...    330   2e-105   
ref|XP_006342333.1|  PREDICTED: probable protein phosphatase 2C 6...    330   2e-105   Solanum tuberosum [potatoes]
ref|XP_010324031.1|  PREDICTED: probable protein phosphatase 2C 5...    330   4e-105   Solanum lycopersicum
ref|XP_010324032.1|  PREDICTED: probable protein phosphatase 2C 5...    329   4e-105   Solanum lycopersicum
ref|XP_010324033.1|  PREDICTED: probable protein phosphatase 2C 5...    329   5e-105   
ref|XP_004243738.1|  PREDICTED: probable protein phosphatase 2C 5...    329   5e-105   Solanum lycopersicum
ref|XP_004243737.1|  PREDICTED: probable protein phosphatase 2C 5...    329   5e-105   Solanum lycopersicum
ref|XP_009777432.1|  PREDICTED: probable protein phosphatase 2C 5...    325   6e-104   Nicotiana sylvestris
ref|XP_009777428.1|  PREDICTED: probable protein phosphatase 2C 5...    326   9e-104   Nicotiana sylvestris
ref|XP_009777431.1|  PREDICTED: probable protein phosphatase 2C 5...    326   9e-104   Nicotiana sylvestris
ref|XP_009603753.1|  PREDICTED: probable protein phosphatase 2C 5...    324   2e-103   
ref|XP_009603748.1|  PREDICTED: probable protein phosphatase 2C 5...    324   3e-103   Nicotiana tomentosiformis
ref|XP_009603752.1|  PREDICTED: probable protein phosphatase 2C 5...    324   4e-103   Nicotiana tomentosiformis
ref|XP_011078036.1|  PREDICTED: probable protein phosphatase 2C 50      309   6e-97    Sesamum indicum [beniseed]
gb|AFP49836.1|  type 2C protein phosphatase                             298   3e-96    Cucumis sativus [cucumbers]
ref|XP_010247361.1|  PREDICTED: probable protein phosphatase 2C 53      303   2e-94    
ref|XP_007012349.1|  ABI1 isoform 1                                     301   5e-94    
ref|XP_010262014.1|  PREDICTED: protein phosphatase 2C 16-like          301   6e-94    Nelumbo nucifera [Indian lotus]
ref|XP_004146814.1|  PREDICTED: protein phosphatase 2C 16-like          301   6e-94    Cucumis sativus [cucumbers]
emb|CBI20679.3|  unnamed protein product                                298   2e-93    Vitis vinifera
ref|XP_009334717.1|  PREDICTED: probable protein phosphatase 2C 50      300   2e-93    
ref|XP_006646035.1|  PREDICTED: probable protein phosphatase 2C 6...    293   2e-93    
gb|KJB54638.1|  hypothetical protein B456_009G042600                    300   3e-93    Gossypium raimondii
ref|XP_008445513.1|  PREDICTED: protein phosphatase 2C 77-like is...    299   4e-93    Cucumis melo [Oriental melon]
ref|XP_007223074.1|  hypothetical protein PRUPE_ppa003748mg             299   5e-93    Prunus persica
ref|XP_012076982.1|  PREDICTED: protein phosphatase 2C 77               298   5e-93    Jatropha curcas
ref|XP_002309484.2|  hypothetical protein POPTR_0006s24100g             298   6e-93    
ref|XP_010648365.1|  PREDICTED: probable protein phosphatase 2C 53      298   6e-93    
gb|AEK05577.1|  abscisic acid insensitivity 1B                          298   6e-93    Populus balsamifera [balsam poplar]
gb|AEK05574.1|  abscisic acid insensitivity 1B                          298   6e-93    Populus balsamifera [balsam poplar]
gb|KHG12551.1|  Protein phosphatase 2C 16 -like protein                 298   7e-93    Gossypium arboreum [tree cotton]
ref|XP_011019392.1|  PREDICTED: probable protein phosphatase 2C 50      298   7e-93    Populus euphratica
gb|KJB54637.1|  hypothetical protein B456_009G042600                    298   7e-93    Gossypium raimondii
gb|AEK05572.1|  abscisic acid insensitivity 1B                          298   7e-93    Populus balsamifera [balsam poplar]
gb|AEK05586.1|  abscisic acid insensitivity 1B                          298   7e-93    Populus balsamifera [balsam poplar]
gb|EEC70963.1|  hypothetical protein OsI_02579                          291   1e-92    Oryza sativa Indica Group [Indian rice]
emb|CAM84275.1|  abscisic insensitive 1B                                297   1e-92    Populus tremula [European aspen]
emb|CAM84299.1|  abscisic insensitive 1B                                297   1e-92    Populus tremula [European aspen]
ref|XP_007215029.1|  hypothetical protein PRUPE_ppa004252mg             296   1e-92    
emb|CAM84257.1|  abscisic insensitive 1B                                297   1e-92    Populus tremula [European aspen]
emb|CAM84282.1|  abscisic insensitive 1B                                297   2e-92    Populus tremula [European aspen]
emb|CAM84291.1|  abscisic insensitive 1B                                297   2e-92    Populus tremula [European aspen]
emb|CAM84287.1|  abscisic insensitive 1B                                297   2e-92    Populus tremula [European aspen]
emb|CAM84260.1|  abscisic insensitive 1B                                297   2e-92    Populus tremula [European aspen]
emb|CAM84269.1|  abscisic insensitive 1B                                297   2e-92    Populus tremula [European aspen]
emb|CAM84265.1|  abscisic insensitive 1B                                297   2e-92    Populus tremula [European aspen]
emb|CAM84273.1|  abscisic insensitive 1B                                297   2e-92    Populus tremula [European aspen]
emb|CAM84271.1|  abscisic insensitive 1B                                297   2e-92    Populus tremula [European aspen]
emb|CAM84286.1|  abscisic insensitive 1B                                297   2e-92    Populus tremula [European aspen]
emb|CAM84268.1|  abscisic insensitive 1B                                297   2e-92    Populus tremula [European aspen]
emb|CAM84258.1|  abscisic insensitive 1B                                297   2e-92    Populus tremula [European aspen]
emb|CAM84256.1|  abscisic insensitive 1B                                297   2e-92    Populus tremula [European aspen]
emb|CAM84289.1|  abscisic insensitive 1B                                297   2e-92    Populus tremula [European aspen]
ref|XP_004144202.1|  PREDICTED: probable protein phosphatase 2C 53      297   2e-92    Cucumis sativus [cucumbers]
ref|XP_008377706.1|  PREDICTED: protein phosphatase 2C 77-like          297   2e-92    
ref|XP_008447624.1|  PREDICTED: protein phosphatase 2C 16 isoform X1    296   3e-92    Cucumis melo [Oriental melon]
ref|XP_008447626.1|  PREDICTED: protein phosphatase 2C 16 isoform X2    295   3e-92    
ref|XP_008220516.1|  PREDICTED: probable protein phosphatase 2C 6       296   3e-92    
emb|CAM84263.1|  abscisic insensitive 1B                                296   4e-92    Populus tremula [European aspen]
ref|XP_009412210.1|  PREDICTED: probable protein phosphatase 2C 6...    296   5e-92    
ref|XP_009412209.1|  PREDICTED: probable protein phosphatase 2C 6...    296   5e-92    Musa acuminata subsp. malaccensis [pisang utan]
emb|CAM84261.1|  abscisic insensitive 1B                                296   5e-92    Populus tremula [European aspen]
ref|XP_011081646.1|  PREDICTED: probable protein phosphatase 2C 53      296   6e-92    Sesamum indicum [beniseed]
ref|XP_004245071.1|  PREDICTED: probable protein phosphatase 2C 6       295   7e-92    Solanum lycopersicum
ref|XP_012068927.1|  PREDICTED: protein phosphatase 2C 16               295   7e-92    
ref|XP_008351947.1|  PREDICTED: probable protein phosphatase 2C 53      296   8e-92    
ref|XP_003603175.1|  Abscisic insensitive 1B                            295   1e-91    Medicago truncatula
gb|KHN29698.1|  Protein phosphatase 2C 16                               295   1e-91    Glycine soja [wild soybean]
ref|XP_006578088.1|  PREDICTED: protein phosphatase 2C 16-like          295   1e-91    Glycine max [soybeans]
ref|XP_010087703.1|  Protein phosphatase 2C 16                          295   1e-91    Morus notabilis
sp|Q0JLP9.1|P2C06_ORYSJ  RecName: Full=Probable protein phosphata...    293   1e-91    Oryza sativa Japonica Group [Japonica rice]
ref|XP_011010154.1|  PREDICTED: protein phosphatase 2C 16-like          295   1e-91    Populus euphratica
emb|CBI35919.3|  unnamed protein product                                293   2e-91    Vitis vinifera
emb|CAM84280.1|  abscisic insensitive 1B                                294   3e-91    Populus tremula [European aspen]
emb|CAM84281.1|  abscisic insensitive 1B                                294   3e-91    Populus tremula [European aspen]
ref|XP_010090094.1|  Protein phosphatase 2C 16                          293   3e-91    Morus notabilis
emb|CDM82904.1|  unnamed protein product                                292   3e-91    Triticum aestivum [Canadian hard winter wheat]
dbj|BAF62436.1|  protein phosphatase 2C                                 292   3e-91    Triticum aestivum [Canadian hard winter wheat]
ref|XP_006474445.1|  PREDICTED: protein phosphatase 2C 16-like is...    294   3e-91    Citrus sinensis [apfelsine]
dbj|BAF62437.1|  protein phosphatase 2C                                 292   4e-91    Triticum monococcum [einkorn wheat]
gb|KDO73536.1|  hypothetical protein CISIN_1g008880mg                   294   4e-91    Citrus sinensis [apfelsine]
gb|EMT03021.1|  Putative protein phosphatase 2C 6                       291   4e-91    
ref|XP_009362332.1|  PREDICTED: probable protein phosphatase 2C 50      294   4e-91    Pyrus x bretschneideri [bai li]
ref|XP_006453049.1|  hypothetical protein CICLE_v10007908mg             293   4e-91    Citrus clementina [clementine]
gb|AFZ94860.1|  ABI1                                                    293   5e-91    Fragaria x ananassa
ref|XP_002514095.1|  protein phosphatase 2c, putative                   293   5e-91    
ref|XP_002324741.2|  hypothetical protein POPTR_0018s04570g             293   6e-91    
ref|XP_004303667.1|  PREDICTED: protein phosphatase 2C 16               293   6e-91    Fragaria vesca subsp. vesca
ref|XP_006426599.1|  hypothetical protein CICLE_v10025314mg             293   7e-91    Citrus clementina [clementine]
gb|KDO65132.1|  hypothetical protein CISIN_1g009083mg                   293   7e-91    Citrus sinensis [apfelsine]
ref|XP_008793265.1|  PREDICTED: probable protein phosphatase 2C 50      292   8e-91    
ref|XP_002304105.2|  hypothetical protein POPTR_0003s04120g             293   8e-91    Populus trichocarpa [western balsam poplar]
ref|XP_010231951.1|  PREDICTED: probable protein phosphatase 2C 6       291   8e-91    Brachypodium distachyon [annual false brome]
ref|XP_006465975.1|  PREDICTED: protein phosphatase 2C 16-like is...    293   8e-91    
ref|XP_002278167.2|  PREDICTED: protein phosphatase 2C 16               293   8e-91    
ref|XP_006601194.1|  PREDICTED: protein phosphatase 2C 16-like is...    290   8e-91    Glycine max [soybeans]
ref|XP_006581294.1|  PREDICTED: protein phosphatase 2C 16-like is...    293   9e-91    Glycine max [soybeans]
dbj|BAK61823.1|  protein phosphatase 2c                                 295   1e-90    Citrus unshiu [satsuma mandarin]
ref|XP_009340690.1|  PREDICTED: protein phosphatase 2C 16-like          292   1e-90    
gb|EMS62830.1|  putative protein phosphatase 2C 6                       290   1e-90    Triticum urartu
ref|XP_008337741.1|  PREDICTED: protein phosphatase 2C 77 isoform X1    289   1e-90    Malus domestica [apple tree]
ref|XP_009372387.1|  PREDICTED: protein phosphatase 2C 16-like          292   1e-90    Pyrus x bretschneideri [bai li]
ref|XP_008228245.1|  PREDICTED: protein phosphatase 2C 16               292   2e-90    Prunus mume [ume]
dbj|BAG91921.1|  unnamed protein product                                284   2e-90    Oryza sativa Japonica Group [Japonica rice]
ref|XP_011467233.1|  PREDICTED: protein phosphatase 2C 16-like is...    291   3e-90    Fragaria vesca subsp. vesca
ref|XP_003550214.1|  PREDICTED: protein phosphatase 2C 16-like is...    290   3e-90    Glycine max [soybeans]
gb|AFL56850.1|  protein phosphatase 2c                                  291   4e-90    Cucumis sativus [cucumbers]
gb|EYU28367.1|  hypothetical protein MIMGU_mgv1a006031mg                288   4e-90    Erythranthe guttata [common monkey flower]
gb|KCW81712.1|  hypothetical protein EUGRSUZ_C03066                     289   7e-90    Eucalyptus grandis [rose gum]
ref|XP_006601188.1|  PREDICTED: protein phosphatase 2C 16-like is...    291   8e-90    Glycine max [soybeans]
ref|XP_010925402.1|  PREDICTED: probable protein phosphatase 2C 50      290   8e-90    Elaeis guineensis
ref|XP_006601191.1|  PREDICTED: protein phosphatase 2C 16-like is...    290   8e-90    Glycine max [soybeans]
gb|EYU28368.1|  hypothetical protein MIMGU_mgv1a006031mg                288   9e-90    Erythranthe guttata [common monkey flower]
ref|XP_008242179.1|  PREDICTED: protein phosphatase 2C 77               288   9e-90    
ref|XP_010094964.1|  Protein phosphatase 2C 16                          290   1e-89    Morus notabilis
ref|XP_009601903.1|  PREDICTED: probable protein phosphatase 2C 5...    287   1e-89    
ref|XP_009590889.1|  PREDICTED: probable protein phosphatase 2C 6       289   1e-89    Nicotiana tomentosiformis
ref|XP_004969414.1|  PREDICTED: probable protein phosphatase 2C 6...    288   1e-89    Setaria italica
ref|XP_007202014.1|  hypothetical protein PRUPE_ppa005286mg             287   2e-89    
ref|NP_001150302.1|  protein phosphatase 2C ABI2                        286   2e-89    Zea mays [maize]
gb|ACF86234.1|  unknown                                                 286   2e-89    Zea mays [maize]
ref|XP_011013159.1|  PREDICTED: probable protein phosphatase 2C 53      289   2e-89    Populus euphratica
ref|XP_004961009.1|  PREDICTED: probable protein phosphatase 2C 5...    286   2e-89    Setaria italica
gb|EYU20326.1|  hypothetical protein MIMGU_mgv1a009511mg                282   3e-89    Erythranthe guttata [common monkey flower]
gb|KHF99231.1|  Protein phosphatase 2C 16 -like protein                 287   3e-89    Gossypium arboreum [tree cotton]
ref|XP_009798002.1|  PREDICTED: protein phosphatase 2C 16-like is...    286   3e-89    Nicotiana sylvestris
emb|CDP03129.1|  unnamed protein product                                288   3e-89    Coffea canephora [robusta coffee]
ref|XP_010915189.1|  PREDICTED: probable protein phosphatase 2C 5...    288   3e-89    Elaeis guineensis
ref|XP_009355509.1|  PREDICTED: protein phosphatase 2C 16-like          288   4e-89    Pyrus x bretschneideri [bai li]
ref|XP_006342957.1|  PREDICTED: protein phosphatase 2C 16-like is...    286   4e-89    Solanum tuberosum [potatoes]
ref|XP_010049216.1|  PREDICTED: probable protein phosphatase 2C 53      288   4e-89    Eucalyptus grandis [rose gum]
ref|XP_009601902.1|  PREDICTED: probable protein phosphatase 2C 5...    288   6e-89    Nicotiana tomentosiformis
ref|XP_007024551.1|  ABI1 isoform 1                                     288   6e-89    
ref|XP_009361654.1|  PREDICTED: probable protein phosphatase 2C 6...    284   7e-89    Pyrus x bretschneideri [bai li]
ref|XP_009795186.1|  PREDICTED: protein phosphatase 2C 16-like          288   7e-89    Nicotiana sylvestris
ref|XP_006342955.1|  PREDICTED: protein phosphatase 2C 16-like is...    288   8e-89    Solanum tuberosum [potatoes]
ref|XP_004287589.1|  PREDICTED: protein phosphatase 2C 16               281   9e-89    Fragaria vesca subsp. vesca
ref|XP_009798001.1|  PREDICTED: probable protein phosphatase 2C 6...    287   1e-88    Nicotiana sylvestris
ref|XP_010498129.1|  PREDICTED: protein phosphatase 2C 7                280   1e-88    
ref|XP_009361653.1|  PREDICTED: protein phosphatase 2C 77-like is...    284   1e-88    Pyrus x bretschneideri [bai li]
ref|XP_010318398.1|  PREDICTED: protein phosphatase 2C ABI2 homol...    285   1e-88    Solanum lycopersicum
ref|XP_008338708.1|  PREDICTED: protein phosphatase 2C 16-like          286   2e-88    Malus domestica [apple tree]
ref|NP_001234686.1|  protein phosphatase 2C ABI2 homolog                286   2e-88    
gb|EYU45874.1|  hypothetical protein MIMGU_mgv1a005458mg                285   2e-88    Erythranthe guttata [common monkey flower]
ref|XP_010318395.1|  PREDICTED: protein phosphatase 2C ABI2 homol...    286   3e-88    Solanum lycopersicum
gb|KJB56947.1|  hypothetical protein B456_009G143300                    285   3e-88    Gossypium raimondii
ref|XP_009616042.1|  PREDICTED: protein phosphatase 2C 16-like          286   3e-88    Nicotiana tomentosiformis
ref|XP_007136858.1|  hypothetical protein PHAVU_009G079600g             286   3e-88    Phaseolus vulgaris [French bean]
gb|EYU21346.1|  hypothetical protein MIMGU_mgv1a006033mg                283   4e-88    Erythranthe guttata [common monkey flower]
ref|XP_008808934.1|  PREDICTED: probable protein phosphatase 2C 50      285   4e-88    
ref|XP_010526048.1|  PREDICTED: probable protein phosphatase 2C 50      284   5e-88    Tarenaya hassleriana [spider flower]
ref|NP_001056498.1|  Os05g0592800                                       283   5e-88    
gb|EAY99256.1|  hypothetical protein OsI_21218                          283   5e-88    Oryza sativa Indica Group [Indian rice]
ref|XP_009802371.1|  PREDICTED: probable protein phosphatase 2C 6       285   5e-88    Nicotiana sylvestris
ref|XP_006596068.1|  PREDICTED: protein phosphatase 2C 16-like is...    285   7e-88    
ref|XP_011100856.1|  PREDICTED: probable protein phosphatase 2C 50      285   9e-88    Sesamum indicum [beniseed]
emb|CDP08300.1|  unnamed protein product                                285   9e-88    Coffea canephora [robusta coffee]
ref|XP_011079888.1|  PREDICTED: protein phosphatase 2C 16-like          285   1e-87    Sesamum indicum [beniseed]
gb|AIG52106.1|  2C-type protein phosphatase protein                     283   1e-87    Zea mays [maize]
ref|XP_010527050.1|  PREDICTED: probable protein phosphatase 2C 53      284   1e-87    Tarenaya hassleriana [spider flower]
tpg|DAA58703.1|  TPA: putative protein phosphatase 2C family protein    283   1e-87    
ref|NP_001147858.1|  LOC100281468                                       283   1e-87    
ref|XP_004498842.1|  PREDICTED: protein phosphatase 2C 16-like is...    285   1e-87    
ref|XP_006342498.1|  PREDICTED: probable protein phosphatase 2C 6...    284   1e-87    Solanum tuberosum [potatoes]
ref|XP_010696551.1|  PREDICTED: probable protein phosphatase 2C 50      283   1e-87    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003588912.1|  Abscisic insensitive 1B                            285   1e-87    Medicago truncatula
ref|XP_008388296.1|  PREDICTED: protein phosphatase 2C 77-like          280   2e-87    
ref|XP_002516100.1|  protein phosphatase 2c, putative                   284   2e-87    Ricinus communis
ref|XP_004501450.1|  PREDICTED: protein phosphatase 2C 16-like is...    284   3e-87    Cicer arietinum [garbanzo]
ref|XP_010476912.1|  PREDICTED: protein phosphatase 2C 7                283   3e-87    Camelina sativa [gold-of-pleasure]
gb|EPS72036.1|  hypothetical protein M569_02722                         276   3e-87    Genlisea aurea
ref|XP_006475507.1|  PREDICTED: protein phosphatase 2C 77-like          280   3e-87    Citrus sinensis [apfelsine]
ref|XP_007012743.1|  Phosphatase 2C family protein, putative isof...    283   3e-87    
ref|XP_009410773.1|  PREDICTED: probable protein phosphatase 2C 6       283   4e-87    
ref|XP_002441622.1|  hypothetical protein SORBIDRAFT_09g030600          279   4e-87    
emb|CBI27871.3|  unnamed protein product                                278   4e-87    Vitis vinifera
ref|XP_010314822.1|  PREDICTED: probable protein phosphatase 2C 5...    280   6e-87    Solanum lycopersicum
ref|XP_002521368.1|  protein phosphatase 2c, putative                   282   7e-87    Ricinus communis
ref|XP_002890234.1|  hypothetical protein ARALYDRAFT_889163             281   8e-87    Arabidopsis lyrata subsp. lyrata
ref|XP_009392933.1|  PREDICTED: probable protein phosphatase 2C 6       281   1e-86    
ref|XP_010049444.1|  PREDICTED: protein phosphatase 2C 77               281   2e-86    Eucalyptus grandis [rose gum]
ref|XP_002455844.1|  hypothetical protein SORBIDRAFT_03g026070          280   2e-86    Sorghum bicolor [broomcorn]
emb|CDO97881.1|  unnamed protein product                                281   2e-86    Coffea canephora [robusta coffee]
ref|XP_004253091.1|  PREDICTED: probable protein phosphatase 2C 5...    281   2e-86    Solanum lycopersicum
ref|XP_010925038.1|  PREDICTED: probable protein phosphatase 2C 6...    280   2e-86    Elaeis guineensis
gb|AFW79364.1|  putative protein phosphatase 2C family protein          278   2e-86    
ref|XP_006654873.1|  PREDICTED: probable protein phosphatase 2C 5...    278   3e-86    Oryza brachyantha
emb|CDX83901.1|  BnaC08g17440D                                          275   3e-86    
ref|XP_010062674.1|  PREDICTED: protein phosphatase 2C 16-like is...    281   4e-86    Eucalyptus grandis [rose gum]
gb|KJB07280.1|  hypothetical protein B456_001G013500                    278   4e-86    Gossypium raimondii
ref|XP_003565810.1|  PREDICTED: probable protein phosphatase 2C 53      277   4e-86    
dbj|BAH56780.1|  AT1G72770                                              273   4e-86    Arabidopsis thaliana [mouse-ear cress]
gb|KHF98958.1|  Protein phosphatase 2C 77 -like protein                 278   5e-86    Gossypium arboreum [tree cotton]
ref|XP_008808224.1|  PREDICTED: probable protein phosphatase 2C 6       279   5e-86    Phoenix dactylifera
ref|XP_008391358.1|  PREDICTED: probable protein phosphatase 2C 50      280   6e-86    
ref|XP_002890233.1|  predicted protein                                  274   1e-85    Arabidopsis lyrata subsp. lyrata
pdb|3RT0|A  Chain A, Crystal Structure Of Pyl10-Hab1 Complex In T...    273   1e-85    Arabidopsis thaliana [mouse-ear cress]
ref|NP_173199.2|  protein phosphatase 2C 7                              278   1e-85    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002279140.1|  PREDICTED: protein phosphatase 2C 77 isoform X2    280   1e-85    Vitis vinifera
pdb|3QN1|B  Chain B, Crystal Structure Of The Pyr1 Abscisic Acid ...    273   1e-85    Arabidopsis thaliana [mouse-ear cress]
dbj|BAC43252.1|  unknown protein                                        278   2e-85    Arabidopsis thaliana [mouse-ear cress]
pdb|3NMT|B  Chain B, Crystal Structure Of Pyrabactin Bound Abscis...    273   2e-85    Arabidopsis thaliana [mouse-ear cress]
pdb|4DS8|B  Chain B, Complex Structure Of Abscisic Acid Receptor ...    273   2e-85    Arabidopsis thaliana [mouse-ear cress]
emb|CDX96761.1|  BnaA08g23040D                                          273   2e-85    
ref|XP_010537577.1|  PREDICTED: protein phosphatase 2C 16               278   2e-85    
pdb|3UJG|B  Chain B, Crystal Structure Of Snrk2.6 In Complex With...    273   2e-85    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010656162.1|  PREDICTED: protein phosphatase 2C 77 isoform X1    280   3e-85    Vitis vinifera
gb|AIZ68188.1|  putative protein phosphatase                            276   5e-85    Ornithogalum longebracteatum [sea-onion]
ref|XP_010937974.1|  PREDICTED: probable protein phosphatase 2C 6       276   5e-85    Elaeis guineensis
ref|XP_008650084.1|  PREDICTED: probable protein phosphatase 2C 5...    278   6e-85    
ref|XP_012077234.1|  PREDICTED: protein phosphatase 2C 77-like          277   7e-85    Jatropha curcas
emb|CDY26234.1|  BnaA06g11830D                                          276   8e-85    Brassica napus [oilseed rape]
ref|XP_002887450.1|  hypothetical protein ARALYDRAFT_895129             276   8e-85    Arabidopsis lyrata subsp. lyrata
ref|XP_006371857.1|  hypothetical protein POPTR_0018s04570g             278   8e-85    
ref|XP_006390620.1|  hypothetical protein EUTSA_v10018441mg             276   9e-85    Eutrema salsugineum [saltwater cress]
gb|EYU26427.1|  hypothetical protein MIMGU_mgv1a017851mg                271   9e-85    Erythranthe guttata [common monkey flower]
ref|NP_177421.1|  protein phosphatase 2C 16                             276   1e-84    Arabidopsis thaliana [mouse-ear cress]
emb|CAA05875.1|  protein phosphatase 2C                                 276   1e-84    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007161134.1|  hypothetical protein PHAVU_001G045300g             277   1e-84    Phaseolus vulgaris [French bean]
ref|XP_004513451.1|  PREDICTED: probable protein phosphatase 2C 6...    276   1e-84    Cicer arietinum [garbanzo]
gb|KHN35879.1|  Hypothetical protein glysoja_013304                     270   2e-84    Glycine soja [wild soybean]
ref|XP_009110399.1|  PREDICTED: protein phosphatase 2C 7-like           272   2e-84    Brassica rapa
gb|AGG35980.1|  hypersensitive to ABA 2                                 275   2e-84    Brassica napus [oilseed rape]
ref|XP_009149210.1|  PREDICTED: protein phosphatase 2C 7                275   3e-84    Brassica rapa
gb|KHN28831.1|  Hypothetical protein glysoja_033886                     268   4e-84    Glycine soja [wild soybean]
ref|XP_010539398.1|  PREDICTED: protein phosphatase 2C 77-like          272   4e-84    Tarenaya hassleriana [spider flower]
ref|XP_008809295.1|  PREDICTED: probable protein phosphatase 2C 6       273   5e-84    
emb|CDY48313.1|  BnaC05g13670D                                          273   8e-84    Brassica napus [oilseed rape]
ref|XP_010536873.1|  PREDICTED: protein phosphatase 2C 77-like          271   8e-84    Tarenaya hassleriana [spider flower]
ref|XP_006351626.1|  PREDICTED: probable protein phosphatase 2C 6...    272   9e-84    
gb|KFK29119.1|  hypothetical protein AALP_AA7G091300                    271   1e-83    Arabis alpina [alpine rockcress]
pdb|3KB3|B  Chain B, Crystal Structure Of Abscisic Acid-Bound Pyl...    267   1e-83    Arabidopsis thaliana [mouse-ear cress]
emb|CDX72943.1|  BnaC06g33910D                                          271   2e-83    
ref|XP_009105943.1|  PREDICTED: protein phosphatase 2C 16               272   2e-83    Brassica rapa
ref|XP_007138695.1|  hypothetical protein PHAVU_009G229900g             273   3e-83    Phaseolus vulgaris [French bean]
ref|XP_010416043.1|  PREDICTED: protein phosphatase 2C 16-like is...    272   3e-83    Camelina sativa [gold-of-pleasure]
ref|XP_010428176.1|  PREDICTED: protein phosphatase 2C 16-like          271   4e-83    Camelina sativa [gold-of-pleasure]
dbj|BAJ33756.1|  unnamed protein product                                264   5e-83    Eutrema halophilum
ref|XP_003534931.1|  PREDICTED: probable protein phosphatase 2C 6...    271   1e-82    
ref|XP_010471312.1|  PREDICTED: protein phosphatase 2C 16-like          270   1e-82    Camelina sativa [gold-of-pleasure]
pdb|4LA7|B  Chain B, X-ray Crystal Structure Of The Pyl2-quinabac...    265   1e-82    Arabidopsis thaliana [mouse-ear cress]
pdb|3NMV|B  Chain B, Crystal Structure Of Pyrabactin-Bound Abscis...    265   1e-82    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010545366.1|  PREDICTED: protein phosphatase 2C 77-like          268   2e-82    
ref|XP_009120223.1|  PREDICTED: protein phosphatase 2C 77               267   3e-82    
ref|XP_003547487.1|  PREDICTED: probable protein phosphatase 2C 6...    270   3e-82    
gb|AGG35959.1|  ABA insensitive PP2C protein 2                          267   3e-82    Brassica napus [oilseed rape]
ref|XP_010540081.1|  PREDICTED: LOW QUALITY PROTEIN: protein phos...    270   4e-82    
ref|NP_200515.1|  protein phosphatase 2C 77                             266   6e-82    Arabidopsis thaliana [mouse-ear cress]
ref|NP_001119448.1|  protein phosphatase 2C 77                          265   7e-82    Arabidopsis thaliana [mouse-ear cress]
gb|ACU18078.1|  unknown                                                 262   7e-82    Glycine max [soybeans]
gb|ERN04870.1|  hypothetical protein AMTR_s00146p00095280               269   1e-81    Amborella trichopoda
ref|XP_011622912.1|  PREDICTED: probable protein phosphatase 2C 53      269   1e-81    
ref|XP_002864495.1|  hypothetical protein ARALYDRAFT_495797             266   1e-81    
gb|KFK43941.1|  hypothetical protein AALP_AA1G194400                    266   1e-81    Arabis alpina [alpine rockcress]
gb|KEH37500.1|  protein phosphatase 2C ABI2-like protein                269   1e-81    Medicago truncatula
ref|XP_010451772.1|  PREDICTED: protein phosphatase 2C 77-like          265   2e-81    Camelina sativa [gold-of-pleasure]
ref|XP_006280494.1|  hypothetical protein CARUB_v10026433mg             265   2e-81    Capsella rubella
ref|XP_010483200.1|  PREDICTED: protein phosphatase 2C 77               265   2e-81    Camelina sativa [gold-of-pleasure]
gb|AFL56268.1|  ABI1-like protein                                       268   2e-81    Cirsium arvense [Canada thistle]
ref|XP_006401249.1|  hypothetical protein EUTSA_v10013611mg             265   2e-81    Eutrema salsugineum [saltwater cress]
ref|XP_010480517.1|  PREDICTED: protein phosphatase 2C 7-like           261   3e-81    Camelina sativa [gold-of-pleasure]
ref|XP_010443374.1|  PREDICTED: protein phosphatase 2C 77-like          266   4e-81    Camelina sativa [gold-of-pleasure]
gb|AFL56849.1|  protein phosphatase 2C                                  270   5e-81    Cucumis sativus [cucumbers]
ref|XP_006416690.1|  hypothetical protein EUTSA_v10007386mg             266   8e-81    Eutrema salsugineum [saltwater cress]
pdb|3KDJ|B  Chain B, Complex Structure Of (+)-Aba-Bound Pyl1 And ...    259   8e-81    Arabidopsis thaliana [mouse-ear cress]
emb|CDY42756.1|  BnaA03g47830D                                          261   3e-80    Brassica napus [oilseed rape]
emb|CDY54381.1|  BnaC09g53650D                                          261   5e-80    Brassica napus [oilseed rape]
emb|CDX92752.1|  BnaC07g40100D                                          261   6e-80    
ref|XP_006413234.1|  hypothetical protein EUTSA_v10025224mg             261   8e-80    Eutrema salsugineum [saltwater cress]
pdb|3NMN|B  Chain B, Crystal Structure Of Pyrabactin-Bound Abscis...    257   8e-80    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006655532.1|  PREDICTED: probable protein phosphatase 2C 5...    256   1e-79    
ref|XP_011072555.1|  PREDICTED: protein phosphatase 2C 16-like          263   2e-79    Sesamum indicum [beniseed]
emb|CDX89368.1|  BnaA01g15250D                                          259   3e-79    
ref|XP_009139861.1|  PREDICTED: protein phosphatase 2C 56-like          259   3e-79    Brassica rapa
ref|XP_003549201.1|  PREDICTED: protein phosphatase 2C 7-like           262   3e-79    Glycine max [soybeans]
ref|NP_194338.1|  protein phosphatase 2C 56                             259   5e-79    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002867581.1|  hypothetical protein ARALYDRAFT_492207             259   5e-79    
gb|AAK59578.1|  putative protein phosphatase ABI1                       259   5e-79    
emb|CAA55484.1|  ABI1                                                   259   5e-79    
ref|XP_009137578.1|  PREDICTED: protein phosphatase 2C 56-like          258   6e-79    
pdb|3JRQ|A  Chain A, Crystal Structure Of (+)-aba-bound Pyl1 In C...    255   7e-79    
gb|AGG35958.1|  ABA insensitive PP2C protein 1                          258   8e-79    
gb|ACU01764.1|  phosphatase 2C                                          259   9e-79    
gb|AAF79469.1|AC022492_13  F1L3.26                                      264   1e-78    
gb|EEC79599.1|  hypothetical protein OsI_20785                          255   1e-78    
gb|EEE64510.1|  hypothetical protein OsJ_19361                          256   2e-78    
ref|NP_001056169.2|  Os05g0537400                                       256   2e-78    
ref|XP_004507966.1|  PREDICTED: probable protein phosphatase 2C 6...    261   2e-78    
ref|XP_002441446.1|  hypothetical protein SORBIDRAFT_09g026860          251   2e-78    
ref|XP_003542343.1|  PREDICTED: protein phosphatase 2C 7-like iso...    259   4e-78    
ref|XP_010479273.1|  PREDICTED: protein phosphatase 2C 7-like           252   7e-78    
gb|KEH32480.1|  protein phosphatase 2C ABI2-like protein                258   9e-78    
emb|CDY14318.1|  BnaA08g14490D                                          255   9e-78    
ref|XP_004961376.1|  PREDICTED: probable protein phosphatase 2C 5...    253   2e-77    
gb|ACA58118.1|  protein phosphatase 2c                                  253   3e-77    
ref|XP_008648017.1|  PREDICTED: uncharacterized protein LOC100381...    252   4e-77    
emb|CDY50003.1|  BnaC08g12100D                                          253   4e-77    
gb|EMS65633.1|  putative protein phosphatase 2C 6                       267   6e-77    
gb|KHG19511.1|  Protein phosphatase 2C 77 -like protein                 253   2e-76    
gb|KJB27199.1|  hypothetical protein B456_004G284400                    253   3e-76    
ref|XP_007154623.1|  hypothetical protein PHAVU_003G134200g             255   4e-76    
gb|KFK43940.1|  hypothetical protein AALP_AA1G194400                    251   2e-75    
ref|XP_006283766.1|  hypothetical protein CARUB_v10004852mg             247   1e-74    
ref|XP_008656568.1|  PREDICTED: probable protein phosphatase 2C 50      246   2e-74    
gb|ABW99630.1|  protein phosphatase 2C                                  239   4e-74    
gb|EPS72331.1|  hypothetical protein M569_02427                         240   6e-74    
ref|XP_006646259.1|  PREDICTED: probable protein phosphatase 2C 5...    243   7e-74    
ref|XP_010438801.1|  PREDICTED: protein phosphatase 2C 56               245   8e-74    
gb|AHE78416.1|  ABA insensitive 1                                       244   2e-73    
gb|EMS48654.1|  putative protein phosphatase 2C 50                      239   2e-73    
ref|XP_010433558.1|  PREDICTED: protein phosphatase 2C 56-like          243   6e-73    
gb|EMS55824.1|  putative protein phosphatase 2C 50                      241   7e-73    
ref|XP_010448328.1|  PREDICTED: protein phosphatase 2C 56-like          243   8e-73    
gb|EMT22583.1|  Putative protein phosphatase 2C 50                      238   1e-72    
gb|EMT25506.1|  Putative protein phosphatase 2C 53                      236   9e-72    
gb|AAW50843.1|  protein phosphatase 2C                                  232   1e-71    
emb|CDM83788.1|  unnamed protein product                                238   2e-71    
dbj|BAJ87284.1|  predicted protein                                      238   2e-71    
ref|XP_011464038.1|  PREDICTED: uncharacterized protein LOC101301...    251   2e-71    
ref|XP_011464039.1|  PREDICTED: uncharacterized protein LOC101301...    250   3e-71    
ref|XP_010682827.1|  PREDICTED: uncharacterized protein LOC104897605    246   1e-70    
gb|AFK40419.1|  unknown                                                 228   5e-70    
gb|EMT29148.1|  Putative protein phosphatase 2C 50                      227   2e-68    
dbj|BAJ93332.1|  predicted protein                                      223   6e-66    
ref|XP_003568010.1|  PREDICTED: probable protein phosphatase 2C 50      223   9e-66    
gb|KDO55426.1|  hypothetical protein CISIN_1g019155mg                   216   2e-63    
ref|XP_008242497.1|  PREDICTED: protein phosphatase 2C 56-like          215   2e-62    
gb|AEK05599.1|  abscisic acid insensitivity 1D                          206   4e-62    
gb|AEK05595.1|  abscisic acid insensitivity 1D                          206   4e-62    
ref|XP_007202122.1|  hypothetical protein PRUPE_ppa006926mg             214   4e-62    
gb|AEK05596.1|  abscisic acid insensitivity 1D                          206   4e-62    
gb|AEK05591.1|  abscisic acid insensitivity 1D                          206   5e-62    
gb|AEK05589.1|  abscisic acid insensitivity 1D                          206   6e-62    
ref|XP_009352549.1|  PREDICTED: protein phosphatase 2C 56-like          213   6e-62    
ref|XP_004287470.1|  PREDICTED: probable protein phosphatase 2C 6       213   7e-62    
gb|AEK05600.1|  abscisic acid insensitivity 1D                          204   4e-61    
gb|AEK05597.1|  abscisic acid insensitivity 1D                          203   7e-61    
ref|XP_002514226.1|  protein phosphatase 2c, putative                   211   7e-61    
ref|XP_006451538.1|  hypothetical protein CICLE_v100086101mg            202   1e-60    
emb|CBI28006.3|  unnamed protein product                                207   3e-60    
ref|XP_010095347.1|  putative protein phosphatase 2C 6                  209   3e-60    
ref|XP_008337597.1|  PREDICTED: protein phosphatase 2C 56-like          209   3e-60    
ref|XP_010049618.1|  PREDICTED: protein phosphatase 2C 77-like is...    209   4e-60    
ref|XP_007160290.1|  hypothetical protein PHAVU_002G309100g             207   8e-60    
ref|XP_009389370.1|  PREDICTED: probable protein phosphatase 2C 53      206   2e-59    
gb|KHN41670.1|  Hypothetical protein glysoja_036414                     201   2e-59    
gb|ABF70120.1|  protein phosphatase 2C, putative                        205   2e-59    
gb|KDO66562.1|  hypothetical protein CISIN_1g016186mg                   206   2e-59    
gb|KHN16641.1|  Hypothetical protein glysoja_002738                     203   3e-59    
ref|XP_006451284.1|  hypothetical protein CICLE_v10008531mg             206   3e-59    
ref|XP_002280468.3|  PREDICTED: probable protein phosphatase 2C 6...    207   3e-59    
ref|XP_010656268.1|  PREDICTED: probable protein phosphatase 2C 6...    207   3e-59    
gb|KHG07172.1|  Protein phosphatase 2C 56 -like protein                 206   4e-59    
ref|XP_010249505.1|  PREDICTED: probable protein phosphatase 2C 6       206   5e-59    
ref|XP_006475563.1|  PREDICTED: protein phosphatase 2C 56-like          206   6e-59    
ref|XP_006381768.1|  hypothetical protein POPTR_0006s17810g             199   2e-58    
ref|XP_007013047.1|  Phosphatase 2C family protein isoform 1            204   2e-58    
ref|XP_010915337.1|  PREDICTED: probable protein phosphatase 2C 51      204   2e-58    
ref|XP_004503481.1|  PREDICTED: probable protein phosphatase 2C 6...    204   3e-58    
gb|KJB65025.1|  hypothetical protein B456_010G076700                    204   3e-58    
ref|XP_003530510.1|  PREDICTED: probable protein phosphatase 2C 6...    202   6e-58    
ref|XP_002980987.1|  hypothetical protein SELMODRAFT_113714             201   7e-58    
ref|XP_001765872.1|  predicted protein                                  200   7e-58    
ref|XP_010267149.1|  PREDICTED: probable protein phosphatase 2C 6       202   2e-57    
emb|CAN71518.1|  hypothetical protein VITISV_042313                     206   2e-57    
ref|XP_001781791.1|  predicted protein                                  199   3e-57    
ref|XP_006451285.1|  hypothetical protein CICLE_v10008531mg             201   4e-57    
ref|XP_006853681.2|  PREDICTED: probable protein phosphatase 2C 51      203   4e-57    
ref|XP_003525286.1|  PREDICTED: probable protein phosphatase 2C 6...    200   4e-57    
ref|XP_003630720.1|  Protein phosphatase 2C                             201   6e-57    
ref|XP_002982468.1|  hypothetical protein SELMODRAFT_179532             201   6e-57    
gb|ERN15148.1|  hypothetical protein AMTR_s00056p00129440               204   7e-57    
ref|XP_009384837.1|  PREDICTED: probable protein phosphatase 2C 68      200   8e-57    
ref|XP_009387749.1|  PREDICTED: probable protein phosphatase 2C 68      199   2e-56    
ref|XP_011012464.1|  PREDICTED: probable protein phosphatase 2C 6...    198   3e-56    
dbj|BAG12298.1|  protein phosphatase 2C                                 201   1e-55    
ref|XP_002513570.1|  protein phosphatase 2c, putative                   196   1e-55    
ref|XP_010688319.1|  PREDICTED: protein phosphatase 2C 56-like          196   1e-55    
ref|XP_012076882.1|  PREDICTED: protein phosphatase 2C 56-like          196   2e-55    
ref|XP_008450778.1|  PREDICTED: probable protein phosphatase 2C 6       195   3e-55    
dbj|BAG12299.1|  protein phosphatase 2C                                 200   4e-55    
ref|XP_009402271.1|  PREDICTED: probable protein phosphatase 2C 30      196   5e-55    
ref|XP_008810491.1|  PREDICTED: probable protein phosphatase 2C 53      194   7e-55    
gb|AAC36697.1|  protein phosphatase-2C                                  194   8e-55    
ref|XP_006827523.1|  PREDICTED: probable protein phosphatase 2C 2...    195   1e-54    
gb|EYU35238.1|  hypothetical protein MIMGU_mgv1a006976mg                194   4e-54    
ref|XP_009604512.1|  PREDICTED: protein phosphatase 2C 37-like          193   5e-54    
ref|XP_008344852.1|  PREDICTED: probable protein phosphatase 2C 24      187   5e-54    
emb|CDY50002.1|  BnaC08g12090D                                          186   5e-54    
ref|XP_002977462.1|  hypothetical protein SELMODRAFT_54708              190   5e-54    
gb|EYU19939.1|  hypothetical protein MIMGU_mgv1a007028mg                193   6e-54    
gb|KEH34758.1|  protein phosphatase 2C-like protein                     192   8e-54    
dbj|BAK05256.1|  predicted protein                                      192   9e-54    
ref|XP_011012462.1|  PREDICTED: probable protein phosphatase 2C 6...    191   1e-53    
ref|XP_011091509.1|  PREDICTED: protein phosphatase 2C 37-like          192   1e-53    
ref|XP_008457441.1|  PREDICTED: probable protein phosphatase 2C 24      192   2e-53    
ref|XP_002456073.1|  hypothetical protein SORBIDRAFT_03g029890          191   2e-53    
ref|XP_004135669.1|  PREDICTED: probable protein phosphatase 2C 6       191   2e-53    
emb|CAB90633.1|  protein phpsphatase 2C (PP2C)                          191   2e-53    
ref|XP_009592346.1|  PREDICTED: probable protein phosphatase 2C 51      191   3e-53    
ref|XP_008356724.1|  PREDICTED: probable protein phosphatase 2C 24      191   3e-53    
ref|XP_007205293.1|  hypothetical protein PRUPE_ppa006696mg             191   3e-53    
ref|XP_003569481.1|  PREDICTED: probable protein phosphatase 2C 8       190   4e-53    
gb|KJB83116.1|  hypothetical protein B456_013G230300                    190   4e-53    
ref|XP_011080695.1|  PREDICTED: probable protein phosphatase 2C 24      190   5e-53    
ref|XP_007009278.1|  Phosphatase PP2C isoform 1                         191   5e-53    
gb|ADE75869.1|  unknown                                                 193   5e-53    
ref|XP_006350568.1|  PREDICTED: probable protein phosphatase 2C 5...    190   5e-53    
ref|XP_002975146.1|  hypothetical protein SELMODRAFT_174627             192   6e-53    
ref|XP_011033764.1|  PREDICTED: protein phosphatase 2C 37-like          190   6e-53    
gb|EPS71711.1|  hypothetical protein M569_03048                         190   6e-53    
ref|XP_008803118.1|  PREDICTED: probable protein phosphatase 2C 24      189   7e-53    
ref|XP_012090097.1|  PREDICTED: probable protein phosphatase 2C 8       189   7e-53    
gb|KCW65565.1|  hypothetical protein EUGRSUZ_G02960                     188   9e-53    
ref|XP_002311183.2|  Protein phosphatase 2C family protein              189   9e-53    
gb|KHF99990.1|  Protein phosphatase 2C 37 -like protein                 189   1e-52    
ref|XP_011076792.1|  PREDICTED: protein phosphatase 2C 37-like          189   1e-52    
ref|XP_010931227.1|  PREDICTED: probable protein phosphatase 2C 24      189   2e-52    
gb|ABC16634.1|  protein phosphatase PP2C                                189   2e-52    
ref|NP_001043754.1|  Os01g0656200                                       189   2e-52    
ref|XP_010106553.1|  putative protein phosphatase 2C 24                 189   2e-52    
gb|KDO46746.1|  hypothetical protein CISIN_1g017373mg                   188   2e-52    
gb|ABD65465.1|  protein phosphatase 2C                                  189   2e-52    
emb|CDM82120.1|  unnamed protein product                                188   2e-52    
gb|KJB74026.1|  hypothetical protein B456_011G268200                    189   2e-52    
gb|KHG22030.1|  Protein phosphatase 2C 56 -like protein                 188   2e-52    
tpg|DAA58292.1|  TPA: putative protein phosphatase 2C family protein    184   2e-52    
ref|XP_004291511.1|  PREDICTED: probable protein phosphatase 2C 24      188   3e-52    
ref|XP_006422177.1|  hypothetical protein CICLE_v10005200mg             187   3e-52    
ref|XP_007016311.1|  Highly ABA-induced PP2C gene 2 isoform 1           190   3e-52    
emb|CDY06705.1|  BnaA10g04840D                                          188   3e-52    
ref|XP_010920508.1|  PREDICTED: probable protein phosphatase 2C 68      188   3e-52    
ref|XP_012088646.1|  PREDICTED: protein phosphatase 2C 37               188   3e-52    
ref|XP_002975042.1|  hypothetical protein SELMODRAFT_150390             189   4e-52    
ref|XP_011014551.1|  PREDICTED: probable protein phosphatase 2C 51      187   4e-52    
ref|XP_010691227.1|  PREDICTED: protein phosphatase 2C 37               187   4e-52    
ref|XP_009771243.1|  PREDICTED: probable protein phosphatase 2C 51      187   4e-52    
ref|XP_010067439.1|  PREDICTED: protein phosphatase 2C 37-like          188   5e-52    
ref|XP_009364345.1|  PREDICTED: probable protein phosphatase 2C 24      187   5e-52    
ref|XP_011003890.1|  PREDICTED: probable protein phosphatase 2C 51      186   5e-52    
ref|XP_008777431.1|  PREDICTED: probable protein phosphatase 2C 24      188   6e-52    
gb|KJB76108.1|  hypothetical protein B456_012G072200                    187   6e-52    
ref|XP_002977550.1|  hypothetical protein SELMODRAFT_451367             187   8e-52    
ref|XP_010510497.1|  PREDICTED: probable protein phosphatase 2C 24      186   9e-52    
ref|XP_009412939.1|  PREDICTED: probable protein phosphatase 2C 8       185   1e-51    
emb|CBI16058.3|  unnamed protein product                                186   1e-51    
ref|XP_010521895.1|  PREDICTED: protein phosphatase 2C 3-like           186   1e-51    
ref|XP_004240955.1|  PREDICTED: probable protein phosphatase 2C 51      187   1e-51    
ref|NP_001062881.2|  Os09g0325700                                       186   1e-51    
gb|ABW81089.1|  unknown                                                 186   1e-51    
ref|XP_012090361.1|  PREDICTED: probable protein phosphatase 2C 7...    187   1e-51    
dbj|BAD23456.1|  protein phosphatase 2C-like                            185   2e-51    
ref|XP_002321444.2|  hypothetical protein POPTR_0015s02070g             184   2e-51    
ref|XP_002510883.1|  protein phosphatase 2c, putative                   186   2e-51    
ref|XP_009343867.1|  PREDICTED: protein phosphatase 2C 37-like          186   2e-51    
ref|XP_011001894.1|  PREDICTED: probable protein phosphatase 2C 51      185   2e-51    
dbj|BAF43700.1|  protein phosphatase 2C                                 186   2e-51    
gb|KJB78838.1|  hypothetical protein B456_013G022100                    186   2e-51    
ref|XP_008221946.1|  PREDICTED: probable protein phosphatase 2C 24      186   2e-51    
gb|KJB78837.1|  hypothetical protein B456_013G022100                    186   2e-51    
ref|XP_009802038.1|  PREDICTED: protein phosphatase 2C 37-like          186   3e-51    
ref|XP_012066955.1|  PREDICTED: probable protein phosphatase 2C 24      186   3e-51    
ref|XP_006846348.1|  PREDICTED: probable protein phosphatase 2C 24      186   3e-51    
ref|XP_008675264.1|  PREDICTED: probable protein phosphatase 2C 8       186   3e-51    
gb|AIB05856.1|  orphans transcription factor                            186   4e-51    
ref|NP_180499.1|  highly ABA-induced PP2C protein 3                     184   4e-51    
gb|KJB74707.1|  hypothetical protein B456_012G003400                    185   4e-51    
gb|KJB70387.1|  hypothetical protein B456_011G071200                    184   5e-51    
ref|XP_010937563.1|  PREDICTED: probable protein phosphatase 2C 24      185   5e-51    
gb|KDO66647.1|  hypothetical protein CISIN_1g0368521mg                  179   6e-51    
ref|XP_006295431.1|  hypothetical protein CARUB_v10024530mg             184   7e-51    
ref|XP_002524215.1|  protein phosphatase 2c, putative                   185   7e-51    
emb|CDP00134.1|  unnamed protein product                                185   7e-51    
ref|XP_010469960.1|  PREDICTED: probable protein phosphatase 2C 24      183   8e-51    
gb|ABW81144.1|  unknown                                                 184   8e-51    
gb|EYU25210.1|  hypothetical protein MIMGU_mgv1a008111mg                184   1e-50    
emb|CDP09108.1|  unnamed protein product                                184   1e-50    
gb|KHG07039.1|  Protein phosphatase 2C 37 -like protein                 184   1e-50    
ref|XP_002318387.2|  hypothetical protein POPTR_0012s01740g             183   1e-50    
gb|ADB22517.1|  protein phosphtase 2C                                   187   1e-50    
ref|XP_011002618.1|  PREDICTED: protein phosphatase 2C 37               184   1e-50    
emb|CBI31627.3|  unnamed protein product                                180   1e-50    
ref|XP_006854472.1|  PREDICTED: probable protein phosphatase 2C 8       184   1e-50    
ref|XP_002282608.1|  PREDICTED: probable protein phosphatase 2C 24      184   2e-50    
ref|XP_009378777.1|  PREDICTED: probable protein phosphatase 2C 51      183   2e-50    
ref|XP_011041658.1|  PREDICTED: probable protein phosphatase 2C 75      183   2e-50    
gb|ABW81041.1|  protein-phosphatase-2C                                  182   2e-50    
gb|ABW74582.1|  putative protein phosphatase                            182   3e-50    
ref|XP_002879213.1|  predicted protein                                  182   3e-50    
ref|XP_010414391.1|  PREDICTED: probable protein phosphatase 2C 24      182   3e-50    
gb|KHG19331.1|  Protein phosphatase 2C 3 -like protein                  183   4e-50    
ref|XP_004145326.1|  PREDICTED: probable protein phosphatase 2C 24      183   4e-50    
gb|EAZ08623.1|  hypothetical protein OsI_30895                          181   5e-50    
ref|XP_010462755.1|  PREDICTED: protein phosphatase 2C 7-like           178   6e-50    
ref|XP_006350789.1|  PREDICTED: protein phosphatase 2C 37-like          182   7e-50    
ref|XP_002314150.1|  phosphatase 2C family protein                      181   7e-50    
ref|XP_004241211.1|  PREDICTED: probable protein phosphatase 2C 24      182   8e-50    



>ref|XP_010324035.1| PREDICTED: probable protein phosphatase 2C 6 isoform X6 [Solanum 
lycopersicum]
 ref|XP_010324036.1| PREDICTED: probable protein phosphatase 2C 6 isoform X6 [Solanum 
lycopersicum]
Length=412

 Score =   328 bits (842),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 167/191 (87%), Positives = 182/191 (95%), Gaps = 1/191 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PEAVGSTA+VA++ P++IIVANCGDSRAVLCRGKLPMPL++DHKPNREDE SRIE LGGK
Sbjct  223  PEAVGSTAIVAVVSPSHIIVANCGDSRAVLCRGKLPMPLTIDHKPNREDECSRIEELGGK  282

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VINWDGHRVSGVLAVSRSIGDRYLRPYVIP PE+MFVPRAKED+CL+LASDGLWDV+TNE
Sbjct  283  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPDPEMMFVPRAKEDDCLILASDGLWDVLTNE  342

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            E CDVARRR+LLWHKKNGGT LSRER ++ DPAAQDAAEYLTR+ALQRGSRDNISVIVVD
Sbjct  343  EACDVARRRILLWHKKNGGT-LSRERGENVDPAAQDAAEYLTRVALQRGSRDNISVIVVD  401

Query  422  LKAQRKFKKKA  390
            LKAQRKFKKK 
Sbjct  402  LKAQRKFKKKT  412



>ref|XP_006342335.1| PREDICTED: probable protein phosphatase 2C 6-like isoform X5 
[Solanum tuberosum]
Length=476

 Score =   330 bits (845),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 169/191 (88%), Positives = 181/191 (95%), Gaps = 1/191 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PEAVGSTAVVA++ PT+IIVANCGDSRAVLCRGKLPMPLS+DHKPNREDE SRIE LGGK
Sbjct  287  PEAVGSTAVVAVVSPTHIIVANCGDSRAVLCRGKLPMPLSIDHKPNREDECSRIEELGGK  346

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VINWDGHRVSGVLAVSRSIGDRYLRPYVIP PE+MFVPRAKED+CL+LASDGLWDV+TNE
Sbjct  347  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPDPEMMFVPRAKEDDCLILASDGLWDVLTNE  406

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            E CDVARRR+LLWHKKNGGT LS ER ++ DPAAQDAAEYLTR+ALQRGSRDNISVIVVD
Sbjct  407  EACDVARRRILLWHKKNGGT-LSSERGENVDPAAQDAAEYLTRVALQRGSRDNISVIVVD  465

Query  422  LKAQRKFKKKA  390
            LKAQRKFKKK 
Sbjct  466  LKAQRKFKKKT  476



>ref|XP_006342331.1| PREDICTED: probable protein phosphatase 2C 6-like isoform X1 
[Solanum tuberosum]
 ref|XP_006342332.1| PREDICTED: probable protein phosphatase 2C 6-like isoform X2 
[Solanum tuberosum]
Length=544

 Score =   330 bits (847),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 169/191 (88%), Positives = 181/191 (95%), Gaps = 1/191 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PEAVGSTAVVA++ PT+IIVANCGDSRAVLCRGKLPMPLS+DHKPNREDE SRIE LGGK
Sbjct  355  PEAVGSTAVVAVVSPTHIIVANCGDSRAVLCRGKLPMPLSIDHKPNREDECSRIEELGGK  414

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VINWDGHRVSGVLAVSRSIGDRYLRPYVIP PE+MFVPRAKED+CL+LASDGLWDV+TNE
Sbjct  415  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPDPEMMFVPRAKEDDCLILASDGLWDVLTNE  474

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            E CDVARRR+LLWHKKNGGT LS ER ++ DPAAQDAAEYLTR+ALQRGSRDNISVIVVD
Sbjct  475  EACDVARRRILLWHKKNGGT-LSSERGENVDPAAQDAAEYLTRVALQRGSRDNISVIVVD  533

Query  422  LKAQRKFKKKA  390
            LKAQRKFKKK 
Sbjct  534  LKAQRKFKKKT  544



>ref|XP_006342334.1| PREDICTED: probable protein phosphatase 2C 6-like isoform X4 
[Solanum tuberosum]
Length=537

 Score =   330 bits (846),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 169/191 (88%), Positives = 181/191 (95%), Gaps = 1/191 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PEAVGSTAVVA++ PT+IIVANCGDSRAVLCRGKLPMPLS+DHKPNREDE SRIE LGGK
Sbjct  348  PEAVGSTAVVAVVSPTHIIVANCGDSRAVLCRGKLPMPLSIDHKPNREDECSRIEELGGK  407

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VINWDGHRVSGVLAVSRSIGDRYLRPYVIP PE+MFVPRAKED+CL+LASDGLWDV+TNE
Sbjct  408  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPDPEMMFVPRAKEDDCLILASDGLWDVLTNE  467

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            E CDVARRR+LLWHKKNGGT LS ER ++ DPAAQDAAEYLTR+ALQRGSRDNISVIVVD
Sbjct  468  EACDVARRRILLWHKKNGGT-LSSERGENVDPAAQDAAEYLTRVALQRGSRDNISVIVVD  526

Query  422  LKAQRKFKKKA  390
            LKAQRKFKKK 
Sbjct  527  LKAQRKFKKKT  537



>ref|XP_006342333.1| PREDICTED: probable protein phosphatase 2C 6-like isoform X3 
[Solanum tuberosum]
Length=543

 Score =   330 bits (847),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 169/191 (88%), Positives = 181/191 (95%), Gaps = 1/191 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PEAVGSTAVVA++ PT+IIVANCGDSRAVLCRGKLPMPLS+DHKPNREDE SRIE LGGK
Sbjct  354  PEAVGSTAVVAVVSPTHIIVANCGDSRAVLCRGKLPMPLSIDHKPNREDECSRIEELGGK  413

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VINWDGHRVSGVLAVSRSIGDRYLRPYVIP PE+MFVPRAKED+CL+LASDGLWDV+TNE
Sbjct  414  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPDPEMMFVPRAKEDDCLILASDGLWDVLTNE  473

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            E CDVARRR+LLWHKKNGGT LS ER ++ DPAAQDAAEYLTR+ALQRGSRDNISVIVVD
Sbjct  474  EACDVARRRILLWHKKNGGT-LSSERGENVDPAAQDAAEYLTRVALQRGSRDNISVIVVD  532

Query  422  LKAQRKFKKKA  390
            LKAQRKFKKK 
Sbjct  533  LKAQRKFKKKT  543



>ref|XP_010324031.1| PREDICTED: probable protein phosphatase 2C 50 isoform X1 [Solanum 
lycopersicum]
Length=544

 Score =   330 bits (845),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 167/191 (87%), Positives = 182/191 (95%), Gaps = 1/191 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PEAVGSTA+VA++ P++IIVANCGDSRAVLCRGKLPMPL++DHKPNREDE SRIE LGGK
Sbjct  355  PEAVGSTAIVAVVSPSHIIVANCGDSRAVLCRGKLPMPLTIDHKPNREDECSRIEELGGK  414

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VINWDGHRVSGVLAVSRSIGDRYLRPYVIP PE+MFVPRAKED+CL+LASDGLWDV+TNE
Sbjct  415  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPDPEMMFVPRAKEDDCLILASDGLWDVLTNE  474

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            E CDVARRR+LLWHKKNGGT LSRER ++ DPAAQDAAEYLTR+ALQRGSRDNISVIVVD
Sbjct  475  EACDVARRRILLWHKKNGGT-LSRERGENVDPAAQDAAEYLTRVALQRGSRDNISVIVVD  533

Query  422  LKAQRKFKKKA  390
            LKAQRKFKKK 
Sbjct  534  LKAQRKFKKKT  544



>ref|XP_010324032.1| PREDICTED: probable protein phosphatase 2C 50 isoform X3 [Solanum 
lycopersicum]
Length=537

 Score =   329 bits (844),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 167/191 (87%), Positives = 182/191 (95%), Gaps = 1/191 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PEAVGSTA+VA++ P++IIVANCGDSRAVLCRGKLPMPL++DHKPNREDE SRIE LGGK
Sbjct  348  PEAVGSTAIVAVVSPSHIIVANCGDSRAVLCRGKLPMPLTIDHKPNREDECSRIEELGGK  407

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VINWDGHRVSGVLAVSRSIGDRYLRPYVIP PE+MFVPRAKED+CL+LASDGLWDV+TNE
Sbjct  408  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPDPEMMFVPRAKEDDCLILASDGLWDVLTNE  467

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            E CDVARRR+LLWHKKNGGT LSRER ++ DPAAQDAAEYLTR+ALQRGSRDNISVIVVD
Sbjct  468  EACDVARRRILLWHKKNGGT-LSRERGENVDPAAQDAAEYLTRVALQRGSRDNISVIVVD  526

Query  422  LKAQRKFKKKA  390
            LKAQRKFKKK 
Sbjct  527  LKAQRKFKKKT  537



>ref|XP_010324033.1| PREDICTED: probable protein phosphatase 2C 50 isoform X5 [Solanum 
lycopersicum]
 ref|XP_010324034.1| PREDICTED: probable protein phosphatase 2C 50 isoform X5 [Solanum 
lycopersicum]
Length=536

 Score =   329 bits (844),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 167/191 (87%), Positives = 182/191 (95%), Gaps = 1/191 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PEAVGSTA+VA++ P++IIVANCGDSRAVLCRGKLPMPL++DHKPNREDE SRIE LGGK
Sbjct  347  PEAVGSTAIVAVVSPSHIIVANCGDSRAVLCRGKLPMPLTIDHKPNREDECSRIEELGGK  406

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VINWDGHRVSGVLAVSRSIGDRYLRPYVIP PE+MFVPRAKED+CL+LASDGLWDV+TNE
Sbjct  407  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPDPEMMFVPRAKEDDCLILASDGLWDVLTNE  466

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            E CDVARRR+LLWHKKNGGT LSRER ++ DPAAQDAAEYLTR+ALQRGSRDNISVIVVD
Sbjct  467  EACDVARRRILLWHKKNGGT-LSRERGENVDPAAQDAAEYLTRVALQRGSRDNISVIVVD  525

Query  422  LKAQRKFKKKA  390
            LKAQRKFKKK 
Sbjct  526  LKAQRKFKKKT  536



>ref|XP_004243738.1| PREDICTED: probable protein phosphatase 2C 50 isoform X4 [Solanum 
lycopersicum]
Length=536

 Score =   329 bits (844),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 167/191 (87%), Positives = 182/191 (95%), Gaps = 1/191 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PEAVGSTA+VA++ P++IIVANCGDSRAVLCRGKLPMPL++DHKPNREDE SRIE LGGK
Sbjct  347  PEAVGSTAIVAVVSPSHIIVANCGDSRAVLCRGKLPMPLTIDHKPNREDECSRIEELGGK  406

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VINWDGHRVSGVLAVSRSIGDRYLRPYVIP PE+MFVPRAKED+CL+LASDGLWDV+TNE
Sbjct  407  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPDPEMMFVPRAKEDDCLILASDGLWDVLTNE  466

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            E CDVARRR+LLWHKKNGGT LSRER ++ DPAAQDAAEYLTR+ALQRGSRDNISVIVVD
Sbjct  467  EACDVARRRILLWHKKNGGT-LSRERGENVDPAAQDAAEYLTRVALQRGSRDNISVIVVD  525

Query  422  LKAQRKFKKKA  390
            LKAQRKFKKK 
Sbjct  526  LKAQRKFKKKT  536



>ref|XP_004243737.1| PREDICTED: probable protein phosphatase 2C 50 isoform X2 [Solanum 
lycopersicum]
Length=543

 Score =   329 bits (844),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 167/191 (87%), Positives = 182/191 (95%), Gaps = 1/191 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PEAVGSTA+VA++ P++IIVANCGDSRAVLCRGKLPMPL++DHKPNREDE SRIE LGGK
Sbjct  354  PEAVGSTAIVAVVSPSHIIVANCGDSRAVLCRGKLPMPLTIDHKPNREDECSRIEELGGK  413

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VINWDGHRVSGVLAVSRSIGDRYLRPYVIP PE+MFVPRAKED+CL+LASDGLWDV+TNE
Sbjct  414  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPDPEMMFVPRAKEDDCLILASDGLWDVLTNE  473

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            E CDVARRR+LLWHKKNGGT LSRER ++ DPAAQDAAEYLTR+ALQRGSRDNISVIVVD
Sbjct  474  EACDVARRRILLWHKKNGGT-LSRERGENVDPAAQDAAEYLTRVALQRGSRDNISVIVVD  532

Query  422  LKAQRKFKKKA  390
            LKAQRKFKKK 
Sbjct  533  LKAQRKFKKKT  543



>ref|XP_009777432.1| PREDICTED: probable protein phosphatase 2C 50 isoform X3 [Nicotiana 
sylvestris]
Length=500

 Score =   325 bits (834),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 165/191 (86%), Positives = 181/191 (95%), Gaps = 1/191 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PEAVGSTAVVA++ PT+IIVANCGDSRAVLCRGKLPMPLS+DHKPNREDE SRIEALGGK
Sbjct  311  PEAVGSTAVVAVVSPTHIIVANCGDSRAVLCRGKLPMPLSIDHKPNREDECSRIEALGGK  370

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VINWDGHRVSGVLAVSRSIGDRYLRPYVIP PE+MFVPR K+D+CL+LASDGLWDV+TNE
Sbjct  371  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPDPEMMFVPRVKDDDCLILASDGLWDVLTNE  430

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            E C+VARRR+LLWHKKNGGT L+ ER ++ DPAAQDAAEYLTR+ALQ+GSRDNISVIVVD
Sbjct  431  EACEVARRRILLWHKKNGGT-LTNERGENIDPAAQDAAEYLTRLALQKGSRDNISVIVVD  489

Query  422  LKAQRKFKKKA  390
            LKAQRKFKKK 
Sbjct  490  LKAQRKFKKKT  500



>ref|XP_009777428.1| PREDICTED: probable protein phosphatase 2C 50 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009777429.1| PREDICTED: probable protein phosphatase 2C 50 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009777430.1| PREDICTED: probable protein phosphatase 2C 50 isoform X1 [Nicotiana 
sylvestris]
Length=527

 Score =   326 bits (835),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 165/191 (86%), Positives = 181/191 (95%), Gaps = 1/191 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PEAVGSTAVVA++ PT+IIVANCGDSRAVLCRGKLPMPLS+DHKPNREDE SRIEALGGK
Sbjct  338  PEAVGSTAVVAVVSPTHIIVANCGDSRAVLCRGKLPMPLSIDHKPNREDECSRIEALGGK  397

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VINWDGHRVSGVLAVSRSIGDRYLRPYVIP PE+MFVPR K+D+CL+LASDGLWDV+TNE
Sbjct  398  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPDPEMMFVPRVKDDDCLILASDGLWDVLTNE  457

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            E C+VARRR+LLWHKKNGGT L+ ER ++ DPAAQDAAEYLTR+ALQ+GSRDNISVIVVD
Sbjct  458  EACEVARRRILLWHKKNGGT-LTNERGENIDPAAQDAAEYLTRLALQKGSRDNISVIVVD  516

Query  422  LKAQRKFKKKA  390
            LKAQRKFKKK 
Sbjct  517  LKAQRKFKKKT  527



>ref|XP_009777431.1| PREDICTED: probable protein phosphatase 2C 50 isoform X2 [Nicotiana 
sylvestris]
Length=526

 Score =   326 bits (835),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 165/191 (86%), Positives = 181/191 (95%), Gaps = 1/191 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PEAVGSTAVVA++ PT+IIVANCGDSRAVLCRGKLPMPLS+DHKPNREDE SRIEALGGK
Sbjct  337  PEAVGSTAVVAVVSPTHIIVANCGDSRAVLCRGKLPMPLSIDHKPNREDECSRIEALGGK  396

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VINWDGHRVSGVLAVSRSIGDRYLRPYVIP PE+MFVPR K+D+CL+LASDGLWDV+TNE
Sbjct  397  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPDPEMMFVPRVKDDDCLILASDGLWDVLTNE  456

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            E C+VARRR+LLWHKKNGGT L+ ER ++ DPAAQDAAEYLTR+ALQ+GSRDNISVIVVD
Sbjct  457  EACEVARRRILLWHKKNGGT-LTNERGENIDPAAQDAAEYLTRLALQKGSRDNISVIVVD  515

Query  422  LKAQRKFKKKA  390
            LKAQRKFKKK 
Sbjct  516  LKAQRKFKKKT  526



>ref|XP_009603753.1| PREDICTED: probable protein phosphatase 2C 50 isoform X3 [Nicotiana 
tomentosiformis]
Length=499

 Score =   324 bits (830),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 164/191 (86%), Positives = 180/191 (94%), Gaps = 1/191 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PEAVGSTAVVA++ PT+IIVANCGDSRAVLCRGKLPMPLS+DHKPNREDE SRIEALGGK
Sbjct  310  PEAVGSTAVVAVVSPTHIIVANCGDSRAVLCRGKLPMPLSIDHKPNREDECSRIEALGGK  369

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VINWDGHRVSGVLAVSRSIGDRYLRPYVIP PE+MFVPR K+D+CL+LASDGLWDV+TNE
Sbjct  370  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPDPEMMFVPRVKDDDCLILASDGLWDVLTNE  429

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            E C+VARRR+LLWHKKNGGT L+ ER ++ DPAAQDAAEYLTR+ALQ+GSRDNISVIVVD
Sbjct  430  EACEVARRRILLWHKKNGGT-LTNERGENVDPAAQDAAEYLTRLALQKGSRDNISVIVVD  488

Query  422  LKAQRKFKKKA  390
            LK QRKFKKK 
Sbjct  489  LKVQRKFKKKT  499



>ref|XP_009603748.1| PREDICTED: probable protein phosphatase 2C 50 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009603749.1| PREDICTED: probable protein phosphatase 2C 50 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009603750.1| PREDICTED: probable protein phosphatase 2C 50 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009603751.1| PREDICTED: probable protein phosphatase 2C 50 isoform X1 [Nicotiana 
tomentosiformis]
Length=526

 Score =   324 bits (831),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 164/191 (86%), Positives = 180/191 (94%), Gaps = 1/191 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PEAVGSTAVVA++ PT+IIVANCGDSRAVLCRGKLPMPLS+DHKPNREDE SRIEALGGK
Sbjct  337  PEAVGSTAVVAVVSPTHIIVANCGDSRAVLCRGKLPMPLSIDHKPNREDECSRIEALGGK  396

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VINWDGHRVSGVLAVSRSIGDRYLRPYVIP PE+MFVPR K+D+CL+LASDGLWDV+TNE
Sbjct  397  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPDPEMMFVPRVKDDDCLILASDGLWDVLTNE  456

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            E C+VARRR+LLWHKKNGGT L+ ER ++ DPAAQDAAEYLTR+ALQ+GSRDNISVIVVD
Sbjct  457  EACEVARRRILLWHKKNGGT-LTNERGENVDPAAQDAAEYLTRLALQKGSRDNISVIVVD  515

Query  422  LKAQRKFKKKA  390
            LK QRKFKKK 
Sbjct  516  LKVQRKFKKKT  526



>ref|XP_009603752.1| PREDICTED: probable protein phosphatase 2C 50 isoform X2 [Nicotiana 
tomentosiformis]
Length=525

 Score =   324 bits (830),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 164/191 (86%), Positives = 180/191 (94%), Gaps = 1/191 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PEAVGSTAVVA++ PT+IIVANCGDSRAVLCRGKLPMPLS+DHKPNREDE SRIEALGGK
Sbjct  336  PEAVGSTAVVAVVSPTHIIVANCGDSRAVLCRGKLPMPLSIDHKPNREDECSRIEALGGK  395

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VINWDGHRVSGVLAVSRSIGDRYLRPYVIP PE+MFVPR K+D+CL+LASDGLWDV+TNE
Sbjct  396  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPDPEMMFVPRVKDDDCLILASDGLWDVLTNE  455

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            E C+VARRR+LLWHKKNGGT L+ ER ++ DPAAQDAAEYLTR+ALQ+GSRDNISVIVVD
Sbjct  456  EACEVARRRILLWHKKNGGT-LTNERGENVDPAAQDAAEYLTRLALQKGSRDNISVIVVD  514

Query  422  LKAQRKFKKKA  390
            LK QRKFKKK 
Sbjct  515  LKVQRKFKKKT  525



>ref|XP_011078036.1| PREDICTED: probable protein phosphatase 2C 50 [Sesamum indicum]
 ref|XP_011078037.1| PREDICTED: probable protein phosphatase 2C 50 [Sesamum indicum]
 ref|XP_011078038.1| PREDICTED: probable protein phosphatase 2C 50 [Sesamum indicum]
Length=549

 Score =   309 bits (791),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 159/191 (83%), Positives = 175/191 (92%), Gaps = 1/191 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE+VGSTAVVA++C T+IIVANCGDSRAVL RGK+PMPLSVDHKPNREDE +RIEA GGK
Sbjct  360  PESVGSTAVVAVVCSTHIIVANCGDSRAVLYRGKVPMPLSVDHKPNREDECARIEAAGGK  419

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VINWDG+RVSGVLAVSRSIGDRYLRPYV+  PEIMFVPR KEDECL+LASDGLWDVMTN 
Sbjct  420  VINWDGYRVSGVLAVSRSIGDRYLRPYVVADPEIMFVPRTKEDECLILASDGLWDVMTNI  479

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            E CD+ARRR+LLWHKKNG T LS+ER  D DPAAQDAA+YL+++A QRGSRDNISVIVVD
Sbjct  480  EACDLARRRILLWHKKNGAT-LSKERGTDIDPAAQDAADYLSQLAFQRGSRDNISVIVVD  538

Query  422  LKAQRKFKKKA  390
            LKAQRKFKKK 
Sbjct  539  LKAQRKFKKKT  549



>gb|AFP49836.1| type 2C protein phosphatase, partial [Cucumis sativus]
Length=278

 Score =   298 bits (763),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 148/191 (77%), Positives = 173/191 (91%), Gaps = 1/191 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVA++C ++IIVANCGDSRAVLCRGK PM LSVDHKPNREDEY+RIE+ GGK
Sbjct  89   PETVGSTAVVALVCSSHIIVANCGDSRAVLCRGKEPMALSVDHKPNREDEYARIESSGGK  148

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+GHRV GVLA+SRSIGDRYL+P++IP PE+MF+PRAKEDECL+LASDGLWDVMTNE
Sbjct  149  VIQWNGHRVFGVLAMSRSIGDRYLKPWIIPDPEVMFIPRAKEDECLILASDGLWDVMTNE  208

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            EVCDVARRR+LLWHKK+G + L+ +R    DPAAQ AA+YL+ +ALQ+GS+DNISVIVVD
Sbjct  209  EVCDVARRRILLWHKKHGASSLA-DRGTGVDPAAQAAADYLSMLALQKGSKDNISVIVVD  267

Query  422  LKAQRKFKKKA  390
            LKAQRKFK K+
Sbjct  268  LKAQRKFKTKS  278



>ref|XP_010247361.1| PREDICTED: probable protein phosphatase 2C 53 [Nelumbo nucifera]
 ref|XP_010247362.1| PREDICTED: probable protein phosphatase 2C 53 [Nelumbo nucifera]
 ref|XP_010247363.1| PREDICTED: probable protein phosphatase 2C 53 [Nelumbo nucifera]
 ref|XP_010247364.1| PREDICTED: probable protein phosphatase 2C 53 [Nelumbo nucifera]
Length=566

 Score =   303 bits (776),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 150/191 (79%), Positives = 175/191 (92%), Gaps = 1/191 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVA++C ++IIVANCGDSRAVLCRGK P+PLSVDHKPNREDEY+RIEA GGK
Sbjct  377  PETVGSTAVVAVICSSHIIVANCGDSRAVLCRGKEPIPLSVDHKPNREDEYARIEAAGGK  436

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+G+RV GVLA+SRSIGDRYL+P++IPVPE+MFVPR KEDECLVLASDGLWDV+TNE
Sbjct  437  VIPWNGYRVCGVLAMSRSIGDRYLKPWIIPVPEVMFVPRTKEDECLVLASDGLWDVLTNE  496

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            EVC+VARRR+LLWHKKNG T L  ER +  DPAAQ AAE+L+++ALQ+GS+DNI+VIVVD
Sbjct  497  EVCEVARRRILLWHKKNGVT-LPAERGNGIDPAAQAAAEFLSKLALQKGSKDNITVIVVD  555

Query  422  LKAQRKFKKKA  390
            LK+QRKFK KA
Sbjct  556  LKSQRKFKSKA  566



>ref|XP_007012349.1| ABI1 isoform 1 [Theobroma cacao]
 ref|XP_007012350.1| ABI1 isoform 1 [Theobroma cacao]
 ref|XP_007012352.1| ABI1 isoform 1 [Theobroma cacao]
 gb|EOY29968.1| ABI1 isoform 1 [Theobroma cacao]
 gb|EOY29969.1| ABI1 isoform 1 [Theobroma cacao]
 gb|EOY29971.1| ABI1 isoform 1 [Theobroma cacao]
Length=558

 Score =   301 bits (772),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 149/190 (78%), Positives = 168/190 (88%), Gaps = 1/190 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVA++C ++I+VANCGDSRAVLCRGK PM LSVDHKPNREDEY RIEA GGK
Sbjct  369  PETVGSTAVVALICSSHIVVANCGDSRAVLCRGKEPMALSVDHKPNREDEYERIEAAGGK  428

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+GHRV GVLA+SRSIGDRYL+P++IP PE+MFVPRAKEDECL+LASDGLWDVMTNE
Sbjct  429  VIQWNGHRVFGVLAMSRSIGDRYLKPWIIPEPEVMFVPRAKEDECLILASDGLWDVMTNE  488

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            E CD+ARRR+L WHKKNG T+ S ER D  DPAAQ AAEYL+  ALQ+GS+DNI+V VVD
Sbjct  489  EACDLARRRILQWHKKNGATLTS-ERGDTIDPAAQAAAEYLSNRALQKGSKDNITVTVVD  547

Query  422  LKAQRKFKKK  393
            LKAQRKFK K
Sbjct  548  LKAQRKFKSK  557



>ref|XP_010262014.1| PREDICTED: protein phosphatase 2C 16-like [Nelumbo nucifera]
Length=568

 Score =   301 bits (772),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 151/190 (79%), Positives = 173/190 (91%), Gaps = 1/190 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVAI+C ++IIVANCGDSRAVLCRGK P+PLSVDHKPNREDEYSRIEA GGK
Sbjct  379  PETVGSTAVVAIICSSHIIVANCGDSRAVLCRGKEPIPLSVDHKPNREDEYSRIEAAGGK  438

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+G+RV GVLA+SRSIGDRYL+P +IP PE+MF+PRAKEDECL+LASDGLWDVMTNE
Sbjct  439  VIQWNGYRVFGVLAMSRSIGDRYLKPCIIPEPEVMFIPRAKEDECLILASDGLWDVMTNE  498

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            EVC+VARRR+LLWHKKNG T L  ER D  DPAAQ AAE+L+++ALQ+GS+DNI+V+VVD
Sbjct  499  EVCEVARRRILLWHKKNGIT-LPAERGDGVDPAAQSAAEFLSKLALQKGSKDNITVVVVD  557

Query  422  LKAQRKFKKK  393
            LKAQRKFK K
Sbjct  558  LKAQRKFKSK  567



>ref|XP_004146814.1| PREDICTED: protein phosphatase 2C 16-like [Cucumis sativus]
 gb|KGN59805.1| hypothetical protein Csa_3G848150 [Cucumis sativus]
Length=536

 Score =   301 bits (770),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 148/191 (77%), Positives = 173/191 (91%), Gaps = 1/191 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVA++C ++IIVANCGDSRAVLCRGK PM LSVDHKPNREDEY+RIE+ GGK
Sbjct  347  PETVGSTAVVALVCSSHIIVANCGDSRAVLCRGKEPMALSVDHKPNREDEYARIESSGGK  406

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+GHRV GVLA+SRSIGDRYL+P++IP PE+MF+PRAKEDECL+LASDGLWDVMTNE
Sbjct  407  VIQWNGHRVFGVLAMSRSIGDRYLKPWIIPDPEVMFIPRAKEDECLILASDGLWDVMTNE  466

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            EVCDVARRR+LLWHKK+G + L+ +R    DPAAQ AA+YL+ +ALQ+GS+DNISVIVVD
Sbjct  467  EVCDVARRRILLWHKKHGASSLA-DRGTGVDPAAQAAADYLSMLALQKGSKDNISVIVVD  525

Query  422  LKAQRKFKKKA  390
            LKAQRKFK K+
Sbjct  526  LKAQRKFKTKS  536



>emb|CBI20679.3| unnamed protein product [Vitis vinifera]
Length=505

 Score =   298 bits (764),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 149/190 (78%), Positives = 168/190 (88%), Gaps = 0/190 (0%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVAI+C ++IIVANCGDSRAVL RGK P+ LSVDHKPNREDEY+RIEA GGK
Sbjct  315  PETVGSTAVVAIICSSHIIVANCGDSRAVLYRGKEPIALSVDHKPNREDEYARIEAAGGK  374

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+GHRV GVLA+SRSIGDRYL+P++IP PE+ F+PRA+EDECLVLASDGLWDVMTNE
Sbjct  375  VIQWNGHRVFGVLAMSRSIGDRYLKPWIIPEPEVTFIPRAREDECLVLASDGLWDVMTNE  434

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            EVCD+ARRR+LLWHKKNG TML  ER    DPAAQ AAE L+  ALQ+GS+DNI+VIVVD
Sbjct  435  EVCDIARRRILLWHKKNGVTMLPSERGQGIDPAAQAAAECLSNRALQKGSKDNITVIVVD  494

Query  422  LKAQRKFKKK  393
            LKAQRKFK K
Sbjct  495  LKAQRKFKSK  504



>ref|XP_009334717.1| PREDICTED: probable protein phosphatase 2C 50 [Pyrus x bretschneideri]
 ref|XP_009334718.1| PREDICTED: probable protein phosphatase 2C 50 [Pyrus x bretschneideri]
 ref|XP_009334719.1| PREDICTED: probable protein phosphatase 2C 50 [Pyrus x bretschneideri]
 ref|XP_009334720.1| PREDICTED: probable protein phosphatase 2C 50 [Pyrus x bretschneideri]
Length=552

 Score =   300 bits (768),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 146/191 (76%), Positives = 169/191 (88%), Gaps = 0/191 (0%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVA++C ++IIVANCGDSRAVLCRGK PM LSVDHKPNREDEY+RIEA GGK
Sbjct  362  PETVGSTAVVALICSSHIIVANCGDSRAVLCRGKEPMALSVDHKPNREDEYARIEAAGGK  421

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+GHRV GVLA+SRSIGDRYL+P++IP PE+MF+PR K+DECL+LASDGLWDVM+NE
Sbjct  422  VIQWNGHRVFGVLAMSRSIGDRYLKPWIIPEPEVMFIPRTKDDECLILASDGLWDVMSNE  481

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            EVCD+ARRR+LLWHKKNG   L +ER    DPAAQ AAE+L+  ALQ+GS+DNI+VIVVD
Sbjct  482  EVCDLARRRILLWHKKNGADGLPQERGIGIDPAAQAAAEFLSNRALQKGSKDNITVIVVD  541

Query  422  LKAQRKFKKKA  390
            LKAQRKFK K 
Sbjct  542  LKAQRKFKSKT  552



>ref|XP_006646035.1| PREDICTED: probable protein phosphatase 2C 6-like, partial [Oryza 
brachyantha]
Length=354

 Score =   293 bits (751),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 146/192 (76%), Positives = 170/192 (89%), Gaps = 1/192 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVA++C ++IIVANCGDSRAVLCRGKLP+PLSVDHKPNREDEY+RIEA GGK
Sbjct  163  PETVGSTAVVAVICSSHIIVANCGDSRAVLCRGKLPVPLSVDHKPNREDEYARIEAEGGK  222

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+G+RV GVLA+SRSIGDRYL+P++IPVPE+  VPRAK+DECLVLASDGLWDVM+NE
Sbjct  223  VIQWNGYRVFGVLAMSRSIGDRYLKPWIIPVPEVTIVPRAKDDECLVLASDGLWDVMSNE  282

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdp-aaqdaAEYLTRIALQRGSRDNISVIVV  426
            EVCDVAR+R+LLWHKKNG    S  RS D    AA+ AAE L+++ALQ+GS+DNISVIVV
Sbjct  283  EVCDVARKRILLWHKKNGSNSSSAPRSGDSSDPAAEAAAECLSKLALQKGSKDNISVIVV  342

Query  425  DLKAQRKFKKKA  390
            DLKA RKFK K+
Sbjct  343  DLKAHRKFKSKS  354



>gb|KJB54638.1| hypothetical protein B456_009G042600 [Gossypium raimondii]
 gb|KJB54639.1| hypothetical protein B456_009G042600 [Gossypium raimondii]
 gb|KJB54641.1| hypothetical protein B456_009G042600 [Gossypium raimondii]
 gb|KJB54642.1| hypothetical protein B456_009G042600 [Gossypium raimondii]
Length=558

 Score =   300 bits (767),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 147/190 (77%), Positives = 169/190 (89%), Gaps = 1/190 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVA++C ++IIVANCGDSRAVLCRGK PM LSVDHKPNREDEY RIEA GGK
Sbjct  369  PETVGSTAVVALICSSHIIVANCGDSRAVLCRGKQPMALSVDHKPNREDEYERIEAAGGK  428

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+GHRV GVLA+SRSIGDRYL+P++IP PE++FVPRAKEDECL+LASDGLWDVM+NE
Sbjct  429  VIQWNGHRVFGVLAMSRSIGDRYLKPWIIPDPEVVFVPRAKEDECLILASDGLWDVMSNE  488

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            E CD+ARRR+L WHKKNG T L+ ER +  DPA+Q AAEYL+  ALQ+GS+DNI+VIVVD
Sbjct  489  EACDLARRRILQWHKKNGAT-LTPERGETIDPASQSAAEYLSNRALQKGSKDNITVIVVD  547

Query  422  LKAQRKFKKK  393
            LKAQRKFK K
Sbjct  548  LKAQRKFKSK  557



>ref|XP_008445513.1| PREDICTED: protein phosphatase 2C 77-like isoform X1 [Cucumis 
melo]
 ref|XP_008445514.1| PREDICTED: protein phosphatase 2C 77-like isoform X1 [Cucumis 
melo]
 ref|XP_008445515.1| PREDICTED: protein phosphatase 2C 77-like isoform X1 [Cucumis 
melo]
 ref|XP_008445516.1| PREDICTED: protein phosphatase 2C 77-like isoform X1 [Cucumis 
melo]
Length=553

 Score =   299 bits (766),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 150/191 (79%), Positives = 168/191 (88%), Gaps = 1/191 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVAI+C ++IIVANCGDSRAVLCRGK PM LSVDHKPNR DEY RIEA GGK
Sbjct  364  PETVGSTAVVAIICASHIIVANCGDSRAVLCRGKEPMALSVDHKPNRADEYERIEAAGGK  423

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+GHRV GVLA+SRSIGDRYL+P++IP PE+MFVPRAK+DECLVLASDGLWDVMTNE
Sbjct  424  VIQWNGHRVFGVLAMSRSIGDRYLKPWIIPEPEVMFVPRAKDDECLVLASDGLWDVMTNE  483

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            EVCD+ARRR+LLWHKKN G  L  ER    DPAAQ AAEYL+  ALQ+GS+DNI+VIV+D
Sbjct  484  EVCDLARRRILLWHKKN-GVSLPSERGLGIDPAAQAAAEYLSNRALQKGSKDNITVIVID  542

Query  422  LKAQRKFKKKA  390
            LKAQRKFK K+
Sbjct  543  LKAQRKFKTKS  553



>ref|XP_007223074.1| hypothetical protein PRUPE_ppa003748mg [Prunus persica]
 gb|EMJ24273.1| hypothetical protein PRUPE_ppa003748mg [Prunus persica]
Length=551

 Score =   299 bits (765),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 147/191 (77%), Positives = 170/191 (89%), Gaps = 0/191 (0%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVA++C ++IIVANCGDSRAVLCRGK PM LSVDHKPNREDEY+RIEA GGK
Sbjct  361  PETVGSTAVVALICSSHIIVANCGDSRAVLCRGKEPMALSVDHKPNREDEYARIEAAGGK  420

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+GHRV GVLA+SRSIGDRYL+P++IP PE+MF+PR K+DECL+LASDGLWDVM+NE
Sbjct  421  VIQWNGHRVFGVLAMSRSIGDRYLKPWIIPEPEVMFIPRTKDDECLILASDGLWDVMSNE  480

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            EVCD+ARRR+LLWHKKNG T L+ ER +  DPAAQ AAE L+  ALQ+GS+DNI+VIVVD
Sbjct  481  EVCDLARRRILLWHKKNGITPLTLERGEGIDPAAQAAAELLSNRALQKGSKDNITVIVVD  540

Query  422  LKAQRKFKKKA  390
            LKAQRKFK K 
Sbjct  541  LKAQRKFKSKT  551



>ref|XP_012076982.1| PREDICTED: protein phosphatase 2C 77 [Jatropha curcas]
 gb|KDP33870.1| hypothetical protein JCGZ_07441 [Jatropha curcas]
Length=546

 Score =   298 bits (764),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 146/190 (77%), Positives = 173/190 (91%), Gaps = 1/190 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVV I+CPT IIVANCGDSRAVLCRGK+ MPLSVDHKP+REDEY+RIEA GGK
Sbjct  353  PETVGSTAVVTIVCPTYIIVANCGDSRAVLCRGKVAMPLSVDHKPDREDEYTRIEAAGGK  412

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            +I W+G RV GVLA+SRSIGDRYL+P+++P PE+MFVPR K+DECL+LASDGLWDVMTN+
Sbjct  413  IIQWNGSRVFGVLAMSRSIGDRYLKPWIVPDPEVMFVPREKDDECLILASDGLWDVMTNQ  472

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            EVCD+ARRR+LLWHK+NG T LS  R+D  DPAAQ AAEYL+++ALQ+GS+DN++VIVVD
Sbjct  473  EVCDIARRRILLWHKRNGDT-LSATRADGVDPAAQAAAEYLSKLALQKGSKDNVTVIVVD  531

Query  422  LKAQRKFKKK  393
            LKAQRKFK+K
Sbjct  532  LKAQRKFKRK  541



>ref|XP_002309484.2| hypothetical protein POPTR_0006s24100g [Populus trichocarpa]
 gb|AEK05571.1| abscisic acid insensitivity 1B [Populus balsamifera]
 gb|AEK05575.1| abscisic acid insensitivity 1B [Populus balsamifera]
 gb|AEK05581.1| abscisic acid insensitivity 1B [Populus balsamifera]
 gb|AEK05582.1| abscisic acid insensitivity 1B [Populus balsamifera]
 gb|AEK05583.1| abscisic acid insensitivity 1B [Populus balsamifera]
 gb|AEK05584.1| abscisic acid insensitivity 1B [Populus balsamifera]
 gb|EEE93007.2| hypothetical protein POPTR_0006s24100g [Populus trichocarpa]
Length=548

 Score =   298 bits (764),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 147/190 (77%), Positives = 170/190 (89%), Gaps = 1/190 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVAI+C ++IIVANCGDSRAVLCRGK PM LSVDHKPNREDEY+RIEA GGK
Sbjct  359  PETVGSTAVVAIICSSHIIVANCGDSRAVLCRGKEPMALSVDHKPNREDEYARIEAAGGK  418

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+GHRV GVLA+SRSIGDRYL+P++IP PE+MF+PRAKEDECL+LASDGLWDVM+NE
Sbjct  419  VIQWNGHRVFGVLAMSRSIGDRYLKPWIIPEPEVMFIPRAKEDECLILASDGLWDVMSNE  478

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            E CD+AR+R+L+WHKKN G  LS  RS+  DPAAQ AAE+L+  ALQ+GS+DNI+VIVVD
Sbjct  479  EACDLARKRILVWHKKN-GVALSSSRSEGIDPAAQAAAEFLSNRALQKGSKDNITVIVVD  537

Query  422  LKAQRKFKKK  393
            LKAQRKFK K
Sbjct  538  LKAQRKFKTK  547



>ref|XP_010648365.1| PREDICTED: probable protein phosphatase 2C 53 [Vitis vinifera]
 ref|XP_010648366.1| PREDICTED: probable protein phosphatase 2C 53 [Vitis vinifera]
Length=551

 Score =   298 bits (764),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 149/191 (78%), Positives = 168/191 (88%), Gaps = 0/191 (0%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVAI+C ++IIVANCGDSRAVL RGK P+ LSVDHKPNREDEY+RIEA GGK
Sbjct  361  PETVGSTAVVAIICSSHIIVANCGDSRAVLYRGKEPIALSVDHKPNREDEYARIEAAGGK  420

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+GHRV GVLA+SRSIGDRYL+P++IP PE+ F+PRA+EDECLVLASDGLWDVMTNE
Sbjct  421  VIQWNGHRVFGVLAMSRSIGDRYLKPWIIPEPEVTFIPRAREDECLVLASDGLWDVMTNE  480

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            EVCD+ARRR+LLWHKKNG TML  ER    DPAAQ AAE L+  ALQ+GS+DNI+VIVVD
Sbjct  481  EVCDIARRRILLWHKKNGVTMLPSERGQGIDPAAQAAAECLSNRALQKGSKDNITVIVVD  540

Query  422  LKAQRKFKKKA  390
            LKAQRKFK K 
Sbjct  541  LKAQRKFKSKT  551



>gb|AEK05577.1| abscisic acid insensitivity 1B [Populus balsamifera]
Length=548

 Score =   298 bits (764),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 147/190 (77%), Positives = 170/190 (89%), Gaps = 1/190 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVAI+C ++IIVANCGDSRAVLCRGK PM LSVDHKPNREDEY+RIEA GGK
Sbjct  359  PETVGSTAVVAIICSSHIIVANCGDSRAVLCRGKEPMALSVDHKPNREDEYARIEAAGGK  418

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+GHRV GVLA+SRSIGDRYL+P++IP PE+MF+PRAKEDECL+LASDGLWDVM+NE
Sbjct  419  VIQWNGHRVFGVLAMSRSIGDRYLKPWIIPEPEVMFIPRAKEDECLILASDGLWDVMSNE  478

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            E CD+AR+R+L+WHKKN G  LS  RS+  DPAAQ AAE+L+  ALQ+GS+DNI+VIVVD
Sbjct  479  EACDLARKRILVWHKKN-GVALSSSRSEGIDPAAQAAAEFLSNRALQKGSKDNITVIVVD  537

Query  422  LKAQRKFKKK  393
            LKAQRKFK K
Sbjct  538  LKAQRKFKTK  547



>gb|AEK05574.1| abscisic acid insensitivity 1B [Populus balsamifera]
 gb|AEK05576.1| abscisic acid insensitivity 1B [Populus balsamifera]
 gb|AEK05580.1| abscisic acid insensitivity 1B [Populus balsamifera]
 gb|AEK05585.1| abscisic acid insensitivity 1B [Populus balsamifera]
 gb|AEK05588.1| abscisic acid insensitivity 1B [Populus balsamifera]
Length=548

 Score =   298 bits (764),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 147/190 (77%), Positives = 170/190 (89%), Gaps = 1/190 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVAI+C ++IIVANCGDSRAVLCRGK PM LSVDHKPNREDEY+RIEA GGK
Sbjct  359  PETVGSTAVVAIICSSHIIVANCGDSRAVLCRGKEPMALSVDHKPNREDEYARIEAXGGK  418

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+GHRV GVLA+SRSIGDRYL+P++IP PE+MF+PRAKEDECL+LASDGLWDVM+NE
Sbjct  419  VIQWNGHRVFGVLAMSRSIGDRYLKPWIIPEPEVMFIPRAKEDECLILASDGLWDVMSNE  478

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            E CD+AR+R+L+WHKKN G  LS  RS+  DPAAQ AAE+L+  ALQ+GS+DNI+VIVVD
Sbjct  479  EACDLARKRILVWHKKN-GVALSSSRSEGIDPAAQAAAEFLSNRALQKGSKDNITVIVVD  537

Query  422  LKAQRKFKKK  393
            LKAQRKFK K
Sbjct  538  LKAQRKFKTK  547



>gb|KHG12551.1| Protein phosphatase 2C 16 -like protein [Gossypium arboreum]
Length=558

 Score =   298 bits (764),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 146/190 (77%), Positives = 169/190 (89%), Gaps = 1/190 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVA++C ++I+VANCGDSRAVLCRGK PM LSVDHKPNREDEY RIEA GGK
Sbjct  369  PETVGSTAVVALICSSHIVVANCGDSRAVLCRGKQPMALSVDHKPNREDEYERIEAAGGK  428

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+GHRV GVLA+SRSIGDRYL+P++IP PE++FVPRAKEDECL+LASDGLWDVM+NE
Sbjct  429  VIQWNGHRVFGVLAMSRSIGDRYLKPWIIPDPEVVFVPRAKEDECLILASDGLWDVMSNE  488

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            E CD+ARRR+L WHKKN GT L+ ER +  DPA+Q AAEYL+  ALQ+GS+DNI+VIVVD
Sbjct  489  EACDLARRRILQWHKKN-GTTLTPERGETIDPASQSAAEYLSNRALQKGSKDNITVIVVD  547

Query  422  LKAQRKFKKK  393
            LKAQRKFK K
Sbjct  548  LKAQRKFKSK  557



>ref|XP_011019392.1| PREDICTED: probable protein phosphatase 2C 50 [Populus euphratica]
 ref|XP_011019393.1| PREDICTED: probable protein phosphatase 2C 50 [Populus euphratica]
 ref|XP_011019394.1| PREDICTED: probable protein phosphatase 2C 50 [Populus euphratica]
 ref|XP_011019395.1| PREDICTED: probable protein phosphatase 2C 50 [Populus euphratica]
 ref|XP_011019397.1| PREDICTED: probable protein phosphatase 2C 50 [Populus euphratica]
 ref|XP_011019398.1| PREDICTED: probable protein phosphatase 2C 50 [Populus euphratica]
 ref|XP_011019399.1| PREDICTED: probable protein phosphatase 2C 50 [Populus euphratica]
 ref|XP_011019400.1| PREDICTED: probable protein phosphatase 2C 50 [Populus euphratica]
Length=546

 Score =   298 bits (763),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 147/190 (77%), Positives = 169/190 (89%), Gaps = 1/190 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVA +C ++IIVANCGDSRAVLCRGK PM LSVDHKPNREDEY+RIEA GGK
Sbjct  357  PETVGSTAVVATICSSHIIVANCGDSRAVLCRGKEPMALSVDHKPNREDEYARIEAAGGK  416

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+GHRV GVLA+SRSIGDRYL+P++IP PE+MF+PRAKEDECL+LASDGLWDVM+NE
Sbjct  417  VIQWNGHRVFGVLAMSRSIGDRYLKPWIIPEPEVMFIPRAKEDECLILASDGLWDVMSNE  476

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            E CD+AR+R+L+WHKKN G  LS  RS+  DPAAQ AAEYL+  ALQ+GS+DNI+VIVVD
Sbjct  477  EACDLARKRILVWHKKN-GVALSSSRSEGIDPAAQAAAEYLSNRALQKGSKDNITVIVVD  535

Query  422  LKAQRKFKKK  393
            LKAQRKFK K
Sbjct  536  LKAQRKFKTK  545



>gb|KJB54637.1| hypothetical protein B456_009G042600 [Gossypium raimondii]
Length=557

 Score =   298 bits (764),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 146/190 (77%), Positives = 169/190 (89%), Gaps = 1/190 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVA++C ++IIVANCGDSRAVLCRGK PM LSVDHKPNREDEY RIEA GGK
Sbjct  369  PETVGSTAVVALICSSHIIVANCGDSRAVLCRGKQPMALSVDHKPNREDEYERIEAAGGK  428

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+GHRV GVLA+SRSIGDRYL+P++IP PE++FVPRAKEDECL+LASDGLWDVM+NE
Sbjct  429  VIQWNGHRVFGVLAMSRSIGDRYLKPWIIPDPEVVFVPRAKEDECLILASDGLWDVMSNE  488

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            E CD+ARRR+L WHKKNG T L+ ER +  DPA+Q AAEYL+  ALQ+GS+DNI+VIVVD
Sbjct  489  EACDLARRRILQWHKKNGAT-LTPERGETIDPASQSAAEYLSNRALQKGSKDNITVIVVD  547

Query  422  LKAQRKFKKK  393
            LKAQRKFK +
Sbjct  548  LKAQRKFKTQ  557



>gb|AEK05572.1| abscisic acid insensitivity 1B [Populus balsamifera]
 gb|AEK05573.1| abscisic acid insensitivity 1B [Populus balsamifera]
 gb|AEK05578.1| abscisic acid insensitivity 1B [Populus balsamifera]
 gb|AEK05579.1| abscisic acid insensitivity 1B [Populus balsamifera]
 gb|AEK05587.1| abscisic acid insensitivity 1B [Populus balsamifera]
Length=548

 Score =   298 bits (763),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 147/190 (77%), Positives = 170/190 (89%), Gaps = 1/190 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVAI+C ++IIVANCGDSRAVLCRGK PM LSVDHKPNREDEY+RIEA GGK
Sbjct  359  PETVGSTAVVAIICSSHIIVANCGDSRAVLCRGKEPMALSVDHKPNREDEYARIEAXGGK  418

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+GHRV GVLA+SRSIGDRYL+P++IP PE+MF+PRAKEDECL+LASDGLWDVM+NE
Sbjct  419  VIQWNGHRVFGVLAMSRSIGDRYLKPWIIPEPEVMFIPRAKEDECLILASDGLWDVMSNE  478

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            E CD+AR+R+L+WHKKN G  LS  RS+  DPAAQ AAE+L+  ALQ+GS+DNI+VIVVD
Sbjct  479  EACDLARKRILVWHKKN-GVALSSSRSEGIDPAAQAAAEFLSNRALQKGSKDNITVIVVD  537

Query  422  LKAQRKFKKK  393
            LKAQRKFK K
Sbjct  538  LKAQRKFKTK  547



>gb|AEK05586.1| abscisic acid insensitivity 1B [Populus balsamifera]
Length=548

 Score =   298 bits (763),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 147/190 (77%), Positives = 170/190 (89%), Gaps = 1/190 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVAI+C ++IIVANCGDSRAVLCRGK PM LSVDHKPNREDEY+RIEA GGK
Sbjct  359  PETVGSTAVVAIICSSHIIVANCGDSRAVLCRGKEPMALSVDHKPNREDEYARIEAXGGK  418

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+GHRV GVLA+SRSIGDRYL+P++IP PE+MF+PRAKEDECL+LASDGLWDVM+NE
Sbjct  419  VIQWNGHRVFGVLAMSRSIGDRYLKPWIIPEPEVMFIPRAKEDECLILASDGLWDVMSNE  478

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            E CD+AR+R+L+WHKKN G  LS  RS+  DPAAQ AAE+L+  ALQ+GS+DNI+VIVVD
Sbjct  479  EACDLARKRILVWHKKN-GVALSSSRSEGIDPAAQAAAEFLSNRALQKGSKDNITVIVVD  537

Query  422  LKAQRKFKKK  393
            LKAQRKFK K
Sbjct  538  LKAQRKFKTK  547



>gb|EEC70963.1| hypothetical protein OsI_02579 [Oryza sativa Indica Group]
 gb|EEE54872.1| hypothetical protein OsJ_02363 [Oryza sativa Japonica Group]
Length=352

 Score =   291 bits (746),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 146/192 (76%), Positives = 169/192 (88%), Gaps = 1/192 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVA++C ++IIVANCGDSRAVLCRGK P+PLSVDHKPNREDEY+RIEA GGK
Sbjct  161  PETVGSTAVVAVICSSHIIVANCGDSRAVLCRGKQPVPLSVDHKPNREDEYARIEAEGGK  220

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+G+RV GVLA+SRSIGDRYL+P++IPVPEI  VPRAK+DECLVLASDGLWDVM+NE
Sbjct  221  VIQWNGYRVFGVLAMSRSIGDRYLKPWIIPVPEITIVPRAKDDECLVLASDGLWDVMSNE  280

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdp-aaqdaAEYLTRIALQRGSRDNISVIVV  426
            EVCDVAR+R+LLWHKKNG    S  RS D    AA+ AAE L+++ALQ+GS+DNISVIVV
Sbjct  281  EVCDVARKRILLWHKKNGTNPASAPRSGDSSDPAAEAAAECLSKLALQKGSKDNISVIVV  340

Query  425  DLKAQRKFKKKA  390
            DLKA RKFK K+
Sbjct  341  DLKAHRKFKSKS  352



>emb|CAM84275.1| abscisic insensitive 1B [Populus tremula]
Length=538

 Score =   297 bits (761),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 146/190 (77%), Positives = 170/190 (89%), Gaps = 1/190 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVAI+C ++IIVANCGDSRAVLCRGK PM LSVDHKPNREDEY+RIEA GGK
Sbjct  349  PETVGSTAVVAIICSSHIIVANCGDSRAVLCRGKEPMALSVDHKPNREDEYARIEAAGGK  408

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+GHRV GVLA+SRSIGDRYL+P++IP PE+MF+PRA+EDECL+LASDGLWDVM+NE
Sbjct  409  VIQWNGHRVFGVLAMSRSIGDRYLKPWIIPEPEVMFIPRAREDECLILASDGLWDVMSNE  468

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            E CD+AR+R+L+WHKKN G  LS  RS+  DPAAQ AAE+L+  ALQ+GS+DNI+VIVVD
Sbjct  469  EACDLARKRILVWHKKN-GVALSSSRSEGIDPAAQAAAEFLSNRALQKGSKDNITVIVVD  527

Query  422  LKAQRKFKKK  393
            LKAQRKFK K
Sbjct  528  LKAQRKFKTK  537



>emb|CAM84299.1| abscisic insensitive 1B [Populus tremula]
Length=538

 Score =   297 bits (761),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 146/190 (77%), Positives = 170/190 (89%), Gaps = 1/190 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVAI+C ++IIVANCGDSRAVLCRGK PM LSVDHKPNREDEY+RIEA GGK
Sbjct  349  PETVGSTAVVAIICSSHIIVANCGDSRAVLCRGKEPMALSVDHKPNREDEYARIEAAGGK  408

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+GHRV GVLA+SRSIGDRYL+P++IP PE+MF+PRA+EDECL+LASDGLWDVM+NE
Sbjct  409  VIQWNGHRVFGVLAMSRSIGDRYLKPWIIPEPEVMFIPRAREDECLILASDGLWDVMSNE  468

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            E CD+AR+R+L+WHKKN G  LS  RS+  DPAAQ AAE+L+  ALQ+GS+DNI+VIVVD
Sbjct  469  EACDLARKRILVWHKKN-GVALSSSRSEGIDPAAQAAAEFLSNRALQKGSKDNITVIVVD  527

Query  422  LKAQRKFKKK  393
            LKAQRKFK K
Sbjct  528  LKAQRKFKTK  537



>ref|XP_007215029.1| hypothetical protein PRUPE_ppa004252mg [Prunus persica]
 gb|EMJ16228.1| hypothetical protein PRUPE_ppa004252mg [Prunus persica]
Length=520

 Score =   296 bits (759),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 148/191 (77%), Positives = 171/191 (90%), Gaps = 1/191 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVA++C ++IIVANCGDSRAVLCRGK  + LSVDHKPNREDEY+RIEA GGK
Sbjct  331  PETVGSTAVVALVCSSHIIVANCGDSRAVLCRGKQAIALSVDHKPNREDEYARIEAAGGK  390

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+GHRV GVLA+SRSIGDRYL+P++IP PE+M VPRA++DECL+LASDGLWDVMTNE
Sbjct  391  VIQWNGHRVFGVLAMSRSIGDRYLKPWIIPEPEVMNVPRARDDECLILASDGLWDVMTNE  450

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            EVC+VARRR+LLWHKKNG T L+ ER    DPAAQ+AA YL+ +ALQ+GSRDNISVIVVD
Sbjct  451  EVCEVARRRILLWHKKNGVTALA-ERGAGVDPAAQEAAAYLSTLALQKGSRDNISVIVVD  509

Query  422  LKAQRKFKKKA  390
            LKAQRKFK K+
Sbjct  510  LKAQRKFKSKS  520



>emb|CAM84257.1| abscisic insensitive 1B [Populus tremula]
Length=538

 Score =   297 bits (761),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 146/190 (77%), Positives = 170/190 (89%), Gaps = 1/190 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVAI+C ++IIVANCGDSRAVLCRGK PM LSVDHKPNREDEY+RIEA GGK
Sbjct  349  PETVGSTAVVAIICSSHIIVANCGDSRAVLCRGKEPMALSVDHKPNREDEYARIEAAGGK  408

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+GHRV GVLA+SRSIGDRYL+P++IP PE+MF+PRA+EDECL+LASDGLWDVM+NE
Sbjct  409  VIQWNGHRVFGVLAMSRSIGDRYLKPWIIPEPEVMFIPRAREDECLILASDGLWDVMSNE  468

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            E CD+AR+R+L+WHKKN G  LS  RS+  DPAAQ AAE+L+  ALQ+GS+DNI+VIVVD
Sbjct  469  EACDLARKRILVWHKKN-GVALSSSRSEGIDPAAQAAAEFLSNRALQKGSKDNITVIVVD  527

Query  422  LKAQRKFKKK  393
            LKAQRKFK K
Sbjct  528  LKAQRKFKTK  537



>emb|CAM84282.1| abscisic insensitive 1B [Populus tremula]
Length=538

 Score =   297 bits (760),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 146/190 (77%), Positives = 170/190 (89%), Gaps = 1/190 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVAI+C ++IIVANCGDSRAVLCRGK PM LSVDHKPNREDEY+RIEA GGK
Sbjct  349  PETVGSTAVVAIICSSHIIVANCGDSRAVLCRGKEPMALSVDHKPNREDEYARIEAAGGK  408

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+GHRV GVLA+SRSIGDRYL+P++IP PE+MF+PRA+EDECL+LASDGLWDVM+NE
Sbjct  409  VIQWNGHRVFGVLAMSRSIGDRYLKPWIIPEPEVMFIPRAREDECLILASDGLWDVMSNE  468

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            E CD+AR+R+L+WHKKN G  LS  RS+  DPAAQ AAE+L+  ALQ+GS+DNI+VIVVD
Sbjct  469  EACDLARKRILVWHKKN-GVALSSSRSEGIDPAAQAAAEFLSNRALQKGSKDNITVIVVD  527

Query  422  LKAQRKFKKK  393
            LKAQRKFK K
Sbjct  528  LKAQRKFKTK  537



>emb|CAM84291.1| abscisic insensitive 1B [Populus tremula]
 emb|CAM84292.1| abscisic insensitive 1B [Populus tremula]
 emb|CAM84295.1| abscisic insensitive 1B [Populus tremula]
Length=538

 Score =   297 bits (760),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 146/190 (77%), Positives = 170/190 (89%), Gaps = 1/190 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVAI+C ++IIVANCGDSRAVLCRGK PM LSVDHKPNREDEY+RIEA GGK
Sbjct  349  PETVGSTAVVAIICSSHIIVANCGDSRAVLCRGKEPMALSVDHKPNREDEYARIEAAGGK  408

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+GHRV GVLA+SRSIGDRYL+P++IP PE+MF+PRA+EDECL+LASDGLWDVM+NE
Sbjct  409  VIQWNGHRVFGVLAMSRSIGDRYLKPWIIPEPEVMFIPRAREDECLILASDGLWDVMSNE  468

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            E CD+AR+R+L+WHKKN G  LS  RS+  DPAAQ AAE+L+  ALQ+GS+DNI+VIVVD
Sbjct  469  EACDLARKRILVWHKKN-GVALSSSRSEGIDPAAQAAAEFLSNRALQKGSKDNITVIVVD  527

Query  422  LKAQRKFKKK  393
            LKAQRKFK K
Sbjct  528  LKAQRKFKTK  537



>emb|CAM84287.1| abscisic insensitive 1B [Populus tremula]
 emb|CAM84288.1| abscisic insensitive 1B [Populus tremula]
 emb|CAM84290.1| abscisic insensitive 1B [Populus tremula]
 emb|CAM84296.1| abscisic insensitive 1B [Populus tremula]
 emb|CAM84298.1| abscisic insensitive 1B [Populus tremula]
Length=538

 Score =   297 bits (760),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 146/190 (77%), Positives = 170/190 (89%), Gaps = 1/190 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVAI+C ++IIVANCGDSRAVLCRGK PM LSVDHKPNREDEY+RIEA GGK
Sbjct  349  PETVGSTAVVAIICSSHIIVANCGDSRAVLCRGKEPMALSVDHKPNREDEYARIEAAGGK  408

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+GHRV GVLA+SRSIGDRYL+P++IP PE+MF+PRA+EDECL+LASDGLWDVM+NE
Sbjct  409  VIQWNGHRVFGVLAMSRSIGDRYLKPWIIPEPEVMFIPRAREDECLILASDGLWDVMSNE  468

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            E CD+AR+R+L+WHKKN G  LS  RS+  DPAAQ AAE+L+  ALQ+GS+DNI+VIVVD
Sbjct  469  EACDLARKRILVWHKKN-GVALSSSRSEGIDPAAQAAAEFLSNRALQKGSKDNITVIVVD  527

Query  422  LKAQRKFKKK  393
            LKAQRKFK K
Sbjct  528  LKAQRKFKTK  537



>emb|CAM84260.1| abscisic insensitive 1B [Populus tremula]
Length=538

 Score =   297 bits (760),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 146/190 (77%), Positives = 170/190 (89%), Gaps = 1/190 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVAI+C ++IIVANCGDSRAVLCRGK PM LSVDHKPNREDEY+RIEA GGK
Sbjct  349  PETVGSTAVVAIICSSHIIVANCGDSRAVLCRGKEPMALSVDHKPNREDEYARIEAAGGK  408

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+GHRV GVLA+SRSIGDRYL+P++IP PE+MF+PRA+EDECL+LASDGLWDVM+NE
Sbjct  409  VIQWNGHRVFGVLAMSRSIGDRYLKPWIIPEPEVMFIPRAREDECLILASDGLWDVMSNE  468

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            E CD+AR+R+L+WHKKN G  LS  RS+  DPAAQ AAE+L+  ALQ+GS+DNI+VIVVD
Sbjct  469  EACDLARKRILVWHKKN-GVALSSSRSEGIDPAAQAAAEFLSNRALQKGSKDNITVIVVD  527

Query  422  LKAQRKFKKK  393
            LKAQRKFK K
Sbjct  528  LKAQRKFKTK  537



>emb|CAM84269.1| abscisic insensitive 1B [Populus tremula]
 emb|CAM84274.1| abscisic insensitive 1B [Populus tremula]
Length=538

 Score =   297 bits (760),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 146/190 (77%), Positives = 170/190 (89%), Gaps = 1/190 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVAI+C ++IIVANCGDSRAVLCRGK PM LSVDHKPNREDEY+RIEA GGK
Sbjct  349  PETVGSTAVVAIICSSHIIVANCGDSRAVLCRGKEPMALSVDHKPNREDEYARIEAAGGK  408

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+GHRV GVLA+SRSIGDRYL+P++IP PE+MF+PRA+EDECL+LASDGLWDVM+NE
Sbjct  409  VIQWNGHRVFGVLAMSRSIGDRYLKPWIIPEPEVMFIPRAREDECLILASDGLWDVMSNE  468

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            E CD+AR+R+L+WHKKN G  LS  RS+  DPAAQ AAE+L+  ALQ+GS+DNI+VIVVD
Sbjct  469  EACDLARKRILVWHKKN-GVALSSSRSEGIDPAAQAAAEFLSNRALQKGSKDNITVIVVD  527

Query  422  LKAQRKFKKK  393
            LKAQRKFK K
Sbjct  528  LKAQRKFKTK  537



>emb|CAM84265.1| abscisic insensitive 1B [Populus tremula]
Length=538

 Score =   297 bits (760),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 146/190 (77%), Positives = 170/190 (89%), Gaps = 1/190 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVAI+C ++IIVANCGDSRAVLCRGK PM LSVDHKPNREDEY+RIEA GGK
Sbjct  349  PETVGSTAVVAIICSSHIIVANCGDSRAVLCRGKEPMALSVDHKPNREDEYARIEAAGGK  408

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+GHRV GVLA+SRSIGDRYL+P++IP PE+MF+PRA+EDECL+LASDGLWDVM+NE
Sbjct  409  VIQWNGHRVFGVLAMSRSIGDRYLKPWIIPEPEVMFIPRAREDECLILASDGLWDVMSNE  468

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            E CD+AR+R+L+WHKKN G  LS  RS+  DPAAQ AAE+L+  ALQ+GS+DNI+VIVVD
Sbjct  469  EACDLARKRILVWHKKN-GVALSSSRSEGIDPAAQAAAEFLSNRALQKGSKDNITVIVVD  527

Query  422  LKAQRKFKKK  393
            LKAQRKFK K
Sbjct  528  LKAQRKFKTK  537



>emb|CAM84273.1| abscisic insensitive 1B [Populus tremula]
Length=538

 Score =   297 bits (760),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 146/190 (77%), Positives = 170/190 (89%), Gaps = 1/190 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVAI+C ++IIVANCGDSRAVLCRGK PM LSVDHKPNREDEY+RIEA GGK
Sbjct  349  PETVGSTAVVAIICSSHIIVANCGDSRAVLCRGKEPMALSVDHKPNREDEYARIEAAGGK  408

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+GHRV GVLA+SRSIGDRYL+P++IP PE+MF+PRA+EDECL+LASDGLWDVM+NE
Sbjct  409  VIQWNGHRVFGVLAMSRSIGDRYLKPWIIPEPEVMFIPRAREDECLILASDGLWDVMSNE  468

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            E CD+AR+R+L+WHKKN G  LS  RS+  DPAAQ AAE+L+  ALQ+GS+DNI+VIVVD
Sbjct  469  EACDLARKRILVWHKKN-GVALSSSRSEGIDPAAQAAAEFLSNRALQKGSKDNITVIVVD  527

Query  422  LKAQRKFKKK  393
            LKAQRKFK K
Sbjct  528  LKAQRKFKTK  537



>emb|CAM84271.1| abscisic insensitive 1B [Populus tremula]
Length=538

 Score =   297 bits (760),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 146/190 (77%), Positives = 170/190 (89%), Gaps = 1/190 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVAI+C ++IIVANCGDSRAVLCRGK PM LSVDHKPNREDEY+RIEA GGK
Sbjct  349  PETVGSTAVVAIICSSHIIVANCGDSRAVLCRGKEPMALSVDHKPNREDEYARIEAAGGK  408

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+GHRV GVLA+SRSIGDRYL+P++IP PE+MF+PRA+EDECL+LASDGLWDVM+NE
Sbjct  409  VIQWNGHRVFGVLAMSRSIGDRYLKPWIIPEPEVMFIPRAREDECLILASDGLWDVMSNE  468

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            E CD+AR+R+L+WHKKN G  LS  RS+  DPAAQ AAE+L+  ALQ+GS+DNI+VIVVD
Sbjct  469  EACDLARKRILVWHKKN-GVALSSSRSEGIDPAAQAAAEFLSNRALQKGSKDNITVIVVD  527

Query  422  LKAQRKFKKK  393
            LKAQRKFK K
Sbjct  528  LKAQRKFKTK  537



>emb|CAM84286.1| abscisic insensitive 1B [Populus tremula]
Length=538

 Score =   297 bits (760),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 146/190 (77%), Positives = 170/190 (89%), Gaps = 1/190 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVAI+C ++IIVANCGDSRAVLCRGK PM LSVDHKPNREDEY+RIEA GGK
Sbjct  349  PETVGSTAVVAIICSSHIIVANCGDSRAVLCRGKEPMALSVDHKPNREDEYARIEAAGGK  408

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+GHRV GVLA+SRSIGDRYL+P++IP PE+MF+PRA+EDECL+LASDGLWDVM+NE
Sbjct  409  VIQWNGHRVFGVLAMSRSIGDRYLKPWIIPEPEVMFIPRAREDECLILASDGLWDVMSNE  468

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            E CD+AR+R+L+WHKKN G  LS  RS+  DPAAQ AAE+L+  ALQ+GS+DNI+VIVVD
Sbjct  469  EACDLARKRILVWHKKN-GVALSSSRSEGIDPAAQAAAEFLSNRALQKGSKDNITVIVVD  527

Query  422  LKAQRKFKKK  393
            LKAQRKFK K
Sbjct  528  LKAQRKFKTK  537



>emb|CAM84268.1| abscisic insensitive 1B [Populus tremula]
Length=538

 Score =   297 bits (760),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 146/190 (77%), Positives = 170/190 (89%), Gaps = 1/190 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVAI+C ++IIVANCGDSRAVLCRGK PM LSVDHKPNREDEY+RIEA GGK
Sbjct  349  PETVGSTAVVAIICSSHIIVANCGDSRAVLCRGKEPMALSVDHKPNREDEYARIEAAGGK  408

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+GHRV GVLA+SRSIGDRYL+P++IP PE+MF+PRA+EDECL+LASDGLWDVM+NE
Sbjct  409  VIQWNGHRVFGVLAMSRSIGDRYLKPWIIPEPEVMFIPRAREDECLILASDGLWDVMSNE  468

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            E CD+AR+R+L+WHKKN G  LS  RS+  DPAAQ AAE+L+  ALQ+GS+DNI+VIVVD
Sbjct  469  EACDLARKRILVWHKKN-GVALSSSRSEGIDPAAQAAAEFLSNRALQKGSKDNITVIVVD  527

Query  422  LKAQRKFKKK  393
            LKAQRKFK K
Sbjct  528  LKAQRKFKTK  537



>emb|CAM84258.1| abscisic insensitive 1B [Populus tremula]
 emb|CAM84259.1| abscisic insensitive 1B [Populus tremula]
 emb|CAM84264.1| abscisic insensitive 1B [Populus tremula]
 emb|CAM84270.1| abscisic insensitive 1B [Populus tremula]
 emb|CAM84272.1| abscisic insensitive 1B [Populus tremula]
 emb|CAM84276.1| abscisic insensitive 1B [Populus tremula]
 emb|CAM84277.1| abscisic insensitive 1B [Populus tremula]
 emb|CAM84278.1| abscisic insensitive 1B [Populus tremula]
 emb|CAM84279.1| abscisic insensitive 1B [Populus tremula]
 emb|CAM84283.1| abscisic insensitive 1B [Populus tremula]
 emb|CAM84284.1| abscisic insensitive 1B [Populus tremula]
 emb|CAM84285.1| abscisic insensitive 1B [Populus tremula]
Length=538

 Score =   297 bits (760),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 146/190 (77%), Positives = 170/190 (89%), Gaps = 1/190 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVAI+C ++IIVANCGDSRAVLCRGK PM LSVDHKPNREDEY+RIEA GGK
Sbjct  349  PETVGSTAVVAIICSSHIIVANCGDSRAVLCRGKEPMALSVDHKPNREDEYARIEAAGGK  408

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+GHRV GVLA+SRSIGDRYL+P++IP PE+MF+PRA+EDECL+LASDGLWDVM+NE
Sbjct  409  VIQWNGHRVFGVLAMSRSIGDRYLKPWIIPEPEVMFIPRAREDECLILASDGLWDVMSNE  468

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            E CD+AR+R+L+WHKKN G  LS  RS+  DPAAQ AAE+L+  ALQ+GS+DNI+VIVVD
Sbjct  469  EACDLARKRILVWHKKN-GVALSSSRSEGIDPAAQAAAEFLSNRALQKGSKDNITVIVVD  527

Query  422  LKAQRKFKKK  393
            LKAQRKFK K
Sbjct  528  LKAQRKFKTK  537



>emb|CAM84256.1| abscisic insensitive 1B [Populus tremula]
 emb|CAM84262.1| abscisic insensitive 1B [Populus tremula]
 emb|CAM84266.1| abscisic insensitive 1B [Populus tremula]
 emb|CAM84267.1| abscisic insensitive 1B [Populus tremula]
Length=538

 Score =   297 bits (760),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 146/190 (77%), Positives = 170/190 (89%), Gaps = 1/190 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVAI+C ++IIVANCGDSRAVLCRGK PM LSVDHKPNREDEY+RIEA GGK
Sbjct  349  PETVGSTAVVAIICSSHIIVANCGDSRAVLCRGKEPMALSVDHKPNREDEYARIEAAGGK  408

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+GHRV GVLA+SRSIGDRYL+P++IP PE+MF+PRA+EDECL+LASDGLWDVM+NE
Sbjct  409  VIQWNGHRVFGVLAMSRSIGDRYLKPWIIPEPEVMFIPRAREDECLILASDGLWDVMSNE  468

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            E CD+AR+R+L+WHKKN G  LS  RS+  DPAAQ AAE+L+  ALQ+GS+DNI+VIVVD
Sbjct  469  EACDLARKRILVWHKKN-GVALSSSRSEGIDPAAQAAAEFLSNRALQKGSKDNITVIVVD  527

Query  422  LKAQRKFKKK  393
            LKAQRKFK K
Sbjct  528  LKAQRKFKTK  537



>emb|CAM84289.1| abscisic insensitive 1B [Populus tremula]
 emb|CAM84293.1| abscisic insensitive 1B [Populus tremula]
 emb|CAM84294.1| abscisic insensitive 1B [Populus tremula]
 emb|CAM84297.1| abscisic insensitive 1B [Populus tremula]
Length=538

 Score =   297 bits (760),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 146/190 (77%), Positives = 170/190 (89%), Gaps = 1/190 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVAI+C ++IIVANCGDSRAVLCRGK PM LSVDHKPNREDEY+RIEA GGK
Sbjct  349  PETVGSTAVVAIICSSHIIVANCGDSRAVLCRGKEPMALSVDHKPNREDEYARIEAAGGK  408

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+GHRV GVLA+SRSIGDRYL+P++IP PE+MF+PRA+EDECL+LASDGLWDVM+NE
Sbjct  409  VIQWNGHRVFGVLAMSRSIGDRYLKPWIIPEPEVMFIPRAREDECLILASDGLWDVMSNE  468

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            E CD+AR+R+L+WHKKN G  LS  RS+  DPAAQ AAE+L+  ALQ+GS+DNI+VIVVD
Sbjct  469  EACDLARKRILVWHKKN-GVALSSSRSEGIDPAAQAAAEFLSNRALQKGSKDNITVIVVD  527

Query  422  LKAQRKFKKK  393
            LKAQRKFK K
Sbjct  528  LKAQRKFKTK  537



>ref|XP_004144202.1| PREDICTED: probable protein phosphatase 2C 53 [Cucumis sativus]
 ref|XP_011657377.1| PREDICTED: probable protein phosphatase 2C 53 [Cucumis sativus]
 ref|XP_011657378.1| PREDICTED: probable protein phosphatase 2C 53 [Cucumis sativus]
 ref|XP_011657379.1| PREDICTED: probable protein phosphatase 2C 53 [Cucumis sativus]
 gb|KGN47603.1| hypothetical protein Csa_6G363590 [Cucumis sativus]
Length=553

 Score =   297 bits (761),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 149/191 (78%), Positives = 167/191 (87%), Gaps = 1/191 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVAI+C ++IIVANCGDSRAVLCRGK PM LSVDHKPNR DEY RIEA GGK
Sbjct  364  PETVGSTAVVAIICASHIIVANCGDSRAVLCRGKEPMALSVDHKPNRADEYERIEAAGGK  423

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+GHRV GVLA+SRSIGDRYL+P++IP PE+MFVPRAK+DECLVLASDGLWDVMTNE
Sbjct  424  VIQWNGHRVFGVLAMSRSIGDRYLKPWIIPEPEVMFVPRAKDDECLVLASDGLWDVMTNE  483

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            EVCD+ARRR+LLWHKKN G  L  ER    DPAAQ AAEYL+  ALQ+GS+DNI+VIV+D
Sbjct  484  EVCDLARRRILLWHKKN-GVSLPSERGLGIDPAAQAAAEYLSNRALQKGSKDNITVIVID  542

Query  422  LKAQRKFKKKA  390
            LK QRKFK K+
Sbjct  543  LKTQRKFKTKS  553



>ref|XP_008377706.1| PREDICTED: protein phosphatase 2C 77-like [Malus domestica]
 ref|XP_008377707.1| PREDICTED: protein phosphatase 2C 77-like [Malus domestica]
 ref|XP_008377708.1| PREDICTED: protein phosphatase 2C 77-like [Malus domestica]
 ref|XP_008377709.1| PREDICTED: protein phosphatase 2C 77-like [Malus domestica]
 ref|XP_008377710.1| PREDICTED: protein phosphatase 2C 77-like [Malus domestica]
Length=552

 Score =   297 bits (760),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 145/190 (76%), Positives = 169/190 (89%), Gaps = 0/190 (0%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVA++C ++IIVANCGDSRAVLCRGK PM LSVDHKP REDEY+RIEA GGK
Sbjct  362  PETVGSTAVVALICSSHIIVANCGDSRAVLCRGKEPMALSVDHKPXREDEYARIEAAGGK  421

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+GHRV GVLA+SRSIGDRYL+P++IP PE+MF+PR K+DECL+LASDGLWDVM+NE
Sbjct  422  VIQWNGHRVFGVLAMSRSIGDRYLKPWIIPEPEVMFIPRTKDDECLILASDGLWDVMSNE  481

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            EVCD+ARRR+LLWHKKNG   L +ER +  DPAAQ AAE+L+  ALQ+GS+DNI+VIVVD
Sbjct  482  EVCDLARRRILLWHKKNGADGLPQERGEGIDPAAQAAAEFLSNRALQKGSKDNITVIVVD  541

Query  422  LKAQRKFKKK  393
            LKAQRKFK K
Sbjct  542  LKAQRKFKSK  551



>ref|XP_008447624.1| PREDICTED: protein phosphatase 2C 16 isoform X1 [Cucumis melo]
 ref|XP_008447625.1| PREDICTED: protein phosphatase 2C 16 isoform X1 [Cucumis melo]
 gb|ADN33732.1| protein phosphatase 2c [Cucumis melo subsp. melo]
Length=536

 Score =   296 bits (759),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 146/191 (76%), Positives = 172/191 (90%), Gaps = 1/191 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVA++C ++IIVANCGDSRAVLCRGK PM LSVDHKPNR DEY+RIE+ GGK
Sbjct  347  PETVGSTAVVALVCSSHIIVANCGDSRAVLCRGKEPMALSVDHKPNRADEYARIESSGGK  406

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+GHRV GVLA+SRSIGDRYL+P++IP PE+MF+PRAKEDECL+LASDGLWDVMTNE
Sbjct  407  VIQWNGHRVFGVLAMSRSIGDRYLKPWIIPDPEVMFIPRAKEDECLILASDGLWDVMTNE  466

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            EVC+VARRR+LLWHKK+G + L+ +R    DPAAQ AA+YL+ +ALQ+GS+DNISVIVVD
Sbjct  467  EVCEVARRRILLWHKKHGASSLA-DRGTGVDPAAQAAADYLSMLALQKGSKDNISVIVVD  525

Query  422  LKAQRKFKKKA  390
            LKAQRKFK K+
Sbjct  526  LKAQRKFKTKS  536



>ref|XP_008447626.1| PREDICTED: protein phosphatase 2C 16 isoform X2 [Cucumis melo]
Length=493

 Score =   295 bits (755),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 146/191 (76%), Positives = 172/191 (90%), Gaps = 1/191 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVA++C ++IIVANCGDSRAVLCRGK PM LSVDHKPNR DEY+RIE+ GGK
Sbjct  304  PETVGSTAVVALVCSSHIIVANCGDSRAVLCRGKEPMALSVDHKPNRADEYARIESSGGK  363

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+GHRV GVLA+SRSIGDRYL+P++IP PE+MF+PRAKEDECL+LASDGLWDVMTNE
Sbjct  364  VIQWNGHRVFGVLAMSRSIGDRYLKPWIIPDPEVMFIPRAKEDECLILASDGLWDVMTNE  423

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            EVC+VARRR+LLWHKK+G + L+ +R    DPAAQ AA+YL+ +ALQ+GS+DNISVIVVD
Sbjct  424  EVCEVARRRILLWHKKHGASSLA-DRGTGVDPAAQAAADYLSMLALQKGSKDNISVIVVD  482

Query  422  LKAQRKFKKKA  390
            LKAQRKFK K+
Sbjct  483  LKAQRKFKTKS  493



>ref|XP_008220516.1| PREDICTED: probable protein phosphatase 2C 6 [Prunus mume]
 ref|XP_008220517.1| PREDICTED: probable protein phosphatase 2C 6 [Prunus mume]
 ref|XP_008220518.1| PREDICTED: probable protein phosphatase 2C 6 [Prunus mume]
 ref|XP_008220519.1| PREDICTED: probable protein phosphatase 2C 6 [Prunus mume]
 ref|XP_008220521.1| PREDICTED: probable protein phosphatase 2C 6 [Prunus mume]
Length=551

 Score =   296 bits (759),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 146/191 (76%), Positives = 169/191 (88%), Gaps = 0/191 (0%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVA++C ++I+VANCGDSRAVLCRGK PM LSVDHKPNREDEY+RIEA GGK
Sbjct  361  PETVGSTAVVALICSSHIVVANCGDSRAVLCRGKEPMALSVDHKPNREDEYARIEAAGGK  420

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+GHRV GVLA+SRSIGDRYL+P++IP PE+MF+PR K+DECL+LASDGLWDVM+NE
Sbjct  421  VIQWNGHRVFGVLAMSRSIGDRYLKPWIIPEPEVMFIPRTKDDECLILASDGLWDVMSNE  480

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            EVCD+ARRR+LLWHKKNG T L  ER +  DPAAQ AAE L+  ALQ+GS+DNI+VIVVD
Sbjct  481  EVCDLARRRILLWHKKNGVTPLPLERGEGIDPAAQAAAELLSNRALQKGSKDNITVIVVD  540

Query  422  LKAQRKFKKKA  390
            LKAQRKFK K 
Sbjct  541  LKAQRKFKSKT  551



>emb|CAM84263.1| abscisic insensitive 1B [Populus tremula]
Length=538

 Score =   296 bits (758),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 145/190 (76%), Positives = 170/190 (89%), Gaps = 1/190 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVAI+C ++IIVANCGDSRAVLCRGK PM LSVDHKPNREDEY+RIEA GGK
Sbjct  349  PETVGSTAVVAIICSSHIIVANCGDSRAVLCRGKEPMALSVDHKPNREDEYARIEAAGGK  408

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+GHRV GVLA+SRSIGDRYL+P++IP PE+MF+PRA+EDECL+LASDGLWD+M+NE
Sbjct  409  VIQWNGHRVFGVLAMSRSIGDRYLKPWIIPEPEVMFIPRAREDECLILASDGLWDLMSNE  468

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            E CD+AR+R+L+WHKKN G  LS  RS+  DPAAQ AAE+L+  ALQ+GS+DNI+VIVVD
Sbjct  469  EACDLARKRILVWHKKN-GVALSSSRSEGIDPAAQAAAEFLSNRALQKGSKDNITVIVVD  527

Query  422  LKAQRKFKKK  393
            LKAQRKFK K
Sbjct  528  LKAQRKFKTK  537



>ref|XP_009412210.1| PREDICTED: probable protein phosphatase 2C 6 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=540

 Score =   296 bits (757),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 143/191 (75%), Positives = 172/191 (90%), Gaps = 0/191 (0%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVA++CP++II+ANCGDSRAVLCRGK P+PLSVDHKPNREDEY+RIEA GGK
Sbjct  338  PETVGSTAVVAVVCPSHIIIANCGDSRAVLCRGKQPIPLSVDHKPNREDEYARIEAQGGK  397

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+G+RV GVLA+SRSIGDRYL+P++IP PE+  VPRA+EDECL+LASDGLWDVM+NE
Sbjct  398  VIQWNGYRVFGVLAMSRSIGDRYLKPWIIPEPEVTIVPRAREDECLILASDGLWDVMSNE  457

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            EVCDVARRR+LLWHKKNG    + +R +  DPAAQ AAE L+R+A+Q+GS+DNI++IVVD
Sbjct  458  EVCDVARRRILLWHKKNGPVSAATQRGEGTDPAAQAAAECLSRLAVQKGSKDNITIIVVD  517

Query  422  LKAQRKFKKKA  390
            LKAQRKFK K+
Sbjct  518  LKAQRKFKSKS  528



>ref|XP_009412209.1| PREDICTED: probable protein phosphatase 2C 6 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=541

 Score =   296 bits (757),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 143/191 (75%), Positives = 172/191 (90%), Gaps = 0/191 (0%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVA++CP++II+ANCGDSRAVLCRGK P+PLSVDHKPNREDEY+RIEA GGK
Sbjct  338  PETVGSTAVVAVVCPSHIIIANCGDSRAVLCRGKQPIPLSVDHKPNREDEYARIEAQGGK  397

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+G+RV GVLA+SRSIGDRYL+P++IP PE+  VPRA+EDECL+LASDGLWDVM+NE
Sbjct  398  VIQWNGYRVFGVLAMSRSIGDRYLKPWIIPEPEVTIVPRAREDECLILASDGLWDVMSNE  457

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            EVCDVARRR+LLWHKKNG    + +R +  DPAAQ AAE L+R+A+Q+GS+DNI++IVVD
Sbjct  458  EVCDVARRRILLWHKKNGPVSAATQRGEGTDPAAQAAAECLSRLAVQKGSKDNITIIVVD  517

Query  422  LKAQRKFKKKA  390
            LKAQRKFK K+
Sbjct  518  LKAQRKFKSKS  528



>emb|CAM84261.1| abscisic insensitive 1B [Populus tremula]
Length=538

 Score =   296 bits (757),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 145/190 (76%), Positives = 170/190 (89%), Gaps = 1/190 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVAI+C ++IIVANCGDSRAVLCRGK PM LSVDHKPNREDEY+RIEA GGK
Sbjct  349  PETVGSTAVVAIICSSHIIVANCGDSRAVLCRGKEPMALSVDHKPNREDEYARIEAAGGK  408

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+GHRV GVLA+SRSIGDRYL+P++IP PE+MF+PRA+EDECL+LASDGLWD+M+NE
Sbjct  409  VIQWNGHRVFGVLAMSRSIGDRYLKPWIIPEPEVMFIPRAREDECLILASDGLWDLMSNE  468

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            E CD+AR+R+L+WHKKN G  LS  RS+  DPAAQ AAE+L+  ALQ+GS+DNI+VIVVD
Sbjct  469  EACDLARKRILVWHKKN-GVALSSSRSEGIDPAAQAAAEFLSNRALQKGSKDNITVIVVD  527

Query  422  LKAQRKFKKK  393
            LKAQRKFK K
Sbjct  528  LKAQRKFKTK  537



>ref|XP_011081646.1| PREDICTED: probable protein phosphatase 2C 53 [Sesamum indicum]
 ref|XP_011081647.1| PREDICTED: probable protein phosphatase 2C 53 [Sesamum indicum]
 ref|XP_011081648.1| PREDICTED: probable protein phosphatase 2C 53 [Sesamum indicum]
Length=545

 Score =   296 bits (757),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 148/191 (77%), Positives = 169/191 (88%), Gaps = 1/191 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVV I+C ++IIVANCGDSRAVLCRGK PM LSVDHKPNREDEY+RIEA GGK
Sbjct  356  PETVGSTAVVTIVCSSHIIVANCGDSRAVLCRGKQPMALSVDHKPNREDEYARIEAAGGK  415

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+GHRV GVLA+SRSIGDRYL+P++IP PE+MFVPRAKEDECL+LASDGLWDVMTNE
Sbjct  416  VIQWNGHRVFGVLAMSRSIGDRYLKPWIIPDPEVMFVPRAKEDECLILASDGLWDVMTNE  475

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            EVCD+AR+R+LLWHK NG T+ S ER +  DPAAQ AAEYL+  ALQ+GS+DNISV+VVD
Sbjct  476  EVCDIARKRILLWHKNNGVTLPS-ERGEGIDPAAQAAAEYLSNRALQKGSKDNISVVVVD  534

Query  422  LKAQRKFKKKA  390
            LKAQRK K + 
Sbjct  535  LKAQRKIKSRT  545



>ref|XP_004245071.1| PREDICTED: probable protein phosphatase 2C 6 [Solanum lycopersicum]
Length=526

 Score =   295 bits (755),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 148/191 (77%), Positives = 169/191 (88%), Gaps = 1/191 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVAI+C ++IIVANCGDSRAVLCRGK PM LSVDHKPNREDEY+RIEA GGK
Sbjct  337  PETVGSTAVVAIVCSSHIIVANCGDSRAVLCRGKEPMALSVDHKPNREDEYARIEAAGGK  396

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+GHRV GVLA+SRSIGDRYL+P++IP PE+MF+PR K+DECL+LASDGLWDVMTNE
Sbjct  397  VIQWNGHRVFGVLAMSRSIGDRYLKPWIIPDPEVMFIPRTKDDECLILASDGLWDVMTNE  456

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            EVCD+AR+R+LLWHKKNG T+ S ER    DPAAQ AAE L+  ALQ+GS+DNI+VIVVD
Sbjct  457  EVCDLARKRILLWHKKNGVTLPS-ERGQGIDPAAQAAAECLSNRALQKGSKDNITVIVVD  515

Query  422  LKAQRKFKKKA  390
            LKAQRKFK K 
Sbjct  516  LKAQRKFKSKT  526



>ref|XP_012068927.1| PREDICTED: protein phosphatase 2C 16 [Jatropha curcas]
 ref|XP_012068928.1| PREDICTED: protein phosphatase 2C 16 [Jatropha curcas]
 ref|XP_012068929.1| PREDICTED: protein phosphatase 2C 16 [Jatropha curcas]
 gb|KDP40737.1| hypothetical protein JCGZ_24736 [Jatropha curcas]
Length=539

 Score =   295 bits (756),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 145/191 (76%), Positives = 172/191 (90%), Gaps = 1/191 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVA++C ++IIVANCGDSRAVL RGK  M LS+DHKPNREDEY+RIEA GGK
Sbjct  350  PETVGSTAVVALVCSSHIIVANCGDSRAVLYRGKESMALSIDHKPNREDEYARIEASGGK  409

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+GHRV GVLA+SRSIGDRYL+P++IP PE+MFVPRA+EDECL+LASDGLWDVMTN+
Sbjct  410  VIQWNGHRVFGVLAMSRSIGDRYLKPWIIPEPEVMFVPRAREDECLILASDGLWDVMTND  469

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            EVC+VAR+R+LLWHKKNG T L+ ER +  DPA+Q AA+YL+ +ALQ+GS+DNISVIVVD
Sbjct  470  EVCEVARKRILLWHKKNGFTSLA-ERGNGIDPASQAAADYLSMLALQKGSKDNISVIVVD  528

Query  422  LKAQRKFKKKA  390
            LKAQRKFK K+
Sbjct  529  LKAQRKFKSKS  539



>ref|XP_008351947.1| PREDICTED: probable protein phosphatase 2C 53 [Malus domestica]
Length=552

 Score =   296 bits (757),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 146/190 (77%), Positives = 168/190 (88%), Gaps = 0/190 (0%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVA++C ++IIVANCGDSRAVLCRGK PM LSVDHKP+REDEY+RIEA GGK
Sbjct  362  PETVGSTAVVALICSSHIIVANCGDSRAVLCRGKEPMALSVDHKPDREDEYARIEAAGGK  421

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+GHRV GVLA+SRSIGDRYL+P +IP PE+MF+PR K+DECLVLASDGLWDVM+NE
Sbjct  422  VIQWNGHRVFGVLAMSRSIGDRYLKPCIIPEPEVMFIPRTKDDECLVLASDGLWDVMSNE  481

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            EVCD+ARRR+LLWHKKNG   L  ER +  DPAAQ AAE+L+  ALQ+GS+DNI+VIVVD
Sbjct  482  EVCDLARRRILLWHKKNGADGLPLERGEGIDPAAQAAAEFLSNRALQKGSKDNITVIVVD  541

Query  422  LKAQRKFKKK  393
            LKAQRKFK K
Sbjct  542  LKAQRKFKSK  551



>ref|XP_003603175.1| Abscisic insensitive 1B [Medicago truncatula]
 gb|AES73426.1| protein phosphatase 2C family protein [Medicago truncatula]
Length=549

 Score =   295 bits (756),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 145/191 (76%), Positives = 168/191 (88%), Gaps = 1/191 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVAI+C ++IIV+NCGDSRAVLCRGK PMPLSVDHKPNR+DEY+RIEA GGK
Sbjct  360  PETVGSTAVVAIVCSSHIIVSNCGDSRAVLCRGKEPMPLSVDHKPNRDDEYARIEAAGGK  419

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+GHRV GVLA+SRSIGDRYL+P +IP PE+ F+PRAK+DECL+LASDGLWDVMTNE
Sbjct  420  VIQWNGHRVFGVLAMSRSIGDRYLKPSIIPEPEVTFIPRAKDDECLILASDGLWDVMTNE  479

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            E CD+ARRR+LLWHKKN G+ LS  R +  D AAQ AAEYL+  ALQ+GS+DNI+V+VVD
Sbjct  480  EACDLARRRILLWHKKN-GSKLSLVRGEGIDLAAQAAAEYLSNRALQKGSKDNITVVVVD  538

Query  422  LKAQRKFKKKA  390
            LKAQRKFK K 
Sbjct  539  LKAQRKFKTKT  549



>gb|KHN29698.1| Protein phosphatase 2C 16 [Glycine soja]
Length=544

 Score =   295 bits (755),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 146/191 (76%), Positives = 169/191 (88%), Gaps = 1/191 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGST+VVAI+C ++IIV+NCGDSRAVLCRGK PM LSVDHKPNR+DEY+RIEA GGK
Sbjct  355  PETVGSTSVVAIICSSHIIVSNCGDSRAVLCRGKEPMALSVDHKPNRDDEYARIEATGGK  414

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+GHRV GVLA+SRSIGDRYL+P++IP PE+ F+PRAK+DECL+LASDGLWDVMTNE
Sbjct  415  VIQWNGHRVFGVLAMSRSIGDRYLKPWIIPDPEVTFLPRAKDDECLILASDGLWDVMTNE  474

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            EVCD+ARRR+LLWHKKN G  L  ER +  DPAAQ AAEYL+  ALQ+GS+DNI+VIVVD
Sbjct  475  EVCDIARRRILLWHKKN-GLALPSERGEGIDPAAQAAAEYLSNRALQKGSKDNITVIVVD  533

Query  422  LKAQRKFKKKA  390
            LKAQRKFK K 
Sbjct  534  LKAQRKFKSKT  544



>ref|XP_006578088.1| PREDICTED: protein phosphatase 2C 16-like [Glycine max]
Length=544

 Score =   295 bits (755),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 146/191 (76%), Positives = 169/191 (88%), Gaps = 1/191 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGST+VVAI+C ++IIV+NCGDSRAVLCRGK PM LSVDHKPNR+DEY+RIEA GGK
Sbjct  355  PETVGSTSVVAIICSSHIIVSNCGDSRAVLCRGKEPMALSVDHKPNRDDEYARIEAAGGK  414

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+GHRV GVLA+SRSIGDRYL+P++IP PE+ F+PRAK+DECL+LASDGLWDVMTNE
Sbjct  415  VIQWNGHRVFGVLAMSRSIGDRYLKPWIIPDPEVTFLPRAKDDECLILASDGLWDVMTNE  474

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            EVCD+ARRR+LLWHKKN G  L  ER +  DPAAQ AAEYL+  ALQ+GS+DNI+VIVVD
Sbjct  475  EVCDIARRRILLWHKKN-GLALPSERGEGIDPAAQAAAEYLSNRALQKGSKDNITVIVVD  533

Query  422  LKAQRKFKKKA  390
            LKAQRKFK K 
Sbjct  534  LKAQRKFKSKT  544



>ref|XP_010087703.1| Protein phosphatase 2C 16 [Morus notabilis]
 gb|EXB29691.1| Protein phosphatase 2C 16 [Morus notabilis]
Length=548

 Score =   295 bits (755),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 145/191 (76%), Positives = 170/191 (89%), Gaps = 1/191 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVA++C ++IIVANCGDSRAVLCRGK P+PLSVDHKPNREDEY+RIEA GGK
Sbjct  359  PETVGSTAVVALVCSSHIIVANCGDSRAVLCRGKEPVPLSVDHKPNREDEYARIEASGGK  418

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+GHRV GVLA+SRSIGDRYL+P++IP PE+M +PR +EDECL+LA+DGLWDVMTNE
Sbjct  419  VIQWNGHRVFGVLAMSRSIGDRYLKPWIIPEPEVMVLPRTREDECLILATDGLWDVMTNE  478

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            EVC+VARRR+LLW+KKNG T  S ER    D AAQ AAE+L+ +ALQ+GS+DNISVIVVD
Sbjct  479  EVCEVARRRILLWYKKNGVTA-SAERGLGTDLAAQAAAEHLSMLALQKGSKDNISVIVVD  537

Query  422  LKAQRKFKKKA  390
            LKAQRKFK K+
Sbjct  538  LKAQRKFKSKS  548



>sp|Q0JLP9.1|P2C06_ORYSJ RecName: Full=Probable protein phosphatase 2C 6; Short=OsPP2C06 
[Oryza sativa Japonica Group]
 pdb|4OIC|B Chain B, Crystal Structrual Of A Soluble Protein
Length=467

 Score =   293 bits (749),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 146/192 (76%), Positives = 169/192 (88%), Gaps = 1/192 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVA++C ++IIVANCGDSRAVLCRGK P+PLSVDHKPNREDEY+RIEA GGK
Sbjct  276  PETVGSTAVVAVICSSHIIVANCGDSRAVLCRGKQPVPLSVDHKPNREDEYARIEAEGGK  335

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+G+RV GVLA+SRSIGDRYL+P++IPVPEI  VPRAK+DECLVLASDGLWDVM+NE
Sbjct  336  VIQWNGYRVFGVLAMSRSIGDRYLKPWIIPVPEITIVPRAKDDECLVLASDGLWDVMSNE  395

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdp-aaqdaAEYLTRIALQRGSRDNISVIVV  426
            EVCDVAR+R+LLWHKKNG    S  RS D    AA+ AAE L+++ALQ+GS+DNISVIVV
Sbjct  396  EVCDVARKRILLWHKKNGTNPASAPRSGDSSDPAAEAAAECLSKLALQKGSKDNISVIVV  455

Query  425  DLKAQRKFKKKA  390
            DLKA RKFK K+
Sbjct  456  DLKAHRKFKSKS  467



>ref|XP_011010154.1| PREDICTED: protein phosphatase 2C 16-like [Populus euphratica]
 ref|XP_011010155.1| PREDICTED: protein phosphatase 2C 16-like [Populus euphratica]
Length=546

 Score =   295 bits (754),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 146/191 (76%), Positives = 169/191 (88%), Gaps = 1/191 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVA++C ++IIVANCGDSRAVLCRGK PM LSVDHKPNREDEY+RIEA GGK
Sbjct  357  PETVGSTAVVALVCSSHIIVANCGDSRAVLCRGKEPMALSVDHKPNREDEYARIEASGGK  416

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+GHRV GVLA+SRSIGDRYL+P++IP PE+MF+PRAK+DECL+LASDGLWDV+TNE
Sbjct  417  VIQWNGHRVFGVLAMSRSIGDRYLKPWIIPDPEVMFLPRAKDDECLILASDGLWDVITNE  476

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            E C+VARRR+LLWHKKNG   L  ER    DPAAQ AA+YL+ +ALQ+GS+DNISVIVVD
Sbjct  477  EACEVARRRILLWHKKNGVASL-LERGKVIDPAAQAAADYLSMLALQKGSKDNISVIVVD  535

Query  422  LKAQRKFKKKA  390
            LK QRKFK K+
Sbjct  536  LKGQRKFKSKS  546



>emb|CBI35919.3| unnamed protein product [Vitis vinifera]
Length=506

 Score =   293 bits (750),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 144/190 (76%), Positives = 169/190 (89%), Gaps = 1/190 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVA++C ++II+ANCGDSRAVLCRGK P+ LS+DH+PNREDEY+RIEA GGK
Sbjct  316  PETVGSTAVVALICSSHIIIANCGDSRAVLCRGKEPIALSIDHRPNREDEYARIEASGGK  375

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+GHRV GVLA+SRSIGDRYL+P++IP PE+M VPRA+ED+CL+LASDGLWDVMTNE
Sbjct  376  VIQWNGHRVFGVLAMSRSIGDRYLKPWIIPEPEVMMVPRAREDDCLILASDGLWDVMTNE  435

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            EVC+VARRR+LLWHKKNG   L  ER    DPAAQ AAEYL+ +A+Q+GS+DNISVIVVD
Sbjct  436  EVCEVARRRILLWHKKNGVASLV-ERGKGIDPAAQAAAEYLSMLAIQKGSKDNISVIVVD  494

Query  422  LKAQRKFKKK  393
            LKAQRKFK K
Sbjct  495  LKAQRKFKSK  504



>emb|CAM84280.1| abscisic insensitive 1B [Populus tremula]
Length=538

 Score =   294 bits (752),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 145/190 (76%), Positives = 169/190 (89%), Gaps = 1/190 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVAI+C ++IIVANCGDSRAVLCRGK PM LSVDHKPNREDEY+ IEA GGK
Sbjct  349  PETVGSTAVVAIICSSHIIVANCGDSRAVLCRGKEPMALSVDHKPNREDEYAWIEAAGGK  408

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+GHRV GVLA+SRSIGDRYL+P++IP PE+MF+PRA+EDECL+LASDGLWDVM+NE
Sbjct  409  VIQWNGHRVFGVLAMSRSIGDRYLKPWIIPEPEVMFIPRAREDECLILASDGLWDVMSNE  468

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            E CD+AR+R+L+WHKKN G  LS  RS+  DPAAQ AAE+L+  ALQ+GS+DNI+VIVVD
Sbjct  469  EACDLARKRILVWHKKN-GVALSSSRSEGIDPAAQAAAEFLSNRALQKGSKDNITVIVVD  527

Query  422  LKAQRKFKKK  393
            LKAQRKFK K
Sbjct  528  LKAQRKFKTK  537



>emb|CAM84281.1| abscisic insensitive 1B [Populus tremula]
Length=538

 Score =   294 bits (752),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 145/190 (76%), Positives = 169/190 (89%), Gaps = 1/190 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVAI+C ++IIVANCGDSRAVLCRGK PM LSVDHKPNREDEY+ IEA GGK
Sbjct  349  PETVGSTAVVAIICSSHIIVANCGDSRAVLCRGKEPMALSVDHKPNREDEYAWIEAAGGK  408

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+GHRV GVLA+SRSIGDRYL+P++IP PE+MF+PRA+EDECL+LASDGLWDVM+NE
Sbjct  409  VIQWNGHRVFGVLAMSRSIGDRYLKPWIIPEPEVMFIPRAREDECLILASDGLWDVMSNE  468

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            E CD+AR+R+L+WHKKN G  LS  RS+  DPAAQ AAE+L+  ALQ+GS+DNI+VIVVD
Sbjct  469  EACDLARKRILVWHKKN-GVALSSSRSEGIDPAAQAAAEFLSNRALQKGSKDNITVIVVD  527

Query  422  LKAQRKFKKK  393
            LKAQRKFK K
Sbjct  528  LKAQRKFKTK  537



>ref|XP_010090094.1| Protein phosphatase 2C 16 [Morus notabilis]
 gb|EXB38891.1| Protein phosphatase 2C 16 [Morus notabilis]
Length=524

 Score =   293 bits (751),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 149/191 (78%), Positives = 169/191 (88%), Gaps = 1/191 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVAI+CPT+IIVANCGDSRAVL RGK P+PLSVDHKP+REDEY RIEA GGK
Sbjct  333  PETVGSTAVVAIICPTHIIVANCGDSRAVLFRGKTPVPLSVDHKPDREDEYERIEAAGGK  392

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+G RV GVLA+SRSIGDRYL+P++IP PE+M V RAKEDECL+LASDGLWDVMTNE
Sbjct  393  VIQWNGSRVFGVLAMSRSIGDRYLKPWIIPDPEVMIVSRAKEDECLILASDGLWDVMTNE  452

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            E C++ARRR+LLWHKK G T LS ER    D AAQDAAEYL+R+ALQ+GS+DNI+VIVVD
Sbjct  453  EACEIARRRILLWHKKYGDT-LSAERGKGVDLAAQDAAEYLSRVALQKGSKDNITVIVVD  511

Query  422  LKAQRKFKKKA  390
            LKA RKFK+KA
Sbjct  512  LKAARKFKRKA  522



>emb|CDM82904.1| unnamed protein product [Triticum aestivum]
 emb|CDM82979.1| unnamed protein product [Triticum aestivum]
Length=479

 Score =   292 bits (747),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 145/191 (76%), Positives = 173/191 (91%), Gaps = 1/191 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVA++C ++IIV+NCGDSRAVLCRGK P+PLSVDHKPNREDEY+RIEA GGK
Sbjct  288  PETVGSTAVVAVICSSHIIVSNCGDSRAVLCRGKQPVPLSVDHKPNREDEYARIEAEGGK  347

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+G+RV GVLA+SRSIGDRYL+P++IPVPE+  VPRAK+DECL+LASDGLWDV++NE
Sbjct  348  VIQWNGYRVFGVLAMSRSIGDRYLKPWIIPVPEVTIVPRAKDDECLILASDGLWDVLSNE  407

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddp-dpaaqdaAEYLTRIALQRGSRDNISVIVV  426
            EVCDVAR+R+LLWHKKNG  + S +RS D  DPAAQ AAE L+++ALQ+GS+DNI+VIVV
Sbjct  408  EVCDVARKRILLWHKKNGVNLSSAQRSGDSPDPAAQAAAECLSKLALQKGSKDNITVIVV  467

Query  425  DLKAQRKFKKK  393
            DLKAQRKFK K
Sbjct  468  DLKAQRKFKSK  478



>dbj|BAF62436.1| protein phosphatase 2C [Triticum aestivum]
Length=479

 Score =   292 bits (747),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 145/191 (76%), Positives = 173/191 (91%), Gaps = 1/191 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVA++C ++IIV+NCGDSRAVLCRGK P+PLSVDHKPNREDEY+RIEA GGK
Sbjct  288  PETVGSTAVVAVICSSHIIVSNCGDSRAVLCRGKQPVPLSVDHKPNREDEYARIEAEGGK  347

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+G+RV GVLA+SRSIGDRYL+P++IPVPE+  VPRAK+DECL+LASDGLWDV++NE
Sbjct  348  VIQWNGYRVFGVLAMSRSIGDRYLKPWIIPVPEVTIVPRAKDDECLILASDGLWDVLSNE  407

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddp-dpaaqdaAEYLTRIALQRGSRDNISVIVV  426
            EVCDVAR+R+LLWHKKNG  + S +RS D  DPAAQ AAE L+++ALQ+GS+DNI+VIVV
Sbjct  408  EVCDVARKRILLWHKKNGVNLSSAQRSGDSPDPAAQAAAECLSKLALQKGSKDNITVIVV  467

Query  425  DLKAQRKFKKK  393
            DLKAQRKFK K
Sbjct  468  DLKAQRKFKSK  478



>ref|XP_006474445.1| PREDICTED: protein phosphatase 2C 16-like isoform X1 [Citrus 
sinensis]
 ref|XP_006474446.1| PREDICTED: protein phosphatase 2C 16-like isoform X2 [Citrus 
sinensis]
 ref|XP_006474447.1| PREDICTED: protein phosphatase 2C 16-like isoform X3 [Citrus 
sinensis]
Length=550

 Score =   294 bits (752),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 145/190 (76%), Positives = 169/190 (89%), Gaps = 1/190 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVAI+C ++IIVANCGDSRAVLCRGK  M LSVDHKPNREDEY+RIEA GGK
Sbjct  361  PETVGSTAVVAIICASHIIVANCGDSRAVLCRGKESMALSVDHKPNREDEYARIEAAGGK  420

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+GHRV GVLA+SRSIGDRYL+P++IP PE+MF+PRA+EDECL+LASDGLWDVMTNE
Sbjct  421  VIQWNGHRVFGVLAMSRSIGDRYLKPWIIPEPEVMFLPRAREDECLILASDGLWDVMTNE  480

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            E C++AR+R+LLWHKKNG T L+  R +  +PAAQ AAEYL+  ALQ+GS+DNISV+VVD
Sbjct  481  EACELARKRILLWHKKNGVT-LATGRGEGINPAAQAAAEYLSNRALQKGSKDNISVVVVD  539

Query  422  LKAQRKFKKK  393
            LKAQRKFK K
Sbjct  540  LKAQRKFKSK  549



>dbj|BAF62437.1| protein phosphatase 2C [Triticum monococcum]
Length=479

 Score =   292 bits (747),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 145/191 (76%), Positives = 173/191 (91%), Gaps = 1/191 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVA++C ++IIV+NCGDSRAVLCRGK P+PLSVDHKPNREDEY+RIEA GGK
Sbjct  288  PETVGSTAVVAVICSSHIIVSNCGDSRAVLCRGKQPVPLSVDHKPNREDEYARIEAEGGK  347

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+G+RV GVLA+SRSIGDRYL+P++IPVPE+  VPRAK+DECL+LASDGLWDV++NE
Sbjct  348  VIQWNGYRVFGVLAMSRSIGDRYLKPWIIPVPEVTIVPRAKDDECLILASDGLWDVLSNE  407

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddp-dpaaqdaAEYLTRIALQRGSRDNISVIVV  426
            EVCDVAR+R+LLWHKKNG  + S +RS D  DPAAQ AAE L+++ALQ+GS+DNI+VIVV
Sbjct  408  EVCDVARKRILLWHKKNGVNLSSAQRSGDSPDPAAQAAAECLSKLALQKGSKDNITVIVV  467

Query  425  DLKAQRKFKKK  393
            DLKAQRKFK K
Sbjct  468  DLKAQRKFKSK  478



>gb|KDO73536.1| hypothetical protein CISIN_1g008880mg [Citrus sinensis]
 gb|KDO73537.1| hypothetical protein CISIN_1g008880mg [Citrus sinensis]
 gb|KDO73538.1| hypothetical protein CISIN_1g008880mg [Citrus sinensis]
 gb|KDO73539.1| hypothetical protein CISIN_1g008880mg [Citrus sinensis]
Length=550

 Score =   294 bits (752),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 146/190 (77%), Positives = 169/190 (89%), Gaps = 1/190 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVAI+C ++IIVANCGDSRAVLCRGK  M LSVDHKPNREDEY+RIEA GGK
Sbjct  361  PETVGSTAVVAIICASHIIVANCGDSRAVLCRGKESMALSVDHKPNREDEYARIEAAGGK  420

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+GHRV GVLA+SRSIGDRYL+P++IP PE+MF+PRA+EDECL+LASDGLWDVMTNE
Sbjct  421  VIQWNGHRVFGVLAMSRSIGDRYLKPWIIPEPEVMFLPRAREDECLILASDGLWDVMTNE  480

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            E C++AR+R+LLWHKKNG T L+  R +  DPAAQ AAEYL+  ALQ+GS+DNISV+VVD
Sbjct  481  EACELARKRILLWHKKNGVT-LATGRGEGIDPAAQAAAEYLSNRALQKGSKDNISVVVVD  539

Query  422  LKAQRKFKKK  393
            LKAQRKFK K
Sbjct  540  LKAQRKFKSK  549



>gb|EMT03021.1| Putative protein phosphatase 2C 6 [Aegilops tauschii]
Length=476

 Score =   291 bits (746),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 145/191 (76%), Positives = 173/191 (91%), Gaps = 1/191 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVA++C ++IIV+NCGDSRAVLCRGK P+PLSVDHKPNREDEY+RIEA GGK
Sbjct  285  PETVGSTAVVAVICSSHIIVSNCGDSRAVLCRGKQPVPLSVDHKPNREDEYARIEAEGGK  344

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+G+RV GVLA+SRSIGDRYL+P++IPVPE+  VPRAK+DECL+LASDGLWDV++NE
Sbjct  345  VIQWNGYRVFGVLAMSRSIGDRYLKPWIIPVPEVTIVPRAKDDECLILASDGLWDVLSNE  404

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddp-dpaaqdaAEYLTRIALQRGSRDNISVIVV  426
            EVCDVAR+R+LLWHKKNG  + S +RS D  DPAAQ AAE L+++ALQ+GS+DNI+VIVV
Sbjct  405  EVCDVARKRILLWHKKNGVNLSSAQRSGDSPDPAAQAAAECLSKLALQKGSKDNITVIVV  464

Query  425  DLKAQRKFKKK  393
            DLKAQRKFK K
Sbjct  465  DLKAQRKFKSK  475



>ref|XP_009362332.1| PREDICTED: probable protein phosphatase 2C 50 [Pyrus x bretschneideri]
 ref|XP_009362340.1| PREDICTED: probable protein phosphatase 2C 50 [Pyrus x bretschneideri]
Length=552

 Score =   294 bits (752),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 145/190 (76%), Positives = 167/190 (88%), Gaps = 0/190 (0%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVA++C ++IIVANCGDSRAVLCRGK PM LSVDHKPNREDEY+RIEA GGK
Sbjct  362  PETVGSTAVVALICSSHIIVANCGDSRAVLCRGKEPMALSVDHKPNREDEYARIEAAGGK  421

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+GHRV GVLA+SRSIGDRYL+P +IP PE+MF+PR K+DECL+LASDGLWDVM+NE
Sbjct  422  VIQWNGHRVCGVLAMSRSIGDRYLKPCIIPEPEVMFIPRTKDDECLILASDGLWDVMSNE  481

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            EVCD+ARRR+LLWHKKNG   L  ER +  DPAAQ AAE+L+  AL +GS+DNI+VIVVD
Sbjct  482  EVCDLARRRILLWHKKNGADGLPLERGEGIDPAAQAAAEFLSNRALLKGSKDNITVIVVD  541

Query  422  LKAQRKFKKK  393
            LKAQRKFK K
Sbjct  542  LKAQRKFKSK  551



>ref|XP_006453049.1| hypothetical protein CICLE_v10007908mg [Citrus clementina]
 ref|XP_006453050.1| hypothetical protein CICLE_v10007908mg [Citrus clementina]
 ref|XP_006453051.1| hypothetical protein CICLE_v10007908mg [Citrus clementina]
 gb|ESR66289.1| hypothetical protein CICLE_v10007908mg [Citrus clementina]
 gb|ESR66290.1| hypothetical protein CICLE_v10007908mg [Citrus clementina]
 gb|ESR66291.1| hypothetical protein CICLE_v10007908mg [Citrus clementina]
Length=550

 Score =   293 bits (751),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 146/190 (77%), Positives = 169/190 (89%), Gaps = 1/190 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVAI+C ++IIVANCGDSRAVLCRGK  M LSVDHKPNREDEY+RIEA GGK
Sbjct  361  PETVGSTAVVAIICASHIIVANCGDSRAVLCRGKESMALSVDHKPNREDEYARIEAAGGK  420

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+GHRV GVLA+SRSIGDRYL+P++IP PE+MF+PRA+EDECL+LASDGLWDVMTNE
Sbjct  421  VIQWNGHRVFGVLAMSRSIGDRYLKPWIIPEPEVMFLPRAREDECLILASDGLWDVMTNE  480

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            E C++AR+R+LLWHKKNG T L+  R +  DPAAQ AAEYL+  ALQ+GS+DNISV+VVD
Sbjct  481  EACELARKRILLWHKKNGVT-LATGRGEGIDPAAQAAAEYLSNRALQKGSKDNISVVVVD  539

Query  422  LKAQRKFKKK  393
            LKAQRKFK K
Sbjct  540  LKAQRKFKSK  549



>gb|AFZ94860.1| ABI1 [Fragaria x ananassa]
Length=546

 Score =   293 bits (751),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 145/191 (76%), Positives = 171/191 (90%), Gaps = 1/191 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVA++C ++IIVANCGDSRA+LCRGK P+PLSVDHKPNREDEY+RIEA GGK
Sbjct  357  PETVGSTAVVALVCSSHIIVANCGDSRAILCRGKQPVPLSVDHKPNREDEYARIEASGGK  416

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+GHRV GVLA+SRSIGDRYL+P++IP PE+M VPRA++DE L+LASDGLWDVMTNE
Sbjct  417  VIQWNGHRVFGVLAMSRSIGDRYLKPWIIPDPEVMIVPRARDDEFLILASDGLWDVMTNE  476

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            E C+VARRR+LLWHKKNG T L+ ER    DPAAQ+AA YL+ +ALQ+GSRDNISV++VD
Sbjct  477  EACEVARRRILLWHKKNGVTPLA-ERGTGVDPAAQEAASYLSTLALQKGSRDNISVVLVD  535

Query  422  LKAQRKFKKKA  390
            LKAQRKFK K+
Sbjct  536  LKAQRKFKSKS  546



>ref|XP_002514095.1| protein phosphatase 2c, putative [Ricinus communis]
 gb|EEF48049.1| protein phosphatase 2c, putative [Ricinus communis]
Length=537

 Score =   293 bits (750),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 146/191 (76%), Positives = 170/191 (89%), Gaps = 1/191 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVAI+CPT +IVANCGDSRAVLCRGK+ MPLSVDHKP+REDEY+RIEA GGK
Sbjct  348  PETVGSTAVVAIVCPTCVIVANCGDSRAVLCRGKVAMPLSVDHKPDREDEYARIEAAGGK  407

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            +I W+G RV GVLA+SRSIGDRYL+P++IP PE+MFVPRAKEDECL++ASDGLWDVMTN+
Sbjct  408  IIQWNGSRVFGVLAMSRSIGDRYLKPWIIPDPEVMFVPRAKEDECLIIASDGLWDVMTNQ  467

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            E CD+ARRR+LLWHK+ G T LS ER +  DPAAQ AAE L+R ALQ+GS+DNI+VIVVD
Sbjct  468  EACDMARRRILLWHKRYGDT-LSAERGERADPAAQAAAECLSRFALQKGSKDNITVIVVD  526

Query  422  LKAQRKFKKKA  390
            LK  RKFK+KA
Sbjct  527  LKCHRKFKRKA  537



>ref|XP_002324741.2| hypothetical protein POPTR_0018s04570g [Populus trichocarpa]
 gb|EEF03306.2| hypothetical protein POPTR_0018s04570g [Populus trichocarpa]
Length=551

 Score =   293 bits (751),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 146/190 (77%), Positives = 168/190 (88%), Gaps = 1/190 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVA +C ++IIVANCGDSRAVLCRGK P+ LSVDHKPNREDEY+RIEA GGK
Sbjct  362  PETVGSTAVVATICSSHIIVANCGDSRAVLCRGKEPVALSVDHKPNREDEYARIEAAGGK  421

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+GHRV GVLA+SRSIGDRYL+P++IP PE+MF+PRAKEDECL+LASDGLWDVM+NE
Sbjct  422  VIQWNGHRVFGVLAMSRSIGDRYLKPWIIPEPEVMFIPRAKEDECLILASDGLWDVMSNE  481

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            E CD+AR+R+L+WHKKNG T LS  R    DPAAQ AAEYL+  ALQ+GS+DNI+VIVVD
Sbjct  482  EACDLARKRILVWHKKNGVT-LSSSRGGGIDPAAQAAAEYLSNRALQKGSKDNITVIVVD  540

Query  422  LKAQRKFKKK  393
            LKAQRKFK K
Sbjct  541  LKAQRKFKTK  550



>ref|XP_004303667.1| PREDICTED: protein phosphatase 2C 16 [Fragaria vesca subsp. vesca]
 ref|XP_011467398.1| PREDICTED: protein phosphatase 2C 16 [Fragaria vesca subsp. vesca]
Length=552

 Score =   293 bits (751),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 145/191 (76%), Positives = 171/191 (90%), Gaps = 1/191 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVA++C ++IIVANCGDSRA+LCRGK P+PLSVDHKPNREDEY+RIEA GGK
Sbjct  363  PETVGSTAVVALVCSSHIIVANCGDSRAILCRGKQPVPLSVDHKPNREDEYARIEASGGK  422

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+GHRV GVLA+SRSIGDRYL+P++IP PE+M VPRA++DE L+LASDGLWDVMTNE
Sbjct  423  VIQWNGHRVFGVLAMSRSIGDRYLKPWIIPDPEVMIVPRARDDEFLILASDGLWDVMTNE  482

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            E C+VARRR+LLWHKKNG T L+ ER    DPAAQ+AA YL+ +ALQ+GSRDNISV++VD
Sbjct  483  EACEVARRRILLWHKKNGVTPLA-ERGTGVDPAAQEAASYLSTLALQKGSRDNISVVLVD  541

Query  422  LKAQRKFKKKA  390
            LKAQRKFK K+
Sbjct  542  LKAQRKFKSKS  552



>ref|XP_006426599.1| hypothetical protein CICLE_v10025314mg [Citrus clementina]
 ref|XP_006426600.1| hypothetical protein CICLE_v10025314mg [Citrus clementina]
 ref|XP_006426601.1| hypothetical protein CICLE_v10025314mg [Citrus clementina]
 gb|ESR39839.1| hypothetical protein CICLE_v10025314mg [Citrus clementina]
 gb|ESR39840.1| hypothetical protein CICLE_v10025314mg [Citrus clementina]
 gb|ESR39841.1| hypothetical protein CICLE_v10025314mg [Citrus clementina]
Length=544

 Score =   293 bits (750),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 145/191 (76%), Positives = 171/191 (90%), Gaps = 1/191 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVA++C ++IIVANCGDSRAVLCRGK PM LSVDHKPNREDEY+RIEA GGK
Sbjct  355  PETVGSTAVVALVCSSHIIVANCGDSRAVLCRGKEPMVLSVDHKPNREDEYARIEASGGK  414

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+GHRV GVLA+SRSIGDRYL+P++IP PE++F+PRA++DECL+LASDGLWDVMTNE
Sbjct  415  VIQWNGHRVFGVLAMSRSIGDRYLKPWIIPEPEVVFIPRARDDECLILASDGLWDVMTNE  474

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            E C+VAR+R+LLWHKK+G   L  ER  + DPAAQ AAEYL+ +ALQ+GS+DNISVIVVD
Sbjct  475  EACEVARKRILLWHKKHGAPPLV-ERGKEIDPAAQAAAEYLSMLALQKGSKDNISVIVVD  533

Query  422  LKAQRKFKKKA  390
            LKAQRKFK K+
Sbjct  534  LKAQRKFKSKS  544



>gb|KDO65132.1| hypothetical protein CISIN_1g009083mg [Citrus sinensis]
 gb|KDO65133.1| hypothetical protein CISIN_1g009083mg [Citrus sinensis]
 gb|KDO65134.1| hypothetical protein CISIN_1g009083mg [Citrus sinensis]
 gb|KDO65135.1| hypothetical protein CISIN_1g009083mg [Citrus sinensis]
Length=544

 Score =   293 bits (750),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 145/191 (76%), Positives = 171/191 (90%), Gaps = 1/191 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVA++C ++IIVANCGDSRAVLCRGK PM LSVDHKPNREDEY+RIEA GGK
Sbjct  355  PETVGSTAVVALVCSSHIIVANCGDSRAVLCRGKEPMVLSVDHKPNREDEYARIEASGGK  414

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+GHRV GVLA+SRSIGDRYL+P++IP PE++F+PRA++DECL+LASDGLWDVMTNE
Sbjct  415  VIQWNGHRVFGVLAMSRSIGDRYLKPWIIPEPEVVFIPRARDDECLILASDGLWDVMTNE  474

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            E C+VAR+R+LLWHKK+G   L  ER  + DPAAQ AAEYL+ +ALQ+GS+DNISVIVVD
Sbjct  475  EACEVARKRILLWHKKHGAPPLV-ERGKEIDPAAQAAAEYLSMLALQKGSKDNISVIVVD  533

Query  422  LKAQRKFKKKA  390
            LKAQRKFK K+
Sbjct  534  LKAQRKFKSKS  544



>ref|XP_008793265.1| PREDICTED: probable protein phosphatase 2C 50 [Phoenix dactylifera]
Length=522

 Score =   292 bits (748),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 140/190 (74%), Positives = 167/190 (88%), Gaps = 0/190 (0%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVA++C ++I++ANCGDSRAVLCRGK PM LSVDHKPNR+DEY+RIEA GGK
Sbjct  329  PETVGSTAVVAVICSSHIVIANCGDSRAVLCRGKEPMALSVDHKPNRDDEYARIEASGGK  388

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+G+RV GVLA+SRSIGDRYL+P++IP PE+  VPR +EDECL+LASDGLWDVM+NE
Sbjct  389  VIQWNGYRVFGVLAMSRSIGDRYLKPWIIPEPEVTIVPRVREDECLILASDGLWDVMSNE  448

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            EVCD ARRR+LLWHKKN G   S +R +  DPAAQ AAEYL ++ALQ+GS+DNI++IVVD
Sbjct  449  EVCDAARRRILLWHKKNAGAASSAQRGEGADPAAQSAAEYLAKLALQKGSKDNITIIVVD  508

Query  422  LKAQRKFKKK  393
            LKAQRKFK K
Sbjct  509  LKAQRKFKSK  518



>ref|XP_002304105.2| hypothetical protein POPTR_0003s04120g [Populus trichocarpa]
 gb|EEE79084.2| hypothetical protein POPTR_0003s04120g [Populus trichocarpa]
Length=546

 Score =   293 bits (749),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 145/191 (76%), Positives = 168/191 (88%), Gaps = 1/191 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVA++C ++IIVANCGDSRAVLCRGK PM LSVDHKPNREDEY+RIEA GGK
Sbjct  357  PETVGSTAVVALVCSSHIIVANCGDSRAVLCRGKEPMALSVDHKPNREDEYARIEASGGK  416

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+GHRV GVLA+SRSIGDRYL+P++IP PE+MF+PR K+DECL+LASDGLWDV+TNE
Sbjct  417  VIQWNGHRVFGVLAMSRSIGDRYLKPWIIPDPEVMFLPRVKDDECLILASDGLWDVITNE  476

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            E C+VARRR+LLWHKKNG   L  ER    DPAAQ AA+YL+ +ALQ+GS+DNISVIVVD
Sbjct  477  EACEVARRRILLWHKKNGVASL-LERGKVIDPAAQAAADYLSMLALQKGSKDNISVIVVD  535

Query  422  LKAQRKFKKKA  390
            LK QRKFK K+
Sbjct  536  LKGQRKFKSKS  546



>ref|XP_010231951.1| PREDICTED: probable protein phosphatase 2C 6 [Brachypodium distachyon]
Length=480

 Score =   291 bits (744),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 145/190 (76%), Positives = 169/190 (89%), Gaps = 1/190 (1%)
 Frame = -3

Query  959  EAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGKV  780
            E VGSTAVVA++C ++IIVANCGDSRAVLCRGK P+PLSVDHKPNREDEY+RIEA GGKV
Sbjct  290  ETVGSTAVVAVICSSHIIVANCGDSRAVLCRGKQPVPLSVDHKPNREDEYARIEAEGGKV  349

Query  779  INWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNEE  600
            I W+G+RV GVLA+SRSIGDRYL+P++IPVPE+  VPRAK+DECL+LASDGLWDVM+NEE
Sbjct  350  IQWNGYRVFGVLAMSRSIGDRYLKPWIIPVPEVTIVPRAKDDECLILASDGLWDVMSNEE  409

Query  599  VCDVARRRLLLWHKKNGGTMLSRERSddpdp-aaqdaAEYLTRIALQRGSRDNISVIVVD  423
            VCDVAR+R+LLWHKKNG    S +RS D    AAQ AAE L+++ALQ+GS+DNISVIVVD
Sbjct  410  VCDVARKRILLWHKKNGVNSSSAQRSGDDSDPAAQAAAECLSKLALQKGSKDNISVIVVD  469

Query  422  LKAQRKFKKK  393
            LKAQRKFK K
Sbjct  470  LKAQRKFKNK  479



>ref|XP_006465975.1| PREDICTED: protein phosphatase 2C 16-like isoform X1 [Citrus 
sinensis]
 ref|XP_006465976.1| PREDICTED: protein phosphatase 2C 16-like isoform X2 [Citrus 
sinensis]
 ref|XP_006465977.1| PREDICTED: protein phosphatase 2C 16-like isoform X3 [Citrus 
sinensis]
 ref|XP_006465978.1| PREDICTED: protein phosphatase 2C 16-like isoform X4 [Citrus 
sinensis]
Length=544

 Score =   293 bits (749),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 145/191 (76%), Positives = 171/191 (90%), Gaps = 1/191 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVA++C ++IIVANCGDSRAVLCRGK PM LSVDHKPNREDEY+RIEA GGK
Sbjct  355  PETVGSTAVVALVCSSHIIVANCGDSRAVLCRGKEPMVLSVDHKPNREDEYARIEASGGK  414

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+GHRV GVLA+SRSIGDRYL+P++IP PE++F+PRA++DECL+LASDGLWDVMTNE
Sbjct  415  VIQWNGHRVFGVLAMSRSIGDRYLKPWIIPEPEVVFIPRARDDECLILASDGLWDVMTNE  474

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            E C+VAR+R+LLWHKK+G   L  ER  + DPAAQ AAEYL+ +ALQ+GS+DNISVIVVD
Sbjct  475  EACEVARKRILLWHKKHGAPPLV-ERGKEIDPAAQAAAEYLSMLALQKGSKDNISVIVVD  533

Query  422  LKAQRKFKKKA  390
            LKAQRKFK K+
Sbjct  534  LKAQRKFKSKS  544



>ref|XP_002278167.2| PREDICTED: protein phosphatase 2C 16 [Vitis vinifera]
 ref|XP_010654501.1| PREDICTED: protein phosphatase 2C 16 [Vitis vinifera]
Length=548

 Score =   293 bits (749),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 144/190 (76%), Positives = 169/190 (89%), Gaps = 1/190 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVA++C ++II+ANCGDSRAVLCRGK P+ LS+DH+PNREDEY+RIEA GGK
Sbjct  358  PETVGSTAVVALICSSHIIIANCGDSRAVLCRGKEPIALSIDHRPNREDEYARIEASGGK  417

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+GHRV GVLA+SRSIGDRYL+P++IP PE+M VPRA+ED+CL+LASDGLWDVMTNE
Sbjct  418  VIQWNGHRVFGVLAMSRSIGDRYLKPWIIPEPEVMMVPRAREDDCLILASDGLWDVMTNE  477

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            EVC+VARRR+LLWHKKNG   L  ER    DPAAQ AAEYL+ +A+Q+GS+DNISVIVVD
Sbjct  478  EVCEVARRRILLWHKKNGVASLV-ERGKGIDPAAQAAAEYLSMLAIQKGSKDNISVIVVD  536

Query  422  LKAQRKFKKK  393
            LKAQRKFK K
Sbjct  537  LKAQRKFKSK  546



>ref|XP_006601194.1| PREDICTED: protein phosphatase 2C 16-like isoform X8 [Glycine 
max]
Length=466

 Score =   290 bits (743),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 143/191 (75%), Positives = 167/191 (87%), Gaps = 0/191 (0%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVA++C ++IIVANCGDSRAVLCRGK PM LSVDHKPNR+DEY+RIEA GGK
Sbjct  276  PETVGSTAVVAVICASHIIVANCGDSRAVLCRGKEPMALSVDHKPNRDDEYARIEAAGGK  335

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+GHRV GVLA+SRSIGDRYL+P++IP PE+ FVPR K+DECL+LASDGLWDVMTNE
Sbjct  336  VIQWNGHRVFGVLAMSRSIGDRYLKPWIIPEPEVTFVPRTKDDECLILASDGLWDVMTNE  395

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            EVCD+AR+R++LW+KKNG    S ER +  DPAAQ AAEYL+  ALQ+GS+DNISVIVVD
Sbjct  396  EVCDLARKRIILWYKKNGLEQPSSERGEGIDPAAQAAAEYLSNRALQKGSKDNISVIVVD  455

Query  422  LKAQRKFKKKA  390
            LK QRK+K K 
Sbjct  456  LKPQRKYKSKT  466



>ref|XP_006581294.1| PREDICTED: protein phosphatase 2C 16-like isoform X1 [Glycine 
max]
 ref|XP_006581295.1| PREDICTED: protein phosphatase 2C 16-like isoform X2 [Glycine 
max]
 gb|KHN32192.1| Protein phosphatase 2C 16 [Glycine soja]
Length=544

 Score =   293 bits (749),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 145/191 (76%), Positives = 168/191 (88%), Gaps = 1/191 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGST+VVAI+C ++IIV+NCGDSRAVLCR K PM LSVDHKPNR+DEY+RIEA GGK
Sbjct  355  PETVGSTSVVAIICSSHIIVSNCGDSRAVLCRAKEPMALSVDHKPNRDDEYARIEAAGGK  414

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+GHRV GVLA+SRSIGDRYL+P++IP PE+ F+PRAK+DECL+LASDGLWDVMTNE
Sbjct  415  VIQWNGHRVFGVLAMSRSIGDRYLKPWIIPDPEVTFLPRAKDDECLILASDGLWDVMTNE  474

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            EVCD+ARRRLLLWHKKN G  L  ER +  DPAAQ AA+YL+  ALQ+GS+DNI+VIVVD
Sbjct  475  EVCDIARRRLLLWHKKN-GLALPSERGEGIDPAAQAAADYLSNRALQKGSKDNITVIVVD  533

Query  422  LKAQRKFKKKA  390
            LKAQRKFK K 
Sbjct  534  LKAQRKFKSKT  544



>dbj|BAK61823.1| protein phosphatase 2c [Citrus unshiu]
Length=630

 Score =   295 bits (755),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 145/190 (76%), Positives = 169/190 (89%), Gaps = 1/190 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVAI+C ++IIVANCGDSRAVLCRGK  M LSVDHKPNREDEY+RIEA GGK
Sbjct  361  PETVGSTAVVAIICASHIIVANCGDSRAVLCRGKESMALSVDHKPNREDEYARIEAAGGK  420

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+GHRV GVLA+SRSIGDRYL+P++IP PE+MF+PRA+EDECL+LASDGLWDVMTNE
Sbjct  421  VIQWNGHRVFGVLAMSRSIGDRYLKPWIIPEPEVMFLPRAREDECLILASDGLWDVMTNE  480

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            E C++AR+R+LLWHKKNG T L+  R +  +PAAQ AAEYL+  ALQ+GS+DNISV+VVD
Sbjct  481  EACELARKRILLWHKKNGVT-LATGRGEGINPAAQAAAEYLSNRALQKGSKDNISVVVVD  539

Query  422  LKAQRKFKKK  393
            LKAQRKFK K
Sbjct  540  LKAQRKFKSK  549



>ref|XP_009340690.1| PREDICTED: protein phosphatase 2C 16-like [Pyrus x bretschneideri]
 ref|XP_009340691.1| PREDICTED: protein phosphatase 2C 16-like [Pyrus x bretschneideri]
 ref|XP_009340692.1| PREDICTED: protein phosphatase 2C 16-like [Pyrus x bretschneideri]
Length=544

 Score =   292 bits (748),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 144/191 (75%), Positives = 168/191 (88%), Gaps = 1/191 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVA++  ++IIVANCGDSRAVLCRGK  +PLSVDHKPNREDEY RIEA GGK
Sbjct  355  PETVGSTAVVALVSSSHIIVANCGDSRAVLCRGKRAIPLSVDHKPNREDEYERIEASGGK  414

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+GHRV GVLA+SRSIGDRYL+P++IP PE+M VPRA++DECL+LASDGLWDVMTNE
Sbjct  415  VIQWNGHRVFGVLAMSRSIGDRYLKPWIIPEPEVMVVPRARDDECLILASDGLWDVMTNE  474

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            E CDVAR+R+LLWHKKNG T L+ ER    DPAA +AA YL+ +ALQ+GS+DNISV+VVD
Sbjct  475  EACDVARKRILLWHKKNGATPLA-ERGTGVDPAAGEAAAYLSTLALQKGSKDNISVVVVD  533

Query  422  LKAQRKFKKKA  390
            LKAQRKFK K+
Sbjct  534  LKAQRKFKSKS  544



>gb|EMS62830.1| putative protein phosphatase 2C 6 [Triticum urartu]
Length=479

 Score =   290 bits (743),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 144/191 (75%), Positives = 173/191 (91%), Gaps = 1/191 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVA++C ++IIV+NCGDSRAVLCRGK P+PLSVDHKPNREDEY+RIEA GGK
Sbjct  288  PETVGSTAVVAVICSSHIIVSNCGDSRAVLCRGKQPVPLSVDHKPNREDEYARIEAEGGK  347

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+G+RV GVLA+SRSIGDRYL+P++IPVPE+  VPRAK+DECL+LASDGLWDV++NE
Sbjct  348  VIQWNGYRVFGVLAMSRSIGDRYLKPWIIPVPEVTIVPRAKDDECLILASDGLWDVLSNE  407

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddp-dpaaqdaAEYLTRIALQRGSRDNISVIVV  426
            EVCDVAR+R+LLWHKKNG  + S +R+ D  DPAAQ AAE L+++ALQ+GS+DNI+VIVV
Sbjct  408  EVCDVARKRILLWHKKNGVNLSSAQRNGDSPDPAAQAAAECLSKLALQKGSKDNITVIVV  467

Query  425  DLKAQRKFKKK  393
            DLKAQRKFK K
Sbjct  468  DLKAQRKFKSK  478



>ref|XP_008337741.1| PREDICTED: protein phosphatase 2C 77 isoform X1 [Malus domestica]
Length=446

 Score =   289 bits (740),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 140/190 (74%), Positives = 170/190 (89%), Gaps = 1/190 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVA++CPT+IIV+NCGDSRAVLCRGK+P+PLSVDHKPNREDEY+RIEA GGK
Sbjct  257  PETVGSTAVVAVICPTHIIVSNCGDSRAVLCRGKVPVPLSVDHKPNREDEYARIEAAGGK  316

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+G RV GVLA+SRSIGDRY++P++IP PE++FV R KEDECL+LASDGLWD +TN+
Sbjct  317  VIQWNGSRVCGVLAMSRSIGDRYMKPWIIPDPEVVFVSREKEDECLILASDGLWDFITNQ  376

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            E CD+ARRR+LLWHKK   TM S ER +  DPAAQ AAEYL+++A+Q+GS+DNI+V+VVD
Sbjct  377  EACDIARRRILLWHKKYSDTM-STERGEGADPAAQSAAEYLSKLAMQKGSKDNITVVVVD  435

Query  422  LKAQRKFKKK  393
            LK+ RKFKKK
Sbjct  436  LKSTRKFKKK  445



>ref|XP_009372387.1| PREDICTED: protein phosphatase 2C 16-like [Pyrus x bretschneideri]
 ref|XP_009372388.1| PREDICTED: protein phosphatase 2C 16-like [Pyrus x bretschneideri]
 ref|XP_009372389.1| PREDICTED: protein phosphatase 2C 16-like [Pyrus x bretschneideri]
 ref|XP_009372390.1| PREDICTED: protein phosphatase 2C 16-like [Pyrus x bretschneideri]
 ref|XP_009372391.1| PREDICTED: protein phosphatase 2C 16-like [Pyrus x bretschneideri]
 ref|XP_009372392.1| PREDICTED: protein phosphatase 2C 16-like [Pyrus x bretschneideri]
Length=544

 Score =   292 bits (748),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 144/191 (75%), Positives = 168/191 (88%), Gaps = 1/191 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVA++  ++IIVANCGDSRAVLCRGK  +PLSVDHKPNREDEY RIEA GGK
Sbjct  355  PETVGSTAVVALVSSSHIIVANCGDSRAVLCRGKRAIPLSVDHKPNREDEYERIEASGGK  414

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+GHRV GVLA+SRSIGDRYL+P++IP PE+M VPRA++DECL+LASDGLWDVMTNE
Sbjct  415  VIQWNGHRVFGVLAMSRSIGDRYLKPWIIPEPEVMVVPRARDDECLILASDGLWDVMTNE  474

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            E CDVAR+R+LLWHKKNG T L+ ER    DPAA +AA YL+ +ALQ+GS+DNISV+VVD
Sbjct  475  EACDVARKRILLWHKKNGATPLA-ERGTGVDPAAGEAAAYLSTLALQKGSKDNISVVVVD  533

Query  422  LKAQRKFKKKA  390
            LKAQRKFK K+
Sbjct  534  LKAQRKFKSKS  544



>ref|XP_008228245.1| PREDICTED: protein phosphatase 2C 16 [Prunus mume]
 ref|XP_008228246.1| PREDICTED: protein phosphatase 2C 16 [Prunus mume]
 ref|XP_008228247.1| PREDICTED: protein phosphatase 2C 16 [Prunus mume]
 ref|XP_008228248.1| PREDICTED: protein phosphatase 2C 16 [Prunus mume]
Length=557

 Score =   292 bits (748),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 147/191 (77%), Positives = 169/191 (88%), Gaps = 1/191 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVA++C ++IIVANCGDSRAVLCRGK  + LSVDHKPNREDEY+RIEA GGK
Sbjct  368  PETVGSTAVVALVCSSHIIVANCGDSRAVLCRGKQAIALSVDHKPNREDEYARIEAAGGK  427

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+GHRV GVLA+SRSIGDRYL+P++IP PE+M V RA++DECL+LASDGLWDVMTNE
Sbjct  428  VIQWNGHRVFGVLAMSRSIGDRYLKPWIIPEPEVMNVARARDDECLILASDGLWDVMTNE  487

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            EVC+VARRR+LLWHKKNG T L  ER    DPAAQ+AA YL+ +ALQ+GSRDNISVIVVD
Sbjct  488  EVCEVARRRILLWHKKNGVTALV-ERGAGVDPAAQEAAAYLSTLALQKGSRDNISVIVVD  546

Query  422  LKAQRKFKKKA  390
            LKAQRKFK K+
Sbjct  547  LKAQRKFKSKS  557



>dbj|BAG91921.1| unnamed protein product [Oryza sativa Japonica Group]
Length=301

 Score =   284 bits (726),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 137/194 (71%), Positives = 169/194 (87%), Gaps = 3/194 (2%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            P+ VGSTAVVA++C +++IVANCGDSRAVLCRGK P+PLS+DHKPNREDEY+RIEALGGK
Sbjct  108  PDTVGSTAVVAVVCSSHVIVANCGDSRAVLCRGKQPLPLSLDHKPNREDEYARIEALGGK  167

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+G+RV GVLA+SRSIGD+YL+PY+IPVPE+  V RAK+D+CL+LASDGLWDVM+NE
Sbjct  168  VIQWNGYRVLGVLAMSRSIGDKYLKPYIIPVPEVTVVARAKDDDCLILASDGLWDVMSNE  227

Query  602  EVCDVARRRLLLWHKKNGGTMLSRE---RSddpdpaaqdaAEYLTRIALQRGSRDNISVI  432
            EVCD AR+R+LLWHKKN  T  +       D  DPAAQ AA+YL+++ALQ+GS+DNI+V+
Sbjct  228  EVCDAARKRILLWHKKNAATASTSSAQISGDSSDPAAQAAADYLSKLALQKGSKDNITVV  287

Query  431  VVDLKAQRKFKKKA  390
            V+DLKA RKFK KA
Sbjct  288  VIDLKAHRKFKSKA  301



>ref|XP_011467233.1| PREDICTED: protein phosphatase 2C 16-like isoform X1 [Fragaria 
vesca subsp. vesca]
 ref|XP_011467234.1| PREDICTED: protein phosphatase 2C 16-like isoform X1 [Fragaria 
vesca subsp. vesca]
 ref|XP_011467235.1| PREDICTED: protein phosphatase 2C 16-like isoform X1 [Fragaria 
vesca subsp. vesca]
 gb|AEP67941.1| protein phosphatase 2C [Fragaria x ananassa]
Length=548

 Score =   291 bits (746),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 145/191 (76%), Positives = 168/191 (88%), Gaps = 1/191 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVA++C ++IIVAN GDSRAVLCRGK PM LSVDHKPNREDEY+RIEA GGK
Sbjct  359  PETVGSTAVVALICSSHIIVANSGDSRAVLCRGKEPMALSVDHKPNREDEYARIEAAGGK  418

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+GHRV GVLA+SRSIGDRYL+P++IP PE+MF+PR K+DECL+LASDGLWDVMTNE
Sbjct  419  VIQWNGHRVFGVLAMSRSIGDRYLKPWIIPEPEVMFIPRTKDDECLILASDGLWDVMTNE  478

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            E CD+ARRR+LLWHKKNG T L  ER +  DPAAQ AAE+L+  ALQ+GS+DNI+VIV+D
Sbjct  479  EACDLARRRILLWHKKNGVT-LPLERGEGIDPAAQAAAEFLSSRALQKGSKDNITVIVID  537

Query  422  LKAQRKFKKKA  390
            LKAQRKFK K 
Sbjct  538  LKAQRKFKSKT  548



>ref|XP_003550214.1| PREDICTED: protein phosphatase 2C 16-like isoform X1 [Glycine 
max]
 ref|XP_006601193.1| PREDICTED: protein phosphatase 2C 16-like isoform X7 [Glycine 
max]
Length=512

 Score =   290 bits (743),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 143/191 (75%), Positives = 167/191 (87%), Gaps = 0/191 (0%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVA++C ++IIVANCGDSRAVLCRGK PM LSVDHKPNR+DEY+RIEA GGK
Sbjct  322  PETVGSTAVVAVICASHIIVANCGDSRAVLCRGKEPMALSVDHKPNRDDEYARIEAAGGK  381

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+GHRV GVLA+SRSIGDRYL+P++IP PE+ FVPR K+DECL+LASDGLWDVMTNE
Sbjct  382  VIQWNGHRVFGVLAMSRSIGDRYLKPWIIPEPEVTFVPRTKDDECLILASDGLWDVMTNE  441

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            EVCD+AR+R++LW+KKNG    S ER +  DPAAQ AAEYL+  ALQ+GS+DNISVIVVD
Sbjct  442  EVCDLARKRIILWYKKNGLEQPSSERGEGIDPAAQAAAEYLSNRALQKGSKDNISVIVVD  501

Query  422  LKAQRKFKKKA  390
            LK QRK+K K 
Sbjct  502  LKPQRKYKSKT  512



>gb|AFL56850.1| protein phosphatase 2c [Cucumis sativus]
Length=546

 Score =   291 bits (745),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 148/205 (72%), Positives = 173/205 (84%), Gaps = 15/205 (7%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVA++C ++IIVANCGDSRAVLCRGK PM LSVDHKPNREDEY+RIE+ GGK
Sbjct  343  PETVGSTAVVALVCSSHIIVANCGDSRAVLCRGKEPMALSVDHKPNREDEYARIESSGGK  402

Query  782  VINWDGHRVSGVLAVSRSI--------------GDRYLRPYVIPVPEIMFVPRAKEDECL  645
            VI W+GHRV GVLA+SRSI              GDRYL+P++IP PE+MF+PRAKEDECL
Sbjct  403  VIQWNGHRVFGVLAMSRSIAQKDRFISFSIYLTGDRYLKPWIIPDPEVMFIPRAKEDECL  462

Query  644  VLASDGLWDVMTNEEVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIAL  465
            +LASDGLWDVMTNEEVCDVARRR+LLWHKK+G + L+ +R    DPAAQ AA+YL+ +AL
Sbjct  463  ILASDGLWDVMTNEEVCDVARRRILLWHKKHGASSLA-DRGTGVDPAAQAAADYLSMLAL  521

Query  464  QRGSRDNISVIVVDLKAQRKFKKKA  390
            Q+GS+DNISVIVVDLKAQRKFK K+
Sbjct  522  QKGSKDNISVIVVDLKAQRKFKTKS  546



>gb|EYU28367.1| hypothetical protein MIMGU_mgv1a006031mg [Erythranthe guttata]
 gb|EYU28369.1| hypothetical protein MIMGU_mgv1a006031mg [Erythranthe guttata]
 gb|EYU28370.1| hypothetical protein MIMGU_mgv1a006031mg [Erythranthe guttata]
Length=439

 Score =   288 bits (736),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 150/190 (79%), Positives = 166/190 (87%), Gaps = 1/190 (1%)
 Frame = -3

Query  959  EAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGKV  780
            E+VGSTAVVA++  T+I+VANCGDSRAVL RGK+P+PLSVDHKPNREDE +RIE  GGKV
Sbjct  251  ESVGSTAVVAVVSSTHIVVANCGDSRAVLYRGKVPVPLSVDHKPNREDECARIEGAGGKV  310

Query  779  INWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNEE  600
            I WDG+RVSGVLAVSRSIGDRYLRPYVI  PEIM+VPRAKEDECL+LASDGLWDVMTNEE
Sbjct  311  IKWDGYRVSGVLAVSRSIGDRYLRPYVIADPEIMWVPRAKEDECLILASDGLWDVMTNEE  370

Query  599  VCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVDL  420
             CD ARRR+LLWHKKNG T  S  R  D DPAAQ AA+YL+++A QRGS DNISVIVVDL
Sbjct  371  ACDFARRRILLWHKKNGPTQ-SEVRGKDIDPAAQAAADYLSKLAFQRGSIDNISVIVVDL  429

Query  419  KAQRKFKKKA  390
            KAQRKFK K 
Sbjct  430  KAQRKFKNKT  439



>gb|KCW81712.1| hypothetical protein EUGRSUZ_C03066 [Eucalyptus grandis]
Length=502

 Score =   289 bits (740),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 144/191 (75%), Positives = 168/191 (88%), Gaps = 1/191 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVA++C ++I+VANCGDSRAVL RGK P+ LSVDHKPNREDEY+RIEA GGK
Sbjct  313  PETVGSTAVVAMICSSHIVVANCGDSRAVLYRGKEPIALSVDHKPNREDEYARIEAAGGK  372

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+GHRV GVLA+SRSIGDRYL+P++IP PE++FVPR +EDECLVLASDGLWDVMTNE
Sbjct  373  VIQWNGHRVFGVLAMSRSIGDRYLKPWIIPEPEVVFVPRTREDECLVLASDGLWDVMTNE  432

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            E CD+AR+RLLLWHKKNG T L   + +  DPAAQ AAEYL++ ALQ+GS+DNI+VIVVD
Sbjct  433  EACDLARKRLLLWHKKNGVTHLPN-KGEVVDPAAQAAAEYLSKCALQKGSKDNITVIVVD  491

Query  422  LKAQRKFKKKA  390
            LKAQRKFK K 
Sbjct  492  LKAQRKFKSKT  502



>ref|XP_006601188.1| PREDICTED: protein phosphatase 2C 16-like isoform X2 [Glycine 
max]
 ref|XP_006601189.1| PREDICTED: protein phosphatase 2C 16-like isoform X3 [Glycine 
max]
 ref|XP_006601190.1| PREDICTED: protein phosphatase 2C 16-like isoform X4 [Glycine 
max]
 gb|KHN20160.1| Protein phosphatase 2C 16 [Glycine soja]
Length=558

 Score =   291 bits (744),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 143/191 (75%), Positives = 167/191 (87%), Gaps = 0/191 (0%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVA++C ++IIVANCGDSRAVLCRGK PM LSVDHKPNR+DEY+RIEA GGK
Sbjct  368  PETVGSTAVVAVICASHIIVANCGDSRAVLCRGKEPMALSVDHKPNRDDEYARIEAAGGK  427

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+GHRV GVLA+SRSIGDRYL+P++IP PE+ FVPR K+DECL+LASDGLWDVMTNE
Sbjct  428  VIQWNGHRVFGVLAMSRSIGDRYLKPWIIPEPEVTFVPRTKDDECLILASDGLWDVMTNE  487

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            EVCD+AR+R++LW+KKNG    S ER +  DPAAQ AAEYL+  ALQ+GS+DNISVIVVD
Sbjct  488  EVCDLARKRIILWYKKNGLEQPSSERGEGIDPAAQAAAEYLSNRALQKGSKDNISVIVVD  547

Query  422  LKAQRKFKKKA  390
            LK QRK+K K 
Sbjct  548  LKPQRKYKSKT  558



>ref|XP_010925402.1| PREDICTED: probable protein phosphatase 2C 50 [Elaeis guineensis]
Length=521

 Score =   290 bits (741),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 139/190 (73%), Positives = 167/190 (88%), Gaps = 0/190 (0%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVA++C ++I++ANCGDSRAVLCRGK PM LSVDHKP+R+DEY+RIEA GGK
Sbjct  328  PETVGSTAVVAVICSSHIVIANCGDSRAVLCRGKEPMALSVDHKPSRDDEYARIEASGGK  387

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+G+RV GVLA+SRSIGDRYL+P++IP PE+  VPR +EDECL+LASDGLWDVM+NE
Sbjct  388  VIQWNGYRVFGVLAMSRSIGDRYLKPWIIPEPEVTIVPRVREDECLILASDGLWDVMSNE  447

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            EVCD ARRR+LLWHKKN G   S +R +  DPAAQ AAEYL ++ALQ+GS+DNI++IVVD
Sbjct  448  EVCDAARRRILLWHKKNAGAASSTQRGEGADPAAQSAAEYLAKLALQKGSKDNITIIVVD  507

Query  422  LKAQRKFKKK  393
            LKAQRKFK K
Sbjct  508  LKAQRKFKSK  517



>ref|XP_006601191.1| PREDICTED: protein phosphatase 2C 16-like isoform X5 [Glycine 
max]
 ref|XP_006601192.1| PREDICTED: protein phosphatase 2C 16-like isoform X6 [Glycine 
max]
Length=533

 Score =   290 bits (742),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 143/191 (75%), Positives = 167/191 (87%), Gaps = 0/191 (0%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVA++C ++IIVANCGDSRAVLCRGK PM LSVDHKPNR+DEY+RIEA GGK
Sbjct  343  PETVGSTAVVAVICASHIIVANCGDSRAVLCRGKEPMALSVDHKPNRDDEYARIEAAGGK  402

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+GHRV GVLA+SRSIGDRYL+P++IP PE+ FVPR K+DECL+LASDGLWDVMTNE
Sbjct  403  VIQWNGHRVFGVLAMSRSIGDRYLKPWIIPEPEVTFVPRTKDDECLILASDGLWDVMTNE  462

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            EVCD+AR+R++LW+KKNG    S ER +  DPAAQ AAEYL+  ALQ+GS+DNISVIVVD
Sbjct  463  EVCDLARKRIILWYKKNGLEQPSSERGEGIDPAAQAAAEYLSNRALQKGSKDNISVIVVD  522

Query  422  LKAQRKFKKKA  390
            LK QRK+K K 
Sbjct  523  LKPQRKYKSKT  533



>gb|EYU28368.1| hypothetical protein MIMGU_mgv1a006031mg [Erythranthe guttata]
Length=460

 Score =   288 bits (736),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 150/190 (79%), Positives = 166/190 (87%), Gaps = 1/190 (1%)
 Frame = -3

Query  959  EAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGKV  780
            E+VGSTAVVA++  T+I+VANCGDSRAVL RGK+P+PLSVDHKPNREDE +RIE  GGKV
Sbjct  272  ESVGSTAVVAVVSSTHIVVANCGDSRAVLYRGKVPVPLSVDHKPNREDECARIEGAGGKV  331

Query  779  INWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNEE  600
            I WDG+RVSGVLAVSRSIGDRYLRPYVI  PEIM+VPRAKEDECL+LASDGLWDVMTNEE
Sbjct  332  IKWDGYRVSGVLAVSRSIGDRYLRPYVIADPEIMWVPRAKEDECLILASDGLWDVMTNEE  391

Query  599  VCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVDL  420
             CD ARRR+LLWHKKNG T  S  R  D DPAAQ AA+YL+++A QRGS DNISVIVVDL
Sbjct  392  ACDFARRRILLWHKKNGPTQ-SEVRGKDIDPAAQAAADYLSKLAFQRGSIDNISVIVVDL  450

Query  419  KAQRKFKKKA  390
            KAQRKFK K 
Sbjct  451  KAQRKFKNKT  460



>ref|XP_008242179.1| PREDICTED: protein phosphatase 2C 77 [Prunus mume]
 ref|XP_008242180.1| PREDICTED: protein phosphatase 2C 77 [Prunus mume]
Length=468

 Score =   288 bits (736),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 141/190 (74%), Positives = 167/190 (88%), Gaps = 0/190 (0%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVV ++CPT+IIVANCGDSRAVLCRGK+ +PLSVDHKPNREDE +RIEA GGK
Sbjct  278  PETVGSTAVVTVICPTHIIVANCGDSRAVLCRGKVAVPLSVDHKPNREDECARIEAAGGK  337

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+G RV GVLA+SRSIGDRYL+P++IP PE +FV R KEDECL+LASDGLWD MTN+
Sbjct  338  VIQWNGSRVFGVLAMSRSIGDRYLKPWIIPDPEAVFVSREKEDECLILASDGLWDFMTNQ  397

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            E CD+ARRR+LLWHKK G T +S ER +  DPAAQ AA+YL+R+ALQ+GS+DNI+V+VVD
Sbjct  398  EACDIARRRILLWHKKYGDTTMSMERGEGVDPAAQAAADYLSRLALQKGSKDNITVVVVD  457

Query  422  LKAQRKFKKK  393
            LKA RKFK+K
Sbjct  458  LKATRKFKRK  467



>ref|XP_010094964.1| Protein phosphatase 2C 16 [Morus notabilis]
 gb|EXB57657.1| Protein phosphatase 2C 16 [Morus notabilis]
Length=548

 Score =   290 bits (742),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 145/190 (76%), Positives = 170/190 (89%), Gaps = 1/190 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVA++C ++IIVANCGDSRAVLCRGK  + LSVDHKP+REDEY+RIEA GGK
Sbjct  359  PETVGSTAVVAVVCSSHIIVANCGDSRAVLCRGKEAIALSVDHKPDREDEYARIEAAGGK  418

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+GHRV GVLA+SRSIGDRYL+P++IP PE+ F+PRAKED+CL+LASDGLWDVMTNE
Sbjct  419  VIQWNGHRVFGVLAMSRSIGDRYLKPWIIPEPEVTFLPRAKEDDCLILASDGLWDVMTNE  478

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            EVCD+ARRR+LLWHKKNG T L +ER +  DPAAQ AAEYL+  ALQ+GS+DNI+VIVVD
Sbjct  479  EVCDLARRRILLWHKKNGIT-LPQERGEGIDPAAQAAAEYLSNRALQKGSKDNITVIVVD  537

Query  422  LKAQRKFKKK  393
            LK+QRKFK K
Sbjct  538  LKSQRKFKTK  547



>ref|XP_009601903.1| PREDICTED: probable protein phosphatase 2C 53 isoform X2 [Nicotiana 
tomentosiformis]
 ref|XP_009601904.1| PREDICTED: probable protein phosphatase 2C 53 isoform X2 [Nicotiana 
tomentosiformis]
Length=451

 Score =   287 bits (734),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 144/191 (75%), Positives = 167/191 (87%), Gaps = 1/191 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVAI+C ++IIV+NCGDSRAVLCRGK P+ LSVDHKPNREDEY RIEA GGK
Sbjct  262  PETVGSTAVVAIVCSSHIIVSNCGDSRAVLCRGKEPLALSVDHKPNREDEYERIEAAGGK  321

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+GHRV GVLA+SRSIGDRYL+P++IP PE+ F+PRAK+DECL+LASDGLWDVMTNE
Sbjct  322  VIQWNGHRVFGVLAMSRSIGDRYLKPWIIPDPEVTFIPRAKDDECLILASDGLWDVMTNE  381

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            EVCD+AR+R+L+WHKKN  T L  ER +  DPAAQ AAE L+  ALQ+GS+DNI+VIVVD
Sbjct  382  EVCDMARKRILMWHKKNSVT-LPMERGEGIDPAAQAAAECLSNRALQKGSKDNITVIVVD  440

Query  422  LKAQRKFKKKA  390
            LKAQRKFK K 
Sbjct  441  LKAQRKFKSKT  451



>ref|XP_009590889.1| PREDICTED: probable protein phosphatase 2C 6 [Nicotiana tomentosiformis]
Length=531

 Score =   289 bits (740),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 145/189 (77%), Positives = 167/189 (88%), Gaps = 1/189 (1%)
 Frame = -3

Query  959  EAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGKV  780
            E VGSTAVVAI+C ++IIVANCGDSRAVLCRGK PM LSVDHKPNREDEYSRIEA GGKV
Sbjct  343  ETVGSTAVVAIVCSSHIIVANCGDSRAVLCRGKEPMALSVDHKPNREDEYSRIEAAGGKV  402

Query  779  INWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNEE  600
            I W+GHRV GVLA+SRSIGDRYL+P++IP PE+MF+PR K+DECL+LASDGLWDVM+NEE
Sbjct  403  IQWNGHRVFGVLAMSRSIGDRYLKPWIIPDPEVMFIPRTKDDECLILASDGLWDVMSNEE  462

Query  599  VCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVDL  420
             CD+AR+R+LLWHKKNG T L+ ER    DPAAQ AAE L+  A+Q+GS+DNI+VIVVDL
Sbjct  463  ACDLARKRILLWHKKNGIT-LTLERGQGIDPAAQAAAECLSNRAIQKGSKDNITVIVVDL  521

Query  419  KAQRKFKKK  393
            KAQRKFK K
Sbjct  522  KAQRKFKSK  530



>ref|XP_004969414.1| PREDICTED: probable protein phosphatase 2C 6-like [Setaria italica]
Length=479

 Score =   288 bits (736),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 144/191 (75%), Positives = 171/191 (90%), Gaps = 1/191 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVA++C ++IIV+NCGDSRAVLCRGK P+PLSVDHKPNREDEY+RIEA GGK
Sbjct  288  PETVGSTAVVAVICSSHIIVSNCGDSRAVLCRGKQPVPLSVDHKPNREDEYARIEAEGGK  347

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+G+RV GVLA+SRSIGDRYL+P++IPVPE+  VPRAK+DECLVLASDGLWDVM+NE
Sbjct  348  VIQWNGYRVFGVLAMSRSIGDRYLKPWIIPVPEVTIVPRAKDDECLVLASDGLWDVMSNE  407

Query  602  EVCDVARRRLLLWHKKNGGTMLSRER-SddpdpaaqdaAEYLTRIALQRGSRDNISVIVV  426
            EVCD+AR+R+LLWHKKNG +  S  R  D  DPAAQ AAE L+++ALQ+GS+DNI+V+VV
Sbjct  408  EVCDIARKRILLWHKKNGTSSSSAPRVGDSADPAAQAAAECLSKLALQKGSKDNITVVVV  467

Query  425  DLKAQRKFKKK  393
            DLKAQRKFK K
Sbjct  468  DLKAQRKFKSK  478



>ref|XP_007202014.1| hypothetical protein PRUPE_ppa005286mg [Prunus persica]
 gb|EMJ03213.1| hypothetical protein PRUPE_ppa005286mg [Prunus persica]
Length=468

 Score =   287 bits (735),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 140/190 (74%), Positives = 167/190 (88%), Gaps = 0/190 (0%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVV ++CPT+IIVANCGDSRAVLCRGK+ +PLSVDH PNREDE +RIEA GGK
Sbjct  278  PETVGSTAVVTVICPTHIIVANCGDSRAVLCRGKVAVPLSVDHNPNREDECARIEAAGGK  337

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+G RV GVLA+SRSIGDRYL+P++IP PE++FV R KEDECL+LASDGLWD MTN+
Sbjct  338  VIQWNGSRVFGVLAMSRSIGDRYLKPWIIPDPEVVFVSREKEDECLILASDGLWDFMTNQ  397

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            E CD+ARRR+LLWHKK G T +S ER +  DPAAQ AA+YL+R+ALQ+GS+DNI+V+VVD
Sbjct  398  EACDIARRRILLWHKKYGDTTMSMERGEGVDPAAQAAADYLSRLALQKGSKDNITVVVVD  457

Query  422  LKAQRKFKKK  393
            LKA RKFK+K
Sbjct  458  LKATRKFKRK  467



>ref|NP_001150302.1| protein phosphatase 2C ABI2 [Zea mays]
 gb|ACG38580.1| protein phosphatase 2C ABI2 [Zea mays]
Length=423

 Score =   286 bits (731),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 142/191 (74%), Positives = 170/191 (89%), Gaps = 1/191 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            P+ VGSTAVVA++C +++IVANCGDSRAVLCRGK P+PLSVDHKPNREDEY+RIEA GGK
Sbjct  232  PDTVGSTAVVALVCSSHVIVANCGDSRAVLCRGKQPLPLSVDHKPNREDEYARIEAQGGK  291

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VINW+G+RV GVLA+SRSIGDRYL+PY+IPVPE+  V RAK+DECL+LASDGLWDVM+NE
Sbjct  292  VINWNGYRVLGVLAMSRSIGDRYLKPYIIPVPEVTIVARAKDDECLILASDGLWDVMSNE  351

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERS-ddpdpaaqdaAEYLTRIALQRGSRDNISVIVV  426
            EVCD AR+R+LLWHKKNG    S +RS D  D AAQ AAEYL+++ALQ+GS+DNI+VIVV
Sbjct  352  EVCDAARKRILLWHKKNGDVSASAQRSGDSADEAAQAAAEYLSKLALQKGSKDNITVIVV  411

Query  425  DLKAQRKFKKK  393
            DLK+ RKFK +
Sbjct  412  DLKSHRKFKSR  422



>gb|ACF86234.1| unknown [Zea mays]
 gb|AFW81327.1| putative protein phosphatase 2C family protein [Zea mays]
 gb|AIB05672.1| orphans transcription factor, partial [Zea mays]
 gb|AIG52101.1| 2C-type protein phosphatase protein [Zea mays]
Length=423

 Score =   286 bits (731),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 142/191 (74%), Positives = 170/191 (89%), Gaps = 1/191 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            P+ VGSTAVVA++C +++IVANCGDSRAVLCRGK P+PLSVDHKPNREDEY+RIEA GGK
Sbjct  232  PDTVGSTAVVALVCSSHVIVANCGDSRAVLCRGKQPLPLSVDHKPNREDEYARIEAQGGK  291

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VINW+G+RV GVLA+SRSIGDRYL+PY+IPVPE+  V RAK+DECL+LASDGLWDVM+NE
Sbjct  292  VINWNGYRVLGVLAMSRSIGDRYLKPYIIPVPEVTIVARAKDDECLILASDGLWDVMSNE  351

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERS-ddpdpaaqdaAEYLTRIALQRGSRDNISVIVV  426
            EVCD AR+R+LLWHKKNG    S +RS D  D AAQ AAEYL+++ALQ+GS+DNI+VIVV
Sbjct  352  EVCDAARKRILLWHKKNGDDSASAQRSGDSADEAAQAAAEYLSKLALQKGSKDNITVIVV  411

Query  425  DLKAQRKFKKK  393
            DLK+ RKFK +
Sbjct  412  DLKSHRKFKSR  422



>ref|XP_011013159.1| PREDICTED: probable protein phosphatase 2C 53 [Populus euphratica]
 ref|XP_011013161.1| PREDICTED: probable protein phosphatase 2C 53 [Populus euphratica]
 ref|XP_011013162.1| PREDICTED: probable protein phosphatase 2C 53 [Populus euphratica]
 ref|XP_011013163.1| PREDICTED: probable protein phosphatase 2C 53 [Populus euphratica]
Length=546

 Score =   289 bits (740),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 144/190 (76%), Positives = 167/190 (88%), Gaps = 1/190 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVA +C ++IIVANCGDSRAVLCRGK P+ LSVDHKPNREDEY+RI+A GGK
Sbjct  357  PETVGSTAVVATICSSHIIVANCGDSRAVLCRGKEPVALSVDHKPNREDEYARIQAAGGK  416

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+GHRV GVLA+SRSIGDRYL+P++IP PE+MF+PRAKEDECL+LASDGLWDVM+NE
Sbjct  417  VIQWNGHRVFGVLAMSRSIGDRYLKPWIIPEPEVMFIPRAKEDECLILASDGLWDVMSNE  476

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            E CD+AR+R+L+WHKKNG T  S  R    DPAAQ AAEYL+  ALQ+GS+DNI+VIVVD
Sbjct  477  EACDLARKRILVWHKKNGVTP-SSSRGGGIDPAAQAAAEYLSNRALQKGSKDNITVIVVD  535

Query  422  LKAQRKFKKK  393
            LKAQRKFK K
Sbjct  536  LKAQRKFKTK  545



>ref|XP_004961009.1| PREDICTED: probable protein phosphatase 2C 53-like [Setaria italica]
Length=451

 Score =   286 bits (733),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 141/191 (74%), Positives = 167/191 (87%), Gaps = 1/191 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            P+ VGSTAVVA++C ++IIVANCGDSRAVLCRGK P+ LSVDHKPNREDEY+RIEA GGK
Sbjct  260  PDTVGSTAVVAVVCSSHIIVANCGDSRAVLCRGKQPLALSVDHKPNREDEYARIEAQGGK  319

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+G+RV GVLA+SRSIGDRYL+PY+IPVPE+  V RAKEDECL+LASDGLWDVM+NE
Sbjct  320  VIQWNGYRVLGVLAMSRSIGDRYLKPYIIPVPEVTIVARAKEDECLILASDGLWDVMSNE  379

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddp-dpaaqdaAEYLTRIALQRGSRDNISVIVV  426
            EVCD AR+R+LLWHKKN     S +RS D  D AAQ AAEYL+++ALQ+GS+DNI+V+VV
Sbjct  380  EVCDAARKRILLWHKKNADASSSAQRSGDSPDQAAQAAAEYLSKLALQKGSKDNITVVVV  439

Query  425  DLKAQRKFKKK  393
            DLK+ RKFK K
Sbjct  440  DLKSHRKFKSK  450



>gb|EYU20326.1| hypothetical protein MIMGU_mgv1a009511mg [Erythranthe guttata]
Length=339

 Score =   282 bits (722),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 143/190 (75%), Positives = 169/190 (89%), Gaps = 1/190 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGST+VVA++C ++IIVAN GDSRAVLCRGK P+ LSVDHKPNREDEY+RIEA GGK
Sbjct  150  PETVGSTSVVALVCSSHIIVANSGDSRAVLCRGKEPVALSVDHKPNREDEYARIEAAGGK  209

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+GHRV GVLA+SRSIGDRYL+P++IP PE+MFVPRAKEDECL+LASDGLWDVMTNE
Sbjct  210  VIQWNGHRVFGVLAMSRSIGDRYLKPWIIPDPEVMFVPRAKEDECLILASDGLWDVMTNE  269

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            EVCD+AR+R+LLWH+ NG T+ S ER +  DPAAQ AAEYL+  ALQ+GS+DNISV+VVD
Sbjct  270  EVCDMARKRILLWHRNNGPTLPS-ERGEGIDPAAQAAAEYLSNRALQKGSKDNISVVVVD  328

Query  422  LKAQRKFKKK  393
            L+AQRK K +
Sbjct  329  LRAQRKPKSR  338



>gb|KHF99231.1| Protein phosphatase 2C 16 -like protein [Gossypium arboreum]
Length=494

 Score =   287 bits (735),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 142/190 (75%), Positives = 167/190 (88%), Gaps = 1/190 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVA++C ++I+VANCGDSRAVLCRGK  M LS DHKP+R+DEY+RIEA GGK
Sbjct  305  PETVGSTAVVALVCSSHIVVANCGDSRAVLCRGKEAMALSSDHKPSRDDEYARIEASGGK  364

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+GHRV GVLA+SRSIGDRYL+P++IP PE+MF+PRA+EDECL+LASDGLWDV++NE
Sbjct  365  VIQWNGHRVFGVLAMSRSIGDRYLKPWIIPEPEVMFIPRAREDECLILASDGLWDVISNE  424

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            E C+VARRR+LLWHKKNG   L  ER    DPAAQ AAEYL+ +A+Q+GSRDNISVIVVD
Sbjct  425  EACEVARRRILLWHKKNGVPSLV-ERGKGIDPAAQAAAEYLSMLAIQKGSRDNISVIVVD  483

Query  422  LKAQRKFKKK  393
            LKAQRKFK K
Sbjct  484  LKAQRKFKSK  493



>ref|XP_009798002.1| PREDICTED: protein phosphatase 2C 16-like isoform X2 [Nicotiana 
sylvestris]
Length=451

 Score =   286 bits (732),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 144/191 (75%), Positives = 167/191 (87%), Gaps = 1/191 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVAI+C ++IIV+N GDSRAVLCRGK P+ LSVDHKPNREDEY RIEA GGK
Sbjct  262  PETVGSTAVVAIVCSSHIIVSNSGDSRAVLCRGKEPLALSVDHKPNREDEYERIEAAGGK  321

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+GHRV GVLA+SRSIGDRYL+P++IP PE+ F+PRAK+DECL+LASDGLWDVMTNE
Sbjct  322  VIQWNGHRVFGVLAMSRSIGDRYLKPWIIPDPEVTFIPRAKDDECLILASDGLWDVMTNE  381

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            EVCD+AR+R+L+WHKKNG T L  ER +  DPAAQ AAE L+  ALQ+GS+DNI+VIVVD
Sbjct  382  EVCDMARKRILMWHKKNGVT-LPMERGEGIDPAAQAAAECLSNRALQKGSKDNITVIVVD  440

Query  422  LKAQRKFKKKA  390
            LKAQRKFK K 
Sbjct  441  LKAQRKFKSKT  451



>emb|CDP03129.1| unnamed protein product [Coffea canephora]
Length=538

 Score =   288 bits (738),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 148/191 (77%), Positives = 169/191 (88%), Gaps = 1/191 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PEAVGSTAVV I+CP++IIVANCGDSRAVLCR K+ +PLS+DHKPNREDEY RIEA GGK
Sbjct  348  PEAVGSTAVVGIICPSHIIVANCGDSRAVLCRAKVAVPLSIDHKPNREDEYERIEAAGGK  407

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI+W G+RVSGVL +SRSIGDRYLRP VI  PE+ FVPR++EDECL+LASDGLWDVMTNE
Sbjct  408  VIDWGGYRVSGVLGMSRSIGDRYLRPSVIADPEMTFVPRSREDECLILASDGLWDVMTNE  467

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            EVC+VARRR+LLWHKKNG +    ER +  DPAAQDAA+YL+R+ALQRGS+DNISVIVVD
Sbjct  468  EVCEVARRRILLWHKKNGPSP-PNERGERIDPAAQDAADYLSRLALQRGSKDNISVIVVD  526

Query  422  LKAQRKFKKKA  390
            LK  RKFKKK 
Sbjct  527  LKPVRKFKKKT  537



>ref|XP_010915189.1| PREDICTED: probable protein phosphatase 2C 50 isoform X1 [Elaeis 
guineensis]
 ref|XP_010915191.1| PREDICTED: probable protein phosphatase 2C 50 isoform X1 [Elaeis 
guineensis]
Length=513

 Score =   288 bits (736),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 139/189 (74%), Positives = 168/189 (89%), Gaps = 0/189 (0%)
 Frame = -3

Query  959  EAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGKV  780
            E VGSTAVVA++C ++II+ANCGDSRAVLCRGK PM LSVDHKPNR+DEY+RIEA GGKV
Sbjct  321  ETVGSTAVVAVICSSHIIIANCGDSRAVLCRGKEPMALSVDHKPNRDDEYARIEAAGGKV  380

Query  779  INWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNEE  600
            I W+G+RV GVLA+SRSIGDRYL+P++IP PE+  VPR +EDECL+LASDGLWDVM+NEE
Sbjct  381  IQWNGYRVLGVLAMSRSIGDRYLKPWIIPEPEVRIVPRVREDECLILASDGLWDVMSNEE  440

Query  599  VCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVDL  420
            VCD AR+R+LLWHKKNG T  S +R +  DPAAQ A+EYL ++ALQ+GS+DNI++IVVDL
Sbjct  441  VCDAARKRILLWHKKNGITASSMQRGEGTDPAAQAASEYLAKLALQKGSKDNITIIVVDL  500

Query  419  KAQRKFKKK  393
            KAQRKFK+K
Sbjct  501  KAQRKFKRK  509



>ref|XP_009355509.1| PREDICTED: protein phosphatase 2C 16-like [Pyrus x bretschneideri]
 ref|XP_009355510.1| PREDICTED: protein phosphatase 2C 16-like [Pyrus x bretschneideri]
 ref|XP_009355511.1| PREDICTED: protein phosphatase 2C 16-like [Pyrus x bretschneideri]
 ref|XP_009355512.1| PREDICTED: protein phosphatase 2C 16-like [Pyrus x bretschneideri]
 ref|XP_009355513.1| PREDICTED: protein phosphatase 2C 16-like [Pyrus x bretschneideri]
Length=544

 Score =   288 bits (738),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 142/190 (75%), Positives = 167/190 (88%), Gaps = 1/190 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVA++  ++IIVANCGDSR+VLCRGK  +PLSVDHKPNREDEY RIEA GGK
Sbjct  355  PETVGSTAVVALVSSSHIIVANCGDSRSVLCRGKQAIPLSVDHKPNREDEYERIEASGGK  414

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+GHRV GVLA+SRSIGDRYL+P++IP PE+M VPRA++DECL+LASDGLWDVMTNE
Sbjct  415  VIQWNGHRVFGVLAMSRSIGDRYLKPWIIPEPEVMVVPRARDDECLILASDGLWDVMTNE  474

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            E C+VARRR+LLWHKKNG T ++ ER    DPAA +AA YL+ +ALQ+GS+DNISV+VVD
Sbjct  475  EACEVARRRILLWHKKNGVTPVA-ERGKGVDPAAGEAAAYLSTLALQKGSKDNISVVVVD  533

Query  422  LKAQRKFKKK  393
            LKAQRKFK K
Sbjct  534  LKAQRKFKSK  543



>ref|XP_006342957.1| PREDICTED: protein phosphatase 2C 16-like isoform X3 [Solanum 
tuberosum]
 ref|XP_006342958.1| PREDICTED: protein phosphatase 2C 16-like isoform X4 [Solanum 
tuberosum]
Length=481

 Score =   286 bits (733),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 145/191 (76%), Positives = 167/191 (87%), Gaps = 1/191 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVA++C ++IIVANCGDSRAVL RGK  + LS+DHKP+REDEY+RIEA GGK
Sbjct  292  PETVGSTAVVAVICSSHIIVANCGDSRAVLYRGKEAVALSIDHKPSREDEYARIEASGGK  351

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+GHRV GVLA+SRSIGDRYL+P++IP PE+MFVPRA+EDECLVLASDGLWDVMTNE
Sbjct  352  VIQWNGHRVFGVLAMSRSIGDRYLKPWIIPEPEVMFVPRAREDECLVLASDGLWDVMTNE  411

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            E C+VARRR+LLWHKKNG   L  ER    DPAAQ AAEYL+ +ALQ+GS+DNISVIVVD
Sbjct  412  EACEVARRRILLWHKKNGTNSLP-ERGQGVDPAAQAAAEYLSSMALQKGSKDNISVIVVD  470

Query  422  LKAQRKFKKKA  390
            LKA RKFK K+
Sbjct  471  LKAHRKFKSKS  481



>ref|XP_010049216.1| PREDICTED: probable protein phosphatase 2C 53 [Eucalyptus grandis]
 ref|XP_010049217.1| PREDICTED: probable protein phosphatase 2C 53 [Eucalyptus grandis]
 gb|KCW81711.1| hypothetical protein EUGRSUZ_C03066 [Eucalyptus grandis]
Length=549

 Score =   288 bits (738),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 144/191 (75%), Positives = 168/191 (88%), Gaps = 1/191 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVA++C ++I+VANCGDSRAVL RGK P+ LSVDHKPNREDEY+RIEA GGK
Sbjct  360  PETVGSTAVVAMICSSHIVVANCGDSRAVLYRGKEPIALSVDHKPNREDEYARIEAAGGK  419

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+GHRV GVLA+SRSIGDRYL+P++IP PE++FVPR +EDECLVLASDGLWDVMTNE
Sbjct  420  VIQWNGHRVFGVLAMSRSIGDRYLKPWIIPEPEVVFVPRTREDECLVLASDGLWDVMTNE  479

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            E CD+AR+RLLLWHKKNG T L   + +  DPAAQ AAEYL++ ALQ+GS+DNI+VIVVD
Sbjct  480  EACDLARKRLLLWHKKNGVTHLPN-KGEVVDPAAQAAAEYLSKCALQKGSKDNITVIVVD  538

Query  422  LKAQRKFKKKA  390
            LKAQRKFK K 
Sbjct  539  LKAQRKFKSKT  549



>ref|XP_009601902.1| PREDICTED: probable protein phosphatase 2C 53 isoform X1 [Nicotiana 
tomentosiformis]
Length=540

 Score =   288 bits (736),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 144/191 (75%), Positives = 167/191 (87%), Gaps = 1/191 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVAI+C ++IIV+NCGDSRAVLCRGK P+ LSVDHKPNREDEY RIEA GGK
Sbjct  351  PETVGSTAVVAIVCSSHIIVSNCGDSRAVLCRGKEPLALSVDHKPNREDEYERIEAAGGK  410

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+GHRV GVLA+SRSIGDRYL+P++IP PE+ F+PRAK+DECL+LASDGLWDVMTNE
Sbjct  411  VIQWNGHRVFGVLAMSRSIGDRYLKPWIIPDPEVTFIPRAKDDECLILASDGLWDVMTNE  470

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            EVCD+AR+R+L+WHKKN  T L  ER +  DPAAQ AAE L+  ALQ+GS+DNI+VIVVD
Sbjct  471  EVCDMARKRILMWHKKNSVT-LPMERGEGIDPAAQAAAECLSNRALQKGSKDNITVIVVD  529

Query  422  LKAQRKFKKKA  390
            LKAQRKFK K 
Sbjct  530  LKAQRKFKSKT  540



>ref|XP_007024551.1| ABI1 isoform 1 [Theobroma cacao]
 gb|EOY27173.1| ABI1 isoform 1 [Theobroma cacao]
Length=543

 Score =   288 bits (736),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 142/190 (75%), Positives = 166/190 (87%), Gaps = 1/190 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVA++C ++I+VANCGDSRAVLCRGK  M LS+DHKPNR+DEY+RIEA GGK
Sbjct  354  PETVGSTAVVALVCSSHIVVANCGDSRAVLCRGKEAMALSIDHKPNRDDEYARIEASGGK  413

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W GHRV GVLA+SRSIGDRYL+P++IP PE+MF+PRA+EDECL+LASDGLWDV++NE
Sbjct  414  VIQWKGHRVFGVLAMSRSIGDRYLKPWIIPEPEVMFIPRAREDECLILASDGLWDVISNE  473

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            E C+VARRR+LLWHKKNG   L  ER    DPAAQ AAEYL+ +A+Q+GS DNISVIVVD
Sbjct  474  EACEVARRRILLWHKKNGVPSLV-ERGKGIDPAAQAAAEYLSMLAVQKGSSDNISVIVVD  532

Query  422  LKAQRKFKKK  393
            LKAQRKFK K
Sbjct  533  LKAQRKFKSK  542



>ref|XP_009361654.1| PREDICTED: probable protein phosphatase 2C 6 isoform X2 [Pyrus 
x bretschneideri]
Length=418

 Score =   284 bits (726),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 139/190 (73%), Positives = 167/190 (88%), Gaps = 1/190 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE  GSTAVV ++CPT+IIVANCGDSRAVLCRGK+ +PLSVDHKP+REDEY+RIEA GGK
Sbjct  229  PETAGSTAVVTVICPTHIIVANCGDSRAVLCRGKVSVPLSVDHKPDREDEYARIEAAGGK  288

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+G RV GVLA SRSIGDRYL+P++IP PE++FV R KEDECL+LASDGLWD +TN+
Sbjct  289  VIQWNGSRVFGVLATSRSIGDRYLKPWIIPDPEVVFVSREKEDECLILASDGLWDFITNQ  348

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            E CD+AR+R+LLWHKK G TM S ER +  DPAAQ AA+YL+R+A+Q+GS+DNI+VIVVD
Sbjct  349  EACDIARKRILLWHKKYGDTM-STERGEGADPAAQSAADYLSRLAMQKGSKDNITVIVVD  407

Query  422  LKAQRKFKKK  393
            LK+ RKFKKK
Sbjct  408  LKSTRKFKKK  417



>ref|XP_009795186.1| PREDICTED: protein phosphatase 2C 16-like [Nicotiana sylvestris]
Length=538

 Score =   288 bits (736),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 145/190 (76%), Positives = 167/190 (88%), Gaps = 1/190 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVA++C ++I+V+NCGDSRAVL RGK  M LS+DHKP+REDEY+RIEA GGK
Sbjct  349  PETVGSTAVVAVICSSHIVVSNCGDSRAVLYRGKEAMALSIDHKPSREDEYARIEASGGK  408

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+GHRV GVLA+SRSIGDRYL+P++IP PEIMFVPRA+EDECLVLASDGLWDVM+NE
Sbjct  409  VIQWNGHRVFGVLAMSRSIGDRYLKPWIIPEPEIMFVPRAREDECLVLASDGLWDVMSNE  468

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            E C+VARRR+LLWHKKNG   L  ER    DPAAQ AAEYL+ +ALQ+GS+DNISVIVVD
Sbjct  469  EACEVARRRILLWHKKNGTNPLP-ERGQGVDPAAQAAAEYLSTMALQKGSKDNISVIVVD  527

Query  422  LKAQRKFKKK  393
            LKAQRKFK K
Sbjct  528  LKAQRKFKSK  537



>ref|XP_006342955.1| PREDICTED: protein phosphatase 2C 16-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006342956.1| PREDICTED: protein phosphatase 2C 16-like isoform X2 [Solanum 
tuberosum]
Length=545

 Score =   288 bits (736),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 145/191 (76%), Positives = 167/191 (87%), Gaps = 1/191 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVA++C ++IIVANCGDSRAVL RGK  + LS+DHKP+REDEY+RIEA GGK
Sbjct  356  PETVGSTAVVAVICSSHIIVANCGDSRAVLYRGKEAVALSIDHKPSREDEYARIEASGGK  415

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+GHRV GVLA+SRSIGDRYL+P++IP PE+MFVPRA+EDECLVLASDGLWDVMTNE
Sbjct  416  VIQWNGHRVFGVLAMSRSIGDRYLKPWIIPEPEVMFVPRAREDECLVLASDGLWDVMTNE  475

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            E C+VARRR+LLWHKKNG   L  ER    DPAAQ AAEYL+ +ALQ+GS+DNISVIVVD
Sbjct  476  EACEVARRRILLWHKKNGTNSLP-ERGQGVDPAAQAAAEYLSSMALQKGSKDNISVIVVD  534

Query  422  LKAQRKFKKKA  390
            LKA RKFK K+
Sbjct  535  LKAHRKFKSKS  545



>ref|XP_004287589.1| PREDICTED: protein phosphatase 2C 16 [Fragaria vesca subsp. vesca]
Length=347

 Score =   281 bits (719),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 141/191 (74%), Positives = 166/191 (87%), Gaps = 3/191 (2%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVA++CP++IIVANCGDSRAVL RG++ MPLSVDHKP+REDEY RIEA GGK
Sbjct  160  PETVGSTAVVAVVCPSHIIVANCGDSRAVLYRGRVAMPLSVDHKPDREDEYERIEAAGGK  219

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI WDG RV GVLA+SRSIGDRYL+P +IP PE+MFV R KEDECL+LASDGLWDV+TNE
Sbjct  220  VIQWDGSRVFGVLAMSRSIGDRYLKPSIIPDPEVMFVSREKEDECLILASDGLWDVITNE  279

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            E CD+ARRR+L+WHKK G T+   ER +  DPAA+ AA YLTR+A+Q+GS+DNI+V+VVD
Sbjct  280  EACDIARRRILVWHKKYGDTV---ERGEGADPAAEAAAVYLTRLAIQKGSKDNITVVVVD  336

Query  422  LKAQRKFKKKA  390
            LKA RKFKKK 
Sbjct  337  LKASRKFKKKT  347



>ref|XP_009798001.1| PREDICTED: probable protein phosphatase 2C 6 isoform X1 [Nicotiana 
sylvestris]
Length=538

 Score =   287 bits (734),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 144/191 (75%), Positives = 167/191 (87%), Gaps = 1/191 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVAI+C ++IIV+N GDSRAVLCRGK P+ LSVDHKPNREDEY RIEA GGK
Sbjct  349  PETVGSTAVVAIVCSSHIIVSNSGDSRAVLCRGKEPLALSVDHKPNREDEYERIEAAGGK  408

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+GHRV GVLA+SRSIGDRYL+P++IP PE+ F+PRAK+DECL+LASDGLWDVMTNE
Sbjct  409  VIQWNGHRVFGVLAMSRSIGDRYLKPWIIPDPEVTFIPRAKDDECLILASDGLWDVMTNE  468

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            EVCD+AR+R+L+WHKKNG T L  ER +  DPAAQ AAE L+  ALQ+GS+DNI+VIVVD
Sbjct  469  EVCDMARKRILMWHKKNGVT-LPMERGEGIDPAAQAAAECLSNRALQKGSKDNITVIVVD  527

Query  422  LKAQRKFKKKA  390
            LKAQRKFK K 
Sbjct  528  LKAQRKFKSKT  538



>ref|XP_010498129.1| PREDICTED: protein phosphatase 2C 7 [Camelina sativa]
Length=311

 Score =   280 bits (715),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 139/191 (73%), Positives = 164/191 (86%), Gaps = 1/191 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVA++C ++IIVANCGDSRAVL RGK  MPLSVDHKP+REDEY+RIE  GGK
Sbjct  122  PETVGSTAVVALVCSSHIIVANCGDSRAVLLRGKDSMPLSVDHKPDREDEYARIEKAGGK  181

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W G RVSGVLA+SRSIGD YL PYVIP PE+MF+PRA+EDECL+LASDGLWDVM+N+
Sbjct  182  VIQWQGARVSGVLAMSRSIGDEYLEPYVIPDPEVMFMPRAREDECLILASDGLWDVMSNQ  241

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            E CD AR+R+L WHKKNG   L+ ER    DPA Q AA+YL+++ALQ+GS+DNIS+IVVD
Sbjct  242  EACDFARKRILAWHKKNGALPLA-ERGVGEDPACQAAADYLSKLALQKGSKDNISIIVVD  300

Query  422  LKAQRKFKKKA  390
            LKAQRKFK ++
Sbjct  301  LKAQRKFKTRS  311



>ref|XP_009361653.1| PREDICTED: protein phosphatase 2C 77-like isoform X1 [Pyrus x 
bretschneideri]
Length=446

 Score =   284 bits (726),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 139/190 (73%), Positives = 167/190 (88%), Gaps = 1/190 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE  GSTAVV ++CPT+IIVANCGDSRAVLCRGK+ +PLSVDHKP+REDEY+RIEA GGK
Sbjct  257  PETAGSTAVVTVICPTHIIVANCGDSRAVLCRGKVSVPLSVDHKPDREDEYARIEAAGGK  316

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+G RV GVLA SRSIGDRYL+P++IP PE++FV R KEDECL+LASDGLWD +TN+
Sbjct  317  VIQWNGSRVFGVLATSRSIGDRYLKPWIIPDPEVVFVSREKEDECLILASDGLWDFITNQ  376

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            E CD+AR+R+LLWHKK G TM S ER +  DPAAQ AA+YL+R+A+Q+GS+DNI+VIVVD
Sbjct  377  EACDIARKRILLWHKKYGDTM-STERGEGADPAAQSAADYLSRLAMQKGSKDNITVIVVD  435

Query  422  LKAQRKFKKK  393
            LK+ RKFKKK
Sbjct  436  LKSTRKFKKK  445



>ref|XP_010318398.1| PREDICTED: protein phosphatase 2C ABI2 homolog isoform X2 [Solanum 
lycopersicum]
Length=480

 Score =   285 bits (729),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 143/191 (75%), Positives = 166/191 (87%), Gaps = 1/191 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVA++C ++IIVANCGDSRAVL RGK  + LS+DHKP+REDEY+RIEA GGK
Sbjct  291  PETVGSTAVVAVICSSHIIVANCGDSRAVLYRGKEAVALSIDHKPSREDEYARIEASGGK  350

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+GHRV GVLA+SRSIGDRYL+P++IP PE+MFVPRA+EDECLVLASDGLWDVMTNE
Sbjct  351  VIQWNGHRVFGVLAMSRSIGDRYLKPWIIPEPEVMFVPRAREDECLVLASDGLWDVMTNE  410

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            E C++ARRR+LLWHKKNG   L  ER    D AAQ AAEYL+ +ALQ+GS+DNISVIVVD
Sbjct  411  EACEMARRRILLWHKKNGTNPLP-ERGQGVDLAAQAAAEYLSSMALQKGSKDNISVIVVD  469

Query  422  LKAQRKFKKKA  390
            LKA RKFK K+
Sbjct  470  LKAHRKFKSKS  480



>ref|XP_008338708.1| PREDICTED: protein phosphatase 2C 16-like [Malus domestica]
 ref|XP_008338709.1| PREDICTED: protein phosphatase 2C 16-like [Malus domestica]
 ref|XP_008338710.1| PREDICTED: protein phosphatase 2C 16-like [Malus domestica]
Length=544

 Score =   286 bits (733),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 142/190 (75%), Positives = 166/190 (87%), Gaps = 1/190 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVA++  ++IIVANCGDSRAVLCRGK  MPLSVDHKPNREDEY RIEA GGK
Sbjct  355  PETVGSTAVVALVSSSHIIVANCGDSRAVLCRGKQAMPLSVDHKPNREDEYERIEASGGK  414

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+GHRV GVLA+SRSIGDRYL+P++IP PE+  VPRA++DECL+LASDGLWDV+TNE
Sbjct  415  VIQWNGHRVFGVLAMSRSIGDRYLKPWIIPEPEVTVVPRARDDECLILASDGLWDVITNE  474

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            E C+VARRR+LLWHKKNG T ++ ER    DPAA +AA YL+ +ALQ+GS+DNISV+VVD
Sbjct  475  EACEVARRRILLWHKKNGVTPVA-ERGKGVDPAAGEAAAYLSTLALQKGSKDNISVVVVD  533

Query  422  LKAQRKFKKK  393
            LKAQRKFK K
Sbjct  534  LKAQRKFKSK  543



>ref|NP_001234686.1| protein phosphatase 2C ABI2 homolog [Solanum lycopersicum]
 dbj|BAI39595.1| protein phosphatase 2C ABI2 homolog [Solanum lycopersicum]
Length=544

 Score =   286 bits (733),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 143/191 (75%), Positives = 166/191 (87%), Gaps = 1/191 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVA++C ++IIVANCGDSRAVL RGK  + LS+DHKP+REDEY+RIEA GGK
Sbjct  355  PETVGSTAVVAVICSSHIIVANCGDSRAVLYRGKEAVALSIDHKPSREDEYARIEASGGK  414

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+GHRV GVLA+SRSIGDRYL+P++IP PE+MFVPRA+EDECLVLASDGLWDVMTNE
Sbjct  415  VIQWNGHRVFGVLAMSRSIGDRYLKPWIIPEPEVMFVPRAREDECLVLASDGLWDVMTNE  474

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            E C++ARRR+LLWHKKNG   L  ER    D AAQ AAEYL+ +ALQ+GS+DNISVIVVD
Sbjct  475  EACEMARRRILLWHKKNGTNPLP-ERGQGVDLAAQAAAEYLSSMALQKGSKDNISVIVVD  533

Query  422  LKAQRKFKKKA  390
            LKA RKFK K+
Sbjct  534  LKAHRKFKSKS  544



>gb|EYU45874.1| hypothetical protein MIMGU_mgv1a005458mg [Erythranthe guttata]
Length=483

 Score =   285 bits (728),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 144/191 (75%), Positives = 165/191 (86%), Gaps = 1/191 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVA++  ++I+VANCGDSRAVL RGK  +PLSVDHKPNREDEY+RIEA GGK
Sbjct  294  PETVGSTAVVAVVSSSHIVVANCGDSRAVLYRGKEAIPLSVDHKPNREDEYARIEAAGGK  353

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+GHRV GVLA+SRSIGDRYL+P +IP PE+MFVPRA+EDECLVLASDGLWDVMTNE
Sbjct  354  VIQWNGHRVLGVLAMSRSIGDRYLKPSIIPEPEVMFVPRAREDECLVLASDGLWDVMTNE  413

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            E CDVARRR+L+WHKKNG   L  +R    DPAAQ AAEYL  +ALQ GS+DNISVIVVD
Sbjct  414  EACDVARRRILIWHKKNGAHPLV-DRGQGVDPAAQAAAEYLCNLALQEGSQDNISVIVVD  472

Query  422  LKAQRKFKKKA  390
            LK++RKFK K+
Sbjct  473  LKSRRKFKSKS  483



>ref|XP_010318395.1| PREDICTED: protein phosphatase 2C ABI2 homolog isoform X1 [Solanum 
lycopersicum]
 ref|XP_010318396.1| PREDICTED: protein phosphatase 2C ABI2 homolog isoform X1 [Solanum 
lycopersicum]
 ref|XP_010318397.1| PREDICTED: protein phosphatase 2C ABI2 homolog isoform X1 [Solanum 
lycopersicum]
Length=544

 Score =   286 bits (732),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 143/191 (75%), Positives = 166/191 (87%), Gaps = 1/191 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVA++C ++IIVANCGDSRAVL RGK  + LS+DHKP+REDEY+RIEA GGK
Sbjct  355  PETVGSTAVVAVICSSHIIVANCGDSRAVLYRGKEAVALSIDHKPSREDEYARIEASGGK  414

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+GHRV GVLA+SRSIGDRYL+P++IP PE+MFVPRA+EDECLVLASDGLWDVMTNE
Sbjct  415  VIQWNGHRVFGVLAMSRSIGDRYLKPWIIPEPEVMFVPRAREDECLVLASDGLWDVMTNE  474

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            E C++ARRR+LLWHKKNG   L  ER    D AAQ AAEYL+ +ALQ+GS+DNISVIVVD
Sbjct  475  EACEMARRRILLWHKKNGTNPLP-ERGQGVDLAAQAAAEYLSSMALQKGSKDNISVIVVD  533

Query  422  LKAQRKFKKKA  390
            LKA RKFK K+
Sbjct  534  LKAHRKFKSKS  544



>gb|KJB56947.1| hypothetical protein B456_009G143300 [Gossypium raimondii]
Length=494

 Score =   285 bits (728),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 141/190 (74%), Positives = 167/190 (88%), Gaps = 1/190 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVA++C ++I+VANCGDSRAVLCRGK  M LS DHKP+R+DEY+RIEA GGK
Sbjct  305  PETVGSTAVVALVCSSHIVVANCGDSRAVLCRGKEAMALSSDHKPSRDDEYARIEASGGK  364

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+GHRV GVLA+SRSIGDRYL+P++IP PE+MF+PRA+EDECL+LASDGLWDV++NE
Sbjct  365  VIQWNGHRVFGVLAMSRSIGDRYLKPWIIPEPEVMFIPRAREDECLILASDGLWDVISNE  424

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            E C+VARRR+LLWHKKNG   L  ER    DPAAQ AAEYL+ +A+Q+GSRDNISVIVVD
Sbjct  425  EACEVARRRILLWHKKNGVPSLV-ERGKGIDPAAQAAAEYLSMLAIQKGSRDNISVIVVD  483

Query  422  LKAQRKFKKK  393
            LKA+RKFK K
Sbjct  484  LKARRKFKSK  493



>ref|XP_009616042.1| PREDICTED: protein phosphatase 2C 16-like [Nicotiana tomentosiformis]
Length=538

 Score =   286 bits (731),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 143/190 (75%), Positives = 167/190 (88%), Gaps = 1/190 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVA++C ++I+V+NCGDSRAVL RGK  M LS+DHKP+REDEY+RIEA GGK
Sbjct  349  PETVGSTAVVAVICSSHIVVSNCGDSRAVLYRGKEAMALSIDHKPSREDEYARIEASGGK  408

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+GHRV GVLA+SRSIGDRYL+P++IP PE+MFVPRA+EDECLVLASDGLWDVM+NE
Sbjct  409  VIQWNGHRVFGVLAMSRSIGDRYLKPWIIPEPEVMFVPRAREDECLVLASDGLWDVMSNE  468

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            E C+VARRR+LLWHKKNG   L  ER    DPAAQ AAEYL+ +ALQ+GS+DNISVIVVD
Sbjct  469  EACEVARRRILLWHKKNGTNPLP-ERGQGVDPAAQAAAEYLSSMALQKGSKDNISVIVVD  527

Query  422  LKAQRKFKKK  393
            LK+QRKFK K
Sbjct  528  LKSQRKFKSK  537



>ref|XP_007136858.1| hypothetical protein PHAVU_009G079600g [Phaseolus vulgaris]
 gb|ESW08852.1| hypothetical protein PHAVU_009G079600g [Phaseolus vulgaris]
Length=547

 Score =   286 bits (732),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 145/191 (76%), Positives = 168/191 (88%), Gaps = 2/191 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVA++C ++I+V+NCGDSRAVLCRGK PM LSVDHKPNR DEY+RI+A GG+
Sbjct  348  PETVGSTAVVAVICSSHIVVSNCGDSRAVLCRGKEPMALSVDHKPNRPDEYARIDAAGGR  407

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+GHRV GVLA+SRSIGDRYL+P++IP PE+ FVPRAK+DECL+LASDGLWDVMTNE
Sbjct  408  VIQWNGHRVFGVLAMSRSIGDRYLKPWIIPDPEVKFVPRAKDDECLILASDGLWDVMTNE  467

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            EVCD+ARRR+LLWHKKN G  L  ER D  DPAAQ AAEYL+  ALQ+GS+DNI+VIVVD
Sbjct  468  EVCDIARRRILLWHKKN-GLALPSERGDGIDPAAQAAAEYLSNRALQKGSKDNITVIVVD  526

Query  422  LKAQR-KFKKK  393
            LKAQR KFK K
Sbjct  527  LKAQRKKFKSK  537



>gb|EYU21346.1| hypothetical protein MIMGU_mgv1a006033mg [Erythranthe guttata]
Length=460

 Score =   283 bits (725),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 139/190 (73%), Positives = 166/190 (87%), Gaps = 0/190 (0%)
 Frame = -3

Query  959  EAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGKV  780
            E VGSTAVVA++C ++IIVANCGDSRAVL RGK  + LSVDHKPNREDEY+RIEA GGKV
Sbjct  271  ETVGSTAVVAVVCSSHIIVANCGDSRAVLYRGKEVVALSVDHKPNREDEYARIEASGGKV  330

Query  779  INWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNEE  600
            I W+GHRV GVLA+SR+IGDRYL+P++IP PEIMFVPRA+EDECLVLA+DGLWDVMTNEE
Sbjct  331  IPWNGHRVFGVLAMSRAIGDRYLKPWIIPEPEIMFVPRAREDECLVLATDGLWDVMTNEE  390

Query  599  VCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVDL  420
            VC+VAR+R+L+WHKKNG      +R    D AAQ AA+YL+ +A+Q+GS+DNIS+IVVDL
Sbjct  391  VCEVARKRILIWHKKNGTNYPLADRGRGVDLAAQAAADYLSNLAIQKGSKDNISIIVVDL  450

Query  419  KAQRKFKKKA  390
            KAQRKFK K+
Sbjct  451  KAQRKFKSKS  460



>ref|XP_008808934.1| PREDICTED: probable protein phosphatase 2C 50 [Phoenix dactylifera]
Length=510

 Score =   285 bits (728),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 139/190 (73%), Positives = 166/190 (87%), Gaps = 0/190 (0%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVA++C ++II+ANCGDSR VLCRGK P+ LSVDHKPNR+DEY+RIEA GGK
Sbjct  320  PETVGSTAVVAVICSSHIIIANCGDSRVVLCRGKEPVALSVDHKPNRDDEYARIEAAGGK  379

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+G+RV GVLA+SRSIGDRYL+P++IP PE+  VPR +EDECL+LASDGLWDVM+NE
Sbjct  380  VIQWNGYRVLGVLAMSRSIGDRYLKPWIIPDPEVTIVPRVREDECLILASDGLWDVMSNE  439

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            EVCD ARRR+LLWHKKNG T  +  R +  DPAAQ AAEYL ++ALQ+GS+DNI++IVVD
Sbjct  440  EVCDAARRRILLWHKKNGVTASTMRRGEGADPAAQAAAEYLEKLALQKGSKDNITIIVVD  499

Query  422  LKAQRKFKKK  393
            LKAQRKFK K
Sbjct  500  LKAQRKFKSK  509



>ref|XP_010526048.1| PREDICTED: probable protein phosphatase 2C 50 [Tarenaya hassleriana]
 ref|XP_010526049.1| PREDICTED: probable protein phosphatase 2C 50 [Tarenaya hassleriana]
 ref|XP_010526050.1| PREDICTED: probable protein phosphatase 2C 50 [Tarenaya hassleriana]
Length=496

 Score =   284 bits (727),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 139/190 (73%), Positives = 166/190 (87%), Gaps = 0/190 (0%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVAI+C ++IIVANCGDSRAVLCRGK P+ LSVDHKPNREDEYSRIEA GGK
Sbjct  305  PETVGSTAVVAIICSSHIIVANCGDSRAVLCRGKEPVALSVDHKPNREDEYSRIEAAGGK  364

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            +I W+GHRV GVLA+SRSIGDRYL+P++IP PE++F PRAK+D+CL+LASDGLWDVMTNE
Sbjct  365  IIEWNGHRVFGVLAMSRSIGDRYLKPWIIPDPEVVFCPRAKDDDCLILASDGLWDVMTNE  424

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            E C+VAR+R+++WHKKNG   L R+R    DPAAQ AAEYL+  ALQ+GS+DNI+V+VVD
Sbjct  425  EACEVARKRIMVWHKKNGVEGLPRDRGKGVDPAAQSAAEYLSNRALQKGSKDNITVVVVD  484

Query  422  LKAQRKFKKK  393
            LKAQR+  K 
Sbjct  485  LKAQRRKSKN  494



>ref|NP_001056498.1| Os05g0592800 [Oryza sativa Japonica Group]
 sp|Q6L4R7.1|P2C53_ORYSJ RecName: Full=Probable protein phosphatase 2C 53; Short=OsPP2C53; 
Flags: Precursor [Oryza sativa Japonica Group]
 gb|AAT44303.1| putative protein phosphatase 2C ABI2 [Oryza sativa Japonica Group]
 dbj|BAF18412.1| Os05g0592800 [Oryza sativa Japonica Group]
 dbj|BAG90506.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE64901.1| hypothetical protein OsJ_19760 [Oryza sativa Japonica Group]
Length=445

 Score =   283 bits (723),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 137/194 (71%), Positives = 169/194 (87%), Gaps = 3/194 (2%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            P+ VGSTAVVA++C +++IVANCGDSRAVLCRGK P+PLS+DHKPNREDEY+RIEALGGK
Sbjct  252  PDTVGSTAVVAVVCSSHVIVANCGDSRAVLCRGKQPLPLSLDHKPNREDEYARIEALGGK  311

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+G+RV GVLA+SRSIGD+YL+PY+IPVPE+  V RAK+D+CL+LASDGLWDVM+NE
Sbjct  312  VIQWNGYRVLGVLAMSRSIGDKYLKPYIIPVPEVTVVARAKDDDCLILASDGLWDVMSNE  371

Query  602  EVCDVARRRLLLWHKKNGGTMLSRE---RSddpdpaaqdaAEYLTRIALQRGSRDNISVI  432
            EVCD AR+R+LLWHKKN  T  +       D  DPAAQ AA+YL+++ALQ+GS+DNI+V+
Sbjct  372  EVCDAARKRILLWHKKNAATASTSSAQISGDSSDPAAQAAADYLSKLALQKGSKDNITVV  431

Query  431  VVDLKAQRKFKKKA  390
            V+DLKA RKFK KA
Sbjct  432  VIDLKAHRKFKSKA  445



>gb|EAY99256.1| hypothetical protein OsI_21218 [Oryza sativa Indica Group]
Length=448

 Score =   283 bits (723),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 137/194 (71%), Positives = 169/194 (87%), Gaps = 3/194 (2%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            P+ VGSTAVVA++C +++IVANCGDSRAVLCRGK P+PLS+DHKPNREDEY+RIEALGGK
Sbjct  255  PDTVGSTAVVAVVCSSHVIVANCGDSRAVLCRGKQPLPLSLDHKPNREDEYARIEALGGK  314

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+G+RV GVLA+SRSIGD+YL+PY+IPVPE+  V RAK+D+CL+LASDGLWDVM+NE
Sbjct  315  VIQWNGYRVLGVLAMSRSIGDKYLKPYIIPVPEVTVVARAKDDDCLILASDGLWDVMSNE  374

Query  602  EVCDVARRRLLLWHKKNGGTMLSRE---RSddpdpaaqdaAEYLTRIALQRGSRDNISVI  432
            EVCD AR+R+LLWHKKN  T  +       D  DPAAQ AA+YL+++ALQ+GS+DNI+V+
Sbjct  375  EVCDAARKRILLWHKKNAATASTSSAQISGDSSDPAAQAAADYLSKLALQKGSKDNITVV  434

Query  431  VVDLKAQRKFKKKA  390
            V+DLKA RKFK KA
Sbjct  435  VIDLKAHRKFKSKA  448



>ref|XP_009802371.1| PREDICTED: probable protein phosphatase 2C 6 [Nicotiana sylvestris]
Length=530

 Score =   285 bits (729),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 143/189 (76%), Positives = 166/189 (88%), Gaps = 1/189 (1%)
 Frame = -3

Query  959  EAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGKV  780
            E VGSTAVVAI+C ++IIVANCGDSRAVLCRGK PM LSVDHKPNREDEY+RIEA GGKV
Sbjct  342  ETVGSTAVVAIVCSSHIIVANCGDSRAVLCRGKEPMALSVDHKPNREDEYARIEAAGGKV  401

Query  779  INWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNEE  600
            I W+GHRV GVLA+SRSIGDRYL+P++IP PE+MF+PR K+DECL+LASDGLWDVM+NEE
Sbjct  402  IQWNGHRVFGVLAMSRSIGDRYLKPWIIPDPEVMFIPRTKDDECLILASDGLWDVMSNEE  461

Query  599  VCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVDL  420
             C++AR+R+LLWHKKNG T L+ ER    DPAAQ AAE L+  A Q+GS+DNI+VIVVDL
Sbjct  462  ACELARKRILLWHKKNGVT-LTLERGQGIDPAAQAAAECLSNRATQKGSKDNITVIVVDL  520

Query  419  KAQRKFKKK  393
            KAQRKFK K
Sbjct  521  KAQRKFKSK  529



>ref|XP_006596068.1| PREDICTED: protein phosphatase 2C 16-like isoform X1 [Glycine 
max]
 ref|XP_006596069.1| PREDICTED: protein phosphatase 2C 16-like isoform X2 [Glycine 
max]
 ref|XP_006596070.1| PREDICTED: protein phosphatase 2C 16-like isoform X3 [Glycine 
max]
 gb|KHN31791.1| Protein phosphatase 2C 16 [Glycine soja]
Length=557

 Score =   285 bits (730),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 140/191 (73%), Positives = 166/191 (87%), Gaps = 0/191 (0%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVA++C ++IIVANCGDSRAVLCRGK PM LSVDHKPNR+DEY+RIEA GGK
Sbjct  367  PETVGSTAVVAVICASHIIVANCGDSRAVLCRGKEPMALSVDHKPNRDDEYARIEAAGGK  426

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+GHRV GVLA+SRSIGDRYL+P++IP PE+ FVPR K+DECL+LASDGLWDVMTNE
Sbjct  427  VIQWNGHRVFGVLAMSRSIGDRYLKPWIIPEPEVTFVPRTKDDECLILASDGLWDVMTNE  486

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            EVCD+AR+R++LW+KKNG    S +R +  DPAAQ AAEYL+  ALQ+GS+DNI+VIVVD
Sbjct  487  EVCDLARKRIILWYKKNGLEQPSSKRGEGIDPAAQAAAEYLSNRALQKGSKDNITVIVVD  546

Query  422  LKAQRKFKKKA  390
            LK  RK+K K 
Sbjct  547  LKPYRKYKSKT  557



>ref|XP_011100856.1| PREDICTED: probable protein phosphatase 2C 50 [Sesamum indicum]
Length=546

 Score =   285 bits (729),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 141/191 (74%), Positives = 168/191 (88%), Gaps = 1/191 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVAI+C ++IIVANCGDSRAVLCRGK PM LSVDHKPNREDEY+RIEA GGK
Sbjct  357  PETVGSTAVVAIVCSSHIIVANCGDSRAVLCRGKEPMALSVDHKPNREDEYARIEASGGK  416

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+GHRV GVLA+SRSIGDRYL+P++IP PE+M VPR +ED+CL+LASDGLWDV+TNE
Sbjct  417  VIQWNGHRVFGVLAMSRSIGDRYLKPWIIPDPEVMIVPRTREDDCLILASDGLWDVLTNE  476

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            EVCD+AR+R+LLWHKKN  T +  +R +  DPAAQ AAEYL+  ALQ+GS+DNISV+V+D
Sbjct  477  EVCDIARKRILLWHKKNAAT-VPLQRGEGIDPAAQAAAEYLSNRALQKGSKDNISVVVLD  535

Query  422  LKAQRKFKKKA  390
            LKAQRK K ++
Sbjct  536  LKAQRKIKNRS  546



>emb|CDP08300.1| unnamed protein product [Coffea canephora]
Length=545

 Score =   285 bits (729),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 142/191 (74%), Positives = 167/191 (87%), Gaps = 1/191 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVA++C ++IIVANCGDSRAVLCRGK PM LS+DHKPNR DEY+RIEA GGK
Sbjct  356  PETVGSTAVVALVCSSHIIVANCGDSRAVLCRGKEPMALSIDHKPNRGDEYARIEAAGGK  415

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+GHRV GVLA+SRSIGDRYL+P++IP PE+MF+PR K+DECL+LASDGLWDVMTNE
Sbjct  416  VIQWNGHRVFGVLAMSRSIGDRYLKPWIIPDPEVMFIPRTKDDECLILASDGLWDVMTNE  475

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            EVCD AR+R+L+WHKKNG T L   R +  DPAAQ AAE L+  A+Q+GS+DNI+VIVVD
Sbjct  476  EVCDTARKRILVWHKKNGVT-LPLGRGEGVDPAAQAAAECLSNRAIQKGSKDNITVIVVD  534

Query  422  LKAQRKFKKKA  390
            LKAQRKFK K+
Sbjct  535  LKAQRKFKSKS  545



>ref|XP_011079888.1| PREDICTED: protein phosphatase 2C 16-like [Sesamum indicum]
 ref|XP_011079897.1| PREDICTED: protein phosphatase 2C 16-like [Sesamum indicum]
 ref|XP_011079905.1| PREDICTED: protein phosphatase 2C 16-like [Sesamum indicum]
Length=543

 Score =   285 bits (728),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 141/190 (74%), Positives = 166/190 (87%), Gaps = 1/190 (1%)
 Frame = -3

Query  959  EAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGKV  780
            E VGSTAVVA++  ++IIV NCGDSRAVL RGK  + LS+DHKPNREDEY+RIEA GGKV
Sbjct  355  ETVGSTAVVAVVSSSHIIVGNCGDSRAVLYRGKEAIALSIDHKPNREDEYARIEASGGKV  414

Query  779  INWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNEE  600
            I W+GHRV GVLA+SRSIGDRYL+P++IP PE+MFVPRA+EDECLVLASDGLWDVMTNEE
Sbjct  415  IQWNGHRVFGVLAMSRSIGDRYLKPWIIPEPEVMFVPRAREDECLVLASDGLWDVMTNEE  474

Query  599  VCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVDL  420
            VC+VAR+R+L+WHKKNG   L+  R    DPAAQ AAEYL+ +A+QRGS+DNIS+IVVDL
Sbjct  475  VCEVARKRILIWHKKNGTNSLAN-RGQGVDPAAQAAAEYLSNLAMQRGSKDNISIIVVDL  533

Query  419  KAQRKFKKKA  390
            KAQRKFK K+
Sbjct  534  KAQRKFKSKS  543



>gb|AIG52106.1| 2C-type protein phosphatase protein [Zea mays]
Length=484

 Score =   283 bits (723),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 140/191 (73%), Positives = 169/191 (88%), Gaps = 1/191 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVA++C ++IIV+NCGDSRAVLCRGK P+PLSVDHKPNREDEY+RIEA GGK
Sbjct  293  PETVGSTAVVAVICSSHIIVSNCGDSRAVLCRGKQPVPLSVDHKPNREDEYARIEAEGGK  352

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+G+RV GVLA+SRSIGDRYL+P++IPVPE+  VPRAK+DECL+LASDGLWDVM+NE
Sbjct  353  VIQWNGYRVFGVLAMSRSIGDRYLKPWIIPVPEVTIVPRAKDDECLILASDGLWDVMSNE  412

Query  602  EVCDVARRRLLLWHKKNGGTMLSRER-SddpdpaaqdaAEYLTRIALQRGSRDNISVIVV  426
            EVC++AR+R+LLWHKKN  +  S  R  D  D AAQ AAE L+++ALQ+GS+DNI+V+VV
Sbjct  413  EVCEIARKRILLWHKKNSTSSSSAPRVGDSADSAAQAAAECLSKLALQKGSKDNITVVVV  472

Query  425  DLKAQRKFKKK  393
            DLKAQRKFK K
Sbjct  473  DLKAQRKFKSK  483



>ref|XP_010527050.1| PREDICTED: probable protein phosphatase 2C 53 [Tarenaya hassleriana]
 ref|XP_010527051.1| PREDICTED: probable protein phosphatase 2C 53 [Tarenaya hassleriana]
Length=519

 Score =   284 bits (726),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 140/191 (73%), Positives = 167/191 (87%), Gaps = 2/191 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            P+ VGSTAVVAI+C ++IIVANCGDSRAVLCRGK P+ LSVDHKPNREDEY RIEA GGK
Sbjct  331  PDTVGSTAVVAIICSSHIIVANCGDSRAVLCRGKEPIALSVDHKPNREDEYVRIEAAGGK  390

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            +I W+GHRV GVLA+SRSIGDRYL+P++IP PE++F PR K+D+CL+LASDGLWDVMTNE
Sbjct  391  IIQWNGHRVFGVLAMSRSIGDRYLKPWIIPDPEVVFCPRTKDDDCLILASDGLWDVMTNE  450

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            E C++AR+R++LWHKKNG +  SR R    DPAAQ AAEYL+  ALQ+GS+DNI+VIVVD
Sbjct  451  EACELARKRIMLWHKKNGLSGSSRGRD--VDPAAQSAAEYLSNRALQKGSKDNITVIVVD  508

Query  422  LKAQRKFKKKA  390
            LKAQRKFK K+
Sbjct  509  LKAQRKFKNKS  519



>tpg|DAA58703.1| TPA: putative protein phosphatase 2C family protein [Zea mays]
 gb|AIB06017.1| orphans transcription factor, partial [Zea mays]
Length=484

 Score =   283 bits (723),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 140/191 (73%), Positives = 169/191 (88%), Gaps = 1/191 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVA++C ++IIV+NCGDSRAVLCRGK P+PLSVDHKPNREDEY+RIEA GGK
Sbjct  293  PETVGSTAVVAVICSSHIIVSNCGDSRAVLCRGKQPVPLSVDHKPNREDEYARIEAEGGK  352

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+G+RV GVLA+SRSIGDRYL+P++IPVPE+  VPRAK+DECL+LASDGLWDVM+NE
Sbjct  353  VIQWNGYRVFGVLAMSRSIGDRYLKPWIIPVPEVTIVPRAKDDECLILASDGLWDVMSNE  412

Query  602  EVCDVARRRLLLWHKKNGGTMLSRER-SddpdpaaqdaAEYLTRIALQRGSRDNISVIVV  426
            EVC++AR+R+LLWHKKN  +  S  R  D  D AAQ AAE L+++ALQ+GS+DNI+V+VV
Sbjct  413  EVCEIARKRILLWHKKNSTSSSSAPRVGDSADSAAQAAAECLSKLALQKGSKDNITVVVV  472

Query  425  DLKAQRKFKKK  393
            DLKAQRKFK K
Sbjct  473  DLKAQRKFKSK  483



>ref|NP_001147858.1| LOC100281468 [Zea mays]
 gb|ACG28912.1| protein phosphatase 2C ABI2 [Zea mays]
Length=484

 Score =   283 bits (723),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 140/191 (73%), Positives = 169/191 (88%), Gaps = 1/191 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVA++C ++IIV+NCGDSRAVLCRGK P+PLSVDHKPNREDEY+RIEA GGK
Sbjct  293  PETVGSTAVVAVICSSHIIVSNCGDSRAVLCRGKQPVPLSVDHKPNREDEYARIEAEGGK  352

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+G+RV GVLA+SRSIGDRYL+P++IPVPE+  VPRAK+DECL+LASDGLWDVM+NE
Sbjct  353  VIQWNGYRVFGVLAMSRSIGDRYLKPWIIPVPEVTIVPRAKDDECLILASDGLWDVMSNE  412

Query  602  EVCDVARRRLLLWHKKNGGTMLSRER-SddpdpaaqdaAEYLTRIALQRGSRDNISVIVV  426
            EVC++AR+R+LLWHKKN  +  S  R  D  D AAQ AAE L+++ALQ+GS+DNI+V+VV
Sbjct  413  EVCEIARKRILLWHKKNSTSSSSAPRVGDSADSAAQAAAECLSKLALQKGSKDNITVVVV  472

Query  425  DLKAQRKFKKK  393
            DLKAQRKFK K
Sbjct  473  DLKAQRKFKSK  483



>ref|XP_004498842.1| PREDICTED: protein phosphatase 2C 16-like isoform X1 [Cicer arietinum]
 ref|XP_004498843.1| PREDICTED: protein phosphatase 2C 16-like isoform X2 [Cicer arietinum]
 ref|XP_004498844.1| PREDICTED: protein phosphatase 2C 16-like isoform X3 [Cicer arietinum]
 ref|XP_004498845.1| PREDICTED: protein phosphatase 2C 16-like isoform X4 [Cicer arietinum]
Length=546

 Score =   285 bits (728),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 142/191 (74%), Positives = 167/191 (87%), Gaps = 1/191 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVA++C ++IIVANCGDSRAVLCRGK P+ LSVDHKPNREDEY+RIEA GGK
Sbjct  357  PETVGSTAVVALICSSHIIVANCGDSRAVLCRGKEPIALSVDHKPNREDEYARIEAAGGK  416

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+GHRV GVLA+SRSIGDRYL+P++IP PE+ F+PRAKEDECL+LASDGLWDVMTNE
Sbjct  417  VIQWNGHRVFGVLAMSRSIGDRYLKPWIIPEPEVQFLPRAKEDECLILASDGLWDVMTNE  476

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            EVCD+AR+R+LLW+KKN    L  ER +  DPAAQ AAE+L+  ALQ+GS+DNI+VIVVD
Sbjct  477  EVCDLARKRILLWYKKN-NLELPLERGEGIDPAAQAAAEFLSNRALQKGSKDNITVIVVD  535

Query  422  LKAQRKFKKKA  390
            LK QRK+K K 
Sbjct  536  LKPQRKYKSKT  546



>ref|XP_006342498.1| PREDICTED: probable protein phosphatase 2C 6-like [Solanum tuberosum]
Length=536

 Score =   284 bits (727),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 140/191 (73%), Positives = 165/191 (86%), Gaps = 1/191 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVA++C ++IIVANCGDSRAVLCRGK PM LSVDHKPNREDEY RIEA GGK
Sbjct  345  PETVGSTAVVAVVCSSHIIVANCGDSRAVLCRGKEPMALSVDHKPNREDEYKRIEAAGGK  404

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+GHRV GVLA+SRSIGD+YL+P++IP PE+ F+PR K+D+CL+LASDGLWDVMTNE
Sbjct  405  VIQWNGHRVFGVLAMSRSIGDKYLKPWIIPDPEVTFIPRTKDDDCLILASDGLWDVMTNE  464

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            E CD+AR+R+L+WHKK G T L  ER +  DPA+Q AAE L+  ALQ+GS+DNI+VIVVD
Sbjct  465  EACDMARKRILMWHKKYGAT-LPVERGEGIDPASQAAAECLSNRALQKGSKDNITVIVVD  523

Query  422  LKAQRKFKKKA  390
            LKAQRKFK K 
Sbjct  524  LKAQRKFKTKT  534



>ref|XP_010696551.1| PREDICTED: probable protein phosphatase 2C 50 [Beta vulgaris 
subsp. vulgaris]
Length=497

 Score =   283 bits (724),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 139/190 (73%), Positives = 165/190 (87%), Gaps = 1/190 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVAI+CPT+IIVANCGDSRAVLCRGK PMPLSVDHKP+R+DE  RIEA  GK
Sbjct  308  PETVGSTAVVAIVCPTHIIVANCGDSRAVLCRGKAPMPLSVDHKPDRKDELDRIEAADGK  367

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+G+RV GVLA+SRSIGDRYL+P++IP PE+  V RAK+D+CL+LASDGLWDV+TNE
Sbjct  368  VIQWNGYRVFGVLAMSRSIGDRYLKPWIIPDPEVTIVQRAKDDDCLILASDGLWDVLTNE  427

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            EVCD ARRR+LLWHKKNG   +S +R +  D AAQ AA+YL+++ALQ+GS+DNI+VIVVD
Sbjct  428  EVCDAARRRILLWHKKNGAN-ISSDRGNSIDLAAQAAADYLSKLALQKGSKDNITVIVVD  486

Query  422  LKAQRKFKKK  393
            LK  RKFK K
Sbjct  487  LKPNRKFKTK  496



>ref|XP_003588912.1| Abscisic insensitive 1B [Medicago truncatula]
 gb|AES59163.1| protein phosphatase 2C family protein [Medicago truncatula]
Length=553

 Score =   285 bits (728),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 143/191 (75%), Positives = 165/191 (86%), Gaps = 1/191 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVA++  ++IIVANCGDSRAVLCRGK PM LSVDHKPNREDEY+RIEA GGK
Sbjct  364  PETVGSTAVVALISSSHIIVANCGDSRAVLCRGKEPMALSVDHKPNREDEYARIEAAGGK  423

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+GHRV GVLA+SRSIGDRYL+P +IP PE+ F+PRAKEDECL+LASDGLWDVMTNE
Sbjct  424  VIQWNGHRVFGVLAMSRSIGDRYLKPSIIPDPEVQFIPRAKEDECLILASDGLWDVMTNE  483

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            EVCD+AR+R+LLW+KKN G  L  ER +  DPAAQ AAE L+  ALQ+GS+DNI+VIVVD
Sbjct  484  EVCDLARKRILLWYKKN-GMELPSERGEGSDPAAQAAAELLSNRALQKGSKDNITVIVVD  542

Query  422  LKAQRKFKKKA  390
            LK QRK+K K 
Sbjct  543  LKPQRKYKNKT  553



>ref|XP_008388296.1| PREDICTED: protein phosphatase 2C 77-like [Malus domestica]
 ref|XP_008388301.1| PREDICTED: protein phosphatase 2C 77-like [Malus domestica]
Length=418

 Score =   280 bits (717),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 138/190 (73%), Positives = 163/190 (86%), Gaps = 1/190 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE  GS AVV ++CPT+IIVANCGDSRAVLCRGK  +PLSVDHKP+REDEY+RIEA GG+
Sbjct  229  PETAGSXAVVTVICPTHIIVANCGDSRAVLCRGKASLPLSVDHKPDREDEYARIEAAGGR  288

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+G RV GVLA SRSIGD YL+P++IP PE++FV R KEDECL+LASDGLWD +TN+
Sbjct  289  VIQWNGSRVFGVLATSRSIGDXYLKPWIIPDPEVVFVSREKEDECLILASDGLWDFITNQ  348

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            E CD+ARRR+LLWHKK G TM S ER +  DPAAQ AAEYL+R+A+Q+GS+DNI+VIVVD
Sbjct  349  EACDIARRRILLWHKKYGDTM-STERGEGADPAAQSAAEYLSRLAMQKGSKDNITVIVVD  407

Query  422  LKAQRKFKKK  393
            LK  RKFKKK
Sbjct  408  LKPTRKFKKK  417



>ref|XP_002516100.1| protein phosphatase 2c, putative [Ricinus communis]
 gb|EEF46102.1| protein phosphatase 2c, putative [Ricinus communis]
Length=550

 Score =   284 bits (726),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 143/190 (75%), Positives = 166/190 (87%), Gaps = 2/190 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVAI+C ++IIVANCGDSRAVL RGK PM LSVDHKPNREDEY+RIEA GGK
Sbjct  362  PETVGSTAVVAIICSSHIIVANCGDSRAVLYRGKEPMALSVDHKPNREDEYARIEAAGGK  421

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+GHRV GVLA+SRSIGDRYL+P++IP PE+MF+PR KEDECL+LASDGLWDV++NE
Sbjct  422  VIPWNGHRVFGVLAMSRSIGDRYLKPWIIPEPEVMFIPRTKEDECLILASDGLWDVISNE  481

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            E CD+ARRR+L+WHKKNG  + +  R D  DPAAQ AAEYL+  ALQ+GS+DNI+VIVVD
Sbjct  482  EACDLARRRILVWHKKNGSALPT--RGDGIDPAAQAAAEYLSNRALQKGSKDNITVIVVD  539

Query  422  LKAQRKFKKK  393
            LKAQRK K K
Sbjct  540  LKAQRKLKSK  549



>ref|XP_004501450.1| PREDICTED: protein phosphatase 2C 16-like isoform X1 [Cicer arietinum]
 ref|XP_004501451.1| PREDICTED: protein phosphatase 2C 16-like isoform X2 [Cicer arietinum]
Length=551

 Score =   284 bits (726),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 142/191 (74%), Positives = 166/191 (87%), Gaps = 1/191 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVAI+C ++IIV+NCGDSRAVLCRGK  M LS+DHKPNR+DEY+RIE  GGK
Sbjct  362  PETVGSTAVVAIVCSSHIIVSNCGDSRAVLCRGKEAMALSIDHKPNRDDEYARIEEAGGK  421

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+GHRV GVLA+SRSIGDRYL+P++IP PE+ F+PRAK DECL+LASDGLWDVMTNE
Sbjct  422  VIQWNGHRVFGVLAMSRSIGDRYLKPWIIPEPEVTFLPRAKGDECLILASDGLWDVMTNE  481

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            E CD+ARRR+LLWHKKN G+ LS  R +  DPAAQ AAEYL+  ALQ+GS+DNI+VIVVD
Sbjct  482  EACDLARRRILLWHKKN-GSELSSIRGEGIDPAAQAAAEYLSNRALQKGSKDNITVIVVD  540

Query  422  LKAQRKFKKKA  390
            LK+QRKFK K 
Sbjct  541  LKSQRKFKTKT  551



>ref|XP_010476912.1| PREDICTED: protein phosphatase 2C 7 [Camelina sativa]
Length=514

 Score =   283 bits (723),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 138/191 (72%), Positives = 163/191 (85%), Gaps = 1/191 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVA++C ++IIVANCGDSRAVL RGK  MPLSVDHKP+REDEY+RIE  GGK
Sbjct  325  PETVGSTAVVALVCSSHIIVANCGDSRAVLLRGKDSMPLSVDHKPDREDEYARIEKAGGK  384

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W G RVSGVLA+SRSIGD YL PYVIP PE+MF+PRA+EDECL+LASDGLWDVM+N+
Sbjct  385  VIQWQGARVSGVLAMSRSIGDEYLEPYVIPDPEVMFMPRAREDECLILASDGLWDVMSNQ  444

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            E CD AR+R+L WHKKNG   L+ ER    D A Q AA+YL+++ALQ+GS+DNIS+IVVD
Sbjct  445  EACDFARKRILAWHKKNGALPLA-ERGVGEDHACQAAADYLSKLALQKGSKDNISIIVVD  503

Query  422  LKAQRKFKKKA  390
            LKAQRKFK ++
Sbjct  504  LKAQRKFKTRS  514



>gb|EPS72036.1| hypothetical protein M569_02722, partial [Genlisea aurea]
Length=323

 Score =   276 bits (707),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 137/190 (72%), Positives = 164/190 (86%), Gaps = 3/190 (2%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVV+I+C ++IIVANCGDSRAVLCRGK P+PLS+DHKPNREDEY+RIEA GGK
Sbjct  137  PETVGSTAVVSIVCSSHIIVANCGDSRAVLCRGKDPIPLSIDHKPNREDEYARIEASGGK  196

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+GHRV GVLA+SRSIGDRYL+P++IP PE+ FVPR +EDECL+LASDGLWDVM+NE
Sbjct  197  VIQWNGHRVFGVLAMSRSIGDRYLKPWIIPDPEVRFVPRTREDECLILASDGLWDVMSNE  256

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            E C++AR+R+LLWHK N   +   ER    DPAAQ AAEYL+  A+Q+GS+DNI+V+VVD
Sbjct  257  EACEMARKRILLWHKNNAVPL---ERGGGIDPAAQAAAEYLSNRAMQKGSKDNITVVVVD  313

Query  422  LKAQRKFKKK  393
            LK QRKFK K
Sbjct  314  LKGQRKFKSK  323



>ref|XP_006475507.1| PREDICTED: protein phosphatase 2C 77-like [Citrus sinensis]
Length=411

 Score =   280 bits (715),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 142/193 (74%), Positives = 167/193 (87%), Gaps = 1/193 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE  GSTAVVAI+ PT IIVANCGDSRAVLCRGK+P+PLSVDHKP+REDE +RIEA GGK
Sbjct  220  PETAGSTAVVAIISPTLIIVANCGDSRAVLCRGKVPVPLSVDHKPDREDELARIEAAGGK  279

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+G RV GVLA+SRSIGDRYL+P++IP P++MFVPRAKED+CL+LASDGLWDVM NE
Sbjct  280  VIQWNGSRVFGVLAMSRSIGDRYLKPWIIPDPDVMFVPRAKEDDCLILASDGLWDVMNNE  339

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            E CDVARRR+LLW+KK+G T L   R D  DPAAQ AA+YL ++A+ +GS+DNI+VIVVD
Sbjct  340  EACDVARRRILLWYKKHGDT-LPATRGDRIDPAAQAAADYLAKLAMHKGSKDNITVIVVD  398

Query  422  LKAQRKFKKKA*C  384
            LKAQRK K+K  C
Sbjct  399  LKAQRKIKRKTLC  411



>ref|XP_007012743.1| Phosphatase 2C family protein, putative isoform 1 [Theobroma 
cacao]
 ref|XP_007012744.1| Phosphatase 2C family protein, putative isoform 1 [Theobroma 
cacao]
 ref|XP_007012745.1| Phosphatase 2C family protein, putative isoform 1 [Theobroma 
cacao]
 gb|EOY30362.1| Phosphatase 2C family protein, putative isoform 1 [Theobroma 
cacao]
 gb|EOY30363.1| Phosphatase 2C family protein, putative isoform 1 [Theobroma 
cacao]
 gb|EOY30364.1| Phosphatase 2C family protein, putative isoform 1 [Theobroma 
cacao]
Length=545

 Score =   283 bits (725),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 144/190 (76%), Positives = 168/190 (88%), Gaps = 1/190 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE  GSTAVVAI+  T+IIVANCGDSRAVL  GK PMPLSVDHKP+REDE +RIEA GGK
Sbjct  356  PETAGSTAVVAIISSTHIIVANCGDSRAVLYHGKFPMPLSVDHKPDREDERARIEAAGGK  415

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W G RV GVLA+SRSIGDRYL+P++IP PE+MFVPRAKEDECL+LASDGLWDV+TNE
Sbjct  416  VIQWKGSRVFGVLAMSRSIGDRYLKPWIIPDPEVMFVPRAKEDECLILASDGLWDVITNE  475

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            E C+VAR+++LLWHKK+ G  LS ER ++ DPAAQ AAEYL+R+AL++GS+DNI+VIVVD
Sbjct  476  EACEVARKQILLWHKKH-GDKLSAERGEEVDPAAQAAAEYLSRLALRKGSKDNITVIVVD  534

Query  422  LKAQRKFKKK  393
            LKAQRKFKKK
Sbjct  535  LKAQRKFKKK  544



>ref|XP_009410773.1| PREDICTED: probable protein phosphatase 2C 6 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009410774.1| PREDICTED: probable protein phosphatase 2C 6 [Musa acuminata 
subsp. malaccensis]
Length=534

 Score =   283 bits (724),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 139/192 (72%), Positives = 172/192 (90%), Gaps = 1/192 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVA++C ++II+ANCGDSRAVLCRGK P+PLSVDHKPNREDEY+RIEA GGK
Sbjct  343  PETVGSTAVVAVICSSHIIIANCGDSRAVLCRGKQPVPLSVDHKPNREDEYARIEAQGGK  402

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI+W+G+RV GVLA+SRSIGD YL+P++IPVPE+  VPR +EDECL+LASDGLWDVM+NE
Sbjct  403  VIHWNGYRVFGVLAMSRSIGDHYLKPWIIPVPEVTIVPRCREDECLILASDGLWDVMSNE  462

Query  602  EVCDVARRRLLLWHKKNG-GTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVV  426
            EVCD+ARRR+LLWHKKNG  +     R ++ DPAAQ AA++L+++A+Q+GS+DNI+VIVV
Sbjct  463  EVCDIARRRILLWHKKNGIVSSPVNHRGEEADPAAQAAADFLSKLAIQKGSKDNITVIVV  522

Query  425  DLKAQRKFKKKA  390
            DLKAQRKFK K+
Sbjct  523  DLKAQRKFKTKS  534



>ref|XP_002441622.1| hypothetical protein SORBIDRAFT_09g030600 [Sorghum bicolor]
 gb|EES20052.1| hypothetical protein SORBIDRAFT_09g030600 [Sorghum bicolor]
Length=400

 Score =   279 bits (713),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 139/191 (73%), Positives = 167/191 (87%), Gaps = 1/191 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            P+ VGSTAV A++C +++IVANCGDSRAVLCRGK P+ LSVDHKPNREDEY+RIEA GGK
Sbjct  209  PDTVGSTAVAALVCSSHVIVANCGDSRAVLCRGKQPLTLSVDHKPNREDEYARIEAQGGK  268

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VINW+G+RV GVLA+SRSIGDRYL+PYVIPVPE+  V RAK+DECL++ASDGLWDVM+NE
Sbjct  269  VINWNGYRVLGVLAMSRSIGDRYLKPYVIPVPEVTIVARAKDDECLIIASDGLWDVMSNE  328

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERS-ddpdpaaqdaAEYLTRIALQRGSRDNISVIVV  426
            EVCD AR+R+LLWHKKN     S +RS D  D AAQ AAEYL+++ALQ+GS+DNI+VIVV
Sbjct  329  EVCDAARKRILLWHKKNADASSSAQRSGDSADEAAQAAAEYLSKLALQKGSKDNITVIVV  388

Query  425  DLKAQRKFKKK  393
            DLK+ RKFK +
Sbjct  389  DLKSHRKFKSR  399



>emb|CBI27871.3| unnamed protein product [Vitis vinifera]
Length=368

 Score =   278 bits (710),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 138/190 (73%), Positives = 166/190 (87%), Gaps = 1/190 (1%)
 Frame = -3

Query  959  EAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGKV  780
            E VGSTAVV I+C T+IIVANCGDSRAVLCRGK+P+PLS+DHKP+REDEY+RIEA GGK+
Sbjct  178  ETVGSTAVVTIICQTHIIVANCGDSRAVLCRGKVPVPLSIDHKPSREDEYARIEAAGGKI  237

Query  779  INWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNEE  600
            I WDG RV GVLA+SRSIGDRYL+P++IP PE+M++PR KEDECL+LASDGLWDVMTN+E
Sbjct  238  IQWDGLRVCGVLAMSRSIGDRYLKPWIIPDPEVMYIPREKEDECLILASDGLWDVMTNQE  297

Query  599  VCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVDL  420
            VCD ARRR+LLWHKKNG    + ER    DPAAQ AAE L+++ALQ+GS+DNI+V+VVDL
Sbjct  298  VCDTARRRILLWHKKNGHNPPA-ERGRGVDPAAQAAAECLSKLALQKGSKDNITVVVVDL  356

Query  419  KAQRKFKKKA  390
            K +RK K+K 
Sbjct  357  KPRRKLKRKT  366



>ref|XP_010314822.1| PREDICTED: probable protein phosphatase 2C 53 isoform X2 [Solanum 
lycopersicum]
Length=454

 Score =   280 bits (716),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 138/188 (73%), Positives = 164/188 (87%), Gaps = 1/188 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVA++C ++IIVANCGDSRAVLCRGK PM LSVDHKPNREDEY RIEA GGK
Sbjct  259  PETVGSTAVVAVVCSSHIIVANCGDSRAVLCRGKEPMALSVDHKPNREDEYKRIEAAGGK  318

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+GHRV GVLA+SRSIGD+YL+P++IP PE+ F+PR K+D+CL+LASDGLWDVMTNE
Sbjct  319  VIQWNGHRVFGVLAMSRSIGDKYLKPWIIPDPEVTFIPRTKDDKCLILASDGLWDVMTNE  378

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            E CD+AR+R+L+WHKK G T L  ER +  DPA+Q AAE L+  ALQ+GS+DNI+VIVVD
Sbjct  379  EACDMARKRILMWHKKYGAT-LPVERGEGIDPASQAAAECLSNRALQKGSKDNITVIVVD  437

Query  422  LKAQRKFK  399
            LKAQ+KFK
Sbjct  438  LKAQKKFK  445



>ref|XP_002521368.1| protein phosphatase 2c, putative [Ricinus communis]
 gb|EEF41036.1| protein phosphatase 2c, putative [Ricinus communis]
Length=536

 Score =   282 bits (722),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 139/191 (73%), Positives = 170/191 (89%), Gaps = 2/191 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVA++C ++IIVANCGDSRAVL RGK  + LS+DHKPNREDEY+RIEA GGK
Sbjct  348  PETVGSTAVVALVCSSHIIVANCGDSRAVLYRGKESIALSIDHKPNREDEYARIEASGGK  407

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+GHRV GVLA+SRSIGDRYL+P++IP PE+MFVPRA++DECL+LASDGLWDVM+N+
Sbjct  408  VIQWNGHRVFGVLAMSRSIGDRYLKPWIIPEPEVMFVPRARDDECLILASDGLWDVMSND  467

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            E C+ AR+R+LLWHKKNG T L+ ER  + DPA+Q AA+YL+ +A+Q+GS+DNISVIVVD
Sbjct  468  EACEAARKRILLWHKKNGATPLA-ERG-NGDPASQAAADYLSMLAMQKGSKDNISVIVVD  525

Query  422  LKAQRKFKKKA  390
            LKAQRKFK K+
Sbjct  526  LKAQRKFKTKS  536



>ref|XP_002890234.1| hypothetical protein ARALYDRAFT_889163 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66493.1| hypothetical protein ARALYDRAFT_889163 [Arabidopsis lyrata subsp. 
lyrata]
Length=514

 Score =   281 bits (720),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 138/191 (72%), Positives = 162/191 (85%), Gaps = 1/191 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVA++C ++IIV+NCGDSRAVL RGK  MPLSVDHKP+REDEY+RIE  GGK
Sbjct  325  PETVGSTAVVALVCSSHIIVSNCGDSRAVLLRGKDSMPLSVDHKPDREDEYARIEKAGGK  384

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W G RVSGVLA+SRSIGD YL PYVIP PE+ F+PRA+EDECL+LASDGLWDVM+N+
Sbjct  385  VIQWQGARVSGVLAMSRSIGDEYLEPYVIPDPEVTFMPRAREDECLILASDGLWDVMSNQ  444

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            E CD ARRR+L WHKKNG   L+ ER    D A Q AAEYL+++ALQ+GS+DNIS+IVVD
Sbjct  445  EACDFARRRILAWHKKNGALPLA-ERGVGEDHACQAAAEYLSKLALQKGSKDNISIIVVD  503

Query  422  LKAQRKFKKKA  390
            LKAQRKFK ++
Sbjct  504  LKAQRKFKTRS  514



>ref|XP_009392933.1| PREDICTED: probable protein phosphatase 2C 6 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009392934.1| PREDICTED: probable protein phosphatase 2C 6 [Musa acuminata 
subsp. malaccensis]
Length=524

 Score =   281 bits (720),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 140/190 (74%), Positives = 167/190 (88%), Gaps = 0/190 (0%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            P+ VGSTAVVA++  ++II+ANCGDSRAVLCRGK PMPLSVDHKPNREDEY+RIEA GGK
Sbjct  335  PDTVGSTAVVAVISSSHIIIANCGDSRAVLCRGKQPMPLSVDHKPNREDEYTRIEAQGGK  394

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+G+RV GVLA+SRSIGDRYL+P++IP PEI FV RA+EDECL++ASDGLWDVM+NE
Sbjct  395  VIQWNGYRVFGVLAMSRSIGDRYLKPWIIPEPEITFVQRAREDECLIVASDGLWDVMSNE  454

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            EVCDVARRR+LLWHKKNG    S  R    DPAAQ AA+ L+++AL++GS+DNI++IVVD
Sbjct  455  EVCDVARRRILLWHKKNGPVPPSTPRGKQADPAAQAAADCLSKLALKKGSKDNITIIVVD  514

Query  422  LKAQRKFKKK  393
            LKAQRKFK K
Sbjct  515  LKAQRKFKNK  524



>ref|XP_010049444.1| PREDICTED: protein phosphatase 2C 77 [Eucalyptus grandis]
 ref|XP_010049445.1| PREDICTED: protein phosphatase 2C 77 [Eucalyptus grandis]
 gb|KCW82034.1| hypothetical protein EUGRSUZ_C03407 [Eucalyptus grandis]
 gb|KCW82035.1| hypothetical protein EUGRSUZ_C03407 [Eucalyptus grandis]
Length=528

 Score =   281 bits (719),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 143/190 (75%), Positives = 166/190 (87%), Gaps = 1/190 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVV ++C T+II+ANCGDSRAVL RGK  +PLSVDHKPNREDE +RIEA GG+
Sbjct  327  PETVGSTAVVGLVCSTHIIIANCGDSRAVLYRGKETVPLSVDHKPNREDECARIEAAGGR  386

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI WDG RV GVLA+SR+IGDRYL+P +IP PE++F PRAKEDECL+LASDGLWDV+TNE
Sbjct  387  VILWDGFRVCGVLAMSRAIGDRYLKPSIIPDPEVVFFPRAKEDECLILASDGLWDVVTNE  446

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            E CD+ARRR+LLWHKKNG   L  ER +  DPAAQ AA+YL+++ALQRGSRDNISVIV+D
Sbjct  447  EACDMARRRILLWHKKNGDN-LPVERGEGADPAAQAAADYLSKLALQRGSRDNISVIVID  505

Query  422  LKAQRKFKKK  393
            LKAQRKFKKK
Sbjct  506  LKAQRKFKKK  515



>ref|XP_002455844.1| hypothetical protein SORBIDRAFT_03g026070 [Sorghum bicolor]
 gb|EES00964.1| hypothetical protein SORBIDRAFT_03g026070 [Sorghum bicolor]
Length=482

 Score =   280 bits (715),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 141/191 (74%), Positives = 169/191 (88%), Gaps = 1/191 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVA++C ++IIV+NCGDSRAVL RGK P+PLSVDHKPNREDEY+RIEA GGK
Sbjct  291  PETVGSTAVVAVICSSHIIVSNCGDSRAVLYRGKQPVPLSVDHKPNREDEYARIEAEGGK  350

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+G+RV GVLA+SRSIGDRYL+P++IPVPE+  VPRAKEDECL+LASDGLWDVM+NE
Sbjct  351  VIQWNGYRVFGVLAMSRSIGDRYLKPWIIPVPEVTIVPRAKEDECLILASDGLWDVMSNE  410

Query  602  EVCDVARRRLLLWHKKNGGTMLSRER-SddpdpaaqdaAEYLTRIALQRGSRDNISVIVV  426
            EVC+VAR+R+LLWHKKNG +  S  R  D  DPAAQ AAE L+++A+Q+GS+DNI+V+VV
Sbjct  411  EVCEVARKRILLWHKKNGTSSSSAPRVGDSADPAAQAAAECLSKLAVQKGSKDNITVVVV  470

Query  425  DLKAQRKFKKK  393
            DLKA RKFK K
Sbjct  471  DLKAHRKFKSK  481



>emb|CDO97881.1| unnamed protein product [Coffea canephora]
Length=528

 Score =   281 bits (719),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 142/186 (76%), Positives = 164/186 (88%), Gaps = 1/186 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVAILC ++IIVANCGDSRAVL RGK  + LS+DHKPNREDEY+RIEA GGK
Sbjct  333  PETVGSTAVVAILCSSHIIVANCGDSRAVLYRGKEAVVLSIDHKPNREDEYARIEASGGK  392

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+GHRV GVLA+SRSIGDRYL+P++IP PE+MF+PRA+EDECLVLASDGLWDVMTNE
Sbjct  393  VIQWNGHRVFGVLAMSRSIGDRYLKPWIIPTPEVMFLPRAREDECLVLASDGLWDVMTNE  452

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            E C+VARRR+LLWHKKNG   L  ER    DPAAQ AAEYL+ +ALQ+GS+D+ISVIV+D
Sbjct  453  EACEVARRRILLWHKKNGTNPLP-ERGQGYDPAAQAAAEYLSMLALQKGSKDDISVIVID  511

Query  422  LKAQRK  405
            LKA+RK
Sbjct  512  LKARRK  517



>ref|XP_004253091.1| PREDICTED: probable protein phosphatase 2C 53 isoform X1 [Solanum 
lycopersicum]
Length=540

 Score =   281 bits (719),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 138/188 (73%), Positives = 164/188 (87%), Gaps = 1/188 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVA++C ++IIVANCGDSRAVLCRGK PM LSVDHKPNREDEY RIEA GGK
Sbjct  345  PETVGSTAVVAVVCSSHIIVANCGDSRAVLCRGKEPMALSVDHKPNREDEYKRIEAAGGK  404

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+GHRV GVLA+SRSIGD+YL+P++IP PE+ F+PR K+D+CL+LASDGLWDVMTNE
Sbjct  405  VIQWNGHRVFGVLAMSRSIGDKYLKPWIIPDPEVTFIPRTKDDKCLILASDGLWDVMTNE  464

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            E CD+AR+R+L+WHKK G T L  ER +  DPA+Q AAE L+  ALQ+GS+DNI+VIVVD
Sbjct  465  EACDMARKRILMWHKKYGAT-LPVERGEGIDPASQAAAECLSNRALQKGSKDNITVIVVD  523

Query  422  LKAQRKFK  399
            LKAQ+KFK
Sbjct  524  LKAQKKFK  531



>ref|XP_010925038.1| PREDICTED: probable protein phosphatase 2C 6 isoform X1 [Elaeis 
guineensis]
 ref|XP_010925039.1| PREDICTED: probable protein phosphatase 2C 6 isoform X1 [Elaeis 
guineensis]
Length=499

 Score =   280 bits (716),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 141/190 (74%), Positives = 166/190 (87%), Gaps = 0/190 (0%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVA++C ++IIVANCGDSRAVLCRGK P+ LSVDHKPNREDEY+RIEA GGK
Sbjct  309  PETVGSTAVVAVICSSHIIVANCGDSRAVLCRGKQPVSLSVDHKPNREDEYARIEAEGGK  368

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+G+RV GVLA+SRSIGDRYL+P++IPVPE+  VPR KED+CLVLASDGLWDVM+NE
Sbjct  369  VIQWNGYRVFGVLAMSRSIGDRYLKPWIIPVPEVTIVPRTKEDDCLVLASDGLWDVMSNE  428

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            EVCDVARRR+L WHKKNG T    +R ++ DPAAQ AA  L++ ALQ+GS+DNI++IVVD
Sbjct  429  EVCDVARRRILSWHKKNGVTTSPIQRGEEADPAAQAAAGCLSKHALQKGSKDNITIIVVD  488

Query  422  LKAQRKFKKK  393
            LK QRKFK K
Sbjct  489  LKCQRKFKSK  498



>gb|AFW79364.1| putative protein phosphatase 2C family protein [Zea mays]
 gb|AIB06016.1| orphans transcription factor, partial [Zea mays]
 gb|AIG52105.1| 2C-type protein phosphatase protein [Zea mays]
Length=459

 Score =   278 bits (712),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 138/192 (72%), Positives = 167/192 (87%), Gaps = 1/192 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            P+ VGSTAVVA++C +++IVANCGDSRAVLCRGK P+ LSVDHKPNREDEY+RIEA GGK
Sbjct  268  PDTVGSTAVVALVCSSHVIVANCGDSRAVLCRGKQPVALSVDHKPNREDEYARIEAQGGK  327

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VINW+G+RV GVLA+SRSIGDRYL+PY+IPVPE+  V RAK+DECL++ASDGLWDVM+NE
Sbjct  328  VINWNGYRVLGVLAMSRSIGDRYLKPYIIPVPEVTIVARAKDDECLIIASDGLWDVMSNE  387

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddp-dpaaqdaAEYLTRIALQRGSRDNISVIVV  426
            EVCD AR+R+LLWHKKN     S +RS D  D AAQ AAEYL+++AL +GS+DNI+VIVV
Sbjct  388  EVCDAARKRILLWHKKNSDASSSAQRSGDSPDEAAQAAAEYLSKLALHKGSKDNITVIVV  447

Query  425  DLKAQRKFKKKA  390
            DLK+ RK K +A
Sbjct  448  DLKSHRKIKSRA  459



>ref|XP_006654873.1| PREDICTED: probable protein phosphatase 2C 53-like [Oryza brachyantha]
Length=443

 Score =   278 bits (711),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 134/194 (69%), Positives = 166/194 (86%), Gaps = 3/194 (2%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            P+ VGSTAVVA++C ++IIVANCGDSRAVLCR K P+PLS+DHKPNREDEY+RIEA GGK
Sbjct  250  PDTVGSTAVVAVVCSSHIIVANCGDSRAVLCRAKQPLPLSLDHKPNREDEYARIEAQGGK  309

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+G+RV GVLA+SRSIGD+YL+PY+IPVPE+  V RA++D+CL+LASDGLWDVM+NE
Sbjct  310  VIQWNGYRVLGVLAMSRSIGDKYLKPYIIPVPEVTVVARARDDDCLILASDGLWDVMSNE  369

Query  602  EVCDVARRRLLLWHKKNGGTMLSRE---RSddpdpaaqdaAEYLTRIALQRGSRDNISVI  432
            EVCD AR+R+LLWHKKN GT  +          DPAAQ AA+YL+++ALQ+GS+DNI+V+
Sbjct  370  EVCDAARKRILLWHKKNAGTASTSSAQISGASSDPAAQAAADYLSKLALQKGSKDNITVV  429

Query  431  VVDLKAQRKFKKKA  390
            V+DLKA RK K KA
Sbjct  430  VIDLKAHRKLKSKA  443



>emb|CDX83901.1| BnaC08g17440D [Brassica napus]
Length=350

 Score =   275 bits (703),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 136/191 (71%), Positives = 162/191 (85%), Gaps = 1/191 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVA++C ++IIV+NCGDSRAVL RGK  MPLSVDHKP+REDEY+RIE  GGK
Sbjct  161  PETVGSTAVVALVCSSHIIVSNCGDSRAVLLRGKESMPLSVDHKPDREDEYARIERAGGK  220

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W G RVSGVLA+SRSIGD+YL PYVIP PE+ F+PRA+EDECL+LASDGLWDVM+N+
Sbjct  221  VIQWQGARVSGVLAMSRSIGDQYLEPYVIPEPEVTFMPRAREDECLILASDGLWDVMSNQ  280

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            + C+ ARRR+L WH+KNG   L+ ER    D A Q AA+YL+++ALQ+GSRDNISVIVVD
Sbjct  281  DACEFARRRILWWHRKNGALPLA-ERGVGEDQACQAAADYLSKLALQKGSRDNISVIVVD  339

Query  422  LKAQRKFKKKA  390
            LKAQRK K +A
Sbjct  340  LKAQRKLKIRA  350



>ref|XP_010062674.1| PREDICTED: protein phosphatase 2C 16-like isoform X1 [Eucalyptus 
grandis]
 gb|KCW69805.1| hypothetical protein EUGRSUZ_F03166 [Eucalyptus grandis]
Length=545

 Score =   281 bits (718),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 140/190 (74%), Positives = 163/190 (86%), Gaps = 0/190 (0%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVA++C ++IIVANCGDSRAVL RGK  MPLSVDHKP+ E EY+RI+A GGK
Sbjct  339  PETVGSTAVVALVCSSHIIVANCGDSRAVLLRGKEAMPLSVDHKPDTEKEYARIDAAGGK  398

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+G+RV GVLA+SRSIGDRYL+P++IP PE+ FVPRA+EDECL++ASDGLWDVMTNE
Sbjct  399  VIQWNGYRVFGVLAMSRSIGDRYLKPWIIPEPEVTFVPRAREDECLIVASDGLWDVMTNE  458

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            E C+VARRR+LLWHKKNG      ER    DPAAQ AAEYL+ +AL +GS+DNISVIVVD
Sbjct  459  EACEVARRRILLWHKKNGVPSSPLERGKGVDPAAQAAAEYLSVLALDKGSKDNISVIVVD  518

Query  422  LKAQRKFKKK  393
            LKAQRKFK K
Sbjct  519  LKAQRKFKSK  528



>gb|KJB07280.1| hypothetical protein B456_001G013500 [Gossypium raimondii]
Length=471

 Score =   278 bits (712),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 139/191 (73%), Positives = 167/191 (87%), Gaps = 1/191 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVA++ PT+IIVAN GDSRAVL RGK PMPLSVDHKP+REDE++RIEA GGK
Sbjct  282  PETVGSTAVVAVVSPTHIIVANSGDSRAVLYRGKHPMPLSVDHKPDREDEHARIEAAGGK  341

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+G RV GVLA+SRSIGDRYL+P++IP PE+MFVPR KEDECL+LASDGLWDV++NE
Sbjct  342  VIQWNGSRVFGVLAMSRSIGDRYLKPWIIPNPEVMFVPRVKEDECLILASDGLWDVISNE  401

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            E C+VAR+R+LLWHKK+ G  L  ER +  D AAQ AA+YL+++AL +GS+DNI+VIV+D
Sbjct  402  EACEVARKRILLWHKKH-GDKLPAERGEGIDLAAQSAADYLSKLALSKGSKDNITVIVLD  460

Query  422  LKAQRKFKKKA  390
            LKAQRKFKKK 
Sbjct  461  LKAQRKFKKKT  471



>ref|XP_003565810.1| PREDICTED: probable protein phosphatase 2C 53 [Brachypodium distachyon]
Length=424

 Score =   277 bits (708),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 136/190 (72%), Positives = 168/190 (88%), Gaps = 1/190 (1%)
 Frame = -3

Query  959  EAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGKV  780
            + VGSTAVVA++C ++++VANCGDSRAVLCRGK P+PLS+DHKPNREDEY+RIEALGGKV
Sbjct  224  DTVGSTAVVAVVCSSHVVVANCGDSRAVLCRGKEPVPLSLDHKPNREDEYARIEALGGKV  283

Query  779  INWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNEE  600
            I W+G+RV GVLA+SRSIGDRYL+PY+IPVPE+  V RA++DECLVLASDGLWDV++NEE
Sbjct  284  IQWNGYRVLGVLAMSRSIGDRYLKPYIIPVPEVTVVARARDDECLVLASDGLWDVLSNEE  343

Query  599  VCDVARRRLLLWHKKNGGTMLSR-ERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            VCD AR+R+LLWHKKN    ++R      PDPAAQ AAEYL+++ALQ+GS+DNI+V+VVD
Sbjct  344  VCDAARKRILLWHKKNATAAVARGSDGGSPDPAAQAAAEYLSKLALQKGSKDNITVLVVD  403

Query  422  LKAQRKFKKK  393
            LKA RKF+ K
Sbjct  404  LKAHRKFRSK  413



>dbj|BAH56780.1| AT1G72770 [Arabidopsis thaliana]
Length=310

 Score =   273 bits (698),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 134/189 (71%), Positives = 163/189 (86%), Gaps = 1/189 (1%)
 Frame = -3

Query  959  EAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGKV  780
            E VGSTAVVA++C ++I+V+NCGDSRAVL RGK  MPLSVDHKP+REDEY+RIE  GGKV
Sbjct  122  ETVGSTAVVALVCSSHIVVSNCGDSRAVLFRGKEAMPLSVDHKPDREDEYARIENAGGKV  181

Query  779  INWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNEE  600
            I W G RV GVLA+SRSIGDRYL+PYVIP PE+ F+PR++EDECL+LASDGLWDVM N+E
Sbjct  182  IQWQGARVFGVLAMSRSIGDRYLKPYVIPEPEVTFMPRSREDECLILASDGLWDVMNNQE  241

Query  599  VCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVDL  420
            VC++ARRR+L+WHKKNG   L+ ER    DPA Q AA+YL+ +ALQ+GS+DNIS+IV+DL
Sbjct  242  VCEIARRRILMWHKKNGAPPLA-ERGKGIDPACQAAADYLSMLALQKGSKDNISIIVIDL  300

Query  419  KAQRKFKKK  393
            KAQRKFK +
Sbjct  301  KAQRKFKTR  309



>gb|KHF98958.1| Protein phosphatase 2C 77 -like protein [Gossypium arboreum]
Length=471

 Score =   278 bits (712),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 139/191 (73%), Positives = 167/191 (87%), Gaps = 1/191 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVA++ PT+IIVAN GDSRAVL RGK PMPLSVDHKP+REDE++RIEA GGK
Sbjct  282  PETVGSTAVVAVVSPTHIIVANSGDSRAVLYRGKHPMPLSVDHKPDREDEHARIEAAGGK  341

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+G RV GVLA+SRSIGDRYL+P++IP PE+MFVPR KEDECL+LASDGLWDV++NE
Sbjct  342  VIQWNGSRVLGVLAMSRSIGDRYLKPWIIPNPEVMFVPRVKEDECLILASDGLWDVISNE  401

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            E C+VAR+R+LLWHKK+ G  L  ER +  D AAQ AA+YL+++AL +GS+DNI+VIV+D
Sbjct  402  EACEVARKRILLWHKKH-GDKLPAERGEGIDLAAQSAADYLSKLALSKGSKDNITVIVLD  460

Query  422  LKAQRKFKKKA  390
            LKAQRKFKKK 
Sbjct  461  LKAQRKFKKKT  471



>ref|XP_008808224.1| PREDICTED: probable protein phosphatase 2C 6 [Phoenix dactylifera]
Length=498

 Score =   279 bits (713),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 139/190 (73%), Positives = 167/190 (88%), Gaps = 0/190 (0%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE  GSTAVVA++C ++IIVANCGDSRAVLCRGK P+PLSVDHKPNREDEY+RIEA GGK
Sbjct  308  PETAGSTAVVAVICSSHIIVANCGDSRAVLCRGKRPLPLSVDHKPNREDEYARIEAEGGK  367

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+G+RV GVLA+SRSIGDRYL+P++IP PE+  VPR KED+CLVLASDGLWDVM+NE
Sbjct  368  VIQWNGYRVFGVLAMSRSIGDRYLKPWIIPEPEVTIVPRTKEDDCLVLASDGLWDVMSNE  427

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            EVCDVARRR+L WHKK+G T    +R ++ DPAAQ AA+ L++ ALQ+GS+DNI++IVVD
Sbjct  428  EVCDVARRRILSWHKKHGVTASPTQRGEEADPAAQAAADCLSKHALQKGSKDNITIIVVD  487

Query  422  LKAQRKFKKK  393
            LK+QRKFK K
Sbjct  488  LKSQRKFKSK  497



>ref|XP_008391358.1| PREDICTED: probable protein phosphatase 2C 50 [Malus domestica]
 ref|XP_008391359.1| PREDICTED: probable protein phosphatase 2C 50 [Malus domestica]
 ref|XP_008391360.1| PREDICTED: probable protein phosphatase 2C 50 [Malus domestica]
 ref|XP_008391361.1| PREDICTED: probable protein phosphatase 2C 50 [Malus domestica]
 ref|XP_008391362.1| PREDICTED: probable protein phosphatase 2C 50 [Malus domestica]
 ref|XP_008391363.1| PREDICTED: probable protein phosphatase 2C 50 [Malus domestica]
Length=544

 Score =   280 bits (717),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 144/191 (75%), Positives = 167/191 (87%), Gaps = 1/191 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVA++  ++IIVANCGDSRAVLCRGK  +PLSVDHKPNREDEY RIEA GGK
Sbjct  355  PETVGSTAVVALVSSSHIIVANCGDSRAVLCRGKQAIPLSVDHKPNREDEYERIEASGGK  414

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+GHRV GVLA+SRSIGDRYL+P++IP PE+M VPRA++DECL+LASDGLWDVMTNE
Sbjct  415  VIQWNGHRVFGVLAMSRSIGDRYLKPWIIPEPEVMVVPRARDDECLILASDGLWDVMTNE  474

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            E CDVAR+R+LLWHKKNG T L+ ER    DPAA +AA YL  +ALQ+GS+DNISV+VVD
Sbjct  475  EACDVARKRILLWHKKNGATPLA-ERGTGVDPAAGEAAAYLATLALQKGSKDNISVVVVD  533

Query  422  LKAQRKFKKKA  390
            LKAQRKFK K+
Sbjct  534  LKAQRKFKSKS  544



>ref|XP_002890233.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66492.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=372

 Score =   274 bits (701),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 133/191 (70%), Positives = 163/191 (85%), Gaps = 1/191 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVA++C ++IIV+NCGDSR VL RGK  MPLSVDHKP+REDEY+RIE  GGK
Sbjct  183  PETVGSTAVVALVCSSHIIVSNCGDSRVVLLRGKESMPLSVDHKPDREDEYARIEKAGGK  242

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W G RVSGVLA+SRSIGD YL PYVIPVPE+ F+PRA+EDECL+LASDGLWDVM+N+
Sbjct  243  VIQWQGARVSGVLAMSRSIGDEYLEPYVIPVPEVTFMPRAREDECLILASDGLWDVMSNQ  302

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            E C++AR+R+L+WHKKNG   L+ ER    D A Q AA YL+++AL++GS+DN+S+IVVD
Sbjct  303  EACELARKRILMWHKKNGSLPLA-ERGVGEDHACQAAAAYLSKLALRKGSKDNVSIIVVD  361

Query  422  LKAQRKFKKKA  390
            LKAQRKFK ++
Sbjct  362  LKAQRKFKTRS  372



>pdb|3RT0|A Chain A, Crystal Structure Of Pyl10-Hab1 Complex In The Absence 
Of Abscisic Acid (Aba)
 pdb|3RT0|B Chain B, Crystal Structure Of Pyl10-Hab1 Complex In The Absence 
Of Abscisic Acid (Aba)
Length=340

 Score =   273 bits (698),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 134/190 (71%), Positives = 163/190 (86%), Gaps = 1/190 (1%)
 Frame = -3

Query  959  EAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGKV  780
            E VGSTAVVA++C ++I+V+NCGDSRAVL RGK  MPLSVDHKP+REDEY+RIE  GGKV
Sbjct  152  ETVGSTAVVALVCSSHIVVSNCGDSRAVLFRGKEAMPLSVDHKPDREDEYARIENAGGKV  211

Query  779  INWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNEE  600
            I W G RV GVLA+SRSIGDRYL+PYVIP PE+ F+PR++EDECL+LASDGLWDVM N+E
Sbjct  212  IQWQGARVFGVLAMSRSIGDRYLKPYVIPEPEVTFMPRSREDECLILASDGLWDVMNNQE  271

Query  599  VCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVDL  420
            VC++ARRR+L+WHKKNG   L+ ER    DPA Q AA+YL+ +ALQ+GS+DNIS+IV+DL
Sbjct  272  VCEIARRRILMWHKKNGAPPLA-ERGKGIDPACQAAADYLSMLALQKGSKDNISIIVIDL  330

Query  419  KAQRKFKKKA  390
            KAQRKFK + 
Sbjct  331  KAQRKFKTRT  340



>ref|NP_173199.2| protein phosphatase 2C 7 [Arabidopsis thaliana]
 sp|Q9LNP9.2|P2C07_ARATH RecName: Full=Protein phosphatase 2C 7; Short=AtPP2C07; AltName: 
Full=Protein HYPERSENSITIVE TO ABA 2; AltName: Full=Protein 
phosphatase 2C HAB2; Short=PP2C HAB2; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AEE29605.1| protein phosphatase 2C 7 [Arabidopsis thaliana]
Length=511

 Score =   278 bits (712),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 135/191 (71%), Positives = 162/191 (85%), Gaps = 1/191 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVA++C ++IIV+NCGDSRAVL RGK  MPLSVDHKP+REDEY+RIE  GGK
Sbjct  322  PETVGSTAVVALVCSSHIIVSNCGDSRAVLLRGKDSMPLSVDHKPDREDEYARIEKAGGK  381

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W G RVSGVLA+SRSIGD+YL P+VIP PE+ F+PRA+EDECL+LASDGLWDVM+N+
Sbjct  382  VIQWQGARVSGVLAMSRSIGDQYLEPFVIPDPEVTFMPRAREDECLILASDGLWDVMSNQ  441

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            E CD ARRR+L WHKKNG   L+ ER    D A Q AAEYL+++A+Q GS+DNIS+IV+D
Sbjct  442  EACDFARRRILAWHKKNGALPLA-ERGVGEDQACQAAAEYLSKLAIQMGSKDNISIIVID  500

Query  422  LKAQRKFKKKA  390
            LKAQRKFK ++
Sbjct  501  LKAQRKFKTRS  511



>ref|XP_002279140.1| PREDICTED: protein phosphatase 2C 77 isoform X2 [Vitis vinifera]
Length=550

 Score =   280 bits (715),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 138/190 (73%), Positives = 166/190 (87%), Gaps = 1/190 (1%)
 Frame = -3

Query  959  EAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGKV  780
            E VGSTAVV I+C T+IIVANCGDSRAVLCRGK+P+PLS+DHKP+REDEY+RIEA GGK+
Sbjct  360  ETVGSTAVVTIICQTHIIVANCGDSRAVLCRGKVPVPLSIDHKPSREDEYARIEAAGGKI  419

Query  779  INWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNEE  600
            I WDG RV GVLA+SRSIGDRYL+P++IP PE+M++PR KEDECL+LASDGLWDVMTN+E
Sbjct  420  IQWDGLRVCGVLAMSRSIGDRYLKPWIIPDPEVMYIPREKEDECLILASDGLWDVMTNQE  479

Query  599  VCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVDL  420
            VCD ARRR+LLWHKKNG    + ER    DPAAQ AAE L+++ALQ+GS+DNI+V+VVDL
Sbjct  480  VCDTARRRILLWHKKNGHNPPA-ERGRGVDPAAQAAAECLSKLALQKGSKDNITVVVVDL  538

Query  419  KAQRKFKKKA  390
            K +RK K+K 
Sbjct  539  KPRRKLKRKT  548



>pdb|3QN1|B Chain B, Crystal Structure Of The Pyr1 Abscisic Acid Receptor 
In Complex With The Hab1 Type 2c Phosphatase Catalytic Domain
 pdb|3ZVU|B Chain B, Structure Of The Pyr1 His60pro Mutant In Complex With 
The Hab1 Phosphatase And Abscisic Acid
Length=337

 Score =   273 bits (697),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 134/189 (71%), Positives = 163/189 (86%), Gaps = 1/189 (1%)
 Frame = -3

Query  959  EAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGKV  780
            E VGSTAVVA++C ++I+V+NCGDSRAVL RGK  MPLSVDHKP+REDEY+RIE  GGKV
Sbjct  149  ETVGSTAVVALVCSSHIVVSNCGDSRAVLFRGKEAMPLSVDHKPDREDEYARIENAGGKV  208

Query  779  INWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNEE  600
            I W G RV GVLA+SRSIGDRYL+PYVIP PE+ F+PR++EDECL+LASDGLWDVM N+E
Sbjct  209  IQWQGARVFGVLAMSRSIGDRYLKPYVIPEPEVTFMPRSREDECLILASDGLWDVMNNQE  268

Query  599  VCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVDL  420
            VC++ARRR+L+WHKKNG   L+ ER    DPA Q AA+YL+ +ALQ+GS+DNIS+IV+DL
Sbjct  269  VCEIARRRILMWHKKNGAPPLA-ERGKGIDPACQAAADYLSMLALQKGSKDNISIIVIDL  327

Query  419  KAQRKFKKK  393
            KAQRKFK +
Sbjct  328  KAQRKFKTR  336



>dbj|BAC43252.1| unknown protein [Arabidopsis thaliana]
Length=511

 Score =   278 bits (711),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 134/191 (70%), Positives = 162/191 (85%), Gaps = 1/191 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVA++C ++IIV+NCGDSRAVL RGK  MPLSVDHKP+REDEY+RIE  GGK
Sbjct  322  PETVGSTAVVALVCSSHIIVSNCGDSRAVLLRGKDSMPLSVDHKPDREDEYARIEKAGGK  381

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W G RVSGVLA+SRSIGD+YL P+VIP PE+ F+PRA+EDECL+LASDGLWDVM+N+
Sbjct  382  VIQWQGARVSGVLAMSRSIGDQYLEPFVIPDPEVTFMPRAREDECLILASDGLWDVMSNQ  441

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            E CD ARRR+L WHKKNG   L+ ER    D A + AAEYL+++A+Q GS+DNIS+IV+D
Sbjct  442  EACDFARRRILAWHKKNGALPLA-ERGVGEDQACRAAAEYLSKLAIQMGSKDNISIIVID  500

Query  422  LKAQRKFKKKA  390
            LKAQRKFK ++
Sbjct  501  LKAQRKFKTRS  511



>pdb|3NMT|B Chain B, Crystal Structure Of Pyrabactin Bound Abscisic Acid 
Receptor Pyl2 Mutant A93f In Complex With Type 2c Protein Phosphatase 
Hab1
 pdb|4LG5|B Chain B, Aba-mimicking Ligand Quinabactin In Complex With Aba 
Receptor Pyl2 And Pp2c Hab1
 pdb|4LGA|B Chain B, Aba-mimicking Ligand N-(2-oxo-1-propyl-1,2,3,4-tetrahydroquinolin-6- 
Yl)-1-phenylmethanesulfonamide In Complex With 
Aba Receptor Pyl2 And Pp2c Hab1
 pdb|4LGB|B Chain B, Aba-mimicking Ligand N-(1-methyl-2-oxo-1,2,3,4-tetrahydroquinolin-6- 
Yl)-1-(4-methylphenyl)methanesulfonamide In 
Complex With Aba Receptor Pyl2 And Pp2c Hab1
Length=341

 Score =   273 bits (697),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 134/190 (71%), Positives = 163/190 (86%), Gaps = 1/190 (1%)
 Frame = -3

Query  959  EAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGKV  780
            E VGSTAVVA++C ++I+V+NCGDSRAVL RGK  MPLSVDHKP+REDEY+RIE  GGKV
Sbjct  153  ETVGSTAVVALVCSSHIVVSNCGDSRAVLFRGKEAMPLSVDHKPDREDEYARIENAGGKV  212

Query  779  INWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNEE  600
            I W G RV GVLA+SRSIGDRYL+PYVIP PE+ F+PR++EDECL+LASDGLWDVM N+E
Sbjct  213  IQWQGARVFGVLAMSRSIGDRYLKPYVIPEPEVTFMPRSREDECLILASDGLWDVMNNQE  272

Query  599  VCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVDL  420
            VC++ARRR+L+WHKKNG   L+ ER    DPA Q AA+YL+ +ALQ+GS+DNIS+IV+DL
Sbjct  273  VCEIARRRILMWHKKNGAPPLA-ERGKGIDPACQAAADYLSMLALQKGSKDNISIIVIDL  331

Query  419  KAQRKFKKKA  390
            KAQRKFK + 
Sbjct  332  KAQRKFKTRT  341



>pdb|4DS8|B Chain B, Complex Structure Of Abscisic Acid Receptor Pyl3-(+)-Aba-Hab1 
In The Presence Of Mn2+
Length=343

 Score =   273 bits (697),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 134/190 (71%), Positives = 163/190 (86%), Gaps = 1/190 (1%)
 Frame = -3

Query  959  EAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGKV  780
            E VGSTAVVA++C ++I+V+NCGDSRAVL RGK  MPLSVDHKP+REDEY+RIE  GGKV
Sbjct  155  ETVGSTAVVALVCSSHIVVSNCGDSRAVLFRGKEAMPLSVDHKPDREDEYARIENAGGKV  214

Query  779  INWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNEE  600
            I W G RV GVLA+SRSIGDRYL+PYVIP PE+ F+PR++EDECL+LASDGLWDVM N+E
Sbjct  215  IQWQGARVFGVLAMSRSIGDRYLKPYVIPEPEVTFMPRSREDECLILASDGLWDVMNNQE  274

Query  599  VCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVDL  420
            VC++ARRR+L+WHKKNG   L+ ER    DPA Q AA+YL+ +ALQ+GS+DNIS+IV+DL
Sbjct  275  VCEIARRRILMWHKKNGAPPLA-ERGKGIDPACQAAADYLSMLALQKGSKDNISIIVIDL  333

Query  419  KAQRKFKKKA  390
            KAQRKFK + 
Sbjct  334  KAQRKFKTRT  343



>emb|CDX96761.1| BnaA08g23040D [Brassica napus]
Length=350

 Score =   273 bits (698),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 135/191 (71%), Positives = 162/191 (85%), Gaps = 1/191 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVA++C ++IIV+NCGDSRAVL RGK  MPLSVDHKP+REDEY+RIE  GGK
Sbjct  161  PETVGSTAVVALVCSSHIIVSNCGDSRAVLLRGKEAMPLSVDHKPDREDEYARIERAGGK  220

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W G RVSGVLA+SRSIGD+YL PYVIP PE+ F+PRA+EDECL+LASDGLWDVM+N+
Sbjct  221  VIQWQGARVSGVLAMSRSIGDQYLEPYVIPEPEVTFMPRAREDECLILASDGLWDVMSNQ  280

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            + C+ ARRR+L WHK+NG   L+ ER    D A Q AA+YL+++ALQ+GSRDNISVIVVD
Sbjct  281  DACEFARRRILWWHKRNGALPLA-ERGVGEDQACQAAADYLSKLALQKGSRDNISVIVVD  339

Query  422  LKAQRKFKKKA  390
            LKAQRK K ++
Sbjct  340  LKAQRKLKIRS  350



>ref|XP_010537577.1| PREDICTED: protein phosphatase 2C 16 [Tarenaya hassleriana]
 ref|XP_010537578.1| PREDICTED: protein phosphatase 2C 16 [Tarenaya hassleriana]
Length=534

 Score =   278 bits (712),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 141/191 (74%), Positives = 166/191 (87%), Gaps = 1/191 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVA++C ++IIV+NCGDSRAVL RGK  M LSVDHKP+REDEY+RIEA GGK
Sbjct  345  PETVGSTAVVALVCSSHIIVSNCGDSRAVLYRGKESMALSVDHKPDREDEYARIEASGGK  404

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+G RV GVLA+SRSIGD YL+P++IP PE+MF+PRA+EDECLVLASDGLWDVMTN+
Sbjct  405  VIQWNGARVFGVLAMSRSIGDSYLKPWIIPEPEVMFIPRAREDECLVLASDGLWDVMTNQ  464

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            E C+VARRR+LLWHKK+G   L+ ER    DPAAQ AAEYL+ +ALQ+GS+DNISVIVVD
Sbjct  465  EACEVARRRILLWHKKHGPPPLA-ERGKGADPAAQAAAEYLSMLALQKGSKDNISVIVVD  523

Query  422  LKAQRKFKKKA  390
            LK QRKFK K+
Sbjct  524  LKTQRKFKNKS  534



>pdb|3UJG|B Chain B, Crystal Structure Of Snrk2.6 In Complex With Hab1
Length=350

 Score =   273 bits (697),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 134/190 (71%), Positives = 163/190 (86%), Gaps = 1/190 (1%)
 Frame = -3

Query  959  EAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGKV  780
            E VGSTAVVA++C ++I+V+NCGDSRAVL RGK  MPLSVDHKP+REDEY+RIE  GGKV
Sbjct  162  ETVGSTAVVALVCSSHIVVSNCGDSRAVLFRGKEAMPLSVDHKPDREDEYARIENAGGKV  221

Query  779  INWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNEE  600
            I W G RV GVLA+SRSIGDRYL+PYVIP PE+ F+PR++EDECL+LASDGLWDVM N+E
Sbjct  222  IQWQGARVFGVLAMSRSIGDRYLKPYVIPEPEVTFMPRSREDECLILASDGLWDVMNNQE  281

Query  599  VCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVDL  420
            VC++ARRR+L+WHKKNG   L+ ER    DPA Q AA+YL+ +ALQ+GS+DNIS+IV+DL
Sbjct  282  VCEIARRRILMWHKKNGAPPLA-ERGKGIDPACQAAADYLSMLALQKGSKDNISIIVIDL  340

Query  419  KAQRKFKKKA  390
            KAQRKFK + 
Sbjct  341  KAQRKFKTRT  350



>ref|XP_010656162.1| PREDICTED: protein phosphatase 2C 77 isoform X1 [Vitis vinifera]
Length=585

 Score =   280 bits (715),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 138/190 (73%), Positives = 166/190 (87%), Gaps = 1/190 (1%)
 Frame = -3

Query  959  EAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGKV  780
            E VGSTAVV I+C T+IIVANCGDSRAVLCRGK+P+PLS+DHKP+REDEY+RIEA GGK+
Sbjct  395  ETVGSTAVVTIICQTHIIVANCGDSRAVLCRGKVPVPLSIDHKPSREDEYARIEAAGGKI  454

Query  779  INWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNEE  600
            I WDG RV GVLA+SRSIGDRYL+P++IP PE+M++PR KEDECL+LASDGLWDVMTN+E
Sbjct  455  IQWDGLRVCGVLAMSRSIGDRYLKPWIIPDPEVMYIPREKEDECLILASDGLWDVMTNQE  514

Query  599  VCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVDL  420
            VCD ARRR+LLWHKKNG    + ER    DPAAQ AAE L+++ALQ+GS+DNI+V+VVDL
Sbjct  515  VCDTARRRILLWHKKNGHNPPA-ERGRGVDPAAQAAAECLSKLALQKGSKDNITVVVVDL  573

Query  419  KAQRKFKKKA  390
            K +RK K+K 
Sbjct  574  KPRRKLKRKT  583



>gb|AIZ68188.1| putative protein phosphatase [Ornithogalum saundersiae]
Length=490

 Score =   276 bits (706),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 138/191 (72%), Positives = 166/191 (87%), Gaps = 1/191 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVA++C ++I+VANCGDSRAVL RGK  +PLS DHKPNR+DEY RIEA GGK
Sbjct  295  PETVGSTAVVAVICSSHIVVANCGDSRAVLYRGKQCIPLSEDHKPNRDDEYQRIEAAGGK  354

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+G RV GVLA+SRSIGDRYL+P++IP PE+  +PR++EDECLVLASDGLWDVM+NE
Sbjct  355  VIQWNGFRVFGVLAMSRSIGDRYLKPWIIPEPEVTIIPRSREDECLVLASDGLWDVMSNE  414

Query  602  EVCDVARRRLLLWHKKNGGTMLSR-ERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVV  426
            EVCD+AR+R+LLWHKKNG T  S   R +  DPAAQ AA+YL+R+ALQ+GS+DNI+VIVV
Sbjct  415  EVCDIARKRILLWHKKNGTTSSSSTHRGEAADPAAQAAADYLSRLALQKGSKDNITVIVV  474

Query  425  DLKAQRKFKKK  393
            DLKAQR+FK K
Sbjct  475  DLKAQRRFKSK  485



>ref|XP_010937974.1| PREDICTED: probable protein phosphatase 2C 6 [Elaeis guineensis]
Length=500

 Score =   276 bits (707),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 136/190 (72%), Positives = 168/190 (88%), Gaps = 0/190 (0%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVA++C ++II+ANCGDSRAVLCRGK  +PLSVDHKPNREDEY+RIEA GGK
Sbjct  310  PETVGSTAVVAVICSSHIIIANCGDSRAVLCRGKQAVPLSVDHKPNREDEYARIEAEGGK  369

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+G+RV GVLA+SRSIGD+YL+P++IPVPE+  VPR KED+CL+LASDGLWDVM+NE
Sbjct  370  VIQWNGYRVFGVLAMSRSIGDQYLKPWIIPVPEVTIVPRTKEDDCLILASDGLWDVMSNE  429

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            EVC+VAR+R+L WHKKNG T+   +R ++ DPAAQ AA+ L++ ALQ+GS+DNI+ +VVD
Sbjct  430  EVCEVARKRILHWHKKNGVTLSPTQRGEEADPAAQAAADCLSKHALQKGSKDNITAVVVD  489

Query  422  LKAQRKFKKK  393
            LKAQRKFK K
Sbjct  490  LKAQRKFKTK  499



>ref|XP_008650084.1| PREDICTED: probable protein phosphatase 2C 53 isoform X1 [Zea 
mays]
Length=585

 Score =   278 bits (712),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 139/192 (72%), Positives = 168/192 (88%), Gaps = 1/192 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            P+ VGSTAVVA++C +++IVANCGDSRAVLCRGK P+ LSVDHKPNREDEY+RIEA GGK
Sbjct  394  PDTVGSTAVVALVCSSHVIVANCGDSRAVLCRGKQPVALSVDHKPNREDEYARIEAQGGK  453

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VINW+G+RV GVLA+SRSIGDRYL+PY+IPVPE+  V RAK+DECL++ASDGLWDVM+NE
Sbjct  454  VINWNGYRVLGVLAMSRSIGDRYLKPYIIPVPEVTIVARAKDDECLIIASDGLWDVMSNE  513

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERS-ddpdpaaqdaAEYLTRIALQRGSRDNISVIVV  426
            EVCD AR+R+LLWHKKN     S +RS D PD AAQ AAEYL+++AL +GS+DNI+VIVV
Sbjct  514  EVCDAARKRILLWHKKNSDASSSAQRSGDSPDEAAQAAAEYLSKLALHKGSKDNITVIVV  573

Query  425  DLKAQRKFKKKA  390
            DLK+ RK K +A
Sbjct  574  DLKSHRKIKSRA  585



>ref|XP_012077234.1| PREDICTED: protein phosphatase 2C 77-like [Jatropha curcas]
 ref|XP_012077235.1| PREDICTED: protein phosphatase 2C 77-like [Jatropha curcas]
 ref|XP_012077236.1| PREDICTED: protein phosphatase 2C 77-like [Jatropha curcas]
 ref|XP_012077237.1| PREDICTED: protein phosphatase 2C 77-like [Jatropha curcas]
 ref|XP_012077238.1| PREDICTED: protein phosphatase 2C 77-like [Jatropha curcas]
 gb|KDP34066.1| hypothetical protein JCGZ_07637 [Jatropha curcas]
Length=546

 Score =   277 bits (709),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 140/191 (73%), Positives = 163/191 (85%), Gaps = 1/191 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVAI+  ++I+VANCGDSRAVL RGK PM LSVDHKPNREDEY+RIEA GGK
Sbjct  357  PETVGSTAVVAIIFSSHIVVANCGDSRAVLYRGKEPMALSVDHKPNREDEYARIEAAGGK  416

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+GHRV GVLA+SRSIGDRYL+P++IP PE+ F+PRAKEDECL+LASDGLWDVM+NE
Sbjct  417  VIQWNGHRVFGVLAMSRSIGDRYLKPWIIPEPEVKFIPRAKEDECLILASDGLWDVMSNE  476

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            E CD+ARRR+L+W+KKN G+     R +  DPAAQ AAEYL   ALQ+GS+DNI+VIVVD
Sbjct  477  EACDLARRRILVWYKKN-GSAFPMSRGEGIDPAAQAAAEYLANRALQKGSKDNITVIVVD  535

Query  422  LKAQRKFKKKA  390
            LKAQRK K K 
Sbjct  536  LKAQRKLKNKT  546



>emb|CDY26234.1| BnaA06g11830D [Brassica napus]
Length=496

 Score =   276 bits (705),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 134/191 (70%), Positives = 162/191 (85%), Gaps = 1/191 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVA++C ++IIV+NCGDSRAVL RGK  MPLSVDHKP+REDEY+RIE  GGK
Sbjct  307  PETVGSTAVVALVCSSHIIVSNCGDSRAVLLRGKDSMPLSVDHKPDREDEYARIERAGGK  366

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W G RVSGVLA+SRSIGD YL PYVIP PE+ F+PRA+EDECL+LASDGLWDV++N+
Sbjct  367  VIQWQGARVSGVLAMSRSIGDEYLEPYVIPDPEVTFMPRAREDECLILASDGLWDVISNQ  426

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            E C+ AR+R+L WHKKNG   L+ ER    D A Q AA+YL+++A+Q+GS+DNIS+IVVD
Sbjct  427  EACEFARKRILWWHKKNGALPLA-ERGVGEDQACQAAADYLSKLAIQKGSKDNISIIVVD  485

Query  422  LKAQRKFKKKA  390
            LKAQRKFK K+
Sbjct  486  LKAQRKFKTKS  496



>ref|XP_002887450.1| hypothetical protein ARALYDRAFT_895129 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63709.1| hypothetical protein ARALYDRAFT_895129 [Arabidopsis lyrata subsp. 
lyrata]
Length=513

 Score =   276 bits (707),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 134/189 (71%), Positives = 163/189 (86%), Gaps = 1/189 (1%)
 Frame = -3

Query  959  EAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGKV  780
            E VGSTAVVA++C ++I+V+NCGDSRAVL RGK  MPLSVDHKP+REDEY+RIE  GGKV
Sbjct  325  ETVGSTAVVALVCSSHIVVSNCGDSRAVLFRGKEAMPLSVDHKPDREDEYARIENAGGKV  384

Query  779  INWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNEE  600
            I W G RV GVLA+SRSIGDRYL+PYVIP PE+ F+PR++EDECL+LASDGLWDVM N+E
Sbjct  385  IQWQGARVFGVLAMSRSIGDRYLKPYVIPEPEVTFMPRSREDECLILASDGLWDVMNNQE  444

Query  599  VCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVDL  420
            VC++ARRR+L+WHKKNG   L+ ER    DPA Q AA+YL+ +ALQ+GS+DNIS+IV+DL
Sbjct  445  VCEIARRRILMWHKKNGALPLA-ERGKGTDPACQAAADYLSMLALQKGSKDNISIIVIDL  503

Query  419  KAQRKFKKK  393
            KAQRKFK +
Sbjct  504  KAQRKFKTR  512



>ref|XP_006371857.1| hypothetical protein POPTR_0018s04570g [Populus trichocarpa]
 gb|ERP49654.1| hypothetical protein POPTR_0018s04570g [Populus trichocarpa]
Length=578

 Score =   278 bits (711),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 146/217 (67%), Positives = 168/217 (77%), Gaps = 28/217 (13%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVA +C ++IIVANCGDSRAVLCRGK P+ LSVDHKPNREDEY+RIEA GGK
Sbjct  362  PETVGSTAVVATICSSHIIVANCGDSRAVLCRGKEPVALSVDHKPNREDEYARIEAAGGK  421

Query  782  VINWDGHRVSGVLAVSRSI---------------------------GDRYLRPYVIPVPE  684
            VI W+GHRV GVLA+SRSI                           GDRYL+P++IP PE
Sbjct  422  VIQWNGHRVFGVLAMSRSIAMSINPWKNSPNVKRSPTALWRIDCLAGDRYLKPWIIPEPE  481

Query  683  IMFVPRAKEDECLVLASDGLWDVMTNEEVCDVARRRLLLWHKKNGGTMLSRERSddpdpa  504
            +MF+PRAKEDECL+LASDGLWDVM+NEE CD+AR+R+L+WHKKNG T LS  R    DPA
Sbjct  482  VMFIPRAKEDECLILASDGLWDVMSNEEACDLARKRILVWHKKNGVT-LSSSRGGGIDPA  540

Query  503  aqdaAEYLTRIALQRGSRDNISVIVVDLKAQRKFKKK  393
            AQ AAEYL+  ALQ+GS+DNI+VIVVDLKAQRKFK K
Sbjct  541  AQAAAEYLSNRALQKGSKDNITVIVVDLKAQRKFKTK  577



>ref|XP_006390620.1| hypothetical protein EUTSA_v10018441mg [Eutrema salsugineum]
 dbj|BAJ34447.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ27906.1| hypothetical protein EUTSA_v10018441mg [Eutrema salsugineum]
Length=498

 Score =   276 bits (705),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 135/190 (71%), Positives = 164/190 (86%), Gaps = 1/190 (1%)
 Frame = -3

Query  959  EAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGKV  780
            E VGSTAVVA++C ++I+V+NCGDSRAVL RGK  MPLSVDHKP+REDEY+RIE  GGKV
Sbjct  310  ETVGSTAVVALVCSSHIVVSNCGDSRAVLYRGKEAMPLSVDHKPDREDEYTRIENAGGKV  369

Query  779  INWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNEE  600
            I W G RV GVLA+SRS+GDRYL+PYVIP PE+ F+PR++EDECL+LASDGLWDVM N+E
Sbjct  370  IQWQGARVFGVLAMSRSLGDRYLKPYVIPEPEVTFMPRSREDECLILASDGLWDVMNNQE  429

Query  599  VCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVDL  420
            VC++ARRR+L+WHKK+G   L+ ER    DPA Q AAEYL+ +ALQ+GS+DNIS+IVVDL
Sbjct  430  VCEIARRRILMWHKKHGAPPLA-ERGKGADPACQAAAEYLSVLALQKGSKDNISIIVVDL  488

Query  419  KAQRKFKKKA  390
            KAQRKFK +A
Sbjct  489  KAQRKFKTRA  498



>gb|EYU26427.1| hypothetical protein MIMGU_mgv1a017851mg, partial [Erythranthe 
guttata]
Length=364

 Score =   271 bits (694),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 136/188 (72%), Positives = 166/188 (88%), Gaps = 0/188 (0%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            P++VGSTAVVA++C T+II+ANCGDSRAVL RGK+P+PL++DHKPN EDE +RIEA GGK
Sbjct  177  PDSVGSTAVVAVVCSTHIIIANCGDSRAVLYRGKVPIPLTIDHKPNSEDECARIEAAGGK  236

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI WDG+RVSG LAVSRSIGDRYLRPYVI  P++M V RA+EDECL+LASDGLWDVMTN+
Sbjct  237  VIKWDGYRVSGFLAVSRSIGDRYLRPYVIADPQVMLVRRAREDECLILASDGLWDVMTNQ  296

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            E C++AR R+L+WHK+NGG  ++ ER +  DPAAQDAA+ L+R+A QRGS DNISV+VVD
Sbjct  297  EACELARWRMLMWHKRNGGGDVAGERGNGVDPAAQDAADCLSRLAFQRGSGDNISVVVVD  356

Query  422  LKAQRKFK  399
            LK+QRKFK
Sbjct  357  LKSQRKFK  364



>ref|NP_177421.1| protein phosphatase 2C 16 [Arabidopsis thaliana]
 ref|NP_001185385.1| protein phosphatase 2C 16 [Arabidopsis thaliana]
 sp|Q9CAJ0.1|P2C16_ARATH RecName: Full=Protein phosphatase 2C 16; Short=AtPP2C16; AltName: 
Full=AtP2C-HA; AltName: Full=Protein HYPERSENSITIVE TO 
ABA 1; AltName: Full=Protein phosphatase 2C HAB1; Short=PP2C 
HAB1; Flags: Precursor [Arabidopsis thaliana]
 gb|AAG51849.1|AC010926_12 protein phosphatase 2C (AtP2C-HA); 19519-17666 [Arabidopsis thaliana]
 gb|AAU05532.1| At1g72770 [Arabidopsis thaliana]
 gb|AEE35370.1| protein phosphatase 2C 16 [Arabidopsis thaliana]
 gb|AEE35372.1| protein phosphatase 2C 16 [Arabidopsis thaliana]
Length=511

 Score =   276 bits (706),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 134/190 (71%), Positives = 163/190 (86%), Gaps = 1/190 (1%)
 Frame = -3

Query  959  EAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGKV  780
            E VGSTAVVA++C ++I+V+NCGDSRAVL RGK  MPLSVDHKP+REDEY+RIE  GGKV
Sbjct  323  ETVGSTAVVALVCSSHIVVSNCGDSRAVLFRGKEAMPLSVDHKPDREDEYARIENAGGKV  382

Query  779  INWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNEE  600
            I W G RV GVLA+SRSIGDRYL+PYVIP PE+ F+PR++EDECL+LASDGLWDVM N+E
Sbjct  383  IQWQGARVFGVLAMSRSIGDRYLKPYVIPEPEVTFMPRSREDECLILASDGLWDVMNNQE  442

Query  599  VCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVDL  420
            VC++ARRR+L+WHKKNG   L+ ER    DPA Q AA+YL+ +ALQ+GS+DNIS+IV+DL
Sbjct  443  VCEIARRRILMWHKKNGAPPLA-ERGKGIDPACQAAADYLSMLALQKGSKDNISIIVIDL  501

Query  419  KAQRKFKKKA  390
            KAQRKFK + 
Sbjct  502  KAQRKFKTRT  511



>emb|CAA05875.1| protein phosphatase 2C [Arabidopsis thaliana]
Length=511

 Score =   276 bits (705),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 134/190 (71%), Positives = 163/190 (86%), Gaps = 1/190 (1%)
 Frame = -3

Query  959  EAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGKV  780
            E VGSTAVVA++C ++I+V+NCGDSRAVL RGK  MPLSVDHKP+REDEY+RIE  GGKV
Sbjct  323  ETVGSTAVVALVCSSHIVVSNCGDSRAVLFRGKEAMPLSVDHKPDREDEYARIENAGGKV  382

Query  779  INWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNEE  600
            I W G RV GVLA+SRSIGDRYL+PYVIP PE+ F+PR++EDECL+LASDGLWDVM N+E
Sbjct  383  IQWQGARVFGVLAMSRSIGDRYLKPYVIPEPEVTFMPRSREDECLILASDGLWDVMNNQE  442

Query  599  VCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVDL  420
            VC++ARRR+L+WHKKNG   L+ ER    DPA Q AA+YL+ +ALQ+GS+DNIS+IV+DL
Sbjct  443  VCEIARRRILMWHKKNGAPPLA-ERGKGIDPACQAAADYLSMLALQKGSKDNISIIVIDL  501

Query  419  KAQRKFKKKA  390
            KAQRKFK + 
Sbjct  502  KAQRKFKTRT  511



>ref|XP_007161134.1| hypothetical protein PHAVU_001G045300g [Phaseolus vulgaris]
 ref|XP_007161135.1| hypothetical protein PHAVU_001G045300g [Phaseolus vulgaris]
 gb|ESW33128.1| hypothetical protein PHAVU_001G045300g [Phaseolus vulgaris]
 gb|ESW33129.1| hypothetical protein PHAVU_001G045300g [Phaseolus vulgaris]
Length=554

 Score =   277 bits (708),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 137/191 (72%), Positives = 165/191 (86%), Gaps = 0/191 (0%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVA++  ++IIVANCGDSRAVLCRGK P+ LS DHKPNR DE++RIEA GGK
Sbjct  364  PETVGSTAVVAVISSSHIIVANCGDSRAVLCRGKEPIALSEDHKPNRTDEHARIEAAGGK  423

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+GHRV GVLA+SRSIGDRYL+P++IP PE+ F+PR K+DECL+LASDGLWDVM+NE
Sbjct  424  VIQWNGHRVFGVLAMSRSIGDRYLKPWIIPEPEVRFLPRTKDDECLILASDGLWDVMSNE  483

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            EVCD+ARRR++LW+KKNG    S ER +  DPAAQ AAEYL+  ALQ+GS+DNI+VIVVD
Sbjct  484  EVCDLARRRIVLWYKKNGLEQPSSERGEGVDPAAQAAAEYLSNRALQKGSKDNITVIVVD  543

Query  422  LKAQRKFKKKA  390
            LK QRK+K K+
Sbjct  544  LKPQRKYKSKS  554



>ref|XP_004513451.1| PREDICTED: probable protein phosphatase 2C 6-like [Cicer arietinum]
Length=531

 Score =   276 bits (706),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 137/191 (72%), Positives = 166/191 (87%), Gaps = 1/191 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PEAVGSTA+VA+L  T+II+ANCGDSRAVLCRGK  + LS DHKPNR+DE+ RIEA GGK
Sbjct  342  PEAVGSTALVAVLTQTHIIIANCGDSRAVLCRGKEALSLSTDHKPNRDDEWERIEASGGK  401

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+G+RV GVLAVSRSIGDRYL+P++IP PE+  + R K DECL+LASDGLWDV+TNE
Sbjct  402  VIQWNGYRVLGVLAVSRSIGDRYLKPWIIPDPEVNCILREKNDECLILASDGLWDVLTNE  461

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            E CD+AR+R+L+WHKKNG   +S  +SD  DPAAQ AAEYL+++ALQRGS+DNISVIV+D
Sbjct  462  EACDIARKRILIWHKKNGSN-VSTGQSDGVDPAAQYAAEYLSKLALQRGSKDNISVIVID  520

Query  422  LKAQRKFKKKA  390
            LKAQR+FK+KA
Sbjct  521  LKAQRQFKRKA  531



>gb|KHN35879.1| Hypothetical protein glysoja_013304 [Glycine soja]
Length=340

 Score =   270 bits (690),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 137/190 (72%), Positives = 160/190 (84%), Gaps = 1/190 (1%)
 Frame = -3

Query  959  EAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGKV  780
            E VGSTAVVAIL  T+IIVANCGDSRAVLCRGK  +PLS DHKPNR+DE+ RIEA GG+V
Sbjct  150  ETVGSTAVVAILTQTHIIVANCGDSRAVLCRGKQALPLSDDHKPNRDDEWERIEAAGGRV  209

Query  779  INWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNEE  600
            I W+G+RV GVLAVSRSIGDRYL+P+VIP PE+  V R K DECL+LASDGLWDVMTNEE
Sbjct  210  IQWNGYRVLGVLAVSRSIGDRYLKPWVIPEPEVKCVQRDKSDECLILASDGLWDVMTNEE  269

Query  599  VCDVARRRLLLWHKKNGGTMLSRERSddpdp-aaqdaAEYLTRIALQRGSRDNISVIVVD  423
             C++AR+R+LLWHKKNG   +S E+  +    AAQ AAEYL+R+ALQRG++DNISVIV+D
Sbjct  270  ACEIARKRILLWHKKNGNNSVSSEQGQEGVDPAAQYAAEYLSRLALQRGTKDNISVIVID  329

Query  422  LKAQRKFKKK  393
            LK QRK KKK
Sbjct  330  LKPQRKIKKK  339



>ref|XP_009110399.1| PREDICTED: protein phosphatase 2C 7-like [Brassica rapa]
 ref|XP_009110400.1| PREDICTED: protein phosphatase 2C 7-like [Brassica rapa]
Length=410

 Score =   272 bits (696),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 135/188 (72%), Positives = 160/188 (85%), Gaps = 1/188 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVA++C ++IIV+NCGDSRAVL RGK  MPLSVDHKP+REDEY+RIE  GGK
Sbjct  221  PETVGSTAVVALVCSSHIIVSNCGDSRAVLLRGKEAMPLSVDHKPDREDEYARIERAGGK  280

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W G RVSGVLA+SRSIGD+YL PYVIP PE+ F+PRA+EDECL+LASDGLWDVM+N+
Sbjct  281  VIQWQGARVSGVLAMSRSIGDQYLEPYVIPEPEVTFMPRAREDECLILASDGLWDVMSNQ  340

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            + C+ ARRR+L WHK+NG   L+ ER    D A Q AA+YL+++ALQ+GSRDNISVIVVD
Sbjct  341  DACEFARRRILWWHKRNGALPLA-ERGVGEDQACQAAADYLSKLALQKGSRDNISVIVVD  399

Query  422  LKAQRKFK  399
            LKAQRK K
Sbjct  400  LKAQRKVK  407



>gb|AGG35980.1| hypersensitive to ABA 2 [Brassica napus]
Length=512

 Score =   275 bits (703),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 132/191 (69%), Positives = 162/191 (85%), Gaps = 1/191 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVA++C ++IIV+NCGDSRAVL RGK  MPLSVDHKP+REDEY+RIE  GGK
Sbjct  323  PETVGSTAVVALVCSSHIIVSNCGDSRAVLLRGKDSMPLSVDHKPDREDEYARIERAGGK  382

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W G RVSGVLA+SRSIGD YL PYVIP PE+ F+PRA+EDECL+LASDGLWDV++N+
Sbjct  383  VIQWQGARVSGVLAMSRSIGDEYLEPYVIPDPEVTFMPRAREDECLILASDGLWDVISNQ  442

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            + C+ AR+R+L WHKKNG   L+ ER    D A Q A++YL+++A+Q+GS+DNIS+IVVD
Sbjct  443  DACEFARKRILWWHKKNGALPLA-ERGVGEDQACQAASDYLSKLAIQKGSKDNISIIVVD  501

Query  422  LKAQRKFKKKA  390
            LKAQRKFK K+
Sbjct  502  LKAQRKFKTKS  512



>ref|XP_009149210.1| PREDICTED: protein phosphatase 2C 7 [Brassica rapa]
Length=508

 Score =   275 bits (702),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 133/191 (70%), Positives = 162/191 (85%), Gaps = 1/191 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVA++C ++IIV+NCGDSRAVL RGK  MPLSVDHKP+REDEY+RIE  GGK
Sbjct  319  PETVGSTAVVALVCSSHIIVSNCGDSRAVLLRGKDSMPLSVDHKPDREDEYARIERAGGK  378

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W G RVSGVLA+SRSIGD YL PYVIP PE+ F+PRA+EDECL+LASDGLWDV++N+
Sbjct  379  VIQWQGARVSGVLAMSRSIGDEYLEPYVIPDPEVTFMPRAREDECLILASDGLWDVISNQ  438

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            + C+ AR+R+L WHKKNG   L+ ER    D A Q AA+YL+++A+Q+GS+DNIS+IVVD
Sbjct  439  DACEFARKRILWWHKKNGALPLA-ERGVGEDQACQAAADYLSKLAIQKGSKDNISIIVVD  497

Query  422  LKAQRKFKKKA  390
            LKAQRKFK K+
Sbjct  498  LKAQRKFKTKS  508



>gb|KHN28831.1| Hypothetical protein glysoja_033886 [Glycine soja]
Length=304

 Score =   268 bits (685),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 136/189 (72%), Positives = 159/189 (84%), Gaps = 0/189 (0%)
 Frame = -3

Query  959  EAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGKV  780
            E VGSTAVVAIL  T+IIVANCGDSRAVLCRG+  +PLS DHKPNR+DE+ RIEA GG++
Sbjct  115  ETVGSTAVVAILTQTHIIVANCGDSRAVLCRGREALPLSDDHKPNRDDEWERIEAAGGRI  174

Query  779  INWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNEE  600
            I W+G+RV GVLAVSRSIGDRYL+P+VIP PE+  +   K DECL+LASDGLWDVMTNEE
Sbjct  175  IQWNGYRVLGVLAVSRSIGDRYLKPWVIPEPEVRCLQLDKNDECLILASDGLWDVMTNEE  234

Query  599  VCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVDL  420
             CD+AR+R+LLWHKKNG    S +  +  DPAAQ AAEYL+R+ALQRG++DNISVIVVDL
Sbjct  235  ACDIARKRILLWHKKNGNNSSSEQGQEGVDPAAQYAAEYLSRLALQRGTKDNISVIVVDL  294

Query  419  KAQRKFKKK  393
            K QRK KKK
Sbjct  295  KPQRKIKKK  303



>ref|XP_010539398.1| PREDICTED: protein phosphatase 2C 77-like [Tarenaya hassleriana]
Length=439

 Score =   272 bits (696),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 138/195 (71%), Positives = 166/195 (85%), Gaps = 4/195 (2%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAV A++ PT+I VANCGDSRAVLCRGK P+PLSVDHKP+REDE +RIEA GGK
Sbjct  243  PETVGSTAVAAVVFPTHIFVANCGDSRAVLCRGKAPLPLSVDHKPDREDEAARIEAAGGK  302

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+G RV GVLA+SRSIGDRYL+P +IP PE+M + R +ED+CL+LASDGLWDVMTNE
Sbjct  303  VIRWNGARVFGVLAMSRSIGDRYLKPSIIPDPEVMVIRRVREDDCLILASDGLWDVMTNE  362

Query  602  EVCDVARRRLLLWHKKN---GGTMLSRE-RSddpdpaaqdaAEYLTRIALQRGSRDNISV  435
            E CD+AR+R+L+WHKKN   G  +L  E R +  DPAAQ AAEYL+++AL++GS+DNISV
Sbjct  363  EACDMARKRILVWHKKNAMAGDALLPMERRGEGIDPAAQTAAEYLSKLALKKGSKDNISV  422

Query  434  IVVDLKAQRKFKKKA  390
            +VVDLKAQRKFK KA
Sbjct  423  VVVDLKAQRKFKSKA  437



>ref|XP_008809295.1| PREDICTED: probable protein phosphatase 2C 6 [Phoenix dactylifera]
 ref|XP_008809296.1| PREDICTED: probable protein phosphatase 2C 6 [Phoenix dactylifera]
Length=484

 Score =   273 bits (699),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 136/189 (72%), Positives = 165/189 (87%), Gaps = 0/189 (0%)
 Frame = -3

Query  959  EAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGKV  780
            E VGSTAVVA++C ++II+ANCGDSRAVLCR K P+PLSVDHKPNREDEY RIEA GGKV
Sbjct  295  ETVGSTAVVAVICSSHIIIANCGDSRAVLCRAKQPVPLSVDHKPNREDEYKRIEAEGGKV  354

Query  779  INWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNEE  600
            I W+G+RV GVLA+SRSIGD+YL+P++IPVPE+  VPR KED+CL+LASDGLWDVM+NEE
Sbjct  355  IQWNGYRVFGVLAMSRSIGDQYLKPWIIPVPEVTIVPRTKEDDCLILASDGLWDVMSNEE  414

Query  599  VCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVDL  420
            VC+VAR+R+L WHK+NG T    +R +  DPAAQ AA+ L++ ALQ+GS+DNI+VIVVDL
Sbjct  415  VCEVARKRILHWHKRNGVTSSPTQRGEKADPAAQAAADCLSKHALQKGSKDNITVIVVDL  474

Query  419  KAQRKFKKK  393
            KAQRKFK K
Sbjct  475  KAQRKFKTK  483



>emb|CDY48313.1| BnaC05g13670D [Brassica napus]
Length=501

 Score =   273 bits (699),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 131/191 (69%), Positives = 162/191 (85%), Gaps = 1/191 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVA++C ++IIV+NCGDSRAVL RGK  MPLSVDHKP+REDEY+RIE  GGK
Sbjct  312  PETVGSTAVVALVCSSHIIVSNCGDSRAVLLRGKDSMPLSVDHKPDREDEYARIERAGGK  371

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W G RVSGVLA+SRSIGD YL PYVIP PE+ F+PRA+EDECL+LASDGLWDV++N+
Sbjct  372  VIQWQGARVSGVLAMSRSIGDEYLEPYVIPDPEVTFMPRAREDECLILASDGLWDVISNQ  431

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            + C+ AR+R+L WHKKNG   L+ ER    D A Q A++YL+++A+Q+GS+DNIS+IVVD
Sbjct  432  DACEFARKRILWWHKKNGALPLA-ERGVGEDQACQAASDYLSKLAIQKGSKDNISIIVVD  490

Query  422  LKAQRKFKKKA  390
            LKAQRKFK ++
Sbjct  491  LKAQRKFKTRS  501



>ref|XP_010536873.1| PREDICTED: protein phosphatase 2C 77-like [Tarenaya hassleriana]
 ref|XP_010536874.1| PREDICTED: protein phosphatase 2C 77-like [Tarenaya hassleriana]
Length=440

 Score =   271 bits (694),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 141/195 (72%), Positives = 165/195 (85%), Gaps = 4/195 (2%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVA++ PT+I VANCGDSRAVLCR K P+PLSVDHKP+REDE +RIEA GGK
Sbjct  244  PETVGSTAVVAVVFPTHIFVANCGDSRAVLCRSKTPLPLSVDHKPDREDEAARIEAAGGK  303

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+  RV GVLA+SRSIGDRYL+P +IP PE+  + R K+D+CLVLASDGLWDVMTNE
Sbjct  304  VIRWNSARVFGVLAMSRSIGDRYLKPSIIPDPEVTAIRRVKDDDCLVLASDGLWDVMTNE  363

Query  602  EVCDVARRRLLLWHKKN---GGTMLSRE-RSddpdpaaqdaAEYLTRIALQRGSRDNISV  435
            EVCDVAR+R+LLWHKKN   G  +L  E R +  DPAAQ AAEYL+++ALQ+GS+DNISV
Sbjct  364  EVCDVARKRILLWHKKNAVAGDALLPAEPRGEGLDPAAQSAAEYLSKLALQKGSKDNISV  423

Query  434  IVVDLKAQRKFKKKA  390
            +VVDLKAQRKFK KA
Sbjct  424  LVVDLKAQRKFKSKA  438



>ref|XP_006351626.1| PREDICTED: probable protein phosphatase 2C 6-like, partial [Solanum 
tuberosum]
Length=453

 Score =   272 bits (695),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 138/191 (72%), Positives = 160/191 (84%), Gaps = 7/191 (4%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVA++C ++IIVAN GDSRAVLCRGK PM LSVDHKPNREDEY+RIEA GGK
Sbjct  270  PETVGSTAVVAVVCSSHIIVANYGDSRAVLCRGKEPMALSVDHKPNREDEYARIEAAGGK  329

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+GHRV GVLA+SRSIGDRYL+P++IP PE+MF+PR K+DECL+LASDGLWDVMTNE
Sbjct  330  VIQWNGHRVFGVLAMSRSIGDRYLKPWIIPDPEVMFIPRTKDDECLILASDGLWDVMTNE  389

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            EVCD+AR+R+LLWH+KNG T+ S ER          AAE L+  AL   S+DNI+VIVVD
Sbjct  390  EVCDLARKRILLWHRKNGVTLPS-ERG---QGIDPAAAECLSNRAL---SKDNITVIVVD  442

Query  422  LKAQRKFKKKA  390
            LKAQRKFK K 
Sbjct  443  LKAQRKFKSKT  453



>gb|KFK29119.1| hypothetical protein AALP_AA7G091300 [Arabis alpina]
Length=433

 Score =   271 bits (693),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 134/195 (69%), Positives = 162/195 (83%), Gaps = 5/195 (3%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGST+VVA++ PT+I VANCGDSRAVLCRGK P+PLSVDHKP+REDE +RIEA GGK
Sbjct  236  PETVGSTSVVAVVLPTHIFVANCGDSRAVLCRGKTPLPLSVDHKPDREDEAARIEAAGGK  295

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            +I WDG RV GVLA+SRSIGDRYL+P +IP PE+M V R KED+CL+LASDG+WDVMT+E
Sbjct  296  IIQWDGARVFGVLAMSRSIGDRYLKPSIIPDPEVMAVRRVKEDDCLILASDGVWDVMTDE  355

Query  602  EVCDVARRRLLLWHKKN-----GGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNIS  438
            E C++AR+R+LLWHKKN        ++   R +  DPAA  AAEYL+++ALQRGS+DNIS
Sbjct  356  EACEMARKRILLWHKKNVMAGDASLLIDERRKEGKDPAAMSAAEYLSKLALQRGSKDNIS  415

Query  437  VIVVDLKAQRKFKKK  393
            V+VVDLK QRKFK K
Sbjct  416  VVVVDLKPQRKFKTK  430



>pdb|3KB3|B Chain B, Crystal Structure Of Abscisic Acid-Bound Pyl2 In Complex 
With Hab1
Length=321

 Score =   267 bits (682),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 132/185 (71%), Positives = 160/185 (86%), Gaps = 1/185 (1%)
 Frame = -3

Query  959  EAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGKV  780
            E VGSTAVVA++C ++I+V+NCGDSRAVL RGK  MPLSVDHKP+REDEY+RIE  GGKV
Sbjct  138  ETVGSTAVVALVCSSHIVVSNCGDSRAVLFRGKEAMPLSVDHKPDREDEYARIENAGGKV  197

Query  779  INWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNEE  600
            I W G RV GVLA+SRSIGDRYL+PYVIP PE+ F+PR++EDECL+LASDGLWDVM N+E
Sbjct  198  IQWQGARVFGVLAMSRSIGDRYLKPYVIPEPEVTFMPRSREDECLILASDGLWDVMNNQE  257

Query  599  VCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVDL  420
            VC++ARRR+L+WHKKNG   L+ ER    DPA Q AA+YL+ +ALQ+GS+DNIS+IV+DL
Sbjct  258  VCEIARRRILMWHKKNGAPPLA-ERGKGIDPACQAAADYLSMLALQKGSKDNISIIVIDL  316

Query  419  KAQRK  405
            KAQRK
Sbjct  317  KAQRK  321



>emb|CDX72943.1| BnaC06g33910D [Brassica napus]
Length=475

 Score =   271 bits (694),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 132/190 (69%), Positives = 165/190 (87%), Gaps = 1/190 (1%)
 Frame = -3

Query  959  EAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGKV  780
            E VGSTAVVA++C ++++V+NCGDSRAVL RGK  MPLSVDHKP+REDEY+RIE  GGKV
Sbjct  287  ETVGSTAVVALVCSSHLVVSNCGDSRAVLYRGKEAMPLSVDHKPDREDEYARIENAGGKV  346

Query  779  INWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNEE  600
            I W G RV GVLA+SRS+GDRYL+PYVIP PE+ F+PR++ED+CL++ASDGLWDVM+N+E
Sbjct  347  IQWQGARVFGVLAMSRSLGDRYLKPYVIPEPEVTFMPRSREDDCLIIASDGLWDVMSNQE  406

Query  599  VCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVDL  420
            VC+VAR+R+L+WHKK+G   L+ ER    DPA Q AAEYL+ +ALQ+GS+DNIS+IVVDL
Sbjct  407  VCEVARKRILMWHKKHGAPPLA-ERGKGTDPACQAAAEYLSVLALQKGSKDNISIIVVDL  465

Query  419  KAQRKFKKKA  390
            KAQRKFK +A
Sbjct  466  KAQRKFKTRA  475



>ref|XP_009105943.1| PREDICTED: protein phosphatase 2C 16 [Brassica rapa]
 ref|XP_009105944.1| PREDICTED: protein phosphatase 2C 16 [Brassica rapa]
 ref|XP_009105945.1| PREDICTED: protein phosphatase 2C 16 [Brassica rapa]
 gb|AGG35979.1| hypersensitive to ABA 1 [Brassica napus]
 emb|CDX96432.1| BnaA07g30430D [Brassica napus]
Length=484

 Score =   272 bits (695),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 132/190 (69%), Positives = 165/190 (87%), Gaps = 1/190 (1%)
 Frame = -3

Query  959  EAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGKV  780
            E VGSTAVVA++C ++++V+NCGDSRAVL RGK  MPLSVDHKP+REDEY+RIE  GGKV
Sbjct  296  ETVGSTAVVALVCSSHLVVSNCGDSRAVLYRGKEAMPLSVDHKPDREDEYARIENAGGKV  355

Query  779  INWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNEE  600
            I W G RV GVLA+SRS+GDRYL+PYVIP PE+ F+PR++ED+CL++ASDGLWDVM+N+E
Sbjct  356  IQWQGARVFGVLAMSRSLGDRYLKPYVIPEPEVTFMPRSREDDCLIIASDGLWDVMSNQE  415

Query  599  VCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVDL  420
            VC+VAR+R+L+WHKK+G   L+ ER    DPA Q AAEYL+ +ALQ+GS+DNIS+IVVDL
Sbjct  416  VCEVARKRILMWHKKHGAPPLA-ERGKGTDPACQAAAEYLSVLALQKGSKDNISIIVVDL  474

Query  419  KAQRKFKKKA  390
            KAQRKFK +A
Sbjct  475  KAQRKFKTRA  484



>ref|XP_007138695.1| hypothetical protein PHAVU_009G229900g [Phaseolus vulgaris]
 ref|XP_007138696.1| hypothetical protein PHAVU_009G229900g [Phaseolus vulgaris]
 ref|XP_007138697.1| hypothetical protein PHAVU_009G229900g [Phaseolus vulgaris]
 gb|ESW10689.1| hypothetical protein PHAVU_009G229900g [Phaseolus vulgaris]
 gb|ESW10690.1| hypothetical protein PHAVU_009G229900g [Phaseolus vulgaris]
 gb|ESW10691.1| hypothetical protein PHAVU_009G229900g [Phaseolus vulgaris]
Length=537

 Score =   273 bits (698),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 143/189 (76%), Positives = 161/189 (85%), Gaps = 1/189 (1%)
 Frame = -3

Query  959  EAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGKV  780
            EAVGSTAVVA+L  T+IIVANCGDSRAVLCRGK  +P+S DHKPNREDE+ RIEA GG+V
Sbjct  349  EAVGSTAVVALLTQTHIIVANCGDSRAVLCRGKEAIPMSDDHKPNREDEWERIEASGGRV  408

Query  779  INWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNEE  600
            I W+G+RV GVLAVSRSIGDRYL+P+VIP PE+  V R K DE LVLASDGLWDVMTNEE
Sbjct  409  IQWNGYRVLGVLAVSRSIGDRYLKPWVIPEPEVKCVQRDKNDEFLVLASDGLWDVMTNEE  468

Query  599  VCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVDL  420
             CD ARRR+LLWHKKNG    S ++   PDPAAQ AAEYL+R+ALQRGS+DNISVIV+DL
Sbjct  469  ACDFARRRILLWHKKNGNNS-SSQQGQGPDPAAQYAAEYLSRLALQRGSKDNISVIVIDL  527

Query  419  KAQRKFKKK  393
            K QRKFKKK
Sbjct  528  KPQRKFKKK  536



>ref|XP_010416043.1| PREDICTED: protein phosphatase 2C 16-like isoform X1 [Camelina 
sativa]
 ref|XP_010416044.1| PREDICTED: protein phosphatase 2C 16-like isoform X2 [Camelina 
sativa]
 ref|XP_010416045.1| PREDICTED: protein phosphatase 2C 16-like isoform X1 [Camelina 
sativa]
Length=502

 Score =   272 bits (695),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 130/189 (69%), Positives = 162/189 (86%), Gaps = 1/189 (1%)
 Frame = -3

Query  959  EAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGKV  780
            E VGSTAVVA++C ++I+V+NCGDSRAVL RGK  MPLSVDHKP+REDEY+RIE  GGKV
Sbjct  314  ETVGSTAVVALVCSSHIVVSNCGDSRAVLFRGKEAMPLSVDHKPDREDEYARIENAGGKV  373

Query  779  INWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNEE  600
            I W G RV GVLA+SRS+GDRYL+PYVIP PE+ F+PR++EDECL+LASDGLWDVM N+E
Sbjct  374  IQWQGARVFGVLAMSRSLGDRYLKPYVIPKPEVTFMPRSREDECLILASDGLWDVMNNQE  433

Query  599  VCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVDL  420
             C++ARRR+L+WHKKNG   ++ ER    DPA Q AA+YL+ +A+Q+GS+DNIS+IV+DL
Sbjct  434  ACEMARRRILMWHKKNGAPPIA-ERGKGTDPACQAAADYLSMLAIQKGSKDNISIIVIDL  492

Query  419  KAQRKFKKK  393
            KAQRKFK +
Sbjct  493  KAQRKFKTR  501



>ref|XP_010428176.1| PREDICTED: protein phosphatase 2C 16-like [Camelina sativa]
 ref|XP_010428177.1| PREDICTED: protein phosphatase 2C 16-like [Camelina sativa]
Length=497

 Score =   271 bits (694),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 130/190 (68%), Positives = 162/190 (85%), Gaps = 1/190 (1%)
 Frame = -3

Query  959  EAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGKV  780
            E VGSTAVVA++C ++I+V+NCGDSRAVL RGK  MPLSVDHKP+REDEY+RIE  GGKV
Sbjct  309  ETVGSTAVVALVCSSHIVVSNCGDSRAVLLRGKEAMPLSVDHKPDREDEYARIENAGGKV  368

Query  779  INWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNEE  600
            I W G RV GVLA+SRS+GDRYL+PYVIP PE+ F+PR++EDECL+LASDGLWDVM N+E
Sbjct  369  IQWQGARVFGVLAMSRSLGDRYLKPYVIPEPEVTFMPRSREDECLILASDGLWDVMNNQE  428

Query  599  VCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVDL  420
             C++ARRR+L+WHKKNG   ++ ER    DPA Q AA+YL+ +A+Q+GS+DNIS+IV+DL
Sbjct  429  ACELARRRILMWHKKNGAPPIA-ERGKGTDPACQAAADYLSMLAIQKGSKDNISIIVIDL  487

Query  419  KAQRKFKKKA  390
            KAQRKFK + 
Sbjct  488  KAQRKFKTRT  497



>dbj|BAJ33756.1| unnamed protein product [Thellungiella halophila]
Length=273

 Score =   264 bits (674),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 129/186 (69%), Positives = 159/186 (85%), Gaps = 1/186 (1%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVA++C ++IIV+NCGDSRAVL RGK  MPLSVDHKP+REDEY+RIE  GGK
Sbjct  84   PETVGSTAVVALVCSSHIIVSNCGDSRAVLLRGKASMPLSVDHKPDREDEYARIERAGGK  143

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W G RVSGVLA+SRSIGD YL PYVIP PE+ F+PRA+EDECL+LASDGLWDV++N+
Sbjct  144  VIQWQGARVSGVLAMSRSIGDEYLEPYVIPDPEVTFMPRAREDECLILASDGLWDVISNQ  203

Query  602  EVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVD  423
            + C++AR+R+L WHK+NG   L+ ER    D A Q AA++L+++ALQ+GS+DNIS+IVVD
Sbjct  204  DACELARKRILWWHKRNGALPLA-ERGVGEDQACQAAADFLSKLALQKGSKDNISIIVVD  262

Query  422  LKAQRK  405
            LKAQRK
Sbjct  263  LKAQRK  268



>ref|XP_003534931.1| PREDICTED: probable protein phosphatase 2C 6-like isoform X1 
[Glycine max]
 ref|XP_006587027.1| PREDICTED: probable protein phosphatase 2C 6-like isoform X2 
[Glycine max]
 ref|XP_006587028.1| PREDICTED: probable protein phosphatase 2C 6-like isoform X3 
[Glycine max]
 ref|XP_006587029.1| PREDICTED: probable protein phosphatase 2C 6-like isoform X4 
[Glycine max]
Length=522

 Score =   271 bits (693),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 137/190 (72%), Positives = 160/190 (84%), Gaps = 1/190 (1%)
 Frame = -3

Query  959  EAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGKV  780
            E VGSTAVVAIL  T+IIVANCGDSRAVLCRGK  +PLS DHKPNR+DE+ RIEA GG+V
Sbjct  332  ETVGSTAVVAILTQTHIIVANCGDSRAVLCRGKQALPLSDDHKPNRDDEWERIEAAGGRV  391

Query  779  INWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNEE  600
            I W+G+RV GVLAVSRSIGDRYL+P+VIP PE+  V R K DECL+LASDGLWDVMTNEE
Sbjct  392  IQWNGYRVLGVLAVSRSIGDRYLKPWVIPEPEVKCVQRDKSDECLILASDGLWDVMTNEE  451

Query  599  VCDVARRRLLLWHKKNGGTMLSRERSddpdp-aaqdaAEYLTRIALQRGSRDNISVIVVD  423
             C++AR+R+LLWHKKNG   +S E+  +    AAQ AAEYL+R+ALQRG++DNISVIV+D
Sbjct  452  ACEIARKRILLWHKKNGNNSVSSEQGQEGVDPAAQYAAEYLSRLALQRGTKDNISVIVID  511

Query  422  LKAQRKFKKK  393
            LK QRK KKK
Sbjct  512  LKPQRKIKKK  521



>ref|XP_010471312.1| PREDICTED: protein phosphatase 2C 16-like [Camelina sativa]
 ref|XP_010471313.1| PREDICTED: protein phosphatase 2C 16-like [Camelina sativa]
Length=497

 Score =   270 bits (691),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 130/189 (69%), Positives = 162/189 (86%), Gaps = 1/189 (1%)
 Frame = -3

Query  959  EAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGKV  780
            E VGSTAVVA++C ++I+V+NCGDSRAVL RGK  MPLSVDHKP+REDEY+RIE  GGKV
Sbjct  309  ETVGSTAVVALVCSSHIVVSNCGDSRAVLFRGKEAMPLSVDHKPDREDEYARIENAGGKV  368

Query  779  INWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNEE  600
            I W G RV GVLA+SRS+GDRYL+PYVIP PE+ F+PR++EDECL+LASDGLWDVM N+E
Sbjct  369  IQWQGARVFGVLAMSRSLGDRYLKPYVIPEPEVTFMPRSREDECLILASDGLWDVMDNQE  428

Query  599  VCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVDL  420
             C++ARRR+L+WHKKNG   ++ ER    DPA Q AA+YL+ +A+Q+GS+DNIS+IV+DL
Sbjct  429  ACEMARRRILMWHKKNGAPPIA-ERGKGTDPACQAAADYLSMLAIQKGSKDNISIIVIDL  487

Query  419  KAQRKFKKK  393
            KAQRKFK +
Sbjct  488  KAQRKFKTR  496



>pdb|4LA7|B Chain B, X-ray Crystal Structure Of The Pyl2-quinabactin-hab1 
Ternary Complex
 pdb|4WVO|B Chain B, An Engineered Pyr1 Mandipropamid Receptor In Complex 
With Mandipropamid And Hab1
Length=331

 Score =   265 bits (677),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 131/184 (71%), Positives = 159/184 (86%), Gaps = 1/184 (1%)
 Frame = -3

Query  959  EAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGKV  780
            E VGSTAVVA++C ++I+V+NCGDSRAVL RGK  MPLSVDHKP+REDEY+RIE  GGKV
Sbjct  149  ETVGSTAVVALVCSSHIVVSNCGDSRAVLFRGKEAMPLSVDHKPDREDEYARIENAGGKV  208

Query  779  INWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNEE  600
            I W G RV GVLA+SRSIGDRYL+PYVIP PE+ F+PR++EDECL+LASDGLWDVM N+E
Sbjct  209  IQWQGARVFGVLAMSRSIGDRYLKPYVIPEPEVTFMPRSREDECLILASDGLWDVMNNQE  268

Query  599  VCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVDL  420
            VC++ARRR+L+WHKKNG   L+ ER    DPA Q AA+YL+ +ALQ+GS+DNIS+IV+DL
Sbjct  269  VCEIARRRILMWHKKNGAPPLA-ERGKGIDPACQAAADYLSMLALQKGSKDNISIIVIDL  327

Query  419  KAQR  408
            KAQR
Sbjct  328  KAQR  331



>pdb|3NMV|B Chain B, Crystal Structure Of Pyrabactin-Bound Abscisic Acid 
Receptor Pyl2 Mutant A93f In Complex With Type 2c Protein Phosphatase 
Abi2
 pdb|3UJK|A Chain A, Crystal Structure Of Protein Phosphatase Abi2
 pdb|3UJL|B Chain B, Crystal Structure Of Abscisic Acid Bound Pyl2 In Complex 
With Type 2c Protein Phosphatase Abi2
Length=324

 Score =   265 bits (677),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 137/195 (70%), Positives = 163/195 (84%), Gaps = 4/195 (2%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGST+VVA++ PT+I VANCGDSRAVLCRGK P+ LSVDHKP+R+DE +RIEA GGK
Sbjct  128  PETVGSTSVVAVVFPTHIFVANCGDSRAVLCRGKTPLALSVDHKPDRDDEAARIEAAGGK  187

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+G RV GVLA+SRSIGDRYL+P VIP PE+  V R KED+CL+LASDGLWDVMTNE
Sbjct  188  VIRWNGARVFGVLAMSRSIGDRYLKPSVIPDPEVTSVRRVKEDDCLILASDGLWDVMTNE  247

Query  602  EVCDVARRRLLLWHKKN---GGTMLSRE-RSddpdpaaqdaAEYLTRIALQRGSRDNISV  435
            EVCD+AR+R+LLWHKKN   G  +L  E R +  DPAA  AAEYL+++ALQ+GS+DNISV
Sbjct  248  EVCDLARKRILLWHKKNAMAGEALLPAEKRGEGKDPAAMSAAEYLSKMALQKGSKDNISV  307

Query  434  IVVDLKAQRKFKKKA  390
            +VVDLK  RKFK K+
Sbjct  308  VVVDLKGIRKFKSKS  322



>ref|XP_010545366.1| PREDICTED: protein phosphatase 2C 77-like [Tarenaya hassleriana]
 ref|XP_010545367.1| PREDICTED: protein phosphatase 2C 77-like [Tarenaya hassleriana]
 ref|XP_010545368.1| PREDICTED: protein phosphatase 2C 77-like [Tarenaya hassleriana]
 ref|XP_010545370.1| PREDICTED: protein phosphatase 2C 77-like [Tarenaya hassleriana]
 ref|XP_010545371.1| PREDICTED: protein phosphatase 2C 77-like [Tarenaya hassleriana]
Length=457

 Score =   268 bits (685),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 138/196 (70%), Positives = 161/196 (82%), Gaps = 5/196 (3%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGSTAVVA++ PT+I VANCGDSRA+LCRGK P+PLSVDHKP+REDE +RIEA GGK
Sbjct  259  PETVGSTAVVALVFPTHIFVANCGDSRALLCRGKTPLPLSVDHKPDREDEAARIEAAGGK  318

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+G RV GVLA+SRSIGDRYL+P +IP PE+    RAKED+CL+LASDGLWDVMT E
Sbjct  319  VIRWNGARVFGVLAMSRSIGDRYLKPSIIPDPEVTVTRRAKEDDCLILASDGLWDVMTCE  378

Query  602  EVCDVARRRLLLWHKKN---GGTMLSRERSddpdp--aaqdaAEYLTRIALQRGSRDNIS  438
            EVCDVAR+R+LLWHKK    G  ML    +       AAQ AAEYL+++ALQ+GS+DNIS
Sbjct  379  EVCDVARKRILLWHKKRAVAGEAMLPVGTAPVEGMDPAAQSAAEYLSKLALQKGSKDNIS  438

Query  437  VIVVDLKAQRKFKKKA  390
            V+VVDLKAQRKFK KA
Sbjct  439  VVVVDLKAQRKFKSKA  454



>ref|XP_009120223.1| PREDICTED: protein phosphatase 2C 77 [Brassica rapa]
 ref|XP_009120224.1| PREDICTED: protein phosphatase 2C 77 [Brassica rapa]
Length=422

 Score =   267 bits (682),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 137/195 (70%), Positives = 163/195 (84%), Gaps = 4/195 (2%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGST+VVA++ PT+I V+NCGDSRAVLCRGK P+ LSVDHKP+REDE +RIEA GGK
Sbjct  226  PETVGSTSVVAVVFPTHIFVSNCGDSRAVLCRGKTPLALSVDHKPDREDEAARIEAAGGK  285

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+G RV GVLA+SRSIGD+YL+P VIP P++  + R KED+CL+LASDGLWDVMTNE
Sbjct  286  VIQWNGARVFGVLAMSRSIGDKYLKPSVIPDPDVTSIRRVKEDDCLILASDGLWDVMTNE  345

Query  602  EVCDVARRRLLLWHKKN---GGTMLSRE-RSddpdpaaqdaAEYLTRIALQRGSRDNISV  435
            EVCD+AR+R+LLWHKKN   G  +L  E R +  DPAA  AAEYL+++ALQRGS+DNISV
Sbjct  346  EVCDMARKRILLWHKKNAMAGDALLPAEKRGEGKDPAAMSAAEYLSKMALQRGSKDNISV  405

Query  434  IVVDLKAQRKFKKKA  390
            IVVDLK  RKFK KA
Sbjct  406  IVVDLKGIRKFKSKA  420



>ref|XP_003547487.1| PREDICTED: probable protein phosphatase 2C 6-like isoform X1 
[Glycine max]
 ref|XP_006597832.1| PREDICTED: probable protein phosphatase 2C 6-like isoform X2 
[Glycine max]
 ref|XP_006597833.1| PREDICTED: probable protein phosphatase 2C 6-like isoform X3 
[Glycine max]
 ref|XP_006597834.1| PREDICTED: probable protein phosphatase 2C 6-like isoform X4 
[Glycine max]
 ref|XP_006597835.1| PREDICTED: probable protein phosphatase 2C 6-like isoform X5 
[Glycine max]
 ref|XP_006597836.1| PREDICTED: probable protein phosphatase 2C 6-like isoform X6 
[Glycine max]
 ref|XP_006597837.1| PREDICTED: probable protein phosphatase 2C 6-like isoform X7 
[Glycine max]
Length=527

 Score =   270 bits (690),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 136/189 (72%), Positives = 159/189 (84%), Gaps = 0/189 (0%)
 Frame = -3

Query  959  EAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGKV  780
            E VGSTAVVAIL  T+IIVANCGDSRAVLCRG+  +PLS DHKPNR+DE+ RIEA GG++
Sbjct  338  ETVGSTAVVAILTQTHIIVANCGDSRAVLCRGREALPLSDDHKPNRDDEWERIEAAGGRI  397

Query  779  INWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNEE  600
            I W+G+RV GVLAVSRSIGDRYL+P+VIP PE+  +   K DECL+LASDGLWDVMTNEE
Sbjct  398  IQWNGYRVLGVLAVSRSIGDRYLKPWVIPEPEVKCLQLDKNDECLILASDGLWDVMTNEE  457

Query  599  VCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIVVDL  420
             CD+AR+R+LLWHKKNG    S +  +  DPAAQ AAEYL+R+ALQRG++DNISVIVVDL
Sbjct  458  ACDIARKRILLWHKKNGNNSSSEQGQEGVDPAAQYAAEYLSRLALQRGTKDNISVIVVDL  517

Query  419  KAQRKFKKK  393
            K QRK KKK
Sbjct  518  KPQRKIKKK  526



>gb|AGG35959.1| ABA insensitive PP2C protein 2 [Brassica napus]
 emb|CDY38260.1| BnaA10g11080D [Brassica napus]
Length=422

 Score =   267 bits (682),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 137/195 (70%), Positives = 163/195 (84%), Gaps = 4/195 (2%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRAVLCRGKLPMPLSVDHKPNREDEYSRIEALGGK  783
            PE VGST+VVA++ PT+I V+NCGDSRAVLCRGK P+ LSVDHKP+REDE +RIEA GGK
Sbjct  226  PETVGSTSVVAVVFPTHIFVSNCGDSRAVLCRGKTPLALSVDHKPDREDEAARIEAAGGK  285

Query  782  VINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMTNE  603
            VI W+G RV GVLA+SRSIGD+YL+P VIP P++  + R KED+CL+LASDGLWDVMTNE
Sbjct  286  VIQWNGARVFGVLAMSRSIGDKYLKPSVIPDPDVTSIRRVKEDDCLILASDGLWDVMTNE  345

Query  602  EVCDVARRRLLLWHKKN---GGTMLSRE-RSddpdpaaqdaAEYLTRIALQRGSRDNISV  435
            EVCD+AR+R+LLWHKKN   G  +L  E R +  DPAA  AAEYL+++ALQRGS+DNISV
Sbjct  346  EVCDMARKRILLWHKKNAMAGDALLPAEKRGEGKDPAAMSAAEYLSKMALQRGSKDNISV  405

Query  434  IVVDLKAQRKFKKKA  390
            IVVDLK  RKFK KA
Sbjct  406  IVVDLKGIRKFKSKA  420



>ref|XP_010540081.1| PREDICTED: LOW QUALITY PROTEIN: protein phosphatase 2C 16-like 
[Tarenaya hassleriana]
Length=525

 Score =   270 bits (689),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 136/193 (70%), Positives = 163/193 (84%), Gaps = 3/193 (2%)
 Frame = -3

Query  962  PEAVGSTAVVAILCPTNIIVANCGDSRA--VLCRGKLPMPLSVDHKPNREDEYSRIEALG  789
            PE VGSTAVVA++C ++IIVANCGDSRA  VL RGK  M LS+DHKP+REDEY+RI+  G
Sbjct  334  PETVGSTAVVALVCSSHIIVANCGDSRARAVLYRGKESMALSIDHKPDREDEYARIDESG  393

Query  788  GKVINWDGHRVSGVLAVSRSIGDRYLRPYVIPVPEIMFVPRAKEDECLVLASDGLWDVMT  609
            GKVI W+G RV GVLA+SRSIGDRYL+P++IP PE+ F+PR +EDECLVLASDGLWDVMT
Sbjct  394  GKVIQWNGARVFGVLAMSRSIGDRYLKPWIIPEPEVTFIPRTREDECLVLASDGLWDVMT  453

Query  608  NEEVCDVARRRLLLWHKKNGGTMLSRERSddpdpaaqdaAEYLTRIALQRGSRDNISVIV  429
            N+E C+ ARRR+LLWHKKNG   L+ ER    DPAAQ AAEYL+ +ALQ+GS+DN+SV+V
Sbjct  454  NQEACETARRRILLWHKKNGSPALA-ERGRGADPAAQAAAEYLSVVALQKGSKDNMSVVV  512

Query  428  VDLKAQRKFKKKA  390
            VDLK QRKFK K+
Sbjct  513  VDLKVQRKFKNKS  525



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2350593015464