BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig11192

Length=869
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|ABZ04081.1|  chloroplast heat shock protein 70-2                     291   4e-89   Ipomoea nil [qian niu]
gb|ABK96230.1|  unknown                                                 269   5e-86   Populus trichocarpa x Populus deltoides
ref|XP_006593240.1|  PREDICTED: stromal 70 kDa heat shock-related...    275   2e-85   
gb|KHN39675.1|  Stromal 70 kDa heat shock-related protein, chloro...    276   5e-84   Glycine soja [wild soybean]
ref|XP_009609390.1|  PREDICTED: stromal 70 kDa heat shock-related...    276   2e-83   Nicotiana tomentosiformis
ref|XP_003548186.1|  PREDICTED: stromal 70 kDa heat shock-related...    276   2e-83   Glycine max [soybeans]
ref|XP_004230445.1|  PREDICTED: stromal 70 kDa heat shock-related...    275   5e-83   Solanum lycopersicum
ref|XP_009775058.1|  PREDICTED: stromal 70 kDa heat shock-related...    275   6e-83   Nicotiana sylvestris
ref|XP_011047905.1|  PREDICTED: stromal 70 kDa heat shock-related...    275   7e-83   Populus euphratica
ref|XP_006349319.1|  PREDICTED: stromal 70 kDa heat shock-related...    275   7e-83   Solanum tuberosum [potatoes]
ref|XP_011087666.1|  PREDICTED: stromal 70 kDa heat shock-related...    274   2e-82   Sesamum indicum [beniseed]
ref|XP_012066679.1|  PREDICTED: stromal 70 kDa heat shock-related...    274   2e-82   Jatropha curcas
ref|XP_009598659.1|  PREDICTED: stromal 70 kDa heat shock-related...    274   2e-82   Nicotiana tomentosiformis
gb|KHG00021.1|  Heat shock 70 kDa 7, chloroplastic -like protein        273   2e-82   Gossypium arboreum [tree cotton]
ref|XP_011016196.1|  PREDICTED: stromal 70 kDa heat shock-related...    273   2e-82   Populus euphratica
ref|XP_011092298.1|  PREDICTED: stromal 70 kDa heat shock-related...    273   3e-82   Sesamum indicum [beniseed]
ref|XP_002279101.1|  PREDICTED: stromal 70 kDa heat shock-related...    272   7e-82   Vitis vinifera
gb|KJB71619.1|  hypothetical protein B456_011G134000                    272   1e-81   Gossypium raimondii
gb|KHG03789.1|  Heat shock 70 kDa 6, chloroplastic -like protein        271   1e-81   Gossypium arboreum [tree cotton]
ref|XP_002526446.1|  heat shock protein, putative                       271   3e-81   Ricinus communis
ref|XP_003592913.1|  Heat shock protein                                 271   3e-81   Medicago truncatula
ref|XP_007033710.1|  Chloroplast heat shock protein 70 isoform 1        269   5e-81   
gb|EYU33275.1|  hypothetical protein MIMGU_mgv1a002169mg                270   5e-81   Erythranthe guttata [common monkey flower]
ref|XP_004485441.1|  PREDICTED: stromal 70 kDa heat shock-related...    270   8e-81   Cicer arietinum [garbanzo]
ref|XP_006389517.1|  Stromal 70 kDa heat shock-related family pro...    270   8e-81   Populus trichocarpa [western balsam poplar]
gb|ABA86577.1|  putative heat shock protein 70                          253   1e-80   Aquilegia olympica
gb|ABA86578.1|  putative heat shock protein 70                          253   1e-80   Semiaquilegia adoxoides
gb|ABA86573.1|  putative heat shock protein 70                          253   1e-80   Aquilegia formosa
ref|XP_007033712.1|  Chloroplast heat shock protein 70 isoform 3        269   2e-80   
gb|AEY83979.1|  heat shock protein 70 KDa                               253   3e-80   Triticum aestivum [Canadian hard winter wheat]
gb|KJB38007.1|  hypothetical protein B456_006G232400                    268   3e-80   Gossypium raimondii
ref|XP_004138943.1|  PREDICTED: stromal 70 kDa heat shock-related...    268   4e-80   
ref|XP_010065272.1|  PREDICTED: stromal 70 kDa heat shock-related...    267   5e-80   Eucalyptus grandis [rose gum]
gb|ABA86576.1|  putative heat shock protein 70                          251   6e-80   Aquilegia pyrenaica
ref|XP_008799965.1|  PREDICTED: stromal 70 kDa heat shock-related...    267   8e-80   Phoenix dactylifera
ref|XP_010030182.1|  PREDICTED: stromal 70 kDa heat shock-related...    267   9e-80   Eucalyptus grandis [rose gum]
ref|XP_008457143.1|  PREDICTED: stromal 70 kDa heat shock-related...    266   1e-79   Cucumis melo [Oriental melon]
gb|AAC03416.1|  heat shock protein 70 precursor                         266   1e-79   Citrullus lanatus [wild melon]
ref|XP_006385039.1|  Stromal 70 kDa heat shock-related family pro...    268   1e-79   
emb|CAA52149.1|  heat shock protein 70                                  266   1e-79   Cucumis sativus [cucumbers]
ref|XP_007148569.1|  hypothetical protein PHAVU_006G219600g             266   1e-79   Phaseolus vulgaris [French bean]
gb|EYU26456.1|  hypothetical protein MIMGU_mgv1a002163mg                266   2e-79   Erythranthe guttata [common monkey flower]
ref|XP_009353782.1|  PREDICTED: stromal 70 kDa heat shock-related...    265   3e-79   Pyrus x bretschneideri [bai li]
ref|XP_008339403.1|  PREDICTED: stromal 70 kDa heat shock-related...    265   3e-79   
ref|XP_008368182.1|  PREDICTED: stromal 70 kDa heat shock-related...    265   3e-79   
ref|XP_004300629.1|  PREDICTED: stromal 70 kDa heat shock-related...    265   3e-79   Fragaria vesca subsp. vesca
gb|KJB27775.1|  hypothetical protein B456_005G009100                    265   4e-79   Gossypium raimondii
ref|XP_010095881.1|  Stromal 70 kDa heat shock-related protein          265   4e-79   Morus notabilis
ref|XP_010087927.1|  Stromal 70 kDa heat shock-related protein          265   4e-79   Morus notabilis
ref|XP_010266362.1|  PREDICTED: stromal 70 kDa heat shock-related...    265   8e-79   Nelumbo nucifera [Indian lotus]
gb|AAB91471.1|  heat shock 70 protein                                   264   1e-78   Spinacia oleracea
ref|XP_009353783.1|  PREDICTED: heat shock 70 kDa protein 6, chlo...    263   1e-78   Pyrus x bretschneideri [bai li]
ref|XP_010681763.1|  PREDICTED: stromal 70 kDa heat shock-related...    264   1e-78   Beta vulgaris subsp. vulgaris [field beet]
prf||1909352A  heat shock protein hsp70                                 263   1e-78
sp|Q02028.1|HSP7S_PEA  RecName: Full=Stromal 70 kDa heat shock-re...    263   1e-78   Pisum sativum [garden pea]
gb|ABZ04080.1|  chloroplast heat shock protein 70-1                     263   2e-78   Ipomoea nil [qian niu]
ref|XP_008357648.1|  PREDICTED: stromal 70 kDa heat shock-related...    262   5e-78   
ref|XP_007148568.1|  hypothetical protein PHAVU_006G219500g             261   8e-78   Phaseolus vulgaris [French bean]
ref|XP_009355320.1|  PREDICTED: stromal 70 kDa heat shock-related...    261   1e-77   Pyrus x bretschneideri [bai li]
ref|XP_010932308.1|  PREDICTED: stromal 70 kDa heat shock-related...    261   1e-77   Elaeis guineensis
ref|XP_010930060.1|  PREDICTED: stromal 70 kDa heat shock-related...    261   1e-77   Elaeis guineensis
ref|XP_008223905.1|  PREDICTED: stromal 70 kDa heat shock-related...    261   1e-77   Prunus mume [ume]
ref|NP_001066486.1|  Os12g0244100                                       260   3e-77   
ref|XP_006858478.1|  PREDICTED: stromal 70 kDa heat shock-related...    260   3e-77   Amborella trichopoda
gb|EEC69073.1|  hypothetical protein OsI_37938                          260   3e-77   Oryza sativa Indica Group [Indian rice]
gb|AFW67931.1|  hypothetical protein ZEAMMB73_095591                    251   5e-77   
gb|ABA81894.1|  heak shock protein 70                                   244   6e-77   Aquilegia formosa
ref|XP_007213617.1|  hypothetical protein PRUPE_ppa002222mg             259   7e-77   
ref|XP_008361671.1|  PREDICTED: stromal 70 kDa heat shock-related...    259   7e-77   
ref|XP_004307167.1|  PREDICTED: stromal 70 kDa heat shock-related...    259   8e-77   Fragaria vesca subsp. vesca
ref|XP_008339404.1|  PREDICTED: stromal 70 kDa heat shock-related...    259   8e-77   
dbj|BAJ88928.1|  predicted protein                                      247   8e-77   Hordeum vulgare subsp. vulgare [two-rowed barley]
sp|Q08080.1|HSP7S_SPIOL  RecName: Full=Stromal 70 kDa heat shock-...    256   2e-76   Spinacia oleracea
ref|XP_009404263.1|  PREDICTED: stromal 70 kDa heat shock-related...    258   2e-76   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAJ84945.1|  predicted protein                                      247   3e-76   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002442079.1|  hypothetical protein SORBIDRAFT_08g009580          257   4e-76   Sorghum bicolor [broomcorn]
gb|AFW56459.1|  stromal heat shock protein                              257   5e-76   
ref|NP_001152528.1|  stromal 70 kDa heat shock-related protein          257   5e-76   Zea mays [maize]
ref|XP_004960697.1|  PREDICTED: stromal 70 kDa heat shock-related...    256   1e-75   Setaria italica
emb|CDP16490.1|  unnamed protein product                                252   2e-75   Coffea canephora [robusta coffee]
ref|XP_006664462.1|  PREDICTED: stromal 70 kDa heat shock-related...    256   2e-75   
gb|KDO44469.1|  hypothetical protein CISIN_1g005099mg                   255   2e-75   Citrus sinensis [apfelsine]
emb|CBI39294.3|  unnamed protein product                                251   3e-75   Vitis vinifera
ref|XP_006492569.1|  PREDICTED: heat shock 70 kDa protein 6, chlo...    254   3e-75   
ref|XP_010533213.1|  PREDICTED: heat shock 70 kDa protein 6, chlo...    254   5e-75   Tarenaya hassleriana [spider flower]
ref|XP_006431617.1|  hypothetical protein CICLE_v10000433mg             254   7e-75   Citrus clementina [clementine]
gb|ADD23344.1|  70 kDa heat shock protein                               253   1e-74   Triticum aestivum [Canadian hard winter wheat]
ref|XP_004962155.1|  PREDICTED: stromal 70 kDa heat shock-related...    253   1e-74   Setaria italica
dbj|BAJ90336.1|  predicted protein                                      253   1e-74   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001055140.1|  Os05g0303000                                       247   2e-74   
ref|XP_009416635.1|  PREDICTED: stromal 70 kDa heat shock-related...    253   2e-74   Musa acuminata subsp. malaccensis [pisang utan]
emb|CAN78265.1|  hypothetical protein VITISV_006707                     251   2e-74   Vitis vinifera
gb|ACT65562.1|  70 kDa heat shock protein                               252   2e-74   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006492570.1|  PREDICTED: heat shock 70 kDa protein 6, chlo...    253   2e-74   Citrus sinensis [apfelsine]
ref|XP_002282802.1|  PREDICTED: stromal 70 kDa heat shock-related...    251   3e-74   Vitis vinifera
dbj|BAD22699.1|  heat shock protein 70                                  239   4e-74   Nicotiana benthamiana
ref|XP_009406395.1|  PREDICTED: stromal 70 kDa heat shock-related...    251   5e-74   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001146752.1|  uncharacterized protein LOC100280354               249   5e-74   Zea mays [maize]
ref|XP_008644594.1|  PREDICTED: stromal 70 kDa heat shock-related...    251   6e-74   Zea mays [maize]
gb|EMT28145.1|  Stromal 70 kDa heat shock-related protein, chloro...    252   7e-74   
tpg|DAA50789.1|  TPA: hypothetical protein ZEAMMB73_352617              250   9e-74   
emb|CDO97622.1|  unnamed protein product                                246   2e-73   Coffea canephora [robusta coffee]
ref|XP_006431615.1|  hypothetical protein CICLE_v10003758mg             250   2e-73   
ref|XP_010238578.1|  PREDICTED: stromal 70 kDa heat shock-related...    249   2e-73   Brachypodium distachyon [annual false brome]
gb|EAY97444.1|  hypothetical protein OsI_19374                          248   4e-73   Oryza sativa Indica Group [Indian rice]
gb|EMS50275.1|  Stromal 70 kDa heat shock-related protein, chloro...    247   4e-73   Triticum urartu
ref|XP_003568673.1|  PREDICTED: stromal 70 kDa heat shock-related...    248   5e-73   Brachypodium distachyon [annual false brome]
ref|XP_002864020.1|  cphsc70-2                                          249   5e-73   Arabidopsis lyrata subsp. lyrata
ref|XP_008792217.1|  PREDICTED: LOW QUALITY PROTEIN: stromal 70 k...    249   6e-73   Phoenix dactylifera
ref|XP_012079755.1|  PREDICTED: stromal 70 kDa heat shock-related...    248   6e-73   Jatropha curcas
gb|AGB06243.1|  heat shock protein 70                                   248   6e-73   Lactuca sativa [cultivated lettuce]
gb|ABP65327.1|  chloroplast heat shock protein 70                       248   7e-73   Cenchrus americanus [bulrush millet]
ref|XP_010530050.1|  PREDICTED: heat shock 70 kDa protein 6, chlo...    249   8e-73   Tarenaya hassleriana [spider flower]
gb|EEE63158.1|  hypothetical protein OsJ_17967                          248   1e-72   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006655173.1|  PREDICTED: stromal 70 kDa heat shock-related...    245   1e-72   Oryza brachyantha
ref|XP_008461924.1|  PREDICTED: stromal 70 kDa heat shock-related...    246   2e-72   Cucumis melo [Oriental melon]
ref|XP_006282334.1|  hypothetical protein CARUB_v10028629mg             247   3e-72   Capsella rubella
ref|XP_002869727.1|  cphsc70-1                                          247   3e-72   
emb|CDY08914.1|  BnaC08g11440D                                          244   4e-72   Brassica napus [oilseed rape]
ref|NP_199802.1|  heat shock protein 70-2                               246   5e-72   Arabidopsis thaliana [mouse-ear cress]
gb|AAF23074.1|AF074969_1  heat shock protein 70                         238   5e-72   Triticum aestivum [Canadian hard winter wheat]
gb|ABR16685.1|  unknown                                                 246   6e-72   Picea sitchensis
gb|KFK36576.1|  hypothetical protein AALP_AA4G141500                    246   6e-72   Arabis alpina [alpine rockcress]
ref|XP_009121331.1|  PREDICTED: heat shock 70 kDa protein 6, chlo...    241   1e-71   Brassica rapa
ref|XP_009794281.1|  PREDICTED: stromal 70 kDa heat shock-related...    244   1e-71   Nicotiana sylvestris
emb|CDY11007.1|  BnaA03g46660D                                          243   1e-71   Brassica napus [oilseed rape]
gb|ABR16620.1|  unknown                                                 245   1e-71   Picea sitchensis
gb|AAF27639.1|AF217459_1  heat shock protein 70                         245   2e-71   Arabidopsis thaliana [mouse-ear cress]
gb|EMT14862.1|  Stromal 70 kDa heat shock-related protein, chloro...    244   2e-71   
gb|KGN44489.1|  hypothetical protein Csa_7G312930                       243   4e-71   Cucumis sativus [cucumbers]
ref|XP_009137440.1|  PREDICTED: heat shock 70 kDa protein 6, chlo...    244   4e-71   Brassica rapa
ref|XP_001772650.1|  predicted protein                                  242   5e-71   
emb|CBI15489.3|  unnamed protein product                                239   5e-71   Vitis vinifera
emb|CDY24832.1|  BnaA08g14780D                                          242   5e-71   Brassica napus [oilseed rape]
ref|XP_004139746.2|  PREDICTED: LOW QUALITY PROTEIN: stromal 70 k...    243   6e-71   Cucumis sativus [cucumbers]
ref|XP_009117142.1|  PREDICTED: heat shock 70 kDa protein 6, chlo...    241   6e-71   Brassica rapa
ref|XP_006283214.1|  hypothetical protein CARUB_v10004245mg             243   6e-71   Capsella rubella
ref|XP_006413449.1|  hypothetical protein EUTSA_v10024543mg             243   1e-70   Eutrema salsugineum [saltwater cress]
gb|KFK33012.1|  hypothetical protein AALP_AA6G318800                    242   1e-70   Arabis alpina [alpine rockcress]
ref|XP_009588865.1|  PREDICTED: stromal 70 kDa heat shock-related...    242   1e-70   Nicotiana tomentosiformis
ref|XP_010441277.1|  PREDICTED: heat shock 70 kDa protein 7, chlo...    242   2e-70   Camelina sativa [gold-of-pleasure]
ref|XP_009109254.1|  PREDICTED: heat shock 70 kDa protein 6, chlo...    242   3e-70   Brassica rapa
ref|NP_194159.1|  chloroplast heat shock protein 70-1                   242   3e-70   Arabidopsis thaliana [mouse-ear cress]
emb|CDX92631.1|  BnaC07g38890D                                          241   3e-70   
ref|XP_010482286.1|  PREDICTED: heat shock 70 kDa protein 7, chlo...    241   3e-70   Camelina sativa [gold-of-pleasure]
ref|XP_006413448.1|  hypothetical protein EUTSA_v10024544mg             241   4e-70   Eutrema salsugineum [saltwater cress]
emb|CDY34275.1|  BnaA01g13780D                                          238   2e-69   Brassica napus [oilseed rape]
ref|XP_011096814.1|  PREDICTED: stromal 70 kDa heat shock-related...    239   3e-69   Sesamum indicum [beniseed]
ref|XP_010442469.1|  PREDICTED: heat shock 70 kDa protein 7, chlo...    239   3e-69   Camelina sativa [gold-of-pleasure]
ref|NP_001233780.1|  heat shock protein 70                              238   6e-69   
ref|XP_010439061.1|  PREDICTED: heat shock 70 kDa protein 6, chlo...    238   1e-68   Camelina sativa [gold-of-pleasure]
ref|XP_010433791.1|  PREDICTED: heat shock 70 kDa protein 6, chlo...    237   1e-68   Camelina sativa [gold-of-pleasure]
ref|XP_010448582.1|  PREDICTED: heat shock 70 kDa protein 6, chlo...    237   1e-68   Camelina sativa [gold-of-pleasure]
gb|AHL64247.1|  heat shock protein 70-1                                 236   2e-68   Brassica napus [oilseed rape]
ref|XP_009137922.1|  PREDICTED: heat shock 70 kDa protein 6, chlo...    236   2e-68   Brassica rapa
ref|XP_006361375.1|  PREDICTED: heat shock 70 kDa protein 6, chlo...    236   3e-68   Solanum tuberosum [potatoes]
emb|CDY03462.1|  BnaC01g16200D                                          236   4e-68   
ref|XP_001752769.1|  predicted protein                                  233   4e-67   
gb|ADB23405.1|  chloroplast Hsp70-1                                     233   4e-67   Physcomitrella patens
emb|CAN81065.1|  hypothetical protein VITISV_000728                     232   8e-67   Vitis vinifera
gb|EYU22829.1|  hypothetical protein MIMGU_mgv1a002344mg                230   3e-66   Erythranthe guttata [common monkey flower]
ref|XP_002974918.1|  hypothetical protein SELMODRAFT_267815             216   5e-61   
ref|XP_002988934.1|  hypothetical protein SELMODRAFT_235653             216   6e-61   
emb|CDY03461.1|  BnaC01g16210D                                          214   4e-60   
ref|XP_010242659.1|  PREDICTED: heat shock 70 kDa protein 6, chlo...    204   1e-57   
emb|CDY03459.1|  BnaC01g16230D                                          197   3e-54   
gb|AAO72585.1|  heat shock-related protein                              191   2e-53   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002982966.1|  hypothetical protein SELMODRAFT_117446             189   3e-51   Selaginella moellendorffii
ref|XP_002965491.1|  hypothetical protein SELMODRAFT_230659             189   3e-51   
emb|CAA65356.1|  heat shock protein 70B                                 189   4e-51   Chlamydomonas reinhardtii
ref|XP_005648953.1|  heat shock protein 70                              188   4e-51   Coccomyxa subellipsoidea C-169
ref|XP_007509042.1|  molecular chaperone DnaK                           189   5e-51   Bathycoccus prasinos
ref|XP_001696432.1|  heat shock protein 70B                             189   5e-51   Chlamydomonas reinhardtii
gb|EPS66995.1|  hypothetical protein M569_07782                         175   1e-50   Genlisea aurea
ref|XP_005848047.1|  heat shock protein 70B                             186   2e-50   Chlorella variabilis
gb|AAL66864.1|  heat shock protein 70B                                  185   1e-49   Dunaliella salina
gb|ADI46914.1|  HSP70bm                                                 184   3e-49   Volvox carteri f. nagariensis
gb|ADB23406.1|  chloroplast Hsp70-2                                     181   3e-48   Physcomitrella patens
ref|XP_001769503.1|  predicted protein                                  181   3e-48   
emb|CAB71138.2|  heat shock protein                                     181   3e-48   Dunaliella salina
emb|CEG00973.1|  Heat shock protein 70 family                           172   5e-48   Ostreococcus tauri
emb|CDY34276.1|  BnaA01g13790D                                          172   6e-48   Brassica napus [oilseed rape]
ref|XP_006431616.1|  hypothetical protein CICLE_v10003537mg             167   2e-47   
ref|XP_002504599.1|  stromal heat shock protein 70 kDa, chloropla...    179   2e-47   Micromonas commoda
ref|XP_003059786.1|  heat shock protein 70, chloroplast precursor       176   2e-46   Micromonas pusilla CCMP1545
ref|XP_002958295.1|  heat shock protein 70B                             175   3e-46   Volvox carteri f. nagariensis
gb|AFC75638.1|  heat shock protein 70                                   174   9e-46   Ulva linza
ref|XP_001416211.1|  Heat Shock Protein 70, chloroplast                 174   1e-45   Ostreococcus lucimarinus CCE9901
ref|NP_050768.1|  heat shock protein 70                                 171   6e-45   Guillardia theta
ref|XP_011397217.1|  Stromal 70 kDa heat shock-related protein, c...    170   1e-44   Auxenochlorella protothecoides
gb|KIZ03901.1|  Stromal heat shock-related protein, chloroplastic...    167   2e-43   Monoraphidium neglectum
ref|YP_001293579.1|  heat shock protein 70                              166   5e-43   Rhodomonas salina
ref|WP_009456920.1|  MULTISPECIES: chaperone protein DnaK               165   1e-42   Fischerella thermalis
ref|WP_017315433.1|  chaperone protein DnaK                             164   2e-42   Mastigocladopsis repens
ref|WP_009629403.1|  chaperone protein DnaK                             163   4e-42   Pseudanabaena biceps
ref|WP_039714306.1|  chaperone protein DnaK                             163   4e-42   
ref|WP_016868683.1|  chaperone protein DnaK                             162   6e-42   Fischerella muscicola
ref|WP_019500233.1|  chaperone protein DnaK                             162   1e-41   Pseudanabaena sp. PCC 6802
ref|WP_019508739.1|  chaperone protein DnaK                             161   2e-41   Pleurocapsa sp. PCC 7319
ref|WP_036481538.1|  chaperone protein DnaK                             161   2e-41   Myxosarcina sp. GI1
ref|WP_025945435.1|  hypothetical protein                               156   2e-41   
ref|WP_015202638.1|  chaperone protein DnaK                             160   3e-41   Crinalium epipsammum
ref|WP_009555257.1|  chaperone protein DnaK                             160   3e-41   Oscillatoriales cyanobacterium JSC-12
ref|WP_015154138.1|  chaperone protein DnaK                             160   4e-41   Chroococcidiopsis
ref|WP_019478314.1|  chaperone protein DnaK                             160   4e-41   
ref|WP_017308317.1|  chaperone protein DnaK                             160   5e-41   Fischerella sp. PCC 9339
ref|WP_006511409.1|  chaperone protein DnaK                             160   5e-41   Xenococcus sp. PCC 7305
ref|WP_017743340.1|  chaperone protein DnaK                             160   5e-41   Scytonema hofmannii
ref|WP_015193629.1|  chaperone protein DnaK                             160   6e-41   Stanieria cyanosphaera
ref|WP_007355040.1|  MULTISPECIES: chaperone protein DnaK               159   8e-41   Kamptonema
ref|WP_017321213.1|  chaperone protein DnaK                             159   8e-41   cyanobacterium PCC 7702
gb|ABE11434.1|  molecular chaperone DnaK2, heat shock protein hsp...    156   9e-41   uncultured Prochlorococcus marinus clone HOT0M-3E5
ref|WP_017289630.1|  chaperone protein DnaK                             159   9e-41   Leptolyngbya boryana
ref|WP_015121772.1|  chaperone protein DnaK                             159   9e-41   Rivularia sp. PCC 7116
ref|WP_022606184.1|  chaperone protein DnaK                             159   1e-40   Rubidibacter lacunae
gb|KIE09746.1|  molecular chaperone DnaK                                159   1e-40   Tolypothrix bouteillei VB521301
ref|WP_019477473.1|  chaperone protein DnaK                             159   1e-40   
ref|WP_017721694.1|  chaperone protein DnaK                             159   2e-40   Oscillatoria sp. PCC 10802
ref|WP_016863303.1|  chaperone protein DnaK                             158   2e-40   Fischerella muscicola
ref|WP_015142182.1|  chaperone protein DnaK                             158   2e-40   Pleurocapsa minor
ref|WP_026721546.1|  chaperone protein DnaK                             158   2e-40   Fischerella sp. PCC 9431
gb|KIJ82554.1|  molecular chaperone DnaK                                158   2e-40   Scytonema tolypothrichoides VB-61278
ref|WP_023069128.1|  chaperone protein DnaK                             158   3e-40   Lyngbya aestuarii
dbj|BAQ61644.1|  chaperone protein DnaK                                 158   3e-40   Geminocystis sp. NIES-3708
gb|KGF98314.1|  Chaperone protein DnaK                                  158   3e-40   Prochlorococcus marinus str. MIT 9302
ref|WP_011126020.1|  MULTISPECIES: chaperone protein dnaK2              158   3e-40   Prochlorococcus
ref|WP_032526476.1|  chaperone protein DnaK                             157   3e-40   Prochlorococcus marinus
ref|WP_032522763.1|  chaperone protein DnaK                             157   3e-40   Prochlorococcus marinus
ref|WP_016872101.1|  chaperone protein DnaK                             157   3e-40   Fischerella thermalis
ref|WP_025927187.1|  chaperone protein DnaK                             157   3e-40   
ref|WP_006530474.1|  chaperone protein DnaK                             157   4e-40   Gloeocapsa sp. PCC 73106
ref|WP_027842766.1|  chaperone protein DnaK                             157   4e-40   Mastigocoleus testarum
ref|WP_032513245.1|  chaperone protein DnaK                             157   4e-40   Prochlorococcus marinus
ref|WP_025915295.1|  chaperone protein DnaK                             157   4e-40   
ref|WP_011611011.1|  chaperone protein DnaK                             157   4e-40   Trichodesmium erythraeum
gb|KGF92589.1|  Chaperone protein DnaK                                  157   4e-40   Prochlorococcus marinus str. MIT 9116
ref|WP_025966005.1|  chaperone protein DnaK                             157   4e-40   
ref|WP_018397531.1|  chaperone protein DnaK                             157   4e-40   filamentous cyanobacterium ESFC-1
ref|WP_044452584.1|  molecular chaperone DnaK                           157   4e-40   Mastigocladus laminosus
ref|WP_025935547.1|  chaperone protein DnaK                             157   5e-40   
ref|WP_042851397.1|  chaperone protein DnaK                             157   5e-40   Prochlorococcus sp. MIT 0604
ref|WP_025961633.1|  chaperone protein DnaK                             157   5e-40   
ref|YP_009051076.1|  heat shock protein 70                              157   5e-40   Galdieria sulphuraria
ref|WP_011819314.1|  chaperone protein DnaK                             157   5e-40   Prochlorococcus marinus
ref|WP_009768114.1|  chaperone protein DnaK                             157   5e-40   Oscillatoriales cyanobacterium JSC-12
ref|WP_011133331.1|  chaperone protein dnaK2                            157   6e-40   Prochlorococcus marinus
ref|WP_015151863.1|  chaperone protein DnaK                             157   6e-40   Oscillatoria acuminata
ref|WP_015224983.1|  chaperone protein DnaK                             157   6e-40   Halothece sp. PCC 7418
ref|WP_025931078.1|  chaperone protein DnaK                             157   6e-40   
gb|ABB50858.1|  Heat shock protein Hsp70                                157   6e-40   Prochlorococcus marinus str. MIT 9312
ref|WP_043693889.1|  chaperone protein DnaK                             157   6e-40   Synechococcus sp. KORDI-49
ref|WP_017311165.1|  chaperone protein DnaK                             157   7e-40   Fischerella sp. PCC 9339
gb|AGG40709.1|  DnaK2                                                   157   7e-40   Synechocystis sp. PCC 6906
ref|WP_006633368.1|  chaperone protein DnaK                             157   7e-40   Microcoleus vaginatus
ref|WP_036924388.1|  chaperone protein DnaK                             156   8e-40   Prochlorococcus marinus
ref|WP_012008577.1|  chaperone protein DnaK                             156   8e-40   Prochlorococcus marinus
ref|WP_024545113.1|  chaperone protein DnaK                             157   8e-40   Synechococcus
gb|EEE41096.1|  chaperone protein DnaK                                  157   8e-40   Prochlorococcus marinus str. MIT 9202
ref|WP_025953021.1|  chaperone protein DnaK                             156   8e-40   
ref|WP_013323950.1|  chaperone protein DnaK                             156   8e-40   Cyanothece sp. PCC 7822
ref|WP_015185130.1|  chaperone protein DnaK                             156   8e-40   Microcoleus sp. PCC 7113
ref|WP_002759737.1|  chaperone protein DnaK                             156   8e-40   Microcystis aeruginosa
ref|WP_026735565.1|  chaperone protein DnaK                             156   9e-40   Fischerella sp. PCC 9605
ref|WP_025960118.1|  molecular chaperone DnaK                           154   9e-40   
ref|WP_041032676.1|  chaperone protein DnaK                             156   9e-40   Tolypothrix campylonemoides
ref|WP_026099660.1|  chaperone protein DnaK                             156   1e-39   Prochlorothrix hollandica
ref|WP_032516201.1|  chaperone protein DnaK                             156   1e-39   Prochlorococcus marinus
ref|WP_009768616.1|  chaperone protein DnaK                             156   1e-39   Oscillatoriales cyanobacterium JSC-12
emb|CCQ61964.1|  Chaperone protein DnaK                                 156   1e-39   Crocosphaera watsonii WH 0401
ref|WP_015954960.1|  chaperone protein DnaK                             156   1e-39   Cyanothece sp. PCC 7424
ref|WP_016870275.1|  chaperone protein DnaK                             156   1e-39   Fischerella muscicola
ref|WP_019474989.1|  chaperone protein DnaK                             156   1e-39   
ref|WP_025973059.1|  chaperone protein DnaK                             156   1e-39   
ref|WP_025959236.1|  MULTISPECIES: chaperone protein DnaK               156   1e-39   
ref|WP_007303526.1|  chaperone protein DnaK                             156   1e-39   Crocosphaera watsonii
ref|WP_025889752.1|  MULTISPECIES: chaperone protein DnaK               156   1e-39   
ref|WP_025929009.1|  chaperone protein DnaK                             156   1e-39   Prochlorococcus
ref|WP_025968392.1|  chaperone protein DnaK                             156   1e-39   
ref|WP_025964469.1|  chaperone protein DnaK                             156   1e-39   
ref|WP_035155787.1|  chaperone protein DnaK                             156   1e-39   
ref|WP_025941079.1|  chaperone protein DnaK                             156   1e-39   
ref|WP_015187089.1|  chaperone protein DnaK                             156   1e-39   
ref|WP_017718163.1|  chaperone protein DnaK                             156   1e-39   
ref|WP_025938838.1|  chaperone protein DnaK                             156   1e-39   
ref|WP_025975618.1|  chaperone protein DnaK                             156   1e-39   
ref|WP_025923741.1|  chaperone protein DnaK                             156   1e-39   
ref|WP_025895251.1|  MULTISPECIES: chaperone protein DnaK               156   1e-39   
ref|WP_025921726.1|  MULTISPECIES: chaperone protein DnaK               155   1e-39   
ref|WP_015139988.1|  chaperone protein DnaK                             155   1e-39   
ref|WP_025976066.1|  chaperone protein DnaK                             155   1e-39   
ref|WP_025906753.1|  MULTISPECIES: chaperone protein DnaK               155   1e-39   
ref|WP_025932735.1|  MULTISPECIES: chaperone protein DnaK               155   2e-39   
ref|WP_016873763.1|  chaperone protein DnaK                             155   2e-39   
gb|ABE11486.1|  molecular chaperone DnaK2, heat shock protein hsp...    155   2e-39   
ref|WP_025927212.1|  MULTISPECIES: chaperone protein DnaK               155   2e-39   
ref|WP_026788429.1|  MULTISPECIES: chaperone protein DnaK               155   2e-39   
ref|WP_002801770.1|  chaperone protein DnaK                             155   2e-39   
ref|WP_045053167.1|  molecular chaperone DnaK                           155   2e-39   
ref|WP_042155265.1|  chaperone protein DnaK                             155   2e-39   
ref|WP_029636198.1|  chaperone protein DnaK [                           155   2e-39   
ref|WP_012308014.1|  MULTISPECIES: chaperone protein DnaK               155   2e-39   
ref|WP_009784036.1|  chaperone protein DnaK                             155   2e-39   
ref|WP_025932824.1|  chaperone protein DnaK                             155   2e-39   
ref|WP_032518028.1|  chaperone protein DnaK                             155   2e-39   
ref|WP_032525209.1|  chaperone protein DnaK                             155   2e-39   
ref|WP_036834349.1|  chaperone protein DnaK                             155   2e-39   
ref|WP_036899236.1|  chaperone protein DnaK                             155   2e-39   
ref|WP_027254455.1|  chaperone protein DnaK                             155   2e-39   
ref|WP_037042443.1|  chaperone protein DnaK                             155   2e-39   
ref|WP_002787253.1|  chaperone protein DnaK                             155   2e-39   
ref|WP_026794968.1|  MULTISPECIES: chaperone protein DnaK               155   2e-39   
ref|WP_002770278.1|  chaperone protein DnaK                             155   2e-39   
gb|ELP56215.1|  chaperone protein DnaK                                  155   2e-39   
ref|WP_026731179.1|  chaperone protein DnaK                             155   2e-39   
ref|WP_002795470.1|  chaperone protein DnaK                             155   2e-39   
ref|WP_037342948.1|  molecular chaperone DnaK                           147   2e-39   
ref|WP_002746489.1|  chaperone protein DnaK                             155   3e-39   
ref|WP_002750478.1|  chaperone protein DnaK                             155   3e-39   
ref|WP_025891247.1|  chaperone protein DnaK                             155   3e-39   
ref|WP_013192044.1|  chaperone protein DnaK                             155   3e-39   
ref|WP_008276022.1|  chaperone protein DnaK                             155   3e-39   
ref|WP_011863799.1|  chaperone protein DnaK                             155   3e-39   
ref|WP_025936358.1|  chaperone protein DnaK                             155   3e-39   
ref|WP_008202581.1|  chaperone protein DnaK                             155   4e-39   
ref|WP_012264781.1|  chaperone protein DnaK                             155   4e-39   
ref|WP_009756730.1|  chaperone protein DnaK                             154   4e-39   
ref|WP_008231477.1|  chaperone protein DnaK                             154   4e-39   
ref|WP_009632510.1|  chaperone protein DnaK                             154   4e-39   
gb|KIE06534.1|  molecular chaperone DnaK                                154   4e-39   
ref|WP_016863628.1|  chaperone protein DnaK                             154   4e-39   
ref|WP_012409493.1|  chaperone protein DnaK                             154   4e-39   
ref|WP_011620810.1|  chaperone protein DnaK                             154   4e-39   
ref|WP_017655708.1|  chaperone protein DnaK                             154   4e-39   
ref|WP_025963427.1|  chaperone protein DnaK                             154   5e-39   
ref|WP_019490128.1|  chaperone protein DnaK                             154   6e-39   
ref|WP_015126522.1|  chaperone protein DnaK                             154   6e-39   
ref|WP_006854936.1|  chaperone protein DnaK                             154   6e-39   
ref|WP_039752834.1|  chaperone protein DnaK                             154   7e-39   
ref|WP_045362117.1|  molecular chaperone DnaK                           154   7e-39   
ref|WP_015328509.1|  chaperone protein DnaK                             154   7e-39   
ref|WP_025956335.1|  MULTISPECIES: chaperone protein DnaK               154   7e-39   
ref|WP_011821186.1|  chaperone protein DnaK                             154   8e-39   
ref|WP_040054446.1|  chaperone protein DnaK                             154   8e-39   
ref|WP_006100892.1|  chaperone protein DnaK                             154   9e-39   
ref|WP_002782380.1|  chaperone protein DnaK                             153   1e-38   
ref|WP_009545807.1|  MULTISPECIES: chaperone protein DnaK               153   1e-38   
dbj|BAQ65389.1|  chaperone protein DnaK                                 153   1e-38   
ref|WP_015229676.1|  chaperone protein DnaK                             153   1e-38   
ref|WP_011316761.1|  chaperone protein DnaK                             153   1e-38   
ref|WP_016877414.1|  chaperone protein DnaK                             153   1e-38   
ref|WP_038654853.1|  chaperone protein DnaK                             153   1e-38   
ref|WP_007099410.1|  chaperone protein DnaK                             153   2e-38   
ref|WP_006456604.1|  chaperone protein DnaK                             153   2e-38   
ref|WP_016952766.1|  chaperone protein DnaK                             153   2e-38   
ref|WP_037331909.1|  hypothetical protein                               145   2e-38   
ref|WP_017294341.1|  chaperone protein DnaK                             152   2e-38   
ref|WP_015167822.1|  chaperone protein DnaK                             152   3e-38   
ref|WP_028947593.1|  chaperone protein DnaK                             152   3e-38   
ref|WP_027402735.1|  chaperone protein DnaK                             152   3e-38   
ref|WP_036919662.1|  MULTISPECIES: chaperone protein DnaK               152   3e-38   
ref|WP_012954617.1|  chaperone protein DnaK                             152   3e-38   
gb|AAN71796.1|  DnaK                                                    151   3e-38   
ref|WP_018398631.1|  chaperone protein DnaK                             152   3e-38   
ref|YP_008965704.1|  dnaK chaperone protein                             152   3e-38   
ref|WP_017303389.1|  chaperone protein DnaK                             152   4e-38   
ref|WP_045867705.1|  molecular chaperone DnaK                           151   4e-38   
ref|WP_015223663.1|  chaperone protein DnaK                             151   5e-38   
ref|WP_015083411.1|  chaperone protein DnaK                             151   6e-38   
ref|WP_015216994.1|  chaperone protein DnaK                             151   6e-38   
ref|WP_007101157.1|  chaperone protein DnaK                             151   6e-38   
ref|WP_011824676.1|  chaperone protein DnaK                             151   6e-38   
ref|WP_018330538.1|  chaperone protein DnaK                             151   7e-38   
ref|WP_011619221.1|  chaperone protein DnaK                             151   7e-38   
ref|WP_035987639.1|  chaperone protein DnaK                             151   7e-38   
ref|WP_012629493.1|  chaperone protein DnaK                             151   8e-38   
dbj|BAA05904.1|  heat shock protein DnaK homolog                        150   8e-38   
ref|WP_011378479.1|  MULTISPECIES: chaperone protein dnaK2              150   9e-38   
ref|WP_026100661.1|  chaperone protein DnaK                             150   9e-38   
ref|WP_015123073.1|  chaperone protein DnaK                             150   1e-37   
ref|WP_030552186.1|  molecular chaperone DnaK                           150   1e-37   
ref|WP_037219219.1|  chaperone protein DnaK                             150   1e-37   
ref|WP_031127266.1|  molecular chaperone DnaK                           150   1e-37   
ref|WP_006852498.1|  chaperone protein DnaK                             150   1e-37   
ref|WP_020550044.1|  hypothetical protein                               143   1e-37   
ref|WP_015173018.1|  chaperone protein DnaK                             150   1e-37   
ref|WP_031511584.1|  molecular chaperone DnaK                           145   2e-37   
ref|WP_011295656.1|  chaperone protein DnaK                             150   2e-37   
ref|WP_015133043.1|  chaperone protein DnaK                             150   2e-37   
ref|WP_015111643.1|  chaperone protein DnaK                             150   2e-37   
ref|WP_039203385.1|  chaperone protein DnaK                             150   2e-37   
ref|WP_010873288.1|  chaperone protein dnaK2                            150   2e-37   
gb|AJW30618.1|  Chaperone protein DnaK                                  149   2e-37   
ref|WP_015219305.1|  chaperone protein DnaK                             149   2e-37   
ref|WP_011361037.1|  chaperone protein DnaK                             149   2e-37   
ref|WP_028090456.1|  chaperone protein DnaK                             149   2e-37   
ref|WP_035830754.1|  chaperone protein DnaK                             149   2e-37   
ref|WP_023072518.1|  chaperone protein DnaK                             149   2e-37   
ref|WP_040944349.1|  chaperone protein DnaK                             149   2e-37   
ref|WP_040935896.1|  chaperone protein DnaK                             149   3e-37   
gb|KDD74350.1|  heat shock protein 70 Hsp70                             149   3e-37   
ref|WP_026217780.1|  hypothetical protein                               141   3e-37   
ref|WP_044106105.1|  molecular chaperone DnaK                           149   3e-37   
ref|WP_028083876.1|  chaperone protein DnaK                             149   3e-37   
ref|WP_015206579.1|  chaperone protein DnaK                             149   3e-37   
gb|AJW31054.1|  Chaperone protein DnaK                                  149   3e-37   
ref|WP_015174829.1|  chaperone protein DnaK                             149   4e-37   
ref|WP_006042706.1|  chaperone protein DnaK                             149   4e-37   
ref|WP_010302557.1|  chaperone protein DnaK                             149   4e-37   
ref|WP_010468928.1|  chaperone protein DnaK                             149   4e-37   
ref|WP_006278041.1|  chaperone protein DnaK                             149   4e-37   
ref|WP_006172701.1|  chaperone protein DnaK                             149   5e-37   
ref|WP_012162913.1|  chaperone protein DnaK                             149   5e-37   
gb|KIY91947.1|  hypothetical protein MNEG_16016                         142   6e-37   
ref|WP_006851906.1|  chaperone protein DnaK                             148   6e-37   
ref|WP_011365594.1|  chaperone protein DnaK                             148   6e-37   
ref|WP_011934399.1|  chaperone protein DnaK                             148   6e-37   
ref|WP_011429052.1|  chaperone protein DnaK                             148   6e-37   
ref|WP_013678525.1|  chaperone protein DnaK                             148   7e-37   
ref|WP_026419748.1|  chaperone protein DnaK                             148   7e-37   
ref|WP_009788574.1|  chaperone protein DnaK                             148   7e-37   
ref|WP_028953215.1|  chaperone protein DnaK                             148   7e-37   
ref|WP_011129361.1|  chaperone protein dnaK2                            148   7e-37   
ref|WP_016699905.1|  chaperone protein DnaK                             148   7e-37   
ref|WP_036906014.1|  chaperone protein DnaK                             148   9e-37   
ref|WP_020941253.1|  chaperone protein DnaK                             147   9e-37   
ref|WP_011144248.1|  chaperone protein DnaK                             148   9e-37   
ref|WP_012407355.1|  chaperone protein DnaK                             148   9e-37   
ref|WP_015199372.1|  chaperone protein DnaK                             147   1e-36   
ref|WP_038552053.1|  chaperone protein DnaK                             147   1e-36   
ref|WP_034249160.1|  chaperone protein DnaK                             147   1e-36   
gb|ABM47313.1|  heat shock protein 70B                                  139   1e-36   
ref|WP_043604470.1|  chaperone protein DnaK                             147   2e-36   
ref|WP_011827572.1|  chaperone protein DnaK                             147   2e-36   
ref|WP_011434322.1|  chaperone protein DnaK                             147   2e-36   
ref|WP_008313778.1|  chaperone protein DnaK                             147   2e-36   
ref|WP_018845937.1|  chaperone protein DnaK                             147   2e-36   
ref|WP_012196391.1|  chaperone protein DnaK                             147   2e-36   
ref|XP_006371453.1|  hypothetical protein POPTR_0019s10660g             142   2e-36   
ref|WP_006512975.1|  chaperone protein DnaK                             147   2e-36   
gb|AKA09182.1|  hypothetical protein SAZ_39805                          140   3e-36   
ref|WP_011243946.1|  Chaperone protein DnaK 2                           146   3e-36   
ref|WP_006197366.1|  chaperone protein DnaK                             146   3e-36   
ref|WP_010032116.1|  molecular chaperone DnaK                           140   3e-36   
ref|WP_015142131.1|  chaperone protein DnaK                             146   3e-36   
ref|WP_010995910.1|  chaperone protein dnaK2                            146   3e-36   
ref|WP_030690794.1|  chaperone protein DnaK                             146   3e-36   
ref|WP_011317183.1|  chaperone protein dnaK2                            146   3e-36   
ref|WP_038542379.1|  chaperone protein DnaK                             146   3e-36   
ref|WP_006909232.1|  chaperone protein DnaK                             146   4e-36   
ref|WP_037574112.1|  chaperone protein DnaK                             146   4e-36   
gb|AHJ30445.1|  Chaperone protein DnaK                                  146   4e-36   
ref|WP_006194492.1|  chaperone protein DnaK                             146   4e-36   
ref|WP_006518058.1|  chaperone protein DnaK                             146   4e-36   
gb|KGG26472.1|  Chaperone protein DnaK                                  145   4e-36   
ref|YP_008145429.1|  heat shock protein 70                              145   5e-36   
ref|WP_015136950.1|  chaperone protein DnaK                             145   5e-36   
ref|WP_030407774.1|  MULTISPECIES: hypothetical protein                 139   5e-36   
ref|WP_022167186.1|  chaperone protein DnaK                             145   5e-36   
ref|WP_015160693.1|  chaperone protein DnaK                             145   5e-36   
ref|WP_015034634.1|  chaperone protein DnaK                             145   6e-36   
ref|WP_022212579.1|  chaperone protein DnaK                             145   6e-36   
ref|YP_003359249.1|  heat shock protein 70                              145   6e-36   
ref|WP_011131619.1|  chaperone protein dnaK2                            145   6e-36   
ref|WP_012597235.1|  MULTISPECIES: chaperone protein DnaK               145   6e-36   
ref|WP_036914902.1|  MULTISPECIES: chaperone protein DnaK               145   7e-36   
ref|WP_017660310.1|  chaperone protein DnaK                             145   7e-36   
ref|WP_009343435.1|  chaperone protein DnaK                             145   8e-36   
ref|WP_015164006.1|  chaperone protein DnaK                             145   8e-36   
ref|WP_008186736.1|  chaperone protein DnaK                             145   9e-36   
ref|WP_016865634.1|  chaperone protein DnaK                             145   9e-36   
ref|WP_045788637.1|  molecular chaperone DnaK                           140   9e-36   
ref|WP_023539842.1|  chaperone protein DnaK                             145   1e-35   
ref|WP_030259125.1|  MULTISPECIES: chaperone protein DnaK               144   1e-35   
ref|WP_033524480.1|  chaperone protein DnaK                             144   1e-35   
ref|WP_039629526.1|  chaperone protein DnaK                             144   1e-35   
ref|WP_010313834.1|  chaperone protein DnaK                             144   1e-35   
ref|WP_012412143.1|  chaperone protein DnaK                             144   1e-35   
ref|WP_035999464.1|  chaperone protein DnaK                             144   1e-35   
ref|WP_015109959.1|  chaperone protein DnaK                             144   1e-35   
ref|WP_030944355.1|  chaperone protein DnaK                             144   1e-35   
gb|AJC53558.1|  molecular chaperone                                     145   2e-35   
ref|WP_009455220.1|  MULTISPECIES: chaperone protein DnaK               144   2e-35   
ref|WP_030966357.1|  molecular chaperone DnaK                           137   2e-35   
ref|WP_004945726.1|  chaperone protein DnaK                             144   2e-35   
ref|WP_037658375.1|  molecular chaperone DnaK                           144   2e-35   
ref|WP_028937793.1|  chaperone protein DnaK                             144   2e-35   
ref|WP_035847345.1|  chaperone protein DnaK                             144   2e-35   
ref|WP_018558351.1|  chaperone protein DnaK                             144   2e-35   
ref|WP_027099573.1|  chaperone protein DnaK                             144   2e-35   
ref|WP_043434261.1|  chaperone protein DnaK                             144   2e-35   
ref|WP_006134637.1|  MULTISPECIES: chaperone protein DnaK               144   2e-35   
ref|WP_039650570.1|  MULTISPECIES: chaperone protein DnaK               144   2e-35   
ref|WP_017298211.1|  chaperone protein DnaK                             144   2e-35   
ref|WP_017240219.1|  chaperone protein DnaK                             144   3e-35   
ref|WP_018092396.1|  chaperone protein DnaK                             144   3e-35   
ref|YP_005088654.1|  heat shock protein 70                              144   3e-35   
ref|WP_036900965.1|  chaperone protein DnaK                             144   3e-35   
ref|WP_042151424.1|  chaperone protein DnaK                             144   3e-35   
ref|WP_006604629.1|  chaperone protein DnaK                             144   3e-35   
ref|WP_033202346.1|  chaperone protein DnaK                             143   3e-35   



>gb|ABZ04081.1| chloroplast heat shock protein 70-2 [Ipomoea nil]
Length=700

 Score =   291 bits (746),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 177/177 (100%), Positives = 177/177 (100%), Gaps = 0/177 (0%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK
Sbjct  524  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  583

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA
Sbjct  584  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  643

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDGDVIDADFTDSK  339
            MAALNQEVMQLGQSLYNQPSASPGAGPTPGGGSAGPSESSGKGPDGDVIDADFTDSK
Sbjct  644  MAALNQEVMQLGQSLYNQPSASPGAGPTPGGGSAGPSESSGKGPDGDVIDADFTDSK  700



>gb|ABK96230.1| unknown [Populus trichocarpa x Populus deltoides]
Length=236

 Score =   269 bits (688),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 151/177 (85%), Positives = 160/177 (90%), Gaps = 1/177 (1%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSVTA+DKGTGKKQDITITGASTLPSDEVERMVSEA++FA+EDK
Sbjct  61   GVPQIEVKFDIDANGILSVTAIDKGTGKKQDITITGASTLPSDEVERMVSEADKFAKEDK  120

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRDAIDTKNQADSVVYQTEKQLKELGEKVP PVKEKVEAKL EL+DAI+GGSTQ MKDA
Sbjct  121  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPAPVKEKVEAKLQELKDAIAGGSTQVMKDA  180

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDGDVIDADFTDSK  339
            M ALNQEVMQLGQSLYNQ   +        GG AGP++SS KGPDGDVIDADFTDSK
Sbjct  181  MTALNQEVMQLGQSLYNQ-PGAAPGAGPAPGGEAGPTDSSSKGPDGDVIDADFTDSK  236



>ref|XP_006593240.1| PREDICTED: stromal 70 kDa heat shock-related protein, chloroplastic-like 
[Glycine max]
Length=443

 Score =   275 bits (702),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 160/178 (90%), Positives = 171/178 (96%), Gaps = 1/178 (1%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSVTA+DKGTGKKQDITITGASTLPSDEVERMV+EAE+F++EDK
Sbjct  266  GVPQIEVKFDIDANGILSVTAIDKGTGKKQDITITGASTLPSDEVERMVNEAEKFSKEDK  325

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRDAIDTKNQADSVVYQTEKQLKELG+KVPGPVKEKVEAKLGEL+DAISGGSTQA+KDA
Sbjct  326  EKRDAIDTKNQADSVVYQTEKQLKELGDKVPGPVKEKVEAKLGELKDAISGGSTQAIKDA  385

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggs-agpsessgkgPDGDVIDADFTDSK  339
            MAALNQEVMQLGQSLYNQP A+   GPTP  G+ +GPSESSGKGPDGDVIDADFTDSK
Sbjct  386  MAALNQEVMQLGQSLYNQPGAAGAGGPTPPPGADSGPSESSGKGPDGDVIDADFTDSK  443



>gb|KHN39675.1| Stromal 70 kDa heat shock-related protein, chloroplastic [Glycine 
soja]
Length=611

 Score =   276 bits (705),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 159/177 (90%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSV A+DKGTGKKQDITITGASTLPSDEVERMV+EAE+F++EDK
Sbjct  435  GVPQIEVKFDIDANGILSVAAIDKGTGKKQDITITGASTLPSDEVERMVNEAEKFSKEDK  494

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRDAIDTKNQADSVVYQTEKQLKELG+KVPGPVKEKVEAKLGEL+DAISGGSTQA+KDA
Sbjct  495  EKRDAIDTKNQADSVVYQTEKQLKELGDKVPGPVKEKVEAKLGELKDAISGGSTQAIKDA  554

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDGDVIDADFTDSK  339
            MAALNQEVMQLGQSLYNQP A+   GPTP G  +GPSESSGKGPDGDVIDADFTDSK
Sbjct  555  MAALNQEVMQLGQSLYNQPGAAGAGGPTPPGADSGPSESSGKGPDGDVIDADFTDSK  611



>ref|XP_009609390.1| PREDICTED: stromal 70 kDa heat shock-related protein, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=707

 Score =   276 bits (707),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 155/179 (87%), Positives = 160/179 (89%), Gaps = 2/179 (1%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSVTA+DKGTGKKQDITITGASTLP DEVERMV EAERFAQEDK
Sbjct  529  GVPQIEVKFDIDANGILSVTAIDKGTGKKQDITITGASTLPGDEVERMVKEAERFAQEDK  588

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRDAIDTKNQADSVVYQTEKQLKELG+KVPGPVKEKVEAKLGEL++AISGGSTQAMKDA
Sbjct  589  EKRDAIDTKNQADSVVYQTEKQLKELGDKVPGPVKEKVEAKLGELKEAISGGSTQAMKDA  648

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgg--gsagpsessgkgPDGDVIDADFTDSK  339
            MAALNQEVMQLGQSLYNQP A    G  P     +     SSGKGPDGDVIDADFTDSK
Sbjct  649  MAALNQEVMQLGQSLYNQPGAGAAPGAGPAPGDSAGPSESSSGKGPDGDVIDADFTDSK  707



>ref|XP_003548186.1| PREDICTED: stromal 70 kDa heat shock-related protein, chloroplastic-like 
[Glycine max]
Length=689

 Score =   276 bits (706),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 159/177 (90%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSV A+DKGTGKKQDITITGASTLPSDEVERMV+EAE+F++EDK
Sbjct  513  GVPQIEVKFDIDANGILSVAAIDKGTGKKQDITITGASTLPSDEVERMVNEAEKFSKEDK  572

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRDAIDTKNQADSVVYQTEKQLKELG+KVPGPVKEKVEAKLGEL+DAISGGSTQA+KDA
Sbjct  573  EKRDAIDTKNQADSVVYQTEKQLKELGDKVPGPVKEKVEAKLGELKDAISGGSTQAIKDA  632

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDGDVIDADFTDSK  339
            MAALNQEVMQLGQSLYNQP A+   GPTP G  +GPSESSGKGPDGDVIDADFTDSK
Sbjct  633  MAALNQEVMQLGQSLYNQPGAAGAGGPTPPGADSGPSESSGKGPDGDVIDADFTDSK  689



>ref|XP_004230445.1| PREDICTED: stromal 70 kDa heat shock-related protein, chloroplastic 
[Solanum lycopersicum]
Length=703

 Score =   275 bits (704),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 160/178 (90%), Positives = 165/178 (93%), Gaps = 1/178 (1%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSVTA+DKGTGKKQDITITGASTLP DEVERMV EAERFAQEDK
Sbjct  526  GVPQIEVKFDIDANGILSVTAIDKGTGKKQDITITGASTLPGDEVERMVKEAERFAQEDK  585

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRDAIDTKNQADSVVYQTEKQLKELG+KVPGPVKEKVEAKLGEL++AISGGSTQ MKDA
Sbjct  586  EKRDAIDTKNQADSVVYQTEKQLKELGDKVPGPVKEKVEAKLGELKEAISGGSTQTMKDA  645

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDG-DVIDADFTDSK  339
            MAALNQEVMQLGQSLYNQP A+PGAGP PGG       SSGKGPDG DVIDADFTDSK
Sbjct  646  MAALNQEVMQLGQSLYNQPGAAPGAGPAPGGADGPSESSSGKGPDGNDVIDADFTDSK  703



>ref|XP_009775058.1| PREDICTED: stromal 70 kDa heat shock-related protein, chloroplastic 
[Nicotiana sylvestris]
 ref|XP_009775069.1| PREDICTED: stromal 70 kDa heat shock-related protein, chloroplastic 
[Nicotiana sylvestris]
Length=706

 Score =   275 bits (703),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 154/179 (86%), Positives = 159/179 (89%), Gaps = 2/179 (1%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSVTA+DKGTGKKQDITITGASTLP DEVERMV EAERFAQEDK
Sbjct  528  GVPQIEVKFDIDANGILSVTAIDKGTGKKQDITITGASTLPGDEVERMVKEAERFAQEDK  587

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRDAIDTKNQADSVVYQTEKQLKELG+KVPGPVKEKVEAKLGEL++AISGGSTQ MKDA
Sbjct  588  EKRDAIDTKNQADSVVYQTEKQLKELGDKVPGPVKEKVEAKLGELKEAISGGSTQTMKDA  647

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgg--gsagpsessgkgPDGDVIDADFTDSK  339
            MAALNQEVMQLGQSLYNQP A    G  P     +     SSGKGPDGDVIDADFTDSK
Sbjct  648  MAALNQEVMQLGQSLYNQPGAGAAPGAGPAPGDSAGPSESSSGKGPDGDVIDADFTDSK  706



>ref|XP_011047905.1| PREDICTED: stromal 70 kDa heat shock-related protein, chloroplastic-like 
[Populus euphratica]
Length=707

 Score =   275 bits (703),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 154/177 (87%), Positives = 162/177 (92%), Gaps = 0/177 (0%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSVTA+DKGTGKKQDITITGASTLPSDEVERMVSEAE+FA+EDK
Sbjct  531  GVPQIEVKFDIDANGILSVTAIDKGTGKKQDITITGASTLPSDEVERMVSEAEKFAKEDK  590

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRDAIDTKNQADSVVYQTEKQLKELGEKVP PVKEKVEAKL EL+DAI+GGSTQ MKDA
Sbjct  591  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPAPVKEKVEAKLQELKDAIAGGSTQVMKDA  650

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDGDVIDADFTDSK  339
            M ALNQEVMQLGQSLYNQP A+        GG AGP++SS KGPDGDVIDADFTDSK
Sbjct  651  MTALNQEVMQLGQSLYNQPGAAAPGAGPAPGGEAGPTDSSSKGPDGDVIDADFTDSK  707



>ref|XP_006349319.1| PREDICTED: stromal 70 kDa heat shock-related protein, chloroplastic-like 
[Solanum tuberosum]
Length=706

 Score =   275 bits (703),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 159/178 (89%), Positives = 164/178 (92%), Gaps = 1/178 (1%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSVTA+DKGTGKKQDITITGASTLP DEVERMV EAERFAQEDK
Sbjct  529  GVPQIEVKFDIDANGILSVTAIDKGTGKKQDITITGASTLPGDEVERMVKEAERFAQEDK  588

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRDAIDTKNQADSVVYQTEKQLKELG+KVPGPVKEKVEAKLGEL++AISGGSTQ MKDA
Sbjct  589  EKRDAIDTKNQADSVVYQTEKQLKELGDKVPGPVKEKVEAKLGELKEAISGGSTQTMKDA  648

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDG-DVIDADFTDSK  339
            MAALNQEVMQLGQSLYNQP A+PGAGP PG        SSGKGPDG DVIDADFTDSK
Sbjct  649  MAALNQEVMQLGQSLYNQPGAAPGAGPAPGSSDGPSESSSGKGPDGDDVIDADFTDSK  706



>ref|XP_011087666.1| PREDICTED: stromal 70 kDa heat shock-related protein, chloroplastic-like 
[Sesamum indicum]
Length=704

 Score =   274 bits (700),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 151/177 (85%), Positives = 160/177 (90%), Gaps = 1/177 (1%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSVTA+DKGTGKKQDITITGASTLPSDEVERMVSEAE+FA+EDK
Sbjct  529  GVPQIEVKFDIDANGILSVTAIDKGTGKKQDITITGASTLPSDEVERMVSEAEKFAKEDK  588

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRDAIDTKNQADSVVYQTEKQLKELG+KVPGPVKEKVEAKLGEL+DAISGGSTQA+KDA
Sbjct  589  EKRDAIDTKNQADSVVYQTEKQLKELGDKVPGPVKEKVEAKLGELKDAISGGSTQAIKDA  648

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDGDVIDADFTDSK  339
            M ALNQEVMQLGQSLYNQ   +        G  A  SES+ KGP+GDVIDADFTDSK
Sbjct  649  MTALNQEVMQLGQSLYNQ-PGAAPGDGPTPGAGATSSESADKGPEGDVIDADFTDSK  704



>ref|XP_012066679.1| PREDICTED: stromal 70 kDa heat shock-related protein, chloroplastic 
[Jatropha curcas]
 gb|KDP42448.1| hypothetical protein JCGZ_00245 [Jatropha curcas]
Length=703

 Score =   274 bits (700),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 153/177 (86%), Positives = 159/177 (90%), Gaps = 0/177 (0%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAE+FA+EDK
Sbjct  527  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAEKFAKEDK  586

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRDAIDTKNQADSVVYQTEKQLKELG+KVP PVKEKVEAKL EL+DAI+ GSTQAMKDA
Sbjct  587  EKRDAIDTKNQADSVVYQTEKQLKELGDKVPAPVKEKVEAKLKELKDAIADGSTQAMKDA  646

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDGDVIDADFTDSK  339
            MAALNQEVMQLGQSLYNQP A             GPS+SS KGPDGDVIDADFTDSK
Sbjct  647  MAALNQEVMQLGQSLYNQPGAGGAGPAPGSEAGPGPSDSSSKGPDGDVIDADFTDSK  703



>ref|XP_009598659.1| PREDICTED: stromal 70 kDa heat shock-related protein, chloroplastic 
[Nicotiana tomentosiformis]
Length=707

 Score =   274 bits (700),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 153/179 (85%), Positives = 159/179 (89%), Gaps = 2/179 (1%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSVTA+DKGTGKKQDITITGASTLP DEVERMV EAERFAQEDK
Sbjct  529  GVPQIEVKFDIDANGILSVTAIDKGTGKKQDITITGASTLPGDEVERMVKEAERFAQEDK  588

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRDAIDTKNQADSVVYQTEKQLKELG+KVPGPVKEKVEAKLGEL++AISGGSTQ MKDA
Sbjct  589  EKRDAIDTKNQADSVVYQTEKQLKELGDKVPGPVKEKVEAKLGELKEAISGGSTQTMKDA  648

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgg--gsagpsessgkgPDGDVIDADFTDSK  339
            MA+LNQEVMQLGQSLYNQP A    G  P     +     SSGKGPDGDVIDADFTDSK
Sbjct  649  MASLNQEVMQLGQSLYNQPGAGAAPGAGPAPGDSAGPSESSSGKGPDGDVIDADFTDSK  707



>gb|KHG00021.1| Heat shock 70 kDa 7, chloroplastic -like protein [Gossypium arboreum]
Length=706

 Score =   273 bits (699),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 155/177 (88%), Positives = 164/177 (93%), Gaps = 0/177 (0%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLP+DEV+RMV EAE+F++EDK
Sbjct  530  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPNDEVDRMVKEAEKFSKEDK  589

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            E+RDAIDTKNQADSVVYQTEKQLKELG+KVPGPVKEKVEAKL ELRDAISGGSTQ MKDA
Sbjct  590  ERRDAIDTKNQADSVVYQTEKQLKELGDKVPGPVKEKVEAKLQELRDAISGGSTQGMKDA  649

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDGDVIDADFTDSK  339
            MAALNQEVMQLGQSLYNQP A+ G G    GG  GPS+SS KGPDGDVIDADFTDSK
Sbjct  650  MAALNQEVMQLGQSLYNQPGAAGGPGGPAPGGETGPSDSSNKGPDGDVIDADFTDSK  706



>ref|XP_011016196.1| PREDICTED: stromal 70 kDa heat shock-related protein, chloroplastic 
[Populus euphratica]
Length=705

 Score =   273 bits (699),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 154/177 (87%), Positives = 160/177 (90%), Gaps = 1/177 (1%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAE+FA+EDK
Sbjct  530  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAEKFAKEDK  589

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRDAIDTKNQADSVVYQTEKQLKELGEKVP PVKEKVEAKL EL+DAI+GGSTQ MKDA
Sbjct  590  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPAPVKEKVEAKLQELKDAIAGGSTQGMKDA  649

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDGDVIDADFTDSK  339
            MAALNQEVMQLGQSLYNQ   +        G  AGPS+SS KGPDGDVIDADFTDSK
Sbjct  650  MAALNQEVMQLGQSLYNQ-PGAAPGAGPAPGSEAGPSDSSSKGPDGDVIDADFTDSK  705



>ref|XP_011092298.1| PREDICTED: stromal 70 kDa heat shock-related protein, chloroplastic 
[Sesamum indicum]
Length=704

 Score =   273 bits (698),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 152/177 (86%), Positives = 160/177 (90%), Gaps = 1/177 (1%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSVTA+DKGTGKKQDITITGASTLPSDEVERMVSEAE+FA+EDK
Sbjct  529  GVPQIEVKFDIDANGILSVTAIDKGTGKKQDITITGASTLPSDEVERMVSEAEKFAKEDK  588

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRDAIDTKNQADSVVYQTEKQLKELG+KVP PVKEKVEAKLGEL+DAISGGSTQAMKDA
Sbjct  589  EKRDAIDTKNQADSVVYQTEKQLKELGDKVPAPVKEKVEAKLGELKDAISGGSTQAMKDA  648

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDGDVIDADFTDSK  339
            M ALNQEVMQLGQSLYNQ   +        GG +  SESS KGP+GDVIDADFTDSK
Sbjct  649  MTALNQEVMQLGQSLYNQ-PGAAPGSGPAPGGGSTSSESSDKGPEGDVIDADFTDSK  704



>ref|XP_002279101.1| PREDICTED: stromal 70 kDa heat shock-related protein, chloroplastic 
[Vitis vinifera]
Length=707

 Score =   272 bits (696),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 155/177 (88%), Positives = 160/177 (90%), Gaps = 2/177 (1%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSVTA+DKGTGKKQDITITGASTLP+DEVERMVSEAERFA+EDK
Sbjct  533  GVPQIEVKFDIDANGILSVTAIDKGTGKKQDITITGASTLPTDEVERMVSEAERFAKEDK  592

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRDAIDTKNQADSVVYQTEKQLKELG+KVP  VKEKVEAKLGEL+DAISGGSTQ MKDA
Sbjct  593  EKRDAIDTKNQADSVVYQTEKQLKELGDKVPAQVKEKVEAKLGELKDAISGGSTQVMKDA  652

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDGDVIDADFTDSK  339
            MAALNQEVMQLGQSLYNQ            G  AGPSESSGKGPDGDVIDADFTDSK
Sbjct  653  MAALNQEVMQLGQSLYNQ--PGAPGAGPAPGSEAGPSESSGKGPDGDVIDADFTDSK  707



>gb|KJB71619.1| hypothetical protein B456_011G134000 [Gossypium raimondii]
 gb|KJB71620.1| hypothetical protein B456_011G134000 [Gossypium raimondii]
Length=706

 Score =   272 bits (695),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 154/177 (87%), Positives = 164/177 (93%), Gaps = 0/177 (0%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLP+DEV+RMV EAE+F++EDK
Sbjct  530  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPNDEVDRMVKEAEKFSKEDK  589

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            E+RDAIDTKNQADSVVYQTEKQLKELG+KVPGPVKEKVEAKL ELRDAISGGSTQ MKDA
Sbjct  590  ERRDAIDTKNQADSVVYQTEKQLKELGDKVPGPVKEKVEAKLQELRDAISGGSTQGMKDA  649

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDGDVIDADFTDSK  339
            MAALNQEVMQLGQSLYNQP A+ G G    GG  GPS+SS KGPDGDVI+ADFTDSK
Sbjct  650  MAALNQEVMQLGQSLYNQPGAAGGPGGPAPGGETGPSDSSNKGPDGDVIEADFTDSK  706



>gb|KHG03789.1| Heat shock 70 kDa 6, chloroplastic -like protein [Gossypium arboreum]
Length=696

 Score =   271 bits (693),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 153/177 (86%), Positives = 158/177 (89%), Gaps = 1/177 (1%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEV+RMV EAERFAQEDK
Sbjct  521  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVDRMVKEAERFAQEDK  580

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRDAIDTKNQADSVVYQTEKQLKELG+KVPGPVKEKVEAKL EL+DAISGGSTQ MKDA
Sbjct  581  EKRDAIDTKNQADSVVYQTEKQLKELGDKVPGPVKEKVEAKLQELKDAISGGSTQGMKDA  640

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDGDVIDADFTDSK  339
            MAALNQEVMQLGQSLYNQ  +   A     GG  G S+SS KG D DVIDADFTDSK
Sbjct  641  MAALNQEVMQLGQSLYNQ-PSGGSAAGPTPGGETGHSDSSNKGSDEDVIDADFTDSK  696



>ref|XP_002526446.1| heat shock protein, putative [Ricinus communis]
 gb|EEF35941.1| heat shock protein, putative [Ricinus communis]
Length=703

 Score =   271 bits (692),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 155/177 (88%), Positives = 163/177 (92%), Gaps = 1/177 (1%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSVTA+DKGTGKKQDITITGASTLPSDEVERMVSEAERFA+EDK
Sbjct  528  GVPQIEVKFDIDANGILSVTAIDKGTGKKQDITITGASTLPSDEVERMVSEAERFAKEDK  587

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRDAIDTKNQADSVVYQTEKQLKELG+KVP PVKEKVEAKL EL+DAI GGSTQ MKDA
Sbjct  588  EKRDAIDTKNQADSVVYQTEKQLKELGDKVPAPVKEKVEAKLKELKDAIEGGSTQGMKDA  647

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDGDVIDADFTDSK  339
            MAALNQEVMQLGQSLYNQ   + GAGP PGG +   S+SS KGP+GDVIDADFTDSK
Sbjct  648  MAALNQEVMQLGQSLYNQ-PGAGGAGPAPGGEAGPSSDSSSKGPEGDVIDADFTDSK  703



>ref|XP_003592913.1| Heat shock protein [Medicago truncatula]
 gb|ABE79560.1| Chaperone DnaK [Medicago truncatula]
 gb|AES63164.1| 70 kDa heat shock protein [Medicago truncatula]
Length=707

 Score =   271 bits (692),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 152/178 (85%), Positives = 158/178 (89%), Gaps = 1/178 (1%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSV A+DKGTGKKQDITITGASTLP DEVERMV+EAERF++EDK
Sbjct  530  GVPQIEVKFDIDANGILSVAAIDKGTGKKQDITITGASTLPGDEVERMVNEAERFSKEDK  589

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKL EL+DAISGGSTQ MKDA
Sbjct  590  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLVELKDAISGGSTQTMKDA  649

Query  509  MAALNQEVMQLGQSLYNQpsas-pgagptpgggsagpsessgkgPDGDVIDADFTDSK  339
            MAALNQEVMQLGQSLYNQP A+       PG  S     SSGKG DGDVIDADFTDSK
Sbjct  650  MAALNQEVMQLGQSLYNQPGAADAAGPTPPGSESGPTDSSSGKGADGDVIDADFTDSK  707



>ref|XP_007033710.1| Chloroplast heat shock protein 70 isoform 1 [Theobroma cacao]
 gb|EOY04636.1| Chloroplast heat shock protein 70 isoform 1 [Theobroma cacao]
Length=665

 Score =   269 bits (688),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 153/177 (86%), Positives = 162/177 (92%), Gaps = 1/177 (1%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEV+RMV EAERFA+EDK
Sbjct  490  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVDRMVKEAERFAKEDK  549

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            E+RDAIDTKNQADSVVYQTEKQLKELG+KVPGPVKEKVEAKL EL+DAISG STQ MKDA
Sbjct  550  ERRDAIDTKNQADSVVYQTEKQLKELGDKVPGPVKEKVEAKLQELKDAISGDSTQGMKDA  609

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDGDVIDADFTDSK  339
            MAALNQEVMQLGQSLYNQ   + G+     GG +GPS+SS KGPDGDVIDADFTDSK
Sbjct  610  MAALNQEVMQLGQSLYNQ-PGAGGSAGPAPGGESGPSDSSNKGPDGDVIDADFTDSK  665



>gb|EYU33275.1| hypothetical protein MIMGU_mgv1a002169mg [Erythranthe guttata]
Length=706

 Score =   270 bits (690),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 152/177 (86%), Positives = 159/177 (90%), Gaps = 1/177 (1%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSV A+DKGTGKKQDITITGASTLPSDEVE+MVSEAE+FA+EDK
Sbjct  531  GVPQIEVKFDIDANGILSVAAIDKGTGKKQDITITGASTLPSDEVEKMVSEAEKFAKEDK  590

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRDAIDTKNQADSVVYQTEKQLKELGEKVP PVKEKVEAKLGEL++AISGGSTQA+KDA
Sbjct  591  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPVPVKEKVEAKLGELKEAISGGSTQAIKDA  650

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDGDVIDADFTDSK  339
            MAALNQEVMQLGQSLYNQ          P  G A   ESSGKGPDGDVIDADFTDSK
Sbjct  651  MAALNQEVMQLGQSLYNQ-PGGAAPSEGPTPGGAAAGESSGKGPDGDVIDADFTDSK  706



>ref|XP_004485441.1| PREDICTED: stromal 70 kDa heat shock-related protein, chloroplastic-like 
[Cicer arietinum]
Length=706

 Score =   270 bits (689),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 157/177 (89%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSV A+DKGTGKKQDITITGASTLP DEV+RMV+EAERFA+EDK
Sbjct  530  GVPQIEVKFDIDANGILSVAAIDKGTGKKQDITITGASTLPGDEVQRMVNEAERFAKEDK  589

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRDAIDTKNQADSVVYQTEKQLKELG+KVPGPVKEKVEAKL EL+DAISGGSTQ +KDA
Sbjct  590  EKRDAIDTKNQADSVVYQTEKQLKELGDKVPGPVKEKVEAKLVELKDAISGGSTQTIKDA  649

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDGDVIDADFTDSK  339
            +AALNQEVMQLGQSLYNQP A+  AGPTP G  +GPSESSGKGPDGDVIDADFTDSK
Sbjct  650  IAALNQEVMQLGQSLYNQPGAAGPAGPTPPGSESGPSESSGKGPDGDVIDADFTDSK  706



>ref|XP_006389517.1| Stromal 70 kDa heat shock-related family protein [Populus trichocarpa]
 gb|ERP48431.1| Stromal 70 kDa heat shock-related family protein [Populus trichocarpa]
Length=706

 Score =   270 bits (689),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 151/177 (85%), Positives = 160/177 (90%), Gaps = 1/177 (1%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSVTA+DKGTGKKQDITITGASTLPSDEVERMVSEA++FA+EDK
Sbjct  531  GVPQIEVKFDIDANGILSVTAIDKGTGKKQDITITGASTLPSDEVERMVSEADKFAKEDK  590

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRDAIDTKNQADSVVYQTEKQLKELGEKVP PVKEKVEAKL EL+DAI+GGSTQ MKDA
Sbjct  591  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPAPVKEKVEAKLQELKDAIAGGSTQVMKDA  650

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDGDVIDADFTDSK  339
            M ALNQEVMQLGQSLYNQ   +        GG AGP++SS KGPDGDVIDADFTDSK
Sbjct  651  MTALNQEVMQLGQSLYNQ-PGAAPGAGPAPGGEAGPTDSSSKGPDGDVIDADFTDSK  706



>gb|ABA86577.1| putative heat shock protein 70 [Aquilegia olympica]
Length=182

 Score =   253 bits (647),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 126/138 (91%), Positives = 135/138 (98%), Gaps = 0/138 (0%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSVTA+DKGTGKKQDITITGASTLPSDEVERMV+EAE+FA+EDK
Sbjct  20   GVPQIEVKFDIDANGILSVTALDKGTGKKQDITITGASTLPSDEVERMVNEAEKFAKEDK  79

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRDAIDTKNQADSVVYQTEKQLKELG+KVP  VKEKVE+KLGEL++AISGGSTQ +KDA
Sbjct  80   EKRDAIDTKNQADSVVYQTEKQLKELGDKVPADVKEKVESKLGELKEAISGGSTQTIKDA  139

Query  509  MAALNQEVMQLGQSLYNQ  456
            MAALNQEVMQLGQSLYNQ
Sbjct  140  MAALNQEVMQLGQSLYNQ  157



>gb|ABA86578.1| putative heat shock protein 70 [Semiaquilegia adoxoides]
Length=182

 Score =   253 bits (647),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 126/138 (91%), Positives = 135/138 (98%), Gaps = 0/138 (0%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSVTA+DKGTGKKQDITITGASTLPSDEVERMV+EAE+FA+EDK
Sbjct  20   GVPQIEVKFDIDANGILSVTALDKGTGKKQDITITGASTLPSDEVERMVNEAEKFAKEDK  79

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRDAIDTKNQADSVVYQTEKQLKELG+KVP  VKEKVE+KLGEL++AISGGSTQ +KDA
Sbjct  80   EKRDAIDTKNQADSVVYQTEKQLKELGDKVPAEVKEKVESKLGELKEAISGGSTQTIKDA  139

Query  509  MAALNQEVMQLGQSLYNQ  456
            MAALNQEVMQLGQSLYNQ
Sbjct  140  MAALNQEVMQLGQSLYNQ  157



>gb|ABA86573.1| putative heat shock protein 70 [Aquilegia formosa]
 gb|ABA86574.1| putative heat shock protein 70 [Aquilegia chrysantha]
 gb|ABA86575.1| putative heat shock protein 70 [Aquilegia brevistyla]
Length=182

 Score =   253 bits (646),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 126/138 (91%), Positives = 135/138 (98%), Gaps = 0/138 (0%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSVTA+DKGTGKKQDITITGASTLPSDEVERMV+EAE+FA+EDK
Sbjct  20   GVPQIEVKFDIDANGILSVTALDKGTGKKQDITITGASTLPSDEVERMVNEAEKFAKEDK  79

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRDAIDTKNQADSVVYQTEKQLKELG+KVP  VKEKVE+KLGEL++AISGGSTQ +KDA
Sbjct  80   EKRDAIDTKNQADSVVYQTEKQLKELGDKVPADVKEKVESKLGELKEAISGGSTQTIKDA  139

Query  509  MAALNQEVMQLGQSLYNQ  456
            MAALNQEVMQLGQSLYNQ
Sbjct  140  MAALNQEVMQLGQSLYNQ  157



>ref|XP_007033712.1| Chloroplast heat shock protein 70 isoform 3 [Theobroma cacao]
 gb|EOY04638.1| Chloroplast heat shock protein 70 isoform 3 [Theobroma cacao]
Length=704

 Score =   269 bits (687),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 153/177 (86%), Positives = 162/177 (92%), Gaps = 1/177 (1%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEV+RMV EAERFA+EDK
Sbjct  529  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVDRMVKEAERFAKEDK  588

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            E+RDAIDTKNQADSVVYQTEKQLKELG+KVPGPVKEKVEAKL EL+DAISG STQ MKDA
Sbjct  589  ERRDAIDTKNQADSVVYQTEKQLKELGDKVPGPVKEKVEAKLQELKDAISGDSTQGMKDA  648

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDGDVIDADFTDSK  339
            MAALNQEVMQLGQSLYNQ   + G+     GG +GPS+SS KGPDGDVIDADFTDSK
Sbjct  649  MAALNQEVMQLGQSLYNQ-PGAGGSAGPAPGGESGPSDSSNKGPDGDVIDADFTDSK  704



>gb|AEY83979.1| heat shock protein 70 KDa, partial [Triticum aestivum]
 gb|AEY83980.1| heat shock protein 70 KDa, partial [Triticum aestivum]
 gb|AEY83981.1| heat shock protein 70 KDa, partial [Triticum aestivum]
Length=194

 Score =   253 bits (646),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 138/177 (78%), Positives = 150/177 (85%), Gaps = 1/177 (1%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSV AVDKGTGKKQDITITGASTLP DEVERMV EA++FAQEDK
Sbjct  17   GVPQIEVKFDIDANGILSVAAVDKGTGKKQDITITGASTLPKDEVERMVEEADKFAQEDK  76

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRDAIDTKNQADSVVYQTEKQLKELG+KVP PVKEKV+ KL EL+DAI+GGSTQ+MK A
Sbjct  77   EKRDAIDTKNQADSVVYQTEKQLKELGDKVPAPVKEKVDVKLQELKDAIAGGSTQSMKTA  136

Query  509  MAALNQEVMQLGQSLYNQpsa-spgagptpgggsagpsessgkgPDGDVIDADFTDS  342
            M ALNQEVMQ+GQ++YNQ SA   G+        AG + S     DGDVIDADFTDS
Sbjct  137  MEALNQEVMQIGQAMYNQTSAGDAGSTDAETEPGAGSTSSGKGPNDGDVIDADFTDS  193



>gb|KJB38007.1| hypothetical protein B456_006G232400 [Gossypium raimondii]
Length=706

 Score =   268 bits (685),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 151/177 (85%), Positives = 158/177 (89%), Gaps = 1/177 (1%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLP DEV+RMV EAERFAQEDK
Sbjct  531  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPGDEVDRMVKEAERFAQEDK  590

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRDAIDTKNQADSVVYQTEKQLKELG+KVPGPVKEKV+AKL EL+DAISGGSTQ MKDA
Sbjct  591  EKRDAIDTKNQADSVVYQTEKQLKELGDKVPGPVKEKVDAKLQELKDAISGGSTQGMKDA  650

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDGDVIDADFTDSK  339
            MAALNQEVMQLGQSLYNQ  ++  A     GG  G S+SS KG D DVIDADFTDSK
Sbjct  651  MAALNQEVMQLGQSLYNQ-PSAGSAAGPAPGGETGRSDSSNKGSDEDVIDADFTDSK  706



>ref|XP_004138943.1| PREDICTED: stromal 70 kDa heat shock-related protein, chloroplastic 
[Cucumis sativus]
 gb|ABM92419.1| chloroplast HSP70 [Cucumis sativus]
 gb|KGN61439.1| Chloroplast HSP70 [Cucumis sativus]
Length=707

 Score =   268 bits (684),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 148/177 (84%), Positives = 164/177 (93%), Gaps = 1/177 (1%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSVTA+DKGTGKKQDITITGASTLPSDEVERMVSEA++FA+EDK
Sbjct  532  GVPQIEVKFDIDANGILSVTAIDKGTGKKQDITITGASTLPSDEVERMVSEADKFAKEDK  591

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRDAIDTKNQADSVVYQTEKQLKELG+KVPGPVKEKVE+KLGEL++AISGGST+A+K+A
Sbjct  592  EKRDAIDTKNQADSVVYQTEKQLKELGDKVPGPVKEKVESKLGELKEAISGGSTEAIKEA  651

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDGDVIDADFTDSK  339
            MAALNQEVMQLGQSLYNQ   +  A        +GPSES+GKGP+GDVIDADF+DSK
Sbjct  652  MAALNQEVMQLGQSLYNQ-PGAGAAPGPGASSESGPSESTGKGPEGDVIDADFSDSK  707



>ref|XP_010065272.1| PREDICTED: stromal 70 kDa heat shock-related protein, chloroplastic-like 
[Eucalyptus grandis]
 gb|KCW62674.1| hypothetical protein EUGRSUZ_G00235 [Eucalyptus grandis]
Length=706

 Score =   267 bits (683),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 150/177 (85%), Positives = 160/177 (90%), Gaps = 1/177 (1%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMV EA++FA+EDK
Sbjct  531  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVKEADKFAKEDK  590

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRDAIDTKNQADSVVYQTEKQLKELG+KVPGPVKEKVEAKL EL+D +SGGSTQA+KDA
Sbjct  591  EKRDAIDTKNQADSVVYQTEKQLKELGDKVPGPVKEKVEAKLKELKDVMSGGSTQAIKDA  650

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDGDVIDADFTDSK  339
            MAALNQEVMQLGQSLY+Q   + GAGP PG G+     SS  G DGDVIDADFTDSK
Sbjct  651  MAALNQEVMQLGQSLYSQ-PGAAGAGPAPGAGARSSDSSSETGQDGDVIDADFTDSK  706



>gb|ABA86576.1| putative heat shock protein 70 [Aquilegia pyrenaica]
Length=182

 Score =   251 bits (642),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 125/138 (91%), Positives = 134/138 (97%), Gaps = 0/138 (0%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSVTA+DKGTGKKQDITITGASTLPSDEVERMV+EAE+FA+EDK
Sbjct  20   GVPQIEVKFDIDANGILSVTALDKGTGKKQDITITGASTLPSDEVERMVNEAEKFAKEDK  79

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRDAIDTKNQADSVVYQTEKQLKELG+KVP  VKEKVE+KLGE ++AISGGSTQ +KDA
Sbjct  80   EKRDAIDTKNQADSVVYQTEKQLKELGDKVPADVKEKVESKLGEFKEAISGGSTQTIKDA  139

Query  509  MAALNQEVMQLGQSLYNQ  456
            MAALNQEVMQLGQSLYNQ
Sbjct  140  MAALNQEVMQLGQSLYNQ  157



>ref|XP_008799965.1| PREDICTED: stromal 70 kDa heat shock-related protein, chloroplastic 
[Phoenix dactylifera]
Length=702

 Score =   267 bits (682),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 147/177 (83%), Positives = 155/177 (88%), Gaps = 1/177 (1%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMV+EAE+FA+EDK
Sbjct  527  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVNEAEKFAKEDK  586

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKR+AIDTKNQA+SVVYQTEKQLKELGEKVP PVKEKVE KLGEL+DAISGGSTQ MKDA
Sbjct  587  EKREAIDTKNQAESVVYQTEKQLKELGEKVPAPVKEKVEGKLGELKDAISGGSTQGMKDA  646

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDGDVIDADFTDSK  339
            MA+LNQEVMQLGQSLYNQ     GAGP PG  +     S      GDVIDADFTDSK
Sbjct  647  MASLNQEVMQLGQSLYNQ-PGGAGAGPAPGADAGPADPSGKGPEGGDVIDADFTDSK  702



>ref|XP_010030182.1| PREDICTED: stromal 70 kDa heat shock-related protein, chloroplastic 
[Eucalyptus grandis]
 gb|KCW57127.1| hypothetical protein EUGRSUZ_I02771 [Eucalyptus grandis]
Length=718

 Score =   267 bits (682),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 149/186 (80%), Positives = 157/186 (84%), Gaps = 9/186 (5%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSV+AVDKGTGKKQDITITGASTLPSDEVERMV EAE+FA+EDK
Sbjct  533  GVPQIEVKFDIDANGILSVSAVDKGTGKKQDITITGASTLPSDEVERMVQEAEKFAKEDK  592

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRDAIDTKNQADSVVYQTEKQLKELG+KVP PVKEKVEAKLGEL++AISGGSTQ +KDA
Sbjct  593  EKRDAIDTKNQADSVVYQTEKQLKELGDKVPAPVKEKVEAKLGELKEAISGGSTQGIKDA  652

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPD---------GDVIDA  357
            MAALNQEVMQLGQSLYNQP A    G    GG+ G    SG   D         GDVIDA
Sbjct  653  MAALNQEVMQLGQSLYNQPGAPGAGGAPGAGGAPGAGGPSGGPTDSSSDNKGPEGDVIDA  712

Query  356  DFTDSK  339
            DFTDSK
Sbjct  713  DFTDSK  718



>ref|XP_008457143.1| PREDICTED: stromal 70 kDa heat shock-related protein, chloroplastic 
[Cucumis melo]
Length=705

 Score =   266 bits (681),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 150/177 (85%), Positives = 163/177 (92%), Gaps = 3/177 (2%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSVTA+DKGTGKKQDITITGASTLPSDEVERMVSEAE+FA+EDK
Sbjct  532  GVPQIEVKFDIDANGILSVTAIDKGTGKKQDITITGASTLPSDEVERMVSEAEKFAKEDK  591

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRDAIDTKNQADSVVYQTEKQLKELG+KVPG VKEKVE+KLGEL++AISGGST+A+K+A
Sbjct  592  EKRDAIDTKNQADSVVYQTEKQLKELGDKVPGSVKEKVESKLGELKEAISGGSTEAIKEA  651

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDGDVIDADFTDSK  339
            MAALNQEVMQLGQSLYNQ      A     G  +GPSES+GKGP+GDVIDADFTDSK
Sbjct  652  MAALNQEVMQLGQSLYNQ---PGAAPGPGAGSESGPSESTGKGPEGDVIDADFTDSK  705



>gb|AAC03416.1| heat shock protein 70 precursor [Citrullus lanatus]
Length=705

 Score =   266 bits (681),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 149/177 (84%), Positives = 162/177 (92%), Gaps = 3/177 (2%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSVTA+DKGTGKKQDITITGASTLPSDEVERMVSE  +FA+EDK
Sbjct  532  GVPQIEVKFDIDANGILSVTAIDKGTGKKQDITITGASTLPSDEVERMVSERRKFAKEDK  591

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRDAIDTKNQADSVVYQTEKQLKELG+KVPGPVKEKVE+KLGEL++AISGGST+A+K+A
Sbjct  592  EKRDAIDTKNQADSVVYQTEKQLKELGDKVPGPVKEKVESKLGELKEAISGGSTEAIKEA  651

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDGDVIDADFTDSK  339
            MAALNQEVMQLGQSLYNQ      A     G  +GPSES+GKGP+GDVIDADFTDSK
Sbjct  652  MAALNQEVMQLGQSLYNQ---PGAAPGAGAGSESGPSESTGKGPEGDVIDADFTDSK  705



>ref|XP_006385039.1| Stromal 70 kDa heat shock-related family protein [Populus trichocarpa]
 gb|ERP62836.1| Stromal 70 kDa heat shock-related family protein [Populus trichocarpa]
Length=766

 Score =   268 bits (684),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 150/177 (85%), Positives = 158/177 (89%), Gaps = 1/177 (1%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSV A+DKGTGKKQDITITGASTLPSDEV RMVSEAE+FA+EDK
Sbjct  591  GVPQIEVKFDIDANGILSVAAIDKGTGKKQDITITGASTLPSDEVGRMVSEAEKFAKEDK  650

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRDAIDTKNQADSVVYQTEKQLKELGEKVP PVKEKVEAKL EL+DA++GGSTQ MKDA
Sbjct  651  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPAPVKEKVEAKLQELKDAVAGGSTQGMKDA  710

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDGDVIDADFTDSK  339
            MAALNQEVMQLGQSLYNQ   +        G  AGPS+SS KGPDGDVIDADFTDSK
Sbjct  711  MAALNQEVMQLGQSLYNQ-PGAAPGAGPAPGSEAGPSDSSNKGPDGDVIDADFTDSK  766



>emb|CAA52149.1| heat shock protein 70 [Cucumis sativus]
Length=707

 Score =   266 bits (680),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 147/177 (83%), Positives = 164/177 (93%), Gaps = 1/177 (1%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSVTA+DKG+GKKQDITITGASTLPSDEVERMVSEA++FA+EDK
Sbjct  532  GVPQIEVKFDIDANGILSVTAIDKGSGKKQDITITGASTLPSDEVERMVSEADKFAKEDK  591

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRDAIDTKNQADSVVYQTEKQLKELG+KVPGPVKEKVE+KLGEL++AISGGST+A+K+A
Sbjct  592  EKRDAIDTKNQADSVVYQTEKQLKELGDKVPGPVKEKVESKLGELKEAISGGSTEAIKEA  651

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDGDVIDADFTDSK  339
            MAALNQEVMQLGQSLYNQ   +  A        +GPSES+GKGP+GDVIDADF+DSK
Sbjct  652  MAALNQEVMQLGQSLYNQ-PGAGAAPGPGASSESGPSESTGKGPEGDVIDADFSDSK  707



>ref|XP_007148569.1| hypothetical protein PHAVU_006G219600g [Phaseolus vulgaris]
 gb|ESW20563.1| hypothetical protein PHAVU_006G219600g [Phaseolus vulgaris]
Length=689

 Score =   266 bits (679),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 156/178 (88%), Positives = 168/178 (94%), Gaps = 1/178 (1%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSV A+DKGTGKKQDITITGASTLPSDEV RMV+EAE+F++EDK
Sbjct  512  GVPQIEVKFDIDANGILSVAAIDKGTGKKQDITITGASTLPSDEVARMVNEAEKFSKEDK  571

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRDAIDTKNQADSVVYQTEKQLKELG+KVPGPVKEKVEAKLGEL++AISGG+TQ++KDA
Sbjct  572  EKRDAIDTKNQADSVVYQTEKQLKELGDKVPGPVKEKVEAKLGELKEAISGGATQSIKDA  631

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggs-agpsessgkgPDGDVIDADFTDSK  339
            MAALNQEVMQLGQSLYNQP A    GPTP  G+ AGPSESSGKGPDGDVIDADFTDSK
Sbjct  632  MAALNQEVMQLGQSLYNQPGAPGAGGPTPPPGADAGPSESSGKGPDGDVIDADFTDSK  689



>gb|EYU26456.1| hypothetical protein MIMGU_mgv1a002163mg [Erythranthe guttata]
Length=706

 Score =   266 bits (679),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 148/177 (84%), Positives = 158/177 (89%), Gaps = 1/177 (1%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSV A+DKGTGKKQDITITGASTLPSDEV+RMVSEAE+FA+EDK
Sbjct  531  GVPQIEVKFDIDANGILSVAAIDKGTGKKQDITITGASTLPSDEVQRMVSEAEKFAKEDK  590

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRDAIDTKNQADSVVYQTEKQLKELG+KVP PVKEKVEAKL EL +AISGGSTQA+KDA
Sbjct  591  EKRDAIDTKNQADSVVYQTEKQLKELGDKVPAPVKEKVEAKLKELNEAISGGSTQAIKDA  650

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDGDVIDADFTDSK  339
            MAALNQEVMQLGQSLYNQ     G  P  G   +  SE+S KGP+GDVIDADFTDSK
Sbjct  651  MAALNQEVMQLGQSLYNQ-PGGAGPTPPGGEAGSSSSETSDKGPEGDVIDADFTDSK  706



>ref|XP_009353782.1| PREDICTED: stromal 70 kDa heat shock-related protein, chloroplastic 
[Pyrus x bretschneideri]
Length=695

 Score =   265 bits (678),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 150/180 (83%), Positives = 156/180 (87%), Gaps = 3/180 (2%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSV AVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK
Sbjct  516  GVPQIEVKFDIDANGILSVAAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  575

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRDAIDTKNQADSVVYQTEKQLKELG+KVP  VKEKVEAKLGEL++ +SGGSTQA+KDA
Sbjct  576  EKRDAIDTKNQADSVVYQTEKQLKELGDKVPAEVKEKVEAKLGELKETVSGGSTQAIKDA  635

Query  509  MAALNQEVMQLGQSLYNQpsas---pgagptpgggsagpsessgkgPDGDVIDADFTDSK  339
            +AALNQEVMQLGQSLYNQP       G  P           SSGKGPDGDVIDADFTDSK
Sbjct  636  IAALNQEVMQLGQSLYNQPGTPGAGAGPTPPGAEAGGSSESSSGKGPDGDVIDADFTDSK  695



>ref|XP_008339403.1| PREDICTED: stromal 70 kDa heat shock-related protein, chloroplastic 
[Malus domestica]
Length=695

 Score =   265 bits (677),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 150/180 (83%), Positives = 156/180 (87%), Gaps = 3/180 (2%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSV AVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK
Sbjct  516  GVPQIEVKFDIDANGILSVAAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  575

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRDAIDTKNQADSVVYQTEKQLKELG+KVP  VKEKVEAKLGEL++ +SGGSTQA+KDA
Sbjct  576  EKRDAIDTKNQADSVVYQTEKQLKELGDKVPAEVKEKVEAKLGELKETVSGGSTQAIKDA  635

Query  509  MAALNQEVMQLGQSLYNQpsas---pgagptpgggsagpsessgkgPDGDVIDADFTDSK  339
            +AALNQEVMQLGQSLYNQP       G  P           SSGKGPDGDVIDADFTDSK
Sbjct  636  IAALNQEVMQLGQSLYNQPGTPGAGAGPTPPGAEAGGSSESSSGKGPDGDVIDADFTDSK  695



>ref|XP_008368182.1| PREDICTED: stromal 70 kDa heat shock-related protein, chloroplastic 
[Malus domestica]
Length=695

 Score =   265 bits (677),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 150/180 (83%), Positives = 156/180 (87%), Gaps = 3/180 (2%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSV AVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK
Sbjct  516  GVPQIEVKFDIDANGILSVAAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  575

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRDAIDTKNQADSVVYQTEKQLKELG+KVP  VKEKVEAKLGEL++ +SGGSTQA+KDA
Sbjct  576  EKRDAIDTKNQADSVVYQTEKQLKELGDKVPAEVKEKVEAKLGELKETVSGGSTQAIKDA  635

Query  509  MAALNQEVMQLGQSLYNQpsas---pgagptpgggsagpsessgkgPDGDVIDADFTDSK  339
            +AALNQEVMQLGQSLYNQP       G  P           SSGKGPDGDVIDADFTDSK
Sbjct  636  IAALNQEVMQLGQSLYNQPGTPGAGAGPTPPGAEAGGSSESSSGKGPDGDVIDADFTDSK  695



>ref|XP_004300629.1| PREDICTED: stromal 70 kDa heat shock-related protein, chloroplastic 
[Fragaria vesca subsp. vesca]
Length=697

 Score =   265 bits (677),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 143/181 (79%), Positives = 154/181 (85%), Gaps = 4/181 (2%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSV AVDKGTGKKQDITITGASTLP+DEV+RMV+EAE+FA+EDK
Sbjct  517  GVPQIEVKFDIDANGILSVAAVDKGTGKKQDITITGASTLPNDEVQRMVNEAEKFAKEDK  576

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRDAIDTKNQADSVVYQTEKQLKELG+KVP PVKEKVEAKLGEL++AISGGSTQA+KD+
Sbjct  577  EKRDAIDTKNQADSVVYQTEKQLKELGDKVPAPVKEKVEAKLGELKEAISGGSTQAIKDS  636

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgP----DGDVIDADFTDS  342
            MAALNQEVMQLGQSLYNQP A          G+      S        DGDVIDADFTDS
Sbjct  637  MAALNQEVMQLGQSLYNQPGAPGAGAGPTPPGAEAGPSESSSSSGKGPDGDVIDADFTDS  696

Query  341  K  339
            K
Sbjct  697  K  697



>gb|KJB27775.1| hypothetical protein B456_005G009100 [Gossypium raimondii]
Length=704

 Score =   265 bits (677),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 149/177 (84%), Positives = 161/177 (91%), Gaps = 0/177 (0%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLP+DEV+RMV EAE+F++EDK
Sbjct  528  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPNDEVDRMVKEAEKFSKEDK  587

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            E+RDAIDTKNQADSVVYQTEKQLKELG+KVPGPVKEKVEAKL EL+DAI+G STQ MKDA
Sbjct  588  ERRDAIDTKNQADSVVYQTEKQLKELGDKVPGPVKEKVEAKLQELKDAIAGDSTQGMKDA  647

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDGDVIDADFTDSK  339
            MAALNQEVMQLGQSLYNQP A   +     GG  GPS+SS KGP+GDVIDADFTDSK
Sbjct  648  MAALNQEVMQLGQSLYNQPGAGGSSAGPAPGGETGPSDSSNKGPEGDVIDADFTDSK  704



>ref|XP_010095881.1| Stromal 70 kDa heat shock-related protein [Morus notabilis]
 gb|EXB62431.1| Stromal 70 kDa heat shock-related protein [Morus notabilis]
Length=707

 Score =   265 bits (677),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 155/180 (86%), Positives = 165/180 (92%), Gaps = 3/180 (2%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSVTA+DKGTGKKQDITITGASTLP+DEV RMV EAE+FA+EDK
Sbjct  528  GVPQIEVKFDIDANGILSVTAIDKGTGKKQDITITGASTLPNDEVSRMVKEAEKFAKEDK  587

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRDAIDTKNQADSVVYQTEKQLKELG+KVPG VKEKVEAKLGEL++AISGGSTQA+KDA
Sbjct  588  EKRDAIDTKNQADSVVYQTEKQLKELGDKVPGAVKEKVEAKLGELKEAISGGSTQAIKDA  647

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggs---agpsessgkgPDGDVIDADFTDSK  339
            MAALNQEVMQLGQSLYNQP  +PGAGP PGG +      S SS KGPDGDVIDADFTDSK
Sbjct  648  MAALNQEVMQLGQSLYNQPGTAPGAGPAPGGETGPSDSSSSSSSKGPDGDVIDADFTDSK  707



>ref|XP_010087927.1| Stromal 70 kDa heat shock-related protein [Morus notabilis]
 gb|EXB30762.1| Stromal 70 kDa heat shock-related protein [Morus notabilis]
Length=707

 Score =   265 bits (677),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 156/180 (87%), Positives = 166/180 (92%), Gaps = 3/180 (2%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSVTA+DKGTGKKQDITITGASTLP+DEV RMV EAE+FA+EDK
Sbjct  528  GVPQIEVKFDIDANGILSVTAIDKGTGKKQDITITGASTLPNDEVSRMVKEAEKFAKEDK  587

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRDAIDTKNQADSVVYQTEKQLKELG+KVPG VKEKVEAKLGEL++AISGGSTQA+KDA
Sbjct  588  EKRDAIDTKNQADSVVYQTEKQLKELGDKVPGAVKEKVEAKLGELKEAISGGSTQAIKDA  647

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggs---agpsessgkgPDGDVIDADFTDSK  339
            MAALNQEVMQLGQSLYNQP A+PGAGP PGG +      S SS KGPDGDVIDADFTDSK
Sbjct  648  MAALNQEVMQLGQSLYNQPGAAPGAGPAPGGETGPSDSSSSSSSKGPDGDVIDADFTDSK  707



>ref|XP_010266362.1| PREDICTED: stromal 70 kDa heat shock-related protein, chloroplastic 
[Nelumbo nucifera]
Length=713

 Score =   265 bits (676),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 149/177 (84%), Positives = 160/177 (90%), Gaps = 1/177 (1%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSVTA+DKGTGKKQDITITGASTLPSDEVERMV EAE+FA+EDK
Sbjct  536  GVPQIEVKFDIDANGILSVTAIDKGTGKKQDITITGASTLPSDEVERMVKEAEKFAKEDK  595

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRDAIDTKNQADSVVYQTEKQLKELG+KVP  VKEKVE+K+GEL++AISGGSTQAMKDA
Sbjct  596  EKRDAIDTKNQADSVVYQTEKQLKELGDKVPAAVKEKVESKIGELKEAISGGSTQAMKDA  655

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpse-ssgkgPDGDVIDADFTDS  342
            +AALNQEVMQLGQSLYNQP +         GG AGPS  S+GK PDGDVIDADFTDS
Sbjct  656  IAALNQEVMQLGQSLYNQPGSPGAGAGPAPGGEAGPSSGSAGKTPDGDVIDADFTDS  712



>gb|AAB91471.1| heat shock 70 protein [Spinacia oleracea]
 gb|AAB96659.1| heat shock 70 protein [Spinacia oleracea]
Length=715

 Score =   264 bits (675),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 145/180 (81%), Positives = 154/180 (86%), Gaps = 3/180 (2%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQ+EVKFDIDANGILSVTA+DKGTGKKQDITITGASTLP DEVERMVSEAE+FA+EDK
Sbjct  536  GVPQVEVKFDIDANGILSVTAIDKGTGKKQDITITGASTLPGDEVERMVSEAEKFAKEDK  595

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKR+ IDTKNQADSVVYQTEKQLKELGEKVP PVKEKVEAKLGEL+DAI+GG TQA+KDA
Sbjct  596  EKREVIDTKNQADSVVYQTEKQLKELGEKVPVPVKEKVEAKLGELKDAINGGETQAIKDA  655

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgP---DGDVIDADFTDSK  339
            MAALNQEVMQLGQSLYNQP A    G  PG      S  S       +GDVIDADFTDSK
Sbjct  656  MAALNQEVMQLGQSLYNQPGAGGEPGAGPGPTPGAESGPSDSTSKGPEGDVIDADFTDSK  715



>ref|XP_009353783.1| PREDICTED: heat shock 70 kDa protein 6, chloroplastic-like [Pyrus 
x bretschneideri]
Length=695

 Score =   263 bits (673),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 149/180 (83%), Positives = 156/180 (87%), Gaps = 3/180 (2%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSV AVDKGTGKKQDITITGASTLPSDEVERMVSEAE+FA+EDK
Sbjct  516  GVPQIEVKFDIDANGILSVAAVDKGTGKKQDITITGASTLPSDEVERMVSEAEKFAKEDK  575

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRDAIDTKNQADSV+YQTEKQLKELG+KVP  VK KVEAKLGEL+DA+SGGSTQA+KDA
Sbjct  576  EKRDAIDTKNQADSVIYQTEKQLKELGDKVPAEVKGKVEAKLGELKDAVSGGSTQAIKDA  635

Query  509  MAALNQEVMQLGQSLYNQpsas---pgagptpgggsagpsessgkgPDGDVIDADFTDSK  339
            MAALNQEVMQLGQSLYNQP       G  P           SSGKGPDGDVIDADFTDSK
Sbjct  636  MAALNQEVMQLGQSLYNQPGTPGAGAGPTPPGSEAGGSSDSSSGKGPDGDVIDADFTDSK  695



>ref|XP_010681763.1| PREDICTED: stromal 70 kDa heat shock-related protein, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=713

 Score =   264 bits (674),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 149/178 (84%), Positives = 155/178 (87%), Gaps = 1/178 (1%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSVTA DKGTGKKQDITITGASTLP DEVERMVSEAERFA+EDK
Sbjct  536  GVPQIEVKFDIDANGILSVTASDKGTGKKQDITITGASTLPGDEVERMVSEAERFAKEDK  595

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRDAIDTKNQADSVVYQTEKQLKELG+KVPG VKEKVEAKLGEL+DA++ G TQA+KDA
Sbjct  596  EKRDAIDTKNQADSVVYQTEKQLKELGDKVPGAVKEKVEAKLGELKDAVAQGETQAIKDA  655

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpse-ssgkgPDGDVIDADFTDSK  339
            MAALNQEVMQLGQSLYNQP A    G  P  G       S  KGPDGDVIDADFTDSK
Sbjct  656  MAALNQEVMQLGQSLYNQPGAGGAPGAGPTPGGEAGPSDSGSKGPDGDVIDADFTDSK  713



>prf||1909352A heat shock protein hsp70
Length=706

 Score =   263 bits (673),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 145/178 (81%), Positives = 157/178 (88%), Gaps = 1/178 (1%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSV A+DKGTGKKQDITITGASTLP DEVERMVSEAERF++EDK
Sbjct  529  GVPQIEVKFDIDANGILSVAAIDKGTGKKQDITITGASTLPGDEVERMVSEAERFSKEDK  588

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKR+AIDTKNQADSVVYQTEKQLKELGEKVP PVKEKVEAKLGEL++AI+GGSTQ +KDA
Sbjct  589  EKREAIDTKNQADSVVYQTEKQLKELGEKVPAPVKEKVEAKLGELKEAITGGSTQTIKDA  648

Query  509  MAALNQEVMQLGQSLYNQp-saspgagptpgggsagpsessgkgPDGDVIDADFTDSK  339
            +AALNQEVMQLGQSLYNQP +A       PG  S     S  +GP+GDVIDADFTDSK
Sbjct  649  LAALNQEVMQLGQSLYNQPGAAGQAGPTPPGSESGPSESSGKEGPEGDVIDADFTDSK  706



>sp|Q02028.1|HSP7S_PEA RecName: Full=Stromal 70 kDa heat shock-related protein, chloroplastic; 
Flags: Precursor [Pisum sativum]
 gb|AAA33637.1| 70 kDa heat shock protein [Pisum sativum]
 emb|CAA49147.1| Psst70 (stress 70 protein) [Pisum sativum]
Length=706

 Score =   263 bits (673),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 145/178 (81%), Positives = 157/178 (88%), Gaps = 1/178 (1%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSV A+DKGTGKKQDITITGASTLP DEVERMVSEAERF++EDK
Sbjct  529  GVPQIEVKFDIDANGILSVAAIDKGTGKKQDITITGASTLPGDEVERMVSEAERFSKEDK  588

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKR+AIDTKNQADSVVYQTEKQLKELGEKVP PVKEKVEAKLGEL++AI+GGSTQ +KDA
Sbjct  589  EKREAIDTKNQADSVVYQTEKQLKELGEKVPAPVKEKVEAKLGELKEAITGGSTQTIKDA  648

Query  509  MAALNQEVMQLGQSLYNQp-saspgagptpgggsagpsessgkgPDGDVIDADFTDSK  339
            +AALNQEVMQLGQSLYNQP +A       PG  S     S  +GP+GDVIDADFTDSK
Sbjct  649  LAALNQEVMQLGQSLYNQPGAAGQAGPTPPGSESGPSESSGKEGPEGDVIDADFTDSK  706



>gb|ABZ04080.1| chloroplast heat shock protein 70-1 [Ipomoea nil]
Length=697

 Score =   263 bits (672),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 152/178 (85%), Positives = 161/178 (90%), Gaps = 2/178 (1%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSV AVDKGTGKKQDITITGASTLP+DEV+RMV EAERFAQEDK
Sbjct  519  GVPQIEVKFDIDANGILSVAAVDKGTGKKQDITITGASTLPNDEVDRMVKEAERFAQEDK  578

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRDAIDTKNQA SVVYQTEKQLK+LG+K+PG VKEKVEAKLGEL+DAISGGSTQAMKDA
Sbjct  579  EKRDAIDTKNQAYSVVYQTEKQLKDLGDKIPGSVKEKVEAKLGELKDAISGGSTQAMKDA  638

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgP--DGDVIDADFTDS  342
            MAALNQEVMQ+GQSLYNQP A+PGAGP PGG +     SS  G   DGDVIDADFTDS
Sbjct  639  MAALNQEVMQIGQSLYNQPGAAPGAGPAPGGSAEPSESSSSSGKGPDGDVIDADFTDS  696



>ref|XP_008357648.1| PREDICTED: stromal 70 kDa heat shock-related protein, chloroplastic 
isoform X1 [Malus domestica]
 ref|XP_008357649.1| PREDICTED: stromal 70 kDa heat shock-related protein, chloroplastic 
isoform X2 [Malus domestica]
Length=695

 Score =   262 bits (669),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 143/180 (79%), Positives = 151/180 (84%), Gaps = 3/180 (2%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDA+GILSV AVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK
Sbjct  516  GVPQIEVKFDIDASGILSVAAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  575

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRDAIDTKNQADSVVYQTEKQLKELG+KVP  VK KVEAKLGEL++ +SGGSTQA+KDA
Sbjct  576  EKRDAIDTKNQADSVVYQTEKQLKELGDKVPAEVKAKVEAKLGELKETVSGGSTQAIKDA  635

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkg---PDGDVIDADFTDSK  339
            +AALNQEVMQLGQSLYNQP            G+     S       PDGDVIDADFTDSK
Sbjct  636  IAALNQEVMQLGQSLYNQPGTPGAGAGPXPPGAEAGGPSESSSGKGPDGDVIDADFTDSK  695



>ref|XP_007148568.1| hypothetical protein PHAVU_006G219500g [Phaseolus vulgaris]
 gb|ESW20562.1| hypothetical protein PHAVU_006G219500g [Phaseolus vulgaris]
Length=689

 Score =   261 bits (667),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 155/178 (87%), Positives = 167/178 (94%), Gaps = 1/178 (1%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSV A+DKGTGKKQDITITGASTLPSDEV RMV+EAE+F++EDK
Sbjct  512  GVPQIEVKFDIDANGILSVAAIDKGTGKKQDITITGASTLPSDEVARMVNEAEKFSKEDK  571

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRDAIDTKNQADSVVYQTEKQLKELG+KVPGPVKEKVEAKLGEL+DAISG + QA+KDA
Sbjct  572  EKRDAIDTKNQADSVVYQTEKQLKELGDKVPGPVKEKVEAKLGELKDAISGDAIQAIKDA  631

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggs-agpsessgkgPDGDVIDADFTDSK  339
            MAALNQEVMQLGQSLYNQP A+   GPTP  G+ AGPSESSGKGP+GDVIDADFTDSK
Sbjct  632  MAALNQEVMQLGQSLYNQPGAAAAGGPTPPPGADAGPSESSGKGPEGDVIDADFTDSK  689



>ref|XP_009355320.1| PREDICTED: stromal 70 kDa heat shock-related protein, chloroplastic-like 
[Pyrus x bretschneideri]
Length=695

 Score =   261 bits (667),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 147/180 (82%), Positives = 155/180 (86%), Gaps = 3/180 (2%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDA+GILSV AVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK
Sbjct  516  GVPQIEVKFDIDASGILSVAAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  575

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRDAIDTKNQADSVVYQTEKQLKELG+KVP  VK KVEAKLGEL++ +SGGSTQA+KDA
Sbjct  576  EKRDAIDTKNQADSVVYQTEKQLKELGDKVPAEVKAKVEAKLGELKETVSGGSTQAIKDA  635

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsag---psessgkgPDGDVIDADFTDSK  339
            +AALNQEVMQLGQSLYNQP            G+        SSGKGPDGDVIDADFTDSK
Sbjct  636  IAALNQEVMQLGQSLYNQPGTPGAGAGPTPPGAEAGGPSESSSGKGPDGDVIDADFTDSK  695



>ref|XP_010932308.1| PREDICTED: stromal 70 kDa heat shock-related protein, chloroplastic-like 
[Elaeis guineensis]
Length=706

 Score =   261 bits (667),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 143/177 (81%), Positives = 153/177 (86%), Gaps = 1/177 (1%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQ+E+KFDIDANGILSVTAVDKG+GKKQDITITGASTLPSDEVERMV+EAE FA+EDK
Sbjct  531  GVPQVEIKFDIDANGILSVTAVDKGSGKKQDITITGASTLPSDEVERMVNEAEMFAKEDK  590

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRD IDTKNQA+SVVYQTEKQLKELG+KVP PVKEKVE KLGEL+DAISGGSTQ MKDA
Sbjct  591  EKRDTIDTKNQAESVVYQTEKQLKELGDKVPAPVKEKVEGKLGELKDAISGGSTQGMKDA  650

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDGDVIDADFTDSK  339
            +AALNQEVMQLGQSLYNQ     GAGP PG  +     S      GDVIDADFTDSK
Sbjct  651  IAALNQEVMQLGQSLYNQ-PGGAGAGPAPGADAGPADPSGKGSEGGDVIDADFTDSK  706



>ref|XP_010930060.1| PREDICTED: stromal 70 kDa heat shock-related protein, chloroplastic 
[Elaeis guineensis]
Length=707

 Score =   261 bits (667),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 140/177 (79%), Positives = 151/177 (85%), Gaps = 0/177 (0%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLP DEV+RMV EAER+A+EDK
Sbjct  531  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPGDEVDRMVKEAERYAKEDK  590

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRDAIDTKNQ++SVVYQTEKQLKELG+KVP  VKEKVEAKL EL+DAI+GGSTQ+MKDA
Sbjct  591  EKRDAIDTKNQSESVVYQTEKQLKELGDKVPAAVKEKVEAKLKELKDAIAGGSTQSMKDA  650

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDGDVIDADFTDSK  339
            MAALNQEVMQLGQSLYNQP A+           +  S   G    GDVIDADFTDSK
Sbjct  651  MAALNQEVMQLGQSLYNQPGAAGAGPAPGADAGSAGSTGKGPDDGGDVIDADFTDSK  707



>ref|XP_008223905.1| PREDICTED: stromal 70 kDa heat shock-related protein, chloroplastic 
[Prunus mume]
Length=706

 Score =   261 bits (666),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 146/182 (80%), Positives = 156/182 (86%), Gaps = 5/182 (3%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSV AVDKGTGKKQDITITGASTLPSDEVERMVSEAERFA+EDK
Sbjct  525  GVPQIEVKFDIDANGILSVAAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAKEDK  584

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKR+AIDTKNQADSVVYQTEKQLKELG+KVP  VKEKVEAKLGEL+++++GGSTQA+KDA
Sbjct  585  EKREAIDTKNQADSVVYQTEKQLKELGDKVPAEVKEKVEAKLGELKESVAGGSTQAIKDA  644

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsag-----psessgkgPDGDVIDADFTD  345
            +AALNQEVMQLGQSLYNQP A                      SSGKGPDGDVIDADFTD
Sbjct  645  IAALNQEVMQLGQSLYNQPGAPGAGAGAGPTPPGAEAGGPSESSSGKGPDGDVIDADFTD  704

Query  344  SK  339
            SK
Sbjct  705  SK  706



>ref|NP_001066486.1| Os12g0244100 [Oryza sativa Japonica Group]
 gb|ABA97211.1| Stromal 70 kDa heat shock-related protein, chloroplast precursor, 
putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF29505.1| Os12g0244100 [Oryza sativa Japonica Group]
 gb|ACA50477.1| 70 kDa heat shock protein [Oryza sativa Japonica Group]
Length=698

 Score =   260 bits (664),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 139/176 (79%), Positives = 154/176 (88%), Gaps = 0/176 (0%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSV A+DKGTGKKQDITITGASTLP DEVERMV EA++FAQEDK
Sbjct  522  GVPQIEVKFDIDANGILSVAAIDKGTGKKQDITITGASTLPKDEVERMVEEADKFAQEDK  581

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRDAIDTKNQADSVVYQTEKQLKELG+KVP PVKEKV+AKL EL++AI+GGSTQ+MKDA
Sbjct  582  EKRDAIDTKNQADSVVYQTEKQLKELGDKVPAPVKEKVDAKLNELKEAIAGGSTQSMKDA  641

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDGDVIDADFTDS  342
            MAALN+EVMQ+GQ++YNQ   +  AGPTPG  +   S       DGDVIDADFTDS
Sbjct  642  MAALNEEVMQIGQAMYNQQPNAGAAGPTPGADAGPTSSGGKGPNDGDVIDADFTDS  697



>ref|XP_006858478.1| PREDICTED: stromal 70 kDa heat shock-related protein, chloroplastic 
[Amborella trichopoda]
 gb|ERN19945.1| hypothetical protein AMTR_s00071p00117740 [Amborella trichopoda]
Length=704

 Score =   260 bits (664),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 140/177 (79%), Positives = 148/177 (84%), Gaps = 0/177 (0%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSV AVDKGTGKKQDITITGASTLP+DEV+RMV EAERFA+EDK
Sbjct  528  GVPQIEVKFDIDANGILSVAAVDKGTGKKQDITITGASTLPNDEVDRMVREAERFAKEDK  587

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRD IDTKNQADSVVYQTEKQLKELG+KVP  VKEKVE+KL EL+ AISGG+TQAMKDA
Sbjct  588  EKRDTIDTKNQADSVVYQTEKQLKELGDKVPASVKEKVESKLSELKGAISGGNTQAMKDA  647

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDGDVIDADFTDSK  339
            MAALNQEVMQLGQSLYNQP A+PG                     GDVIDADFTDSK
Sbjct  648  MAALNQEVMQLGQSLYNQPGAAPGGPGAGPTAGEAAGSDGKAADGGDVIDADFTDSK  704



>gb|EEC69073.1| hypothetical protein OsI_37938 [Oryza sativa Indica Group]
 gb|EEE53011.1| hypothetical protein OsJ_35701 [Oryza sativa Japonica Group]
Length=715

 Score =   260 bits (665),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 139/176 (79%), Positives = 154/176 (88%), Gaps = 0/176 (0%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSV A+DKGTGKKQDITITGASTLP DEVERMV EA++FAQEDK
Sbjct  539  GVPQIEVKFDIDANGILSVAAIDKGTGKKQDITITGASTLPKDEVERMVEEADKFAQEDK  598

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRDAIDTKNQADSVVYQTEKQLKELG+KVP PVKEKV+AKL EL++AI+GGSTQ+MKDA
Sbjct  599  EKRDAIDTKNQADSVVYQTEKQLKELGDKVPAPVKEKVDAKLNELKEAIAGGSTQSMKDA  658

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDGDVIDADFTDS  342
            MAALN+EVMQ+GQ++YNQ   +  AGPTPG  +   S       DGDVIDADFTDS
Sbjct  659  MAALNEEVMQIGQAMYNQQPNAGAAGPTPGADAGPTSSGGKGPNDGDVIDADFTDS  714



>gb|AFW67931.1| hypothetical protein ZEAMMB73_095591 [Zea mays]
Length=375

 Score =   251 bits (640),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 135/178 (76%), Positives = 151/178 (85%), Gaps = 1/178 (1%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLP DEVERMV EAE+FA+EDK
Sbjct  198  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPKDEVERMVDEAEKFAKEDK  257

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRDAIDTKNQA+SV+YQTEKQLKELG+KVPG VK KVE+KL EL+DA++GGSTQ MKDA
Sbjct  258  EKRDAIDTKNQAESVIYQTEKQLKELGDKVPGDVKGKVESKLQELKDAVAGGSTQTMKDA  317

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkg-PDGDVIDADFTDSK  339
            ++ALNQEVMQ+GQSLY+Q  A           +   + +S K   DGDVIDADFTDSK
Sbjct  318  ISALNQEVMQIGQSLYSQQGAPGAGPGPADASAGSAAGTSEKPGDDGDVIDADFTDSK  375



>gb|ABA81894.1| heak shock protein 70 [Aquilegia formosa]
Length=182

 Score =   244 bits (622),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 123/138 (89%), Positives = 130/138 (94%), Gaps = 0/138 (0%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSVTA+DK TGKK DITITGASTLPSDEVERMV+E   FA+EDK
Sbjct  20   GVPQIEVKFDIDANGILSVTALDKRTGKKXDITITGASTLPSDEVERMVNEXXXFAKEDK  79

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRDAIDTKNQADSVVYQTEKQLKELGEKVP  VKEKVE+KLGEL++AISGGSTQ +KDA
Sbjct  80   EKRDAIDTKNQADSVVYQTEKQLKELGEKVPAAVKEKVESKLGELKEAISGGSTQTIKDA  139

Query  509  MAALNQEVMQLGQSLYNQ  456
            MAALNQEVMQLGQSLYNQ
Sbjct  140  MAALNQEVMQLGQSLYNQ  157



>ref|XP_007213617.1| hypothetical protein PRUPE_ppa002222mg [Prunus persica]
 gb|EMJ14816.1| hypothetical protein PRUPE_ppa002222mg [Prunus persica]
Length=699

 Score =   259 bits (661),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 145/182 (80%), Positives = 155/182 (85%), Gaps = 5/182 (3%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSV AVDKGTGKKQDITITGASTLPSDEVERMVSEAERFA+EDK
Sbjct  518  GVPQIEVKFDIDANGILSVAAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAKEDK  577

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKR+AIDTKNQADSVVYQTEKQLKELG+KVP  VKEKVEAKLGEL+++++GGSTQA+KDA
Sbjct  578  EKREAIDTKNQADSVVYQTEKQLKELGDKVPAEVKEKVEAKLGELKESVAGGSTQAIKDA  637

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsag-----psessgkgPDGDVIDADFTD  345
            + ALNQEVMQLGQSLYNQP A                      SSGKGPDGDVIDADFTD
Sbjct  638  ITALNQEVMQLGQSLYNQPGAPGAGAGAGPTPPGAEAGGPSESSSGKGPDGDVIDADFTD  697

Query  344  SK  339
            SK
Sbjct  698  SK  699



>ref|XP_008361671.1| PREDICTED: stromal 70 kDa heat shock-related protein, chloroplastic-like 
[Malus domestica]
Length=695

 Score =   259 bits (661),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 146/180 (81%), Positives = 155/180 (86%), Gaps = 3/180 (2%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSV AVDKGTGKKQDITITGASTLPSDEVERMV+EAE+FA+EDK
Sbjct  516  GVPQIEVKFDIDANGILSVAAVDKGTGKKQDITITGASTLPSDEVERMVNEAEKFAKEDK  575

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRDAIDTKNQADSV+YQTEKQLKELG+KVP  VK KVEAKLGEL+DA+SGGSTQA+KD 
Sbjct  576  EKRDAIDTKNQADSVIYQTEKQLKELGDKVPAEVKGKVEAKLGELKDAVSGGSTQAIKDG  635

Query  509  MAALNQEVMQLGQSLYNQpsas---pgagptpgggsagpsessgkgPDGDVIDADFTDSK  339
            +AALNQEVMQLGQSLYNQP       G  P           SSGKGPDGDVIDADFTDSK
Sbjct  636  IAALNQEVMQLGQSLYNQPGTPGAGAGPTPPGSEAGGSSDSSSGKGPDGDVIDADFTDSK  695



>ref|XP_004307167.1| PREDICTED: stromal 70 kDa heat shock-related protein, chloroplastic-like 
[Fragaria vesca subsp. vesca]
Length=701

 Score =   259 bits (661),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 147/181 (81%), Positives = 159/181 (88%), Gaps = 4/181 (2%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSV A+DKGTGK+QDITITGASTLP+DEV+RMV+EAE+FA+EDK
Sbjct  521  GVPQIEVKFDIDANGILSVAAIDKGTGKQQDITITGASTLPNDEVQRMVNEAEKFAKEDK  580

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRDAIDTKNQADSVVYQTEKQLKELGEKVP PVKEKVEAKLGEL++AISGGSTQ +KDA
Sbjct  581  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPAPVKEKVEAKLGELKEAISGGSTQVIKDA  640

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgg----gsagpsessgkgPDGDVIDADFTDS  342
            MAALNQEVMQLGQSLYNQP A              G +  S SSGKGP+GDVIDADFTDS
Sbjct  641  MAALNQEVMQLGQSLYNQPGAPGAGAGPTPPGAEDGPSESSSSSGKGPEGDVIDADFTDS  700

Query  341  K  339
            K
Sbjct  701  K  701



>ref|XP_008339404.1| PREDICTED: stromal 70 kDa heat shock-related protein, chloroplastic-like 
[Malus domestica]
 ref|XP_008368181.1| PREDICTED: stromal 70 kDa heat shock-related protein, chloroplastic-like 
[Malus domestica]
Length=695

 Score =   259 bits (661),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 146/180 (81%), Positives = 155/180 (86%), Gaps = 3/180 (2%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSV AVDKGTGKKQDITITGASTLPSDEVERMV+EAE+FA+EDK
Sbjct  516  GVPQIEVKFDIDANGILSVAAVDKGTGKKQDITITGASTLPSDEVERMVNEAEKFAKEDK  575

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRDAIDTKNQADSV+YQTEKQLKELG+KVP  VK KVEAKLGEL+DA+SGGSTQA+KD 
Sbjct  576  EKRDAIDTKNQADSVIYQTEKQLKELGDKVPAEVKGKVEAKLGELKDAVSGGSTQAIKDG  635

Query  509  MAALNQEVMQLGQSLYNQpsas---pgagptpgggsagpsessgkgPDGDVIDADFTDSK  339
            +AALNQEVMQLGQSLYNQP       G  P           SSGKGPDGDVIDADFTDSK
Sbjct  636  IAALNQEVMQLGQSLYNQPGTPGAGAGPTPPGSEAGGSSDSSSGKGPDGDVIDADFTDSK  695



>dbj|BAJ88928.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=288

 Score =   247 bits (631),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 134/176 (76%), Positives = 147/176 (84%), Gaps = 0/176 (0%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSV AVDKGTGKKQDITITGASTLP DEVE+MV EAE+FA EDK
Sbjct  112  GVPQIEVKFDIDANGILSVAAVDKGTGKKQDITITGASTLPKDEVEKMVEEAEKFAAEDK  171

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRDAIDTKNQA+SV+YQTEKQLKELG+KVPG VKEKVE KL EL+DA++GGST+ +KDA
Sbjct  172  EKRDAIDTKNQAESVIYQTEKQLKELGDKVPGDVKEKVEGKLKELQDAVAGGSTETIKDA  231

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDGDVIDADFTDS  342
            +AALNQEVMQLGQSLY Q  + P  G    G +     S   G  GDVIDADFTDS
Sbjct  232  LAALNQEVMQLGQSLYQQQGSGPTPGAGADGTADSAGPSEKTGDGGDVIDADFTDS  287



>sp|Q08080.1|HSP7S_SPIOL RecName: Full=Stromal 70 kDa heat shock-related protein, chloroplastic, 
partial [Spinacia oleracea]
 gb|AAA18570.1| 80 kDa heat shock protein, partial [Spinacia oleracea]
Length=599

 Score =   256 bits (653),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 126/138 (91%), Positives = 134/138 (97%), Gaps = 0/138 (0%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQ+EVKFDIDANGILSVTA+DKGTGKKQDITITGASTLP DEVERMVSEAE+FA+EDK
Sbjct  409  GVPQVEVKFDIDANGILSVTAIDKGTGKKQDITITGASTLPGDEVERMVSEAEKFAKEDK  468

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKR+ IDTKNQADSVVYQTEKQLKELGEKVP PVKEKVEAKLGEL+DAI+GG TQA+KDA
Sbjct  469  EKREVIDTKNQADSVVYQTEKQLKELGEKVPVPVKEKVEAKLGELKDAINGGETQAIKDA  528

Query  509  MAALNQEVMQLGQSLYNQ  456
            MAALNQEVMQLGQSLYNQ
Sbjct  529  MAALNQEVMQLGQSLYNQ  546



>ref|XP_009404263.1| PREDICTED: stromal 70 kDa heat shock-related protein, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=701

 Score =   258 bits (658),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 135/177 (76%), Positives = 151/177 (85%), Gaps = 0/177 (0%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMV EAE++A+EDK
Sbjct  525  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVKEAEKYAKEDK  584

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKR+AIDTKNQ++SV+YQTEKQLKELG+KVP  VKEKVEAKL EL+DA++GGSTQ+MKDA
Sbjct  585  EKREAIDTKNQSESVIYQTEKQLKELGDKVPASVKEKVEAKLKELKDAVAGGSTQSMKDA  644

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDGDVIDADFTDSK  339
            M  LNQEVMQLGQSLYNQP A+     +  G  +          +GDVIDADFTDSK
Sbjct  645  MTTLNQEVMQLGQSLYNQPGAAGAGPASADGAGSSAESPGKGPDNGDVIDADFTDSK  701



>dbj|BAJ84945.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=323

 Score =   247 bits (631),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 134/176 (76%), Positives = 147/176 (84%), Gaps = 0/176 (0%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSV AVDKGTGKKQDITITGASTLP DEVE+MV EAE+FA EDK
Sbjct  147  GVPQIEVKFDIDANGILSVAAVDKGTGKKQDITITGASTLPKDEVEKMVEEAEKFAAEDK  206

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRDAIDTKNQA+SV+YQTEKQLKELG+KVPG VKEKVE KL EL+DA++GGST+ +KDA
Sbjct  207  EKRDAIDTKNQAESVIYQTEKQLKELGDKVPGDVKEKVEGKLKELQDAVAGGSTETIKDA  266

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDGDVIDADFTDS  342
            +AALNQEVMQLGQSLY Q  + P  G    G +     S   G  GDVIDADFTDS
Sbjct  267  LAALNQEVMQLGQSLYQQQGSGPTPGAGADGTADSAGPSEKTGDGGDVIDADFTDS  322



>ref|XP_002442079.1| hypothetical protein SORBIDRAFT_08g009580 [Sorghum bicolor]
 gb|EES15917.1| hypothetical protein SORBIDRAFT_08g009580 [Sorghum bicolor]
Length=702

 Score =   257 bits (656),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 139/176 (79%), Positives = 153/176 (87%), Gaps = 1/176 (1%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSV A+DKGTGKKQDITITGASTLP DEVERMV EA++FA+EDK
Sbjct  527  GVPQIEVKFDIDANGILSVAAIDKGTGKKQDITITGASTLPKDEVERMVEEADKFAKEDK  586

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRDAIDTKNQADSVVYQTEKQLKELG+KVP PVKEKV+ KL EL+DAISGGSTQ+MKDA
Sbjct  587  EKRDAIDTKNQADSVVYQTEKQLKELGDKVPAPVKEKVDVKLQELKDAISGGSTQSMKDA  646

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDGDVIDADFTDS  342
            MAALNQEVMQ+GQ++YNQ   +  AGPTPG  +     +     DGDVIDADFTDS
Sbjct  647  MAALNQEVMQIGQAMYNQ-PGASAAGPTPGAEAGPTPGTGPAQNDGDVIDADFTDS  701



>gb|AFW56459.1| stromal heat shock protein [Zea mays]
Length=703

 Score =   257 bits (656),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 139/176 (79%), Positives = 153/176 (87%), Gaps = 1/176 (1%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSV A+DKGTGKKQDITITGASTLP DEVERMV EA++FA+EDK
Sbjct  528  GVPQIEVKFDIDANGILSVAAIDKGTGKKQDITITGASTLPKDEVERMVEEADKFAKEDK  587

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRDAIDTKNQADSVVYQTEKQLKELG+KVP PVKEKV+ KL EL+DAISGGSTQ+MKDA
Sbjct  588  EKRDAIDTKNQADSVVYQTEKQLKELGDKVPAPVKEKVDVKLQELKDAISGGSTQSMKDA  647

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDGDVIDADFTDS  342
            MAALNQEVMQ+GQ++YNQ   +  AGPTPG  +     +     DGDVIDADFTDS
Sbjct  648  MAALNQEVMQIGQAMYNQ-PGASAAGPTPGAEAGPTPGTGPTQNDGDVIDADFTDS  702



>ref|NP_001152528.1| stromal 70 kDa heat shock-related protein [Zea mays]
 gb|ACG48046.1| stromal 70 kDa heat shock-related protein [Zea mays]
Length=703

 Score =   257 bits (656),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 139/176 (79%), Positives = 153/176 (87%), Gaps = 1/176 (1%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSV A+DKGTGKKQDITITGASTLP DEVERMV EA++FA+EDK
Sbjct  528  GVPQIEVKFDIDANGILSVAAIDKGTGKKQDITITGASTLPKDEVERMVEEADKFAKEDK  587

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRDAIDTKNQADSVVYQTEKQLKELG+KVP PVKEKV+ KL EL+DAISGGSTQ+MKDA
Sbjct  588  EKRDAIDTKNQADSVVYQTEKQLKELGDKVPAPVKEKVDVKLQELKDAISGGSTQSMKDA  647

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDGDVIDADFTDS  342
            MAALNQEVMQ+GQ++YNQ   +  AGPTPG  +     +     DGDVIDADFTDS
Sbjct  648  MAALNQEVMQIGQAMYNQ-PGASAAGPTPGAEAGPTPGTGPTQNDGDVIDADFTDS  702



>ref|XP_004960697.1| PREDICTED: stromal 70 kDa heat shock-related protein, chloroplastic-like 
[Setaria italica]
Length=702

 Score =   256 bits (653),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 136/176 (77%), Positives = 150/176 (85%), Gaps = 1/176 (1%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSV A+DKGTGKKQDITITGASTLP DEVERMV EA++FA+EDK
Sbjct  527  GVPQIEVKFDIDANGILSVAAIDKGTGKKQDITITGASTLPKDEVERMVEEADKFAKEDK  586

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRDAIDTKNQADSVVYQTEKQLKELG+KVP PVKEKV+ KL EL+DAISGGSTQ MKDA
Sbjct  587  EKRDAIDTKNQADSVVYQTEKQLKELGDKVPAPVKEKVDVKLQELKDAISGGSTQGMKDA  646

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDGDVIDADFTDS  342
            MAALNQEVMQ+GQ++YNQ   + G+ P    G    +  +    DGDVIDADFTDS
Sbjct  647  MAALNQEVMQIGQAMYNQ-PGAAGSTPDAEAGPTPGAGPAKGPNDGDVIDADFTDS  701



>emb|CDP16490.1| unnamed protein product [Coffea canephora]
Length=564

 Score =   252 bits (644),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 140/178 (79%), Positives = 157/178 (88%), Gaps = 1/178 (1%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLP DEV++MV EAE+FA+EDK
Sbjct  387  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPKDEVDKMVQEAEKFAKEDK  446

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKR+AIDTKNQADS++YQTEKQLKELGEKVP  VKEKVEAKL EL+DA+SGGSTQA+KDA
Sbjct  447  EKREAIDTKNQADSIIYQTEKQLKELGEKVPAAVKEKVEAKLTELKDAVSGGSTQAIKDA  506

Query  509  MAALNQEVMQLGQSLYNQp-saspgagptpgggsagpsessgkgPDGDVIDADFTDSK  339
            MAALNQEVMQLGQSLY+QP +   G  P    G++G +  S  G DGDVIDADF++SK
Sbjct  507  MAALNQEVMQLGQSLYSQPGTPGDGPTPGADAGASGSTGKSSGGDDGDVIDADFSESK  564



>ref|XP_006664462.1| PREDICTED: stromal 70 kDa heat shock-related protein, chloroplastic-like 
[Oryza brachyantha]
Length=733

 Score =   256 bits (653),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 139/180 (77%), Positives = 153/180 (85%), Gaps = 4/180 (2%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSV A+DKGTGKKQDITITGASTLP DEVERMV EA++FAQEDK
Sbjct  553  GVPQIEVKFDIDANGILSVAAIDKGTGKKQDITITGASTLPKDEVERMVEEADKFAQEDK  612

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRDAIDTKNQADSVVYQTEKQLKELG+KVP PVKEKV+AKL ELR+AI+GGSTQ MKDA
Sbjct  613  EKRDAIDTKNQADSVVYQTEKQLKELGDKVPAPVKEKVDAKLNELREAIAGGSTQNMKDA  672

Query  509  MAALNQEVMQLGQSLYNQpsaspgagpt----pgggsagpsessgkgPDGDVIDADFTDS  342
            MAALN+EVMQ+GQ++YNQ   +  AGPT       G+   S  +    DGDVIDADFTDS
Sbjct  673  MAALNEEVMQIGQAMYNQQPNAGAAGPTPGADADAGAGPTSSGAKGPNDGDVIDADFTDS  732



>gb|KDO44469.1| hypothetical protein CISIN_1g005099mg [Citrus sinensis]
Length=714

 Score =   255 bits (652),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 145/178 (81%), Positives = 154/178 (87%), Gaps = 1/178 (1%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSV+AVDKGTGKKQDITITGASTLP+DEV+RMV EAERFA+EDK
Sbjct  537  GVPQIEVKFDIDANGILSVSAVDKGTGKKQDITITGASTLPNDEVQRMVQEAERFAKEDK  596

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRDAIDTKNQADSVVYQTEKQLKELG+KVP  VK KVE KL EL+DAI+ GSTQAMKD 
Sbjct  597  EKRDAIDTKNQADSVVYQTEKQLKELGDKVPAEVKGKVEGKLKELKDAIAEGSTQAMKDT  656

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpse-ssgkgPDGDVIDADFTDSK  339
            MAALNQEVMQLGQSLYNQP A    G  P  G+   +  SS KG DGDVIDADFTDSK
Sbjct  657  MAALNQEVMQLGQSLYNQPGAGAAPGAGPTPGAEAGASDSSNKGQDGDVIDADFTDSK  714



>emb|CBI39294.3| unnamed protein product [Vitis vinifera]
Length=558

 Score =   251 bits (642),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 142/178 (80%), Positives = 154/178 (87%), Gaps = 7/178 (4%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLP+DEV+RMV EAE+FA+EDK
Sbjct  387  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPNDEVDRMVKEAEKFAKEDK  446

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGS-TQAMKD  513
            EKRDAIDTKNQADSVVYQTEKQLKELG+KVP PVK KVEAKL EL+DAIS GS TQ +KD
Sbjct  447  EKRDAIDTKNQADSVVYQTEKQLKELGDKVPAPVKGKVEAKLKELKDAISSGSTTQTIKD  506

Query  512  AMAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDGDVIDADFTDSK  339
            AMAALNQEVMQ+GQSLY+Q      AG    G  AG + S+   PDGDVIDADFT+SK
Sbjct  507  AMAALNQEVMQIGQSLYSQ------AGAPGAGAGAGAAGSTDSKPDGDVIDADFTESK  558



>ref|XP_006492569.1| PREDICTED: heat shock 70 kDa protein 6, chloroplastic-like [Citrus 
sinensis]
Length=714

 Score =   254 bits (650),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 145/178 (81%), Positives = 154/178 (87%), Gaps = 1/178 (1%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSV+AVDKGTGKKQDITITGASTLP+DEV+RMV EAERFA+EDK
Sbjct  537  GVPQIEVKFDIDANGILSVSAVDKGTGKKQDITITGASTLPNDEVQRMVQEAERFAKEDK  596

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRDAIDTKNQADSVVYQTEKQLKELG+KVP  VK KVE KL EL+DAI+ GSTQAMKD 
Sbjct  597  EKRDAIDTKNQADSVVYQTEKQLKELGDKVPAEVKGKVEGKLKELKDAIAEGSTQAMKDT  656

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpse-ssgkgPDGDVIDADFTDSK  339
            MAALNQEVMQLGQSLYNQP A    G  P  G+   +  SS KG DGDVIDADFTDSK
Sbjct  657  MAALNQEVMQLGQSLYNQPGAGAAPGAGPTPGAEAGASDSSNKGQDGDVIDADFTDSK  714



>ref|XP_010533213.1| PREDICTED: heat shock 70 kDa protein 6, chloroplastic-like [Tarenaya 
hassleriana]
Length=710

 Score =   254 bits (649),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 144/177 (81%), Positives = 155/177 (88%), Gaps = 2/177 (1%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLP DEV++MV EAERFA+EDK
Sbjct  536  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPKDEVDKMVQEAERFAKEDK  595

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRDAIDTKNQA+SVVYQTEKQLK+LGEKVPGPVKEKVEAKL EL+D I+ GSTQ +KDA
Sbjct  596  EKRDAIDTKNQAESVVYQTEKQLKDLGEKVPGPVKEKVEAKLQELKDKIASGSTQDIKDA  655

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDGDVIDADFTDSK  339
            MAALNQEVMQ+GQSLYNQ    P       GGS   S SSGKG +GDVIDADFTD+K
Sbjct  656  MAALNQEVMQIGQSLYNQ--PGPSGTGPEAGGSPSESSSSGKGTEGDVIDADFTDTK  710



>ref|XP_006431617.1| hypothetical protein CICLE_v10000433mg [Citrus clementina]
 gb|ESR44857.1| hypothetical protein CICLE_v10000433mg [Citrus clementina]
Length=714

 Score =   254 bits (648),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 144/178 (81%), Positives = 154/178 (87%), Gaps = 1/178 (1%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSV+AVDKGTGKKQDITITGASTLP+DEV+RMV EAERFA+EDK
Sbjct  537  GVPQIEVKFDIDANGILSVSAVDKGTGKKQDITITGASTLPNDEVQRMVQEAERFAKEDK  596

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRDAIDTKNQADSVVYQTEKQLKELG+KVP  VK KVE KL EL+DAI+ GSTQAMKD 
Sbjct  597  EKRDAIDTKNQADSVVYQTEKQLKELGDKVPAEVKGKVEGKLKELKDAIAEGSTQAMKDT  656

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpse-ssgkgPDGDVIDADFTDSK  339
            M+ALNQEVMQLGQSLYNQP A    G  P  G+   +  SS KG DGDVIDADFTDSK
Sbjct  657  MSALNQEVMQLGQSLYNQPGAGAAPGAGPTPGAEAGASDSSNKGQDGDVIDADFTDSK  714



>gb|ADD23344.1| 70 kDa heat shock protein [Triticum aestivum]
Length=690

 Score =   253 bits (646),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 138/177 (78%), Positives = 150/177 (85%), Gaps = 1/177 (1%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSV AVDKGTGKKQDITITGASTLP DEVERMV EA++FAQEDK
Sbjct  513  GVPQIEVKFDIDANGILSVAAVDKGTGKKQDITITGASTLPKDEVERMVEEADKFAQEDK  572

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRDAIDTKNQADSVVYQTEKQLKELG+KVP PVKEKV+ KL EL+DAI+GGSTQ+MK A
Sbjct  573  EKRDAIDTKNQADSVVYQTEKQLKELGDKVPAPVKEKVDVKLQELKDAIAGGSTQSMKTA  632

Query  509  MAALNQEVMQLGQSLYNQpsas-pgagptpgggsagpsessgkgPDGDVIDADFTDS  342
            M ALNQEVMQ+GQ++YNQ SA   G+        AG + S     DGDVIDADFTDS
Sbjct  633  MEALNQEVMQIGQAMYNQTSAGDAGSTDAETEPGAGSTSSGKGPNDGDVIDADFTDS  689



>ref|XP_004962155.1| PREDICTED: stromal 70 kDa heat shock-related protein, chloroplastic-like 
[Setaria italica]
Length=680

 Score =   253 bits (645),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 136/177 (77%), Positives = 148/177 (84%), Gaps = 2/177 (1%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLP DEVERMV EAE+FA+EDK
Sbjct  506  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPKDEVERMVDEAEKFAKEDK  565

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRDAIDTKNQA+SV+YQTEKQLKELG+KVPG VK KVEAKL EL+DA++GGSTQ MKDA
Sbjct  566  EKRDAIDTKNQAESVIYQTEKQLKELGDKVPGDVKGKVEAKLQELKDAVAGGSTQTMKDA  625

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDGDVIDADFTDSK  339
            ++ALNQEVMQLGQSLY+Q            G  A    S     +GDVIDADFTDSK
Sbjct  626  LSALNQEVMQLGQSLYSQ--QGAPGAGPTPGADASAGSSEKPADEGDVIDADFTDSK  680



>dbj|BAJ90336.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ95763.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=692

 Score =   253 bits (645),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 134/179 (75%), Positives = 147/179 (82%), Gaps = 3/179 (2%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSV AVDKGTGKKQDITITGASTLP DEVERMV EA++FAQEDK
Sbjct  513  GVPQIEVKFDIDANGILSVAAVDKGTGKKQDITITGASTLPKDEVERMVEEADKFAQEDK  572

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRDAIDTKNQADSVVYQTEKQLKELG+KVP PVKEKV+ KL EL+DAI+GGSTQ+MK +
Sbjct  573  EKRDAIDTKNQADSVVYQTEKQLKELGDKVPAPVKEKVDVKLQELKDAIAGGSTQSMKTS  632

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgk---gPDGDVIDADFTDS  342
            M ALNQEVMQ+GQ++YNQ SA               + S+       DGDVIDADFTDS
Sbjct  633  MEALNQEVMQIGQAMYNQTSAGGAGSTDAEAEPTPSAGSTSSGKGPNDGDVIDADFTDS  691



>ref|NP_001055140.1| Os05g0303000 [Oryza sativa Japonica Group]
 dbj|BAF17054.1| Os05g0303000, partial [Oryza sativa Japonica Group]
Length=459

 Score =   247 bits (630),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 135/179 (75%), Positives = 152/179 (85%), Gaps = 2/179 (1%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSV+AVDKGTGKKQDITITGASTLP DEVE+MV EAE+FA+EDK
Sbjct  281  GVPQIEVKFDIDANGILSVSAVDKGTGKKQDITITGASTLPKDEVEKMVEEAEKFAKEDK  340

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRDAIDTKNQA+SV+YQTEKQLKELG+KVPG VK KVEAKL EL+DA++GGSTQ MKDA
Sbjct  341  EKRDAIDTKNQAESVIYQTEKQLKELGDKVPGDVKGKVEAKLTELKDAVAGGSTQTMKDA  400

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkg--PDGDVIDADFTDSK  339
            +AALNQEVMQLGQ+LY+Q  A           +AG +  S K    +GDVIDADFTDS+
Sbjct  401  LAALNQEVMQLGQALYSQQGAPGAGPTPGADAAAGSAGPSEKPGGEEGDVIDADFTDSQ  459



>ref|XP_009416635.1| PREDICTED: stromal 70 kDa heat shock-related protein, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=711

 Score =   253 bits (645),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 137/183 (75%), Positives = 152/183 (83%), Gaps = 7/183 (4%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLP+DEVERMV EAE+FA+EDK
Sbjct  528  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPTDEVERMVKEAEKFAKEDK  587

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRDAIDTKNQ++SV+YQTEKQLKELG+KVP  VKEKVE KL +L+DA++GGSTQ+MKDA
Sbjct  588  EKRDAIDTKNQSESVIYQTEKQLKELGDKVPAAVKEKVEGKLKDLKDAVAGGSTQSMKDA  647

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpggg-------sagpsessgkgPDGDVIDADF  351
            MAALNQEVMQLGQSLYNQP A+        G        +     SS    +GDVIDADF
Sbjct  648  MAALNQEVMQLGQSLYNQPGAAGAGPGAGAGSGPAPGADAGSSGPSSKGSENGDVIDADF  707

Query  350  TDS  342
            TDS
Sbjct  708  TDS  710



>emb|CAN78265.1| hypothetical protein VITISV_006707 [Vitis vinifera]
Length=645

 Score =   251 bits (642),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 142/178 (80%), Positives = 154/178 (87%), Gaps = 7/178 (4%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLP+DEV+RMV EAE+FA+EDK
Sbjct  474  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPNDEVDRMVKEAEKFAKEDK  533

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGS-TQAMKD  513
            EKRDAIDTKNQADSVVYQTEKQLKELG+KVP PVK KVEAKL EL+DAIS GS TQ +KD
Sbjct  534  EKRDAIDTKNQADSVVYQTEKQLKELGDKVPAPVKGKVEAKLKELKDAISSGSTTQTIKD  593

Query  512  AMAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDGDVIDADFTDSK  339
            AMAALNQEVMQ+GQSLY+Q      AG    G  AG + S+   PDGDVIDADFT+SK
Sbjct  594  AMAALNQEVMQIGQSLYSQ------AGAPGAGAGAGAAGSTDSKPDGDVIDADFTESK  645



>gb|ACT65562.1| 70 kDa heat shock protein [Triticum aestivum]
Length=690

 Score =   252 bits (644),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 137/177 (77%), Positives = 147/177 (83%), Gaps = 1/177 (1%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSV AVDKGTGKKQDITITGASTLP DEVERMV EA++FAQEDK
Sbjct  513  GVPQIEVKFDIDANGILSVAAVDKGTGKKQDITITGASTLPKDEVERMVEEADKFAQEDK  572

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRDAIDTKNQADSVVYQTEKQLKELG+KVP PVKEKV+ KL EL+DAI+GGSTQ MK A
Sbjct  573  EKRDAIDTKNQADSVVYQTEKQLKELGDKVPAPVKEKVDVKLQELKDAIAGGSTQNMKTA  632

Query  509  MAALNQEVMQLGQSLYNQpsaspgagp-tpgggsagpsessgkgPDGDVIDADFTDS  342
            M ALNQEVMQ+GQ++YNQ SA             AG + S     DGDVIDADFTDS
Sbjct  633  MEALNQEVMQIGQAMYNQTSAGGAGSTDAETEPGAGSTSSGKGPNDGDVIDADFTDS  689



>ref|XP_006492570.1| PREDICTED: heat shock 70 kDa protein 6, chloroplastic-like [Citrus 
sinensis]
Length=710

 Score =   253 bits (645),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 144/177 (81%), Positives = 154/177 (87%), Gaps = 5/177 (3%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSVTAVDKG+GKKQDITITGASTLPSDEVERMV EAE+FA+EDK
Sbjct  539  GVPQIEVKFDIDANGILSVTAVDKGSGKKQDITITGASTLPSDEVERMVKEAEKFAKEDK  598

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            E+RDAIDTKNQADS+VYQTEKQLKELGEKVP PVKEKVE KL +L+D+IS  STQ MKDA
Sbjct  599  ERRDAIDTKNQADSLVYQTEKQLKELGEKVPAPVKEKVEGKLQDLKDSISEESTQKMKDA  658

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDGDVIDADFTDSK  339
            MAALNQEVMQLGQSLYNQ            G  AGPS+SS KGPD DVIDADF+DSK
Sbjct  659  MAALNQEVMQLGQSLYNQ-----PGAGPAPGAEAGPSDSSNKGPDSDVIDADFSDSK  710



>ref|XP_002282802.1| PREDICTED: stromal 70 kDa heat shock-related protein, chloroplastic-like 
[Vitis vinifera]
Length=690

 Score =   251 bits (642),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 142/178 (80%), Positives = 154/178 (87%), Gaps = 7/178 (4%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLP+DEV+RMV EAE+FA+EDK
Sbjct  519  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPNDEVDRMVKEAEKFAKEDK  578

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGS-TQAMKD  513
            EKRDAIDTKNQADSVVYQTEKQLKELG+KVP PVK KVEAKL EL+DAIS GS TQ +KD
Sbjct  579  EKRDAIDTKNQADSVVYQTEKQLKELGDKVPAPVKGKVEAKLKELKDAISSGSTTQTIKD  638

Query  512  AMAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDGDVIDADFTDSK  339
            AMAALNQEVMQ+GQSLY+Q      AG    G  AG + S+   PDGDVIDADFT+SK
Sbjct  639  AMAALNQEVMQIGQSLYSQ------AGAPGAGAGAGAAGSTDSKPDGDVIDADFTESK  690



>dbj|BAD22699.1| heat shock protein 70 [Nicotiana benthamiana]
Length=247

 Score =   239 bits (609),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 128/173 (74%), Positives = 141/173 (82%), Gaps = 5/173 (3%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSVTA DKGTGKKQDITITGASTLP DEV+RMV EAE+FA+EDK
Sbjct  63   GVPQIEVKFDIDANGILSVTATDKGTGKKQDITITGASTLPKDEVDRMVQEAEKFAKEDK  122

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRD+IDTKNQA+SVVYQTEKQLKELG+KVP  VK+KVE+KL EL+DAISGGSTQ +KD 
Sbjct  123  EKRDSIDTKNQAESVVYQTEKQLKELGDKVPADVKDKVESKLRELKDAISGGSTQTIKDT  182

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDGDVIDADF  351
            MAALNQEVMQLGQSLY+Q            G +           DG+VIDADF
Sbjct  183  MAALNQEVMQLGQSLYSQ-----PDAAAGPGPAGASGSRGKDDGDGEVIDADF  230



>ref|XP_009406395.1| PREDICTED: stromal 70 kDa heat shock-related protein, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=703

 Score =   251 bits (642),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 137/177 (77%), Positives = 153/177 (86%), Gaps = 1/177 (1%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEV+RMV EAE+FA+EDK
Sbjct  528  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVDRMVKEAEKFAKEDK  587

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRD IDTKNQ++SV+YQTEKQLKELG+KVP  VKEKVEAKL +L+DA++GGSTQ+MKD 
Sbjct  588  EKRDDIDTKNQSESVIYQTEKQLKELGDKVPAEVKEKVEAKLKDLKDAVAGGSTQSMKDT  647

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDGDVIDADFTDSK  339
            MAALNQEVMQLGQSLYNQ   + G G  PG  +     S+    +GDVIDADFTDSK
Sbjct  648  MAALNQEVMQLGQSLYNQ-PGAAGPGSAPGADAGSAGPSTKGPDNGDVIDADFTDSK  703



>ref|NP_001146752.1| uncharacterized protein LOC100280354 [Zea mays]
 gb|ACL54679.1| unknown [Zea mays]
Length=622

 Score =   249 bits (637),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 137/178 (77%), Positives = 153/178 (86%), Gaps = 1/178 (1%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSV+AVDKGTGKKQDITITGASTLP DEVERMV EAE+FA+EDK
Sbjct  445  GVPQIEVKFDIDANGILSVSAVDKGTGKKQDITITGASTLPKDEVERMVGEAEKFAKEDK  504

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRDAIDTKNQA+SV+YQTEKQLKELG+KVPG VK KVE+KL EL+DA++GGSTQ MKDA
Sbjct  505  EKRDAIDTKNQAESVIYQTEKQLKELGDKVPGDVKGKVESKLQELKDAVAGGSTQTMKDA  564

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPD-GDVIDADFTDSK  339
            M+ALNQEVMQ+GQ+LY+Q  A           SAG + +S K  D GDVIDADFTDSK
Sbjct  565  MSALNQEVMQIGQALYSQQGAPGAGPGAADASSAGSAGTSEKPGDGGDVIDADFTDSK  622



>ref|XP_008644594.1| PREDICTED: stromal 70 kDa heat shock-related protein, chloroplastic-like 
[Zea mays]
 gb|AFW67932.1| hypothetical protein ZEAMMB73_095591 [Zea mays]
Length=683

 Score =   251 bits (640),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 135/178 (76%), Positives = 151/178 (85%), Gaps = 1/178 (1%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLP DEVERMV EAE+FA+EDK
Sbjct  506  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPKDEVERMVDEAEKFAKEDK  565

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRDAIDTKNQA+SV+YQTEKQLKELG+KVPG VK KVE+KL EL+DA++GGSTQ MKDA
Sbjct  566  EKRDAIDTKNQAESVIYQTEKQLKELGDKVPGDVKGKVESKLQELKDAVAGGSTQTMKDA  625

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgP-DGDVIDADFTDSK  339
            ++ALNQEVMQ+GQSLY+Q  A           +   + +S K   DGDVIDADFTDSK
Sbjct  626  ISALNQEVMQIGQSLYSQQGAPGAGPGPADASAGSAAGTSEKPGDDGDVIDADFTDSK  683



>gb|EMT28145.1| Stromal 70 kDa heat shock-related protein, chloroplastic [Aegilops 
tauschii]
Length=752

 Score =   252 bits (643),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 137/177 (77%), Positives = 147/177 (83%), Gaps = 1/177 (1%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSV AVDKGTGKKQDITITGASTLP DEVERMV EA++FAQEDK
Sbjct  575  GVPQIEVKFDIDANGILSVAAVDKGTGKKQDITITGASTLPKDEVERMVEEADKFAQEDK  634

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRDAIDTKNQADSVVYQTEKQLKELG+KVP PVKEKV+ KL EL+DAI+GGSTQ MK A
Sbjct  635  EKRDAIDTKNQADSVVYQTEKQLKELGDKVPAPVKEKVDVKLQELKDAIAGGSTQNMKTA  694

Query  509  MAALNQEVMQLGQSLYNQpsaspgagp-tpgggsagpsessgkgPDGDVIDADFTDS  342
            M ALNQEVMQ+GQ++YNQ SA             AG + S     DGDVIDADFTDS
Sbjct  695  MEALNQEVMQIGQAMYNQTSAGGAGSTDAETEPGAGSTSSGKGPNDGDVIDADFTDS  751



>tpg|DAA50789.1| TPA: hypothetical protein ZEAMMB73_352617 [Zea mays]
 tpg|DAA50790.1| TPA: hypothetical protein ZEAMMB73_352617 [Zea mays]
Length=683

 Score =   250 bits (639),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 137/178 (77%), Positives = 153/178 (86%), Gaps = 1/178 (1%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSV+AVDKGTGKKQDITITGASTLP DEVERMV EAE+FA+EDK
Sbjct  506  GVPQIEVKFDIDANGILSVSAVDKGTGKKQDITITGASTLPKDEVERMVGEAEKFAKEDK  565

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRDAIDTKNQA+SV+YQTEKQLKELG+KVPG VK KVE+KL EL+DA++GGSTQ MKDA
Sbjct  566  EKRDAIDTKNQAESVIYQTEKQLKELGDKVPGDVKGKVESKLQELKDAVAGGSTQTMKDA  625

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPD-GDVIDADFTDSK  339
            M+ALNQEVMQ+GQ+LY+Q  A           SAG + +S K  D GDVIDADFTDSK
Sbjct  626  MSALNQEVMQIGQALYSQQGAPGAGPGAADASSAGSAGTSEKPGDGGDVIDADFTDSK  683



>emb|CDO97622.1| unnamed protein product [Coffea canephora]
Length=559

 Score =   246 bits (629),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 138/177 (78%), Positives = 151/177 (85%), Gaps = 4/177 (2%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSV AVDKG+GKKQDITITGASTLPSDEVERMV EAE+F++EDK
Sbjct  387  GVPQIEVKFDIDANGILSVAAVDKGSGKKQDITITGASTLPSDEVERMVKEAEKFSREDK  446

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRDAIDTKNQADS+VYQTEKQLKE G+KVP  VKE+VEAK+GEL+DAISG STQA+KDA
Sbjct  447  EKRDAIDTKNQADSIVYQTEKQLKEFGDKVPAAVKEQVEAKVGELKDAISGDSTQAIKDA  506

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDGDVIDADFTDSK  339
            MAALNQEVM+LG S+Y +    PG  P  G         SGKG DGDVIDADFTDSK
Sbjct  507  MAALNQEVMKLGSSVYGK----PGESPDAGAAPGTEPGPSGKGNDGDVIDADFTDSK  559



>ref|XP_006431615.1| hypothetical protein CICLE_v10003758mg, partial [Citrus clementina]
 gb|ESR44855.1| hypothetical protein CICLE_v10003758mg, partial [Citrus clementina]
Length=744

 Score =   250 bits (639),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 143/177 (81%), Positives = 153/177 (86%), Gaps = 5/177 (3%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSVTAVDKG+GKKQDI ITGASTLPSDEVERMV EAE+FA+EDK
Sbjct  573  GVPQIEVKFDIDANGILSVTAVDKGSGKKQDIIITGASTLPSDEVERMVKEAEKFAKEDK  632

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            E+RDAIDTKNQADS+VYQTEKQLKELGEKVP PVKEKVE KL +L+D+IS  STQ MKDA
Sbjct  633  ERRDAIDTKNQADSLVYQTEKQLKELGEKVPAPVKEKVEGKLQDLKDSISEESTQKMKDA  692

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDGDVIDADFTDSK  339
            MAALNQEVMQLGQSLYNQ            G  AGPS+SS KGPD DVIDADF+DSK
Sbjct  693  MAALNQEVMQLGQSLYNQ-----PGAGPAPGAEAGPSDSSNKGPDSDVIDADFSDSK  744



>ref|XP_010238578.1| PREDICTED: stromal 70 kDa heat shock-related protein, chloroplastic-like 
[Brachypodium distachyon]
Length=688

 Score =   249 bits (636),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 134/177 (76%), Positives = 145/177 (82%), Gaps = 1/177 (1%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSV AVDKGTGKKQDITITGASTLP DEVERMV EA++FAQEDK
Sbjct  511  GVPQIEVKFDIDANGILSVAAVDKGTGKKQDITITGASTLPKDEVERMVEEADKFAQEDK  570

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRDAIDTKNQADSVVYQTEKQLKELG+KVP PVKEKV+ KL EL+DAI+GGST  MK A
Sbjct  571  EKRDAIDTKNQADSVVYQTEKQLKELGDKVPAPVKEKVDVKLQELKDAIAGGSTPTMKAA  630

Query  509  MAALNQEVMQLGQSLYNQpsaspgagp-tpgggsagpsessgkgPDGDVIDADFTDS  342
            M ALNQEVMQ+GQ++YNQ S             + G   +   G DGDVIDADFTDS
Sbjct  631  MEALNQEVMQIGQAMYNQSSGGASGPTDAGAEPTPGAGPTGSSGNDGDVIDADFTDS  687



>gb|EAY97444.1| hypothetical protein OsI_19374 [Oryza sativa Indica Group]
Length=648

 Score =   248 bits (633),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 135/179 (75%), Positives = 152/179 (85%), Gaps = 2/179 (1%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSV+AVDKGTGKKQDITITGASTLP DEVE+MV EAE+FA+EDK
Sbjct  470  GVPQIEVKFDIDANGILSVSAVDKGTGKKQDITITGASTLPKDEVEKMVEEAEKFAKEDK  529

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRDAIDTKNQA+SV+YQTEKQLKELG+KVPG VK KVEAKL EL+DA++GGSTQ MKDA
Sbjct  530  EKRDAIDTKNQAESVIYQTEKQLKELGDKVPGDVKGKVEAKLTELKDAVAGGSTQTMKDA  589

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkg--PDGDVIDADFTDSK  339
            +AALNQEVMQLGQ+LY+Q  A           +AG +  S K    +GDVIDADFTDS+
Sbjct  590  LAALNQEVMQLGQALYSQQGAPGAGPTPGADAAAGSAGPSEKPGGEEGDVIDADFTDSQ  648



>gb|EMS50275.1| Stromal 70 kDa heat shock-related protein, chloroplastic [Triticum 
urartu]
Length=621

 Score =   247 bits (631),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 137/176 (78%), Positives = 149/176 (85%), Gaps = 0/176 (0%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSV AVDKGTGKKQDITITGASTLP DEVE+MV EAE+FA EDK
Sbjct  445  GVPQIEVKFDIDANGILSVAAVDKGTGKKQDITITGASTLPKDEVEKMVEEAEKFAAEDK  504

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRDAIDTKNQA+SV+YQTEKQLKELG+KVPG VKEKVE KL EL+DA++GGSTQ +KDA
Sbjct  505  EKRDAIDTKNQAESVMYQTEKQLKELGDKVPGDVKEKVEGKLKELQDAVAGGSTQTIKDA  564

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDGDVIDADFTDS  342
            +AALNQEVMQLGQSLY Q  + P  G      S GP  S+  G  GDVIDADFTDS
Sbjct  565  LAALNQEVMQLGQSLYQQQGSGPTPGADGAADSTGPGPSAKTGDGGDVIDADFTDS  620



>ref|XP_003568673.1| PREDICTED: stromal 70 kDa heat shock-related protein, chloroplastic-like 
[Brachypodium distachyon]
Length=684

 Score =   248 bits (634),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 136/177 (77%), Positives = 148/177 (84%), Gaps = 0/177 (0%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSV AVDKGTGKKQDITITGASTLP DEVE+MV EAE+FA EDK
Sbjct  508  GVPQIEVKFDIDANGILSVAAVDKGTGKKQDITITGASTLPKDEVEKMVEEAEKFAAEDK  567

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRDAIDTKNQA+SV+YQTEKQLKELG+KVPG VK KVE KL EL+DA++GG+TQ +KDA
Sbjct  568  EKRDAIDTKNQAESVIYQTEKQLKELGDKVPGEVKGKVEGKLVELKDAVAGGTTQTIKDA  627

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDGDVIDADFTDSK  339
            +AALNQEVMQLGQSLY Q  A        G G+A    S   G DGDVIDADFTDSK
Sbjct  628  LAALNQEVMQLGQSLYQQQGAPGAGPTPGGDGTADSGPSEKPGDDGDVIDADFTDSK  684



>ref|XP_002864020.1| cphsc70-2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH40279.1| cphsc70-2 [Arabidopsis lyrata subsp. lyrata]
Length=713

 Score =   249 bits (635),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 138/180 (77%), Positives = 147/180 (82%), Gaps = 3/180 (2%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSV+A DKGTGKKQDITITGASTLP DEV+ MV EAERFA+EDK
Sbjct  534  GVPQIEVKFDIDANGILSVSASDKGTGKKQDITITGASTLPKDEVDTMVQEAERFAKEDK  593

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRDAIDTKNQADSVVYQTEKQLKELGEK+PGPVKEKVEAKL EL++ I  GSTQ +KD 
Sbjct  594  EKRDAIDTKNQADSVVYQTEKQLKELGEKIPGPVKEKVEAKLQELKEKIGSGSTQEIKDT  653

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkg---PDGDVIDADFTDSK  339
            MAALNQEVMQ+GQSLYNQP       P  G  S+    SS        GDVIDADFTDSK
Sbjct  654  MAALNQEVMQIGQSLYNQPQPGGAGSPPGGEASSSSDSSSSAKGGDNGGDVIDADFTDSK  713



>ref|XP_008792217.1| PREDICTED: LOW QUALITY PROTEIN: stromal 70 kDa heat shock-related 
protein, chloroplastic-like [Phoenix dactylifera]
Length=718

 Score =   249 bits (635),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 137/188 (73%), Positives = 148/188 (79%), Gaps = 11/188 (6%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLP DEVERMV EAER+A+EDK
Sbjct  531  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPGDEVERMVKEAERYAKEDK  590

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKR+AIDTKNQ++SVVYQTEKQLKELG+KV   VKEKVE KL EL+DAI+GGSTQ+MKDA
Sbjct  591  EKREAIDTKNQSESVVYQTEKQLKELGDKVSAAVKEKVEGKLKELKDAIAGGSTQSMKDA  650

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPD-----------GDVI  363
            MAALNQEVMQLGQSLYNQP A+        G +                       GDVI
Sbjct  651  MAALNQEVMQLGQSLYNQPGAAGAGAGAGAGAAGPGPAPGADAGSAGSAGKGPDDGGDVI  710

Query  362  DADFTDSK  339
            DADFTDSK
Sbjct  711  DADFTDSK  718



>ref|XP_012079755.1| PREDICTED: stromal 70 kDa heat shock-related protein, chloroplastic-like 
[Jatropha curcas]
 gb|KDP31625.1| hypothetical protein JCGZ_14850 [Jatropha curcas]
Length=665

 Score =   248 bits (633),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 136/176 (77%), Positives = 149/176 (85%), Gaps = 11/176 (6%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITI+GASTLPSDEVERMV EAE+FA+EDK
Sbjct  500  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITISGASTLPSDEVERMVREAEKFAKEDK  559

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
             KRDAIDTKNQA++VVYQTE+QLKELG+KVP  VKEKVEAKL  L+DAISGGSTQ +KDA
Sbjct  560  AKRDAIDTKNQAETVVYQTERQLKELGQKVPLSVKEKVEAKLKHLKDAISGGSTQTIKDA  619

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDGDVIDADFTDS  342
            MA LNQEVMQLGQ LYNQ            G  AG S+S+ K  DGDVIDADFT++
Sbjct  620  MAVLNQEVMQLGQFLYNQ-----------QGTEAGQSKSTRKSDDGDVIDADFTET  664



>gb|AGB06243.1| heat shock protein 70 [Lactuca sativa]
Length=697

 Score =   248 bits (634),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 134/177 (76%), Positives = 154/177 (87%), Gaps = 1/177 (1%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSVTA+DKGTGKKQDITITGASTLPSDEVERMV+EAE++A+EDK
Sbjct  522  GVPQIEVKFDIDANGILSVTAIDKGTGKKQDITITGASTLPSDEVERMVAEAEKYAKEDK  581

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKR+AIDTKNQA+S VYQ EKQLKE+GEKVPG VKEKVEAKL EL+DAISGG+TQ+MKDA
Sbjct  582  EKREAIDTKNQAESAVYQCEKQLKEVGEKVPGEVKEKVEAKLKELKDAISGGTTQSMKDA  641

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDGDVIDADFTDSK  339
            MAALNQE+MQ+GQ++Y+Q     GA     GG  G +  S    DG+VIDADF+DS+
Sbjct  642  MAALNQEMMQVGQAIYSQ-GGGGGAAAAASGGEGGKASGSSGEGDGEVIDADFSDSQ  697



>gb|ABP65327.1| chloroplast heat shock protein 70 [Cenchrus americanus]
Length=679

 Score =   248 bits (633),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 135/177 (76%), Positives = 150/177 (85%), Gaps = 3/177 (2%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLP DEVERMV EAERFA+EDK
Sbjct  506  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPKDEVERMVDEAERFAKEDK  565

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRDAIDTKNQA+SV+YQTEKQLKELG+KVP  VK KV++KL EL+DA++GGSTQ MKDA
Sbjct  566  EKRDAIDTKNQAESVIYQTEKQLKELGDKVPSDVKGKVKSKLQELKDAVAGGSTQMMKDA  625

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDGDVIDADFTDSK  339
            ++ALNQEVMQLGQSLY+Q       G +P  G+         G +GDVIDADFTDSK
Sbjct  626  LSALNQEVMQLGQSLYSQ---QGAPGASPTPGADATGSPEKPGGEGDVIDADFTDSK  679



>ref|XP_010530050.1| PREDICTED: heat shock 70 kDa protein 6, chloroplastic [Tarenaya 
hassleriana]
Length=722

 Score =   249 bits (635),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 144/183 (79%), Positives = 154/183 (84%), Gaps = 6/183 (3%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSV AVDKGTGKKQDITITGASTLP DEV++MV EAERF++EDK
Sbjct  540  GVPQIEVKFDIDANGILSVAAVDKGTGKKQDITITGASTLPKDEVDKMVQEAERFSKEDK  599

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKL EL+D I+ GSTQ +KDA
Sbjct  600  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLQELKDKIASGSTQEIKDA  659

Query  509  MAALNQEVMQLGQSLYNQ------psaspgagptpgggsagpsessgkgPDGDVIDADFT  348
            MAALNQEVMQ+GQ+LYNQ       S   GA      G +  S SS KG DGDVIDADFT
Sbjct  660  MAALNQEVMQIGQALYNQPGDASAGSGPGGASSGAEAGPSDSSASSSKGSDGDVIDADFT  719

Query  347  DSK  339
            DSK
Sbjct  720  DSK  722



>gb|EEE63158.1| hypothetical protein OsJ_17967 [Oryza sativa Japonica Group]
Length=689

 Score =   248 bits (632),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 135/179 (75%), Positives = 152/179 (85%), Gaps = 2/179 (1%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSV+AVDKGTGKKQDITITGASTLP DEVE+MV EAE+FA+EDK
Sbjct  511  GVPQIEVKFDIDANGILSVSAVDKGTGKKQDITITGASTLPKDEVEKMVEEAEKFAKEDK  570

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRDAIDTKNQA+SV+YQTEKQLKELG+KVPG VK KVEAKL EL+DA++GGSTQ MKDA
Sbjct  571  EKRDAIDTKNQAESVIYQTEKQLKELGDKVPGDVKGKVEAKLTELKDAVAGGSTQTMKDA  630

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkg--PDGDVIDADFTDSK  339
            +AALNQEVMQLGQ+LY+Q  A           +AG +  S K    +GDVIDADFTDS+
Sbjct  631  LAALNQEVMQLGQALYSQQGAPGAGPTPGADAAAGSAGPSEKPGGEEGDVIDADFTDSQ  689



>ref|XP_006655173.1| PREDICTED: stromal 70 kDa heat shock-related protein, chloroplastic-like, 
partial [Oryza brachyantha]
Length=604

 Score =   245 bits (626),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 133/181 (73%), Positives = 149/181 (82%), Gaps = 4/181 (2%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSV+AVDKGTGKKQDITITGASTLP DEVE+MV EAE+FA+EDK
Sbjct  424  GVPQIEVKFDIDANGILSVSAVDKGTGKKQDITITGASTLPKDEVEKMVEEAEKFAKEDK  483

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRDAIDTKNQA+SV+YQTEKQLKELG+KVPG VK KVEAKL EL+DA++GGSTQ MKDA
Sbjct  484  EKRDAIDTKNQAESVIYQTEKQLKELGDKVPGDVKGKVEAKLTELKDAVAGGSTQTMKDA  543

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgP----DGDVIDADFTDS  342
            +AALNQEVMQLGQ+LY+Q  A            AG   +         +GDVIDADFTDS
Sbjct  544  LAALNQEVMQLGQALYSQQGAPGAGPTPGADAGAGGGSAGPSEKPGGEEGDVIDADFTDS  603

Query  341  K  339
            +
Sbjct  604  Q  604



>ref|XP_008461924.1| PREDICTED: stromal 70 kDa heat shock-related protein, chloroplastic-like 
[Cucumis melo]
Length=677

 Score =   246 bits (629),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 129/176 (73%), Positives = 146/176 (83%), Gaps = 3/176 (2%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSVTA+DKGTGKKQDITITGASTLPSDEV+RMV EAE+FA+EDK
Sbjct  504  GVPQIEVKFDIDANGILSVTAIDKGTGKKQDITITGASTLPSDEVDRMVKEAEKFAKEDK  563

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRDAIDTKNQADSVVYQTEKQLKELG+K+P  V++ VEAKL EL+D IS GST+ +K+A
Sbjct  564  EKRDAIDTKNQADSVVYQTEKQLKELGDKIPTSVRDTVEAKLKELKDVISNGSTETIKNA  623

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDGDVIDADFTDS  342
            MAALNQEVMQ+GQSLY+Q   S  +       +   S  S    DGDV+DADF DS
Sbjct  624  MAALNQEVMQIGQSLYSQ---STTSSAGTASRTQSTSSGSTGETDGDVVDADFVDS  676



>ref|XP_006282334.1| hypothetical protein CARUB_v10028629mg [Capsella rubella]
 gb|EOA15232.1| hypothetical protein CARUB_v10028629mg [Capsella rubella]
Length=719

 Score =   247 bits (630),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 139/181 (77%), Positives = 152/181 (84%), Gaps = 4/181 (2%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSV+A DKGTGKKQDITITGASTLP DEV+ MV EAERFA+EDK
Sbjct  539  GVPQIEVKFDIDANGILSVSASDKGTGKKQDITITGASTLPKDEVDTMVQEAERFAKEDK  598

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRDAIDTKNQADS+VYQTEKQLKELGEK+PGPVKEKVEAKL EL++ I  GSTQ +KD 
Sbjct  599  EKRDAIDTKNQADSIVYQTEKQLKELGEKIPGPVKEKVEAKLQELKEKIESGSTQEIKDT  658

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPD----GDVIDADFTDS  342
            MAALNQEVMQ+GQSLYNQP +     P  GG ++  S+SS    D    GDVIDADFTDS
Sbjct  659  MAALNQEVMQIGQSLYNQPQSGGAGSPPGGGEASSGSDSSSSTKDGDNGGDVIDADFTDS  718

Query  341  K  339
            K
Sbjct  719  K  719



>ref|XP_002869727.1| cphsc70-1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45986.1| cphsc70-1 [Arabidopsis lyrata subsp. lyrata]
Length=718

 Score =   247 bits (630),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 140/180 (78%), Positives = 149/180 (83%), Gaps = 3/180 (2%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSV+AVDKGTGKKQDITITGASTLP DEV++MV EAERFA++DK
Sbjct  539  GVPQIEVKFDIDANGILSVSAVDKGTGKKQDITITGASTLPKDEVDQMVQEAERFAKDDK  598

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRDAIDTKNQADSVVYQTEKQLKELGEK+PG VKEKVEAKL EL+D I  GSTQ +KDA
Sbjct  599  EKRDAIDTKNQADSVVYQTEKQLKELGEKIPGEVKEKVEAKLQELKDKIGNGSTQEIKDA  658

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkg--PDG-DVIDADFTDSK  339
            MAALNQEVMQ+GQSLYNQP A         GG    S  S      DG DVIDADFTDSK
Sbjct  659  MAALNQEVMQIGQSLYNQPGAGAPGAGPSPGGEGASSADSSSSKGADGDDVIDADFTDSK  718



>emb|CDY08914.1| BnaC08g11440D [Brassica napus]
Length=621

 Score =   244 bits (624),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 138/176 (78%), Positives = 150/176 (85%), Gaps = 0/176 (0%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSV+A DKGTGKKQDITITGASTLP DEVE+MV EAERFA++DK
Sbjct  445  GVPQIEVKFDIDANGILSVSASDKGTGKKQDITITGASTLPKDEVEQMVQEAERFAKDDK  504

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRDAIDTKNQADSVVYQTEKQLKELGEK+PG VKEKVEAKL EL+D I  GSTQ +KD 
Sbjct  505  EKRDAIDTKNQADSVVYQTEKQLKELGEKIPGEVKEKVEAKLQELKDKIGSGSTQEIKDT  564

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDGDVIDADFTDS  342
            MAALNQEVMQ+GQS+YNQP A  GAG + GG     ++SS      DVIDADFTDS
Sbjct  565  MAALNQEVMQIGQSMYNQPGAGAGAGSSTGGEGDSSADSSSSKGGDDVIDADFTDS  620



>ref|NP_199802.1| heat shock protein 70-2 [Arabidopsis thaliana]
 sp|Q9LTX9.1|HSP7G_ARATH RecName: Full=Heat shock 70 kDa protein 7, chloroplastic; AltName: 
Full=Chloroplast heat shock protein 70-2; Short=cpHsc70-2; 
AltName: Full=Heat shock protein 70-7; Short=AtHsp70-7; 
Flags: Precursor [Arabidopsis thaliana]
 dbj|BAA97012.1| heat shock protein 70 [Arabidopsis thaliana]
 gb|AAN41319.1| putative heat shock protein 70 [Arabidopsis thaliana]
 gb|AED95870.1| heat shock protein 70-2 [Arabidopsis thaliana]
Length=718

 Score =   246 bits (629),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 137/179 (77%), Positives = 147/179 (82%), Gaps = 3/179 (2%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSV+A DKGTGKKQDITITGASTLP DEV+ MV EAERFA+EDK
Sbjct  539  GVPQIEVKFDIDANGILSVSASDKGTGKKQDITITGASTLPKDEVDTMVQEAERFAKEDK  598

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRDAIDTKNQADSVVYQTEKQLKELGEK+PGPVKEKVEAKL EL++ I+ GSTQ +KD 
Sbjct  599  EKRDAIDTKNQADSVVYQTEKQLKELGEKIPGPVKEKVEAKLQELKEKIASGSTQEIKDT  658

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkg---PDGDVIDADFTDS  342
            MAALNQEVMQ+GQSLYNQP       P  G  S+    SS        GDVIDADFTDS
Sbjct  659  MAALNQEVMQIGQSLYNQPQPGGADSPPGGEASSSSDTSSSAKGGDNGGDVIDADFTDS  717



>gb|AAF23074.1|AF074969_1 heat shock protein 70 [Triticum aestivum]
Length=376

 Score =   238 bits (607),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 134/178 (75%), Positives = 145/178 (81%), Gaps = 2/178 (1%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSV AVDKGTGKKQDITITGASTLP DEVE+MV EAE+FA EDK
Sbjct  198  GVPQIEVKFDIDANGILSVAAVDKGTGKKQDITITGASTLPKDEVEKMVEEAEKFAAEDK  257

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRDAIDTKNQA+SV+YQTEKQLKELG+KVPG VKEKVE KL EL+ A++GGSTQ +KDA
Sbjct  258  EKRDAIDTKNQAESVIYQTEKQLKELGDKVPGDVKEKVEGKLKELQVAVAGGSTQTIKDA  317

Query  509  MAALNQEVMQLGQSLYNQpsaspgagp--tpgggsagpsessgkgPDGDVIDADFTDS  342
            +AALNQEVMQLGQSLY Q  + P  G          GP  S   G  GDVIDADF DS
Sbjct  318  LAALNQEVMQLGQSLYQQQGSGPTPGADGAADSTGPGPGPSEKTGDGGDVIDADFIDS  375



>gb|ABR16685.1| unknown [Picea sitchensis]
Length=708

 Score =   246 bits (628),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 136/176 (77%), Positives = 147/176 (84%), Gaps = 2/176 (1%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            G+PQIEVKFDIDANGILSV AVDKGTGKKQDITITGASTLP+DEVE+MV EAERF++EDK
Sbjct  534  GIPQIEVKFDIDANGILSVAAVDKGTGKKQDITITGASTLPTDEVEKMVKEAERFSKEDK  593

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKR+AIDTKNQADSVVYQTEKQLKELGEKVP  VK+KVEAKL EL+DAI  GSTQ+MKD 
Sbjct  594  EKREAIDTKNQADSVVYQTEKQLKELGEKVPAEVKDKVEAKLKELKDAIDSGSTQSMKDT  653

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDGDVIDADFTDS  342
            MAALNQEVMQLGQSLYNQP A+ G       G       +  G   DVIDADFTDS
Sbjct  654  MAALNQEVMQLGQSLYNQPGAAGGPTTGGEAGPGSSGGKAPGGD--DVIDADFTDS  707



>gb|KFK36576.1| hypothetical protein AALP_AA4G141500 [Arabis alpina]
Length=714

 Score =   246 bits (628),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 139/179 (78%), Positives = 148/179 (83%), Gaps = 2/179 (1%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSV+A DKGTGKKQDITITGASTLP DEVE+MV EAERFA++DK
Sbjct  536  GVPQIEVKFDIDANGILSVSAADKGTGKKQDITITGASTLPKDEVEQMVQEAERFAKDDK  595

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRDAIDTKNQADSVVYQTEKQLKELGEK+PG VKEKVEAKL EL+D I  GSTQ +KD 
Sbjct  596  EKRDAIDTKNQADSVVYQTEKQLKELGEKIPGEVKEKVEAKLQELKDKIGSGSTQEIKDT  655

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsag-psessgkgPDG-DVIDADFTDSK  339
            MAALNQEVMQ+GQSLYNQP A                S +SGK  DG DVIDADFTDSK
Sbjct  656  MAALNQEVMQIGQSLYNQPGAGGAGPGAGPSPGGEDASSASGKSGDGDDVIDADFTDSK  714



>ref|XP_009121331.1| PREDICTED: heat shock 70 kDa protein 6, chloroplastic-like [Brassica 
rapa]
Length=533

 Score =   241 bits (616),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 137/180 (76%), Positives = 147/180 (82%), Gaps = 4/180 (2%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSV+A DKGTGKKQDITITGASTLP DEVE+MV EAERFA++DK
Sbjct  353  GVPQIEVKFDIDANGILSVSASDKGTGKKQDITITGASTLPKDEVEQMVQEAERFAKDDK  412

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRDAIDTKNQADSVVYQTEKQLKELGEK+PG VKEKVEAKL EL+D I  GSTQ +KD 
Sbjct  413  EKRDAIDTKNQADSVVYQTEKQLKELGEKIPGEVKEKVEAKLQELKDKIGNGSTQEIKDT  472

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDG----DVIDADFTDS  342
            MAALNQEVMQ+GQS+YNQP A  GAG   G G+       G         DVIDADFTDS
Sbjct  473  MAALNQEVMQIGQSMYNQPGAGAGAGAGAGAGAGSSPGGEGDSSSSKGGDDVIDADFTDS  532



>ref|XP_009794281.1| PREDICTED: stromal 70 kDa heat shock-related protein, chloroplastic-like 
[Nicotiana sylvestris]
Length=692

 Score =   244 bits (624),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 131/176 (74%), Positives = 148/176 (84%), Gaps = 0/176 (0%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSVTA DKGTGKKQDITITGASTLP DEV+RMV EAE+FA+EDK
Sbjct  516  GVPQIEVKFDIDANGILSVTATDKGTGKKQDITITGASTLPKDEVDRMVQEAEKFAKEDK  575

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRD+IDTKNQA+SVVYQTEKQLKELG+KVP  VK+KVE+KL EL+DAI+GGSTQ +KD 
Sbjct  576  EKRDSIDTKNQAESVVYQTEKQLKELGDKVPADVKDKVESKLRELKDAIAGGSTQTIKDT  635

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDGDVIDADFTDS  342
            MAALNQEVMQLGQSLY+QP A+ G      G +           DG+VIDADF++S
Sbjct  636  MAALNQEVMQLGQSLYSQPGAAAGPAGAAAGPAGASGSRGKDDGDGEVIDADFSES  691



>emb|CDY11007.1| BnaA03g46660D [Brassica napus]
Length=622

 Score =   243 bits (621),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 132/178 (74%), Positives = 147/178 (83%), Gaps = 1/178 (1%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSV+A DKGTGKKQDITITGASTLP DEVE+MV EAERFA++DK
Sbjct  445  GVPQIEVKFDIDANGILSVSASDKGTGKKQDITITGASTLPKDEVEQMVQEAERFAKDDK  504

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKR+AIDTKNQADSVVYQTEKQLKELGEK+PG VKEKVEAKL EL+D ++ G+TQ +KD 
Sbjct  505  EKREAIDTKNQADSVVYQTEKQLKELGEKIPGEVKEKVEAKLQELKDKLASGTTQEIKDT  564

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDG-DVIDADFTDSK  339
            MAALNQEVMQ+GQS+YNQP A  GA           + +      G DVIDADFTDSK
Sbjct  565  MAALNQEVMQIGQSMYNQPGAGAGAAAAGPSPGGEYASADSASKGGDDVIDADFTDSK  622



>gb|ABR16620.1| unknown [Picea sitchensis]
Length=709

 Score =   245 bits (625),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 136/176 (77%), Positives = 147/176 (84%), Gaps = 2/176 (1%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSV AVDKGT KKQDITITGASTLP+DEVE+MV EAERF++EDK
Sbjct  535  GVPQIEVKFDIDANGILSVAAVDKGTAKKQDITITGASTLPTDEVEKMVKEAERFSKEDK  594

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKR+AIDTKNQADSVVYQTEKQLKELGEKVP  VK+KVEAKL EL+DAI+ GSTQ+MKD 
Sbjct  595  EKREAIDTKNQADSVVYQTEKQLKELGEKVPAEVKDKVEAKLKELKDAIASGSTQSMKDT  654

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDGDVIDADFTDS  342
            MAALNQEVMQLGQSLYNQP  + G       G   P   +  G   DVIDADFTDS
Sbjct  655  MAALNQEVMQLGQSLYNQPGPAGGPTAGGEAGPGSPGGKTPGGD--DVIDADFTDS  708



>gb|AAF27639.1|AF217459_1 heat shock protein 70 [Arabidopsis thaliana]
Length=718

 Score =   245 bits (625),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 136/179 (76%), Positives = 147/179 (82%), Gaps = 3/179 (2%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSV+A D+GTGKKQDITITGASTLP DEV+ MV EAERFA+EDK
Sbjct  539  GVPQIEVKFDIDANGILSVSASDQGTGKKQDITITGASTLPKDEVDTMVQEAERFAKEDK  598

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRDAIDTKNQADSVVYQTEKQLKELGEK+PGPVKEKVEAKL EL++ I+ GSTQ +KD 
Sbjct  599  EKRDAIDTKNQADSVVYQTEKQLKELGEKIPGPVKEKVEAKLQELKEKIASGSTQEIKDT  658

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkg---PDGDVIDADFTDS  342
            MAALNQEVMQ+GQSLYNQP       P  G  S+    SS        GDVIDADFTDS
Sbjct  659  MAALNQEVMQIGQSLYNQPQPGGADSPPGGEASSSSDTSSSAKGGDNGGDVIDADFTDS  717



>gb|EMT14862.1| Stromal 70 kDa heat shock-related protein, chloroplastic [Aegilops 
tauschii]
Length=682

 Score =   244 bits (623),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 139/176 (79%), Positives = 151/176 (86%), Gaps = 2/176 (1%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSV AVDKGTGKKQDITITGASTLP DEVE+MV EAE+FA EDK
Sbjct  508  GVPQIEVKFDIDANGILSVAAVDKGTGKKQDITITGASTLPKDEVEKMVEEAEKFAAEDK  567

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRDAIDTKNQA+SV+YQTEKQLKELG+KVPG VKEKVE KL EL+DA++GGSTQ +KDA
Sbjct  568  EKRDAIDTKNQAESVIYQTEKQLKELGDKVPGDVKEKVEGKLKELQDAVAGGSTQTIKDA  627

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDGDVIDADFTDS  342
            +AALNQEVMQLGQSLY Q  + P  G      S GPSE +G G  GDVIDADFTDS
Sbjct  628  LAALNQEVMQLGQSLYQQQGSGPTPGADGAADSTGPSEKTGDG--GDVIDADFTDS  681



>gb|KGN44489.1| hypothetical protein Csa_7G312930 [Cucumis sativus]
Length=666

 Score =   243 bits (620),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 128/176 (73%), Positives = 145/176 (82%), Gaps = 3/176 (2%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSVTA+DKGTGKKQDITITGASTLPSDEV+RMV EAE+FA+EDK
Sbjct  493  GVPQIEVKFDIDANGILSVTAIDKGTGKKQDITITGASTLPSDEVDRMVKEAEKFAKEDK  552

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRDAIDTKNQADSVVYQTEKQLKELG+K+P  V++ VEAKL EL+DAIS GS + +K A
Sbjct  553  EKRDAIDTKNQADSVVYQTEKQLKELGDKIPSSVRDTVEAKLKELKDAISNGSIETIKVA  612

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDGDVIDADFTDS  342
            MAALNQEVMQ+GQSLY+Q   +  +       +   S  S    DGDV+DADF DS
Sbjct  613  MAALNQEVMQMGQSLYSQ---ATASSAGTASRTQSTSSGSSGETDGDVVDADFVDS  665



>ref|XP_009137440.1| PREDICTED: heat shock 70 kDa protein 6, chloroplastic-like [Brassica 
rapa]
Length=710

 Score =   244 bits (622),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 132/178 (74%), Positives = 147/178 (83%), Gaps = 1/178 (1%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSV+A DKGTGKKQDITITGASTLP DEVE+MV EAERFA++DK
Sbjct  533  GVPQIEVKFDIDANGILSVSASDKGTGKKQDITITGASTLPKDEVEQMVQEAERFAKDDK  592

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKR+AIDTKNQADSVVYQTEKQLKELGEK+PG VKEKVEAKL EL+D ++ G+TQ +KD 
Sbjct  593  EKREAIDTKNQADSVVYQTEKQLKELGEKIPGEVKEKVEAKLQELKDKLASGTTQEIKDT  652

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDG-DVIDADFTDSK  339
            MAALNQEVMQ+GQS+YNQP A  GA           + +      G DVIDADFTDSK
Sbjct  653  MAALNQEVMQIGQSMYNQPGAGAGAAAAGPSPGGEYASADSASKGGDDVIDADFTDSK  710



>ref|XP_001772650.1| predicted protein [Physcomitrella patens]
 ref|XP_001772691.1| predicted protein [Physcomitrella patens]
 gb|EDQ62514.1| predicted protein [Physcomitrella patens]
 gb|EDQ62555.1| predicted protein [Physcomitrella patens]
Length=641

 Score =   242 bits (618),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 134/177 (76%), Positives = 147/177 (83%), Gaps = 2/177 (1%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQ+EV+FDIDANGILSV+A+DKGTGKKQDITITGASTLP DEVERMV EAE+F QEDK
Sbjct  467  GVPQVEVRFDIDANGILSVSAMDKGTGKKQDITITGASTLPKDEVERMVQEAEKFGQEDK  526

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRDA+DTKNQADSVVYQTEKQLKEL +KVP  VK+KVEAKL EL+DAI+  +TQ+MKDA
Sbjct  527  EKRDAVDTKNQADSVVYQTEKQLKELADKVPAEVKDKVEAKLKELKDAIASDNTQSMKDA  586

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDGDVIDADFTDSK  339
            MAALNQEVMQLGQSLYNQP A         GG    S  +  G   DVIDADFTDSK
Sbjct  587  MAALNQEVMQLGQSLYNQPGAGGAPEGGAPGGQGSSSGPAAGGD--DVIDADFTDSK  641



>emb|CBI15489.3| unnamed protein product [Vitis vinifera]
Length=500

 Score =   239 bits (609),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 120/130 (92%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSVTA+DKGTGKKQDITITGASTLP+DEVERMVSEAERFA+EDK
Sbjct  364  GVPQIEVKFDIDANGILSVTAIDKGTGKKQDITITGASTLPTDEVERMVSEAERFAKEDK  423

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRDAIDTKNQADSVVYQTEKQLKELG+KVP  VKEKVEAKLGEL+DAISGGSTQ MKDA
Sbjct  424  EKRDAIDTKNQADSVVYQTEKQLKELGDKVPAQVKEKVEAKLGELKDAISGGSTQVMKDA  483

Query  509  MAALNQEVMQ  480
            MAALNQE  Q
Sbjct  484  MAALNQESHQ  493



>emb|CDY24832.1| BnaA08g14780D [Brassica napus]
Length=625

 Score =   242 bits (617),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 137/180 (76%), Positives = 147/180 (82%), Gaps = 4/180 (2%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSV+A DKGTGKKQDITITGASTLP DEVE+MV EAERFA++DK
Sbjct  445  GVPQIEVKFDIDANGILSVSASDKGTGKKQDITITGASTLPKDEVEQMVQEAERFAKDDK  504

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRDAIDTKNQADSVVYQTEKQLKELGEK+PG VKEKVEAKL EL+D I  GSTQ +KD 
Sbjct  505  EKRDAIDTKNQADSVVYQTEKQLKELGEKIPGEVKEKVEAKLQELKDKIGNGSTQEIKDT  564

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDG----DVIDADFTDS  342
            MAALNQEVMQ+GQS+YNQP A  GAG   G G+       G         DVIDADFTDS
Sbjct  565  MAALNQEVMQIGQSMYNQPGAGAGAGAGAGAGAGSSPGGEGDSSSSKGGDDVIDADFTDS  624



>ref|XP_004139746.2| PREDICTED: LOW QUALITY PROTEIN: stromal 70 kDa heat shock-related 
protein, chloroplastic [Cucumis sativus]
Length=677

 Score =   243 bits (619),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 128/176 (73%), Positives = 145/176 (82%), Gaps = 3/176 (2%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSVTA+DKGTGKKQDITITGASTLPSDEV+RMV EAE+FA+EDK
Sbjct  504  GVPQIEVKFDIDANGILSVTAIDKGTGKKQDITITGASTLPSDEVDRMVKEAEKFAKEDK  563

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRDAIDTKNQADSVVYQTEKQLKELG+K+P  V++ VEAKL EL+DAIS GS + +K A
Sbjct  564  EKRDAIDTKNQADSVVYQTEKQLKELGDKIPSSVRDTVEAKLKELKDAISNGSIETIKVA  623

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDGDVIDADFTDS  342
            MAALNQEVMQ+GQSLY+Q   +  +       +   S  S    DGDV+DADF DS
Sbjct  624  MAALNQEVMQMGQSLYSQ---ATASSAGTASRTQSTSSGSSGETDGDVVDADFVDS  676



>ref|XP_009117142.1| PREDICTED: heat shock 70 kDa protein 6, chloroplastic-like [Brassica 
rapa]
Length=616

 Score =   241 bits (616),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 137/180 (76%), Positives = 147/180 (82%), Gaps = 4/180 (2%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSV+A DKGTGKKQDITITGASTLP DEVE+MV EAERFA++DK
Sbjct  436  GVPQIEVKFDIDANGILSVSASDKGTGKKQDITITGASTLPKDEVEQMVQEAERFAKDDK  495

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRDAIDTKNQADSVVYQTEKQLKELGEK+PG VKEKVEAKL EL+D I  GSTQ +KD 
Sbjct  496  EKRDAIDTKNQADSVVYQTEKQLKELGEKIPGEVKEKVEAKLQELKDKIGNGSTQEIKDT  555

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDG----DVIDADFTDS  342
            MAALNQEVMQ+GQS+YNQP A  GAG   G G+       G         DVIDADFTDS
Sbjct  556  MAALNQEVMQIGQSMYNQPGAGAGAGAGAGAGAGSSPGGEGDSSSSKGGDDVIDADFTDS  615



>ref|XP_006283214.1| hypothetical protein CARUB_v10004245mg [Capsella rubella]
 gb|EOA16112.1| hypothetical protein CARUB_v10004245mg [Capsella rubella]
Length=717

 Score =   243 bits (621),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 141/180 (78%), Positives = 152/180 (84%), Gaps = 3/180 (2%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSV+AVDKGTGKKQDITITGASTLP DEV++MV EAERFA++DK
Sbjct  538  GVPQIEVKFDIDANGILSVSAVDKGTGKKQDITITGASTLPKDEVDQMVQEAERFAKDDK  597

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRDAIDTKNQADSVVYQTEKQLKELGEK+PG VKEKVEAKL EL+D I  GSTQ +KD 
Sbjct  598  EKRDAIDTKNQADSVVYQTEKQLKELGEKIPGDVKEKVEAKLQELKDKIGSGSTQEIKDT  657

Query  509  MAALNQEVMQLGQSLYNQ---psaspgagptpgggsagpsessgkgPDGDVIDADFTDSK  339
            MAALNQEVMQ+GQSLYNQ    +   GA P   G S+G S SS  G   DVIDADFTDSK
Sbjct  658  MAALNQEVMQIGQSLYNQPGAGAPGAGAPPGGEGASSGDSSSSKGGDGEDVIDADFTDSK  717



>ref|XP_006413449.1| hypothetical protein EUTSA_v10024543mg [Eutrema salsugineum]
 gb|ESQ54902.1| hypothetical protein EUTSA_v10024543mg [Eutrema salsugineum]
Length=714

 Score =   243 bits (619),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 134/179 (75%), Positives = 147/179 (82%), Gaps = 2/179 (1%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSV+A DKGTGKKQDITITGASTLP DEV++MV EAERFA++DK
Sbjct  536  GVPQIEVKFDIDANGILSVSASDKGTGKKQDITITGASTLPKDEVDQMVQEAERFAKDDK  595

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRDAIDTKNQADSVVYQTEKQLKELGEK+PG VKEKVEAKL EL+D I  G+TQ +KD 
Sbjct  596  EKRDAIDTKNQADSVVYQTEKQLKELGEKIPGEVKEKVEAKLQELKDKIGSGTTQEIKDT  655

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDG--DVIDADFTDSK  339
            MAALNQEVMQ+GQS+YNQP A  GA           + S+     G  DVIDADFTDSK
Sbjct  656  MAALNQEVMQIGQSMYNQPGAGAGAAGPGPNPGGEDASSADSSSKGGDDVIDADFTDSK  714



>gb|KFK33012.1| hypothetical protein AALP_AA6G318800 [Arabis alpina]
Length=709

 Score =   242 bits (618),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 130/177 (73%), Positives = 142/177 (80%), Gaps = 0/177 (0%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSV+A DKGTGKKQDITITGASTLP DEV+ MV EAERFA+EDK
Sbjct  533  GVPQIEVKFDIDANGILSVSASDKGTGKKQDITITGASTLPKDEVDTMVQEAERFAKEDK  592

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRD IDTKNQADS+VYQTEKQLKELGEK+PGPVKEKVE KL EL+D +  G+TQ +KD 
Sbjct  593  EKRDEIDTKNQADSLVYQTEKQLKELGEKIPGPVKEKVETKLQELKDKLGSGTTQEIKDT  652

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDGDVIDADFTDSK  339
            MAALNQEVMQ+GQSLYNQP      G     G    S +       DVIDADF+DSK
Sbjct  653  MAALNQEVMQIGQSLYNQPQPGAAPGGEASSGPDSSSSNKDGDNGADVIDADFSDSK  709



>ref|XP_009588865.1| PREDICTED: stromal 70 kDa heat shock-related protein, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=689

 Score =   242 bits (617),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 133/176 (76%), Positives = 148/176 (84%), Gaps = 2/176 (1%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSV A DKGTGKKQDITITGASTLP DEV+RMV EAE+FA+EDK
Sbjct  515  GVPQIEVKFDIDANGILSVMATDKGTGKKQDITITGASTLPKDEVDRMVQEAEKFAKEDK  574

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRD+IDTKNQA+SVVYQTEKQLKELG+KVP  VK+KVE+KL EL+DAISGGSTQ +KDA
Sbjct  575  EKRDSIDTKNQAESVVYQTEKQLKELGDKVPADVKDKVESKLSELKDAISGGSTQTIKDA  634

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDGDVIDADFTDS  342
            MAALNQEVMQLGQSLY+Q      AGP   G +     S     DG+VIDADF++S
Sbjct  635  MAALNQEVMQLGQSLYSQ--PGAAAGPAGAGPAGASGSSGKDDGDGEVIDADFSES  688



>ref|XP_010441277.1| PREDICTED: heat shock 70 kDa protein 7, chloroplastic-like [Camelina 
sativa]
Length=719

 Score =   242 bits (618),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 135/180 (75%), Positives = 147/180 (82%), Gaps = 4/180 (2%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSV+A DKGTGKKQDITITGASTLP DEV+ MV EAERFA+EDK
Sbjct  539  GVPQIEVKFDIDANGILSVSASDKGTGKKQDITITGASTLPKDEVDTMVQEAERFAKEDK  598

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRDAIDTKNQADS+VYQTEKQLKELGEK+PGPVKEKVEAKL EL++ I+  STQ +KD 
Sbjct  599  EKRDAIDTKNQADSIVYQTEKQLKELGEKIPGPVKEKVEAKLQELKEKIASESTQEIKDT  658

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDG----DVIDADFTDS  342
            MAALNQEVMQ+GQSLYNQP +     P  G  S+    SS     G    DVIDADFTDS
Sbjct  659  MAALNQEVMQIGQSLYNQPQSGGAGSPPGGEASSASDSSSSSTKGGDNNADVIDADFTDS  718



>ref|XP_009109254.1| PREDICTED: heat shock 70 kDa protein 6, chloroplastic-like [Brassica 
rapa]
Length=717

 Score =   242 bits (617),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 137/180 (76%), Positives = 147/180 (82%), Gaps = 4/180 (2%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSV+A DKGTGKKQDITITGASTLP DEVE+MV EAERFA++DK
Sbjct  537  GVPQIEVKFDIDANGILSVSASDKGTGKKQDITITGASTLPKDEVEQMVQEAERFAKDDK  596

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRDAIDTKNQADSVVYQTEKQLKELGEK+PG VKEKVEAKL EL+D I  GSTQ +KD 
Sbjct  597  EKRDAIDTKNQADSVVYQTEKQLKELGEKIPGEVKEKVEAKLQELKDKIGNGSTQEIKDT  656

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDG----DVIDADFTDS  342
            MAALNQEVMQ+GQS+YNQP A  GAG   G G+       G         DVIDADFTDS
Sbjct  657  MAALNQEVMQIGQSMYNQPGAGAGAGAGAGAGAGSSPGGEGDSSSSKGGDDVIDADFTDS  716



>ref|NP_194159.1| chloroplast heat shock protein 70-1 [Arabidopsis thaliana]
 sp|Q9STW6.1|HSP7F_ARATH RecName: Full=Heat shock 70 kDa protein 6, chloroplastic; AltName: 
Full=Chloroplast heat shock protein 70-1; Short=cpHsc70-1; 
AltName: Full=Heat shock protein 70-6; Short=AtHsp70-6; 
Flags: Precursor [Arabidopsis thaliana]
 emb|CAB45063.1| hsp 70-like protein [Arabidopsis thaliana]
 emb|CAB79338.1| hsp 70-like protein [Arabidopsis thaliana]
 gb|AAL59960.1| putative hsp 70 protein [Arabidopsis thaliana]
 gb|AAN71949.1| putative hsp 70 protein [Arabidopsis thaliana]
 gb|AEE84884.1| chloroplast heat shock protein 70-1 [Arabidopsis thaliana]
Length=718

 Score =   242 bits (617),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 121/138 (88%), Positives = 130/138 (94%), Gaps = 0/138 (0%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSV+AVDKGTGKKQDITITGASTLP DEV++MV EAERFA++DK
Sbjct  539  GVPQIEVKFDIDANGILSVSAVDKGTGKKQDITITGASTLPKDEVDQMVQEAERFAKDDK  598

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRDAIDTKNQADSVVYQTEKQLKELGEK+PG VKEKVEAKL EL+D I  GSTQ +KDA
Sbjct  599  EKRDAIDTKNQADSVVYQTEKQLKELGEKIPGEVKEKVEAKLQELKDKIGSGSTQEIKDA  658

Query  509  MAALNQEVMQLGQSLYNQ  456
            MAALNQEVMQ+GQSLYNQ
Sbjct  659  MAALNQEVMQIGQSLYNQ  676



>emb|CDX92631.1| BnaC07g38890D [Brassica napus]
Length=708

 Score =   241 bits (616),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 131/176 (74%), Positives = 145/176 (82%), Gaps = 0/176 (0%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSV+A DKGTGKKQDITITGASTLP DEVE+MV EAERFA++DK
Sbjct  533  GVPQIEVKFDIDANGILSVSASDKGTGKKQDITITGASTLPKDEVEQMVQEAERFAKDDK  592

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKR+AIDTKNQADSVVYQTEKQLKELGEK+PG VKEKVEAKL EL+D ++ G+TQ +KD 
Sbjct  593  EKREAIDTKNQADSVVYQTEKQLKELGEKIPGEVKEKVEAKLQELKDKLASGTTQEIKDT  652

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDGDVIDADFTDS  342
            MAALNQEVMQ+GQS+YNQP A         GG    S  S      DVIDADFTD+
Sbjct  653  MAALNQEVMQIGQSMYNQPGAGAAGAGPSPGGEDASSADSTGKGGDDVIDADFTDT  708



>ref|XP_010482286.1| PREDICTED: heat shock 70 kDa protein 7, chloroplastic isoform 
X1 [Camelina sativa]
 ref|XP_010482287.1| PREDICTED: heat shock 70 kDa protein 7, chloroplastic isoform 
X2 [Camelina sativa]
 ref|XP_010482288.1| PREDICTED: heat shock 70 kDa protein 7, chloroplastic isoform 
X3 [Camelina sativa]
Length=717

 Score =   241 bits (616),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 133/179 (74%), Positives = 146/179 (82%), Gaps = 3/179 (2%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSV+A DKGTGKKQDITITGASTLP DEV+ MV EAERFA+EDK
Sbjct  538  GVPQIEVKFDIDANGILSVSASDKGTGKKQDITITGASTLPKDEVDTMVQEAERFAKEDK  597

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRDAIDTKNQADS+VYQTEKQLKELGEK+PGPVKEKVEAKL EL++ I+ GSTQ +K+ 
Sbjct  598  EKRDAIDTKNQADSIVYQTEKQLKELGEKIPGPVKEKVEAKLQELKEKIASGSTQEIKET  657

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPD---GDVIDADFTDS  342
            MAALNQEVMQ+GQSLYNQ  +     P  G  S+    SS         DVIDADFTDS
Sbjct  658  MAALNQEVMQIGQSLYNQSQSGGAGSPPGGEASSASDSSSSTKGGDNVDDVIDADFTDS  716



>ref|XP_006413448.1| hypothetical protein EUTSA_v10024544mg [Eutrema salsugineum]
 gb|ESQ54901.1| hypothetical protein EUTSA_v10024544mg [Eutrema salsugineum]
Length=713

 Score =   241 bits (615),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 134/180 (74%), Positives = 146/180 (81%), Gaps = 3/180 (2%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSV+A DKGTGKKQDITITGASTLP DEVE+MV EAERFA++DK
Sbjct  534  GVPQIEVKFDIDANGILSVSASDKGTGKKQDITITGASTLPKDEVEQMVQEAERFAKDDK  593

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRDAIDTKNQADSVVYQTEKQLKELG+K+PG VKEKVEAKL EL+D I  GSTQ +KD 
Sbjct  594  EKRDAIDTKNQADSVVYQTEKQLKELGDKIPGEVKEKVEAKLQELKDKIGSGSTQEIKDT  653

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPD---GDVIDADFTDSK  339
            MAALNQEVMQ+GQS+YNQP A  GA           + S+         DVIDADFTDSK
Sbjct  654  MAALNQEVMQIGQSMYNQPGAGAGAAGPGPSPGGEGASSTDSSSSKGGDDVIDADFTDSK  713



>emb|CDY34275.1| BnaA01g13780D [Brassica napus]
Length=625

 Score =   238 bits (606),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 139/181 (77%), Positives = 154/181 (85%), Gaps = 4/181 (2%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSV+A DKGTGKKQDITITGASTLP DEV++MV EAERFA++DK
Sbjct  445  GVPQIEVKFDIDANGILSVSASDKGTGKKQDITITGASTLPKDEVDQMVQEAERFAKDDK  504

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRDAIDTKNQADSVVYQTEKQLKELGEK+PG VK KVEAKL EL+D I+ G+TQ +KD 
Sbjct  505  EKRDAIDTKNQADSVVYQTEKQLKELGEKIPGEVKGKVEAKLQELKDKIASGTTQEIKDT  564

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDG----DVIDADFTDS  342
            MAALNQEVMQ+GQS+YNQP A  GAGP+PGG  A  ++SS          DVIDADFTDS
Sbjct  565  MAALNQEVMQIGQSMYNQPGAGAGAGPSPGGEDASSADSSTDSSSSKGGDDVIDADFTDS  624

Query  341  K  339
            K
Sbjct  625  K  625



>ref|XP_011096814.1| PREDICTED: stromal 70 kDa heat shock-related protein, chloroplastic-like 
[Sesamum indicum]
Length=694

 Score =   239 bits (609),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 128/176 (73%), Positives = 149/176 (85%), Gaps = 1/176 (1%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSVTA+DKGTGKKQDITITGASTLP DEV+RMV +AER+A+EDK
Sbjct  519  GVPQIEVKFDIDANGILSVTAIDKGTGKKQDITITGASTLPKDEVDRMVKDAERYAKEDK  578

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKR+AIDTKNQA+SV+YQTEKQLKELG+K+P  VK+KVE+KL EL+D+ISGGSTQA+KDA
Sbjct  579  EKREAIDTKNQAESVMYQTEKQLKELGDKIPAAVKDKVESKLKELKDSISGGSTQAIKDA  638

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDGDVIDADFTDS  342
            M  LNQEVMQ+GQSLY+Q   + GA    G  S   S       DG+VIDADF++S
Sbjct  639  MTELNQEVMQMGQSLYSQ-PGAAGAEHAGGATSDSGSTGKSSDGDGEVIDADFSES  693



>ref|XP_010442469.1| PREDICTED: heat shock 70 kDa protein 7, chloroplastic-like [Camelina 
sativa]
Length=717

 Score =   239 bits (610),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 134/179 (75%), Positives = 146/179 (82%), Gaps = 3/179 (2%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSV+A DKGTGKKQDITITGASTLP DEV+ MV EAERFA+EDK
Sbjct  538  GVPQIEVKFDIDANGILSVSASDKGTGKKQDITITGASTLPKDEVDTMVQEAERFAKEDK  597

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRDAIDTKNQADS+VYQTEKQLKELGEK+P PVKEKVEAKL EL++ I+ GSTQ +KD 
Sbjct  598  EKRDAIDTKNQADSIVYQTEKQLKELGEKIPEPVKEKVEAKLQELKEKIASGSTQEIKDT  657

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPD---GDVIDADFTDS  342
            MAALNQEVMQ+GQSLYNQP +     P  G  S+    SS         DVIDADFTDS
Sbjct  658  MAALNQEVMQIGQSLYNQPQSGGAGSPPGGEASSASDSSSSTKGGDNVDDVIDADFTDS  716



>ref|NP_001233780.1| heat shock protein 70 [Solanum lycopersicum]
 gb|ABW76421.1| heat shock protein 70 [Solanum lycopersicum]
Length=692

 Score =   238 bits (606),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 128/176 (73%), Positives = 144/176 (82%), Gaps = 0/176 (0%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSVTA DKGTGKKQDITITGASTLP DEV+RMV EAE+FA+EDK
Sbjct  516  GVPQIEVKFDIDANGILSVTATDKGTGKKQDITITGASTLPKDEVDRMVQEAEKFAREDK  575

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKR+AID KNQA+SVVYQTEKQLKELG+KVP  VK KVE+KL EL+DAISG STQ +K A
Sbjct  576  EKREAIDAKNQAESVVYQTEKQLKELGDKVPADVKNKVESKLKELKDAISGDSTQTIKVA  635

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDGDVIDADFTDS  342
            MAALNQEVMQLGQSLY+QP  +        G +     +     DG+VIDADF++S
Sbjct  636  MAALNQEVMQLGQSLYSQPGPAGSGPSPGAGTTGSSGSTGKDDGDGEVIDADFSES  691



>ref|XP_010439061.1| PREDICTED: heat shock 70 kDa protein 6, chloroplastic [Camelina 
sativa]
Length=719

 Score =   238 bits (606),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 118/138 (86%), Positives = 129/138 (93%), Gaps = 0/138 (0%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSV+AVDKGTGKKQDITITGASTLP DEV++MV EAERFA++DK
Sbjct  538  GVPQIEVKFDIDANGILSVSAVDKGTGKKQDITITGASTLPKDEVDQMVQEAERFAKDDK  597

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRDAIDTKNQADSVVYQTEKQLKELGEK+PG VKEKVE KL EL++ I+ GSTQ +KD 
Sbjct  598  EKRDAIDTKNQADSVVYQTEKQLKELGEKIPGDVKEKVEGKLQELKEKIASGSTQEIKDT  657

Query  509  MAALNQEVMQLGQSLYNQ  456
            MAALNQEVMQ+GQSLYNQ
Sbjct  658  MAALNQEVMQIGQSLYNQ  675



>ref|XP_010433791.1| PREDICTED: heat shock 70 kDa protein 6, chloroplastic-like [Camelina 
sativa]
Length=719

 Score =   237 bits (605),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 118/138 (86%), Positives = 129/138 (93%), Gaps = 0/138 (0%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSV+A DKGTGKKQDITITGASTLP DEV++MV EAERFA++DK
Sbjct  538  GVPQIEVKFDIDANGILSVSAADKGTGKKQDITITGASTLPKDEVDQMVQEAERFAKDDK  597

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRDAIDTKNQADSVVYQTEKQLKELGEK+PG VKEKVEAKL EL++ I+ GSTQ +KD 
Sbjct  598  EKRDAIDTKNQADSVVYQTEKQLKELGEKIPGDVKEKVEAKLQELKEKIASGSTQEIKDT  657

Query  509  MAALNQEVMQLGQSLYNQ  456
            MAALNQEVMQ+GQSLYNQ
Sbjct  658  MAALNQEVMQIGQSLYNQ  675



>ref|XP_010448582.1| PREDICTED: heat shock 70 kDa protein 6, chloroplastic [Camelina 
sativa]
Length=719

 Score =   237 bits (605),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 118/138 (86%), Positives = 129/138 (93%), Gaps = 0/138 (0%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSV+A DKGTGKKQDITITGASTLP DEV++MV EAERFA++DK
Sbjct  538  GVPQIEVKFDIDANGILSVSAADKGTGKKQDITITGASTLPKDEVDQMVQEAERFAKDDK  597

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRDAIDTKNQADSVVYQTEKQLKELGEK+PG VKEKVEAKL EL++ I+ GSTQ +KD 
Sbjct  598  EKRDAIDTKNQADSVVYQTEKQLKELGEKIPGDVKEKVEAKLQELKEKIASGSTQEIKDT  657

Query  509  MAALNQEVMQLGQSLYNQ  456
            MAALNQEVMQ+GQSLYNQ
Sbjct  658  MAALNQEVMQIGQSLYNQ  675



>gb|AHL64247.1| heat shock protein 70-1 [Brassica napus]
Length=712

 Score =   236 bits (603),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 134/180 (74%), Positives = 150/180 (83%), Gaps = 4/180 (2%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSV+A DKGTGKKQDITITGASTLP DEVE+MV EAERFA++DK
Sbjct  533  GVPQIEVKFDIDANGILSVSASDKGTGKKQDITITGASTLPKDEVEQMVQEAERFAKDDK  592

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKR+AIDTKNQADSVVYQTEKQLKELGEK+PG VKEKVEAKL EL+D ++ G+TQ +KD 
Sbjct  593  EKREAIDTKNQADSVVYQTEKQLKELGEKIPGEVKEKVEAKLQELKDKLASGTTQEIKDT  652

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDG----DVIDADFTDS  342
            MAALNQEVMQ+GQS+YNQP A  GAG    G S G  ++S          DVIDADFTD+
Sbjct  653  MAALNQEVMQIGQSMYNQPGAGAGAGAAGAGPSPGGEDASSAASASKGGDDVIDADFTDT  712



>ref|XP_009137922.1| PREDICTED: heat shock 70 kDa protein 6, chloroplastic [Brassica 
rapa]
Length=711

 Score =   236 bits (603),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 141/177 (80%), Positives = 156/177 (88%), Gaps = 1/177 (1%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSV+A DKGTGKKQDITITGASTLP DEV++MV EAERFA++DK
Sbjct  536  GVPQIEVKFDIDANGILSVSASDKGTGKKQDITITGASTLPKDEVDQMVQEAERFAKDDK  595

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRDAIDTKNQADSVVYQTEKQLKELGEK+PG VK KVEAKL EL+D I+ G+TQ +KD 
Sbjct  596  EKRDAIDTKNQADSVVYQTEKQLKELGEKIPGEVKGKVEAKLQELKDKIASGTTQEIKDT  655

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDGDVIDADFTDSK  339
            MAALNQEVMQ+GQS+YNQP A  GAGP+PGG  A  ++SS K  D DVIDADFTDSK
Sbjct  656  MAALNQEVMQIGQSMYNQPGAGAGAGPSPGGEDASSADSSSKDGD-DVIDADFTDSK  711



>ref|XP_006361375.1| PREDICTED: heat shock 70 kDa protein 6, chloroplastic-like [Solanum 
tuberosum]
Length=696

 Score =   236 bits (602),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 132/180 (73%), Positives = 151/180 (84%), Gaps = 4/180 (2%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSVTA DKGTGKKQDITITGASTLP DEV+RMV EAE+FA+EDK
Sbjct  516  GVPQIEVKFDIDANGILSVTATDKGTGKKQDITITGASTLPKDEVDRMVQEAEKFAREDK  575

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKR+AID KNQA+SVVYQTEKQLKELG+KVP  VK+KVE+KL EL+DAIS  STQ +KDA
Sbjct  576  EKREAIDAKNQAESVVYQTEKQLKELGDKVPSDVKDKVESKLKELKDAISSDSTQTIKDA  635

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkg----PDGDVIDADFTDS  342
            MAALNQEVMQLGQSLY+QP A+ G   +     +G + +SG       DG+VIDADF++S
Sbjct  636  MAALNQEVMQLGQSLYSQPGAAAGPASSGPSPGSGTTGASGSTGKDDGDGEVIDADFSES  695



>emb|CDY03462.1| BnaC01g16200D [Brassica napus]
Length=712

 Score =   236 bits (601),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 139/177 (79%), Positives = 156/177 (88%), Gaps = 1/177 (1%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSV+A DKGTGKKQDITITGASTLP DEV++MV EAERFA++DK
Sbjct  537  GVPQIEVKFDIDANGILSVSASDKGTGKKQDITITGASTLPKDEVDQMVQEAERFAKDDK  596

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRDAIDTKNQADS+VYQTEKQLKELGEK+PG VK KVEAKL EL+D I+ G+TQ +KD 
Sbjct  597  EKRDAIDTKNQADSIVYQTEKQLKELGEKIPGEVKGKVEAKLQELKDKIASGTTQEIKDT  656

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDGDVIDADFTDSK  339
            MAALNQEVMQ+GQS+YNQP A  GA P+PGG +A  ++SS K  D DVIDADFTDSK
Sbjct  657  MAALNQEVMQIGQSMYNQPGAGAGASPSPGGEAASSADSSSKDGD-DVIDADFTDSK  712



>ref|XP_001752769.1| predicted protein [Physcomitrella patens]
 gb|EDQ82273.1| predicted protein [Physcomitrella patens]
Length=677

 Score =   233 bits (593),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 128/177 (72%), Positives = 145/177 (82%), Gaps = 4/177 (2%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQ+EV+FDIDANGILSV+A +KGTGKKQDITITGASTLP DEVERMV EAERF Q DK
Sbjct  505  GVPQVEVRFDIDANGILSVSATEKGTGKKQDITITGASTLPKDEVERMVEEAERFGQADK  564

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKR+A+DTKNQADSVVYQTEKQLKEL +KVP  VK+KVEAKL +L+DAI+  +TQ+MKDA
Sbjct  565  EKREAVDTKNQADSVVYQTEKQLKELADKVPAEVKDKVEAKLKDLKDAIASDNTQSMKDA  624

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDGDVIDADFTDSK  339
            +AALNQEVMQ GQSLYNQP  +P        GS+    + G     DVIDADFTDSK
Sbjct  625  IAALNQEVMQFGQSLYNQPGGAPEGSAPGAQGSSTGPAAGGD----DVIDADFTDSK  677



>gb|ADB23405.1| chloroplast Hsp70-1 [Physcomitrella patens]
Length=710

 Score =   233 bits (594),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 128/177 (72%), Positives = 145/177 (82%), Gaps = 4/177 (2%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQ+EV+FDIDANGILSV+A +KGTGKKQDITITGASTLP DEVERMV EAERF Q DK
Sbjct  538  GVPQVEVRFDIDANGILSVSATEKGTGKKQDITITGASTLPKDEVERMVEEAERFGQADK  597

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKR+A+DTKNQADSVVYQTEKQLKEL +KVP  VK+KVEAKL +L+DAI+  +TQ+MKDA
Sbjct  598  EKREAVDTKNQADSVVYQTEKQLKELADKVPAEVKDKVEAKLKDLKDAIASDNTQSMKDA  657

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDGDVIDADFTDSK  339
            +AALNQEVMQ GQSLYNQP  +P        GS+    + G     DVIDADFTDSK
Sbjct  658  IAALNQEVMQFGQSLYNQPGGAPEGSAPGAQGSSTGPAAGGD----DVIDADFTDSK  710



>emb|CAN81065.1| hypothetical protein VITISV_000728 [Vitis vinifera]
Length=693

 Score =   232 bits (591),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 139/177 (79%), Positives = 145/177 (82%), Gaps = 16/177 (9%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSVTA+DKGTGKKQDITITGASTLP+DEVERMVSEAERFA+EDK
Sbjct  533  GVPQIEVKFDIDANGILSVTAIDKGTGKKQDITITGASTLPTDEVERMVSEAERFAKEDK  592

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRDAIDTKNQADSVVYQTEKQLKELG+KVP  VKEKVEAKLGEL+DAI           
Sbjct  593  EKRDAIDTKNQADSVVYQTEKQLKELGDKVPAQVKEKVEAKLGELKDAI-----------  641

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDGDVIDADFTDSK  339
                 +EVMQLGQSLYNQ            G  AGPSESSGKGPDGDVIDADFTDSK
Sbjct  642  ---FRREVMQLGQSLYNQ--PGAPGAGPAPGSEAGPSESSGKGPDGDVIDADFTDSK  693



>gb|EYU22829.1| hypothetical protein MIMGU_mgv1a002344mg [Erythranthe guttata]
Length=686

 Score =   230 bits (587),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 126/176 (72%), Positives = 149/176 (85%), Gaps = 4/176 (2%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLP DEV++MV +AE +A+EDK
Sbjct  514  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPKDEVDKMVKDAEIYAKEDK  573

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKR+AIDTKNQA+SV+YQTEKQLKELG+KVP  VKE+VE+KL +L+D+++GGST+A+KDA
Sbjct  574  EKREAIDTKNQAESVLYQTEKQLKELGDKVPSDVKERVESKLKDLKDSLAGGSTRAIKDA  633

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDGDVIDADFTDS  342
             +ALNQEVMQLGQSLY+Q    PG       GS   S +     +GDVIDADFT+S
Sbjct  634  TSALNQEVMQLGQSLYSQ----PGGAAAASEGSTSSSSAKSSDGNGDVIDADFTES  685



>ref|XP_002974918.1| hypothetical protein SELMODRAFT_267815 [Selaginella moellendorffii]
 gb|EFJ23703.1| hypothetical protein SELMODRAFT_267815 [Selaginella moellendorffii]
Length=660

 Score =   216 bits (549),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 107/138 (78%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEV+FDIDANGILSV+A DKGTGKKQDITITGASTLP DEVERMV+EAE+F++EDK
Sbjct  481  GVPQIEVRFDIDANGILSVSATDKGTGKKQDITITGASTLPQDEVERMVNEAEKFSKEDK  540

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKR+A+D KNQADS+VYQTEKQLKELG+KVP  VK KVE K+  L+DAI+  +TQ +KDA
Sbjct  541  EKREAVDVKNQADSLVYQTEKQLKELGDKVPADVKGKVEDKVKALKDAIASDNTQKIKDA  600

Query  509  MAALNQEVMQLGQSLYNQ  456
             A LNQEVMQ+GQSLY+Q
Sbjct  601  TADLNQEVMQIGQSLYSQ  618



>ref|XP_002988934.1| hypothetical protein SELMODRAFT_235653 [Selaginella moellendorffii]
 gb|EFJ09963.1| hypothetical protein SELMODRAFT_235653 [Selaginella moellendorffii]
Length=663

 Score =   216 bits (549),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 107/138 (78%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEV+FDIDANGILSV+A DKGTGKKQDITITGASTLP DEVERMV+EAE+F++EDK
Sbjct  484  GVPQIEVRFDIDANGILSVSATDKGTGKKQDITITGASTLPQDEVERMVNEAEKFSKEDK  543

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKR+A+D KNQADS+VYQTEKQLKELG+KVP  VK KVE K+  L+DAI+  +TQ +KDA
Sbjct  544  EKREAVDVKNQADSLVYQTEKQLKELGDKVPADVKGKVEDKVKALKDAIASDNTQKIKDA  603

Query  509  MAALNQEVMQLGQSLYNQ  456
             A LNQEVMQ+GQSLY+Q
Sbjct  604  TADLNQEVMQIGQSLYSQ  621



>emb|CDY03461.1| BnaC01g16210D [Brassica napus]
Length=711

 Score =   214 bits (545),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 104/138 (75%), Positives = 122/138 (88%), Gaps = 0/138 (0%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVP+I+VKFDIDANGILS TA D+ TG KQ+ITITG++TL  DEVE+MV EAERFA++DK
Sbjct  542  GVPKIDVKFDIDANGILSATATDRATGNKQEITITGSTTLSKDEVEKMVKEAERFAKDDK  601

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            +KR+AIDTKNQADSVVYQTEKQLKE GEK+PG VKEK+E+KL EL D I  GSTQ +KD+
Sbjct  602  QKREAIDTKNQADSVVYQTEKQLKEFGEKIPGEVKEKIESKLQELEDKIGSGSTQEIKDS  661

Query  509  MAALNQEVMQLGQSLYNQ  456
            MAALNQEVMQ+GQS+ NQ
Sbjct  662  MAALNQEVMQIGQSMCNQ  679



>ref|XP_010242659.1| PREDICTED: heat shock 70 kDa protein 6, chloroplastic-like [Nelumbo 
nucifera]
Length=526

 Score =   204 bits (519),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 124/146 (85%), Positives = 131/146 (90%), Gaps = 1/146 (1%)
 Frame = -1

Query  779  DITITGASTLPSDEVERMVSEAERFAQEDKEKRDAIDTKNQADSVVYQTEKQLKELGEKV  600
            D TITGASTLPSDEVERMV EAERFA+EDKEKRDAIDTKNQADSVVYQTEKQLKELG+KV
Sbjct  381  DSTITGASTLPSDEVERMVKEAERFAKEDKEKRDAIDTKNQADSVVYQTEKQLKELGDKV  440

Query  599  PGPVKEKVEAKLGELRDAISGGSTQAMKDAMAALNQEVMQLGQSLYNQpsaspgagptpg  420
            P  VKEKVE+KLGEL++AISGGSTQA KDAMAALNQEVMQLGQSLYNQ   SPGAGP PG
Sbjct  441  PAAVKEKVESKLGELKEAISGGSTQAXKDAMAALNQEVMQLGQSLYNQ-PGSPGAGPAPG  499

Query  419  ggsagpsessgkgPDGDVIDADFTDS  342
            G +   S S+GK PDGDVIDADFTDS
Sbjct  500  GEAGPSSGSAGKTPDGDVIDADFTDS  525



>emb|CDY03459.1| BnaC01g16230D [Brassica napus]
Length=662

 Score =   197 bits (502),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 94/136 (69%), Positives = 119/136 (88%), Gaps = 0/136 (0%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVP+I+VKFDIDANGILS+TA ++ +G KQ+ITITGA+T+P D VE+MV EAERFA++DK
Sbjct  519  GVPKIDVKFDIDANGILSITATERASGNKQEITITGATTVPKDVVEKMVKEAERFAKDDK  578

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKR+A+DTKN+ADSVVY+TEKQLK  GEK+PG VKEK+EAKL EL+  I  GS Q +KD+
Sbjct  579  EKREAVDTKNKADSVVYKTEKQLKIFGEKIPGEVKEKIEAKLQELKVKIGSGSIQEIKDS  638

Query  509  MAALNQEVMQLGQSLY  462
            +AA+NQEVMQ+G S+Y
Sbjct  639  IAAVNQEVMQIGLSMY  654



>gb|AAO72585.1| heat shock-related protein [Oryza sativa Japonica Group]
Length=418

 Score =   191 bits (484),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 104/139 (75%), Positives = 118/139 (85%), Gaps = 0/139 (0%)
 Frame = -1

Query  758  STLPSDEVERMVSEAERFAQEDKEKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEK  579
            STLP DEVERMV EA++FAQEDKEKRDAIDTKNQADSVVYQTEKQLKELG+KVP PVKEK
Sbjct  279  STLPKDEVERMVEEADKFAQEDKEKRDAIDTKNQADSVVYQTEKQLKELGDKVPAPVKEK  338

Query  578  VEAKLGELRDAISGGSTQAMKDAMAALNQEVMQLGQSLYNQpsaspgagptpgggsagps  399
            V+AKL EL++AI+GGSTQ+MKDAMAALN+EVMQ+GQ++YNQ   +  AGPTPG  +   S
Sbjct  339  VDAKLNELKEAIAGGSTQSMKDAMAALNEEVMQIGQAMYNQQPNAGAAGPTPGADAGPTS  398

Query  398  essgkgPDGDVIDADFTDS  342
                   DGDVIDADFTDS
Sbjct  399  SGGKGPNDGDVIDADFTDS  417



>ref|XP_002982966.1| hypothetical protein SELMODRAFT_117446 [Selaginella moellendorffii]
 gb|EFJ15775.1| hypothetical protein SELMODRAFT_117446 [Selaginella moellendorffii]
Length=686

 Score =   189 bits (481),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 106/175 (61%), Positives = 130/175 (74%), Gaps = 8/175 (5%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEV+FDIDANGILSV+A +KGTGKKQDITITGASTL  DEVERMV EAERF  ED+
Sbjct  518  GVPQIEVRFDIDANGILSVSATEKGTGKKQDITITGASTLSQDEVERMVQEAERFRAEDE  577

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            +KR  +D +N+A+S+VYQTEKQ++ELG KVP  VK KVE K+  L+  +S G T+ +KDA
Sbjct  578  KKRGDVDARNEAESLVYQTEKQVEELGGKVPADVKSKVEDKVKALKVEMSSGDTRKIKDA  637

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDGD-VIDADFT  348
            +AAL QE MQ+GQSLY+Q         T        ++ +  G DGD VIDADF+
Sbjct  638  IAALRQEAMQIGQSLYSQ-------AGTKEAKETKGTKETKDGSDGDEVIDADFS  685



>ref|XP_002965491.1| hypothetical protein SELMODRAFT_230659 [Selaginella moellendorffii]
 gb|EFJ32911.1| hypothetical protein SELMODRAFT_230659 [Selaginella moellendorffii]
Length=657

 Score =   189 bits (479),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 106/175 (61%), Positives = 130/175 (74%), Gaps = 8/175 (5%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEV+FDIDANGILSV+A +KGTGKKQ+ITITGASTL  DEVERMV EAERF  ED+
Sbjct  489  GVPQIEVRFDIDANGILSVSATEKGTGKKQEITITGASTLSQDEVERMVQEAERFRAEDE  548

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            +KR  +D +N+A+S+VYQTEKQL+ELG KVP  VK KVE K+  L+  +S G T+ +KDA
Sbjct  549  KKRGDVDARNEAESLVYQTEKQLEELGGKVPADVKSKVEDKVKALKVEMSSGDTRKIKDA  608

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDGD-VIDADFT  348
            +AAL QE MQ+GQSLY+Q         T        ++ +  G DGD VIDADF+
Sbjct  609  IAALRQEAMQIGQSLYSQ-------AGTKEAKETKGTKETKDGSDGDEVIDADFS  656



>emb|CAA65356.1| heat shock protein 70B [Chlamydomonas reinhardtii]
Length=679

 Score =   189 bits (479),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 111/178 (62%), Positives = 133/178 (75%), Gaps = 1/178 (1%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSVTA DKGT KKQDI ITGASTL   +VERMV EAE+FA EDK
Sbjct  502  GVPQIEVKFDIDANGILSVTATDKGTSKKQDIRITGASTLDKGDVERMVKEAEKFAGEDK  561

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            ++R++++TKNQA+++VYQTEKQLKE   KVP  +K KVEAKLGEL+ A+     +A K A
Sbjct  562  KRRESVETKNQAETMVYQTEKQLKEFEGKVPADIKAKVEAKLGELKAALPADDAEATKAA  621

Query  509  MAALNQEVMQLGQSLYNQ-psaspgagptpgggsagpsessgkgPDGDVIDADFTDSK  339
            M AL QEVM +GQ++Y+Q  +A  GA     G  AG   + G   D DVIDA+FTD K
Sbjct  622  MNALQQEVMAMGQAMYSQAGAAPGGAPGAEPGAGAGAGGAPGGKKDDDVIDAEFTDKK  679



>ref|XP_005648953.1| heat shock protein 70 [Coccomyxa subellipsoidea C-169]
 gb|EIE24409.1| heat shock protein 70 [Coccomyxa subellipsoidea C-169]
Length=646

 Score =   188 bits (478),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 109/176 (62%), Positives = 135/176 (77%), Gaps = 1/176 (1%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQ+EVKFDIDANGILSVTA DKGTGKKQDI ITGASTL  DEV+RMV +AE+FA EDK
Sbjct  470  GVPQVEVKFDIDANGILSVTATDKGTGKKQDIKITGASTLAGDEVDRMVKDAEKFADEDK  529

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            +KR+A+D KNQADS+VYQTEKQL ELG+KVP  VK KVE+++  L++  +G  T+A K A
Sbjct  530  KKREAVDVKNQADSLVYQTEKQLTELGDKVPADVKSKVESQITSLKETAAGDDTEATKKA  589

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDGDVIDADFTDS  342
            +  L +EVM +GQ++Y QP  +PG     G G+  P     KG D +V+DA+FTDS
Sbjct  590  IEDLQKEVMAIGQAIYGQPGGAPGPDAAAGPGAGAPGGDEKKGGD-NVVDAEFTDS  644



>ref|XP_007509042.1| molecular chaperone DnaK [Bathycoccus prasinos]
 emb|CCO19499.1| molecular chaperone DnaK [Bathycoccus prasinos]
Length=806

 Score =   189 bits (481),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 94/136 (69%), Positives = 113/136 (83%), Gaps = 0/136 (0%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSV A DKGTGKKQDI ITGASTL SDEV+RMV+EAE+F++EDK
Sbjct  570  GVPQIEVKFDIDANGILSVEACDKGTGKKQDIKITGASTLSSDEVDRMVNEAEKFSEEDK  629

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            +KR+ +D +N ADS+ YQTEKQL ELG+KVP  VKEKV  KL EL+ A+ GG    MK+A
Sbjct  630  KKREDVDVRNSADSMAYQTEKQLTELGDKVPEDVKEKVNQKLTELKSAVEGGDIAQMKEA  689

Query  509  MAALNQEVMQLGQSLY  462
              AL +EVM++GQ++Y
Sbjct  690  QEALQKEVMEMGQAIY  705



>ref|XP_001696432.1| heat shock protein 70B [Chlamydomonas reinhardtii]
 gb|EDP08409.1| heat shock protein 70B [Chlamydomonas reinhardtii]
Length=679

 Score =   189 bits (479),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 111/178 (62%), Positives = 133/178 (75%), Gaps = 1/178 (1%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSVTA DKGT KKQDI ITGASTL   +VERMV EAE+FA EDK
Sbjct  502  GVPQIEVKFDIDANGILSVTATDKGTSKKQDIRITGASTLDKGDVERMVKEAEKFAGEDK  561

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            ++R++++TKNQA+++VYQTEKQLKE   KVP  +K KVEAKLGEL+ A+     +A K A
Sbjct  562  KRRESVETKNQAETMVYQTEKQLKEFEGKVPADIKAKVEAKLGELKAALPADDAEATKAA  621

Query  509  MAALNQEVMQLGQSLYNQ-psaspgagptpgggsagpsessgkgPDGDVIDADFTDSK  339
            M AL QEVM +GQ++Y+Q  +A  GA     G  AG   + G   D DVIDA+FTD K
Sbjct  622  MNALQQEVMAMGQAMYSQAGAAPGGAPGAEPGAGAGAGGAPGGKKDDDVIDAEFTDKK  679



>gb|EPS66995.1| hypothetical protein M569_07782, partial [Genlisea aurea]
Length=141

 Score =   175 bits (444),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 100/139 (72%), Positives = 107/139 (77%), Gaps = 6/139 (4%)
 Frame = -1

Query  740  EVERMVSEAERFAQEDKEKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLG  561
            +VERMV EAERFA+EDKEKRDAIDTKNQ DSV YQTEKQLKELG+KVP PVKEKVEAKLG
Sbjct  3    QVERMVKEAERFAKEDKEKRDAIDTKNQGDSVAYQTEKQLKELGDKVPAPVKEKVEAKLG  62

Query  560  ELRDAISGGSTQAMKDAMAALNQEVMQLGQSLYNQ------psaspgagptpgggsagps  399
            ELR+AISGGSTQA+KDAMAALNQEVMQLGQSLYNQ                  GG    +
Sbjct  63   ELREAISGGSTQAIKDAMAALNQEVMQLGQSLYNQPGAGGAAGGGAPGTGPAPGGGTAEA  122

Query  398  essgkgPDGDVIDADFTDS  342
               G   +GDVIDADFTDS
Sbjct  123  GGKGGAAEGDVIDADFTDS  141



>ref|XP_005848047.1| heat shock protein 70B [Chlorella variabilis]
 gb|EFN55945.1| heat shock protein 70B [Chlorella variabilis]
Length=676

 Score =   186 bits (473),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 109/179 (61%), Positives = 129/179 (72%), Gaps = 6/179 (3%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQ+EV+FDIDANGILSVTA DKGTGKKQDI ITGASTLPSDEV+RMV +AE+ A+ED+
Sbjct  503  GVPQVEVRFDIDANGILSVTATDKGTGKKQDIKITGASTLPSDEVDRMVKDAEKNAEEDR  562

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            + R+ IDTKNQADS VYQTEKQLKE  +KVP  VK KVEAKL  L++AI       +K+A
Sbjct  563  KARELIDTKNQADSQVYQTEKQLKEFADKVPEEVKGKVEAKLAALKEAIPSDDVPKIKEA  622

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDGDVIDADFTDSK*D  333
            M  L +EVM LGQ++Y Q  A   A      GS+   +        DVIDA+FTDS  D
Sbjct  623  MEELQKEVMTLGQAVYGQQQAGGAAPGGEDAGSSSGPKGD------DVIDAEFTDSPKD  675



>gb|AAL66864.1| heat shock protein 70B [Dunaliella salina]
Length=669

 Score =   185 bits (469),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 102/177 (58%), Positives = 126/177 (71%), Gaps = 6/177 (3%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            G+PQIEVKFDIDANGILSVTA DKG+GKKQDI ITGASTL  D+VERMV+EAERFA EDK
Sbjct  499  GMPQIEVKFDIDANGILSVTATDKGSGKKQDIKITGASTLGKDDVERMVAEAERFAGEDK  558

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            +KR+A+DTKNQA+S++YQTEKQL E  EKVP  VK  ++ ++ ELRD+      + MK  
Sbjct  559  KKREAVDTKNQAESMIYQTEKQLDEFKEKVPEDVKSSIQNRVKELRDSAGADDVEGMKKG  618

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDGDVIDADFTDSK  339
            + +L QEVM++GQ++Y Q           G     P     K  DG VIDA++TD K
Sbjct  619  IESLQQEVMKMGQAMYGQ------PSGDAGAAGGQPGPEPPKDSDGGVIDAEYTDKK  669



>gb|ADI46914.1| HSP70bm [Volvox carteri f. nagariensis]
Length=668

 Score =   184 bits (466),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 90/138 (65%), Positives = 114/138 (83%), Gaps = 0/138 (0%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSVTA DKGTGKKQDI ITGASTL   +V+RMV EAE+FA EDK
Sbjct  499  GVPQIEVKFDIDANGILSVTATDKGTGKKQDIRITGASTLDKSDVDRMVKEAEKFAAEDK  558

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            ++R+ ++ KNQA+++VYQTEKQLKE   KVPG ++ KVEAKLG+L+  +     +++K+A
Sbjct  559  KRREGVELKNQAETMVYQTEKQLKEFEGKVPGEIEAKVEAKLGDLKSCLGTDDAESIKNA  618

Query  509  MAALNQEVMQLGQSLYNQ  456
            M AL QEVM +GQ++Y+Q
Sbjct  619  MNALQQEVMAMGQAMYSQ  636



>gb|ADB23406.1| chloroplast Hsp70-2 [Physcomitrella patens]
Length=707

 Score =   181 bits (459),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 104/176 (59%), Positives = 127/176 (72%), Gaps = 5/176 (3%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEV FDIDANGILSVTA+DKG+GKKQDI ITGASTL  D+VERMV EAER A+EDK
Sbjct  536  GVPQIEVTFDIDANGILSVTAMDKGSGKKQDIQITGASTLNKDDVERMVQEAERNAEEDK  595

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            ++R+ ID KNQ+DS++YQ EKQLKEL +KVP  +K +VE K+ +L++A      + MK A
Sbjct  596  KRREVIDLKNQSDSMIYQAEKQLKELSDKVPADLKSRVETKVVDLKEAAKTEDVEKMKRA  655

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDGDVIDADFTDS  342
              AL QEVMQ+GQ++Y       GA           + SS  G D +VIDADFTDS
Sbjct  656  QEALQQEVMQIGQAIYGS-----GAAHAGPAQPGSGAASSPPGDDAEVIDADFTDS  706



>ref|XP_001769503.1| predicted protein [Physcomitrella patens]
 gb|EDQ65664.1| predicted protein, partial [Physcomitrella patens]
Length=648

 Score =   181 bits (458),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 104/176 (59%), Positives = 127/176 (72%), Gaps = 5/176 (3%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEV FDIDANGILSVTA+DKG+GKKQDI ITGASTL  D+VERMV EAER A+EDK
Sbjct  478  GVPQIEVTFDIDANGILSVTAMDKGSGKKQDIQITGASTLNKDDVERMVQEAERNAEEDK  537

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            ++R+ ID KNQ+DS++YQ EKQLKEL +KVP  +K +VE K+ +L++A      + MK A
Sbjct  538  KRREVIDLKNQSDSMIYQAEKQLKELSDKVPADLKSRVETKVVDLKEAAKTEDVEKMKRA  597

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDGDVIDADFTDS  342
              AL QEVMQ+GQ++Y       GA           + SS  G D +VIDADFTDS
Sbjct  598  QEALQQEVMQIGQAIYGS-----GAAHAGPAQPGSGAASSPPGDDAEVIDADFTDS  648



>emb|CAB71138.2| heat shock protein [Dunaliella salina]
Length=670

 Score =   181 bits (458),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 102/177 (58%), Positives = 128/177 (72%), Gaps = 5/177 (3%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            G+PQIEVKFDIDANGILSVTA DKG+GKKQDI ITGASTL  D+VERMV++AERFA EDK
Sbjct  499  GMPQIEVKFDIDANGILSVTATDKGSGKKQDIKITGASTLGKDDVERMVADAERFAGEDK  558

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            +KR+A+DTKNQA+S++YQTEKQL E  EKVP  VK  ++ ++ ELR++      + MK  
Sbjct  559  KKREAVDTKNQAESMIYQTEKQLDEFKEKVPEDVKSSIQNRVKELRESAGADDVEGMKKG  618

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDGDVIDADFTDSK  339
            + AL QEVM++GQ++Y Q       G     G+   S    K  DG VIDA++TD K
Sbjct  619  IEALQQEVMKMGQAMYGQ-----PGGDAGAAGAQPGSGEPPKDGDGGVIDAEYTDKK  670



>emb|CEG00973.1| Heat shock protein 70 family, partial [Ostreococcus tauri]
Length=249

 Score =   172 bits (435),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 85/136 (63%), Positives = 107/136 (79%), Gaps = 0/136 (0%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSV A DKGTGKKQDI ITGASTL SDEVERMV++AE+FA ED 
Sbjct  84   GVPQIEVKFDIDANGILSVEACDKGTGKKQDIKITGASTLSSDEVERMVADAEKFASEDY  143

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
             KR+ ++ +N +DS+VYQTEKQL ELG+K+P  +K++V  KL  L+ A++    + MK A
Sbjct  144  AKREQVEMRNSSDSMVYQTEKQLNELGDKIPQEIKDQVLKKLESLKHALATDDVEKMKTA  203

Query  509  MAALNQEVMQLGQSLY  462
               L Q+VM +GQ++Y
Sbjct  204  QEELQQQVMAMGQAMY  219



>emb|CDY34276.1| BnaA01g13790D [Brassica napus]
Length=264

 Score =   172 bits (435),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 105/177 (59%), Positives = 124/177 (70%), Gaps = 14/177 (8%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVP I+VK DIDANGILS TA D+ TG KQ+ITITGA+TLP DE       AERFA++DK
Sbjct  102  GVPNIDVKIDIDANGILSATATDRATGNKQEITITGATTLPKDE-------AERFAKDDK  154

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKR+AIDTKNQ        EKQL+  GEK+PG +KEK+EAKL EL+D I  GSTQ +KD+
Sbjct  155  EKREAIDTKNQK-------EKQLEIFGEKIPGEMKEKIEAKLQELKDKIGSGSTQEIKDS  207

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDGDVIDADFTDSK  339
            +AALNQEVMQ+G  +YNQP A       PGG  +   +SS      DVID D TDSK
Sbjct  208  VAALNQEVMQIGLFMYNQPGAGAAGPSPPGGEGSSSEDSSSSKGGDDVIDPDLTDSK  264



>ref|XP_006431616.1| hypothetical protein CICLE_v10003537mg [Citrus clementina]
 gb|ESR44856.1| hypothetical protein CICLE_v10003537mg [Citrus clementina]
Length=150

 Score =   167 bits (423),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 102/147 (69%), Positives = 115/147 (78%), Gaps = 5/147 (3%)
 Frame = -1

Query  779  DITITGASTLPSDEVERMVSEAERFAQEDKEKRDAIDTKNQADSVVYQTEKQLKELGEKV  600
            D T++ +     + VERMV EAE+FA+EDKE+RDAIDTKNQADS+VYQTEKQLKEL EKV
Sbjct  9    DFTLSPSLFRIKNWVERMVKEAEKFAKEDKERRDAIDTKNQADSLVYQTEKQLKELAEKV  68

Query  599  PGPVKEKVEAKLGELRDAISGGSTQAMKDAMAALNQEVMQLGQSLYNQpsaspgagptpg  420
            P PVKEKVE KL +L+D+IS  STQ MKDAMAALNQEVMQLGQSLYNQ            
Sbjct  69   PAPVKEKVEGKLQDLKDSISEESTQKMKDAMAALNQEVMQLGQSLYNQ-----PGAGPAP  123

Query  419  ggsagpsessgkgPDGDVIDADFTDSK  339
            G  AGPS+SS KGPD DVIDADF+DSK
Sbjct  124  GAEAGPSDSSNKGPDSDVIDADFSDSK  150



>ref|XP_002504599.1| stromal heat shock protein 70 kDa, chloroplast precursor [Micromonas 
sp. RCC299]
 gb|ACO65857.1| stromal heat shock protein 70 kDa, chloroplast precursor [Micromonas 
sp. RCC299]
Length=735

 Score =   179 bits (453),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 92/136 (68%), Positives = 107/136 (79%), Gaps = 0/136 (0%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSV+AVDKGTGK  DI ITGASTL  DEVERMV +AE  A+ DK
Sbjct  564  GVPQIEVKFDIDANGILSVSAVDKGTGKAADIKITGASTLSEDEVERMVKDAESNAEADK  623

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
             +RDA+DTKN ADS+ YQTEKQL+ELG+K+P   KEKV+ K+ ELR AI      AMK+ 
Sbjct  624  AQRDAVDTKNSADSMCYQTEKQLEELGDKIPEDTKEKVKGKVAELRAAIEADDLAAMKEK  683

Query  509  MAALNQEVMQLGQSLY  462
              AL QEVM +GQ++Y
Sbjct  684  QEALQQEVMAMGQAMY  699



>ref|XP_003059786.1| heat shock protein 70, chloroplast precursor [Micromonas pusilla 
CCMP1545]
 gb|EEH55738.1| heat shock protein 70, chloroplast precursor [Micromonas pusilla 
CCMP1545]
Length=695

 Score =   176 bits (445),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 91/136 (67%), Positives = 104/136 (76%), Gaps = 0/136 (0%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSV+A DKGTGK  DI ITGASTL  DEVE+MV +AE FA ED 
Sbjct  519  GVPQIEVKFDIDANGILSVSAADKGTGKAADIKITGASTLSEDEVEKMVKDAEAFASEDA  578

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRDA+DTKN ADS+ YQTEKQL+E G+K+P  VKEKV+ K+ ELR AI   +   MK  
Sbjct  579  EKRDAVDTKNSADSMAYQTEKQLEEFGDKLPEEVKEKVKGKVAELRAAIEADNLADMKTK  638

Query  509  MAALNQEVMQLGQSLY  462
               L  EVM +GQS+Y
Sbjct  639  QEELQTEVMAMGQSMY  654



>ref|XP_002958295.1| heat shock protein 70B [Volvox carteri f. nagariensis]
 gb|ADI46845.1| HSP70bf [Volvox carteri f. nagariensis]
 gb|EFJ40669.1| heat shock protein 70B [Volvox carteri f. nagariensis]
Length=666

 Score =   175 bits (443),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 87/138 (63%), Positives = 113/138 (82%), Gaps = 0/138 (0%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSVTA DKGTGKKQDI ITGASTL   +V+RMV EAE+FA EDK
Sbjct  501  GVPQIEVKFDIDANGILSVTATDKGTGKKQDIRITGASTLDKSDVDRMVKEAEKFASEDK  560

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            ++R++++ KNQA+++VYQTEKQLKE   KV   +K KV++KL +L+ +++    +A+K A
Sbjct  561  KRRESVELKNQAETMVYQTEKQLKEFEGKVTPEIKMKVDSKLADLKSSLTSDDAEAVKAA  620

Query  509  MAALNQEVMQLGQSLYNQ  456
            M AL QEVM +GQ++Y+Q
Sbjct  621  MNALQQEVMAMGQAMYSQ  638



>gb|AFC75638.1| heat shock protein 70 [Ulva linza]
Length=712

 Score =   174 bits (440),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 87/136 (64%), Positives = 107/136 (79%), Gaps = 0/136 (0%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            G+PQIEVKFDIDANGILSVTA DKGTGK  DI ITGASTL  DEV +MV++AE+FA EDK
Sbjct  526  GIPQIEVKFDIDANGILSVTAQDKGTGKSTDIKITGASTLSDDEVSQMVNDAEKFADEDK  585

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
             KR+A++TKNQADS+VYQT KQL E G+KVP  VK+ VE K+ EL +A+     + MK  
Sbjct  586  NKREAVETKNQADSMVYQTRKQLTEFGDKVPEDVKKTVEDKINELDEAVKADDVEKMKTK  645

Query  509  MAALNQEVMQLGQSLY  462
            M  LNQEV ++G+++Y
Sbjct  646  MEELNQEVTKIGEAMY  661



>ref|XP_001416211.1| Heat Shock Protein 70, chloroplast [Ostreococcus lucimarinus 
CCE9901]
 gb|ABO94504.1| Heat Shock Protein 70, chloroplast [Ostreococcus lucimarinus 
CCE9901]
Length=695

 Score =   174 bits (440),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 88/136 (65%), Positives = 108/136 (79%), Gaps = 0/136 (0%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEVKFDIDANGILSV A DKGTGKKQDI ITGASTL SDEV+RMV++AE+FA ED 
Sbjct  531  GVPQIEVKFDIDANGILSVEACDKGTGKKQDIKITGASTLSSDEVDRMVADAEKFASEDA  590

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
             KR+ ++ +N ADS+VYQTEKQ++EL EK+P  VKEKV  K+ EL+ AI+    + MK A
Sbjct  591  AKREQVEVRNSADSMVYQTEKQVQELDEKIPQDVKEKVLEKVAELKQAIASDDLEKMKTA  650

Query  509  MAALNQEVMQLGQSLY  462
               L Q+VM +GQ++Y
Sbjct  651  QEDLQQQVMAMGQAMY  666



>ref|NP_050768.1| heat shock protein 70 (chloroplast) [Guillardia theta]
 sp|P29215.2|DNAK_GUITH RecName: Full=Chaperone protein dnaK; AltName: Full=HSP70; AltName: 
Full=Heat shock 70 kDa protein; AltName: Full=Heat shock 
protein 70 (chloroplast) [Guillardia theta]
 gb|AAC35702.1| Hsp70-type chaperone (chloroplast) [Guillardia theta]
Length=627

 Score =   171 bits (433),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 97/177 (55%), Positives = 121/177 (68%), Gaps = 12/177 (7%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEV FDIDANGILSVTA DKGTGK+Q ITITGASTLPSDEVERMV+EA+  A+EDK
Sbjct  463  GVPQIEVTFDIDANGILSVTAKDKGTGKEQSITITGASTLPSDEVERMVNEAQNSAKEDK  522

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRD ID KNQ+DS+ YQ+EKQLKEL  K+    K K+ + + ELR+AI+  +   M+D 
Sbjct  523  EKRDKIDLKNQSDSLCYQSEKQLKELEGKIDDTNKNKISSMISELRNAINNENYDEMRDL  582

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDGDVIDADFTDSK  339
             + L   +M LG+S+Y +                  S SS    +  VIDADF+++K
Sbjct  583  NSKLQTALMDLGKSVYEK------------TSKEQTSTSSPTNSNDSVIDADFSETK  627



>ref|XP_011397217.1| Stromal 70 kDa heat shock-related protein, chloroplastic [Auxenochlorella 
protothecoides]
 gb|KFM24329.1| Stromal 70 kDa heat shock-related protein, chloroplastic [Auxenochlorella 
protothecoides]
Length=683

 Score =   170 bits (431),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 84/136 (62%), Positives = 107/136 (79%), Gaps = 0/136 (0%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEV+FDIDANGILSVTA DKGTGK QDI ITGASTLP +EV+RMV +AE+FA+ED+
Sbjct  501  GVPQIEVRFDIDANGILSVTASDKGTGKSQDIKITGASTLPGEEVDRMVKDAEKFAEEDR  560

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            ++R+ +D KNQADS+VYQTEKQL E G+K P  VK K+E ++  ++ A  G    A+K A
Sbjct  561  KRRELVDLKNQADSIVYQTEKQLAEFGDKAPADVKAKLEERVEAVKKAAPGEDAAAIKAA  620

Query  509  MAALNQEVMQLGQSLY  462
            +  L +E M LGQ++Y
Sbjct  621  IEDLQKEAMALGQAVY  636



>gb|KIZ03901.1| Stromal heat shock-related protein, chloroplastic Flags: Precursor 
[Monoraphidium neglectum]
Length=680

 Score =   167 bits (423),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 95/181 (52%), Positives = 121/181 (67%), Gaps = 6/181 (3%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            G+PQIEVKFDIDANGILSVTA DKGTGKKQDI ITGASTL  DEVE+MV+EA+RFA+EDK
Sbjct  499  GIPQIEVKFDIDANGILSVTATDKGTGKKQDIKITGASTLGKDEVEKMVNEADRFAEEDK  558

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            ++R+A++ KN A+ ++YQTEKQLKE  EKVP  +K KVE K+  ++DA++  +T  +K  
Sbjct  559  KRREAVEAKNSAEGLIYQTEKQLKEFAEKVPAELKAKVEEKVKAVKDAVAEDNTDKIKAT  618

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDGD------VIDADFT  348
               L +EVM LG ++Y+Q      A      G                     VIDA+FT
Sbjct  619  SEELQKEVMNLGAAVYSQGGQQQQAPGAEAPGGGAAPGGGSAPGGSGKGDDGSVIDAEFT  678

Query  347  D  345
            D
Sbjct  679  D  679



>ref|YP_001293579.1| heat shock protein 70 [Rhodomonas salina]
 gb|ABO70801.1| heat shock protein 70 [Rhodomonas salina]
Length=629

 Score =   166 bits (419),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 95/178 (53%), Positives = 122/178 (69%), Gaps = 12/178 (7%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEV FDIDANGILSVTA DKGTGK+Q ITITGASTLPSDEV+RMV E+E+ A EDK
Sbjct  463  GVPQIEVTFDIDANGILSVTAKDKGTGKEQSITITGASTLPSDEVDRMVRESEKNAAEDK  522

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKR+ ID KNQ+DS+ YQ+EKQ+K+LG+KV    K K+EA + +LR+A+     +AM   
Sbjct  523  EKRERIDLKNQSDSLCYQSEKQIKDLGDKVTEEDKNKIEASITKLREAVEKDDYEAMGTL  582

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDGD-VIDADFTDSK  339
               L  E+M++G+ +Y++                     S K  D D VIDADF+++K
Sbjct  583  NKVLQDELMEIGKKVYSK-----------AETPNQEPSKSEKTRDNDSVIDADFSETK  629



>ref|WP_009456920.1| MULTISPECIES: chaperone protein DnaK [Fischerella]
 gb|EHC14028.1| Chaperone protein dnaK [Fischerella sp. JSC-11]
Length=638

 Score =   165 bits (417),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 98/177 (55%), Positives = 119/177 (67%), Gaps = 0/177 (0%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEV FDIDANGIL+VTA DKGTGK+Q I+ITGASTL   +VERMV EAE+ A  DK
Sbjct  462  GVPQIEVTFDIDANGILNVTAKDKGTGKEQSISITGASTLDKSDVERMVREAEQNAAADK  521

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            E+R+ ID KNQADS+ YQ EKQL+ELG+KVP   K KVE  + +LRDAIS    + +K  
Sbjct  522  ERREKIDRKNQADSLAYQAEKQLQELGDKVPAADKTKVEGLVKDLRDAISKDDDEQIKKL  581

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDGDVIDADFTDSK  339
            M  L Q +  +G ++Y Q         T    +   + SS  G   DVIDADFT+SK
Sbjct  582  MPELQQALFAVGSNIYQQAGGGATGDGTGTTDAGAGASSSTGGGGDDVIDADFTESK  638



>ref|WP_017315433.1| chaperone protein DnaK [Mastigocladopsis repens]
Length=639

 Score =   164 bits (415),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 97/177 (55%), Positives = 121/177 (68%), Gaps = 0/177 (0%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEV FDIDANGIL+VTA DKGTGK+Q I+ITGASTL   EVERMV+EAE+ A  DK
Sbjct  463  GVPQIEVIFDIDANGILNVTAKDKGTGKEQSISITGASTLDKSEVERMVNEAEKNASADK  522

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            E+R+ ID KNQADS+ YQ EKQ++ELG+KVP   K K+E  + +LRDA+S    + +K  
Sbjct  523  ERREKIDRKNQADSLSYQAEKQIQELGDKVPAADKTKIEGLVKDLRDAVSKEDDEQIKKL  582

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDGDVIDADFTDSK  339
            M  L Q +  +G ++Y Q     G+    GG       +S  G   DVIDADFT+SK
Sbjct  583  MPELQQALFAVGSNIYQQAGGGDGSAAGAGGADTSGGGASSSGSGDDVIDADFTESK  639



>ref|WP_009629403.1| chaperone protein DnaK [Pseudanabaena biceps]
 gb|ELS30531.1| Chaperone protein dnaK [Pseudanabaena biceps PCC 7429]
Length=633

 Score =   163 bits (412),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 98/177 (55%), Positives = 116/177 (66%), Gaps = 5/177 (3%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEV FDIDANG+LSVTA DKGTGK Q I+I+GASTLP DEVERMV+EAER A  DK
Sbjct  462  GVPQIEVIFDIDANGLLSVTAKDKGTGKVQTISISGASTLPKDEVERMVNEAERNASADK  521

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRD I+ KNQADS+ YQ EKQLK+LG+KVP   K K+E  +  LR+ I+    +A+   
Sbjct  522  EKRDRIEAKNQADSLAYQAEKQLKDLGDKVPDAEKTKIEGLVKSLREVIAKDDHEAISAQ  581

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDGDVIDADFTDSK  339
               L Q +  L  S+Y Q     G    P G +           D DVIDADFT+SK
Sbjct  582  TEELKQALYALSSSVYQQ-----GGAEAPEGAAPQDGTKDAASGDDDVIDADFTESK  633



>ref|WP_039714306.1| chaperone protein DnaK [Scytonema millei]
 gb|KIF22036.1| molecular chaperone DnaK [Scytonema millei VB511283]
Length=636

 Score =   163 bits (412),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 96/177 (54%), Positives = 124/177 (70%), Gaps = 3/177 (2%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEV FDIDANGIL+VTA DKG+GK+Q I+ITGASTL  +EVERMV+EAER A  DK
Sbjct  463  GVPQIEVTFDIDANGILNVTAKDKGSGKEQSISITGASTLDKNEVERMVTEAERNASTDK  522

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            E+R+ +D KNQADS+ YQ EKQLK+LG+KVP   + KVE  + +LR+A++    +A++  
Sbjct  523  ERREKVDRKNQADSLSYQAEKQLKDLGDKVPASDRTKVEGLIKDLREAVNKEDDEAIQRV  582

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDGDVIDADFTDSK  339
            M  L Q +  +G +LY Q   +   G  PG G  G + +       DVIDADFT+SK
Sbjct  583  MPELQQTLYAIGTNLYQQTGGAAPGGADPGAGDGGSTSAPSGD---DVIDADFTESK  636



>ref|WP_016868683.1| chaperone protein DnaK [Fischerella muscicola]
Length=638

 Score =   162 bits (411),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 98/177 (55%), Positives = 120/177 (68%), Gaps = 0/177 (0%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEV FDIDANGIL+VTA DKGTGK+Q I+ITGASTL   +VERMV EAE+ A  DK
Sbjct  462  GVPQIEVTFDIDANGILNVTAKDKGTGKEQSISITGASTLDKSDVERMVREAEQNAAADK  521

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            E+R+ ID KNQADS+ YQ EKQL+ELG+KVP   K KVE  + +LRDAIS    + +K  
Sbjct  522  ERREKIDRKNQADSLAYQAEKQLQELGDKVPAADKTKVEGLVKDLRDAISKDDDEQIKKL  581

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDGDVIDADFTDSK  339
            M  L Q +  +G ++Y Q         T    ++  + SS  G   DVIDADFT+SK
Sbjct  582  MPELQQALFAVGSNIYQQAGGGATGDGTGTTDASAGASSSTGGGGDDVIDADFTESK  638



>ref|WP_019500233.1| chaperone protein DnaK [Pseudanabaena sp. PCC 6802]
Length=637

 Score =   162 bits (409),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 98/177 (55%), Positives = 117/177 (66%), Gaps = 1/177 (1%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEV FDIDANGIL+V A DKGTGK+Q ITITGASTLP  EVERMV EAE  A  DK
Sbjct  462  GVPQIEVTFDIDANGILAVKAKDKGTGKEQSITITGASTLPDSEVERMVREAEANASSDK  521

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKR+ I+ KNQADS+ YQ EKQ+K+LG+KVP   K K+E  + +LRDAI+      +K  
Sbjct  522  EKRERIEAKNQADSLAYQAEKQIKDLGDKVPAADKTKIEGLIKDLRDAIASEDHDRIKSL  581

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDGDVIDADFTDSK  339
               L Q +  L  S+Y Q S   G+      G    +  +  G D DVIDADFT+SK
Sbjct  582  SEDLKQALYALSTSVYQQSSGDGGSSSGGSSGMDDSTRDAASGSD-DVIDADFTESK  637



>ref|WP_019508739.1| chaperone protein DnaK [Pleurocapsa sp. PCC 7319]
Length=640

 Score =   161 bits (408),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 95/178 (53%), Positives = 123/178 (69%), Gaps = 1/178 (1%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEV FDIDANGIL+VTA DKGTGK+Q I+ITGASTLP DEV+RMV EAE  A  DK
Sbjct  463  GVPQIEVTFDIDANGILNVTAKDKGTGKEQSISITGASTLPDDEVDRMVQEAESNAAADK  522

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            E+R+AID KNQADS+VYQ EKQL ELG+KVP   K K E  + +L++A++    + +K  
Sbjct  523  ERREAIDRKNQADSLVYQAEKQLSELGDKVPADDKTKAEGLIKDLKEAVASEDDEKIKTL  582

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDG-DVIDADFTDSK  339
            +  L Q +  +G ++Y Q   +  A P    G+  P E +     G DVIDA+F+++K
Sbjct  583  LPELQQTLYSIGSNIYQQGEGAADAAPGGAPGAEAPPEDAEGSSSGDDVIDAEFSETK  640



>ref|WP_036481538.1| chaperone protein DnaK [Myxosarcina sp. GI1]
Length=644

 Score =   161 bits (408),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 83/138 (60%), Positives = 102/138 (74%), Gaps = 0/138 (0%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEV FDIDANGIL+VTA DKGTGK+Q I+ITGASTLP DEV+RMV EAE  A  DK
Sbjct  463  GVPQIEVTFDIDANGILNVTAKDKGTGKEQSISITGASTLPDDEVDRMVQEAESNASADK  522

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            E+R+ ID KNQADS+VYQ EKQL ELG+KVP   K K E  + +L+DA++    + +K  
Sbjct  523  ERREKIDRKNQADSLVYQAEKQLNELGDKVPADDKSKAEGLIKDLKDAVAAEDDEKIKTV  582

Query  509  MAALNQEVMQLGQSLYNQ  456
            M  L Q +  +G ++Y Q
Sbjct  583  MPELQQILYTIGSNIYQQ  600



>ref|WP_025945435.1| hypothetical protein, partial [Prochlorococcus sp. scB241_528K19]
Length=322

 Score =   156 bits (395),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 97/177 (55%), Positives = 120/177 (68%), Gaps = 3/177 (2%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEV FDIDANGILSVTA DKG+GK+Q I+ITGASTL  +EVE+MV +AE  A  DK
Sbjct  148  GVPQIEVTFDIDANGILSVTAKDKGSGKEQSISITGASTLSDNEVEKMVKDAESNASADK  207

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKR+ ID KNQA+++VYQTEKQL ELG+K+    K KVE K   L++A S    ++MK  
Sbjct  208  EKREKIDLKNQAETLVYQTEKQLGELGDKIDAAAKSKVEEKSNALKEATSKEDYESMKKL  267

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDGDVIDADFTDSK  339
            +  L QE+  +G S+Y QP   P +    GG     S   G     DVIDADFT++K
Sbjct  268  LEELQQELYAVGSSVYQQPGNQPPSPGAAGGSDQNDSNEKGGD---DVIDADFTETK  321



>ref|WP_015202638.1| chaperone protein DnaK [Crinalium epipsammum]
 gb|AFZ12517.1| Chaperone protein dnaK [Crinalium epipsammum PCC 9333]
Length=638

 Score =   160 bits (406),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 91/177 (51%), Positives = 118/177 (67%), Gaps = 1/177 (1%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEV FDIDANGIL V A DKGTGK+Q I+ITGASTLP+DEV+RMV EAE+ +  D+
Sbjct  463  GVPQIEVTFDIDANGILQVMAKDKGTGKEQSISITGASTLPNDEVDRMVKEAEKNSSADR  522

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            E+R+ ID KNQADS+VYQ EKQ+ ELG+KVP   K K E  + +LRDA++      +K  
Sbjct  523  ERREKIDRKNQADSLVYQAEKQITELGDKVPAGDKSKAEGLINDLRDAVAKDDDDRIKTV  582

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDGDVIDADFTDSK  339
            M  L Q +  +G S+Y Q   +           A  +  +  G D DVIDA+F+++K
Sbjct  583  MPELQQTLYTIGSSIYQQAGGATADPTGGASDGASGNGQTSGGGD-DVIDAEFSETK  638



>ref|WP_009555257.1| chaperone protein DnaK [Oscillatoriales cyanobacterium JSC-12]
 gb|EKQ70683.1| chaperone protein DnaK [Oscillatoriales cyanobacterium JSC-12]
Length=638

 Score =   160 bits (406),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 95/177 (54%), Positives = 118/177 (67%), Gaps = 0/177 (0%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEV FDIDANGIL VTA DKGTGK+Q I+ITGASTLP +EVERMV +AER A  DK
Sbjct  462  GVPQIEVTFDIDANGILQVTAKDKGTGKEQSISITGASTLPKEEVERMVKDAERNAAADK  521

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            E+R+ ID KNQAD++ YQ EKQL ELG+KVP   K K+E  + +LR+A S      +K  
Sbjct  522  ERREKIDLKNQADTLAYQAEKQLGELGDKVPEADKTKLEGLIKDLREAASKEDFDRIKSL  581

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDGDVIDADFTDSK  339
               L Q +  +G ++Y Q   +     +     AG S  +G   + DVIDADFT+SK
Sbjct  582  TTELQQALYTIGSNIYQQAGGASPGDGSSSDPGAGSSAGAGSSGEDDVIDADFTESK  638



>ref|WP_015154138.1| chaperone protein DnaK [Chroococcidiopsis thermalis]
 gb|AFY87590.1| chaperone protein DnaK [Chroococcidiopsis thermalis PCC 7203]
Length=636

 Score =   160 bits (405),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 96/177 (54%), Positives = 125/177 (71%), Gaps = 3/177 (2%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEV FDIDANGIL+VTA DKG+GK+Q I+ITGASTL  +EVERMV+EAER A  DK
Sbjct  463  GVPQIEVTFDIDANGILNVTAKDKGSGKEQSISITGASTLDKNEVERMVTEAERNASTDK  522

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            ++R+ +D KNQADS+ YQ EKQLK+LG+KVP   + KVE  + +LR+A++    +A++  
Sbjct  523  DRREKVDRKNQADSLSYQAEKQLKDLGDKVPASDRTKVEGLIKDLREAVNKEDDEAIQRV  582

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDGDVIDADFTDSK  339
            M  L Q +  +G +LY Q   +   G  PG G  G + + G     DVIDADFT+SK
Sbjct  583  MPELQQTLYAIGTNLYQQAGGAAPGGADPGAGEGGSTSAPGGD---DVIDADFTESK  636



>ref|WP_019478314.1| chaperone protein DnaK [Prochlorococcus sp. W8]
Length=631

 Score =   160 bits (405),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 96/178 (54%), Positives = 119/178 (67%), Gaps = 8/178 (4%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEV FDIDANGILSVTA DKG+GK+Q I+ITGASTL  +EV++MV +AE  A  DK
Sbjct  461  GVPQIEVTFDIDANGILSVTAKDKGSGKEQSISITGASTLSDNEVDKMVKDAETNASADK  520

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRD ID KNQ++++VYQTEKQL ELG+K+    K KVE K   L+DAIS      MK  
Sbjct  521  EKRDRIDLKNQSETLVYQTEKQLAELGDKIDQATKSKVEEKSKTLKDAISNEDYDLMKKL  580

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDG-DVIDADFTDSK  339
            +  L QE+  +G S+Y Q              +    ++S +  DG DVIDADFT+SK
Sbjct  581  LEELQQELYAVGSSVYQQ-------PGNQAPAAGSEEQTSSEKNDGDDVIDADFTESK  631



>ref|WP_017308317.1| chaperone protein DnaK [Fischerella sp. PCC 9339]
Length=629

 Score =   160 bits (405),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 94/177 (53%), Positives = 116/177 (66%), Gaps = 10/177 (6%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            G+PQIEV FDIDANGILS TA +K TGKKQ I+ITGASTL   EVERMV EAER A+ED+
Sbjct  463  GMPQIEVTFDIDANGILSATAREKATGKKQSISITGASTLDKSEVERMVKEAERNAEEDR  522

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
             +R+ IDTKN ADSV YQ EKQL++LG+KVP   K +VE  +G+LR AI   +   MK  
Sbjct  523  RRREQIDTKNMADSVAYQAEKQLQDLGDKVPPADKSRVEGLIGDLRQAIEQNNIDRMKSL  582

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDGDVIDADFTDSK  339
               + Q +MQ+G ++Y+Q  ASP  G +                  DVIDADF + K
Sbjct  583  TNEIQQALMQIGTAVYSQAGASPNGGTSTDRQGGSE----------DVIDADFVEQK  629



>ref|WP_006511409.1| chaperone protein DnaK [Xenococcus sp. PCC 7305]
 gb|ELS01476.1| chaperone protein DnaK [Xenococcus sp. PCC 7305]
Length=643

 Score =   160 bits (405),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 83/138 (60%), Positives = 103/138 (75%), Gaps = 0/138 (0%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEV FDIDANGIL+V A DKGTGK+Q I+ITGASTLP +EV+RMV+EAE  A  DK
Sbjct  463  GVPQIEVTFDIDANGILNVAAKDKGTGKEQSISITGASTLPDEEVDRMVNEAEANADADK  522

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            E+RDAID KNQADS+VYQ EKQ+ ELG+KVP   K K E  + +L+DA++    + +K  
Sbjct  523  ERRDAIDRKNQADSLVYQAEKQINELGDKVPEADKTKAEGLIKDLKDALAAEDDEKIKTL  582

Query  509  MAALNQEVMQLGQSLYNQ  456
            M  L Q +  +G S+Y Q
Sbjct  583  MPELQQVLYTIGSSVYQQ  600



>ref|WP_017743340.1| chaperone protein DnaK [Scytonema hofmanni]
Length=639

 Score =   160 bits (404),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 96/177 (54%), Positives = 120/177 (68%), Gaps = 0/177 (0%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEV FDIDANGIL+VTA DKGTGK+Q I+ITGASTL   EV+RMV+EAER A  DK
Sbjct  463  GVPQIEVIFDIDANGILNVTAKDKGTGKEQSISITGASTLDKSEVDRMVNEAERNASTDK  522

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            E+R+ ID KNQADS+ YQ EKQL+ELG+KVP   K KV   + +LRDA++    + +K  
Sbjct  523  ERREKIDRKNQADSLAYQAEKQLEELGDKVPDADKTKVAGLVKDLRDAVAKEDDEQIKKV  582

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDGDVIDADFTDSK  339
            M  L Q +  +G ++Y Q      A  +    ++    SS  G   DVIDADFT+SK
Sbjct  583  MPELQQALFAVGSNIYQQGGGDTSASSSSSSSTSDGGASSSGGSGDDVIDADFTESK  639



>ref|WP_015193629.1| chaperone protein DnaK [Stanieria cyanosphaera]
 gb|AFZ35961.1| Chaperone protein dnaK [Stanieria cyanosphaera PCC 7437]
Length=637

 Score =   160 bits (404),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 82/138 (59%), Positives = 103/138 (75%), Gaps = 0/138 (0%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEV FDIDANGIL+VTA DKGTGK+Q I+ITGASTLP DEV+RMV EAE  A  D+
Sbjct  463  GVPQIEVTFDIDANGILNVTAKDKGTGKEQSISITGASTLPDDEVDRMVREAESNAAADQ  522

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            E+R+ ID KNQADS+VYQ EKQL ELG+KVP   K K E  + +LR+A++  + + +K  
Sbjct  523  ERREKIDRKNQADSLVYQAEKQLTELGDKVPAADKTKAEGLIKDLREAVNSENDEKIKTL  582

Query  509  MAALNQEVMQLGQSLYNQ  456
            M  L Q +  +G ++Y Q
Sbjct  583  MPELQQTLYSIGSNIYQQ  600



>ref|WP_007355040.1| MULTISPECIES: chaperone protein DnaK [Kamptonema]
 emb|CBN55825.1| molecular chaperone DnaK [ [[Oscillatoria] sp. PCC 6506]
Length=639

 Score =   159 bits (403),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 97/177 (55%), Positives = 116/177 (66%), Gaps = 0/177 (0%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEV FDIDANGIL+V A DKGTGK+Q I+ITGASTLP +EVERMV EAE  A  DK
Sbjct  462  GVPQIEVTFDIDANGILNVAAKDKGTGKEQSISITGASTLPGNEVERMVKEAEANATADK  521

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            E+R+ ID KNQADS+ YQ EKQL ELG+KVP   K K+E  + +LRDAI+      +K  
Sbjct  522  ERRERIDRKNQADSLAYQIEKQLAELGDKVPAADKTKIEGLIKDLRDAIAKEDDDRIKTL  581

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDGDVIDADFTDSK  339
               L Q    +  +LY Q     G G   G G+ G   + G     DVIDADFT++K
Sbjct  582  TTELQQAFYAVSSNLYQQAGGDGGPGGPGGPGAPGGGATGGGSAPDDVIDADFTEAK  638



>ref|WP_017321213.1| chaperone protein DnaK [cyanobacterium PCC 7702]
Length=635

 Score =   159 bits (403),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 99/177 (56%), Positives = 120/177 (68%), Gaps = 4/177 (2%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEV FDIDANGIL+VTA DKGTGK+Q I+ITGASTL   EVERMV EAER A  D+
Sbjct  463  GVPQIEVVFDIDANGILNVTAKDKGTGKEQSISITGASTLDKAEVERMVKEAERNAAADR  522

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            E+R+ ID KNQADS+ YQ EKQL+ELG+KV    K KVE  + ELR+AIS    + +K  
Sbjct  523  ERREKIDRKNQADSLAYQAEKQLQELGDKVNAADKTKVEGLVKELREAISKEDDEQIKKL  582

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDGDVIDADFTDSK  339
            M  L Q +  +G ++Y Q  AS  +        +  S  SG+    DVIDADFT+SK
Sbjct  583  MPELQQALFAVGSNIYQQAGASTSSAGAGSSDGSTSSSGSGE----DVIDADFTESK  635



>gb|ABE11434.1| molecular chaperone DnaK2, heat shock protein hsp70-2 [uncultured 
Prochlorococcus marinus clone HOT0M-3E5]
Length=381

 Score =   156 bits (394),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 97/177 (55%), Positives = 120/177 (68%), Gaps = 3/177 (2%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEV FDIDANGILSVTA DKG+GK+Q I+ITGASTL  +EVE+MV +AE  A  DK
Sbjct  207  GVPQIEVTFDIDANGILSVTAKDKGSGKEQSISITGASTLSDNEVEKMVKDAESNASADK  266

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKR+ ID KNQA+++VYQTEKQL ELG+K+    K KVE K   L++A S    ++MK  
Sbjct  267  EKREKIDLKNQAETLVYQTEKQLGELGDKIDAAAKSKVEEKSNALKEATSKEDYESMKKL  326

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDGDVIDADFTDSK  339
            +  L QE+  +G S+Y QP   P +    GG     S   G     DVIDADFT++K
Sbjct  327  LEELQQELYAVGSSVYQQPGNQPPSPGAAGGPDQSDSNEKGGD---DVIDADFTETK  380



>ref|WP_017289630.1| chaperone protein DnaK [Leptolyngbya boryana]
Length=633

 Score =   159 bits (402),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 93/177 (53%), Positives = 114/177 (64%), Gaps = 5/177 (3%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEV FDIDANGIL+V+A DKGTGK+Q I+ITGASTLP D+VERMV +AE+ A  DK
Sbjct  462  GVPQIEVTFDIDANGILTVSAKDKGTGKEQSISITGASTLPKDDVERMVRDAEQNASTDK  521

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            E+R+ ID KNQADS+ YQ EKQ+ ELG+KVP   K KVE  + +LRDAI+      +K  
Sbjct  522  ERRERIDLKNQADSLAYQAEKQISELGDKVPADDKTKVEGLVKDLRDAIAAEDFDRIKSL  581

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDGDVIDADFTDSK  339
               L Q +  + Q+LY Q                G +         DVIDADFT+SK
Sbjct  582  QTDLQQSLYGISQNLYQQAGGEAPGADPGASAGGGSTSGGD-----DVIDADFTESK  633



>ref|WP_015121772.1| chaperone protein DnaK [Rivularia sp. PCC 7116]
 gb|AFY58220.1| chaperone protein DnaK [Rivularia sp. PCC 7116]
Length=642

 Score =   159 bits (402),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 96/180 (53%), Positives = 123/180 (68%), Gaps = 3/180 (2%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEV FDIDANGIL+VTA DKGTGK+Q I+ITGASTL   EVERMV+EAE F+  DK
Sbjct  463  GVPQIEVVFDIDANGILNVTAKDKGTGKEQSISITGASTLDKTEVERMVNEAESFSSTDK  522

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            E+R+ ID KNQADS+ YQ EKQL+ELG+KVP   K K+E  + +L+DA++    + ++  
Sbjct  523  ERREKIDRKNQADSLAYQAEKQLQELGDKVPADDKTKIEGLVKDLKDAVAKEDDEQIQKV  582

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggs---agpsessgkgPDGDVIDADFTDSK  339
            M  L Q +  +G ++Y Q   +   G  PGG +   A     +G     DVIDADFT+SK
Sbjct  583  MPELQQALFTVGSNMYQQAGGAAPDGAAPGGEAPNGATGDADAGASAGDDVIDADFTESK  642



>ref|WP_022606184.1| chaperone protein DnaK [Rubidibacter lacunae]
 gb|ERN41852.1| chaperone protein DnaK [Rubidibacter lacunae KORDI 51-2]
Length=639

 Score =   159 bits (402),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 90/177 (51%), Positives = 119/177 (67%), Gaps = 0/177 (0%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEV FDIDANGIL+VTA DKGTGK+Q I+ITGASTL  DEV RMV EAE+ A EDK
Sbjct  463  GVPQIEVTFDIDANGILNVTAKDKGTGKEQSISITGASTLSDDEVNRMVDEAEKNASEDK  522

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            E+R+ I+ KNQADS+VYQ +KQL+ELG+KVP   K K E  + +LRDA++      ++  
Sbjct  523  ERRERIERKNQADSLVYQADKQLQELGDKVPADDKSKAEGLIADLRDAVAKEDDDRIQTL  582

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDGDVIDADFTDSK  339
            M  L Q +  +G ++Y Q + +     +        + SS      DVIDA+F+++K
Sbjct  583  MPELQQTLYSIGTNVYQQGAPAGAPDGSAPDSGPTDAGSSASSDGDDVIDAEFSETK  639



>gb|KIE09746.1| molecular chaperone DnaK [Tolypothrix bouteillei VB521301]
Length=637

 Score =   159 bits (401),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 100/177 (56%), Positives = 122/177 (69%), Gaps = 2/177 (1%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEV FDIDANGIL+VTA DKGTGK+Q I+ITGASTL   EVERMV+EAER A  DK
Sbjct  463  GVPQIEVIFDIDANGILNVTAKDKGTGKEQSISITGASTLDKTEVERMVNEAERNASTDK  522

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            E+R+ ID KNQADS+ YQ EKQL+ELG+KVP   K KVE  + +LR+A++    + +K  
Sbjct  523  ERREKIDRKNQADSLAYQAEKQLEELGDKVPAADKTKVEGLVKDLREAVAKEDDEQIKKV  582

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDGDVIDADFTDSK  339
            M  L Q +  +G ++Y Q      A   P   S G + S G G   DVIDADFT+SK
Sbjct  583  MPELQQALFAVGSNIYQQAGGGASATGAPSDPSDGGASSGGSGD--DVIDADFTESK  637



>ref|WP_019477473.1| chaperone protein DnaK [Prochlorococcus sp. W7]
Length=631

 Score =   159 bits (401),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 94/178 (53%), Positives = 119/178 (67%), Gaps = 8/178 (4%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEV FDIDANGILSVTA DKG+GK+Q I+ITGASTL  +EV++MV +AE  A  DK
Sbjct  461  GVPQIEVTFDIDANGILSVTAKDKGSGKEQSISITGASTLSDNEVDKMVKDAETNASADK  520

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRD ID KNQ++++VYQTEKQL ELG+K+    K KVE K   L+DA++     +MK  
Sbjct  521  EKRDRIDLKNQSETLVYQTEKQLAELGDKIDQATKSKVEEKSKALKDAVANEDYDSMKKL  580

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDG-DVIDADFTDSK  339
            +  L QE+  +G S+Y Q              +    ++S    DG DVIDADFT+SK
Sbjct  581  LEELQQELYAVGSSVYQQ-------PGNQPPAAGSEQQTSSDKNDGDDVIDADFTESK  631



>ref|WP_017721694.1| chaperone protein DnaK [Oscillatoria sp. PCC 10802]
Length=633

 Score =   159 bits (401),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 89/177 (50%), Positives = 117/177 (66%), Gaps = 6/177 (3%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEV FDIDANGILSV+A DKGTGK+Q ITITGASTL   +VERMV EAER A+ D+
Sbjct  463  GVPQIEVTFDIDANGILSVSAKDKGTGKQQSITITGASTLDKSDVERMVKEAERNAESDR  522

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            ++R+ IDTKN ADS+ YQ EKQLK+LG+KVP   + + E  + +LR+AI+  ++  +K  
Sbjct  523  KRREEIDTKNMADSLAYQAEKQLKDLGDKVPAADRSRAEGLIKDLREAINTNNSDRIKSL  582

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDGDVIDADFTDSK  339
               L Q +MQ+G ++Y Q   S  +     G     +         DVIDADF + +
Sbjct  583  SDNLQQAMMQIGSAIYAQAGGSAPSSKAHAGDPGSSAGGE------DVIDADFVERR  633



>ref|WP_016863303.1| chaperone protein DnaK [Fischerella muscicola]
Length=635

 Score =   158 bits (400),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 94/177 (53%), Positives = 114/177 (64%), Gaps = 3/177 (2%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEV FDIDANGIL+VTA DKGTGK+Q I+ITGASTL   +VERMV EAE+ A  DK
Sbjct  462  GVPQIEVVFDIDANGILNVTAKDKGTGKEQSISITGASTLDKSDVERMVREAEQNASTDK  521

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            E+R+ ID KNQADS+ YQ EKQL+ELG+KVP   K KVE  + +LRDAI+    + +K  
Sbjct  522  ERREKIDRKNQADSLAYQAEKQLQELGDKVPEADKTKVEGLVKDLRDAITKDDDEQIKKL  581

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDGDVIDADFTDSK  339
            M  L Q +  +G ++Y Q                  S         DVIDADFT+SK
Sbjct  582  MPELQQALFAVGSNIYQQAGGGAPTDAAGTTDGGASSTGGTGD---DVIDADFTESK  635



>ref|WP_015142182.1| chaperone protein DnaK [Pleurocapsa minor]
 gb|AFY75874.1| chaperone protein DnaK [Pleurocapsa sp. PCC 7327]
Length=623

 Score =   158 bits (399),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 89/177 (50%), Positives = 116/177 (66%), Gaps = 16/177 (9%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEV FDIDANGILSVTA D+GTGK+Q I+ITGASTLP +EVERMV +AE  A ED+
Sbjct  463  GVPQIEVTFDIDANGILSVTARDRGTGKQQSISITGASTLPKNEVERMVRDAESHAAEDR  522

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            ++R+ IDTKN ADS  YQ EKQL++LG++V    K +VE  + +LR+AI+  +   MK  
Sbjct  523  KRREQIDTKNLADSAAYQAEKQLRDLGDRVSAADKSRVEGLVKDLREAINQENYDRMKSL  582

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDGDVIDADFTDSK  339
               L Q +MQ+G ++Y Q  ++ G                      DVIDADF ++K
Sbjct  583  TNELQQLLMQVGSNIYAQAGSATGGTAGG----------------NDVIDADFVENK  623



>ref|WP_026721546.1| chaperone protein DnaK [Fischerella sp. PCC 9431]
Length=635

 Score =   158 bits (399),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 95/177 (54%), Positives = 115/177 (65%), Gaps = 3/177 (2%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEV FDIDANGIL+VTA DKGTGK+Q I+ITGASTL   +VERMV EAE+ A  DK
Sbjct  462  GVPQIEVVFDIDANGILNVTAKDKGTGKEQSISITGASTLDKSDVERMVREAEQNASTDK  521

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            E+R+ ID KNQADS+ YQ EKQL+ELG+KVP   K KVE  + +LRDAI+    + +K  
Sbjct  522  ERREKIDRKNQADSLAYQAEKQLQELGDKVPEADKSKVEGLVKDLRDAITKDDDEQIKKL  581

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDGDVIDADFTDSK  339
            M  L Q +  +G ++Y Q         T        S         DVIDADFT+SK
Sbjct  582  MPELQQALFAVGSNIYQQAGGGAPTDGTGTTDGGASSTGGTGD---DVIDADFTESK  635



>gb|KIJ82554.1| molecular chaperone DnaK [Scytonema tolypothrichoides VB-61278]
Length=637

 Score =   158 bits (399),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 101/177 (57%), Positives = 123/177 (69%), Gaps = 2/177 (1%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEV FDIDANGIL+VTA DKGTGK+Q I+ITGASTL   +VERMV EAE+ A  DK
Sbjct  463  GVPQIEVVFDIDANGILNVTAKDKGTGKEQSISITGASTLDKSDVERMVREAEQNASTDK  522

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            E+R+ ID KNQADS+ YQ EKQL+ELG+KVP   K KVE  + +LRDA+S    + +K  
Sbjct  523  ERREKIDRKNQADSLAYQAEKQLQELGDKVPPADKTKVEGLVKDLRDAVSKEDDEQIKKV  582

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDGDVIDADFTDSK  339
            M  L Q +  +G ++Y Q   +  +  T    S G S SSG G   DVIDADFT+SK
Sbjct  583  MPELQQALFAVGSNIYQQAGGAEASANTGANTSDGSSSSSGSGD--DVIDADFTESK  637



>ref|WP_023069128.1| chaperone protein DnaK [Lyngbya aestuarii]
 gb|ERT04607.1| chaperone protein DnaK [Lyngbya aestuarii BL J]
Length=641

 Score =   158 bits (399),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 95/179 (53%), Positives = 118/179 (66%), Gaps = 2/179 (1%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEV FDIDANGIL+VTA DKGTGK+Q I+ITGASTLP  EVERMV EAE+ A  DK
Sbjct  463  GVPQIEVTFDIDANGILNVTAKDKGTGKEQSISITGASTLPDTEVERMVQEAEQNASTDK  522

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            E+R+ ID KNQADS+ YQ EKQ+ ELG+KVP   K K+E  + +LR+AIS  + + ++  
Sbjct  523  ERREKIDRKNQADSLSYQAEKQISELGDKVPADEKTKIEGMIKDLREAISQDNDEKIQTL  582

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDG--DVIDADFTDSK  339
               L Q +  L  +LY Q   + GA      G      +S        DVIDADFT++K
Sbjct  583  TTDLQQALYTLSSNLYQQAGGAEGAPGEGAPGPEAGDSASSSSSSSSEDVIDADFTETK  641



>dbj|BAQ61644.1| chaperone protein DnaK [Geminocystis sp. NIES-3708]
Length=632

 Score =   158 bits (399),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 83/138 (60%), Positives = 103/138 (75%), Gaps = 0/138 (0%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEV FDIDANGIL+VTA DKGTGK+Q I+ITGASTLP DEV+RMV EAE  A  DK
Sbjct  462  GVPQIEVIFDIDANGILNVTAKDKGTGKEQSISITGASTLPDDEVDRMVKEAENNAAADK  521

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            E+R+AI+ KNQADS+VYQ EKQL ELG+KV G  K K E  + +L+DA++    + +K  
Sbjct  522  ERREAIERKNQADSLVYQAEKQLTELGDKVSGDDKAKAEGLIKDLKDAVAKEDDEKIKTV  581

Query  509  MAALNQEVMQLGQSLYNQ  456
            M  L Q +  +G ++Y Q
Sbjct  582  MPELQQVLYTIGSNIYQQ  599



>gb|KGF98314.1| Chaperone protein DnaK [Prochlorococcus marinus str. MIT 9302]
Length=645

 Score =   158 bits (399),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 99/177 (56%), Positives = 122/177 (69%), Gaps = 3/177 (2%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEV FDIDANGILSVTA DKG+GK+Q I+ITGASTL  +EVE+MV +AE  A  DK
Sbjct  471  GVPQIEVTFDIDANGILSVTAKDKGSGKEQSISITGASTLSDNEVEKMVKDAESNASVDK  530

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKR+ ID KNQA+++VYQTEKQL ELG+KV   VK KVE K   L++A S    ++MK  
Sbjct  531  EKREKIDLKNQAETLVYQTEKQLGELGDKVDAAVKSKVEEKSNALKEATSKEDYESMKKL  590

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDGDVIDADFTDSK  339
            +  L QE+  +G S+Y QP   P +  + GG     S   G     DVIDADFT++K
Sbjct  591  LEELQQELYAVGSSVYQQPGNQPPSPGSAGGPEKNDSNDKGSD---DVIDADFTETK  644



>ref|WP_011126020.1| MULTISPECIES: chaperone protein dnaK2 [Prochlorococcus]
 ref|NP_876262.1| Molecular chaperone, DnaK [Prochlorococcus marinus subsp. marinus 
str. CCMP1375]
 sp|Q7V9G2.1|DNAK2_PROMA RecName: Full=Chaperone protein dnaK2; AltName: Full=HSP70-2; 
AltName: Full=Heat shock 70 kDa protein 2; AltName: Full=Heat 
shock protein 70-2 [Prochlorococcus marinus subsp. marinus 
str. CCMP1375]
 gb|AAQ00915.1| Molecular chaperone, DnaK [Prochlorococcus marinus subsp. marinus 
str. CCMP1375]
 gb|KGG10590.1| Chaperone protein DnaK [Prochlorococcus marinus str. LG]
 gb|KGG19944.1| Chaperone protein DnaK [Prochlorococcus marinus str. SS2]
 gb|KGG23836.1| Chaperone protein DnaK [Prochlorococcus marinus str. SS35]
 gb|KGG31904.1| Chaperone protein DnaK [Prochlorococcus marinus str. SS51]
 gb|KGG35931.1| Chaperone protein DnaK [Prochlorococcus sp. SS52]
Length=633

 Score =   158 bits (399),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 93/177 (53%), Positives = 117/177 (66%), Gaps = 5/177 (3%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEV FDIDANGILSVTA DKG+GK+Q I+ITGASTL  +EVE+MV +AE  A  DK
Sbjct  462  GVPQIEVTFDIDANGILSVTAKDKGSGKEQSISITGASTLSDNEVEKMVKDAETNATADK  521

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKRD ID KNQA+++VYQTEKQL ELG+KV    K KVEAK  +L++A      + MK  
Sbjct  522  EKRDRIDIKNQAETLVYQTEKQLGELGDKVDEEAKAKVEAKRIQLKEATEKDDYETMKTL  581

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDGDVIDADFTDSK  339
            +  L +E+  LG S+Y Q         +          ++    + DVIDA+FT+SK
Sbjct  582  VEDLQKELYSLGASVYQQ-----SNAASQAADGTSSESNNSTEGNDDVIDAEFTESK  633



>ref|WP_032526476.1| chaperone protein DnaK [Prochlorococcus marinus]
Length=635

 Score =   157 bits (398),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 99/177 (56%), Positives = 122/177 (69%), Gaps = 3/177 (2%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEV FDIDANGILSVTA DKG+GK+Q I+ITGASTL  +EVE+MV +AE  A  DK
Sbjct  461  GVPQIEVTFDIDANGILSVTAKDKGSGKEQSISITGASTLSDNEVEKMVKDAESNASVDK  520

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKR+ ID KNQA+++VYQTEKQL ELG+KV   VK KVE K   L++A S    ++MK  
Sbjct  521  EKREKIDLKNQAETLVYQTEKQLGELGDKVDAAVKSKVEEKSNALKEATSKEDYESMKKL  580

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDGDVIDADFTDSK  339
            +  L QE+  +G S+Y QP   P +  + GG     S   G     DVIDADFT++K
Sbjct  581  LEELQQELYAVGSSVYQQPGNQPPSPGSAGGPEKNDSNDKGSD---DVIDADFTETK  634



>ref|WP_032522763.1| chaperone protein DnaK [Prochlorococcus marinus]
 gb|KGF94951.1| Chaperone protein DnaK [Prochlorococcus marinus str. MIT 9201]
Length=635

 Score =   157 bits (398),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 97/177 (55%), Positives = 119/177 (67%), Gaps = 3/177 (2%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEV FDIDANGILSVTA DKG+GK+Q I+ITGASTL  +EVE+MV +AE  A  DK
Sbjct  461  GVPQIEVTFDIDANGILSVTAKDKGSGKEQSISITGASTLSDNEVEKMVKDAESNASADK  520

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKR+ ID KNQA+++VYQTEKQL ELG+K+    K KVE K   L++AIS    + MK  
Sbjct  521  EKREKIDLKNQAETLVYQTEKQLGELGDKIDAAAKSKVEEKSNALKEAISKEDYELMKTL  580

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDGDVIDADFTDSK  339
            +  L QE+  +G S+Y QP   P +   P       S   G     DVIDADFT++K
Sbjct  581  LEELQQELYAVGSSVYQQPGNQPPSPGAPSDSDQSDSNEKGGD---DVIDADFTETK  634



>ref|WP_016872101.1| chaperone protein DnaK [Fischerella thermalis]
Length=622

 Score =   157 bits (398),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 90/177 (51%), Positives = 112/177 (63%), Gaps = 17/177 (10%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEV FDIDANGILSV+A DK TGK+Q ITITGASTL   EVE+MV EAER A+ D+
Sbjct  463  GVPQIEVTFDIDANGILSVSAKDKATGKQQSITITGASTLDKSEVEKMVKEAERNAEADR  522

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
             +R+ IDTKN ADSV YQ EKQLK+LG+KVP   K ++E  + +LR AI   +   MK  
Sbjct  523  RRREQIDTKNNADSVAYQAEKQLKDLGDKVPAADKTRLEEMIQDLRTAIEQENYDRMKSL  582

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDGDVIDADFTDSK  339
               + Q +MQ+G ++Y+Q +    +                     DVIDADF D K
Sbjct  583  TNDIQQALMQIGSAVYSQQTGGSTSSGGE-----------------DVIDADFIDQK  622



>ref|WP_025927187.1| chaperone protein DnaK [Prochlorococcus sp. scB241_528J8]
Length=635

 Score =   157 bits (398),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 97/177 (55%), Positives = 119/177 (67%), Gaps = 3/177 (2%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEV FDIDANGILSVTA DKG+GK+Q I+ITGASTL  +EVE+MV +AE  A  DK
Sbjct  461  GVPQIEVTFDIDANGILSVTAKDKGSGKEQSISITGASTLSDNEVEKMVKDAESNASADK  520

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKR+ ID KNQA+++VYQTEKQL ELG+K+    K KVE K   L++A S    ++MK  
Sbjct  521  EKREKIDLKNQAETLVYQTEKQLGELGDKIEAAAKSKVEEKSNALKEATSKEDYESMKKL  580

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDGDVIDADFTDSK  339
            +  L QE+  +G S+Y QP   P    +  G     S   G     DVIDADFT+SK
Sbjct  581  LEELQQELYAVGSSVYQQPGNQPPTPGSASGPDQTESNDKGGD---DVIDADFTESK  634



>ref|WP_006530474.1| chaperone protein DnaK [Gloeocapsa sp. PCC 73106]
 gb|ELR96619.1| chaperone protein DnaK [Gloeocapsa sp. PCC 73106]
Length=635

 Score =   157 bits (398),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 82/138 (59%), Positives = 104/138 (75%), Gaps = 0/138 (0%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEV FDIDANGIL+VTA DKGTGK+Q I+ITGASTLPS+EV+RMV EAE  A  DK
Sbjct  463  GVPQIEVTFDIDANGILNVTAKDKGTGKEQSISITGASTLPSNEVDRMVKEAEANAAADK  522

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            E+R+ ID KNQADS+VYQ EKQ++ELG+KVP   K K EA + +L++A+S    + +K  
Sbjct  523  ERREKIDRKNQADSLVYQAEKQMEELGDKVPSGDKSKAEALIKDLKEAVSQDDDERIKTL  582

Query  509  MAALNQEVMQLGQSLYNQ  456
               L Q +  +G ++Y Q
Sbjct  583  TPELQQTLYTIGTNIYQQ  600



>ref|WP_027842766.1| chaperone protein DnaK [Mastigocoleus testarum]
Length=645

 Score =   157 bits (398),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 97/183 (53%), Positives = 122/183 (67%), Gaps = 6/183 (3%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEV FDIDANGIL+VTA DKGTGK+Q I+ITGASTL   EVERMV EAE+F+ EDK
Sbjct  463  GVPQIEVTFDIDANGILNVTAKDKGTGKEQSISITGASTLDKSEVERMVDEAEKFSSEDK  522

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            E+R+ ID KNQADS+ YQ EKQ++ELG+KVP   K K+E  + +LR+A++    + ++  
Sbjct  523  ERREKIDRKNQADSLAYQAEKQIEELGDKVPADDKTKIEGLIKDLREAVNKEDDEQIQKF  582

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDG------DVIDADFT  348
            M  L Q +  +  ++Y Q           GG SAG S SS            DVIDADFT
Sbjct  583  MPELQQALFSVSSNIYQQAGGDAAGAGATGGPSAGASSSSSDSASTSGTGGDDVIDADFT  642

Query  347  DSK  339
            +SK
Sbjct  643  ESK  645



>ref|WP_032513245.1| chaperone protein DnaK [Prochlorococcus marinus]
 gb|KGF92193.1| Chaperone protein DnaK [Prochlorococcus marinus str. MIT 9107]
Length=635

 Score =   157 bits (398),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 98/177 (55%), Positives = 122/177 (69%), Gaps = 3/177 (2%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEV FDIDANGILSVTA DKG+GK+Q I+ITGASTL  +EVE+MV +AE  A  DK
Sbjct  461  GVPQIEVTFDIDANGILSVTAKDKGSGKEQSISITGASTLSDNEVEKMVKDAESNASVDK  520

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKR+ ID KNQA+++VYQTEKQL ELG+K+    K KVE K   L++AIS    ++MK  
Sbjct  521  EKREKIDLKNQAETLVYQTEKQLGELGDKIDSAAKSKVEEKSNALKEAISKEDYESMKKL  580

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDGDVIDADFTDSK  339
            +  L QE+  +G S+Y QP   P +  + GG     S   G     DVIDADFT++K
Sbjct  581  LEELQQELYAVGSSVYQQPGNQPPSPGSAGGPDQNVSNEKGGD---DVIDADFTETK  634



>ref|WP_025915295.1| chaperone protein DnaK [Prochlorococcus sp. scB245a_520K10]
Length=635

 Score =   157 bits (397),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 97/177 (55%), Positives = 119/177 (67%), Gaps = 3/177 (2%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEV FDIDANGILSVTA DKG+GK+Q I+ITGASTL  +EVE+MV +AE  A  DK
Sbjct  461  GVPQIEVTFDIDANGILSVTAKDKGSGKEQSISITGASTLSDNEVEKMVKDAESNASADK  520

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKR+ ID KNQA+++VYQTEKQL ELG+K+    K KVE K   L++A S    ++MK  
Sbjct  521  EKREKIDLKNQAETLVYQTEKQLGELGDKIDAAAKSKVEEKSNALKEATSKEDYESMKKL  580

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDGDVIDADFTDSK  339
            +  L QE+  +G S+Y QP   P    +  G     S   G     DVIDADFT+SK
Sbjct  581  LEELQQELYAVGSSVYQQPGNQPPTPGSSSGPDQTESNDKGGD---DVIDADFTESK  634



>ref|WP_011611011.1| chaperone protein DnaK [Trichodesmium erythraeum]
 gb|ABG50632.1| chaperone protein DnaK [Trichodesmium erythraeum IMS101]
Length=638

 Score =   157 bits (397),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 95/177 (54%), Positives = 120/177 (68%), Gaps = 0/177 (0%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEV FDIDANGIL+VTA DKGTGK+Q I+ITGASTLP  EV+RMV EAE  A  DK
Sbjct  462  GVPQIEVTFDIDANGILNVTAKDKGTGKEQSISITGASTLPDTEVDRMVKEAEANATADK  521

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            E+RD ID KNQADS+ YQ EKQ++ELG+KVP   K K+E  + +LRDA++    + +   
Sbjct  522  ERRDKIDRKNQADSLAYQAEKQIQELGDKVPEADKTKIEGLIKDLRDAVAQEDDEKITSL  581

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDGDVIDADFTDSK  339
               L Q +  +  ++Y Q   +PG G TP   +   + SS      DVIDADFT++K
Sbjct  582  TTELQQALYSVSSNMYQQSGGAPGEGSTPNSDAGSGASSSNATGGDDVIDADFTETK  638



>gb|KGF92589.1| Chaperone protein DnaK [Prochlorococcus marinus str. MIT 9116]
 gb|KGF95704.1| Chaperone protein DnaK [Prochlorococcus marinus str. MIT 9123]
Length=645

 Score =   157 bits (398),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 98/177 (55%), Positives = 122/177 (69%), Gaps = 3/177 (2%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEV FDIDANGILSVTA DKG+GK+Q I+ITGASTL  +EVE+MV +AE  A  DK
Sbjct  471  GVPQIEVTFDIDANGILSVTAKDKGSGKEQSISITGASTLSDNEVEKMVKDAESNASVDK  530

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKR+ ID KNQA+++VYQTEKQL ELG+K+    K KVE K   L++AIS    ++MK  
Sbjct  531  EKREKIDLKNQAETLVYQTEKQLGELGDKIDSAAKSKVEEKSNALKEAISKEDYESMKKL  590

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDGDVIDADFTDSK  339
            +  L QE+  +G S+Y QP   P +  + GG     S   G     DVIDADFT++K
Sbjct  591  LEELQQELYAVGSSVYQQPGNQPPSPGSAGGPDQNVSNEKGGD---DVIDADFTETK  644



>ref|WP_025966005.1| chaperone protein DnaK [Prochlorococcus sp. scB243_496M6]
Length=635

 Score =   157 bits (397),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 99/178 (56%), Positives = 123/178 (69%), Gaps = 5/178 (3%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEV FDIDANGILSVTA DKG+GK+Q I+ITGASTL  +EVE+MV +AE  A  DK
Sbjct  461  GVPQIEVTFDIDANGILSVTAKDKGSGKEQSISITGASTLSDNEVEKMVKDAESNASADK  520

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKR+ ID KNQA+++VYQTEKQL ELG+K+    K KVE K   L++A S    ++MK  
Sbjct  521  EKREKIDLKNQAETLVYQTEKQLGELGDKIDAAAKSKVEEKSNALKEATSKEDYESMKKL  580

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDG-DVIDADFTDSK  339
            +  L QE+  +G S+Y Q    PG+ P   G   G  +S     DG DVIDADFT++K
Sbjct  581  LEELQQELYAVGSSVYQQ----PGSQPPSPGAPGGSDQSDSNEKDGDDVIDADFTETK  634



>ref|WP_018397531.1| chaperone protein DnaK [filamentous cyanobacterium ESFC-1]
Length=649

 Score =   157 bits (398),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 83/138 (60%), Positives = 100/138 (72%), Gaps = 0/138 (0%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEV FDIDANGIL+VTA DKGTGK+Q I+ITGASTLP  EV+RMV EAE  A  DK
Sbjct  463  GVPQIEVTFDIDANGILNVTAKDKGTGKEQSISITGASTLPDTEVDRMVQEAESNAAADK  522

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            E+R+ ID KNQADS+VYQ EKQL ELG+KV G  K K E  + EL++AI+      ++  
Sbjct  523  ERREKIDRKNQADSLVYQAEKQLNELGDKVSGDDKSKAEGMIAELKEAIAQEDDAKIQSV  582

Query  509  MAALNQEVMQLGQSLYNQ  456
            M  L Q +  +G S+Y Q
Sbjct  583  MPELQQTLYSIGSSVYQQ  600



>ref|WP_044452584.1| molecular chaperone DnaK [Mastigocladus laminosus]
 gb|KIY10137.1| molecular chaperone DnaK [Mastigocladus laminosus UU774]
Length=635

 Score =   157 bits (397),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 93/177 (53%), Positives = 115/177 (65%), Gaps = 3/177 (2%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEV FDIDANGIL+VTA DKGTGK+Q I+ITGASTL   +VERMV EAE+ A  DK
Sbjct  462  GVPQIEVVFDIDANGILNVTAKDKGTGKEQSISITGASTLDKSDVERMVREAEQNASTDK  521

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            ++R+ ID KNQADS+ YQ EKQL+ELG+KVP   K KVE  + +LRDAI+    + +K  
Sbjct  522  DRREKIDRKNQADSLAYQAEKQLQELGDKVPEADKTKVEGLVKDLRDAITKDDDEQIKKL  581

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDGDVIDADFTDSK  339
            M  L Q +  +G ++Y Q                  S  +      DVIDADFT+SK
Sbjct  582  MPELQQALFAVGSNIYQQAGGGAPTDAAGTTDGGASSTGATGD---DVIDADFTESK  635



>ref|WP_025935547.1| chaperone protein DnaK [Prochlorococcus sp. scB245a_518A17]
Length=635

 Score =   157 bits (397),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 100/178 (56%), Positives = 124/178 (70%), Gaps = 5/178 (3%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEV FDIDANGILSVTA DKG+GK+Q I+ITGASTL  +EVE+MV +AE  A  DK
Sbjct  461  GVPQIEVTFDIDANGILSVTAKDKGSGKEQSISITGASTLSDNEVEKMVKDAESNASADK  520

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKR+ ID KNQA+++VYQTEKQL ELG+K+    K KVE K   L++A S    ++MK  
Sbjct  521  EKREKIDLKNQAETLVYQTEKQLGELGDKIDAAAKSKVEEKSNALKEATSKEDYESMKKL  580

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDG-DVIDADFTDSK  339
            +  L QE+  +G S+Y Q    PG  P   G + GP +S     DG DVIDADFT++K
Sbjct  581  LEELQQELYAVGSSVYQQ----PGNQPPSPGSAGGPDQSDSNEKDGDDVIDADFTETK  634



>ref|WP_042851397.1| chaperone protein DnaK [Prochlorococcus sp. MIT 0604]
 gb|AIQ96081.1| Chaperone protein DnaK [Prochlorococcus sp. MIT 0604]
Length=635

 Score =   157 bits (397),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 98/177 (55%), Positives = 121/177 (68%), Gaps = 3/177 (2%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEV FDIDANGILSVTA DKG+GK+Q I+ITGASTL  +EVE+MV +AE  A  DK
Sbjct  461  GVPQIEVTFDIDANGILSVTAKDKGSGKEQSISITGASTLSDNEVEKMVKDAESNASADK  520

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKR+ ID KNQA+++VYQTEKQL ELG+K+    K KVE K   L++A S    ++MK  
Sbjct  521  EKREKIDLKNQAETLVYQTEKQLSELGDKIDAAAKSKVEEKSNALKEATSKEDYESMKKL  580

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDGDVIDADFTDSK  339
            +  L QE+  +G S+Y QP   P    + GG     S+  G     DVIDADFT+SK
Sbjct  581  LEELQQELYAVGSSVYQQPGNQPPTPDSAGGPDQTDSKDKGGD---DVIDADFTESK  634



>ref|WP_025961633.1| chaperone protein DnaK [Prochlorococcus sp. scB245a_519L21]
Length=635

 Score =   157 bits (397),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 98/177 (55%), Positives = 120/177 (68%), Gaps = 3/177 (2%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEV FDIDANGILSVTA DKG+GK+Q I+ITGASTL  +EVE+MV +AE  A  DK
Sbjct  461  GVPQIEVTFDIDANGILSVTAKDKGSGKEQSISITGASTLSDNEVEKMVKDAESNASADK  520

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKR+ ID KNQA+++VYQTEKQL ELG+K+    K KVE K   L++A S    Q+MK  
Sbjct  521  EKREKIDLKNQAETLVYQTEKQLGELGDKIDAAAKSKVEEKSNALKEATSKEDYQSMKKL  580

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDGDVIDADFTDSK  339
            +  L QE+  +G S+Y QP   P +    GG     S   G     DVIDADFT++K
Sbjct  581  LEELQQELYAVGSSVYQQPGNQPPSPGAAGGPDQNDSNEKGGD---DVIDADFTETK  634



>ref|YP_009051076.1| heat shock protein 70 [Galdieria sulphuraria]
 ref|XP_005705015.1| [pt] molecular chaperone DnaK [Galdieria sulphuraria]
 gb|EME28495.1| [pt] molecular chaperone DnaK [Galdieria sulphuraria]
 gb|AIG92519.1| heat shock protein 70 [Galdieria sulphuraria]
Length=634

 Score =   157 bits (397),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 80/137 (58%), Positives = 101/137 (74%), Gaps = 0/137 (0%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEV FDIDANGILSVTA DK T K+Q ITITGAST P +EVERMV EAE++A EDK
Sbjct  463  GVPQIEVTFDIDANGILSVTAKDKATNKEQSITITGASTSPKEEVERMVREAEQYANEDK  522

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            E+R+ ID KNQ+DS++YQTEKQ+KE G+K+    K  +E+ +  LR +I   +   MK  
Sbjct  523  ERREKIDLKNQSDSLIYQTEKQIKEFGDKISSEDKTNLESLVQNLRASIQEENYDQMKSI  582

Query  509  MAALNQEVMQLGQSLYN  459
               L Q++M +GQ LY+
Sbjct  583  SQTLQQKLMNIGQKLYS  599



>ref|WP_011819314.1| chaperone protein DnaK [Prochlorococcus marinus]
 gb|ABM71197.1| Molecular chaperone DnaK2, heat shock protein hsp70-2 [Prochlorococcus 
marinus str. AS9601]
Length=635

 Score =   157 bits (397),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 96/177 (54%), Positives = 119/177 (67%), Gaps = 3/177 (2%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEV FDIDANGILSVTA DKG+GK+Q I+ITGASTL  +EVE+MV +AE  A  DK
Sbjct  461  GVPQIEVTFDIDANGILSVTAKDKGSGKEQSISITGASTLSDNEVEKMVKDAESNASADK  520

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKR+ ID KNQA+++VYQTEKQL ELG+K+    K KVE K   L++A S    ++MK  
Sbjct  521  EKREKIDLKNQAETLVYQTEKQLGELGDKIDAATKSKVEEKSNSLKEATSKEDYESMKKL  580

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDGDVIDADFTDSK  339
            +  L QE+  +G S+Y QP   P +     G     S   G     DVIDADFT++K
Sbjct  581  LEELQQELYAVGSSVYQQPGNQPPSPGAASGSDQSDSNEKGGD---DVIDADFTETK  634



>ref|WP_009768114.1| chaperone protein DnaK [Oscillatoriales cyanobacterium JSC-12]
 gb|EKQ67307.1| chaperone protein DnaK [Oscillatoriales cyanobacterium JSC-12]
Length=630

 Score =   157 bits (397),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 94/175 (54%), Positives = 114/175 (65%), Gaps = 8/175 (5%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEV FDIDANGILSV+A DK TGK+Q ITITGASTL   EVERMV EAER A+ D+
Sbjct  463  GVPQIEVTFDIDANGILSVSAKDKATGKQQSITITGASTLDQSEVERMVKEAERNAEADR  522

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
             +R+ IDTKN ADSV YQ EKQLK+LG+KVP   K ++E  + +LR AI   +   MK  
Sbjct  523  RRREQIDTKNTADSVAYQAEKQLKDLGDKVPTADKTRLEGMVQDLRTAIQQENYDRMKSL  582

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDGDVIDADFTD  345
               + Q +MQ+G ++Y+Q S S   G      +    E        DVIDADF D
Sbjct  583  TNDIQQALMQIGSAVYSQASGSTTNGSNSTSSTGSSGE--------DVIDADFVD  629



>ref|WP_011133331.1| chaperone protein dnaK2 [Prochlorococcus marinus]
 sp|Q7UZG3.1|DNAK2_PROMP RecName: Full=Chaperone protein dnaK2; AltName: Full=HSP70-2; 
AltName: Full=Heat shock 70 kDa protein 2; AltName: Full=Heat 
shock protein 70-2 [Prochlorococcus marinus subsp. pastoris 
str. CCMP1986]
 emb|CAE20163.1| Molecular chaperone DnaK2, heat shock protein hsp70-2 [Prochlorococcus 
marinus subsp. pastoris str. CCMP1986]
 gb|KGF86951.1| Chaperone protein DnaK [Prochlorococcus marinus str. EQPAC1]
Length=634

 Score =   157 bits (397),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 99/177 (56%), Positives = 123/177 (69%), Gaps = 5/177 (3%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEV FDIDANGILSVTA DKG+GK+Q I+ITGASTL  +EV++MV +AE  A  DK
Sbjct  462  GVPQIEVTFDIDANGILSVTAKDKGSGKEQSISITGASTLSDNEVDKMVKDAESNASVDK  521

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKR+ ID KNQA+++VYQTEKQL ELG+KV    K KVE K   L++A S    +AMK  
Sbjct  522  EKREKIDLKNQAETLVYQTEKQLGELGDKVDASAKAKVEEKSKALKEATSKEDYEAMKKL  581

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDGDVIDADFTDSK  339
            +  L QE+  +G S+Y Q          P  G+   +ES+ KG D DVIDADFT++K
Sbjct  582  LEELQQELYAIGSSVYQQ-----PGNQPPAPGTPDSNESNDKGGDDDVIDADFTETK  633



>ref|WP_015151863.1| chaperone protein DnaK [Oscillatoria acuminata]
 gb|AFY85257.1| chaperone protein DnaK [Oscillatoria acuminata PCC 6304]
Length=637

 Score =   157 bits (397),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 83/138 (60%), Positives = 98/138 (71%), Gaps = 0/138 (0%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEV FDIDANGIL+V A DKGTGK+Q I+ITGASTLP DEVERMV EAE  A  DK
Sbjct  462  GVPQIEVTFDIDANGILNVHAKDKGTGKEQSISITGASTLPGDEVERMVREAESNATADK  521

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            E+R+ ID KNQADS+ YQ EKQ+ ELG+KVP   K KV   +  L+DAI+    + MK  
Sbjct  522  ERREKIDLKNQADSLTYQAEKQMSELGDKVPADEKTKVTDLIQALKDAIAKDDLELMKSQ  581

Query  509  MAALNQEVMQLGQSLYNQ  456
            M  L Q +  +G  +Y Q
Sbjct  582  MTELQQALYAIGSKIYEQ  599



>ref|WP_015224983.1| chaperone protein DnaK [Halothece sp. PCC 7418]
 gb|AFZ43106.1| chaperone protein DnaK [Halothece sp. PCC 7418]
Length=641

 Score =   157 bits (397),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 93/179 (52%), Positives = 124/179 (69%), Gaps = 2/179 (1%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEV FDIDANGIL+VTA DKG+GK+Q I+ITGASTLP DEVERMV EAE+ A+EDK
Sbjct  463  GVPQIEVTFDIDANGILNVTAKDKGSGKEQSISITGASTLPEDEVERMVDEAEKNAEEDK  522

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            ++R+ I+ KNQADS+VYQ EKQ+ ELG+KVP   K K E  + +L++A+S      ++  
Sbjct  523  QRREKIERKNQADSLVYQAEKQINELGDKVPAEEKTKAEDLISQLKEAVSQEDDDQIQKL  582

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsa-gpsessgkgPDG-DVIDADFTDSK  339
            M  L Q +  +G ++Y Q   +        G ++    ESS    DG DVIDA+F+++K
Sbjct  583  MPELQQVLYSIGSNVYQQDGTAAADAAAGDGAASGETGESSSGKSDGDDVIDAEFSETK  641



>ref|WP_025931078.1| chaperone protein DnaK [Prochlorococcus sp. scB241_528O2]
Length=635

 Score =   157 bits (396),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 97/177 (55%), Positives = 119/177 (67%), Gaps = 3/177 (2%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEV FDIDANGILSVTA DKG+GK+Q I+ITGASTL  +EVE+MV +AE  A  DK
Sbjct  461  GVPQIEVTFDIDANGILSVTAKDKGSGKEQSISITGASTLSDNEVEKMVKDAESNASVDK  520

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            EKR+ ID KNQA+++VYQTEKQL ELG+K+    K KVE K   L++A S    ++MK  
Sbjct  521  EKREKIDLKNQAETLVYQTEKQLGELGDKIDAAAKSKVEEKSNALKEATSKEDYESMKKL  580

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDGDVIDADFTDSK  339
            +  L QE+  +G S+Y Q        PTPG         S    + DVIDADFT+SK
Sbjct  581  LEELQQELYAVGSSVYQQ---PGNQPPTPGSAGGSDQNDSNDKGEDDVIDADFTESK  634



>gb|ABB50858.1| Heat shock protein Hsp70 [Prochlorococcus marinus str. MIT 9312]
Length=645

 Score =   157 bits (396),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 97/178 (54%), Positives = 123/178 (69%), Gaps = 5/178 (3%)
 Frame = -1

Query  869  GVPQIEVKFDIDANGILSVTAVDKGTGKKQDITITGASTLPSDEVERMVSEAERFAQEDK  690
            GVPQIEV FDIDANGILSVTA DKG+GK+Q I+ITGASTL  +EVE+MV +AE  A  DK
Sbjct  471  GVPQIEVTFDIDANGILSVTAKDKGSGKEQSISITGASTLSDNEVEKMVKDAESNASADK  530

Query  689  EKRDAIDTKNQADSVVYQTEKQLKELGEKVPGPVKEKVEAKLGELRDAISGGSTQAMKDA  510
            +KR+ ID KNQA+++VYQTEKQL ELG+K+    K KVE K   L++A S    ++MK  
Sbjct  531  DKREKIDLKNQAETLVYQTEKQLSELGDKIDAAAKSKVEEKSNALKEATSKEDYESMKKL  590

Query  509  MAALNQEVMQLGQSLYNQpsaspgagptpgggsagpsessgkgPDG-DVIDADFTDSK  339
            +  L QE+  +G S+Y Q    PG  P   G +  P ++     DG DVIDADFT++K
Sbjct  591  LEELQQELYAVGSSVYQQ----PGNQPPSPGSTGSPDQNDSNEKDGDDVIDADFTETK  644



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1936147003653