BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig11176

Length=914
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009803816.1|  PREDICTED: protease Do-like 10, mitochondrial      409   1e-135   Nicotiana sylvestris
ref|XP_009611385.1|  PREDICTED: protease Do-like 10, mitochondrial      408   3e-135   Nicotiana tomentosiformis
gb|EYU39504.1|  hypothetical protein MIMGU_mgv1a003194mg                404   1e-133   Erythranthe guttata [common monkey flower]
ref|XP_011077091.1|  PREDICTED: protease Do-like 10, mitochondrial      403   3e-133   Sesamum indicum [beniseed]
ref|XP_006353238.1|  PREDICTED: protease Do-like 10, mitochondria...    402   1e-132   Solanum tuberosum [potatoes]
emb|CDP04134.1|  unnamed protein product                                401   1e-132   Coffea canephora [robusta coffee]
ref|XP_002265825.2|  PREDICTED: protease Do-like 10, mitochondrial      397   2e-131   Vitis vinifera
ref|XP_004250091.1|  PREDICTED: protease Do-like 10, mitochondrial      394   7e-130   Solanum lycopersicum
ref|XP_010528621.1|  PREDICTED: protease Do-like 10, mitochondrial      392   4e-129   Tarenaya hassleriana [spider flower]
ref|XP_008776774.1|  PREDICTED: protease Do-like 10, mitochondria...    390   8e-129   Phoenix dactylifera
ref|XP_010277816.1|  PREDICTED: protease Do-like 10, mitochondrial      389   4e-128   Nelumbo nucifera [Indian lotus]
ref|XP_008224670.1|  PREDICTED: protease Do-like 10, mitochondrial      390   5e-128   Prunus mume [ume]
gb|KJB49014.1|  hypothetical protein B456_008G097600                    382   5e-128   Gossypium raimondii
gb|ACF84354.1|  unknown                                                 383   2e-127   Zea mays [maize]
ref|XP_011011698.1|  PREDICTED: protease Do-like 10, mitochondrial      386   5e-127   Populus euphratica
ref|XP_007211387.1|  hypothetical protein PRUPE_ppa003181mg             387   5e-127   Prunus persica
ref|XP_006468667.1|  PREDICTED: protease Do-like 10, mitochondria...    387   6e-127   Citrus sinensis [apfelsine]
ref|XP_010927886.1|  PREDICTED: protease Do-like 10, mitochondrial      385   8e-127   Elaeis guineensis
ref|XP_002441105.1|  hypothetical protein SORBIDRAFT_09g020480          385   2e-126   Sorghum bicolor [broomcorn]
ref|XP_007028414.1|  DegP protease 10 isoform 1                         385   2e-126   
gb|KJB49010.1|  hypothetical protein B456_008G097600                    383   5e-126   Gossypium raimondii
ref|XP_008647597.1|  PREDICTED: hypothetical protein isoform X1         384   6e-126   Zea mays [maize]
ref|XP_006448510.1|  hypothetical protein CICLE_v10014700mg             384   6e-126   Citrus clementina [clementine]
gb|KJB49013.1|  hypothetical protein B456_008G097600                    382   7e-126   Gossypium raimondii
gb|EMS52153.1|  Protease Do-like 10, mitochondrial                      384   7e-126   Triticum urartu
ref|XP_008377055.1|  PREDICTED: protease Do-like 10, mitochondrial      382   1e-125   
ref|XP_010110145.1|  Protease Do-like 10                                381   2e-125   Morus notabilis
ref|XP_002463281.1|  hypothetical protein SORBIDRAFT_02g041140          382   2e-125   Sorghum bicolor [broomcorn]
ref|XP_004293434.2|  PREDICTED: protease Do-like 10, mitochondrial      382   3e-125   Fragaria vesca subsp. vesca
ref|XP_012078920.1|  PREDICTED: protease Do-like 10, mitochondria...    381   4e-125   Jatropha curcas
ref|XP_002514764.1|  serine endopeptidase degp2, putative               378   2e-124   
ref|XP_004962074.1|  PREDICTED: protease Do-like 10, mitochondria...    380   2e-124   Setaria italica
ref|XP_009420477.1|  PREDICTED: protease Do-like 10, mitochondrial      379   3e-124   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006655329.1|  PREDICTED: protease Do-like 10, mitochondria...    375   5e-124   
ref|XP_004152886.1|  PREDICTED: protease Do-like 10, mitochondrial      380   5e-124   Cucumis sativus [cucumbers]
ref|XP_002311275.1|  hypothetical protein POPTR_0008s07940g             378   1e-123   
ref|XP_003568444.1|  PREDICTED: protease Do-like 10, mitochondrial      378   2e-123   Brachypodium distachyon [annual false brome]
gb|KHG11681.1|  hypothetical protein F383_13103                         376   3e-123   Gossypium arboreum [tree cotton]
gb|EEE63742.1|  hypothetical protein OsJ_18561                          375   1e-122   Oryza sativa Japonica Group [Japonica rice]
gb|EAY98063.1|  hypothetical protein OsI_19981                          376   2e-122   Oryza sativa Indica Group [Indian rice]
ref|XP_010027457.1|  PREDICTED: protease Do-like 10, mitochondrial      374   4e-122   Eucalyptus grandis [rose gum]
ref|XP_007150859.1|  hypothetical protein PHAVU_004G000300g             373   5e-122   Phaseolus vulgaris [French bean]
ref|XP_002868484.1|  DEGP10                                             374   5e-122   
ref|NP_001055560.1|  Os05g0417100                                       374   7e-122   
gb|KHN40897.1|  Protease Do-like 10, mitochondrial                      367   2e-121   Glycine soja [wild soybean]
ref|XP_006858733.2|  PREDICTED: protease Do-like 10, mitochondrial      370   2e-121   
gb|ERN20200.1|  hypothetical protein AMTR_s00066p00121670               371   5e-121   Amborella trichopoda
ref|XP_003534464.1|  PREDICTED: protease Do-like 10, mitochondria...    369   1e-120   Glycine max [soybeans]
ref|NP_568543.1|  protease Do-like 10                                   370   1e-120   Arabidopsis thaliana [mouse-ear cress]
gb|KEH24729.1|  DegP protease                                           364   4e-120   Medicago truncatula
ref|XP_004489189.1|  PREDICTED: protease Do-like 10, mitochondria...    366   2e-119   Cicer arietinum [garbanzo]
ref|XP_010435521.1|  PREDICTED: protease Do-like 10, mitochondrial      366   6e-119   Camelina sativa [gold-of-pleasure]
gb|KEH24728.1|  DegP protease                                           365   7e-119   Medicago truncatula
ref|XP_006283411.1|  hypothetical protein CARUB_v10004459mg             364   2e-118   Capsella rubella
ref|XP_010440805.1|  PREDICTED: protease Do-like 10, mitochondria...    362   8e-118   
ref|XP_010673840.1|  PREDICTED: protease Do-like 10, mitochondrial      363   1e-117   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010440803.1|  PREDICTED: protease Do-like 10, mitochondria...    362   1e-117   Camelina sativa [gold-of-pleasure]
ref|XP_010450457.1|  PREDICTED: protease Do-like 10, mitochondrial      362   2e-117   Camelina sativa [gold-of-pleasure]
ref|XP_006405960.1|  hypothetical protein EUTSA_v10027701mg             360   1e-116   Eutrema salsugineum [saltwater cress]
emb|CDY53528.1|  BnaCnng25320D                                          357   3e-115   Brassica napus [oilseed rape]
ref|XP_009139697.1|  PREDICTED: protease Do-like 10, mitochondrial      355   6e-115   Brassica rapa
emb|CDX74606.1|  BnaA04g07830D                                          354   2e-114   
ref|XP_006858734.1|  PREDICTED: protease Do-like 10, mitochondria...    343   9e-111   Amborella trichopoda
gb|EPS59937.1|  hypothetical protein M569_14869                         327   3e-109   Genlisea aurea
ref|XP_002963416.1|  hypothetical protein SELMODRAFT_62730              315   2e-100   
ref|XP_002971553.1|  hypothetical protein SELMODRAFT_62447              313   5e-100   
ref|NP_001142088.1|  hypothetical protein                               312   1e-98    Zea mays [maize]
ref|XP_012078922.1|  PREDICTED: protease Do-like 10, mitochondria...    310   5e-98    
ref|XP_010027524.1|  PREDICTED: protease Do-like 10, mitochondrial      306   2e-96    Eucalyptus grandis [rose gum]
gb|KJB49011.1|  hypothetical protein B456_008G097600                    295   1e-92    Gossypium raimondii
ref|XP_007028415.1|  DegP protease 10 isoform 2                         296   3e-92    
ref|XP_008441958.1|  PREDICTED: protease Do-like 10, mitochondrial      291   8e-90    
gb|KCW54069.1|  hypothetical protein EUGRSUZ_I00050                     274   3e-84    Eucalyptus grandis [rose gum]
ref|XP_010027526.1|  PREDICTED: protease Do-like 10, mitochondria...    274   5e-84    Eucalyptus grandis [rose gum]
ref|XP_010027525.1|  PREDICTED: protease Do-like 10, mitochondria...    270   3e-82    Eucalyptus grandis [rose gum]
ref|XP_002888435.1|  predicted protein                                  267   2e-81    
ref|XP_007028416.1|  DegP protease 10 isoform 3                         266   6e-81    
ref|XP_002951860.1|  trypsin family                                     266   1e-80    Volvox carteri f. nagariensis
ref|XP_002886956.1|  hypothetical protein ARALYDRAFT_315601             260   1e-78    Arabidopsis lyrata subsp. lyrata
gb|KIZ03685.1|  hypothetical protein MNEG_4270                          254   1e-78    Monoraphidium neglectum
gb|KDO77071.1|  hypothetical protein CISIN_1g007765mg                   257   9e-78    Citrus sinensis [apfelsine]
ref|XP_010027559.1|  PREDICTED: protease Do-like 10, mitochondrial      258   1e-77    Eucalyptus grandis [rose gum]
ref|XP_008776775.1|  PREDICTED: protease Do-like 10, mitochondria...    255   2e-77    
ref|NP_564856.1|  putativeDegP protease 3                               253   8e-76    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002886957.1|  hypothetical protein ARALYDRAFT_894151             248   3e-74    Arabidopsis lyrata subsp. lyrata
ref|XP_006391530.1|  hypothetical protein EUTSA_v10019569mg             237   3e-72    
ref|XP_009140719.1|  PREDICTED: putative protease Do-like 3, mito...    245   5e-72    Brassica rapa
ref|XP_010513422.1|  PREDICTED: putative protease Do-like 3, mito...    242   5e-72    Camelina sativa [gold-of-pleasure]
sp|Q9SHZ0.1|DEGP4_ARATH  RecName: Full=Protease Do-like 4, mitoch...    241   2e-71    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010511113.1|  PREDICTED: putative protease Do-like 3, mito...    240   1e-70    Camelina sativa [gold-of-pleasure]
ref|XP_004344572.1|  DegPtype protease                                  239   2e-70    Acanthamoeba castellanii str. Neff
ref|XP_002499997.1|  predicted protein                                  236   7e-70    Micromonas commoda
ref|XP_006391532.1|  hypothetical protein EUTSA_v10019834mg             238   2e-69    
ref|XP_006301507.1|  hypothetical protein CARUB_v10021933mg             232   1e-67    Capsella rubella
ref|XP_010418975.1|  PREDICTED: putative protease Do-like 3, mito...    227   1e-65    Camelina sativa [gold-of-pleasure]
gb|KFK41004.1|  hypothetical protein AALP_AA2G073000                    223   2e-65    Arabis alpina [alpine rockcress]
emb|CDY35320.1|  BnaA04g15270D                                          226   2e-65    Brassica napus [oilseed rape]
gb|KCW54067.1|  hypothetical protein EUGRSUZ_I00047                     221   1e-64    Eucalyptus grandis [rose gum]
emb|CDY07457.1|  BnaA07g25360D                                          222   2e-64    Brassica napus [oilseed rape]
ref|XP_009105158.1|  PREDICTED: putative protease Do-like 3, mito...    221   2e-64    Brassica rapa
ref|XP_006391531.1|  hypothetical protein EUTSA_v10019570mg             221   3e-64    
ref|XP_002888434.1|  predicted protein                                  221   2e-63    
ref|XP_010030295.1|  PREDICTED: uncharacterized protein LOC104420090    224   4e-63    
ref|XP_002866059.1|  predicted protein                                  218   6e-63    
ref|XP_003055699.1|  predicted protein                                  216   3e-62    Micromonas pusilla CCMP1545
gb|KCW54108.1|  hypothetical protein EUGRSUZ_I00089                     205   3e-61    Eucalyptus grandis [rose gum]
ref|XP_002866058.1|  hypothetical protein ARALYDRAFT_357728             209   3e-59    
gb|KDO66274.1|  hypothetical protein CISIN_1g036586mg                   207   3e-58    Citrus sinensis [apfelsine]
ref|XP_006446449.1|  hypothetical protein CICLE_v10014711mg             207   5e-58    Citrus clementina [clementine]
ref|XP_006470390.1|  PREDICTED: protease Do-like 9-like                 206   1e-57    Citrus sinensis [apfelsine]
ref|XP_011071819.1|  PREDICTED: protease Do-like 9 isoform X2           203   3e-57    Sesamum indicum [beniseed]
emb|CDY39277.1|  BnaC06g27140D                                          200   2e-56    Brassica napus [oilseed rape]
ref|NP_568583.1|  DegP protease 13                                      199   2e-56    
sp|Q9LK71.2|DGP11_ARATH  RecName: Full=Putative protease Do-like ...    201   4e-56    Arabidopsis thaliana [mouse-ear cress]
emb|CDP16995.1|  unnamed protein product                                201   9e-56    Coffea canephora [robusta coffee]
sp|Q9FM41.1|DGP13_ARATH  RecName: Full=Putative protease Do-like 13     198   1e-55    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010456846.1|  PREDICTED: putative protease Do-like 11, mit...    199   3e-55    
ref|XP_006289059.1|  hypothetical protein CARUB_v10002456mg             194   3e-55    
ref|NP_566551.1|  DegP protease 11                                      198   7e-55    
gb|EYU42545.1|  hypothetical protein MIMGU_mgv1a0052332mg               194   8e-55    Erythranthe guttata [common monkey flower]
ref|XP_011071818.1|  PREDICTED: protease Do-like 9 isoform X1           202   8e-55    
ref|XP_011087156.1|  PREDICTED: protease Do-like 9                      198   1e-54    Sesamum indicum [beniseed]
ref|XP_009379979.1|  PREDICTED: protease Do-like 9                      198   1e-54    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003608950.1|  hypothetical protein MTR_4g106730                  198   1e-54    Medicago truncatula
ref|XP_010446115.1|  PREDICTED: putative protease Do-like 3, mito...    197   1e-54    Camelina sativa [gold-of-pleasure]
ref|XP_012080109.1|  PREDICTED: protease Do-like 9                      197   2e-54    Jatropha curcas
dbj|BAB01153.1|  unnamed protein product                                197   2e-54    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006376843.1|  hypothetical protein POPTR_0012s07930g             196   5e-54    
ref|XP_010436835.1|  PREDICTED: LOW QUALITY PROTEIN: putative pro...    195   5e-54    
ref|XP_011044336.1|  PREDICTED: protease Do-like 9                      196   6e-54    Populus euphratica
ref|XP_010424503.1|  PREDICTED: putative protease Do-like 11, mit...    195   1e-53    
ref|XP_010928580.1|  PREDICTED: protease Do-like 9                      195   1e-53    Elaeis guineensis
ref|NP_566552.1|  DEGP protease 12                                      193   1e-53    
ref|XP_011015595.1|  PREDICTED: protease Do-like 9                      194   2e-53    Populus euphratica
sp|Q9LK70.1|DGP12_ARATH  RecName: Full=Putative protease Do-like ...    193   2e-53    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010678720.1|  PREDICTED: protease Do-like 9                      193   5e-53    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006282154.1|  hypothetical protein CARUB_v10028411mg             192   7e-53    
ref|XP_010254385.1|  PREDICTED: protease Do-like 9                      193   8e-53    Nelumbo nucifera [Indian lotus]
ref|XP_002321577.2|  hypothetical protein POPTR_0015s08440g             192   1e-52    Populus trichocarpa [western balsam poplar]
ref|XP_006281902.1|  hypothetical protein CARUB_v10028106mg             189   2e-52    
ref|XP_002885148.1|  hypothetical protein ARALYDRAFT_479117             190   3e-52    
gb|KJB40784.1|  hypothetical protein B456_007G077100                    191   6e-52    Gossypium raimondii
ref|XP_006339987.1|  PREDICTED: protease Do-like 9-like                 190   1e-51    Solanum tuberosum [potatoes]
ref|XP_009107927.1|  PREDICTED: putative protease Do-like 12, mit...    188   1e-51    Brassica rapa
ref|XP_010424502.1|  PREDICTED: putative protease Do-like 12, mit...    188   2e-51    
gb|KHN48612.1|  Protease Do-like 9                                      185   2e-51    Glycine soja [wild soybean]
emb|CDY46469.1|  BnaA08g06390D                                          188   2e-51    Brassica napus [oilseed rape]
ref|XP_006655949.1|  PREDICTED: protease Do-like 9-like                 187   2e-51    Oryza brachyantha
ref|XP_009794183.1|  PREDICTED: protease Do-like 9                      189   2e-51    Nicotiana sylvestris
gb|KCW49312.1|  hypothetical protein EUGRSUZ_K02868                     187   3e-51    Eucalyptus grandis [rose gum]
ref|XP_002885149.1|  DEGP12                                             187   3e-51    
dbj|GAM25013.1|  hypothetical protein SAMD00019534_081880               186   5e-51    Acytostelium subglobosum LB1
ref|XP_010111735.1|  Protease Do-like 9                                 188   6e-51    Morus notabilis
ref|XP_004508846.1|  PREDICTED: protease Do-like 9-like                 187   6e-51    Cicer arietinum [garbanzo]
gb|EFA82977.1|  hypothetical protein PPL_03755                          187   1e-50    Heterostelium album PN500
ref|XP_002968921.1|  hypothetical protein SELMODRAFT_90340              186   1e-50    
ref|XP_010037587.1|  PREDICTED: protease Do-like 9                      187   1e-50    Eucalyptus grandis [rose gum]
ref|XP_009609751.1|  PREDICTED: protease Do-like 9                      187   1e-50    Nicotiana tomentosiformis
gb|EMS45662.1|  Protease Do-like 9                                      185   2e-50    Triticum urartu
gb|KHN18478.1|  Protease Do-like 9                                      184   2e-50    Glycine soja [wild soybean]
dbj|BAJ90442.1|  predicted protein                                      186   3e-50    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008659079.1|  PREDICTED: protease Do-like 9                      178   3e-50    Zea mays [maize]
ref|XP_002989968.1|  hypothetical protein SELMODRAFT_130891             185   4e-50    
ref|XP_011402326.1|  Protease Do-like 9                                 185   4e-50    Auxenochlorella protothecoides
gb|KIZ00510.1|  hypothetical protein MNEG_7454                          186   4e-50    Monoraphidium neglectum
ref|NP_001057235.1|  Os06g0234100                                       186   6e-50    
ref|XP_007514393.1|  predicted protein                                  184   6e-50    Bathycoccus prasinos
gb|KHF97497.1|  Protease Do-like 9                                      177   6e-50    Gossypium arboreum [tree cotton]
ref|XP_003525265.1|  PREDICTED: protease Do-like 9-like                 185   7e-50    Glycine max [soybeans]
ref|XP_008239730.1|  PREDICTED: protease Do-like 9                      185   8e-50    Prunus mume [ume]
ref|XP_008438126.1|  PREDICTED: protease Do-like 9                      185   8e-50    Cucumis melo [Oriental melon]
ref|XP_004152460.1|  PREDICTED: protease Do-like 9                      184   9e-50    Cucumis sativus [cucumbers]
ref|XP_010678716.1|  PREDICTED: protease Do-like 9 isoform X1           183   1e-49    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_005704063.1|  serine-type endopeptidase isoform 2                184   1e-49    Galdieria sulphuraria
ref|XP_004252189.1|  PREDICTED: protease Do-like 9                      184   2e-49    Solanum lycopersicum
ref|XP_003550747.1|  PREDICTED: protease Do-like 9-like                 183   2e-49    Glycine max [soybeans]
ref|XP_010272002.1|  PREDICTED: protease Do-like 9                      183   2e-49    Nelumbo nucifera [Indian lotus]
ref|XP_005704064.1|  serine-type endopeptidase isoform 1                183   2e-49    Galdieria sulphuraria
gb|EEE57793.1|  hypothetical protein OsJ_08344                          181   3e-49    Oryza sativa Japonica Group [Japonica rice]
ref|XP_003564034.1|  PREDICTED: protease Do-like 9                      182   6e-49    Brachypodium distachyon [annual false brome]
ref|XP_010227815.1|  PREDICTED: protease Do-like 9                      180   7e-49    Brachypodium distachyon [annual false brome]
ref|XP_004965071.1|  PREDICTED: protease Do-like 9-like                 182   7e-49    Setaria italica
ref|XP_001774430.1|  predicted protein                                  179   1e-48    
ref|XP_010678718.1|  PREDICTED: protease Do-like 9 isoform X2           180   1e-48    Beta vulgaris subsp. vulgaris [field beet]
gb|KCW54110.1|  hypothetical protein EUGRSUZ_I000922                    171   1e-48    Eucalyptus grandis [rose gum]
ref|XP_007155398.1|  hypothetical protein PHAVU_003G198000g             181   1e-48    Phaseolus vulgaris [French bean]
ref|XP_007036141.1|  Protease Do-like 9 isoform 1                       181   2e-48    Theobroma cacao [chocolate]
ref|XP_010029214.1|  PREDICTED: protease Do-like 9                      181   2e-48    Eucalyptus grandis [rose gum]
ref|XP_006649039.1|  PREDICTED: protease Do-like 9-like                 179   2e-48    
gb|EAY87490.1|  hypothetical protein OsI_08898                          180   3e-48    Oryza sativa Indica Group [Indian rice]
ref|XP_006836679.1|  PREDICTED: protease Do-like 9                      181   3e-48    Amborella trichopoda
ref|NP_568577.1|  DegP protease 9                                       180   3e-48    Arabidopsis thaliana [mouse-ear cress]
dbj|BAD15737.1|  putative DegP2 protease                                180   3e-48    Oryza sativa Japonica Group [Japonica rice]
ref|XP_001753311.1|  predicted protein                                  182   3e-48    
ref|XP_010913540.1|  PREDICTED: protease Do-like 9 isoform X2           176   5e-48    
ref|XP_002981859.1|  hypothetical protein SELMODRAFT_154815             177   6e-48    
ref|XP_002982828.1|  hypothetical protein SELMODRAFT_116969             178   8e-48    
ref|XP_005831529.1|  hypothetical protein GUITHDRAFT_72154              176   9e-48    Guillardia theta CCMP2712
gb|AFW76813.1|  hypothetical protein ZEAMMB73_778886                    179   9e-48    
ref|XP_002511438.1|  serine endopeptidase degp2, putative               179   1e-47    Ricinus communis
ref|XP_008647464.1|  PREDICTED: uncharacterized protein LOC100217...    179   1e-47    
emb|CDX99642.1|  BnaC04g33990D                                          178   1e-47    
ref|XP_004953885.1|  PREDICTED: protease Do-like 9-like                 178   1e-47    Setaria italica
ref|XP_004960292.1|  PREDICTED: protease Do-like 2, chloroplastic...    179   2e-47    Setaria italica
gb|AFW57620.1|  hypothetical protein ZEAMMB73_444319                    176   2e-47    
ref|XP_006476740.1|  PREDICTED: protease Do-like 9-like isoform X2      176   2e-47    Citrus sinensis [apfelsine]
ref|XP_010254399.1|  PREDICTED: protease Do-like 9 isoform X1           178   2e-47    Nelumbo nucifera [Indian lotus]
ref|XP_006283387.1|  hypothetical protein CARUB_v10004432mg             178   2e-47    Capsella rubella
ref|XP_010450719.1|  PREDICTED: protease Do-like 9                      178   2e-47    Camelina sativa [gold-of-pleasure]
ref|XP_007217173.1|  hypothetical protein PRUPE_ppa003383mg             177   3e-47    Prunus persica
ref|XP_002452567.1|  hypothetical protein SORBIDRAFT_04g028270          177   3e-47    Sorghum bicolor [broomcorn]
ref|XP_012081992.1|  PREDICTED: protease Do-like 9                      177   4e-47    Jatropha curcas
gb|EMT18472.1|  Protease Do-like protein 9                              176   6e-47    
ref|XP_010913539.1|  PREDICTED: protease Do-like 9 isoform X1           176   7e-47    Elaeis guineensis
ref|XP_008230646.1|  PREDICTED: protease Do-like 9                      176   8e-47    Prunus mume [ume]
ref|XP_008793849.1|  PREDICTED: protease Do-like 9                      176   8e-47    Phoenix dactylifera
emb|CBI15070.3|  unnamed protein product                                174   8e-47    Vitis vinifera
ref|XP_008643959.1|  PREDICTED: uncharacterized protein LOC100381...    176   8e-47    
ref|XP_011399889.1|  Protease Do-like 9                                 174   1e-46    Auxenochlorella protothecoides
gb|EMS48865.1|  Protease Do-like 9                                      173   1e-46    Triticum urartu
gb|KFK33145.1|  hypothetical protein AALP_AA6G336800                    176   1e-46    Arabis alpina [alpine rockcress]
ref|NP_001146551.1|  hypothetical protein                               176   1e-46    Zea mays [maize]
ref|XP_009139975.1|  PREDICTED: protease Do-like 9                      176   1e-46    Brassica rapa
ref|XP_010233342.1|  PREDICTED: protease Do-like 2, chloroplastic       176   1e-46    
ref|XP_002868670.1|  hypothetical protein ARALYDRAFT_493972             176   2e-46    
emb|CDY53116.1|  BnaCnng24440D                                          176   2e-46    Brassica napus [oilseed rape]
ref|XP_010528270.1|  PREDICTED: protease Do-like 9                      176   2e-46    Tarenaya hassleriana [spider flower]
emb|CDY44585.1|  BnaA04g10050D                                          176   2e-46    Brassica napus [oilseed rape]
ref|XP_010678715.1|  PREDICTED: protease Do-like 9                      174   2e-46    Beta vulgaris subsp. vulgaris [field beet]
dbj|BAK07966.1|  predicted protein                                      175   3e-46    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008341479.1|  PREDICTED: protease Do-like 9                      175   3e-46    Malus domestica [apple tree]
ref|XP_004252664.1|  PREDICTED: protease Do-like 9                      175   3e-46    Solanum lycopersicum
ref|XP_006476739.1|  PREDICTED: protease Do-like 9-like isoform X1      175   3e-46    Citrus sinensis [apfelsine]
ref|XP_009348028.1|  PREDICTED: protease Do-like 9                      174   4e-46    
ref|XP_002280249.1|  PREDICTED: protease Do-like 9                      174   4e-46    Vitis vinifera
ref|XP_007140930.1|  hypothetical protein PHAVU_008G153200g             174   4e-46    Phaseolus vulgaris [French bean]
emb|CAN74170.1|  hypothetical protein VITISV_013882                     174   5e-46    Vitis vinifera
ref|XP_006405537.1|  hypothetical protein EUTSA_v10027697mg             174   5e-46    Eutrema salsugineum [saltwater cress]
ref|XP_002439270.1|  hypothetical protein SORBIDRAFT_09g003540          174   6e-46    Sorghum bicolor [broomcorn]
ref|XP_009140230.1|  PREDICTED: protease Do-like 9                      174   6e-46    Brassica rapa
ref|XP_011028602.1|  PREDICTED: protease Do-like 9                      173   7e-46    Populus euphratica
ref|XP_009349862.1|  PREDICTED: protease Do-like 9                      173   8e-46    Pyrus x bretschneideri [bai li]
ref|XP_008780936.1|  PREDICTED: protease Do-like 9                      173   1e-45    Phoenix dactylifera
gb|KFG58629.1|  trypsin domain-containing protein                       166   1e-45    Toxoplasma gondii RUB
ref|XP_010236127.1|  PREDICTED: protease Do-like 9 isoform X2           171   1e-45    Brachypodium distachyon [annual false brome]
gb|AAT93972.1|  putative DegP2 protease                                 173   1e-45    Oryza sativa Japonica Group [Japonica rice]
emb|CDX91770.1|  BnaC08g06890D                                          167   1e-45    
ref|XP_004298924.1|  PREDICTED: protease Do-like 9                      172   2e-45    Fragaria vesca subsp. vesca
ref|XP_002502087.1|  predicted protein                                  171   2e-45    Micromonas commoda
ref|XP_010437094.1|  PREDICTED: putative protease Do-like 11, mit...    172   2e-45    
gb|EMS54752.1|  Protease Do-like 2, chloroplastic                       172   2e-45    Triticum urartu
emb|CDY15934.1|  BnaA04g11770D                                          172   3e-45    Brassica napus [oilseed rape]
ref|XP_010272003.1|  PREDICTED: protease Do-like 9                      172   3e-45    Nelumbo nucifera [Indian lotus]
ref|XP_009609244.1|  PREDICTED: protease Do-like 9                      172   3e-45    Nicotiana tomentosiformis
ref|XP_006363999.1|  PREDICTED: protease Do-like 9-like                 172   3e-45    Solanum tuberosum [potatoes]
emb|CBI34956.3|  unnamed protein product                                170   4e-45    Vitis vinifera
ref|XP_010236126.1|  PREDICTED: protease Do-like 9 isoform X1           171   4e-45    Brachypodium distachyon [annual false brome]
ref|XP_006654043.1|  PREDICTED: protease Do-like 2, chloroplastic...    171   6e-45    Oryza brachyantha
gb|EMT00922.1|  Protease Do-like 2, chloroplastic                       172   6e-45    
ref|XP_009348035.1|  PREDICTED: protease Do-like 9                      169   7e-45    Pyrus x bretschneideri [bai li]
ref|XP_007031392.1|  Protease Do-like 9 isoform 1                       171   1e-44    
gb|KJB08193.1|  hypothetical protein B456_001G070400                    171   1e-44    Gossypium raimondii
dbj|BAJ90870.1|  predicted protein                                      171   1e-44    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002517376.1|  serine endopeptidase degp2, putative               170   1e-44    Ricinus communis
ref|XP_010111534.1|  Protease Do-like 9                                 170   1e-44    Morus notabilis
ref|XP_010554015.1|  PREDICTED: protease Do-like 9                      170   2e-44    Tarenaya hassleriana [spider flower]
ref|XP_001633828.1|  predicted protein                                  170   2e-44    Nematostella vectensis
ref|XP_008341480.1|  PREDICTED: protease Do-like 9                      170   2e-44    
ref|XP_006378624.1|  hypothetical protein POPTR_0010s18430g             164   2e-44    
gb|ERN16863.1|  hypothetical protein AMTR_s00057p00143260               169   2e-44    Amborella trichopoda
ref|XP_003288812.1|  hypothetical protein DICPUDRAFT_153086             169   3e-44    Dictyostelium purpureum
ref|XP_006855396.2|  PREDICTED: protease Do-like 2, chloroplastic       169   4e-44    Amborella trichopoda
emb|CAN62736.1|  hypothetical protein VITISV_027750                     169   4e-44    Vitis vinifera
ref|XP_004357429.1|  hypothetical protein DFA_02707                     169   4e-44    Cavenderia fasciculata
ref|XP_002275131.1|  PREDICTED: protease Do-like 9                      169   4e-44    Vitis vinifera
gb|ABE65743.1|  DegP protease                                           166   5e-44    Arabidopsis thaliana [mouse-ear cress]
ref|NP_564857.2|  DegP protease 4                                       166   5e-44    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007144564.1|  hypothetical protein PHAVU_007G1665001g            165   6e-44    Phaseolus vulgaris [French bean]
ref|XP_007144565.1|  hypothetical protein PHAVU_007G1665001g            164   2e-43    Phaseolus vulgaris [French bean]
ref|XP_004306333.2|  PREDICTED: protease Do-like 9                      167   2e-43    
gb|KJB40785.1|  hypothetical protein B456_007G077100                    167   2e-43    
ref|XP_009349861.1|  PREDICTED: protease Do-like 9                      167   2e-43    
ref|XP_008887060.1|  trypsin domain-containing protein                  168   2e-43    
gb|KJB40786.1|  hypothetical protein B456_007G077100                    167   2e-43    
gb|AFW73360.1|  hypothetical protein ZEAMMB73_819902                    167   2e-43    
ref|XP_002946355.1|  trypsin family                                     166   3e-43    
ref|XP_003516811.1|  PREDICTED: protease Do-like 9-like                 166   3e-43    
ref|XP_002370490.1|  trypsin, putative                                  167   5e-43    
gb|KFH09397.1|  trypsin domain-containing protein                       167   6e-43    
ref|XP_005850048.1|  hypothetical protein CHLNCDRAFT_34342              166   7e-43    
gb|EPT25374.1|  trypsin domain-containing protein                       166   8e-43    
gb|ESS28089.1|  trypsin domain-containing protein                       166   8e-43    
ref|XP_006289341.1|  hypothetical protein CARUB_v10002825mg             165   1e-42    
ref|XP_005644766.1|  trypsin-like serine protease                       164   1e-42    
ref|XP_007216372.1|  hypothetical protein PRUPE_ppa021785mg             164   1e-42    
ref|XP_004148888.1|  PREDICTED: protease Do-like 2, chloroplastic       164   2e-42    
ref|XP_640805.1|  hypothetical protein DDB_G0281081                     164   2e-42    
ref|XP_005649879.1|  trypsin-like serine protease                       163   2e-42    
ref|XP_008386612.1|  PREDICTED: protease Do-like 2, chloroplastic       164   3e-42    
ref|XP_007200306.1|  hypothetical protein PRUPE_ppa002853mg             164   3e-42    
gb|EPR63244.1|  trypsin domain-containing protein                       164   3e-42    
gb|EYU46653.1|  hypothetical protein MIMGU_mgv1a0034321mg               158   4e-42    
ref|XP_008230647.1|  PREDICTED: protease Do-like 9                      163   4e-42    
ref|XP_006439771.1|  hypothetical protein CICLE_v10019344mg             163   5e-42    
ref|XP_003057446.1|  predicted protein                                  161   9e-42    
ref|XP_003520225.1|  PREDICTED: protease Do-like 2, chloroplastic...    162   9e-42    
ref|XP_003886416.1|  hypothetical protein NCLIV_068150                  163   1e-41    
ref|XP_002948745.1|  hypothetical protein VOLCADRAFT_58517              160   1e-41    
ref|XP_007031393.1|  Protease Do-like 9 isoform 2                       161   2e-41    
gb|EMT08042.1|  Protease Do-like protein 9                              161   2e-41    
gb|KEH43264.1|  DegP protease                                           161   2e-41    
ref|XP_004495997.1|  PREDICTED: protease Do-like 2, chloroplastic...    161   2e-41    
ref|XP_006389663.1|  hypothetical protein POPTR_0020s00220g             161   3e-41    
ref|XP_010041338.1|  PREDICTED: protease Do-like 2, chloroplastic       161   3e-41    
ref|XP_008451432.1|  PREDICTED: protease Do-like 2, chloroplastic       161   3e-41    
ref|XP_009587779.1|  PREDICTED: protease Do-like 2, chloroplastic...    160   3e-41    
ref|XP_002511437.1|  serine endopeptidase degp2, putative               160   3e-41    
ref|XP_009587778.1|  PREDICTED: protease Do-like 2, chloroplastic...    160   4e-41    
ref|XP_006588605.1|  PREDICTED: protease Do-like 2, chloroplastic...    160   4e-41    
ref|XP_009587776.1|  PREDICTED: protease Do-like 2, chloroplastic...    160   4e-41    
ref|XP_010323029.1|  PREDICTED: protease Do-like 2, chloroplastic       160   5e-41    
ref|NP_001168096.1|  uncharacterized protein LOC100381831               153   6e-41    
ref|XP_011458665.1|  PREDICTED: protease Do-like 2, chloroplastic...    160   7e-41    
ref|XP_004290719.1|  PREDICTED: protease Do-like 2, chloroplastic...    160   8e-41    
ref|XP_003536894.1|  PREDICTED: protease Do-like 2, chloroplastic...    160   8e-41    
ref|XP_006352801.1|  PREDICTED: protease Do-like 2, chloroplastic...    160   9e-41    
ref|XP_006479864.1|  PREDICTED: protease Do-like 2, chloroplastic...    159   9e-41    
ref|XP_005537155.1|  DegP protease                                      159   9e-41    
ref|XP_006444216.1|  hypothetical protein CICLE_v10019366mg             159   9e-41    
ref|XP_012082659.1|  PREDICTED: protease Do-like 2, chloroplastic       159   1e-40    
ref|XP_010545055.1|  PREDICTED: protease Do-like 2, chloroplastic       159   1e-40    
gb|KFK37547.1|  hypothetical protein AALP_AA4G271000                    159   1e-40    
gb|KFK37548.1|  hypothetical protein AALP_AA4G271000                    159   1e-40    
ref|XP_010070002.1|  PREDICTED: protease Do-like 2, chloroplastic       159   1e-40    
ref|XP_002958880.1|  serine protease                                    158   1e-40    
ref|XP_010247118.1|  PREDICTED: protease Do-like 2, chloroplastic       159   1e-40    
ref|XP_007050776.1|  DEGP protease 2 isoform 1                          159   2e-40    
ref|XP_002270247.1|  PREDICTED: protease Do-like 2, chloroplastic       159   2e-40    
gb|ETO06735.1|  hypothetical protein RFI_30658                          157   2e-40    
ref|XP_009384166.1|  PREDICTED: protease Do-like 2, chloroplastic       159   2e-40    
ref|XP_002974405.1|  hypothetical protein SELMODRAFT_100929             157   2e-40    
ref|XP_010507830.1|  PREDICTED: protease Do-like 2, chloroplastic       158   3e-40    
ref|XP_009631857.1|  PREDICTED: protease Do-like 2, chloroplastic...    158   3e-40    
ref|XP_006295823.1|  hypothetical protein CARUB_v10024950mg             158   3e-40    
ref|XP_009768576.1|  PREDICTED: protease Do-like 2, chloroplastic...    158   3e-40    
ref|XP_009768577.1|  PREDICTED: protease Do-like 2, chloroplastic...    158   3e-40    
gb|AET50594.1|  hypothetical protein                                    158   3e-40    
ref|XP_009631856.1|  PREDICTED: protease Do-like 2, chloroplastic...    158   3e-40    
emb|CDJ68975.1|  trypsin, putative                                      157   3e-40    
emb|CDJ40717.1|  trypsin, putative                                      157   4e-40    
ref|XP_009768575.1|  PREDICTED: protease Do-like 2, chloroplastic...    158   4e-40    
ref|XP_002863059.1|  hypothetical protein ARALYDRAFT_497185             158   4e-40    
ref|XP_002882138.1|  hypothetical protein ARALYDRAFT_483986             157   4e-40    
ref|XP_002875030.1|  predicted protein                                  157   6e-40    
pdb|4FLN|A  Chain A, Crystal Structure Of Plant Protease Deg2           157   6e-40    
ref|XP_009773293.1|  PREDICTED: protease Do-like 2, chloroplastic       157   7e-40    
ref|XP_008800525.1|  PREDICTED: protease Do-like 2, chloroplastic       157   7e-40    
gb|EYU29924.1|  hypothetical protein MIMGU_mgv1a005009mg                156   8e-40    
ref|NP_566115.1|  DegP2 protease                                        157   9e-40    
ref|NP_001118544.1|  DegP2 protease                                     157   9e-40    
ref|XP_004306334.1|  PREDICTED: protease Do-like 9                      155   1e-39    
ref|XP_011079745.1|  PREDICTED: protease Do-like 2, chloroplastic       156   1e-39    
ref|XP_010518514.1|  PREDICTED: protease Do-like 2, chloroplastic...    156   1e-39    
ref|XP_010518515.1|  PREDICTED: protease Do-like 2, chloroplastic...    156   2e-39    
ref|XP_008368916.1|  PREDICTED: protease Do-like 2, chloroplastic       156   2e-39    
emb|CDP03552.1|  unnamed protein product                                155   2e-39    
ref|XP_010941774.1|  PREDICTED: protease Do-like 2, chloroplastic       156   2e-39    
ref|XP_006397989.1|  hypothetical protein EUTSA_v10001363mg             155   2e-39    
ref|XP_001417982.1|  predicted protein                                  155   2e-39    
ref|XP_001701981.1|  DegP-type protease                                 155   3e-39    
ref|XP_005650005.1|  trypsin-like serine protease                       155   3e-39    
ref|XP_007050777.1|  DEGP protease 2 isoform 2                          155   3e-39    
ref|XP_002985706.1|  hypothetical protein SELMODRAFT_122577             154   4e-39    
ref|XP_011033618.1|  PREDICTED: protease Do-like 2, chloroplastic       155   4e-39    
ref|XP_009118165.1|  PREDICTED: protease Do-like 2, chloroplastic       155   4e-39    
ref|XP_006366368.1|  PREDICTED: protease Do-like 2, chloroplastic...    155   5e-39    
gb|AAB60913.1|  F5I14.17 gene product                                   153   6e-39    
ref|XP_006439772.1|  hypothetical protein CICLE_v10019344mg             152   6e-39    
ref|XP_010506841.1|  PREDICTED: protease Do-like 2, chloroplastic       154   6e-39    
ref|XP_009344540.1|  PREDICTED: protease Do-like 9 isoform X2           154   6e-39    
ref|XP_002520690.1|  serine endopeptidase degp2, putative               154   7e-39    
ref|XP_009344539.1|  PREDICTED: protease Do-like 9 isoform X1           154   7e-39    
ref|XP_006391529.1|  hypothetical protein EUTSA_v10019498mg             149   8e-39    
ref|XP_006439770.1|  hypothetical protein CICLE_v10019344mg             152   8e-39    
ref|XP_010684759.1|  PREDICTED: protease Do-like 2, chloroplastic...    153   1e-38    
ref|XP_004247469.1|  PREDICTED: protease Do-like 2, chloroplastic       153   2e-38    
gb|EPS65237.1|  hypothetical protein M569_09541                         151   2e-38    
gb|KDD74963.1|  hypothetical protein H632_c960p1                        152   2e-38    
emb|CBI32271.3|  unnamed protein product                                153   2e-38    
ref|XP_010684757.1|  PREDICTED: protease Do-like 2, chloroplastic...    153   2e-38    
ref|XP_011082504.1|  PREDICTED: protease Do-like 2, chloroplastic       152   3e-38    
gb|KJB47046.1|  hypothetical protein B456_008G008100                    152   3e-38    
ref|WP_029716855.1|  hypothetical protein                               149   3e-38    
ref|XP_002154609.2|  PREDICTED: protease Do-like 10, mitochondria...    152   3e-38    
ref|XP_010254417.1|  PREDICTED: protease Do-like 9 isoform X2           152   4e-38    
ref|XP_006439769.1|  hypothetical protein CICLE_v10019344mg             151   6e-38    
ref|XP_008348037.1|  PREDICTED: protease Do-like 9                      149   3e-37    
ref|XP_011011013.1|  PREDICTED: LOW QUALITY PROTEIN: protease Do-...    149   4e-37    
ref|WP_035698046.1|  hypothetical protein                               147   5e-37    
emb|CDY55521.1|  BnaA04g29470D                                          149   6e-37    
emb|CDY27464.1|  BnaC04g51050D                                          148   8e-37    
gb|KFG27726.1|  trypsin domain protein                                  140   4e-36    
ref|WP_038960950.1|  hypothetical protein                               145   6e-36    
ref|XP_008235077.1|  PREDICTED: protease Do-like 2, chloroplastic       145   1e-35    
gb|KIY95877.1|  hypothetical protein MNEG_12084                         144   2e-35    
emb|CBJ48373.1|  conserved unknown protein                              144   2e-35    
gb|KFG45747.1|  trypsin domain-containing protein                       138   2e-35    
emb|CEF97941.1|  Serine endopeptidase DegP2                             143   3e-35    
emb|CDP02143.1|  unnamed protein product                                138   4e-35    
ref|XP_003079294.1|  putative DegP2 protease (ISS)                      143   2e-34    
ref|XP_004829939.1|  serine protease, putative                          141   2e-34    
gb|KFH12639.1|  trypsin domain-containing protein                       139   3e-34    
ref|XP_005827715.1|  hypothetical protein GUITHDRAFT_164606             140   6e-34    
gb|KDO69730.1|  hypothetical protein CISIN_1g007213mg                   139   1e-33    
gb|ABR25659.1|  protease do-2 like                                      134   1e-33    
emb|CCF73353.1|  unnamed protein product                                135   1e-32    
emb|CBX27101.1|  Protease Do-like 10, mitochondrial                     135   2e-32    
gb|AIA26574.1|  serine protease                                         135   2e-32    
emb|CDR95924.1|  DegP protease, putative                                135   3e-32    
gb|KHN03752.1|  Protease Do-like 2, chloroplastic                       135   4e-32    
gb|EWM29653.1|  protease do-like 9                                      134   5e-32    
gb|KHN46596.1|  Protease Do-like 2, chloroplastic                       134   5e-32    
gb|EWM29652.1|  protease do-like 9                                      134   1e-31    
ref|XP_006391634.1|  hypothetical protein EUTSA_v10023879mg             131   2e-31    
ref|XP_007028418.1|  DegP protease 10 isoform 5                         131   6e-31    
ref|XP_005779861.1|  hypothetical protein EMIHUDRAFT_430070             130   1e-30    
gb|KJB49012.1|  hypothetical protein B456_008G097600                    129   1e-30    
gb|ETO17994.1|  hypothetical protein RFI_19299                          125   2e-30    
ref|XP_001610362.1|  DegP protease                                      129   2e-30    
gb|KCW54068.1|  hypothetical protein EUGRSUZ_I00049                     122   3e-30    
ref|WP_027353863.1|  hypothetical protein                               129   3e-30    
ref|XP_765845.1|  serine protease                                       128   5e-30    
ref|XP_011400998.1|  Protease Do-like 9                                 129   1e-29    
ref|XP_009689126.1|  serine protease                                    128   1e-29    
dbj|BAK01822.1|  predicted protein                                      127   1e-29    
ref|XP_005774372.1|  hypothetical protein EMIHUDRAFT_74740              127   2e-29    
ref|XP_008647465.1|  PREDICTED: uncharacterized protein LOC100217...    127   2e-29    
ref|XP_007031394.1|  Protease Do-like 9 isoform 3                       127   2e-29    
ref|XP_002286231.1|  trypsin-like serine protease                       125   5e-29    
gb|KCW56073.1|  hypothetical protein EUGRSUZ_I01831                     125   6e-29    
gb|ETO21210.1|  hypothetical protein RFI_15994                          124   6e-29    
gb|ERN06904.1|  hypothetical protein AMTR_s00005p00256670               117   1e-28    
ref|XP_002321037.1|  putative DegP2 protease family protein             125   1e-28    
ref|XP_007209088.1|  hypothetical protein PRUPE_ppa003679mg             124   3e-28    
gb|ABW31588.1|  trypsin-like serine protease, putative                  122   4e-28    
ref|WP_041661167.1|  hypothetical protein                               122   4e-28    
gb|ABW33227.1|  protease, putative                                      122   5e-28    
gb|KCW54014.1|  hypothetical protein EUGRSUZ_I00006                     121   7e-28    
emb|CDY66495.1|  BnaCnng51110D                                          115   7e-28    
ref|XP_005717038.1|  unnamed protein product                            119   1e-27    
ref|XP_954412.1|  serine protease (zymogen-like)                        122   2e-27    
gb|KDO69729.1|  hypothetical protein CISIN_1g007213mg                   122   2e-27    
gb|ACY19155.1|  peptidase S1 and S6 chymotrypsin/Hap                    120   2e-27    
ref|XP_011628691.1|  PREDICTED: protease Do-like 10, mitochondria...    119   4e-27    
ref|WP_013942997.1|  protease Do-like 10                                119   5e-27    
ref|XP_007050778.1|  DEGP protease 2 isoform 3                          119   1e-26    
ref|XP_005714405.1|  unnamed protein product                            118   1e-26    
ref|WP_045501556.1|  hypothetical protein                               117   4e-26    
ref|XP_005764176.1|  hypothetical protein EMIHUDRAFT_247734             115   3e-25    
ref|WP_045121455.1|  hypothetical protein                               114   4e-25    
gb|EJK64737.1|  hypothetical protein THAOC_14498                        115   5e-25    
gb|EPS74298.1|  hypothetical protein M569_00454                         113   5e-25    
ref|XP_003881237.1|  peptidase S1, chymotrypsin:PDZ/DHR/GLGF doma...    115   6e-25    
ref|WP_041280057.1|  hypothetical protein                               113   8e-25    
ref|XP_006439768.1|  hypothetical protein CICLE_v10019344mg             112   9e-25    
emb|CDJ62816.1|  trypsin, putative                                      115   9e-25    
emb|CCK81051.1|  serine protease, related to trypsin                    113   1e-24    
gb|KJB47047.1|  hypothetical protein B456_008G008100                    113   1e-24    
gb|AAB60923.1|  F5I14.16                                                112   1e-24    
emb|CDX93500.1|  BnaA06g05480D                                          109   3e-24    
emb|CDJ40146.1|  hypothetical protein ETH_00012215                      113   4e-24    
ref|XP_006439767.1|  hypothetical protein CICLE_v10019344mg             111   4e-24    
gb|KFG31101.1|  serine protease                                         112   8e-24    
gb|ESS33926.1|  serine protease                                         112   8e-24    
ref|XP_006286181.1|  hypothetical protein CARUB_v10007745mg             110   8e-24    
gb|EPR59808.1|  serine protease                                         112   8e-24    
ref|XP_002368468.1|  trypsin, putative                                  112   9e-24    
gb|KFG42321.1|  serine protease                                         112   1e-23    
ref|XP_008889209.1|  serine protease                                    112   1e-23    
emb|CAX68967.1|  periplasmic serine endoprotease of the DegP/Htr ...    109   2e-23    
emb|CDJ60046.1|  DegPtype protease, related                             109   5e-23    
ref|XP_002862794.1|  hypothetical protein ARALYDRAFT_920262             107   6e-23    
ref|XP_004989115.1|  hypothetical protein PTSG_09760                    108   8e-23    
ref|XP_001689823.1|  DegP-type protease                                 108   1e-22    
ref|WP_040504359.1|  hypothetical protein                               107   1e-22    
ref|XP_001748733.1|  hypothetical protein                               108   1e-22    
ref|XP_002945705.1|  trypsin family                                     107   1e-22    
ref|WP_025566621.1|  hypothetical protein                               106   2e-22    
ref|WP_033407513.1|  peptidase S1 and S6 chymotrypsin/Hap               106   2e-22    
gb|ABK21948.1|  unknown                                                 101   5e-22    
ref|WP_024123741.1|  MULTISPECIES: hypothetical protein                 101   6e-22    
gb|AHH80643.1|  protease Do-like 2                                      105   7e-22    
gb|EJK72666.1|  hypothetical protein THAOC_05779                        102   8e-22    
ref|WP_021745262.1|  trypsin                                            102   3e-21    
gb|ACI15904.1|  serine protease                                         103   4e-21    
ref|XP_005767710.1|  hypothetical protein EMIHUDRAFT_103267             103   4e-21    
ref|WP_038142065.1|  peptidase S1 and S6 chymotrypsin/Hap               102   5e-21    
ref|WP_012861033.1|  serine protease                                    102   8e-21    
emb|CDJ59597.1|  trypsin, putative                                      100   8e-21    
ref|WP_026746190.1|  serine protease                                    101   1e-20    



>ref|XP_009803816.1| PREDICTED: protease Do-like 10, mitochondrial [Nicotiana sylvestris]
Length=593

 Score =   409 bits (1052),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 193/241 (80%), Positives = 219/241 (91%), Gaps = 0/241 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            VS+I+PLSDA +VL+KDDI+LSFDG+ IANDGTV FRNRERITFDHLVSMKKPNETA LK
Sbjct  353  VSRINPLSDASRVLKKDDIVLSFDGVPIANDGTVPFRNRERITFDHLVSMKKPNETAELK  412

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSP  524
            VLRNGE H+F I L PL+PLVPVHQFDKLPS+FIFAGLVFIPLTQP+LHEYGEDWYN SP
Sbjct  413  VLRNGEVHDFKIMLHPLQPLVPVHQFDKLPSYFIFAGLVFIPLTQPFLHEYGEDWYNASP  472

Query  523  RRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLV  344
            RRLCERALR+LP KPGEQ +ILSQVL+DDIN GYERLAELQV KVNGVEV NLKHLR+LV
Sbjct  473  RRLCERALRELPKKPGEQFIILSQVLMDDINAGYERLAELQVKKVNGVEVLNLKHLRQLV  532

Query  343  EDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDECAPALELACS  164
            ED +++ +RFDLDDERVIVLNY+ A++ATSRILKRHRIP+AMS+DL +DE A  L+ ACS
Sbjct  533  EDGNQKNVRFDLDDERVIVLNYESARIATSRILKRHRIPHAMSTDLTDDENAAELQSACS  592

Query  163  N  161
            +
Sbjct  593  S  593



>ref|XP_009611385.1| PREDICTED: protease Do-like 10, mitochondrial [Nicotiana tomentosiformis]
Length=593

 Score =   408 bits (1048),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 194/241 (80%), Positives = 219/241 (91%), Gaps = 0/241 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            VS+I+PLSDA +VL+KDDIILSFDG+ IANDGTV FRNRERITFDHLVSMKKPNETA LK
Sbjct  353  VSRINPLSDASRVLKKDDIILSFDGVPIANDGTVPFRNRERITFDHLVSMKKPNETAELK  412

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSP  524
            VLRNG+ H+F I L PL+PLVPVHQFDKLPS+FIFAGLVFIPLTQP+LHEYGEDWYN SP
Sbjct  413  VLRNGKVHDFKITLHPLQPLVPVHQFDKLPSYFIFAGLVFIPLTQPFLHEYGEDWYNASP  472

Query  523  RRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLV  344
            RRLCERALR+LP KPGEQ +ILSQVL+DDIN GYERLAELQV KVNGVEV NLKHLR+LV
Sbjct  473  RRLCERALRELPKKPGEQFIILSQVLMDDINAGYERLAELQVKKVNGVEVLNLKHLRQLV  532

Query  343  EDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDECAPALELACS  164
            ED +++ +RFDLDDERVIVLNY+ A++ATSRILKRHRIP+AMSSDL +DE A  L+ ACS
Sbjct  533  EDGNQKNVRFDLDDERVIVLNYESARIATSRILKRHRIPHAMSSDLTDDENAVELQSACS  592

Query  163  N  161
            +
Sbjct  593  S  593



>gb|EYU39504.1| hypothetical protein MIMGU_mgv1a003194mg [Erythranthe guttata]
Length=601

 Score =   404 bits (1038),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 189/240 (79%), Positives = 215/240 (90%), Gaps = 0/240 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            VS+I+P SDA++VL+KDDIILSFDG+ IANDG+V FRNRERITFDHLVSMKKPN+TA +K
Sbjct  361  VSRINPTSDAHRVLKKDDIILSFDGVPIANDGSVAFRNRERITFDHLVSMKKPNDTAQVK  420

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSP  524
            VLR+GE+HEF++ L PL PLVPVHQFDKLPS+ IFAGLVF+PLTQPYLHEYGEDWYN SP
Sbjct  421  VLRSGEEHEFTVTLRPLHPLVPVHQFDKLPSYLIFAGLVFVPLTQPYLHEYGEDWYNASP  480

Query  523  RRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLV  344
            RRLCERALR+LP KPG+Q VILSQVL+DDINTGYERLA+LQV KVNGVEV+NLKHLR+LV
Sbjct  481  RRLCERALRELPQKPGQQFVILSQVLMDDINTGYERLADLQVKKVNGVEVDNLKHLRQLV  540

Query  343  EDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDECAPALELACS  164
            ED   E +RFDLDDERVIVLNYD AK ATSRILKRHRIP AMS DLI ++    +E+ACS
Sbjct  541  EDGGNENVRFDLDDERVIVLNYDSAKTATSRILKRHRIPSAMSDDLIEEQDVSVIEVACS  600



>ref|XP_011077091.1| PREDICTED: protease Do-like 10, mitochondrial [Sesamum indicum]
Length=596

 Score =   403 bits (1035),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 186/240 (78%), Positives = 224/240 (93%), Gaps = 0/240 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            VS+I+P SDAY+VL+KDDIILSFDG+ IANDG+V FRNRERITFDHLVSMK+PN+TA +K
Sbjct  356  VSRINPTSDAYRVLKKDDIILSFDGVPIANDGSVPFRNRERITFDHLVSMKRPNDTARVK  415

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSP  524
            VLR+G++HEF+I L PL+PLVPVHQFDKLPS+FIFAGLVF+PLTQPYLHEYGEDWYNTSP
Sbjct  416  VLRDGKEHEFTITLRPLQPLVPVHQFDKLPSYFIFAGLVFVPLTQPYLHEYGEDWYNTSP  475

Query  523  RRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLV  344
            RRLCERALR+LP K G+QLVILSQVL+DDINTGYERL++LQV KVNG+EV+NLKHLR+LV
Sbjct  476  RRLCERALRELPQKTGQQLVILSQVLMDDINTGYERLSDLQVKKVNGIEVDNLKHLRQLV  535

Query  343  EDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDECAPALELACS  164
            E++S++ +RFDLDD+RVIVLNY+ AK+AT+RILKRHRIP AMSSDL+++E    +ELAC+
Sbjct  536  ENSSRDNVRFDLDDDRVIVLNYNSAKMATTRILKRHRIPSAMSSDLVDEEGGSNIELACA  595



>ref|XP_006353238.1| PREDICTED: protease Do-like 10, mitochondrial-like [Solanum tuberosum]
Length=597

 Score =   402 bits (1032),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 190/241 (79%), Positives = 218/241 (90%), Gaps = 0/241 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            VS+I+PLSDA +VL+KDDIILSFDG+ IA+DGTV FRNRERI+FDHLVSMKKPNETA LK
Sbjct  357  VSRINPLSDACRVLKKDDIILSFDGVPIASDGTVPFRNRERISFDHLVSMKKPNETAELK  416

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSP  524
            VLRNGE H+F I L PL+PLVPVHQFDKLPS+FIFAGLVFIPLTQP+LHEYGE+WYNTSP
Sbjct  417  VLRNGEVHDFKITLHPLQPLVPVHQFDKLPSYFIFAGLVFIPLTQPFLHEYGEEWYNTSP  476

Query  523  RRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLV  344
            RRLCERALR+LP KPGEQ +ILSQVL+DDIN GYERLAELQV KVNGVEV NLKHLR+LV
Sbjct  477  RRLCERALRELPKKPGEQFIILSQVLMDDINAGYERLAELQVKKVNGVEVLNLKHLRQLV  536

Query  343  EDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDECAPALELACS  164
            ED +++ +RFDLDDERVIVLNY+ A++ATSRILKRHRIP+AMS DL +++ A  L+ ACS
Sbjct  537  EDGNQKNVRFDLDDERVIVLNYESARIATSRILKRHRIPHAMSIDLTDEQNAAELQSACS  596

Query  163  N  161
             
Sbjct  597  T  597



>emb|CDP04134.1| unnamed protein product [Coffea canephora]
Length=591

 Score =   401 bits (1031),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 193/230 (84%), Positives = 214/230 (93%), Gaps = 0/230 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            VSKI+PLS+A+KVL+KDDI+LSFDG+ IANDGTV FRNRERITFDHLVSMKKPNETAVLK
Sbjct  350  VSKINPLSNAHKVLKKDDILLSFDGVPIANDGTVPFRNRERITFDHLVSMKKPNETAVLK  409

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSP  524
            VLRNGE+HEF+I L PL+PLVPVHQFDKLPS+FIFAGL+F+PLTQPYLHEYGEDWYNTSP
Sbjct  410  VLRNGEEHEFNITLQPLQPLVPVHQFDKLPSYFIFAGLLFVPLTQPYLHEYGEDWYNTSP  469

Query  523  RRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLV  344
            RRLCERALR+LP K GE+LVILSQVL+DDINTGYERLAELQV KV+ VEVENLKHL +LV
Sbjct  470  RRLCERALRELPRKAGEELVILSQVLMDDINTGYERLAELQVKKVDNVEVENLKHLCQLV  529

Query  343  EDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDE  194
            E   KE IRFDLDDERVIVLNY +AKVATSRIL+RHRIP AMS DL+N+E
Sbjct  530  EGCEKEAIRFDLDDERVIVLNYSMAKVATSRILQRHRIPNAMSGDLLNNE  579



>ref|XP_002265825.2| PREDICTED: protease Do-like 10, mitochondrial [Vitis vinifera]
 emb|CBI33040.3| unnamed protein product [Vitis vinifera]
Length=564

 Score =   397 bits (1021),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 188/239 (79%), Positives = 215/239 (90%), Gaps = 0/239 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            VSKI+PLSDA++VL+KDDIIL+FDG+ IANDGTV FRNRERITFDHLVSMKKPNETA +K
Sbjct  324  VSKINPLSDAHRVLKKDDIILAFDGVPIANDGTVPFRNRERITFDHLVSMKKPNETAQVK  383

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSP  524
            VLR+GE++EFS+ L  L+PLVPV QFDKLPS+FIFAGLVF+PLTQPYLHEYGEDWYNT P
Sbjct  384  VLRDGEEYEFSVTLQTLQPLVPVQQFDKLPSYFIFAGLVFVPLTQPYLHEYGEDWYNTCP  443

Query  523  RRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLV  344
            RRLCERALR+LPT+PGEQ+VILSQVL+DDIN GYERLA+LQV KVNGVE++NLKH  +LV
Sbjct  444  RRLCERALRELPTRPGEQIVILSQVLMDDINAGYERLADLQVKKVNGVEIKNLKHFSQLV  503

Query  343  EDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDECAPALELAC  167
            E+ S E +RFDLDDERVIVLNY LAK+ATSRILKRHRIP AMS DLI  + +   ELAC
Sbjct  504  ENCSMESLRFDLDDERVIVLNYQLAKIATSRILKRHRIPSAMSRDLIQKQDSSEAELAC  562



>ref|XP_004250091.1| PREDICTED: protease Do-like 10, mitochondrial [Solanum lycopersicum]
Length=595

 Score =   394 bits (1013),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 187/239 (78%), Positives = 216/239 (90%), Gaps = 0/239 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            VS+I+PLSDA +VL+KDDI+LSFDG+ IA+DGTV FRNRERI+FDHLVSMKKPNETA L+
Sbjct  357  VSRINPLSDASRVLKKDDIVLSFDGVPIASDGTVPFRNRERISFDHLVSMKKPNETAELE  416

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSP  524
            VLR+GE H+F I L PL+PLVPVHQFDKLPS+FIFAGLVFIPLTQP+LHEYGE+WYNTSP
Sbjct  417  VLRDGEVHDFKITLHPLQPLVPVHQFDKLPSYFIFAGLVFIPLTQPFLHEYGEEWYNTSP  476

Query  523  RRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLV  344
            RRLCERALR+LP KPGEQ VILSQVL+DDIN GYERLAELQV KVNGVEV NLKHLR+LV
Sbjct  477  RRLCERALRELPKKPGEQFVILSQVLMDDINAGYERLAELQVKKVNGVEVLNLKHLRQLV  536

Query  343  EDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDECAPALELAC  167
            ED +++ +RFDLDDERVIVLNY+ A++ATSRILKRHRIP+AMS DL +++ A  L  AC
Sbjct  537  EDGNQKNVRFDLDDERVIVLNYESARIATSRILKRHRIPHAMSIDLTDEQNAAELLSAC  595



>ref|XP_010528621.1| PREDICTED: protease Do-like 10, mitochondrial [Tarenaya hassleriana]
Length=594

 Score =   392 bits (1008),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 184/240 (77%), Positives = 214/240 (89%), Gaps = 0/240 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            +SKI+PLSDA++VL+KDDIIL+FDG+AIANDGTV FRNRERITFDHLVSMKKPNETA++K
Sbjct  354  ISKINPLSDAHRVLKKDDIILAFDGVAIANDGTVPFRNRERITFDHLVSMKKPNETALVK  413

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSP  524
            VLR+G +HEF I L PL+PLVPVHQFD LPS++IFAG VF+PLTQPYLHEYGEDWYN+SP
Sbjct  414  VLRDGTEHEFIISLKPLQPLVPVHQFDTLPSYYIFAGFVFVPLTQPYLHEYGEDWYNSSP  473

Query  523  RRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLV  344
            RRLCERALR LP K GEQLVILSQVL+DDINTGYERLAELQV KVNGVEV+NL+HL +L+
Sbjct  474  RRLCERALRDLPKKAGEQLVILSQVLMDDINTGYERLAELQVKKVNGVEVDNLRHLCQLI  533

Query  343  EDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDECAPALELACS  164
            E  S E +R DLDDERVIVLNY  AK+ATSRILKRHRIP +MSSDL++++      +AC+
Sbjct  534  EKCSDENLRLDLDDERVIVLNYPFAKIATSRILKRHRIPSSMSSDLLSEQNTATESVACA  593



>ref|XP_008776774.1| PREDICTED: protease Do-like 10, mitochondrial isoform X1 [Phoenix 
dactylifera]
Length=568

 Score =   390 bits (1003),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 187/242 (77%), Positives = 216/242 (89%), Gaps = 1/242 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            V+KI+PLS A++VL+KDDIIL+FDG+ IANDGTV FRNRERITFDHLVSMKKPNETA ++
Sbjct  327  VNKINPLSAAHRVLKKDDIILAFDGVPIANDGTVPFRNRERITFDHLVSMKKPNETAHVR  386

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSP  524
            VLR+G +HEF I L PL+PLVPVHQFD LPS++IFAGLVF+PLTQPYLHEYGEDWYNTSP
Sbjct  387  VLRDGTEHEFCISLLPLQPLVPVHQFDTLPSYYIFAGLVFVPLTQPYLHEYGEDWYNTSP  446

Query  523  RRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLV  344
            RRLCERALR+LP + GEQLVILSQVL+DDIN GYERL+ELQV K NGVEVENLKHL +LV
Sbjct  447  RRLCERALRELPKRAGEQLVILSQVLMDDINAGYERLSELQVKKANGVEVENLKHLCELV  506

Query  343  EDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDEC-APALELAC  167
            E  S+E +RFDLDDERVIVLNY  A++ATSRILKRHRIP AMSSDLIND+     +++AC
Sbjct  507  EGCSEESLRFDLDDERVIVLNYQNARLATSRILKRHRIPSAMSSDLINDQTNVSEIKVAC  566

Query  166  SN  161
            S+
Sbjct  567  SS  568



>ref|XP_010277816.1| PREDICTED: protease Do-like 10, mitochondrial [Nelumbo nucifera]
Length=573

 Score =   389 bits (999),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 187/230 (81%), Positives = 210/230 (91%), Gaps = 0/230 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            V KI+PLSDA +VL+KDDIIL+FD + IANDGTV FRNRERITFDHLVSMKKPNETA + 
Sbjct  332  VCKINPLSDANRVLKKDDIILAFDDVPIANDGTVPFRNRERITFDHLVSMKKPNETAKVT  391

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSP  524
            VLRNG ++EF+I L PL+PLVPVHQFDKLPS+FIFAGLVF+PLTQPYLHEYGEDWYNTSP
Sbjct  392  VLRNGVEYEFNITLLPLQPLVPVHQFDKLPSYFIFAGLVFVPLTQPYLHEYGEDWYNTSP  451

Query  523  RRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLV  344
            RRLCERALR+LP K GEQLVILSQVL+DD+NTGYERLAE+QV KVNGVEVENLKHL +LV
Sbjct  452  RRLCERALRELPKKAGEQLVILSQVLMDDVNTGYERLAEMQVKKVNGVEVENLKHLCRLV  511

Query  343  EDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDE  194
            ED S+E +RFDLDD+RVIVLNY  AKVATSRILKRHRIP AMS+DLI ++
Sbjct  512  EDCSEESLRFDLDDDRVIVLNYQSAKVATSRILKRHRIPSAMSNDLIEEQ  561



>ref|XP_008224670.1| PREDICTED: protease Do-like 10, mitochondrial [Prunus mume]
Length=595

 Score =   390 bits (1001),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 184/230 (80%), Positives = 213/230 (93%), Gaps = 0/230 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            VSKI+PLSD+YKVL+KDDIIL+FDG+ IANDGTV FRNRERITFDHLVSMKKPNETAV++
Sbjct  352  VSKINPLSDSYKVLKKDDIILAFDGVPIANDGTVPFRNRERITFDHLVSMKKPNETAVVR  411

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSP  524
            VLR+GE++EF+I L PL+PLVPVHQFDKLPS++IFAGLVF+PLTQPYLHEYGEDWYNTSP
Sbjct  412  VLRDGEEYEFNITLRPLQPLVPVHQFDKLPSYYIFAGLVFVPLTQPYLHEYGEDWYNTSP  471

Query  523  RRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLV  344
            RRLCE ALR+ P + GEQL+ILSQVL+DDIN GYERLAELQV KVNG+EVENLKHL +LV
Sbjct  472  RRLCESALREPPKRAGEQLIILSQVLMDDINAGYERLAELQVKKVNGIEVENLKHLCQLV  531

Query  343  EDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDE  194
            E+ SKE +RFDLDD+RVIVLN+ LAKVATS+ILK HRIP AMS+DLI+ +
Sbjct  532  ENCSKESVRFDLDDDRVIVLNHSLAKVATSKILKCHRIPSAMSNDLIDKQ  581



>gb|KJB49014.1| hypothetical protein B456_008G097600 [Gossypium raimondii]
Length=382

 Score =   382 bits (981),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 178/230 (77%), Positives = 210/230 (91%), Gaps = 0/230 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            VSKI+PLSDAY VL+KDDIIL FDG+ IANDGTV FRNRERITFDHLVSMKKPNETA++K
Sbjct  144  VSKINPLSDAYGVLKKDDIILEFDGVPIANDGTVPFRNRERITFDHLVSMKKPNETALVK  203

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSP  524
            VLRNG++H F+I L PL+PLVPVHQFDKLPS++IFAGLVF+PLTQPYLHEYGEDWYNTSP
Sbjct  204  VLRNGQEHAFTITLQPLQPLVPVHQFDKLPSYYIFAGLVFVPLTQPYLHEYGEDWYNTSP  263

Query  523  RRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLV  344
            RRLCERALR+LP + GEQLVILSQVL+DDIN GYERLAELQV KVNG+E++NLKHL +LV
Sbjct  264  RRLCERALRELPKRAGEQLVILSQVLMDDINAGYERLAELQVKKVNGIEIKNLKHLCQLV  323

Query  343  EDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDE  194
            E+ S+E +R DLDD+RV+ LNY+ A++ATSRIL+RHRIP  MS DL++++
Sbjct  324  ENCSRESLRIDLDDDRVVALNYESARIATSRILERHRIPSRMSIDLLSEQ  373



>gb|ACF84354.1| unknown [Zea mays]
Length=446

 Score =   383 bits (984),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 183/242 (76%), Positives = 211/242 (87%), Gaps = 1/242 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            VS+I+PLSDAYKVL+KDDI+L FDG+ IANDGTV FRNRERITFDHLVSMKKP ETAVLK
Sbjct  205  VSRINPLSDAYKVLKKDDILLEFDGVPIANDGTVPFRNRERITFDHLVSMKKPEETAVLK  264

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSP  524
            VLR+G++ E  + L PL+PLVPVHQFDKLPS++IFAG VFIPLTQPYLHE+GEDWYN SP
Sbjct  265  VLRDGKEQELGVTLRPLQPLVPVHQFDKLPSYYIFAGFVFIPLTQPYLHEFGEDWYNASP  324

Query  523  RRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLV  344
            RRLCERALR+LP K GEQLVILSQVL+DDIN GYERLAELQV KVNGVEVENLKHL  LV
Sbjct  325  RRLCERALRELPKKTGEQLVILSQVLMDDINVGYERLAELQVKKVNGVEVENLKHLCSLV  384

Query  343  EDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDECAPA-LELAC  167
            E  ++E +RFDLDDERVIVL Y  A++ATSR+LKRHRIP A+SSDL+ D+     +E +C
Sbjct  385  EGCTEENLRFDLDDERVIVLKYQNARLATSRVLKRHRIPSAISSDLVEDQVTDGEVETSC  444

Query  166  SN  161
            ++
Sbjct  445  TS  446



>ref|XP_011011698.1| PREDICTED: protease Do-like 10, mitochondrial [Populus euphratica]
Length=580

 Score =   386 bits (992),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 184/241 (76%), Positives = 213/241 (88%), Gaps = 0/241 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            VSKI+PLSDA++VL+KDDIIL+FDG+ IANDGTV FRNRERITFDHLVSMKKPNETA ++
Sbjct  340  VSKINPLSDAHRVLKKDDIILAFDGVPIANDGTVPFRNRERITFDHLVSMKKPNETASVR  399

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSP  524
            +LR GE+HEFSI L PL+PLVPVHQFDKLPS++IFAGLVF+PLTQPYLHEYGE+WYNTSP
Sbjct  400  LLRGGEEHEFSITLRPLQPLVPVHQFDKLPSYYIFAGLVFVPLTQPYLHEYGEEWYNTSP  459

Query  523  RRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLV  344
            RRLCERAL++LP K  +QL+ILSQVL+DDIN GYERLAELQV KVNGVE++N+KHL +LV
Sbjct  460  RRLCERALKELPKKADQQLIILSQVLMDDINAGYERLAELQVKKVNGVEIDNMKHLCQLV  519

Query  343  EDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDECAPALELACS  164
             D S E +RFDLDD+RVI LNY  AKVATSRILKRHRIP AMSSDL  ++  P  E A S
Sbjct  520  GDCSSESLRFDLDDDRVIALNYQSAKVATSRILKRHRIPSAMSSDLSAEQNIPESESASS  579

Query  163  N  161
            +
Sbjct  580  S  580



>ref|XP_007211387.1| hypothetical protein PRUPE_ppa003181mg [Prunus persica]
 gb|EMJ12586.1| hypothetical protein PRUPE_ppa003181mg [Prunus persica]
Length=595

 Score =   387 bits (994),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 183/230 (80%), Positives = 211/230 (92%), Gaps = 0/230 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            VSKI PLSDAYKVL+KDDIIL+FDG+ +ANDGTV FRNRERITFDHLVSMKKPNETAV++
Sbjct  352  VSKISPLSDAYKVLKKDDIILAFDGVPVANDGTVPFRNRERITFDHLVSMKKPNETAVVR  411

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSP  524
            VLR+GE++E +I L PL+PLVPVHQFDKLPS++IFAGLVF+PLTQPYLHEYGEDWYNTSP
Sbjct  412  VLRDGEEYEINITLQPLQPLVPVHQFDKLPSYYIFAGLVFVPLTQPYLHEYGEDWYNTSP  471

Query  523  RRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLV  344
            RRLCE ALR+ P + GEQLVILSQVL+DDIN GYERLAELQV KVNG+EVENLKH+ +LV
Sbjct  472  RRLCESALREPPKRAGEQLVILSQVLMDDINAGYERLAELQVKKVNGIEVENLKHICQLV  531

Query  343  EDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDE  194
            E+ SKE +RFDLDD+RVIVLN+ LAKVATS+ILK HRIP AMS+DLI+ +
Sbjct  532  ENCSKESVRFDLDDDRVIVLNHSLAKVATSKILKCHRIPSAMSNDLIDKQ  581



>ref|XP_006468667.1| PREDICTED: protease Do-like 10, mitochondrial-like [Citrus sinensis]
 gb|KDO77070.1| hypothetical protein CISIN_1g007765mg [Citrus sinensis]
Length=590

 Score =   387 bits (993),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 184/238 (77%), Positives = 215/238 (90%), Gaps = 1/238 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            V+KI+PLSDA+++L+KDDIIL+FDG+ IANDGTV FRNRERITFDHLVSMKKPNE ++++
Sbjct  345  VNKINPLSDAHEILKKDDIILAFDGVPIANDGTVAFRNRERITFDHLVSMKKPNEKSLVR  404

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSP  524
            VLR+G++HEFSI L  L+PLVPVHQFDKLPS++IFAGLVFIPLTQPYLHEYGEDWYNTSP
Sbjct  405  VLRDGKEHEFSITLRLLQPLVPVHQFDKLPSYYIFAGLVFIPLTQPYLHEYGEDWYNTSP  464

Query  523  RRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLV  344
            RRLCERALR+LP K GEQLVILSQVL+DDIN GYER A+LQV KVNGVE+ENLKHL +LV
Sbjct  465  RRLCERALRELPKKAGEQLVILSQVLMDDINAGYERFADLQVKKVNGVEIENLKHLCQLV  524

Query  343  EDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDECAPALELA  170
            E+ S E +RFDLDD+RV+VLNYD+AK+ATS+ILKRHRIP AMS DL N E    +ELA
Sbjct  525  ENCSSENLRFDLDDDRVVVLNYDVAKIATSKILKRHRIPSAMSGDL-NGEQISEIELA  581



>ref|XP_010927886.1| PREDICTED: protease Do-like 10, mitochondrial [Elaeis guineensis]
Length=568

 Score =   385 bits (990),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 186/242 (77%), Positives = 217/242 (90%), Gaps = 1/242 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            V+KI+PLSDA++VL+KDDIIL+FDG+ IANDGTV FRNRERITFDHLVSMKKPNETA ++
Sbjct  327  VNKINPLSDAHRVLKKDDIILAFDGVPIANDGTVPFRNRERITFDHLVSMKKPNETAHVR  386

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSP  524
            VLR+G ++EF I L PL+PLVPVHQFDKLP ++IFAGLVF+PLTQPYLHEYGEDWYNTSP
Sbjct  387  VLRDGIENEFCISLQPLQPLVPVHQFDKLPGYYIFAGLVFVPLTQPYLHEYGEDWYNTSP  446

Query  523  RRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLV  344
            RRLCERALR+LP + GEQLVILSQVL+DDIN GYERL+ELQV KVNGVEVENLKHL +LV
Sbjct  447  RRLCERALRELPKRAGEQLVILSQVLMDDINAGYERLSELQVKKVNGVEVENLKHLCELV  506

Query  343  EDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDEC-APALELAC  167
            E  S+E +RFDLDDERVIVLNY  A++ATSRIL RHRIP AMSSDLI+D+     +++AC
Sbjct  507  EGCSEESLRFDLDDERVIVLNYQNARLATSRILNRHRIPSAMSSDLIDDQTNVSEIKVAC  566

Query  166  SN  161
            S+
Sbjct  567  SS  568



>ref|XP_002441105.1| hypothetical protein SORBIDRAFT_09g020480 [Sorghum bicolor]
 gb|EES19535.1| hypothetical protein SORBIDRAFT_09g020480 [Sorghum bicolor]
Length=587

 Score =   385 bits (989),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 183/242 (76%), Positives = 211/242 (87%), Gaps = 1/242 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            VS+I+PLSDAYK+L+KDDI+L FDG+ IANDGTV FRNRERITFDHLVSMKKP ETAVLK
Sbjct  346  VSRINPLSDAYKILKKDDILLEFDGVPIANDGTVPFRNRERITFDHLVSMKKPEETAVLK  405

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSP  524
            VLR+G++ E  + L PL+PLVPVHQFDKLPS++IFAG VFIPLTQPYLHE+GEDWYN SP
Sbjct  406  VLRDGKEQELKVTLRPLQPLVPVHQFDKLPSYYIFAGFVFIPLTQPYLHEFGEDWYNASP  465

Query  523  RRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLV  344
            RRLCERALR+LP K GEQLVILSQVL+DDIN GYERLAELQV KVNGVEVENLKHL  LV
Sbjct  466  RRLCERALRELPKKAGEQLVILSQVLMDDINVGYERLAELQVKKVNGVEVENLKHLCSLV  525

Query  343  EDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDECAPA-LELAC  167
            E  ++E +RFDLDDERVIVL Y  A++ATSR+LKRHRIP A+SSDL+ DE     +E +C
Sbjct  526  EGCTEENLRFDLDDERVIVLKYQNARLATSRVLKRHRIPSAISSDLVQDEATNGEVETSC  585

Query  166  SN  161
            ++
Sbjct  586  TS  587



>ref|XP_007028414.1| DegP protease 10 isoform 1 [Theobroma cacao]
 gb|EOY08916.1| DegP protease 10 isoform 1 [Theobroma cacao]
Length=602

 Score =   385 bits (990),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 180/226 (80%), Positives = 208/226 (92%), Gaps = 0/226 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            VSKI+PLSDA++VL+KDDIIL FDG+ IANDGTV FRNRERITFDHLVSMKKPNETAV+K
Sbjct  366  VSKINPLSDAHRVLKKDDIILEFDGVPIANDGTVPFRNRERITFDHLVSMKKPNETAVVK  425

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSP  524
            VLRNGE+H F+I L PL+PLVPVHQFDKLPS++IFAGLVF+PLTQPYLHEYGEDWYNTSP
Sbjct  426  VLRNGEEHAFTITLRPLQPLVPVHQFDKLPSYYIFAGLVFVPLTQPYLHEYGEDWYNTSP  485

Query  523  RRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLV  344
            RRLCERALR+LP + GEQLVILSQVL+DDIN GYERLAELQV KVNG+E++NLKHL +LV
Sbjct  486  RRLCERALRELPKQAGEQLVILSQVLMDDINAGYERLAELQVKKVNGIEIQNLKHLCQLV  545

Query  343  EDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  206
            E+ S E +RFDLDD+RV+ LN++ A++ATSRIL+RHRIP  MSSDL
Sbjct  546  ENCSTESLRFDLDDDRVVALNFESARIATSRILERHRIPSRMSSDL  591



>gb|KJB49010.1| hypothetical protein B456_008G097600 [Gossypium raimondii]
Length=551

 Score =   383 bits (983),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 178/230 (77%), Positives = 210/230 (91%), Gaps = 0/230 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            VSKI+PLSDAY VL+KDDIIL FDG+ IANDGTV FRNRERITFDHLVSMKKPNETA++K
Sbjct  313  VSKINPLSDAYGVLKKDDIILEFDGVPIANDGTVPFRNRERITFDHLVSMKKPNETALVK  372

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSP  524
            VLRNG++H F+I L PL+PLVPVHQFDKLPS++IFAGLVF+PLTQPYLHEYGEDWYNTSP
Sbjct  373  VLRNGQEHAFTITLQPLQPLVPVHQFDKLPSYYIFAGLVFVPLTQPYLHEYGEDWYNTSP  432

Query  523  RRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLV  344
            RRLCERALR+LP + GEQLVILSQVL+DDIN GYERLAELQV KVNG+E++NLKHL +LV
Sbjct  433  RRLCERALRELPKRAGEQLVILSQVLMDDINAGYERLAELQVKKVNGIEIKNLKHLCQLV  492

Query  343  EDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDE  194
            E+ S+E +R DLDD+RV+ LNY+ A++ATSRIL+RHRIP  MS DL++++
Sbjct  493  ENCSRESLRIDLDDDRVVALNYESARIATSRILERHRIPSRMSIDLLSEQ  542



>ref|XP_008647597.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|AFW78023.1| hypothetical protein ZEAMMB73_513869 [Zea mays]
Length=585

 Score =   384 bits (986),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 183/242 (76%), Positives = 211/242 (87%), Gaps = 1/242 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            VS+I+PLSDAYKVL+KDDI+L FDG+ IANDGTV FRNRERITFDHLVSMKKP ETAVLK
Sbjct  344  VSRINPLSDAYKVLKKDDILLEFDGVPIANDGTVPFRNRERITFDHLVSMKKPEETAVLK  403

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSP  524
            VLR+G++ E  + L PL+PLVPVHQFDKLPS++IFAG VFIPLTQPYLHE+GEDWYN SP
Sbjct  404  VLRDGKEQELGVTLRPLQPLVPVHQFDKLPSYYIFAGFVFIPLTQPYLHEFGEDWYNASP  463

Query  523  RRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLV  344
            RRLCERALR+LP K GEQLVILSQVL+DDIN GYERLAELQV KVNGVEVENLKHL  LV
Sbjct  464  RRLCERALRELPKKTGEQLVILSQVLMDDINVGYERLAELQVKKVNGVEVENLKHLCSLV  523

Query  343  EDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDECAPA-LELAC  167
            E  ++E +RFDLDDERVIVL Y  A++ATSR+LKRHRIP A+SSDL+ D+     +E +C
Sbjct  524  EGCTEENLRFDLDDERVIVLKYQNARLATSRVLKRHRIPSAISSDLVEDQVTDGEVETSC  583

Query  166  SN  161
            ++
Sbjct  584  TS  585



>ref|XP_006448510.1| hypothetical protein CICLE_v10014700mg [Citrus clementina]
 gb|ESR61750.1| hypothetical protein CICLE_v10014700mg [Citrus clementina]
Length=590

 Score =   384 bits (986),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 182/238 (76%), Positives = 214/238 (90%), Gaps = 1/238 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            V+KI+PLSDA+++L+KDDIIL+FDG+ IANDGTV FRNRERITFDHLVSMKKPNE ++++
Sbjct  345  VNKINPLSDAHEILKKDDIILAFDGVPIANDGTVAFRNRERITFDHLVSMKKPNEKSLVR  404

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSP  524
            VLR+G++HEFSI L PL+ LVPVHQFDKLPS++IFAGLVF PLTQPYLHEYGEDWYNTSP
Sbjct  405  VLRDGKEHEFSITLRPLQSLVPVHQFDKLPSYYIFAGLVFTPLTQPYLHEYGEDWYNTSP  464

Query  523  RRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLV  344
            RRLCERALR+LP K GEQLVILSQVL+DDIN GYER A+LQV KVNGVE+ENLKHL +LV
Sbjct  465  RRLCERALRELPKKAGEQLVILSQVLMDDINAGYERFADLQVKKVNGVEIENLKHLCQLV  524

Query  343  EDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDECAPALELA  170
            E+ S E +RFDLDD+RV+VLNYD+AK+ATS+ILKRHRIP A+S DL N E    +ELA
Sbjct  525  ENCSTENLRFDLDDDRVVVLNYDVAKIATSKILKRHRIPSALSGDL-NGEQISEIELA  581



>gb|KJB49013.1| hypothetical protein B456_008G097600 [Gossypium raimondii]
Length=542

 Score =   382 bits (982),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 178/230 (77%), Positives = 210/230 (91%), Gaps = 0/230 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            VSKI+PLSDAY VL+KDDIIL FDG+ IANDGTV FRNRERITFDHLVSMKKPNETA++K
Sbjct  304  VSKINPLSDAYGVLKKDDIILEFDGVPIANDGTVPFRNRERITFDHLVSMKKPNETALVK  363

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSP  524
            VLRNG++H F+I L PL+PLVPVHQFDKLPS++IFAGLVF+PLTQPYLHEYGEDWYNTSP
Sbjct  364  VLRNGQEHAFTITLQPLQPLVPVHQFDKLPSYYIFAGLVFVPLTQPYLHEYGEDWYNTSP  423

Query  523  RRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLV  344
            RRLCERALR+LP + GEQLVILSQVL+DDIN GYERLAELQV KVNG+E++NLKHL +LV
Sbjct  424  RRLCERALRELPKRAGEQLVILSQVLMDDINAGYERLAELQVKKVNGIEIKNLKHLCQLV  483

Query  343  EDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDE  194
            E+ S+E +R DLDD+RV+ LNY+ A++ATSRIL+RHRIP  MS DL++++
Sbjct  484  ENCSRESLRIDLDDDRVVALNYESARIATSRILERHRIPSRMSIDLLSEQ  533



>gb|EMS52153.1| Protease Do-like 10, mitochondrial [Triticum urartu]
Length=585

 Score =   384 bits (985),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 181/242 (75%), Positives = 214/242 (88%), Gaps = 1/242 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            VS+I+PLSDAYK+LRKDDI+L FDG+ IANDGTV FRNRERITFDHLVSMKKP ETAV+K
Sbjct  344  VSRINPLSDAYKILRKDDILLEFDGVPIANDGTVPFRNRERITFDHLVSMKKPEETAVIK  403

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSP  524
            VLR+G++HE ++ L PL+PLVPVHQFDKLPS++IFAG VFIPLTQPYLHE+GEDWYN SP
Sbjct  404  VLRDGKEHELNVTLRPLQPLVPVHQFDKLPSYYIFAGFVFIPLTQPYLHEFGEDWYNASP  463

Query  523  RRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLV  344
            RRLCERALR+LP K G+QLVILSQVL+DDIN GYERLAELQV KVNGVEVENLKHL  +V
Sbjct  464  RRLCERALRELPKKAGQQLVILSQVLMDDINVGYERLAELQVKKVNGVEVENLKHLCSIV  523

Query  343  EDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDECAPA-LELAC  167
            E+ ++E +R DLDDERVIVL +  A++ATSRILKRHRIP AMSSDL++++ +    E +C
Sbjct  524  ENCTEENLRIDLDDERVIVLKFQNARLATSRILKRHRIPSAMSSDLVDEQASKGETEASC  583

Query  166  SN  161
            +N
Sbjct  584  TN  585



>ref|XP_008377055.1| PREDICTED: protease Do-like 10, mitochondrial [Malus domestica]
Length=572

 Score =   382 bits (982),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 181/226 (80%), Positives = 207/226 (92%), Gaps = 0/226 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            V+KI+PLSDAYKVL+KDDIIL FDG+ +ANDGTVHFRNRERITFDHLVSMKKPNETA+++
Sbjct  344  VNKINPLSDAYKVLKKDDIILVFDGVPVANDGTVHFRNRERITFDHLVSMKKPNETAIVR  403

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSP  524
            VLR+GE++EFSI L PL+PLVPVHQFDKLPS++IFAGLVF+PLTQPYLHEYGEDWYN+SP
Sbjct  404  VLRDGEEYEFSIALQPLQPLVPVHQFDKLPSYYIFAGLVFVPLTQPYLHEYGEDWYNSSP  463

Query  523  RRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLV  344
            RRLCE ALR+ P +PG+QLVILSQVL+DDIN GYERLAELQV KVNGVEV+NLKHL  LV
Sbjct  464  RRLCESALREPPKRPGQQLVILSQVLMDDINAGYERLAELQVKKVNGVEVDNLKHLCLLV  523

Query  343  EDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  206
            E+ S+E +RFDLDD+RVIVLN  LAKVATS+ILK HRIP  MS DL
Sbjct  524  ENCSEESVRFDLDDDRVIVLNRRLAKVATSKILKCHRIPSVMSDDL  569



>ref|XP_010110145.1| Protease Do-like 10 [Morus notabilis]
 gb|EXC25314.1| Protease Do-like 10 [Morus notabilis]
Length=542

 Score =   381 bits (979),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 178/230 (77%), Positives = 210/230 (91%), Gaps = 0/230 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            VSKI+PLSDA KVL+KDDIIL+FDG+ IANDGTV FRNRERITFDHLVSMKKP ETAV++
Sbjct  312  VSKINPLSDANKVLKKDDIILAFDGVPIANDGTVCFRNRERITFDHLVSMKKPKETAVVR  371

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSP  524
            VLR+GE+HEF I L PL+PLVP HQFD+LPS++IFAGLVF+PLTQPYLHEYGEDWYNT+P
Sbjct  372  VLRDGEEHEFFITLRPLQPLVPAHQFDRLPSYYIFAGLVFVPLTQPYLHEYGEDWYNTAP  431

Query  523  RRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLV  344
            R LC+RALR+LP KPGEQLVILSQVL+DD+N GYERLAELQV KVNG+E+ENLKHL +LV
Sbjct  432  RSLCQRALRELPKKPGEQLVILSQVLMDDVNAGYERLAELQVKKVNGLEIENLKHLCQLV  491

Query  343  EDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDE  194
            E+N+++ +RFDLDDERVI LNY+ AK+ATS+ILK HRIP AMS DL +++
Sbjct  492  ENNTEDNVRFDLDDERVIALNYNSAKIATSKILKWHRIPSAMSKDLADEK  541



>ref|XP_002463281.1| hypothetical protein SORBIDRAFT_02g041140 [Sorghum bicolor]
 gb|EER99802.1| hypothetical protein SORBIDRAFT_02g041140 [Sorghum bicolor]
Length=586

 Score =   382 bits (982),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 183/242 (76%), Positives = 210/242 (87%), Gaps = 1/242 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            VS+I+PLSDAYK+L+KDDI+L FDG+ IANDGTV FRNRERITFDHLVSMKKP ETAVLK
Sbjct  345  VSRINPLSDAYKILKKDDILLEFDGVPIANDGTVPFRNRERITFDHLVSMKKPEETAVLK  404

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSP  524
            VLR+G++ E  + L PL+PLVPVHQFDKLPS++IFAG VFIP TQPYLHE+GEDWYN SP
Sbjct  405  VLRDGKEQELRVTLRPLQPLVPVHQFDKLPSYYIFAGFVFIPFTQPYLHEFGEDWYNASP  464

Query  523  RRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLV  344
            RRLCERALR+LP K GEQLVILSQVL+DDIN GYERLAELQV KVNGVEVENLKHL  LV
Sbjct  465  RRLCERALRELPKKAGEQLVILSQVLMDDINVGYERLAELQVKKVNGVEVENLKHLCSLV  524

Query  343  EDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDECAPA-LELAC  167
            E  ++E +RFDLDDERVIVL Y  AK+ATSR+LKRHRIP A+SSDL+ DE     +E +C
Sbjct  525  EGCTEENLRFDLDDERVIVLKYQNAKLATSRVLKRHRIPSAISSDLVEDEPTNGEVETSC  584

Query  166  SN  161
            ++
Sbjct  585  TS  586



>ref|XP_004293434.2| PREDICTED: protease Do-like 10, mitochondrial [Fragaria vesca 
subsp. vesca]
 ref|XP_011460090.1| PREDICTED: protease Do-like 10, mitochondrial [Fragaria vesca 
subsp. vesca]
Length=570

 Score =   382 bits (980),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 179/227 (79%), Positives = 209/227 (92%), Gaps = 0/227 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            VSKI+PLSDA+KVL+KDDI+L FDG+ +ANDGTVHFRNRERITFDHLVSMKKPNETAV++
Sbjct  342  VSKINPLSDAHKVLKKDDIVLVFDGVPVANDGTVHFRNRERITFDHLVSMKKPNETAVVR  401

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSP  524
            VLR+G+++EFSI L PL+PLVPVHQFDK+PS++IFAGLVF+PLTQPYLHEYGEDWYNTSP
Sbjct  402  VLRDGKEYEFSITLQPLQPLVPVHQFDKVPSYYIFAGLVFVPLTQPYLHEYGEDWYNTSP  461

Query  523  RRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLV  344
            R+LCE ALR+ P + GEQ VILSQVL+DDIN GYERLAELQV KVNG EVENLKHL +LV
Sbjct  462  RKLCEIALRESPKRAGEQFVILSQVLMDDINAGYERLAELQVKKVNGKEVENLKHLCQLV  521

Query  343  EDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLI  203
            E  S+E +RFDLDD+RV+VLNY+LAKVATS+ILK HRIP AMS+DL+
Sbjct  522  ESCSEESVRFDLDDDRVVVLNYNLAKVATSKILKCHRIPSAMSNDLV  568



>ref|XP_012078920.1| PREDICTED: protease Do-like 10, mitochondrial isoform X1 [Jatropha 
curcas]
 ref|XP_012078921.1| PREDICTED: protease Do-like 10, mitochondrial isoform X2 [Jatropha 
curcas]
 gb|KDP32493.1| hypothetical protein JCGZ_13418 [Jatropha curcas]
Length=565

 Score =   381 bits (979),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 179/238 (75%), Positives = 210/238 (88%), Gaps = 0/238 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            VSKI+PLSDAY+++RKDDII++FD + IANDGTV FRNRERITFDHLVSMKKPNETA+L+
Sbjct  328  VSKINPLSDAYRIIRKDDIIMAFDDVPIANDGTVPFRNRERITFDHLVSMKKPNETALLR  387

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSP  524
            + R G++HEFSI + PL+PLVPVHQFDKLPS++IFAGLVF+PL+QPYLHEYGEDWYNTSP
Sbjct  388  IFREGKEHEFSITVRPLQPLVPVHQFDKLPSYYIFAGLVFVPLSQPYLHEYGEDWYNTSP  447

Query  523  RRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLV  344
            RRLCERALR LP K GEQLVILSQVL+DDIN GYERLAELQV +VNGVE+ENLKHL  +V
Sbjct  448  RRLCERALRDLPKKAGEQLVILSQVLMDDINAGYERLAELQVKEVNGVEIENLKHLCHIV  507

Query  343  EDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDECAPALELA  170
            E  + E +RFDLDD+RVIVLNY  A+VATSRILKRHRIP  MS DL++++     E+A
Sbjct  508  ERCTAESLRFDLDDDRVIVLNYSSARVATSRILKRHRIPSPMSRDLVDEQSELESEMA  565



>ref|XP_002514764.1| serine endopeptidase degp2, putative [Ricinus communis]
 gb|EEF47318.1| serine endopeptidase degp2, putative [Ricinus communis]
Length=527

 Score =   378 bits (971),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 180/229 (79%), Positives = 210/229 (92%), Gaps = 0/229 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            VSKI+PLSDA++VLRKDDIIL+FDG+ IANDGTV FRNRERITFDHLVSMKKPNETA+++
Sbjct  299  VSKINPLSDAHRVLRKDDIILAFDGVPIANDGTVPFRNRERITFDHLVSMKKPNETALVR  358

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSP  524
            +LR+GE+ E++I + PL+PLVPVHQFDKLPS++IFAGLVF+PLTQPYLHEYGEDWYN+SP
Sbjct  359  ILRDGEEQEYNIIIRPLQPLVPVHQFDKLPSYYIFAGLVFVPLTQPYLHEYGEDWYNSSP  418

Query  523  RRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLV  344
            RRLCE ALR+LP K GEQLVILSQVL+DDIN GYERLAELQV KVNGV +ENLKHL +LV
Sbjct  419  RRLCEHALRELPKKAGEQLVILSQVLMDDINAGYERLAELQVKKVNGVVIENLKHLCQLV  478

Query  343  EDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLIND  197
            E  S ER+RFDLDD+RVIVLNY+LAK+ATS+ILK HRIP A S DLI++
Sbjct  479  EGCSAERLRFDLDDDRVIVLNYNLAKLATSKILKHHRIPSAKSCDLIDE  527



>ref|XP_004962074.1| PREDICTED: protease Do-like 10, mitochondrial-like [Setaria italica]
Length=586

 Score =   380 bits (975),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 179/242 (74%), Positives = 212/242 (88%), Gaps = 1/242 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            VS+I+PLSDA+K+L+KDDI+L+FDG+ IANDGTV FRNRERITFDHLVSMKKP ETAVLK
Sbjct  345  VSRINPLSDAHKILKKDDILLAFDGVPIANDGTVPFRNRERITFDHLVSMKKPGETAVLK  404

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSP  524
             LR+G++ E S+ L PL+PLVPVHQFDKLPS++IFAG VFIPLTQPYLHE+GEDWYN SP
Sbjct  405  ALRDGKEQELSVILRPLQPLVPVHQFDKLPSYYIFAGFVFIPLTQPYLHEFGEDWYNASP  464

Query  523  RRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLV  344
            RRLCERALR+LP K GEQLV+LSQVL+DDIN GYERLAELQV KVNGVEVENLKHL  LV
Sbjct  465  RRLCERALRELPKKAGEQLVVLSQVLMDDINVGYERLAELQVKKVNGVEVENLKHLCSLV  524

Query  343  EDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDECAPA-LELAC  167
            E  ++E +RFDLDDERVI+L Y  A++ATSR+LKRHRIP AMSSDL+ ++     +E +C
Sbjct  525  ESCTEENLRFDLDDERVIILKYQNARLATSRVLKRHRIPSAMSSDLVEEQATNGEVEASC  584

Query  166  SN  161
            ++
Sbjct  585  TS  586



>ref|XP_009420477.1| PREDICTED: protease Do-like 10, mitochondrial [Musa acuminata 
subsp. malaccensis]
Length=564

 Score =   379 bits (973),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 182/242 (75%), Positives = 213/242 (88%), Gaps = 1/242 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            V+KI+PLSDA+ VL+KDDIIL+FDG+ IANDG+V FRNRERITFDHLVSMKKP ETA+L 
Sbjct  323  VNKINPLSDAHNVLKKDDIILAFDGVPIANDGSVPFRNRERITFDHLVSMKKPGETAILS  382

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSP  524
            +LR+G + EFSI L PL+PLVPVHQFDKLPS++IFAGLVF+PLTQPYLHEYGEDWYNTSP
Sbjct  383  LLRDGIEQEFSISLRPLQPLVPVHQFDKLPSYYIFAGLVFVPLTQPYLHEYGEDWYNTSP  442

Query  523  RRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLV  344
            RRLCERALR+LP + GEQLVILSQVL+DDIN GYERL+E QV KVN VEVENLKHL  L+
Sbjct  443  RRLCERALRELPKRAGEQLVILSQVLMDDINAGYERLSEFQVKKVNDVEVENLKHLCGLI  502

Query  343  EDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDECAPA-LELAC  167
            E  ++E IR DLDDERVIVLNY  A++ATSRILKRHRIP AMS+DLI+++     +E+AC
Sbjct  503  EGCTEESIRLDLDDERVIVLNYKNARLATSRILKRHRIPSAMSNDLIDEQATNGEVEVAC  562

Query  166  SN  161
            S+
Sbjct  563  SS  564



>ref|XP_006655329.1| PREDICTED: protease Do-like 10, mitochondrial-like [Oryza brachyantha]
Length=475

 Score =   375 bits (964),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 179/247 (72%), Positives = 212/247 (86%), Gaps = 6/247 (2%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            VS+I+PLSDA++VL+KDDI+L FDG+ IANDGTV FRNRERITFDHLVSMKKP E AVLK
Sbjct  229  VSRINPLSDAHRVLKKDDILLEFDGVPIANDGTVPFRNRERITFDHLVSMKKPGEKAVLK  288

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSP  524
            VLR+G +HE ++ + PL+PLVPVHQFD+LPS++IFAG VFIPLTQPYLHE+GEDWYN SP
Sbjct  289  VLRDGNEHELNVTVRPLQPLVPVHQFDQLPSYYIFAGFVFIPLTQPYLHEFGEDWYNNSP  348

Query  523  RRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLV  344
            RRLCERALR+LP K GEQLVILSQVL+DDIN GYERLAELQV KVNG+EVENLKHL  LV
Sbjct  349  RRLCERALRELPKKAGEQLVILSQVLMDDINVGYERLAELQVKKVNGIEVENLKHLCSLV  408

Query  343  EDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDECAPA------  182
            E  ++E +RFDLDDERVIVL Y  AK+ATSRILKRHRIP A+SSDL++++          
Sbjct  409  EGCTEENLRFDLDDERVIVLKYKNAKLATSRILKRHRIPSAISSDLVDEQATDGEATNGE  468

Query  181  LELACSN  161
            +E +C++
Sbjct  469  IEASCTS  475



>ref|XP_004152886.1| PREDICTED: protease Do-like 10, mitochondrial [Cucumis sativus]
 gb|KGN61234.1| hypothetical protein Csa_2G072480 [Cucumis sativus]
Length=601

 Score =   380 bits (975),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 185/241 (77%), Positives = 212/241 (88%), Gaps = 1/241 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            V+KI+PLSDAY +++KDDIIL+FDG  IANDGTV FRNRERITFDHLVSMKKPNE +V+K
Sbjct  362  VNKINPLSDAYDIMKKDDIILAFDGEPIANDGTVSFRNRERITFDHLVSMKKPNEKSVVK  421

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSP  524
            VLRNGE  E  I L PL+PLVPVHQFDKLPS++IFAGLVFIPLTQPYLHEYGEDWYNTSP
Sbjct  422  VLRNGEVCELRITLRPLQPLVPVHQFDKLPSYYIFAGLVFIPLTQPYLHEYGEDWYNTSP  481

Query  523  RRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLV  344
            RRLCERALR+LP KPGEQ VILSQVL+DDIN GYERLAELQV KVNGVEV+NLKHL +LV
Sbjct  482  RRLCERALRELPKKPGEQFVILSQVLMDDINAGYERLAELQVKKVNGVEVDNLKHLCQLV  541

Query  343  EDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDECAPALELACS  164
             D S++ +RFDLDD+RVIVLN+++AK+ATSRILKRHRIP A+S DL+ D      +LA S
Sbjct  542  -DKSEDSVRFDLDDDRVIVLNFEMAKIATSRILKRHRIPSALSHDLMEDLSFHNSQLASS  600

Query  163  N  161
            +
Sbjct  601  S  601



>ref|XP_002311275.1| hypothetical protein POPTR_0008s07940g [Populus trichocarpa]
 gb|EEE88642.1| hypothetical protein POPTR_0008s07940g [Populus trichocarpa]
Length=587

 Score =   378 bits (971),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 183/248 (74%), Positives = 212/248 (85%), Gaps = 7/248 (3%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            VSKI+PLSDA++VL+ DDIIL+FDG+ IANDGTV FRNRERITFDHLVSMKKPNETA ++
Sbjct  340  VSKINPLSDAHRVLKTDDIILAFDGVPIANDGTVPFRNRERITFDHLVSMKKPNETASVR  399

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSP  524
            +LR GE+HEFSI L PL+PLVPVHQFDKLPS++IFAGLVF+PLTQPYLHEYGE+WYNTSP
Sbjct  400  LLRGGEEHEFSITLRPLQPLVPVHQFDKLPSYYIFAGLVFVPLTQPYLHEYGEEWYNTSP  459

Query  523  RRLCERALRKLPTKPGEQLVILSQ-------VLLDDINTGYERLAELQVNKVNGVEVENL  365
            RRLCERAL++LP K  +QL+ILSQ       VL+DDIN GYERLAELQV KVNGVE++NL
Sbjct  460  RRLCERALKELPKKADQQLIILSQACLRFFFVLMDDINAGYERLAELQVKKVNGVEIDNL  519

Query  364  KHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDECAP  185
            KHL +L+ D S E +RFDLDD+RVI LNY  AKVATSRILKRHRIP AMSSDL  ++  P
Sbjct  520  KHLCQLIRDCSSESLRFDLDDDRVIALNYQSAKVATSRILKRHRIPSAMSSDLSAEQNIP  579

Query  184  ALELACSN  161
              E A S+
Sbjct  580  ESESASSS  587



>ref|XP_003568444.1| PREDICTED: protease Do-like 10, mitochondrial [Brachypodium distachyon]
Length=585

 Score =   378 bits (970),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 177/230 (77%), Positives = 207/230 (90%), Gaps = 0/230 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            VS+I+PLSDAYK+LRKDDI+L FDG+ +ANDGTV FRNRERITFDHLVSMKKP E AVLK
Sbjct  344  VSRINPLSDAYKILRKDDILLEFDGVPVANDGTVPFRNRERITFDHLVSMKKPEEIAVLK  403

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSP  524
            VLR+G++HE ++ L PL+PLVPVHQFDKLPS++IFAG VFIPLTQPYLHE+G+DWYNTSP
Sbjct  404  VLRDGKEHELTVTLRPLQPLVPVHQFDKLPSYYIFAGFVFIPLTQPYLHEFGDDWYNTSP  463

Query  523  RRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLV  344
            RRLCERALR+LP K G+QLVILSQVL+DDIN GYERLAELQV KVNGVE+ENLKHL  LV
Sbjct  464  RRLCERALRELPKKAGQQLVILSQVLMDDINVGYERLAELQVKKVNGVEIENLKHLCGLV  523

Query  343  EDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDE  194
            E  + E +RFDLDDERVIVL +  A++ATSRILKRHRIP AMS+DL++++
Sbjct  524  EGCTDENLRFDLDDERVIVLKFQNARLATSRILKRHRIPSAMSNDLVDEQ  573



>gb|KHG11681.1| hypothetical protein F383_13103 [Gossypium arboreum]
Length=551

 Score =   376 bits (965),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 176/230 (77%), Positives = 207/230 (90%), Gaps = 0/230 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            VSKI+PLSDAY VL+KDDIIL FDG+ IANDGTV FRNRERITFDHLVSMKKPNETA++K
Sbjct  313  VSKINPLSDAYGVLKKDDIILEFDGVPIANDGTVPFRNRERITFDHLVSMKKPNETALVK  372

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSP  524
            VLRNG +H F+I L PL+PLVPVHQFDKLPS++IFAGLVF+PLTQPYLHEYGEDWYNTSP
Sbjct  373  VLRNGGEHAFTITLQPLQPLVPVHQFDKLPSYYIFAGLVFVPLTQPYLHEYGEDWYNTSP  432

Query  523  RRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLV  344
            RRLCE ALR+LP + GEQLVILSQVL+DDIN GYERLAELQV  VNG+E++NLKHL +LV
Sbjct  433  RRLCELALRELPKRAGEQLVILSQVLMDDINAGYERLAELQVKNVNGIEIKNLKHLCQLV  492

Query  343  EDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDE  194
            E+ S+E +R DLDD+RV+ LNY+ A++ATSRIL+RHRIP  MS DL++++
Sbjct  493  ENCSRESLRIDLDDDRVVALNYESARIATSRILERHRIPSRMSIDLLSEQ  542



>gb|EEE63742.1| hypothetical protein OsJ_18561 [Oryza sativa Japonica Group]
Length=563

 Score =   375 bits (962),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 177/230 (77%), Positives = 206/230 (90%), Gaps = 0/230 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            VS+I+PLSDA++VL+KDDI+L FDG+ IANDGTV FRNRERITFDHLVSMKKP E AVLK
Sbjct  315  VSRINPLSDAHRVLKKDDILLEFDGVPIANDGTVPFRNRERITFDHLVSMKKPGEMAVLK  374

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSP  524
            VLR+G++HE ++ + PL+PLVPVHQFDKLPS++IFAG VFIPLTQPYLHE+GEDWYN SP
Sbjct  375  VLRDGKEHELNVTVRPLQPLVPVHQFDKLPSYYIFAGFVFIPLTQPYLHEFGEDWYNNSP  434

Query  523  RRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLV  344
            RRLCERALR+LP K  EQLVILSQVL+DDIN GYERLAELQV KVNGVEVENLKHL  LV
Sbjct  435  RRLCERALRELPKKAAEQLVILSQVLMDDINVGYERLAELQVKKVNGVEVENLKHLCSLV  494

Query  343  EDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDE  194
            E  ++E +RFDLDDERVIVL Y  AK+ATSRILKRHRIP A+S+DL++++
Sbjct  495  ESCTEENLRFDLDDERVIVLKYQNAKLATSRILKRHRIPSAISADLVDEQ  544



>gb|EAY98063.1| hypothetical protein OsI_19981 [Oryza sativa Indica Group]
Length=614

 Score =   376 bits (965),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 177/230 (77%), Positives = 207/230 (90%), Gaps = 0/230 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            VS+I+PLSDA++VL+KDDI+L FDG+ IANDGTV FRNRERITFDHLVSMKKP E AVLK
Sbjct  366  VSRINPLSDAHRVLKKDDILLEFDGVPIANDGTVPFRNRERITFDHLVSMKKPGEMAVLK  425

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSP  524
            VLR+G++HE ++ + PL+PLVPVHQFDKLPS++IFAG VFIPLTQPYLHE+GEDWYN SP
Sbjct  426  VLRDGKEHELNVTVRPLQPLVPVHQFDKLPSYYIFAGFVFIPLTQPYLHEFGEDWYNNSP  485

Query  523  RRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLV  344
            RRLCERALR+LP K GEQLVILSQVL+DDIN GYERLAELQV +VNGVEVENLKHL  LV
Sbjct  486  RRLCERALRELPKKAGEQLVILSQVLMDDINVGYERLAELQVKRVNGVEVENLKHLCSLV  545

Query  343  EDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDE  194
            E  ++E +RFDLDDERVIVL Y  AK+ATSRILKRHRIP A+S+DL++++
Sbjct  546  ESCTEENLRFDLDDERVIVLKYQNAKLATSRILKRHRIPSAISADLVDEQ  595



>ref|XP_010027457.1| PREDICTED: protease Do-like 10, mitochondrial [Eucalyptus grandis]
 gb|KCW54013.1| hypothetical protein EUGRSUZ_I00006 [Eucalyptus grandis]
Length=567

 Score =   374 bits (959),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 177/239 (74%), Positives = 208/239 (87%), Gaps = 1/239 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            V+KI+PLS+AY++L+KDDIIL+FDG+ +ANDGT+ FRNRERITFDHL SMKKPNETA+++
Sbjct  328  VNKINPLSEAYRILKKDDIILAFDGVPVANDGTIPFRNRERITFDHLASMKKPNETALIR  387

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSP  524
            VLR+GE  EFSI L PL+ LVPVHQFDKLPS++IFAGL+F+PLTQPYLHEYGEDWYNTSP
Sbjct  388  VLRDGEVKEFSIALRPLQQLVPVHQFDKLPSYYIFAGLIFVPLTQPYLHEYGEDWYNTSP  447

Query  523  RRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLV  344
            RRLCERALR+LP   GE+LVILSQVL+DDIN GYERLAELQV KVNG+E+ENL+HL +LV
Sbjct  448  RRLCERALRELPKNAGEELVILSQVLMDDINAGYERLAELQVRKVNGIEIENLRHLYRLV  507

Query  343  EDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDECAPALELAC  167
            E  + E +RFDLDDERVIV NY  AK+ATS ILKRHRIP   S+DLI DE     +LAC
Sbjct  508  EHCTSESVRFDLDDERVIVFNYHTAKIATSTILKRHRIPSVASTDLI-DEQNSQEDLAC  565



>ref|XP_007150859.1| hypothetical protein PHAVU_004G000300g [Phaseolus vulgaris]
 gb|ESW22853.1| hypothetical protein PHAVU_004G000300g [Phaseolus vulgaris]
Length=549

 Score =   373 bits (957),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 174/230 (76%), Positives = 209/230 (91%), Gaps = 0/230 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            VSKI+PLSDAYK+L+KDDIILSFDG+ +ANDGTV FRNRERITFDHLVSMKKPNE A+++
Sbjct  320  VSKINPLSDAYKILKKDDIILSFDGVLLANDGTVPFRNRERITFDHLVSMKKPNEKAIVR  379

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSP  524
            VLR+G++HE SI L P++PLVPVHQFDKLPS++IFAGLVF+ LTQPYLHEYGEDWYNTSP
Sbjct  380  VLRDGQEHELSIILRPIQPLVPVHQFDKLPSYYIFAGLVFVTLTQPYLHEYGEDWYNTSP  439

Query  523  RRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLV  344
            RRLCERALR+LP K  +QLVILSQVL+DDIN GYERLAELQV KVNG E++NL+HLR+LV
Sbjct  440  RRLCERALRELPKKANQQLVILSQVLMDDINAGYERLAELQVLKVNGTEIDNLEHLRQLV  499

Query  343  EDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDE  194
            ++ + E +R DLDD+RVIVLNY++AK+ATS ILKRHRIP ++S DL++ E
Sbjct  500  QNCNAEFLRIDLDDDRVIVLNYEMAKIATSSILKRHRIPSSVSIDLLDTE  549



>ref|XP_002868484.1| DEGP10 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH44743.1| DEGP10 [Arabidopsis lyrata subsp. lyrata]
Length=586

 Score =   374 bits (960),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 181/242 (75%), Positives = 216/242 (89%), Gaps = 3/242 (1%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            VSKI+PLSDA+K+L+KDD+IL+FDG+ IANDGTV FRNRERITFDHLVSMKKP+ETA++K
Sbjct  344  VSKINPLSDAHKLLKKDDVILAFDGVPIANDGTVPFRNRERITFDHLVSMKKPDETALVK  403

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSP  524
            VLR G++HEFSI L PL+PLVPVHQFD+LPS++IFAG VF+PLTQPYLHEYGEDWYNTSP
Sbjct  404  VLREGKEHEFSITLRPLQPLVPVHQFDQLPSYYIFAGFVFVPLTQPYLHEYGEDWYNTSP  463

Query  523  RRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLV  344
            R LC+RAL+ LP K G+QLVI+SQVL+DDINTGYERLAELQVNKVNGVEV+NL+HL +L+
Sbjct  464  RTLCQRALKDLPKKAGQQLVIVSQVLMDDINTGYERLAELQVNKVNGVEVDNLRHLCQLI  523

Query  343  EDNSKERIRFDLDDE-RVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDECAPALELA-  170
            E+ + E++R DLDDE RVIVLNY  AK+ATS ILKRHRI  A+SSDL+ ++  P  ELA 
Sbjct  524  ENCNTEKLRIDLDDESRVIVLNYQSAKIATSLILKRHRIASAISSDLLVEQ-NPETELAS  582

Query  169  CS  164
            CS
Sbjct  583  CS  584



>ref|NP_001055560.1| Os05g0417100 [Oryza sativa Japonica Group]
 gb|AAT77386.1| putative serine protease [Oryza sativa Japonica Group]
 gb|AAU10782.1| putative serine protease [Oryza sativa Japonica Group]
 dbj|BAF17474.1| Os05g0417100 [Oryza sativa Japonica Group]
 dbj|BAG93339.1| unnamed protein product [Oryza sativa Japonica Group]
Length=614

 Score =   374 bits (961),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 177/230 (77%), Positives = 206/230 (90%), Gaps = 0/230 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            VS+I+PLSDA++VL+KDDI+L FDG+ IANDGTV FRNRERITFDHLVSMKKP E AVLK
Sbjct  366  VSRINPLSDAHRVLKKDDILLEFDGVPIANDGTVPFRNRERITFDHLVSMKKPGEMAVLK  425

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSP  524
            VLR+G++HE ++ + PL+PLVPVHQFDKLPS++IFAG VFIPLTQPYLHE+GEDWYN SP
Sbjct  426  VLRDGKEHELNVTVRPLQPLVPVHQFDKLPSYYIFAGFVFIPLTQPYLHEFGEDWYNNSP  485

Query  523  RRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLV  344
            RRLCERALR+LP K  EQLVILSQVL+DDIN GYERLAELQV KVNGVEVENLKHL  LV
Sbjct  486  RRLCERALRELPKKAAEQLVILSQVLMDDINVGYERLAELQVKKVNGVEVENLKHLCSLV  545

Query  343  EDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDE  194
            E  ++E +RFDLDDERVIVL Y  AK+ATSRILKRHRIP A+S+DL++++
Sbjct  546  ESCTEENLRFDLDDERVIVLKYQNAKLATSRILKRHRIPSAISADLVDEQ  595



>gb|KHN40897.1| Protease Do-like 10, mitochondrial [Glycine soja]
Length=434

 Score =   367 bits (943),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 176/230 (77%), Positives = 205/230 (89%), Gaps = 0/230 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            VSKI+PLSDAYKVL+KDDIILSFDG+ IANDGTV FRNRERITFDHLVSMKK NE A+++
Sbjct  205  VSKINPLSDAYKVLKKDDIILSFDGVPIANDGTVPFRNRERITFDHLVSMKKTNEKALVR  264

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSP  524
            +LR+G++ E SI L P++PLVPVHQFDKLPS++IFAGLVFIPLTQPYLHEYGEDWYNTSP
Sbjct  265  ILRDGQEQELSIILQPIQPLVPVHQFDKLPSYYIFAGLVFIPLTQPYLHEYGEDWYNTSP  324

Query  523  RRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLV  344
            RRLCERALR+LP K  +QLVILSQVL+DDIN GYERLAELQV KVN  E++NL+HLR+LV
Sbjct  325  RRLCERALRELPKKANQQLVILSQVLMDDINAGYERLAELQVLKVNETEIDNLEHLRQLV  384

Query  343  EDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDE  194
            E  + E +R DL+D+RVIVLNY  AK+ATSRILKRHRIP +MS DL++ E
Sbjct  385  ESCNTEFLRLDLEDDRVIVLNYGTAKIATSRILKRHRIPSSMSVDLLDTE  434



>ref|XP_006858733.2| PREDICTED: protease Do-like 10, mitochondrial, partial [Amborella 
trichopoda]
Length=536

 Score =   370 bits (951),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 175/228 (77%), Positives = 209/228 (92%), Gaps = 0/228 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            VSKI+P+SDA++VL+KDDIIL+FDG+ IANDGTV FRNRERITFDHLVSMKK NETA ++
Sbjct  296  VSKINPISDAHRVLKKDDIILAFDGVPIANDGTVPFRNRERITFDHLVSMKKANETANIR  355

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSP  524
            VLR+G++ E S+ + PLK LVPVH+++KLPS++IFAGLVF+PLTQPYLHEYGEDWYNTSP
Sbjct  356  VLRDGQELELSVVVHPLKALVPVHEYEKLPSYYIFAGLVFVPLTQPYLHEYGEDWYNTSP  415

Query  523  RRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLV  344
            RRLCERALR+LP K GEQLVILSQVL+D+IN GYERLAELQV KVNGVE++NLKHL +LV
Sbjct  416  RRLCERALRELPEKVGEQLVILSQVLMDEINVGYERLAELQVKKVNGVEIDNLKHLCELV  475

Query  343  EDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLIN  200
            ED  +E +RFDLDDERV+VLNY+ AK+ATSRILKRHRIP AMS+DL++
Sbjct  476  EDCKEESLRFDLDDERVVVLNYNKAKLATSRILKRHRIPSAMSTDLLD  523



>gb|ERN20200.1| hypothetical protein AMTR_s00066p00121670 [Amborella trichopoda]
Length=573

 Score =   371 bits (952),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 175/229 (76%), Positives = 209/229 (91%), Gaps = 0/229 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            VSKI+P+SDA++VL+KDDIIL+FDG+ IANDGTV FRNRERITFDHLVSMKK NETA ++
Sbjct  333  VSKINPISDAHRVLKKDDIILAFDGVPIANDGTVPFRNRERITFDHLVSMKKANETANIR  392

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSP  524
            VLR+G++ E S+ + PLK LVPVH+++KLPS++IFAGLVF+PLTQPYLHEYGEDWYNTSP
Sbjct  393  VLRDGQELELSVVVHPLKALVPVHEYEKLPSYYIFAGLVFVPLTQPYLHEYGEDWYNTSP  452

Query  523  RRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLV  344
            RRLCERALR+LP K GEQLVILSQVL+D+IN GYERLAELQV KVNGVE++NLKHL +LV
Sbjct  453  RRLCERALRELPEKVGEQLVILSQVLMDEINVGYERLAELQVKKVNGVEIDNLKHLCELV  512

Query  343  EDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLIND  197
            ED  +E +RFDLDDERV+VLNY+ AK+ATSRILKRHRIP AMS+DL++ 
Sbjct  513  EDCKEESLRFDLDDERVVVLNYNKAKLATSRILKRHRIPSAMSTDLLDS  561



>ref|XP_003534464.1| PREDICTED: protease Do-like 10, mitochondrial-like [Glycine max]
Length=528

 Score =   369 bits (946),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 176/230 (77%), Positives = 205/230 (89%), Gaps = 0/230 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            VSKI+PLSDAYKVL+KDDIILSFDG+ IANDGTV FRNRERITFDHLVSMKK NE A+++
Sbjct  299  VSKINPLSDAYKVLKKDDIILSFDGVPIANDGTVPFRNRERITFDHLVSMKKTNEKALVR  358

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSP  524
            +LR+G++ E SI L P++PLVPVHQFDKLPS++IFAGLVFIPLTQPYLHEYGEDWYNTSP
Sbjct  359  ILRDGQEQELSIILQPIQPLVPVHQFDKLPSYYIFAGLVFIPLTQPYLHEYGEDWYNTSP  418

Query  523  RRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLV  344
            RRLCERALR+LP K  +QLVILSQVL+DDIN GYERLAELQV KVN  E++NL+HLR+LV
Sbjct  419  RRLCERALRELPKKANQQLVILSQVLMDDINAGYERLAELQVLKVNETEIDNLEHLRQLV  478

Query  343  EDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDE  194
            E  + E +R DL+D+RVIVLNY  AK+ATSRILKRHRIP +MS DL++ E
Sbjct  479  ESCNTEFLRLDLEDDRVIVLNYGTAKIATSRILKRHRIPSSMSVDLLDTE  528



>ref|NP_568543.1| protease Do-like 10 [Arabidopsis thaliana]
 sp|Q9FIV6.1|DGP10_ARATH RecName: Full=Protease Do-like 10, mitochondrial; Flags: Precursor 
[Arabidopsis thaliana]
 dbj|BAB11638.1| serine protease-like protein [Arabidopsis thaliana]
 gb|AAL47441.1| AT5g36950/MLF18_70 [Arabidopsis thaliana]
 gb|AAT85770.1| At5g36950 [Arabidopsis thaliana]
 gb|AED94131.1| protease Do-like 10 [Arabidopsis thaliana]
Length=586

 Score =   370 bits (951),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 176/241 (73%), Positives = 211/241 (88%), Gaps = 1/241 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            VSKI+PLSDA+K+L+KDD++L+FDG+ IANDGTV FRNRERITFDHLVSMKKP+ETA++K
Sbjct  344  VSKINPLSDAHKILKKDDVLLAFDGVPIANDGTVPFRNRERITFDHLVSMKKPDETALVK  403

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSP  524
            VLR G++HEFSI L PL+PLVPVHQFD+LPS++IFAG VF+PLTQPYLHEYGEDWYNTSP
Sbjct  404  VLREGKEHEFSITLRPLQPLVPVHQFDQLPSYYIFAGFVFVPLTQPYLHEYGEDWYNTSP  463

Query  523  RRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLV  344
            R LC RAL+ LP K G+QLVI+SQVL+DDINTGYERLAELQVNKVNGVEV NL+HL +L+
Sbjct  464  RTLCHRALKDLPKKAGQQLVIVSQVLMDDINTGYERLAELQVNKVNGVEVNNLRHLCQLI  523

Query  343  EDNSKERIRFDLDDE-RVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDECAPALELAC  167
            E+ + E++R DLDDE RVIVLNY  AK+ATS ILKRHRI  A+SSDL+ ++       +C
Sbjct  524  ENCNTEKLRIDLDDESRVIVLNYQSAKIATSLILKRHRIASAISSDLLIEQNLETELASC  583

Query  166  S  164
            S
Sbjct  584  S  584



>gb|KEH24729.1| DegP protease [Medicago truncatula]
Length=443

 Score =   364 bits (935),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 175/241 (73%), Positives = 211/241 (88%), Gaps = 2/241 (1%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            V+KI+PLSDAY+VL+K+DIILSFDG+ IANDGTV FRNRERITFDHLVSMKK NE AV++
Sbjct  205  VNKINPLSDAYRVLKKNDIILSFDGVPIANDGTVPFRNRERITFDHLVSMKKLNEKAVVR  264

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSP  524
            V+R+G++ E SI L P++PLVPVHQFDKLPS++IFAGLVF+PLTQPYLHEYGEDWYN SP
Sbjct  265  VMRDGQELELSITLQPIQPLVPVHQFDKLPSYYIFAGLVFVPLTQPYLHEYGEDWYNASP  324

Query  523  RRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLV  344
            RRLCERALR+LP K  +QLVILSQVL+DDIN GYERLA+LQV KVNG E++NL+HL +LV
Sbjct  325  RRLCERALRELPKKENQQLVILSQVLMDDINAGYERLADLQVLKVNGTEIDNLEHLCQLV  384

Query  343  EDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDECAPALELACS  164
            E+ +K+ + FDLDD RVIVLNY+ AK+ATSRIL RHRIP +MS+DLI+ +    L+L  S
Sbjct  385  ENCTKDSLHFDLDDNRVIVLNYETAKIATSRILTRHRIPSSMSADLIDAQ--NNLQLTSS  442

Query  163  N  161
            N
Sbjct  443  N  443



>ref|XP_004489189.1| PREDICTED: protease Do-like 10, mitochondrial-like [Cicer arietinum]
Length=550

 Score =   366 bits (939),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 173/226 (77%), Positives = 202/226 (89%), Gaps = 0/226 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            V+KI+PLSDAYKVL+KDDIILSFDG+ IANDGTV FRNRERITFDHLVSMKK +E AV++
Sbjct  309  VNKINPLSDAYKVLKKDDIILSFDGVPIANDGTVSFRNRERITFDHLVSMKKLDEKAVVR  368

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSP  524
            VLR G++ E SI L P++PLVPVHQFDKLPS++IFAGLVF+PLTQPYLHEYGEDWYN SP
Sbjct  369  VLRGGQEIELSITLRPIQPLVPVHQFDKLPSYYIFAGLVFVPLTQPYLHEYGEDWYNASP  428

Query  523  RRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLV  344
            RRLCERALR+LP K  +QLVILSQVL+DDIN GYERLA+ QV KVNG E++NL+HL +LV
Sbjct  429  RRLCERALRELPKKENQQLVILSQVLMDDINAGYERLADFQVLKVNGTEIDNLEHLCQLV  488

Query  343  EDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  206
            E+ S E + FDLDD+RVIVLNY+ AK+ATSRILKRHRIP +MS+DL
Sbjct  489  ENCSTESLHFDLDDDRVIVLNYETAKIATSRILKRHRIPSSMSTDL  534



>ref|XP_010435521.1| PREDICTED: protease Do-like 10, mitochondrial [Camelina sativa]
Length=598

 Score =   366 bits (940),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 176/241 (73%), Positives = 209/241 (87%), Gaps = 2/241 (1%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            +SKI+PLSDAY++L+KDD+ILSFD ++IANDGTV FRNRERITFDHLVSMKKPNE+A++K
Sbjct  355  ISKINPLSDAYRILKKDDVILSFDSVSIANDGTVPFRNRERITFDHLVSMKKPNESALVK  414

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSP  524
            VLR G++ EFSI L PL+PLVPVHQFD+LPS++IFAG VF+PLTQPYLHEYGEDWYNTSP
Sbjct  415  VLREGKEQEFSITLKPLQPLVPVHQFDQLPSYYIFAGFVFVPLTQPYLHEYGEDWYNTSP  474

Query  523  RRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLV  344
            R LC RAL+ LP K G+QLVI+SQVL+DDINTGYERL ELQV KVNGVEV+NL+HL +L+
Sbjct  475  RSLCVRALKDLPKKAGQQLVIVSQVLMDDINTGYERLTELQVKKVNGVEVDNLRHLCQLI  534

Query  343  EDNSKERIRFDL-DDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDECAPALELAC  167
            E+ + E +R DL DDERVI LNY  AK+ATS ILKRHRI  AMSSDL+ ++  P  ELA 
Sbjct  535  ENCNTENLRVDLEDDERVIFLNYQSAKIATSLILKRHRIASAMSSDLLIEQ-NPVTELAS  593

Query  166  S  164
            S
Sbjct  594  S  594



>gb|KEH24728.1| DegP protease [Medicago truncatula]
Length=550

 Score =   365 bits (936),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 175/241 (73%), Positives = 211/241 (88%), Gaps = 2/241 (1%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            V+KI+PLSDAY+VL+K+DIILSFDG+ IANDGTV FRNRERITFDHLVSMKK NE AV++
Sbjct  312  VNKINPLSDAYRVLKKNDIILSFDGVPIANDGTVPFRNRERITFDHLVSMKKLNEKAVVR  371

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSP  524
            V+R+G++ E SI L P++PLVPVHQFDKLPS++IFAGLVF+PLTQPYLHEYGEDWYN SP
Sbjct  372  VMRDGQELELSITLQPIQPLVPVHQFDKLPSYYIFAGLVFVPLTQPYLHEYGEDWYNASP  431

Query  523  RRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLV  344
            RRLCERALR+LP K  +QLVILSQVL+DDIN GYERLA+LQV KVNG E++NL+HL +LV
Sbjct  432  RRLCERALRELPKKENQQLVILSQVLMDDINAGYERLADLQVLKVNGTEIDNLEHLCQLV  491

Query  343  EDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDECAPALELACS  164
            E+ +K+ + FDLDD RVIVLNY+ AK+ATSRIL RHRIP +MS+DLI+ +    L+L  S
Sbjct  492  ENCTKDSLHFDLDDNRVIVLNYETAKIATSRILTRHRIPSSMSADLIDAQ--NNLQLTSS  549

Query  163  N  161
            N
Sbjct  550  N  550



>ref|XP_006283411.1| hypothetical protein CARUB_v10004459mg [Capsella rubella]
 gb|EOA16309.1| hypothetical protein CARUB_v10004459mg [Capsella rubella]
Length=577

 Score =   364 bits (935),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 176/242 (73%), Positives = 213/242 (88%), Gaps = 3/242 (1%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            +SKI+PLSDA+++L+KDD+ILSFD ++IANDGTV FRNRERITFD+LVSMKKP+ETA++K
Sbjct  335  ISKINPLSDAHRILKKDDVILSFDNVSIANDGTVPFRNRERITFDYLVSMKKPDETALVK  394

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSP  524
            VLR G++HEFSI L PL+PLVPVHQFD+LPS++IFAG VF+PLTQPYLHEYGEDWYNTSP
Sbjct  395  VLREGKEHEFSITLKPLQPLVPVHQFDQLPSYYIFAGFVFVPLTQPYLHEYGEDWYNTSP  454

Query  523  RRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLV  344
            R LC RAL+ LP K G+QLVI+SQVL+DDINTGYERLAELQV KVNGVEV+NL+HL +L+
Sbjct  455  RSLCMRALKDLPKKAGQQLVIVSQVLMDDINTGYERLAELQVKKVNGVEVDNLRHLCQLI  514

Query  343  EDNSKERIRFDL-DDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDECAPALELA-  170
            E+ + E +R DL DDERVI+LNY  AK+ATS ILKRHRI  A+SSDL+ ++  P  ELA 
Sbjct  515  ENCNTEELRLDLDDDERVIILNYQSAKIATSLILKRHRIASAISSDLLIEQ-NPVTELAS  573

Query  169  CS  164
            CS
Sbjct  574  CS  575



>ref|XP_010440805.1| PREDICTED: protease Do-like 10, mitochondrial isoform X2 [Camelina 
sativa]
Length=567

 Score =   362 bits (930),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 175/242 (72%), Positives = 206/242 (85%), Gaps = 2/242 (1%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            +SKI+PLSDA+++L+KDD+ILSFD ++IANDGTV FRNRERITFDHLVSMKKPNETA++K
Sbjct  324  ISKINPLSDAHRILKKDDVILSFDSVSIANDGTVPFRNRERITFDHLVSMKKPNETALVK  383

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSP  524
            VLR G++ EFSI L PL+PLVPVHQFD+LPS++IFAG VF+PLTQPYLHEYGEDWYNTSP
Sbjct  384  VLREGKEQEFSITLKPLQPLVPVHQFDQLPSYYIFAGFVFVPLTQPYLHEYGEDWYNTSP  443

Query  523  RRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLV  344
            R LC RAL+ LP K G+QLVI+SQVL+DDINTGYERL ELQV KVNGVEV+NL+HL +L+
Sbjct  444  RSLCVRALKDLPKKAGQQLVIVSQVLMDDINTGYERLTELQVKKVNGVEVDNLRHLCQLI  503

Query  343  EDNSKERIRFDL-DDERVIVLNYDLAKVATSRILKRHRIPYAMSSD-LINDECAPALELA  170
            E+ + E +R DL DDERVI LNY  AK+ATS ILKRHRI  AMSSD LI       L  +
Sbjct  504  ENCNTENLRVDLEDDERVIFLNYQSAKIATSLILKRHRIASAMSSDLLIEQNLVTELASS  563

Query  169  CS  164
            CS
Sbjct  564  CS  565



>ref|XP_010673840.1| PREDICTED: protease Do-like 10, mitochondrial [Beta vulgaris 
subsp. vulgaris]
Length=590

 Score =   363 bits (931),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 171/235 (73%), Positives = 210/235 (89%), Gaps = 0/235 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            VSKI+P+S+A+K+L++DDIIL+FDG++IANDGTV FRNRERI FDHLVSMKK NE A LK
Sbjct  351  VSKINPISEAHKILKRDDIILAFDGVSIANDGTVPFRNRERIPFDHLVSMKKVNEKAELK  410

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSP  524
            VLR+G++++FSI + PL+PLVPVHQFDKLPS++IFAGLVFIPL+QPYLHEYGE+WYNTSP
Sbjct  411  VLRDGKEYDFSINVQPLQPLVPVHQFDKLPSYYIFAGLVFIPLSQPYLHEYGEEWYNTSP  470

Query  523  RRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLV  344
            RRLCERALR++P K G+QLVILSQVL+DDIN GYERL+ELQV KVNGVE++NLKHL +LV
Sbjct  471  RRLCERALREVPKKAGQQLVILSQVLMDDINAGYERLSELQVRKVNGVEIDNLKHLCQLV  530

Query  343  EDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDECAPAL  179
            ED  ++ +R DLDD+RVIVL+Y  AK+ATSRIL RHRIP + SSDL++ E  P +
Sbjct  531  EDCKEKNLRIDLDDDRVIVLDYHKAKLATSRILTRHRIPSSTSSDLVDSEEEPTV  585



>ref|XP_010440803.1| PREDICTED: protease Do-like 10, mitochondrial isoform X1 [Camelina 
sativa]
Length=590

 Score =   362 bits (930),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 175/242 (72%), Positives = 206/242 (85%), Gaps = 2/242 (1%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            +SKI+PLSDA+++L+KDD+ILSFD ++IANDGTV FRNRERITFDHLVSMKKPNETA++K
Sbjct  347  ISKINPLSDAHRILKKDDVILSFDSVSIANDGTVPFRNRERITFDHLVSMKKPNETALVK  406

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSP  524
            VLR G++ EFSI L PL+PLVPVHQFD+LPS++IFAG VF+PLTQPYLHEYGEDWYNTSP
Sbjct  407  VLREGKEQEFSITLKPLQPLVPVHQFDQLPSYYIFAGFVFVPLTQPYLHEYGEDWYNTSP  466

Query  523  RRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLV  344
            R LC RAL+ LP K G+QLVI+SQVL+DDINTGYERL ELQV KVNGVEV+NL+HL +L+
Sbjct  467  RSLCVRALKDLPKKAGQQLVIVSQVLMDDINTGYERLTELQVKKVNGVEVDNLRHLCQLI  526

Query  343  EDNSKERIRFDL-DDERVIVLNYDLAKVATSRILKRHRIPYAMSSD-LINDECAPALELA  170
            E+ + E +R DL DDERVI LNY  AK+ATS ILKRHRI  AMSSD LI       L  +
Sbjct  527  ENCNTENLRVDLEDDERVIFLNYQSAKIATSLILKRHRIASAMSSDLLIEQNLVTELASS  586

Query  169  CS  164
            CS
Sbjct  587  CS  588



>ref|XP_010450457.1| PREDICTED: protease Do-like 10, mitochondrial [Camelina sativa]
Length=598

 Score =   362 bits (930),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 175/242 (72%), Positives = 206/242 (85%), Gaps = 2/242 (1%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            VSKI+PLSDA+++L+KDD+IL+FD ++IANDGTV FRNRERITFDHLVSMKKPNETA++K
Sbjct  355  VSKINPLSDAHRILKKDDVILAFDSVSIANDGTVPFRNRERITFDHLVSMKKPNETALVK  414

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSP  524
            VLR G++ EFSI L PL+PLVPVHQFD+LPS++IFAG VF+PLTQPYLHEYGEDWYNTSP
Sbjct  415  VLREGKEQEFSITLKPLQPLVPVHQFDQLPSYYIFAGFVFVPLTQPYLHEYGEDWYNTSP  474

Query  523  RRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLV  344
            R LC RAL+ LP K G+QLVI+SQVL+DDINTGYERL ELQV KVNGVEV+NL+HL +L+
Sbjct  475  RSLCMRALKDLPKKAGQQLVIVSQVLMDDINTGYERLTELQVKKVNGVEVDNLRHLCQLI  534

Query  343  EDNSKERIRFDL-DDERVIVLNYDLAKVATSRILKRHRIPYAMSSD-LINDECAPALELA  170
            E+ + E +R DL DDERVI LNY  AK+ATS ILKRHRI  AMSSD LI       L  +
Sbjct  535  ENCNTENLRVDLEDDERVIFLNYQSAKIATSLILKRHRIASAMSSDLLIEQNLVTELASS  594

Query  169  CS  164
            CS
Sbjct  595  CS  596



>ref|XP_006405960.1| hypothetical protein EUTSA_v10027701mg [Eutrema salsugineum]
 gb|ESQ47413.1| hypothetical protein EUTSA_v10027701mg [Eutrema salsugineum]
Length=578

 Score =   360 bits (924),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 171/242 (71%), Positives = 209/242 (86%), Gaps = 2/242 (1%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            VSK++PLSDA+++L+KDD+IL+FDG  IAN+GTVHFR +ERI FDHLVSMKKP+ETA++K
Sbjct  336  VSKLNPLSDAHRILKKDDVILAFDGAPIANEGTVHFRKKERINFDHLVSMKKPDETALVK  395

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSP  524
            VLR G++HEF I L PL+PLVPVHQFD+LPS++IFAG VF+ LTQPYLHEYGEDWYN SP
Sbjct  396  VLREGKEHEFRITLKPLQPLVPVHQFDQLPSYYIFAGFVFVRLTQPYLHEYGEDWYNISP  455

Query  523  RRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLV  344
            RRLCERALR LP KPG++LVI+SQVL+DDINTGYERLAELQV KVNGVEV+NL+HL +L+
Sbjct  456  RRLCERALRDLPKKPGQELVIISQVLMDDINTGYERLAELQVEKVNGVEVDNLRHLCQLI  515

Query  343  EDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDECAPALELA-C  167
            E+ + E +R DLD+ RV+ L+Y  A+VATS ILKRHRI  AMSSDL+ ++  P  ELA C
Sbjct  516  ENCNTENLRIDLDEGRVLALHYHSARVATSLILKRHRIASAMSSDLLMEQ-NPVTELASC  574

Query  166  SN  161
            S 
Sbjct  575  ST  576



>emb|CDY53528.1| BnaCnng25320D [Brassica napus]
Length=581

 Score =   357 bits (915),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 167/240 (70%), Positives = 204/240 (85%), Gaps = 0/240 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            +SKI+PLSDA+K+L+K+D+IL+FDG+ I NDGTV  R +ERITFDH+VSMKKPNETA++K
Sbjct  336  ISKINPLSDAHKILKKEDVILAFDGVPIGNDGTVPLRKKERITFDHMVSMKKPNETALVK  395

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSP  524
            VLR G++HEF I L PL+PLVPVHQFD+LPS++IFAG VF+PLTQPYLHEYGEDWYNT P
Sbjct  396  VLREGKEHEFCITLRPLQPLVPVHQFDQLPSYYIFAGFVFVPLTQPYLHEYGEDWYNTCP  455

Query  523  RRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLV  344
            RRLCERALR LP K  +QLVI+SQVL+DDINTG+ERLAELQV KVNGVEV+NL+HL +L+
Sbjct  456  RRLCERALRDLPEKSNQQLVIISQVLMDDINTGFERLAELQVKKVNGVEVDNLRHLCQLI  515

Query  343  EDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDECAPALELACS  164
            E+   E ++ DLDD RV+ L Y  A++ATS ILKRHRI  AMSSDL+ ++   A ELA S
Sbjct  516  ENCDAENLKLDLDDGRVLALKYQDARLATSLILKRHRIASAMSSDLLIEQNNLATELAAS  575



>ref|XP_009139697.1| PREDICTED: protease Do-like 10, mitochondrial [Brassica rapa]
Length=573

 Score =   355 bits (912),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 167/240 (70%), Positives = 203/240 (85%), Gaps = 0/240 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            +SKI+PLSDA+K+L K+D+IL+FDG+ I NDGTV  R +ERITFDH+VSMKKPNETA++K
Sbjct  328  ISKINPLSDAHKILNKEDVILAFDGVPIGNDGTVPLRKKERITFDHMVSMKKPNETALVK  387

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSP  524
            VLR G++HEF I L PL+PLVPVHQFD+LPS++IFAG VF+PLTQPYLHEYGEDWYNT P
Sbjct  388  VLREGKEHEFCITLRPLQPLVPVHQFDQLPSYYIFAGFVFVPLTQPYLHEYGEDWYNTCP  447

Query  523  RRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLV  344
            RRLCERALR LP K  +QLVI+SQVL+DDINTG+ERLAELQV KVNGVEV+NL+HL +L+
Sbjct  448  RRLCERALRDLPEKSNQQLVIISQVLMDDINTGFERLAELQVKKVNGVEVDNLRHLCQLI  507

Query  343  EDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDECAPALELACS  164
            E+   E ++ DLDD RV+ L Y  A++ATS ILKRHRI  AMSSDL+ ++   A ELA S
Sbjct  508  ENCDTENLKLDLDDGRVLALKYQDARLATSLILKRHRIASAMSSDLLIEQNNLATELAAS  567



>emb|CDX74606.1| BnaA04g07830D [Brassica napus]
Length=573

 Score =   354 bits (908),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 166/240 (69%), Positives = 203/240 (85%), Gaps = 0/240 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            +SKI+PLSDA+K+L K+D+IL+FDG+ I NDGTV  R +ERITFDH+VSMKKPNETA++K
Sbjct  328  ISKINPLSDAHKILNKEDVILAFDGVPIGNDGTVPLRKKERITFDHMVSMKKPNETALVK  387

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSP  524
            VLR G++HEF I L PL+PLVPVHQFD+LPS++IF+G VF+PLTQPYLHEYGEDWYNT P
Sbjct  388  VLREGKEHEFCITLRPLQPLVPVHQFDQLPSYYIFSGFVFVPLTQPYLHEYGEDWYNTCP  447

Query  523  RRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLV  344
            RRLCERALR LP K  +QLVI+SQVL+DDINTG+ERLAELQV KVNGVEV+NL+HL +L+
Sbjct  448  RRLCERALRDLPEKSNQQLVIISQVLMDDINTGFERLAELQVKKVNGVEVDNLRHLCQLI  507

Query  343  EDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDECAPALELACS  164
            E+   E ++ DLDD RV+ L Y  A++ATS ILKRHRI  AMSSDL+ ++   A ELA S
Sbjct  508  ENCDTENLKLDLDDGRVLALKYQDARLATSLILKRHRIASAMSSDLLIEQNNLATELAAS  567



>ref|XP_006858734.1| PREDICTED: protease Do-like 10, mitochondrial isoform X1 [Amborella 
trichopoda]
 gb|ERN20201.1| hypothetical protein AMTR_s00066p00122890 [Amborella trichopoda]
Length=524

 Score =   343 bits (880),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 160/230 (70%), Positives = 199/230 (87%), Gaps = 0/230 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            VSKI+P+SDA++VL+KDDI+L+FDG+ IANDGTV FRNRERITF+HLVSMKK NET+ ++
Sbjct  284  VSKINPISDAHRVLKKDDIMLAFDGVPIANDGTVPFRNRERITFEHLVSMKKANETSKIR  343

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSP  524
            VLR+G++ E S+ + PL  LVPVHQ+DKLPS++IFAGLVF+PLTQPYLHE+GEDWYNTSP
Sbjct  344  VLRDGQELELSVVVHPLNALVPVHQYDKLPSYYIFAGLVFVPLTQPYLHEFGEDWYNTSP  403

Query  523  RRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLV  344
            R LC+ + R++P K GEQLVILSQVL+D+IN GYERL +LQV KVNGVE+ NLKHL +LV
Sbjct  404  RHLCDLSFRRMPKKVGEQLVILSQVLMDEINVGYERLEDLQVKKVNGVEINNLKHLCQLV  463

Query  343  EDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDE  194
            ED  +E +R DLD ERV+ LNY+ AK+ATS ILKRHRIP A S+DL++ E
Sbjct  464  EDCKEESLRLDLDKERVVALNYNKAKLATSHILKRHRIPSATSTDLLDSE  513



>gb|EPS59937.1| hypothetical protein M569_14869, partial [Genlisea aurea]
Length=196

 Score =   327 bits (839),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 157/196 (80%), Positives = 182/196 (93%), Gaps = 1/196 (1%)
 Frame = -2

Query  787  TVHFRNRERITFDHLVSMKKPNETAVLKVLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSF  608
            +V FRNRERITFDHLVSMKKP+E A++K+LR+GE+ EF+I L PL+PLVPVHQFDKLPS+
Sbjct  1    SVPFRNRERITFDHLVSMKKPDEVALVKILRDGEELEFTITLRPLQPLVPVHQFDKLPSY  60

Query  607  FIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINT  428
            FIFAGLVF+PLTQPYLHEYGEDWYNTSPRRLCERALR+LP K G+QL+ILSQVL+DDINT
Sbjct  61   FIFAGLVFVPLTQPYLHEYGEDWYNTSPRRLCERALRELPRKGGQQLIILSQVLMDDINT  120

Query  427  GYERLAELQVNKVNGVEVENLKHLRKLVEDN-SKERIRFDLDDERVIVLNYDLAKVATSR  251
            GYERLA+LQV KVNG+EV+NL HLR+LVED+ S+E IRFD+DDERV+VLNY LAKVATSR
Sbjct  121  GYERLADLQVKKVNGIEVDNLVHLRRLVEDSHSREVIRFDMDDERVMVLNYSLAKVATSR  180

Query  250  ILKRHRIPYAMSSDLI  203
            +LKRHRIP A+S DLI
Sbjct  181  VLKRHRIPSAVSWDLI  196



>ref|XP_002963416.1| hypothetical protein SELMODRAFT_62730, partial [Selaginella moellendorffii]
 gb|EFJ35287.1| hypothetical protein SELMODRAFT_62730, partial [Selaginella moellendorffii]
Length=472

 Score =   315 bits (807),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 145/226 (64%), Positives = 188/226 (83%), Gaps = 0/226 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            VSK++PL++    ++KDD++L+FDG+ IANDG+V FRNRERI+F HLV+MK+  E+A L+
Sbjct  247  VSKVYPLTEVSNYIKKDDVLLAFDGVLIANDGSVTFRNRERISFVHLVTMKREGESAALR  306

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSP  524
            VLR+G++  F++KL P+KPLVP HQF++LPS++IFAGLVF+PLT PYLHEYG+DWYN SP
Sbjct  307  VLRDGKEINFNVKLAPVKPLVPNHQFERLPSYYIFAGLVFVPLTLPYLHEYGDDWYNASP  366

Query  523  RRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLV  344
            RRLC+R   K+P KPGEQ VI+SQVL+DDIN GYERLAELQV +VNG ++ NL+HLR+LV
Sbjct  367  RRLCDRTFSKMPKKPGEQFVIMSQVLIDDINAGYERLAELQVKQVNGEKIVNLQHLRRLV  426

Query  343  EDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  206
            E   +  IRFDLDD RVIVL Y+ AK A+ RIL+ HRI  A+S+DL
Sbjct  427  EGCKEPYIRFDLDDGRVIVLKYESAKEASLRILQNHRISSAVSTDL  472



>ref|XP_002971553.1| hypothetical protein SELMODRAFT_62447, partial [Selaginella moellendorffii]
 gb|EFJ27302.1| hypothetical protein SELMODRAFT_62447, partial [Selaginella moellendorffii]
Length=463

 Score =   313 bits (803),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 144/227 (63%), Positives = 188/227 (83%), Gaps = 0/227 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            VSK++PL++    ++KDD++L+FDG+ IANDG+V FRNRERI+F HLV+MK+  E+A L+
Sbjct  237  VSKVYPLTEVSNYIKKDDVLLAFDGVLIANDGSVTFRNRERISFVHLVTMKREGESAALR  296

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSP  524
            VLR+G++  F++KL P+KPLVP HQF++LPS++IFAGLVF+PLT PYLHEYG+DWYN SP
Sbjct  297  VLRDGKEINFNVKLAPVKPLVPNHQFERLPSYYIFAGLVFVPLTLPYLHEYGDDWYNASP  356

Query  523  RRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLV  344
            RRLC+R   K+P KPGEQ VI+SQVL+DDIN GYERLAELQV +VNG ++ NL+HLR+LV
Sbjct  357  RRLCDRTFSKMPKKPGEQFVIMSQVLIDDINAGYERLAELQVKQVNGEKIVNLQHLRRLV  416

Query  343  EDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLI  203
            E   +  IRFDLDD RVIVL Y+ AK A+ RIL+ HRI   +S+DL+
Sbjct  417  EGCKEPYIRFDLDDGRVIVLKYESAKEASLRILQNHRISSPVSTDLL  463



>ref|NP_001142088.1| hypothetical protein [Zea mays]
 gb|ACF87611.1| unknown [Zea mays]
 gb|AFW78022.1| hypothetical protein ZEAMMB73_513869 [Zea mays]
Length=556

 Score =   312 bits (800),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 158/242 (65%), Positives = 183/242 (76%), Gaps = 30/242 (12%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            VS+I+PLSDAYKVL+KDDI+L FDG+ IANDGTV FRNRERITFDHLVSMKKP ETAVLK
Sbjct  344  VSRINPLSDAYKVLKKDDILLEFDGVPIANDGTVPFRNRERITFDHLVSMKKPEETAVLK  403

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSP  524
            VLR+G++ E  + L P                             PYLHE+GEDWYN SP
Sbjct  404  VLRDGKEQELGVTLRP-----------------------------PYLHEFGEDWYNASP  434

Query  523  RRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLV  344
            RRLCERALR+LP K GEQLVILSQVL+DDIN GYERLAELQV KVNGVEVENLKHL  LV
Sbjct  435  RRLCERALRELPKKTGEQLVILSQVLMDDINVGYERLAELQVKKVNGVEVENLKHLCSLV  494

Query  343  EDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDECAPA-LELAC  167
            E  ++E +RFDLDDERVIVL Y  A++ATSR+LKRHRIP A+SSDL+ D+     +E +C
Sbjct  495  EGCTEENLRFDLDDERVIVLKYQNARLATSRVLKRHRIPSAISSDLVEDQVTDGEVETSC  554

Query  166  SN  161
            ++
Sbjct  555  TS  556



>ref|XP_012078922.1| PREDICTED: protease Do-like 10, mitochondrial isoform X3 [Jatropha 
curcas]
Length=536

 Score =   310 bits (795),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 155/238 (65%), Positives = 181/238 (76%), Gaps = 29/238 (12%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            VSKI+PLSDAY+++RKDDII++FD + IANDGTV FRNRERITFDHLVSMKKPNETA+L+
Sbjct  328  VSKINPLSDAYRIIRKDDIIMAFDDVPIANDGTVPFRNRERITFDHLVSMKKPNETALLR  387

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSP  524
            + R G++HEFSI + P                             PYLHEYGEDWYNTSP
Sbjct  388  IFREGKEHEFSITVRP-----------------------------PYLHEYGEDWYNTSP  418

Query  523  RRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLV  344
            RRLCERALR LP K GEQLVILSQVL+DDIN GYERLAELQV +VNGVE+ENLKHL  +V
Sbjct  419  RRLCERALRDLPKKAGEQLVILSQVLMDDINAGYERLAELQVKEVNGVEIENLKHLCHIV  478

Query  343  EDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDECAPALELA  170
            E  + E +RFDLDD+RVIVLNY  A+VATSRILKRHRIP  MS DL++++     E+A
Sbjct  479  ERCTAESLRFDLDDDRVIVLNYSSARVATSRILKRHRIPSPMSRDLVDEQSELESEMA  536



>ref|XP_010027524.1| PREDICTED: protease Do-like 10, mitochondrial [Eucalyptus grandis]
 gb|KCW54066.1| hypothetical protein EUGRSUZ_I00047 [Eucalyptus grandis]
Length=541

 Score =   306 bits (785),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 150/230 (65%), Positives = 180/230 (78%), Gaps = 1/230 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            V+ IHPLSDAY++L+KDDIIL+FD   +ANDGT  FR RERI FDH VSMKKPN+   +K
Sbjct  304  VNSIHPLSDAYRILKKDDIILAFDNRPVANDGTTPFRKRERIAFDHWVSMKKPNDPVPIK  363

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSP  524
            V R  ++ EFSI L PL+PLVPVHQFDK PS++IFAGL+FIPLTQPYL EY  D Y+  P
Sbjct  364  VFREKKECEFSITLRPLQPLVPVHQFDKHPSYYIFAGLIFIPLTQPYLDEYA-DRYSMWP  422

Query  523  RRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLV  344
            RRLCERAL +LP   G+++VI+S+VL  DIN GYE LAELQV KVNG E+ENL HL +LV
Sbjct  423  RRLCERALEELPRNAGQEIVIISKVLTADINAGYEHLAELQVRKVNGTEIENLSHLYRLV  482

Query  343  EDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDE  194
            ED + E IRFDLD+E VIV NY +AK AT+ IL RHRIP   S+DLI ++
Sbjct  483  EDCTDESIRFDLDNEGVIVFNYPMAKTATTTILMRHRIPSTASADLIVEQ  532



>gb|KJB49011.1| hypothetical protein B456_008G097600 [Gossypium raimondii]
Length=487

 Score =   295 bits (755),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 137/162 (85%), Positives = 152/162 (94%), Gaps = 0/162 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            VSKI+PLSDAY VL+KDDIIL FDG+ IANDGTV FRNRERITFDHLVSMKKPNETA++K
Sbjct  313  VSKINPLSDAYGVLKKDDIILEFDGVPIANDGTVPFRNRERITFDHLVSMKKPNETALVK  372

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSP  524
            VLRNG++H F+I L PL+PLVPVHQFDKLPS++IFAGLVF+PLTQPYLHEYGEDWYNTSP
Sbjct  373  VLRNGQEHAFTITLQPLQPLVPVHQFDKLPSYYIFAGLVFVPLTQPYLHEYGEDWYNTSP  432

Query  523  RRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQV  398
            RRLCERALR+LP + GEQLVILSQVL+DDIN GYERLAELQV
Sbjct  433  RRLCERALRELPKRAGEQLVILSQVLMDDINAGYERLAELQV  474



>ref|XP_007028415.1| DegP protease 10 isoform 2 [Theobroma cacao]
 gb|EOY08917.1| DegP protease 10 isoform 2 [Theobroma cacao]
Length=537

 Score =   296 bits (757),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 137/161 (85%), Positives = 152/161 (94%), Gaps = 0/161 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            VSKI+PLSDA++VL+KDDIIL FDG+ IANDGTV FRNRERITFDHLVSMKKPNETAV+K
Sbjct  366  VSKINPLSDAHRVLKKDDIILEFDGVPIANDGTVPFRNRERITFDHLVSMKKPNETAVVK  425

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSP  524
            VLRNGE+H F+I L PL+PLVPVHQFDKLPS++IFAGLVF+PLTQPYLHEYGEDWYNTSP
Sbjct  426  VLRNGEEHAFTITLRPLQPLVPVHQFDKLPSYYIFAGLVFVPLTQPYLHEYGEDWYNTSP  485

Query  523  RRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQ  401
            RRLCERALR+LP + GEQLVILSQVL+DDIN GYERLAELQ
Sbjct  486  RRLCERALRELPKQAGEQLVILSQVLMDDINAGYERLAELQ  526



>ref|XP_008441958.1| PREDICTED: protease Do-like 10, mitochondrial [Cucumis melo]
Length=586

 Score =   291 bits (744),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 136/164 (83%), Positives = 150/164 (91%), Gaps = 0/164 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            V+KI+PLSDAY +++KDDIIL+FDG  IANDGTV FRNRERITFDHLVSMKKPNE +V+K
Sbjct  423  VNKINPLSDAYDIMKKDDIILAFDGEPIANDGTVSFRNRERITFDHLVSMKKPNEKSVIK  482

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSP  524
            +LRNGE  E SI L PL+PLVPVHQFDKLPS++IFAGLVFIPLTQPYLHEYGEDWYNTSP
Sbjct  483  ILRNGEVCELSITLRPLQPLVPVHQFDKLPSYYIFAGLVFIPLTQPYLHEYGEDWYNTSP  542

Query  523  RRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNK  392
            RRLCERALR+LP KPGEQ VILSQVL+DDIN GYERLAELQV K
Sbjct  543  RRLCERALRELPKKPGEQFVILSQVLMDDINAGYERLAELQVKK  586



>gb|KCW54069.1| hypothetical protein EUGRSUZ_I00050 [Eucalyptus grandis]
Length=517

 Score =   274 bits (701),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 139/227 (61%), Positives = 170/227 (75%), Gaps = 1/227 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            VS I+ LSDAY+ L KDDIIL FDG+ +ANDGTV FR+RER+ FDHL SMKKPNE A++K
Sbjct  288  VSSINLLSDAYRFLEKDDIILEFDGVPVANDGTVTFRHRERVNFDHLASMKKPNEVALIK  347

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSP  524
            VLR   + + +I L PL+PLVPVHQFDK PS+FIF GL+F  LTQPYLHEY  D Y+  P
Sbjct  348  VLRKEIECKVNITLRPLQPLVPVHQFDKHPSYFIFGGLIFTSLTQPYLHEYA-DRYSMLP  406

Query  523  RRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLV  344
            RRL + AL +LP   G+++VI+S VL+DDI  GY  LA LQV KVN +E++NL+HL +LV
Sbjct  407  RRLWQLALEELPRNAGQEIVIISMVLMDDITEGYGNLAALQVRKVNEIEIQNLRHLYELV  466

Query  343  EDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLI  203
            E  +   IRFDLD+ERVIVL Y  AK ATS I  R+ IP   S+DLI
Sbjct  467  EHCTAPSIRFDLDEERVIVLKYSEAKTATSTIRARYNIPSIASADLI  513



>ref|XP_010027526.1| PREDICTED: protease Do-like 10, mitochondrial isoform X2 [Eucalyptus 
grandis]
 gb|KCW54070.1| hypothetical protein EUGRSUZ_I00050 [Eucalyptus grandis]
Length=534

 Score =   274 bits (701),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 139/227 (61%), Positives = 170/227 (75%), Gaps = 1/227 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            VS I+ LSDAY+ L KDDIIL FDG+ +ANDGTV FR+RER+ FDHL SMKKPNE A++K
Sbjct  305  VSSINLLSDAYRFLEKDDIILEFDGVPVANDGTVTFRHRERVNFDHLASMKKPNEVALIK  364

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSP  524
            VLR   + + +I L PL+PLVPVHQFDK PS+FIF GL+F  LTQPYLHEY  D Y+  P
Sbjct  365  VLRKEIECKVNITLRPLQPLVPVHQFDKHPSYFIFGGLIFTSLTQPYLHEYA-DRYSMLP  423

Query  523  RRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLV  344
            RRL + AL +LP   G+++VI+S VL+DDI  GY  LA LQV KVN +E++NL+HL +LV
Sbjct  424  RRLWQLALEELPRNAGQEIVIISMVLMDDITEGYGNLAALQVRKVNEIEIQNLRHLYELV  483

Query  343  EDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLI  203
            E  +   IRFDLD+ERVIVL Y  AK ATS I  R+ IP   S+DLI
Sbjct  484  EHCTAPSIRFDLDEERVIVLKYSEAKTATSTIRARYNIPSIASADLI  530



>ref|XP_010027525.1| PREDICTED: protease Do-like 10, mitochondrial isoform X1 [Eucalyptus 
grandis]
Length=554

 Score =   270 bits (690),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 138/227 (61%), Positives = 166/227 (73%), Gaps = 1/227 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            VS I+ LSDAY+ L KDDIIL FDG+ +ANDGTV FR+RER+ FDHL SMKKPNE A++K
Sbjct  305  VSSINLLSDAYRFLEKDDIILEFDGVPVANDGTVTFRHRERVNFDHLASMKKPNEVALIK  364

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSP  524
            VLR   + + +I L PL+PLVPV QFDK PS++IF GLVF PLTQ YL EY  D Y   P
Sbjct  365  VLRKEIECKVNITLRPLQPLVPVRQFDKHPSYYIFGGLVFTPLTQSYLREYA-DRYRMWP  423

Query  523  RRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLV  344
            RRLC+ A  +LP   G+++VI+S VL DD+N GYE LAELQV KVN +E++NL HL +LV
Sbjct  424  RRLCQLAREELPRNAGQEIVIISMVLRDDVNAGYEHLAELQVRKVNEIEIQNLSHLYRLV  483

Query  343  EDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLI  203
            E  +   IRFDLD ERVIV  Y  AK ATS IL  + IP   S+DLI
Sbjct  484  EHCTALSIRFDLDKERVIVFKYSEAKTATSTILTHYNIPSIASADLI  530



>ref|XP_002888435.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64694.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=528

 Score =   267 bits (682),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 135/226 (60%), Positives = 167/226 (74%), Gaps = 10/226 (4%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            +++I+PLSDAYK LRKDDIIL+ D + I ND  V FRN+ERI F+H VSMKK NET +LK
Sbjct  304  INEINPLSDAYKRLRKDDIILAIDDVLIGNDAKVAFRNKERINFNHFVSMKKLNETVLLK  363

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSP  524
            VLR G++H+F I L P+ PLVPVHQ+DKLPS++IFAG VF+PLTQPY+            
Sbjct  364  VLREGKEHDFHISLKPVPPLVPVHQYDKLPSYYIFAGFVFVPLTQPYI----------DS  413

Query  523  RRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLV  344
              +C  A + +P K GEQLVI+SQVL DDIN GY    +L+V KVNGV+VENLKHL +LV
Sbjct  414  TLICNCANKNMPEKAGEQLVIISQVLADDINAGYTDFNDLKVIKVNGVQVENLKHLSELV  473

Query  343  EDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  206
            E    E +R DL++E+V+VLNY+ AK ATS ILK HRIP A S DL
Sbjct  474  EKCCTEDLRLDLENEKVVVLNYENAKEATSLILKLHRIPSANSKDL  519



>ref|XP_007028416.1| DegP protease 10 isoform 3 [Theobroma cacao]
 gb|EOY08918.1| DegP protease 10 isoform 3 [Theobroma cacao]
Length=514

 Score =   266 bits (679),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 123/149 (83%), Positives = 137/149 (92%), Gaps = 0/149 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            VSKI+PLSDA++VL+KDDIIL FDG+ IANDGTV FRNRERITFDHLVSMKKPNETAV+K
Sbjct  366  VSKINPLSDAHRVLKKDDIILEFDGVPIANDGTVPFRNRERITFDHLVSMKKPNETAVVK  425

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSP  524
            VLRNGE+H F+I L PL+PLVPVHQFDKLPS++IFAGLVF+PLTQPYLHEYGEDWYNTSP
Sbjct  426  VLRNGEEHAFTITLRPLQPLVPVHQFDKLPSYYIFAGLVFVPLTQPYLHEYGEDWYNTSP  485

Query  523  RRLCERALRKLPTKPGEQLVILSQVLLDD  437
            RRLCERALR+LP + GEQLVILSQ   D 
Sbjct  486  RRLCERALRELPKQAGEQLVILSQSGFDG  514



>ref|XP_002951860.1| trypsin family [Volvox carteri f. nagariensis]
 gb|EFJ46965.1| trypsin family [Volvox carteri f. nagariensis]
Length=571

 Score =   266 bits (680),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 122/227 (54%), Positives = 174/227 (77%), Gaps = 0/227 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            V+ I   S+A KVL+  D++L FDG+ IANDGTVH R RERI F +L+++K    TA +K
Sbjct  345  VNTIQKTSNAAKVLKPGDVLLEFDGVTIANDGTVHLRQRERIYFSYLITLKPTGATAKIK  404

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSP  524
            VLR+GE   + + + P   LVPVH +D+LPS+F++AGLVF+PLTQPYLHEYGEDW NT+P
Sbjct  405  VLRDGEVLSYDLTVTPNDLLVPVHCYDRLPSYFMYAGLVFVPLTQPYLHEYGEDWMNTAP  464

Query  523  RRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLV  344
            RRL ++AL  +  KP +Q+VILSQVL+DD+NTGY++   LQV +VNG EV NL HL++LV
Sbjct  465  RRLYDKALHGMMQKPHQQIVILSQVLVDDVNTGYQQFQSLQVLRVNGTEVLNLTHLKELV  524

Query  343  EDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLI  203
            E  ++  +RF+L+DER++V++  LA  A +RI++R+R+P ++S D++
Sbjct  525  EGAAERFVRFELEDERIMVVDRSLALNANNRIMERYRVPSSVSVDIV  571



>ref|XP_002886956.1| hypothetical protein ARALYDRAFT_315601 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63215.1| hypothetical protein ARALYDRAFT_315601 [Arabidopsis lyrata subsp. 
lyrata]
Length=545

 Score =   260 bits (665),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 130/226 (58%), Positives = 167/226 (74%), Gaps = 10/226 (4%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            + KI+PLSD+YKVL+K+D+IL+ DG+ I ND TV FRN+ERITF HLVSMKKP E A+LK
Sbjct  318  IKKINPLSDSYKVLKKNDVILAIDGVPIGNDSTVPFRNKERITFKHLVSMKKPCERALLK  377

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSP  524
            VLR G+++EFSI L P+  LVP+HQFDK PS++IF GLVF+PLT+PY+ +     Y    
Sbjct  378  VLREGKEYEFSISLKPVPRLVPMHQFDKPPSYYIFGGLVFVPLTKPYIDDASISKY----  433

Query  523  RRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLV  344
                  AL K+P K GEQ+VI+SQ+L DDINTGY    +LQV KVNGV+V NLKHL  L+
Sbjct  434  ------ALEKMPKKAGEQIVIISQILEDDINTGYNIFEDLQVKKVNGVQVHNLKHLYNLI  487

Query  343  EDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  206
            E+   E++  DL+ + +I L+Y  AK ATS+ILK+  IP AMS DL
Sbjct  488  EECCTEKLLMDLEQDNIIALDYKSAKKATSKILKKLEIPSAMSKDL  533



>gb|KIZ03685.1| hypothetical protein MNEG_4270 [Monoraphidium neglectum]
Length=347

 Score =   254 bits (650),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 118/226 (52%), Positives = 167/226 (74%), Gaps = 0/226 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            V+++ P S   +V++K D++L+FDG+ IANDGTVHFR+RERI F  L++ K    TA L 
Sbjct  10   VNRVQPTSPTARVMKKGDVLLAFDGVKIANDGTVHFRSRERIFFTALITQKPTGSTARLS  69

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSP  524
            VLR+G+  EF + L PL+ LVP+ ++D++PSF ++AGLVF+PL+QPYLHE+GEDW   SP
Sbjct  70   VLRDGQLDEFDVPLQPLQTLVPICKYDEVPSFLMYAGLVFVPLSQPYLHEFGEDWIANSP  129

Query  523  RRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLV  344
            RRL E+AL  L  +P +Q+VILSQVL+DD+NTG++    LQV +VNG EV NL+HLR L+
Sbjct  130  RRLVEKALNGLMQRPEQQIVILSQVLVDDVNTGFQGFQNLQVLRVNGEEVLNLRHLRALL  189

Query  343  EDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  206
                   +R DL+D+R+IVL+   A  +T RI +R+R+P+  S+DL
Sbjct  190  AGCDAPYVRLDLEDDRIIVLDRAAADASTLRIQQRYRVPFLESADL  235



>gb|KDO77071.1| hypothetical protein CISIN_1g007765mg [Citrus sinensis]
Length=490

 Score =   257 bits (656),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 118/145 (81%), Positives = 137/145 (94%), Gaps = 0/145 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            V+KI+PLSDA+++L+KDDIIL+FDG+ IANDGTV FRNRERITFDHLVSMKKPNE ++++
Sbjct  345  VNKINPLSDAHEILKKDDIILAFDGVPIANDGTVAFRNRERITFDHLVSMKKPNEKSLVR  404

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSP  524
            VLR+G++HEFSI L  L+PLVPVHQFDKLPS++IFAGLVFIPLTQPYLHEYGEDWYNTSP
Sbjct  405  VLRDGKEHEFSITLRLLQPLVPVHQFDKLPSYYIFAGLVFIPLTQPYLHEYGEDWYNTSP  464

Query  523  RRLCERALRKLPTKPGEQLVILSQV  449
            RRLCERALR+LP K GEQLVILSQV
Sbjct  465  RRLCERALRELPKKAGEQLVILSQV  489



>ref|XP_010027559.1| PREDICTED: protease Do-like 10, mitochondrial [Eucalyptus grandis]
Length=533

 Score =   258 bits (658),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 133/227 (59%), Positives = 163/227 (72%), Gaps = 2/227 (1%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            VS I+ LSDAY+ L KDDIIL FDG  +ANDGTV FR+RERI FDHL SMKKPN   ++K
Sbjct  305  VSSINILSDAYRFLEKDDIILEFDGKPVANDGTVTFRHRERIDFDHLASMKKPNGKTLIK  364

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSP  524
            VLR   +  F I L PL+PLVPVHQFDK PS++IF GL+F  LTQPYLHEY  D Y+  P
Sbjct  365  VLRKERECIFDITLRPLQPLVPVHQFDKHPSYYIFGGLIFTSLTQPYLHEYA-DRYSVWP  423

Query  523  RRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLV  344
            RRLC+ A R       +++VI+S VL+DDI  GY  LA LQV KVN ++++NL+HL + +
Sbjct  424  RRLCQLAQRT-SKNADQEIVIISMVLMDDITEGYGNLAALQVRKVNEIDIQNLRHLYEFL  482

Query  343  EDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLI  203
            E  +   IRFDLD+ERVIV  Y  AK+ATS IL R+ IP   S+DLI
Sbjct  483  EHCTATSIRFDLDEERVIVFKYREAKIATSTILTRYNIPSIASADLI  529



>ref|XP_008776775.1| PREDICTED: protease Do-like 10, mitochondrial isoform X2 [Phoenix 
dactylifera]
Length=471

 Score =   255 bits (652),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 117/145 (81%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            V+KI+PLS A++VL+KDDIIL+FDG+ IANDGTV FRNRERITFDHLVSMKKPNETA ++
Sbjct  327  VNKINPLSAAHRVLKKDDIILAFDGVPIANDGTVPFRNRERITFDHLVSMKKPNETAHVR  386

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSP  524
            VLR+G +HEF I L PL+PLVPVHQFD LPS++IFAGLVF+PLTQPYLHEYGEDWYNTSP
Sbjct  387  VLRDGTEHEFCISLLPLQPLVPVHQFDTLPSYYIFAGLVFVPLTQPYLHEYGEDWYNTSP  446

Query  523  RRLCERALRKLPTKPGEQLVILSQV  449
            RRLCERALR+LP + GEQLVILSQV
Sbjct  447  RRLCERALRELPKRAGEQLVILSQV  471



>ref|NP_564856.1| putativeDegP protease 3 [Arabidopsis thaliana]
 sp|Q9SHZ1.1|DEGP3_ARATH RecName: Full=Putative protease Do-like 3, mitochondrial; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAF23847.1|AC007234_19 F1E22.1 [Arabidopsis thaliana]
 gb|AEE34405.1| putativeDegP protease 3 [Arabidopsis thaliana]
Length=559

 Score =   253 bits (647),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 127/226 (56%), Positives = 164/226 (73%), Gaps = 10/226 (4%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            ++KI+PLSD +KVL+KDDIIL+ DG+ I ND +VHFR +ERITF HLVSMKKP ETA+LK
Sbjct  326  INKINPLSDVHKVLKKDDIILAIDGVPIGNDSSVHFRKKERITFKHLVSMKKPCETALLK  385

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSP  524
            VLR G+++EF+  L  + PLVP  Q+DK  S++IF GLVF+PLT+PY+            
Sbjct  386  VLREGKEYEFNSSLKSVPPLVPKRQYDKSASYYIFGGLVFLPLTKPYIDS----------  435

Query  523  RRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLV  344
              + E AL K+P K GEQ+VI+SQ+L DDINTGY    + QV KVNGV+V NLKHL KLV
Sbjct  436  SCVSESALGKMPKKAGEQVVIISQILEDDINTGYSIFEDFQVKKVNGVQVHNLKHLYKLV  495

Query  343  EDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  206
            E+   E +R DL+ ++VI L+Y  AK  TS+ILK  +IP A+S DL
Sbjct  496  EECCTETVRMDLEKDKVITLDYKSAKKVTSKILKSLKIPSAVSEDL  541



>ref|XP_002886957.1| hypothetical protein ARALYDRAFT_894151 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63216.1| hypothetical protein ARALYDRAFT_894151 [Arabidopsis lyrata subsp. 
lyrata]
Length=496

 Score =   248 bits (632),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 123/226 (54%), Positives = 160/226 (71%), Gaps = 9/226 (4%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            + KI+  S AY +L+KDDI+L+ DG+ I ND TV FR +ERI F HLVSMKKP E   LK
Sbjct  278  IRKINRSSSAYNILKKDDILLAIDGVPIENDETVIFRKKERINFSHLVSMKKPGEKTSLK  337

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSP  524
            VLR G+KHEF+I + P++ L+PV+ FDKLPS++IFAG VF+PLT+PYL            
Sbjct  338  VLREGKKHEFNINITPVESLLPVYHFDKLPSYYIFAGFVFLPLTKPYLD---------CS  388

Query  523  RRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLV  344
              +C+ AL  +P KPGEQ+VI+SQVL  D++ GY  L +LQV +VNGV+VENLKHL +L+
Sbjct  389  YSMCDCALTHMPKKPGEQIVIISQVLEADVSVGYANLTDLQVKRVNGVQVENLKHLCQLI  448

Query  343  EDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  206
            E    E +R DL+    I LN + AK AT++ILKR+ IP AMS DL
Sbjct  449  EGCCTEDLRLDLEGAFAITLNQNYAKKATAKILKRYGIPSAMSKDL  494



>ref|XP_006391530.1| hypothetical protein EUTSA_v10019569mg, partial [Eutrema salsugineum]
 gb|ESQ28816.1| hypothetical protein EUTSA_v10019569mg, partial [Eutrema salsugineum]
Length=316

 Score =   237 bits (605),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 120/226 (53%), Positives = 162/226 (72%), Gaps = 10/226 (4%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            +++I+PLSDA+K L+KDD+IL+ DG++I ND  VHFR +E ITF HLVSMKKP ETA++K
Sbjct  84   INEINPLSDAHKFLKKDDVILAIDGVSIGNDSKVHFRKQETITFKHLVSMKKPCETALVK  143

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSP  524
            VLR G++HEF+I + P++PLVP   FDK  S+ I+ G+V + LT+PY+            
Sbjct  144  VLREGKEHEFNISVKPVQPLVPTQHFDKHRSYCIYGGVVLVALTKPYI----------DS  193

Query  523  RRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLV  344
              + E  L K+P K  EQ+VI+SQ+L DDIN  YE   +LQV KVNGVEV+NLKHL +L+
Sbjct  194  SYISESFLGKMPKKAVEQIVIISQILEDDINADYEGFEDLQVKKVNGVEVDNLKHLCQLI  253

Query  343  EDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  206
            E+     +R DL++E+V+VLN   A+ ATSRILK  +IP AMS DL
Sbjct  254  EECCTRFLRLDLENEKVLVLNNKSAEKATSRILKDLKIPSAMSEDL  299



>ref|XP_009140719.1| PREDICTED: putative protease Do-like 3, mitochondrial [Brassica 
rapa]
Length=634

 Score =   245 bits (626),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 117/226 (52%), Positives = 168/226 (74%), Gaps = 10/226 (4%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            V++I+PLSDAY  L+KDD+IL+ DG++I ND  V F N++ + F HLVSMKKP+ETA++K
Sbjct  399  VNEINPLSDAYNFLKKDDVILAIDGVSIGNDSKVPFLNQDTVDFKHLVSMKKPSETALIK  458

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSP  524
            VLR G++ EF++ L P++PLVP+H FDK+ S++I+ G +F+PL+QPY+   G D      
Sbjct  459  VLREGKECEFNVGLKPVQPLVPLHNFDKIRSYYIYGGFLFVPLSQPYID--GSD------  510

Query  523  RRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLV  344
              +CE + +K+P K  EQ+VI+SQ+L DDIN GY    +LQV KVNG+EV+NLKHL +++
Sbjct  511  --MCECSSKKMPKKASEQIVIISQILEDDINAGYASFEDLQVKKVNGIEVDNLKHLCQVI  568

Query  343  EDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  206
            E+ S   +R DL++E+V++LN  LA+ A S ILK  +IP AMS DL
Sbjct  569  EECSTGFLRLDLENEKVLILNNKLARKANSTILKELKIPSAMSDDL  614



>ref|XP_010513422.1| PREDICTED: putative protease Do-like 3, mitochondrial [Camelina 
sativa]
Length=502

 Score =   242 bits (618),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 120/227 (53%), Positives = 164/227 (72%), Gaps = 11/227 (5%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            + KI+P S AY +L+ DD++L+ DG++I ND TV FR +ERI ++HLVSMKKP ET  L 
Sbjct  284  IRKINPWSSAYGILKMDDVLLAIDGVSIGNDETVVFRKKERINYNHLVSMKKPGETTSLI  343

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSP  524
            VLR G+KHEF+I + P++ L+PV+QFDKLPS++I+AG VF+PLT+PY+            
Sbjct  344  VLREGKKHEFNINITPVESLIPVYQFDKLPSYYIYAGFVFLPLTKPYM----------DC  393

Query  523  RRLCERALRKLPTKPGEQLVILSQVLLDDINTGYER-LAELQVNKVNGVEVENLKHLRKL  347
              + +  L  +P KPGEQ+V++SQVL  DIN GY   L +L+V +VNGV+VENLKHLRKL
Sbjct  394  SYMSDCLLNHMPKKPGEQIVVISQVLEADINVGYGADLTDLKVKRVNGVQVENLKHLRKL  453

Query  346  VEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  206
            +E+ S + +R DL+ +  I LN + AK  TS+ILKR+ IP AMS DL
Sbjct  454  IEECSTKDLRLDLEGDFAITLNQNDAKNVTSKILKRYGIPSAMSKDL  500



>sp|Q9SHZ0.1|DEGP4_ARATH RecName: Full=Protease Do-like 4, mitochondrial; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAF23846.1|AC007234_18 F1E22.2 [Arabidopsis thaliana]
Length=518

 Score =   241 bits (615),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 125/225 (56%), Positives = 159/225 (71%), Gaps = 15/225 (7%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            +++I+PLSDAYK LRKDDIIL+ D + I ND  V FRN+ERI F+H VSMKK +ET +L+
Sbjct  304  INEINPLSDAYKRLRKDDIILAIDDVLIGNDAKVTFRNKERINFNHFVSMKKLDETVLLQ  363

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSP  524
            VLR+G++HEF I + P+ PLVP HQ+DKLPS++IFAG VF+PLTQPY+            
Sbjct  364  VLRDGKEHEFHIMVKPVPPLVPGHQYDKLPSYYIFAGFVFVPLTQPYI----------DS  413

Query  523  RRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLV  344
              +C  A++ +P K GEQL     VL DDIN GY     L+V KVNGV+VENLKHL +LV
Sbjct  414  TLICNCAIKYMPEKAGEQL-----VLADDINAGYTDFKNLKVIKVNGVQVENLKHLTELV  468

Query  343  EDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSD  209
            E    E +R DL++E+V+VLNY  AK ATS IL+ HRIP A   D
Sbjct  469  ETCWTEDLRLDLENEKVVVLNYANAKEATSLILELHRIPSANEYD  513



>ref|XP_010511113.1| PREDICTED: putative protease Do-like 3, mitochondrial [Camelina 
sativa]
Length=562

 Score =   240 bits (612),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 125/237 (53%), Positives = 169/237 (71%), Gaps = 11/237 (5%)
 Frame = -2

Query  913  LQMVQS*LGA-VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVS  737
            LQM +   G  V++I+PL+DA+ VL+K D+IL+ DG+ I ND  V  R +ERI+F HLVS
Sbjct  316  LQMSKEMTGILVNQINPLADAHNVLKKYDVILAIDGVPIGNDSRVPLRKQERISFKHLVS  375

Query  736  MKKPNETAVLKVLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLH  557
            MKK ++TA+ KVLR G++HEF+I L P++PLVPV+ FDK PS++IF GLVF+PLTQPY+ 
Sbjct  376  MKKSSDTALFKVLREGKEHEFNISLKPVQPLVPVNHFDKPPSYYIFGGLVFVPLTQPYID  435

Query  556  EYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVE  377
                         + E AL K+PTK  EQ+VI+SQ+L DDIN+G +   +LQV KVNGV+
Sbjct  436  S----------SYVSECALEKMPTKASEQIVIISQILEDDINSGLDIFEDLQVKKVNGVQ  485

Query  376  VENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  206
            V+NLKHL  L+E+ S E +RFDL+ ++   L+Y  AK AT +ILK  +I  AMS DL
Sbjct  486  VDNLKHLFHLIENCSTEYLRFDLEKDKFFGLHYKSAKKATPKILKSLKILSAMSEDL  542



>ref|XP_004344572.1| DegPtype protease [Acanthamoeba castellanii str. Neff]
 gb|ELR20829.1| DegPtype protease [Acanthamoeba castellanii str. Neff]
Length=561

 Score =   239 bits (611),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 124/250 (50%), Positives = 165/250 (66%), Gaps = 22/250 (9%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            V+ +  +S A  VL+KDD++LS DG  IANDGTV FR RERI FD++ SMK+  E   L+
Sbjct  304  VNHVEAVSKAKGVLQKDDVLLSIDGNRIANDGTVAFRKRERIFFDYVTSMKQVGEYCRLE  363

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLHE-------YGE  545
            +LRNGEK E S++L P++PLVP+H+FD+ PSFFI  GLVF PLTQPYL E       YGE
Sbjct  364  ILRNGEKQEVSVQLSPVQPLVPIHRFDQRPSFFIHGGLVFTPLTQPYLQEGSHFYFQYGE  423

Query  544  DWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENL  365
            DWYN+SPR+LC +AL +   +P +++VILS VL+ +IN GY+++  LQ+ + N  +++NL
Sbjct  424  DWYNSSPRKLCMKALTEYMEEPDQEVVILSAVLVHEINYGYQQMTNLQLLRFNDQKIKNL  483

Query  364  KHLRKLVEDNSKERIRFDLDDE---------------RVIVLNYDLAKVATSRILKRHRI  230
            K L KLV  N +  +RFD D+                RVI+L  D AK A   IL RHRI
Sbjct  484  KQLAKLVAANKQPYLRFDFDEHVRATCNTPALRHVTGRVIILEADAAKQAEEAILTRHRI  543

Query  229  PYAMSSDLIN  200
            P   S DL +
Sbjct  544  PSPHSPDLFD  553



>ref|XP_002499997.1| predicted protein, partial [Micromonas sp. RCC299]
 gb|ACO61255.1| predicted protein, partial [Micromonas sp. RCC299]
Length=476

 Score =   236 bits (601),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 108/231 (47%), Positives = 163/231 (71%), Gaps = 4/231 (2%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            ++++  L  A   L+KDD+++  DG  +ANDGTV FR  ER+ FD+L+S+K+P ET   K
Sbjct  246  ITEVLELGPAAGHLKKDDVLMEVDGKKVANDGTVSFRGWERVAFDYLISLKRPGETVEAK  305

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSP  524
            + R  E    S  + P  PLVPVHQ+D+LPS++++AGLVF PLTQP+L E+G+DW+NT+P
Sbjct  306  IRRKTEAFTASFAVKPRAPLVPVHQYDRLPSYYVYAGLVFSPLTQPHLQEFGDDWFNTAP  365

Query  523  RRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLV  344
            RRL +RAL   PT PG+++VILSQVL D++N GY+ + +L+V  VNG EV++L+ L+  V
Sbjct  366  RRLVDRALNDHPTSPGQEVVILSQVLADEVNAGYQGMHDLEVRAVNGREVKSLRELKAEV  425

Query  343  EDNSKER----IRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLI  203
            E  +  +    +R D  ++RV+V++ + A+ A  RI+ +HR+P  MS DL+
Sbjct  426  EKGTGAKGGKFLRLDFVNDRVLVISREEAERAHGRIMAKHRVPSRMSPDLV  476



>ref|XP_006391532.1| hypothetical protein EUTSA_v10019834mg [Eutrema salsugineum]
 gb|ESQ28818.1| hypothetical protein EUTSA_v10019834mg [Eutrema salsugineum]
Length=595

 Score =   238 bits (606),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 120/226 (53%), Positives = 162/226 (72%), Gaps = 10/226 (4%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            +++I+PLSDA+K L+KDD+IL+ DG++I ND  VHFR +E ITF HLVSMKKP ETA++K
Sbjct  363  INEINPLSDAHKFLKKDDVILAIDGVSIGNDSKVHFRKQETITFKHLVSMKKPCETALVK  422

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSP  524
            VLR G++HEF+I + P++PLVP   FDK  S+ I+ G+V + LT+PY+            
Sbjct  423  VLREGKEHEFNISVKPVQPLVPTQHFDKHRSYCIYGGVVLVALTKPYI----------DS  472

Query  523  RRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLV  344
              + E  L K+P K  EQ+VI+SQ+L DDIN  YE   +LQV KVNGVEV+NLKHL +L+
Sbjct  473  SYISESFLGKMPKKAVEQIVIISQILEDDINADYEGFEDLQVKKVNGVEVDNLKHLCQLI  532

Query  343  EDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  206
            E+     +R DL++E+V+VLN   A+ ATSRILK  +IP AMS DL
Sbjct  533  EECCTRFLRLDLENEKVLVLNNKSAEKATSRILKDLKIPSAMSEDL  578



>ref|XP_006301507.1| hypothetical protein CARUB_v10021933mg [Capsella rubella]
 gb|EOA34405.1| hypothetical protein CARUB_v10021933mg [Capsella rubella]
Length=566

 Score =   232 bits (592),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 121/237 (51%), Positives = 169/237 (71%), Gaps = 11/237 (5%)
 Frame = -2

Query  913  LQMVQS*LGA-VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVS  737
            L+M +   G  V++I+PLSDA K L+  D+IL+ DG+ I ND TV FR +ER++F HLVS
Sbjct  322  LKMAKGMTGILVNRINPLSDACKYLKNCDVILAIDGVPIGNDSTVPFRKQERVSFKHLVS  381

Query  736  MKKPNETAVLKVLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLH  557
            MKK  +TA+ KVLR G++HEF+I L P++PLVPV+ F+K PS++I+ GLVF+PLTQPY+ 
Sbjct  382  MKKSCDTALFKVLREGKEHEFNISLKPVQPLVPVNLFEKPPSYYIYGGLVFVPLTQPYI-  440

Query  556  EYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVE  377
               ++ Y      + E AL K+P K  EQ+VI+SQ+L DDI +G   + +LQV KVNGV+
Sbjct  441  ---DNSY------VSECALEKMPRKADEQIVIISQILEDDITSGLSMVEDLQVKKVNGVQ  491

Query  376  VENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  206
            V+NLKHL  L+E+   E ++F+L+ +    LN+  AK ATS+ILK  +IP AMS DL
Sbjct  492  VDNLKHLFHLIEECCTEYLKFELEKDMFFALNHKSAKKATSKILKNLKIPSAMSDDL  548



>ref|XP_010418975.1| PREDICTED: putative protease Do-like 3, mitochondrial [Camelina 
sativa]
Length=572

 Score =   227 bits (578),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 120/237 (51%), Positives = 167/237 (70%), Gaps = 11/237 (5%)
 Frame = -2

Query  913  LQMVQS*LGA-VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVS  737
            LQM +   G  V++I+PL+DA+KVL+K D+IL+ DG+ I ND  V  R +ERI+F HLVS
Sbjct  326  LQMSKEMTGILVNQINPLADAHKVLKKYDVILAIDGVPIGNDSRVPLRKQERISFKHLVS  385

Query  736  MKKPNETAVLKVLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLH  557
            MKK ++TA++KVLR G+++EF+I L P++PLVPV+ FDK PS++IF GLVF+PL+Q Y+ 
Sbjct  386  MKKSSDTALIKVLREGKEYEFNISLKPVQPLVPVNHFDKPPSYYIFGGLVFVPLSQAYVD  445

Query  556  EYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVE  377
                         + E AL K+PTK  EQ+VI+SQ+L DDI +G     +LQV KVNGV+
Sbjct  446  S----------SYVSECALEKMPTKADEQIVIISQILEDDITSGLGIFEDLQVKKVNGVQ  495

Query  376  VENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  206
            V+NLKHL  L+E+   E +RFDL+ ++   L+Y  AK AT +ILK  +I  A+S DL
Sbjct  496  VDNLKHLFNLIENCCTEYLRFDLEKDKFFGLHYKSAKEATPKILKNLKILSAVSEDL  552



>gb|KFK41004.1| hypothetical protein AALP_AA2G073000 [Arabis alpina]
Length=444

 Score =   223 bits (569),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 109/203 (54%), Positives = 148/203 (73%), Gaps = 10/203 (5%)
 Frame = -2

Query  814  DGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLKVLRNGEKHEFSIKLFPLKPLVPV  635
            DG++I ND TV FR +ERI ++HLVSMKKP ET +LKVLR G++H+F+I + P++PL+PV
Sbjct  244  DGVSIGNDETVKFRKKERINYNHLVSMKKPAETTLLKVLREGKQHKFNINIKPVEPLIPV  303

Query  634  HQFDKLPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILS  455
            + +DKLPS++I AG VF+PLT+PY+        + +P  +C+  L  +P K GEQ+V++S
Sbjct  304  YLYDKLPSYYILAGFVFVPLTKPYM--------DCAP--ICDCVLENMPKKAGEQIVVIS  353

Query  454  QVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYD  275
            QVL DDIN GY    +LQV KVNGV+VENLKHL +L+E    E +R DL+ E VI+L + 
Sbjct  354  QVLEDDINVGYSSFEDLQVKKVNGVQVENLKHLFQLIEGCCTEDLRLDLEKENVIILKHK  413

Query  274  LAKVATSRILKRHRIPYAMSSDL  206
             AK ATS+ILK + IP A S DL
Sbjct  414  AAKKATSKILKCYGIPSARSKDL  436



>emb|CDY35320.1| BnaA04g15270D [Brassica napus]
Length=540

 Score =   226 bits (575),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 112/226 (50%), Positives = 158/226 (70%), Gaps = 23/226 (10%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            V++I+PLSDAY  L+KDD+IL+ DG+ I ND  V F N++ + F HLVSMKKP+ETA++K
Sbjct  318  VNEINPLSDAYNFLKKDDVILAIDGVPIGNDSKVPFLNQDTVDFKHLVSMKKPSETALIK  377

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSP  524
            VLR G++ EF++ L P+KPLVP+H FDK+ S++++ G +F+PL+QPY+   G D      
Sbjct  378  VLREGKECEFNVGLKPVKPLVPLHNFDKMRSYYVYGGFLFVPLSQPYID--GSDI-----  430

Query  523  RRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLV  344
                            EQ+VI+SQ+L DDIN GY    +LQV KVNG+EV+NLKHL +++
Sbjct  431  ----------------EQIVIISQILEDDINAGYASFEDLQVKKVNGIEVDNLKHLCQVI  474

Query  343  EDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  206
            E+ S   +R DL++E+V++LN  LA+ A S ILK  +IP AMS DL
Sbjct  475  EECSTGFLRLDLENEKVLILNNKLARKANSTILKELKIPSAMSDDL  520



>gb|KCW54067.1| hypothetical protein EUGRSUZ_I00047 [Eucalyptus grandis]
Length=464

 Score =   221 bits (564),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 107/161 (66%), Positives = 128/161 (80%), Gaps = 1/161 (1%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            V+ IHPLSDAY++L+KDDIIL+FD   +ANDGT  FR RERI FDH VSMKKPN+   +K
Sbjct  304  VNSIHPLSDAYRILKKDDIILAFDNRPVANDGTTPFRKRERIAFDHWVSMKKPNDPVPIK  363

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSP  524
            V R  ++ EFSI L PL+PLVPVHQFDK PS++IFAGL+FIPLTQPYL EY  D Y+  P
Sbjct  364  VFREKKECEFSITLRPLQPLVPVHQFDKHPSYYIFAGLIFIPLTQPYLDEYA-DRYSMWP  422

Query  523  RRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQ  401
            RRLCERAL +LP   G+++VI+S+VL  DIN GYE LAELQ
Sbjct  423  RRLCERALEELPRNAGQEIVIISKVLTADINAGYEHLAELQ  463



>emb|CDY07457.1| BnaA07g25360D [Brassica napus]
Length=483

 Score =   222 bits (565),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 115/227 (51%), Positives = 149/227 (66%), Gaps = 23/227 (10%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            + +I+PLS +Y +L+KDDI+LS DG++I ND TV FR  E I F HLVSMKKP ET  LK
Sbjct  276  IKRINPLSSSYGILKKDDILLSIDGVSIGNDETVVFRKTESINFSHLVSMKKPRETTTLK  335

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLT-QPYLHEYGEDWYNTS  527
            VLR+G+ HEF+I + P++PL+ V QFDKLPS++IFAGLVF+P T QP             
Sbjct  336  VLRDGKTHEFNINITPVEPLIQVCQFDKLPSYYIFAGLVFLPSTPQP-------------  382

Query  526  PRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKL  347
                       +P K GEQ+V LSQVL D+   GY      +V KVNGV+VENLKHLR+L
Sbjct  383  ---------GTVPKKAGEQIVQLSQVLEDETTVGYTFSNNSRVKKVNGVQVENLKHLRQL  433

Query  346  VEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  206
            +E    E +R DL+++  I++ Y   K AT +ILKR+ IP  MS DL
Sbjct  434  IEKCCTEDLRIDLENDNTIIIGYKSGKRATPKILKRYGIPSTMSKDL  480



>ref|XP_009105158.1| PREDICTED: putative protease Do-like 3, mitochondrial [Brassica 
rapa]
Length=483

 Score =   221 bits (564),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 115/227 (51%), Positives = 149/227 (66%), Gaps = 23/227 (10%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            + +I+PLS +Y +L+KDDI+LS DG++I ND TV FR  E I F HLVSMKKP ET  LK
Sbjct  276  IKRINPLSSSYGILKKDDILLSIDGVSIGNDETVVFRKTESINFSHLVSMKKPRETTTLK  335

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLT-QPYLHEYGEDWYNTS  527
            VLR+G+ HEF+I + P++PL+ V QFDKLPS++IFAGLVF+P T QP             
Sbjct  336  VLRDGKTHEFNINITPVEPLIQVCQFDKLPSYYIFAGLVFLPSTPQP-------------  382

Query  526  PRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKL  347
                       +P K GEQ+V LSQVL D+   GY      +V KVNGV+VENLKHLR+L
Sbjct  383  ---------GTVPKKAGEQIVQLSQVLEDETTVGYTFSNNSRVKKVNGVQVENLKHLRQL  433

Query  346  VEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  206
            +E    E +R DL+++  I++ Y   K AT +ILKR+ IP  MS DL
Sbjct  434  IEKCCTEDLRIDLENDNTIIIGYKSGKRATPKILKRYGIPSTMSKDL  480



>ref|XP_006391531.1| hypothetical protein EUTSA_v10019570mg, partial [Eutrema salsugineum]
 gb|ESQ28817.1| hypothetical protein EUTSA_v10019570mg, partial [Eutrema salsugineum]
Length=489

 Score =   221 bits (564),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 113/226 (50%), Positives = 149/226 (66%), Gaps = 16/226 (7%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            V +++PLS  + +L+KDD++LS DG++I ND TV FR  ERI F HLVSMKKP ET  L+
Sbjct  271  VKRVNPLSSCHNILKKDDVLLSIDGVSIGNDETVSFRKAERINFSHLVSMKKPGETISLE  330

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSP  524
            VLR G +H+       L+PL+P++QFDKLPS++IF G VF+PLTQPY+          S 
Sbjct  331  VLREGIQHK-------LEPLIPMYQFDKLPSYYIFGGFVFVPLTQPYID-------CCSA  376

Query  523  RRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLV  344
            RR      R +P K GEQ+VI+SQVL D+   GY      QV +VNGV VENLKHLR+L+
Sbjct  377  RR--SSVFRNMPKKAGEQIVIISQVLEDETTVGYTIFENSQVKQVNGVPVENLKHLRQLL  434

Query  343  EDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  206
            E+   E +R DL+ +  I+ +    K  T +ILKR+ IP AMS DL
Sbjct  435  EECCTEYLRLDLEKDNTIIASSKSTKKVTGKILKRYGIPNAMSKDL  480



>ref|XP_002888434.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64693.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=553

 Score =   221 bits (562),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 115/227 (51%), Positives = 153/227 (67%), Gaps = 26/227 (11%)
 Frame = -2

Query  886  AVSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVL  707
            AV  I+PLSDA+KVL+KDD I+  D                R++F HLVSMKKP +TA  
Sbjct  335  AVKSINPLSDAHKVLKKDDEIIVQD----------------RVSFKHLVSMKKPCDTASF  378

Query  706  KVLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLHEYGEDWYNTS  527
            KVLR G++HEF+I L P++PLVPV+Q+D  PS++I+ GLVF+PLTQPY+           
Sbjct  379  KVLREGKEHEFNISLKPVQPLVPVNQYDMPPSYYIYGGLVFVPLTQPYIDR---------  429

Query  526  PRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKL  347
               +CE  ++K+PTK GEQ+VI+SQ+L DDI +G     +LQV K+NGVEV+NLKHL +L
Sbjct  430  -SYICECCVKKMPTKAGEQIVIISQILEDDITSGLSIFEDLQVKKLNGVEVDNLKHLCQL  488

Query  346  VEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  206
            +E+ S E +RFDL+D     L +  AK AT +ILK  +IP AMS DL
Sbjct  489  IEECSNEYLRFDLEDNNFFFLEHKSAKKATCKILKSLKIPSAMSEDL  535



>ref|XP_010030295.1| PREDICTED: uncharacterized protein LOC104420090 [Eucalyptus grandis]
Length=844

 Score =   224 bits (572),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 113/193 (59%), Positives = 139/193 (72%), Gaps = 1/193 (1%)
 Frame = -2

Query  778  FRNRERITFDHLVSMKKPNETAVLKVLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIF  599
            F +RERI FD L SMKKPNE A++KVLR   + +F+I L PL+PLVPV QFDK PS++IF
Sbjct  636  FWHRERIDFDQLASMKKPNEVALIKVLRKERECKFNITLRPLQPLVPVRQFDKRPSYYIF  695

Query  598  AGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYE  419
             GL+F PLTQPYL EY  DW +  PRRL + A  +LP   G+++VI+S VL DD+N GYE
Sbjct  696  GGLIFTPLTQPYLDEYA-DWDSMWPRRLWQLAPEELPRNAGQEIVIISMVLRDDVNAGYE  754

Query  418  RLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKR  239
             LAELQV KVN +E++NL+HL  LVE  +   IRFDLD ERVIV  Y  AK ATS IL  
Sbjct  755  HLAELQVRKVNEIEIQNLRHLYGLVEHCTAPSIRFDLDKERVIVFKYSEAKTATSTILTH  814

Query  238  HRIPYAMSSDLIN  200
            + IP   S+DLI+
Sbjct  815  YNIPSIASADLID  827



>ref|XP_002866059.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42318.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=517

 Score =   218 bits (556),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 114/226 (50%), Positives = 156/226 (69%), Gaps = 12/226 (5%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            +++I+ LS A  +L+KDD+IL+ DG+ I ND T+ FR +ERI F+HLV++KK  ET +LK
Sbjct  287  INEINLLSSAQGILKKDDVILAIDGVPIGNDETIPFRKKERINFEHLVTIKKSGETVLLK  346

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSP  524
            VLR G++HEF+I +   +PLVP      LPS++I AG VF+PLT+PY+         +  
Sbjct  347  VLRKGKEHEFNIIVRHDQPLVPDRH---LPSYYILAGFVFVPLTKPYI---------SKS  394

Query  523  RRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLV  344
             ++CE +  +   K GEQ+VI+SQVLL+DI TGY    +LQV  VNGVEV NL+HL +L+
Sbjct  395  CKICECSSNRKAKKAGEQIVIISQVLLNDITTGYRDFKDLQVKNVNGVEVLNLRHLSELI  454

Query  343  EDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  206
            E   +E +R DL++ RVI LNY  AK ATS IL+ H IP AMS DL
Sbjct  455  EKCCEEDLRLDLENGRVISLNYTSAKEATSWILEHHGIPSAMSKDL  500



>ref|XP_003055699.1| predicted protein, partial [Micromonas pusilla CCMP1545]
 gb|EEH60951.1| predicted protein, partial [Micromonas pusilla CCMP1545]
Length=492

 Score =   216 bits (550),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 108/226 (48%), Positives = 151/226 (67%), Gaps = 6/226 (3%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            V+++ PLS A   L  DD++L  DG AIANDG+V FR  ER+ FDHLVS+K+  E   +K
Sbjct  273  VTEVAPLSPAKGKLFADDVLLEIDGAAIANDGSVSFRGWERVAFDHLVSLKRAGENIRMK  332

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSP  524
            VL         +   P  PLVPVHQ+D+LP++F+FAGLVF PLTQP+LHE+G+DWY+ +P
Sbjct  333  VL------TVDVVATPRAPLVPVHQYDRLPTYFVFAGLVFCPLTQPHLHEWGDDWYDKAP  386

Query  523  RRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLV  344
            RRLC+RA+      P EQ+VILS VL D+IN GY+   +L+V++V G +V+N++ L   +
Sbjct  387  RRLCDRAMHSHMKVPDEQVVILSHVLADEINVGYQGKHDLEVSRVCGAKVKNMRELAAAL  446

Query  343  EDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  206
            + +  E +R D     V+V+N    + A  RIL +HR+P  MS DL
Sbjct  447  DAHDGEFVRVDFVGGDVVVVNAKEGRAAGERILAKHRVPARMSPDL  492



>gb|KCW54108.1| hypothetical protein EUGRSUZ_I00089 [Eucalyptus grandis]
Length=195

 Score =   205 bits (521),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 104/179 (58%), Positives = 129/179 (72%), Gaps = 1/179 (1%)
 Frame = -2

Query  736  MKKPNETAVLKVLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLH  557
            MKKPNE A++KVLR   + +F+I L PL+PLVPV QFDK PS++IF GL+F PLTQPYL 
Sbjct  1    MKKPNEVALIKVLRKERECKFNITLRPLQPLVPVRQFDKRPSYYIFGGLIFTPLTQPYLD  60

Query  556  EYGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVE  377
            EY  DW +  PRRL + A  +LP   G+++VI+S VL DD+N GYE LAELQV KVN +E
Sbjct  61   EYA-DWDSMWPRRLWQLAPEELPRNAGQEIVIISMVLRDDVNAGYEHLAELQVRKVNEIE  119

Query  376  VENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLIN  200
            ++NL+HL  LVE  +   IRFDLD ERVIV  Y  AK ATS IL  + IP   S+DLI+
Sbjct  120  IQNLRHLYGLVEHCTAPSIRFDLDKERVIVFKYSEAKTATSTILTHYNIPSIASADLID  178



>ref|XP_002866058.1| hypothetical protein ARALYDRAFT_357728 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42317.1| hypothetical protein ARALYDRAFT_357728 [Arabidopsis lyrata subsp. 
lyrata]
Length=516

 Score =   209 bits (531),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 107/224 (48%), Positives = 152/224 (68%), Gaps = 11/224 (5%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            +++I+ +S A+KVL+KDD+IL+ DG+ I ND    FR +ER+ F+HLVSMKKP ET + K
Sbjct  303  INEINLVSAAHKVLKKDDVILAIDGVPIGNDEKFVFRGKERVNFNHLVSMKKPGETGLFK  362

Query  703  VLRNGEKHEFSIKLFPLKP-LVPVHQFDKLPSFFIFAGLVFIPLTQPYLHEYGEDWYNTS  527
            VLR+G +HEF I L  ++  LVPV +FD   + ++FAG +F+PL++P +          S
Sbjct  363  VLRDGREHEFKISLNSVQQRLVPVRKFDT--NCYVFAGFIFVPLSKPNIE--------NS  412

Query  526  PRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKL  347
               +C+  L++ P KP  +++I+SQVL D IN GY     LQV KVNG EVE++ HLR+L
Sbjct  413  SGAICDCTLKRRPQKPVHEIIIISQVLWDVINVGYSSFKNLQVKKVNGEEVESMNHLRRL  472

Query  346  VEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMS  215
            ++    E +R DL+  +VIVLNY  A+  TS IL+RHRIP AMS
Sbjct  473  IKKCRTEDLRLDLEKGKVIVLNYKSARKETSLILERHRIPSAMS  516



>gb|KDO66274.1| hypothetical protein CISIN_1g036586mg [Citrus sinensis]
Length=568

 Score =   207 bits (527),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 111/227 (49%), Positives = 149/227 (66%), Gaps = 1/227 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            + +I P +    VL+  DIILSFDGI IANDGTV FR+ ERI F +LVS K   ++AV+K
Sbjct  340  IRRIEPTAPESHVLKPSDIILSFDGIDIANDGTVPFRHGERIGFSYLVSQKYTGDSAVVK  399

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLH-EYGEDWYNTS  527
            VLRN E HEF+IKL   K L+P H   + PS++I AG VF  +T PYL  EYG+D+   +
Sbjct  400  VLRNSEVHEFNIKLSTHKRLIPAHINGRPPSYYIIAGFVFTAVTAPYLRSEYGKDYEFDA  459

Query  526  PRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKL  347
            P +L ++ L  +     EQ+V++SQVL+ DIN GYE +   QV  +NG  V+NLK L  +
Sbjct  460  PVKLLDKLLHAMAQSVDEQIVVVSQVLVADINIGYEEIVNTQVLALNGKPVQNLKSLADM  519

Query  346  VEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  206
            VE +  E ++FDL+ ++++VL    AK ATS IL  H IP AMS DL
Sbjct  520  VESSEDEFLKFDLEYQQIVVLKSKTAKEATSDILATHCIPSAMSGDL  566



>ref|XP_006446449.1| hypothetical protein CICLE_v10014711mg [Citrus clementina]
 gb|ESR59689.1| hypothetical protein CICLE_v10014711mg [Citrus clementina]
Length=586

 Score =   207 bits (527),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 111/227 (49%), Positives = 149/227 (66%), Gaps = 1/227 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            + +I P +    VL+  DIILSFDGI IANDGTV FR+ ERI F +LVS K   ++AV+K
Sbjct  358  IRRIEPTAPESHVLKPSDIILSFDGIDIANDGTVPFRHGERIGFSYLVSQKYTGDSAVVK  417

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLH-EYGEDWYNTS  527
            VLRN E HEF+IKL   K L+P H   + PS++I AG VF  +T PYL  EYG+D+   +
Sbjct  418  VLRNSEVHEFNIKLSTHKRLIPAHINGRPPSYYIIAGFVFTAVTAPYLRSEYGKDYEFDA  477

Query  526  PRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKL  347
            P +L ++ L  +     EQ+V++SQVL+ DIN GYE +   QV  +NG  V+NLK L  +
Sbjct  478  PVKLLDKLLHAMAQSVDEQIVVVSQVLVADINIGYEEIVNTQVLALNGKPVQNLKSLADM  537

Query  346  VEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  206
            VE +  E ++FDL+ ++++VL    AK ATS IL  H IP AMS DL
Sbjct  538  VESSEDEFLKFDLEYQQIVVLKTKTAKEATSDILATHCIPSAMSGDL  584



>ref|XP_006470390.1| PREDICTED: protease Do-like 9-like [Citrus sinensis]
Length=587

 Score =   206 bits (524),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 111/227 (49%), Positives = 148/227 (65%), Gaps = 1/227 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            + +I P +    VL+  DIILSFDGI IANDGTV FR+ ERI F +LVS K   ++AV+K
Sbjct  359  IRRIEPTAPESHVLKPSDIILSFDGIDIANDGTVPFRHGERIGFSYLVSQKYTGDSAVVK  418

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLH-EYGEDWYNTS  527
            VLRN E HEF+IKL   K L+P H   + PS++I AG VF  +T PYL  EYG+D+   +
Sbjct  419  VLRNSEVHEFNIKLSTHKRLIPAHINGRPPSYYIIAGFVFTAVTAPYLRSEYGKDYEFDA  478

Query  526  PRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKL  347
            P +L ++ L  +     EQ+V++SQVL+ DIN GYE +   QV  +NG  V NLK L  +
Sbjct  479  PVKLLDKLLHAMAQSVDEQIVVVSQVLVADINIGYEEIVNTQVLALNGKPVRNLKSLADM  538

Query  346  VEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  206
            VE +  E ++FDL+ ++++VL    AK ATS IL  H IP AMS DL
Sbjct  539  VESSEDEFLKFDLEYQQIVVLKSKTAKEATSDILATHCIPSAMSGDL  585



>ref|XP_011071819.1| PREDICTED: protease Do-like 9 isoform X2 [Sesamum indicum]
Length=492

 Score =   203 bits (516),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 105/227 (46%), Positives = 150/227 (66%), Gaps = 1/227 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            + +I P +  +KVL+  DIILSFDG+ IANDGTV FR+ ERI F +LVS K   + A ++
Sbjct  264  IRRIDPTAPEFKVLKPSDIILSFDGVDIANDGTVPFRHGERIGFSYLVSQKYTGDNAAIE  323

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTS  527
            VLRN E  +F++KL   + L+P H   + PS++I AG VF  ++ PYL  EYG+D+   +
Sbjct  324  VLRNSETLKFNVKLGTHRRLIPAHNKGRPPSYYIVAGFVFTTVSVPYLRSEYGKDYEYEA  383

Query  526  PRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKL  347
            P +L ++ L ++P  P EQ+V++SQVL+ DIN GYE +   QV+  NG  V+NLK L  +
Sbjct  384  PVKLLDKLLHEMPQSPEEQIVVVSQVLVADINIGYEDIVNTQVHAFNGKPVKNLKSLAHM  443

Query  346  VEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  206
            VE+   E ++FDL+ ++++VL    AK AT  IL  H IP AMS DL
Sbjct  444  VENCDDEYLKFDLEYQQIVVLRTKNAKAATLDILSTHCIPSAMSDDL  490



>emb|CDY39277.1| BnaC06g27140D [Brassica napus]
Length=455

 Score =   200 bits (508),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 108/230 (47%), Positives = 144/230 (63%), Gaps = 26/230 (11%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDG---IAIANDGTVHFRNRERITFDHLVSMKKPNETA  713
            + +I+P S +Y +L+KDD++LS +      I    TV FR  E I F HLVSMKKP ET 
Sbjct  245  IKRINPSSSSYGILKKDDVLLSIETTRQFTIFMFDTVVFRKTESINFSHLVSMKKPCETT  304

Query  712  VLKVLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLT-QPYLHEYGEDWY  536
             LKVLR+G+ HEF+I + P++PL+ V QFDKLPS+++FAGLVF+P T QP          
Sbjct  305  TLKVLRDGKTHEFNINITPVEPLIQVCQFDKLPSYYVFAGLVFLPSTPQP----------  354

Query  535  NTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHL  356
                          +P K GEQ+V+LSQVL D+   GY  L   +V KVNGV+VENLKHL
Sbjct  355  ------------GTIPKKAGEQIVLLSQVLEDETTVGYTFLNNSRVKKVNGVQVENLKHL  402

Query  355  RKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  206
            R+L+E      +R DL+++  I++ Y   K AT +ILKR+ IP  MS DL
Sbjct  403  RQLIEKCCTGDLRIDLENDNTIIIGYKSGKRATPKILKRYGIPSTMSKDL  452



>ref|NP_568583.1| DegP protease 13 [Arabidopsis thaliana]
 gb|AED94564.1| DegP protease 13 [Arabidopsis thaliana]
Length=410

 Score =   199 bits (505),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 108/230 (47%), Positives = 146/230 (63%), Gaps = 23/230 (10%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            +  I+  SDA  +L+K D+ILS DG+AI NDGTV   NRER   D LVS+K+  ET +LK
Sbjct  194  IYNINQHSDALNILKKYDVILSIDGVAIENDGTVIIPNRERTRLDDLVSLKQLGETILLK  253

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSP  524
            +LR G+ HEF+I L P++ LVP  Q D  PS++IFAG VF+PL +   H  G +      
Sbjct  254  ILREGKMHEFNITLRPVQRLVPAGQIDNNPSYYIFAGFVFVPLRKQ--HFKGSN------  305

Query  523  RRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLV  344
                           GEQ+V++S+VL D IN  Y     L+VN VN V+VENLKHL +L+
Sbjct  306  ---------------GEQIVVISEVLADVINVEYYMYKHLKVNSVNKVKVENLKHLCELI  350

Query  343  EDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDE  194
            E    + +R +L D RVI+L+Y  AK +TS IL+RHR+P+AMS DL+ D+
Sbjct  351  EKCCTKDLRLELGDGRVIILDYQFAKSSTSLILERHRVPWAMSKDLMTDQ  400



>sp|Q9LK71.2|DGP11_ARATH RecName: Full=Putative protease Do-like 11, mitochondrial; Flags: 
Precursor [Arabidopsis thaliana]
Length=560

 Score =   201 bits (512),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 109/235 (46%), Positives = 149/235 (63%), Gaps = 29/235 (12%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            ++KI+  S AYK+LRKDDIIL+ DG+ I ND  V F+N+ RI F +LVSMKKP E A++K
Sbjct  330  INKINSSSGAYKILRKDDIILAIDGVPIGNDEKVPFQNKRRIDFSYLVSMKKPGEKALVK  389

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSP  524
            VLRNG+++E++I L P+KP   V QF  +PS++IF G VF+PLT+ YL            
Sbjct  390  VLRNGKEYEYNISLKPVKPNFTVQQFYNVPSYYIFGGFVFVPLTKTYLDS----------  439

Query  523  RRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLV  344
                               V +S+ L DDIN GY+ L   QV KVNGVEV+NLKHL +L+
Sbjct  440  ---------------EHHQVKISERLADDINEGYQSLYGAQVEKVNGVEVKNLKHLCELI  484

Query  343  EDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDECAPAL  179
            E+ S E +R +  + +V+VLNY+ AK AT +IL+RH+I   +S D+    C P L
Sbjct  485  EECSTEDLRLEFKNHKVLVLNYESAKKATLQILERHKIKSVISKDI----CLPML  535



>emb|CDP16995.1| unnamed protein product [Coffea canephora]
Length=580

 Score =   201 bits (510),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 106/227 (47%), Positives = 149/227 (66%), Gaps = 1/227 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            + +I P +    +L+  DIILSFDG+ IANDGTV FR+ ERI F +LVS K   ++A +K
Sbjct  352  IRRIDPTAPESDLLKPSDIILSFDGVDIANDGTVPFRHGERIGFSYLVSQKYTGDSAAIK  411

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTS  527
            VLRN E  +F+IKL   + L+P H   K PS++I AG VF  ++ PYL  EYG+D+   +
Sbjct  412  VLRNSETIKFNIKLASHRRLIPAHNKGKPPSYYIIAGFVFTTVSVPYLRSEYGKDYEYEA  471

Query  526  PRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKL  347
            P +L ++ L ++P  P EQ+V++SQVL+ DIN GYE +   QV   NG  V+NLK+L  +
Sbjct  472  PVKLLDKLLHEMPKSPDEQIVVVSQVLVADINIGYEDIVNTQVLAFNGKPVKNLKNLASM  531

Query  346  VEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  206
            VE  + E ++FDL+ ++++VL    AK AT  IL  H IP AMS DL
Sbjct  532  VESCNDEFLQFDLEYQQIVVLQTKGAKAATLDILTTHCIPSAMSDDL  578



>sp|Q9FM41.1|DGP13_ARATH RecName: Full=Putative protease Do-like 13 [Arabidopsis thaliana]
 dbj|BAB08526.1| unnamed protein product [Arabidopsis thaliana]
Length=486

 Score =   198 bits (504),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 108/230 (47%), Positives = 146/230 (63%), Gaps = 23/230 (10%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            +  I+  SDA  +L+K D+ILS DG+AI NDGTV   NRER   D LVS+K+  ET +LK
Sbjct  270  IYNINQHSDALNILKKYDVILSIDGVAIENDGTVIIPNRERTRLDDLVSLKQLGETILLK  329

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSP  524
            +LR G+ HEF+I L P++ LVP  Q D  PS++IFAG VF+PL +   H  G +      
Sbjct  330  ILREGKMHEFNITLRPVQRLVPAGQIDNNPSYYIFAGFVFVPLRKQ--HFKGSN------  381

Query  523  RRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLV  344
                           GEQ+V++S+VL D IN  Y     L+VN VN V+VENLKHL +L+
Sbjct  382  ---------------GEQIVVISEVLADVINVEYYMYKHLKVNSVNKVKVENLKHLCELI  426

Query  343  EDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDE  194
            E    + +R +L D RVI+L+Y  AK +TS IL+RHR+P+AMS DL+ D+
Sbjct  427  EKCCTKDLRLELGDGRVIILDYQFAKSSTSLILERHRVPWAMSKDLMTDQ  476



>ref|XP_010456846.1| PREDICTED: putative protease Do-like 11, mitochondrial [Camelina 
sativa]
Length=581

 Score =   199 bits (507),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 112/236 (47%), Positives = 156/236 (66%), Gaps = 17/236 (7%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            ++K++  S A+K+LRK DIIL+ DG+ I ND  V F+N+ RI F HLVS +K    A++K
Sbjct  335  INKVYSSSGAHKILRKYDIILAIDGVPIGNDEKVPFQNKNRINFSHLVSCEK----ALVK  390

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSP  524
            VLR G++HE++I L P+KP V V QF  LPS++IF   VF+PLT+ Y  EYG        
Sbjct  391  VLRKGKEHEYNITLKPVKPNVKVQQFYNLPSYYIFGVFVFVPLTKAYFDEYGLSG-----  445

Query  523  RRLCERALRKLPTKPGE-QLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKL  347
               C+ AL     K GE QLVI+SQ+L DDIN  Y+ L +LQV  VN V+++NLKHL +L
Sbjct  446  ---CKCALYDTYIKAGEHQLVIISQILDDDINKEYQSLEDLQVKNVNRVKIKNLKHLCEL  502

Query  346  VEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDECAPAL  179
            VE  S + +RF L+D+ V+VLN + A+ AT +I++RH+I   +S D+    C P L
Sbjct  503  VEKCSTKDLRFVLEDDNVMVLNTESARKATLKIMERHKIKSVISKDI----CLPML  554



>ref|XP_006289059.1| hypothetical protein CARUB_v10002456mg [Capsella rubella]
 gb|EOA21957.1| hypothetical protein CARUB_v10002456mg [Capsella rubella]
Length=350

 Score =   194 bits (493),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 110/223 (49%), Positives = 152/223 (68%), Gaps = 9/223 (4%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            ++KI+  S AYK+LRK+DIIL+ DG+ I  DG V FRN ERI+F+HL+SMKKP E  ++K
Sbjct  135  INKINSSSGAYKILRKNDIILAIDGVPIGLDGKVPFRNEERISFNHLISMKKPYEKILVK  194

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSP  524
            VLR G++HE++I L P+KP + V Q+  +PS++IF G VF+PLT+ Y+ +          
Sbjct  195  VLRKGKEHEYNISLKPVKPHISVQQYYNIPSYYIFGGFVFVPLTKLYIDDL---------  245

Query  523  RRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLV  344
              +C   L        EQ VI+SQV+  DIN GY  L +LQV KVNGV+V+NLKHL +L+
Sbjct  246  SYMCGCVLHDQYEFTDEQHVIISQVMSHDINQGYSDLEDLQVKKVNGVKVKNLKHLCELI  305

Query  343  EDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMS  215
            E   ++ +R DL+D++VIVLNY  AK AT  IL+RH I  A +
Sbjct  306  EGCCRKNLRLDLEDDKVIVLNYKSAKKATFEILERHNIKSAWA  348



>ref|NP_566551.1| DegP protease 11 [Arabidopsis thaliana]
 gb|AEE75833.1| DegP protease 11 [Arabidopsis thaliana]
Length=555

 Score =   198 bits (503),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 108/235 (46%), Positives = 146/235 (62%), Gaps = 34/235 (14%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            ++KI+  S AYK+LRKDDIIL+ DG+ I ND  V F+N+ RI F +LVSMKKP E A++K
Sbjct  330  INKINSSSGAYKILRKDDIILAIDGVPIGNDEKVPFQNKRRIDFSYLVSMKKPGEKALVK  389

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSP  524
            VLRNG+++E++I L P+KP   V QF  +PS++IF G VF+PLT+ YL            
Sbjct  390  VLRNGKEYEYNISLKPVKPNFTVQQFYNVPSYYIFGGFVFVPLTKTYLDSEHH-------  442

Query  523  RRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLV  344
                                   Q L DDIN GY+ L   QV KVNGVEV+NLKHL +L+
Sbjct  443  -----------------------QRLADDINEGYQSLYGAQVEKVNGVEVKNLKHLCELI  479

Query  343  EDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDECAPAL  179
            E+ S E +R +  + +V+VLNY+ AK AT +IL+RH+I   +S D+    C P L
Sbjct  480  EECSTEDLRLEFKNHKVLVLNYESAKKATLQILERHKIKSVISKDI----CLPML  530



>gb|EYU42545.1| hypothetical protein MIMGU_mgv1a0052332mg, partial [Erythranthe 
guttata]
Length=386

 Score =   194 bits (493),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 105/227 (46%), Positives = 145/227 (64%), Gaps = 1/227 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            + +I P +  + VL+  DIILSFD + IANDGTV FR+ ERI F +LVS K   + A +K
Sbjct  158  IRRIDPTAPEFAVLKPSDIILSFDRVDIANDGTVPFRHGERIGFSYLVSQKYSGDNAAIK  217

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTS  527
            VLR+ E  +F+IKL   K L+P H   K PS++I AG VF  ++ PYL  EYG+D+   +
Sbjct  218  VLRSSETLKFNIKLDTHKRLIPAHNRGKPPSYYIVAGFVFTTVSVPYLRSEYGKDYEYEA  277

Query  526  PRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKL  347
            P +L ++ L ++     EQ+V++SQVL+ DIN GYE +   QV   NG  V+NLK L  +
Sbjct  278  PVKLLDKLLHEMRQSAEEQIVVVSQVLVADINIGYEEIVNTQVLAFNGQPVKNLKSLASM  337

Query  346  VEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  206
            VE  S E ++FDL+ ++++VL    AK AT  IL  H IP AMS DL
Sbjct  338  VESCSDEYLKFDLEYQQIVVLQTKTAKAATLDILSTHCIPSAMSDDL  384



>ref|XP_011071818.1| PREDICTED: protease Do-like 9 isoform X1 [Sesamum indicum]
Length=977

 Score =   202 bits (513),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 105/227 (46%), Positives = 150/227 (66%), Gaps = 1/227 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            + +I P +  +KVL+  DIILSFDG+ IANDGTV FR+ ERI F +LVS K   + A ++
Sbjct  749  IRRIDPTAPEFKVLKPSDIILSFDGVDIANDGTVPFRHGERIGFSYLVSQKYTGDNAAIE  808

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLH-EYGEDWYNTS  527
            VLRN E  +F++KL   + L+P H   + PS++I AG VF  ++ PYL  EYG+D+   +
Sbjct  809  VLRNSETLKFNVKLGTHRRLIPAHNKGRPPSYYIVAGFVFTTVSVPYLRSEYGKDYEYEA  868

Query  526  PRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKL  347
            P +L ++ L ++P  P EQ+V++SQVL+ DIN GYE +   QV+  NG  V+NLK L  +
Sbjct  869  PVKLLDKLLHEMPQSPEEQIVVVSQVLVADINIGYEDIVNTQVHAFNGKPVKNLKSLAHM  928

Query  346  VEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  206
            VE+   E ++FDL+ ++++VL    AK AT  IL  H IP AMS DL
Sbjct  929  VENCDDEYLKFDLEYQQIVVLRTKNAKAATLDILSTHCIPSAMSDDL  975



>ref|XP_011087156.1| PREDICTED: protease Do-like 9 [Sesamum indicum]
Length=573

 Score =   198 bits (503),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 104/227 (46%), Positives = 148/227 (65%), Gaps = 1/227 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            + +I P S  +KVL+  DIILSFDG+ IA DGTV FR+ ERI F +LVS K  +++A ++
Sbjct  345  IRRIGPSSPLFKVLKPSDIILSFDGVDIAEDGTVPFRHGERIGFSYLVSQKYTDDSAEIE  404

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLH-EYGEDWYNTS  527
            VLRN E+ +F + L     LVP H   K PS++I AG VF P++ PYL  EYG+++    
Sbjct  405  VLRNSERLKFKVDLGTHTRLVPAHNNGKPPSYYIIAGFVFTPVSVPYLRSEYGKEYECEG  464

Query  526  PRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKL  347
            P +L ++ L ++P    EQ+V++SQVL+ DIN GYE +   QV   NG  V+NLK L  +
Sbjct  465  PVKLLDKVLHEMPQSVDEQIVVISQVLVADINIGYEDIVNTQVLAFNGQPVKNLKSLVTM  524

Query  346  VEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  206
            VE  + + ++FDL+ ++++VL    AK AT  IL RH +P AMS DL
Sbjct  525  VESCTDKYMKFDLEYQQIVVLRTRTAKAATLNILTRHCVPSAMSDDL  571



>ref|XP_009379979.1| PREDICTED: protease Do-like 9 [Musa acuminata subsp. malaccensis]
Length=578

 Score =   198 bits (503),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 105/229 (46%), Positives = 149/229 (65%), Gaps = 1/229 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            V +I P    ++ L+  DIILSFDG+ IANDGTV FR+ ERI F +LVS K   E A++K
Sbjct  350  VRRIEPTGPEFEFLKSSDIILSFDGVDIANDGTVPFRHGERIAFSYLVSQKYTGENALVK  409

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLH-EYGEDWYNTS  527
            VLR+ + +EF+IKL   K L+P H   K PS++I AG VF  ++ PYL  EYG+D+   +
Sbjct  410  VLRDSKVYEFNIKLATHKRLIPAHIKGKPPSYYIIAGFVFTAISVPYLRSEYGKDYEYDA  469

Query  526  PRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKL  347
            P +L ++ L  +     EQLV++SQVL+ D+N GYE +   QV   NG  V+NL+ L  +
Sbjct  470  PVKLLDKLLHTMAHSHDEQLVVISQVLVADVNIGYEDIVNTQVMAFNGKPVKNLRTLANM  529

Query  346  VEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLIN  200
            VE+ S+E ++FDL+ ++++VL    AK AT  IL  H IP A+S DL +
Sbjct  530  VENCSEEFLKFDLEYQQIVVLQTKTAKAATPDILATHCIPSAVSEDLTS  578



>ref|XP_003608950.1| hypothetical protein MTR_4g106730 [Medicago truncatula]
 gb|AES91147.1| serine endopeptidase degp2 protein, putative [Medicago truncatula]
Length=590

 Score =   198 bits (503),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 106/227 (47%), Positives = 144/227 (63%), Gaps = 1/227 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            + +I P S    VL+  D+ILSFDG+ IANDGTV FR+ ERI F +L+S K   + A +K
Sbjct  362  IRRIDPTSPESNVLKPSDVILSFDGVDIANDGTVPFRHGERIGFSYLISQKYTGDDAAIK  421

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLH-EYGEDWYNTS  527
            VLR+    +F+IKL   + L+P H   K PS++I AG VF  ++ PYL  EYG+D+   +
Sbjct  422  VLRSSNVLKFNIKLDGHRRLIPAHSKGKPPSYYIIAGFVFSTVSVPYLRSEYGKDYEYEA  481

Query  526  PRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKL  347
            P ++ ++ L  +P  P EQLV++SQVL+ DIN GYE +   QV   NG  V+NLK L  +
Sbjct  482  PVKILDKLLYAMPQSPDEQLVVISQVLVADINIGYEEIVNTQVVGFNGKPVKNLKSLAAM  541

Query  346  VEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  206
            VE    E ++FDLD E+++VL    AK AT  IL  H IP AMS DL
Sbjct  542  VESCDDEYLKFDLDYEQIVVLRTKTAKAATLDILATHCIPSAMSDDL  588



>ref|XP_010446115.1| PREDICTED: putative protease Do-like 3, mitochondrial [Camelina 
sativa]
Length=529

 Score =   197 bits (500),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 102/225 (45%), Positives = 149/225 (66%), Gaps = 10/225 (4%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            +++++ +S A+K L+KDD+IL+ DG+ I ND T+  R +ERI F+HLVSMKKP E  + K
Sbjct  313  INEMNMVSAAHKFLKKDDVILAIDGVPIGNDATIVLRGKERINFNHLVSMKKPGEKGLFK  372

Query  703  VLRNGEKHEFSIKLFPLKP-LVPVHQFDKL-PSFFIFAGLVFIPLTQPYLHEYGEDWYNT  530
            VLR+G +HEF I L  ++P LVPV Q+D   P  +IFAG +F  L++P +        + 
Sbjct  373  VLRDGREHEFKISLNSVQPRLVPVRQYDPFDPRCYIFAGFIFASLSKPKI--------DN  424

Query  529  SPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRK  350
            S   +C+ AL++ P K  ++++I+S++L DDIN GY    +LQV KVNG E+ NL HLR+
Sbjct  425  SSDAICDCALKRRPEKAAQEIIIISEMLEDDINVGYYSFKKLQVKKVNGEELLNLDHLRR  484

Query  349  LVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMS  215
             +E    E +R DL+  +VI+L+Y  A      ILKRHRIP +MS
Sbjct  485  RIEKCRTEVLRLDLEKGKVIILHYKSACEENLLILKRHRIPSSMS  529



>ref|XP_012080109.1| PREDICTED: protease Do-like 9 [Jatropha curcas]
 gb|KDP31134.1| hypothetical protein JCGZ_11510 [Jatropha curcas]
Length=572

 Score =   197 bits (501),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 106/227 (47%), Positives = 144/227 (63%), Gaps = 1/227 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            + +I P +   KVL+  DIILSFDG+ IANDGTV FR+ ERI F +L+S K   + A + 
Sbjct  344  IRRIDPTAPESKVLKPSDIILSFDGVDIANDGTVPFRHGERIGFSYLISQKYTGDNAAIS  403

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLH-EYGEDWYNTS  527
            VLRN E   F IKL   + LVP H   + PS++I AG VF  ++ PYL  EYG+D+   +
Sbjct  404  VLRNSETLNFDIKLSTHRRLVPPHVKGRPPSYYIIAGFVFSTVSVPYLRSEYGKDYEYEA  463

Query  526  PRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKL  347
            P +L ++ L  +P  P EQLV++SQVL+ DIN GYE +   QV   NG  V+NLK L  +
Sbjct  464  PVKLLDKLLHSMPQSPDEQLVVISQVLVADINIGYEDIVNTQVLAFNGKPVKNLKSLVTM  523

Query  346  VEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  206
            VE  + E ++F+L+ E+++VL    AK AT  +L  H IP AMS DL
Sbjct  524  VESCTDEFLKFELEYEQIVVLRTKTAKAATVDVLTTHCIPSAMSDDL  570



>dbj|BAB01153.1| unnamed protein product [Arabidopsis thaliana]
Length=565

 Score =   197 bits (500),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 111/240 (46%), Positives = 152/240 (63%), Gaps = 34/240 (14%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            ++KI+  S AYK+LRKDDIIL+ DG+ I ND  V F+N+ RI F +LVSMKKP E A++K
Sbjct  330  INKINSSSGAYKILRKDDIILAIDGVPIGNDEKVPFQNKRRIDFSYLVSMKKPGEKALVK  389

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSP  524
            VLRNG+++E++I L P+KP   V QF  +PS++IF G VF+PLT+ YL            
Sbjct  390  VLRNGKEYEYNISLKPVKPNFTVQQFYNVPSYYIFGGFVFVPLTKTYLDS----------  439

Query  523  RRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERL--AEL---QVNKVNGVEVENLKH  359
                               V +S+ L DDIN GY+ L  A+L   QV KVNGVEV+NLKH
Sbjct  440  ---------------EHHQVKISERLADDINEGYQSLYGAQLWWEQVEKVNGVEVKNLKH  484

Query  358  LRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDECAPAL  179
            L +L+E+ S E +R +  + +V+VLNY+ AK AT +IL+RH+I   +S D+    C P L
Sbjct  485  LCELIEECSTEDLRLEFKNHKVLVLNYESAKKATLQILERHKIKSVISKDI----CLPML  540



>ref|XP_006376843.1| hypothetical protein POPTR_0012s07930g [Populus trichocarpa]
 ref|XP_002318029.2| hypothetical protein POPTR_0012s07930g [Populus trichocarpa]
 gb|ERP54640.1| hypothetical protein POPTR_0012s07930g [Populus trichocarpa]
 gb|EEE96249.2| hypothetical protein POPTR_0012s07930g [Populus trichocarpa]
Length=559

 Score =   196 bits (497),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 105/227 (46%), Positives = 147/227 (65%), Gaps = 1/227 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            + +I P +   +VL+  DIILSFDG+ IANDGTV FR+ ERI F +L+S K   + AV+K
Sbjct  331  IRRIDPTAPESEVLQPSDIILSFDGVDIANDGTVPFRHGERIGFSYLISQKYTGDNAVIK  390

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTS  527
            VLRN +  EF IKL   + L+P H   K PS++I AG VF  ++ PYL  EYG+++   +
Sbjct  391  VLRNSKTLEFDIKLSTHRRLIPPHVKGKPPSYYIIAGFVFTTVSVPYLRSEYGKEYEFEA  450

Query  526  PRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKL  347
            P +L ++ L  +P  P EQ+V++SQVL+ DIN GYE +   QV   NG  V+NLK L  +
Sbjct  451  PVKLLDKLLHSMPQSPDEQIVVVSQVLVADINIGYEDIVNTQVVAFNGKPVKNLKSLANM  510

Query  346  VEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  206
            VE+   E ++FDL+ ++++VL    AK AT  IL  H IP A+S DL
Sbjct  511  VENFDDEFLKFDLEYDQIVVLRTKTAKEATVDILTTHGIPSAISDDL  557



>ref|XP_010436835.1| PREDICTED: LOW QUALITY PROTEIN: putative protease Do-like 13 
[Camelina sativa]
Length=520

 Score =   195 bits (495),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 109/228 (48%), Positives = 148/228 (65%), Gaps = 12/228 (5%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRE-RITFDHLVSMKKPNETAVL  707
            ++ I+  SDA  +L+KDDIIL+ DG+AI NDG V   NRE RIT D LVSMK+  ET +L
Sbjct  292  INNIYQHSDALNILKKDDIILAIDGVAIENDGIVVLPNREKRITLDDLVSMKQSGETILL  351

Query  706  KVLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLHEYGEDWYNTS  527
            KVLR G+ HEFSI L P++ LV     D   S++IFAG VF+PL++ ++        +  
Sbjct  352  KVLREGKMHEFSITLKPVQWLV-----DNNSSYYIFAGFVFVPLSKQHIKS------SNV  400

Query  526  PRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKL  347
              +L        P K G+Q+VI+S++L D IN  +     LQV  VN V+VENLKHL +L
Sbjct  401  MHKLAYNNDNNKPKKAGDQIVIISEILADVINVAFYMFKNLQVKSVNEVKVENLKHLYEL  460

Query  346  VEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLI  203
            +E  S + +R DL   RVIVL+Y  AK +T  IL+RHR+P+AMS+DL+
Sbjct  461  IEKCSDKDLRLDLGGGRVIVLDYQSAKSSTCLILERHRVPWAMSNDLM  508



>ref|XP_011044336.1| PREDICTED: protease Do-like 9 [Populus euphratica]
Length=559

 Score =   196 bits (497),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 105/227 (46%), Positives = 146/227 (64%), Gaps = 1/227 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            + +I P +   + L+  DIILSFDG+ IANDGTV FR+ ERI F +L+S K   + AV+K
Sbjct  331  IRRIDPTAPESEALQPSDIILSFDGVDIANDGTVPFRHGERIGFSYLISQKYTGDNAVIK  390

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTS  527
            VLRN +  EF IKL   + L+P H   K PS++I AG VF  ++ PYL  EYG+++   +
Sbjct  391  VLRNSKTLEFDIKLSTHRRLIPPHVKGKPPSYYIIAGFVFTTVSVPYLRSEYGKEYEFEA  450

Query  526  PRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKL  347
            P +L ++ L  +P  P EQ+V++SQVL+ DIN GYE +   QV   NG  V+NLK L  +
Sbjct  451  PVKLLDKLLHSMPQSPDEQIVVVSQVLVADINIGYEDIVNTQVVAFNGKPVKNLKSLANM  510

Query  346  VEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  206
            VE+   E ++FDL+ E+++VL    AK AT  IL  H IP A+S DL
Sbjct  511  VENFDDEFLKFDLEYEQIVVLRTKTAKEATVDILTTHGIPSAISDDL  557



>ref|XP_010424503.1| PREDICTED: putative protease Do-like 11, mitochondrial [Camelina 
sativa]
Length=585

 Score =   195 bits (496),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 116/236 (49%), Positives = 162/236 (69%), Gaps = 13/236 (6%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            ++K++    A+K+LRK DIIL+ DG+ I ND  V F+N+ RI F HLVS+KKP E A++K
Sbjct  335  INKVYSSWGAHKILRKYDIILAIDGVPIGNDEKVPFQNKNRINFSHLVSLKKPGEKALVK  394

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSP  524
            +LR G++HE++I L P+KP V V QF  LPS++IF G VF+PLT+ Y      D  + S 
Sbjct  395  ILRKGKEHEYNITLKPVKPNVKVQQFYNLPSYYIFGGFVFVPLTKAY-----SDNLSLSG  449

Query  523  RRLCERALRKLPTKPGE-QLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKL  347
               C+ AL     K GE QLVI+S++L DDIN GY+RL +LQV KVN V+V+NLKHL +L
Sbjct  450  ---CKCALYDTYRKAGEHQLVIISKILEDDINKGYQRLDDLQVKKVNRVKVKNLKHLCEL  506

Query  346  VEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDECAPAL  179
            VE  S + +R  L+D++V+VLN + AK AT +I++RH+I   +S D+    C P L
Sbjct  507  VEKCSTKYLRLVLEDDKVMVLNTESAKKATLKIMERHKIKSVISKDI----CLPML  558



>ref|XP_010928580.1| PREDICTED: protease Do-like 9 [Elaeis guineensis]
Length=579

 Score =   195 bits (495),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 107/227 (47%), Positives = 146/227 (64%), Gaps = 1/227 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            V ++ P +     L+  DIILSFDG+ IANDGTV FR+ ERI F +LVS K   E A++K
Sbjct  351  VRRVEPTAPESDFLKPSDIILSFDGVDIANDGTVPFRHGERIGFSYLVSQKYTGENAMVK  410

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLH-EYGEDWYNTS  527
            VLR  + +EF++KL   K LVP H   K PS++I AGLVF  ++ PYL  EYG+D+   +
Sbjct  411  VLREKKVYEFNVKLATHKRLVPAHIKGKPPSYYIIAGLVFAAISVPYLRSEYGKDYEYDA  470

Query  526  PRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKL  347
            P +L ++ L  +     EQLV++SQVL+ DIN GYE +   QV   NG  V+NLK L  +
Sbjct  471  PVKLLDKHLHAMAQAHDEQLVVISQVLVADINIGYEDIVNTQVLSFNGKPVKNLKSLASM  530

Query  346  VEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  206
            VE+  +E ++FDL+ ++++VL    AK AT  IL  H IP AMS DL
Sbjct  531  VENCDEEFLQFDLEYQQIVVLKTRTAKAATKDILLTHCIPSAMSGDL  577



>ref|NP_566552.1| DEGP protease 12 [Arabidopsis thaliana]
 gb|AEE75834.1| DEGP protease 12 [Arabidopsis thaliana]
Length=491

 Score =   193 bits (491),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 101/225 (45%), Positives = 150/225 (67%), Gaps = 26/225 (12%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            ++KI+  S A+K+LRKDDIIL+ DG+ + ++         RI+F+H +SMKKP+E  ++K
Sbjct  293  INKINSSSGAHKILRKDDIILAIDGVPVLSE-------MRRISFNHFISMKKPDENILVK  345

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSP  524
            VLR G++HE++I L P+KP + V Q+  LPS++IF G VF+PLT+ Y+ +    +Y  + 
Sbjct  346  VLRKGKEHEYNISLKPVKPHIQVQQYYNLPSYYIFGGFVFVPLTKSYIDD---KYYKITD  402

Query  523  RRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLV  344
                            EQ VI+SQV+ DDIN GY    +LQV KVNGV+V+NLKHLR+L+
Sbjct  403  ----------------EQHVIISQVMPDDINKGYSNFKDLQVEKVNGVKVKNLKHLRELI  446

Query  343  EDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSD  209
            E    + +R DL++++V+VLNY+ AK AT  IL+RH I  A +S+
Sbjct  447  EGCFSKDLRLDLENDKVMVLNYESAKKATFEILERHNIKSAWASE  491



>ref|XP_011015595.1| PREDICTED: protease Do-like 9 [Populus euphratica]
 ref|XP_011015596.1| PREDICTED: protease Do-like 9 [Populus euphratica]
 ref|XP_011015597.1| PREDICTED: protease Do-like 9 [Populus euphratica]
Length=559

 Score =   194 bits (493),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 104/227 (46%), Positives = 146/227 (64%), Gaps = 1/227 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            + +I P +   + L+  DIILSFDG+ IANDGTV FR+ ERI F +L+S K   + AV+K
Sbjct  331  IRRIDPTAPESEALQPSDIILSFDGVDIANDGTVPFRHGERIGFSYLISQKYTGDNAVIK  390

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTS  527
            VLRN +  EF IKL   + L+P H   K PS++I AG VF  ++ PYL  EYG+++   +
Sbjct  391  VLRNSKTLEFDIKLSTHRRLIPPHVKGKPPSYYIIAGFVFTTVSVPYLRSEYGKEYEFEA  450

Query  526  PRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKL  347
            P +L ++ L  +P  P EQ+V++SQVL+ DIN GYE +   QV   NG  V+NLK L  +
Sbjct  451  PVKLLDKLLHSMPQSPDEQIVVVSQVLVADINIGYEDIVNTQVVAFNGKPVKNLKSLANM  510

Query  346  VEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  206
            VE+   E ++FDL+ ++++VL    AK AT  IL  H IP A+S DL
Sbjct  511  VENFDDEFLKFDLEYDQIVVLRTKTAKEATVDILTTHGIPSAISDDL  557



>sp|Q9LK70.1|DGP12_ARATH RecName: Full=Putative protease Do-like 12, mitochondrial; Flags: 
Precursor [Arabidopsis thaliana]
 dbj|BAB01154.1| unnamed protein product [Arabidopsis thaliana]
Length=499

 Score =   193 bits (490),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 101/225 (45%), Positives = 150/225 (67%), Gaps = 26/225 (12%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            ++KI+  S A+K+LRKDDIIL+ DG+ + ++         RI+F+H +SMKKP+E  ++K
Sbjct  301  INKINSSSGAHKILRKDDIILAIDGVPVLSE-------MRRISFNHFISMKKPDENILVK  353

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSP  524
            VLR G++HE++I L P+KP + V Q+  LPS++IF G VF+PLT+ Y+ +    +Y  + 
Sbjct  354  VLRKGKEHEYNISLKPVKPHIQVQQYYNLPSYYIFGGFVFVPLTKSYIDD---KYYKITD  410

Query  523  RRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLV  344
                            EQ VI+SQV+ DDIN GY    +LQV KVNGV+V+NLKHLR+L+
Sbjct  411  ----------------EQHVIISQVMPDDINKGYSNFKDLQVEKVNGVKVKNLKHLRELI  454

Query  343  EDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSD  209
            E    + +R DL++++V+VLNY+ AK AT  IL+RH I  A +S+
Sbjct  455  EGCFSKDLRLDLENDKVMVLNYESAKKATFEILERHNIKSAWASE  499



>ref|XP_010678720.1| PREDICTED: protease Do-like 9 [Beta vulgaris subsp. vulgaris]
Length=566

 Score =   193 bits (491),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 104/227 (46%), Positives = 144/227 (63%), Gaps = 1/227 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            V ++ P +   KVLR  D+ILSFDG+ IANDGTV FR+ ERI F +L+S K   + A +K
Sbjct  338  VRRVDPTAPESKVLRPSDVILSFDGVDIANDGTVPFRHGERIGFSYLISQKYTGDKAEIK  397

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTS  527
            VLR+     FSIKL   + LVP H   + PS++I AG VF  ++ PYL  EYG+++   +
Sbjct  398  VLRDSVIQTFSIKLGTHRRLVPAHSKGRPPSYYIVAGFVFTTVSVPYLRSEYGKEYEYDA  457

Query  526  PRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKL  347
            P +L ++ L  +P    E+LV++SQVL+ DIN GYE +   QV   NG  V NLK L  +
Sbjct  458  PVKLLDKLLHSMPQSKDEELVVISQVLVADINIGYEEIVNTQVIAFNGNPVTNLKTLASM  517

Query  346  VEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  206
            VE  + E ++F+LD ++++VL  + AK AT  IL  H IP AMS DL
Sbjct  518  VESCNDEFMKFNLDYDQIVVLRTETAKAATIDILATHCIPSAMSDDL  564



>ref|XP_006282154.1| hypothetical protein CARUB_v10028411mg [Capsella rubella]
 gb|EOA15052.1| hypothetical protein CARUB_v10028411mg [Capsella rubella]
Length=508

 Score =   192 bits (487),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 104/225 (46%), Positives = 146/225 (65%), Gaps = 11/225 (5%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            +++++ +S A+ +L+KDD+IL+ DG+ I ND T+  R +ERI F+HLVSMKK  E  V K
Sbjct  293  INEMNMVSAAHTILKKDDVILAIDGVPIGNDETILLRGKERIHFNHLVSMKKQGEKGVFK  352

Query  703  VLRNGEKHEFSIKLFPLKP-LVPVHQFDKL-PSFFIFAGLVFIPLTQPYLHEYGEDWYNT  530
            VLR+G +HEF I L  ++  LVPV +FD   P ++IFAG +F  L++  +        N+
Sbjct  353  VLRDGREHEFKISLNSMQQRLVPVREFDPFYPKWYIFAGFIFASLSKRNIK-------NS  405

Query  529  SPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRK  350
            S R  C+ AL + P K  E+ +I+SQVLLDDIN GY     LQV KVNG EV ++  LR 
Sbjct  406  STR--CDCALERRPEKYYEETIIISQVLLDDINVGYYSFKNLQVKKVNGEEVRHMNQLRT  463

Query  349  LVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMS  215
            L++    E +R DL+  +VI+LNY  A+  T  IL+RHRIP  MS
Sbjct  464  LIKKCRTEDLRLDLEKGKVIILNYKSARKETLLILERHRIPSCMS  508



>ref|XP_010254385.1| PREDICTED: protease Do-like 9 [Nelumbo nucifera]
Length=577

 Score =   193 bits (490),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 106/227 (47%), Positives = 145/227 (64%), Gaps = 1/227 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            V +I P S   +VL+  D+ILSFDGI +AND TV FR+ ERI F +LVS K   E AV+K
Sbjct  349  VRRIEPTSPLSQVLKPSDVILSFDGIDVANDETVPFRHGERIGFSYLVSQKYTGENAVVK  408

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTS  527
            VLR+ E  EF+IKL   K L+P H   + PS++I AG VF  ++ PYL  EYG+D+   +
Sbjct  409  VLRDSEILEFNIKLATYKRLIPAHIKGRPPSYYIIAGFVFTMVSVPYLRSEYGKDYECDA  468

Query  526  PRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKL  347
            P +L ++ L  +     E+LV++SQVL+ DIN GYE +   QV   NG  V+NLK L  +
Sbjct  469  PVKLLDKHLHAMAQSDDEELVVVSQVLVADINIGYENIVNTQVLAFNGKPVKNLKSLCNM  528

Query  346  VEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  206
            VE+   E ++F+L+ ++++VL    AK AT  IL  H IP AMS DL
Sbjct  529  VENCDDEFLKFELEYQQLVVLQTKTAKAATPDILTTHCIPSAMSGDL  575



>ref|XP_002321577.2| hypothetical protein POPTR_0015s08440g [Populus trichocarpa]
 gb|EEF05704.2| hypothetical protein POPTR_0015s08440g [Populus trichocarpa]
Length=556

 Score =   192 bits (487),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 103/227 (45%), Positives = 146/227 (64%), Gaps = 1/227 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            + ++ P +   +VL+  DIILSFDG+ IANDGTV FR+ ERI F +L+S K   + A +K
Sbjct  328  IRRVDPTALESEVLQPSDIILSFDGVDIANDGTVPFRHGERIGFSYLISQKYTGDNAAIK  387

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLH-EYGEDWYNTS  527
            VLRN +  EF IKL   + L+P H   K PS++I AG VF  ++ PYL  EYG+++   +
Sbjct  388  VLRNSKTLEFVIKLSTHRRLIPPHVKGKPPSYYIIAGFVFTTVSVPYLRSEYGKEYEFEA  447

Query  526  PRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKL  347
            P +L ++ L  +P  P EQ+V++SQVL+ DIN GYE +   QV   NG  V+NLK L  +
Sbjct  448  PVKLLDKLLHSMPQSPDEQMVVVSQVLVADINIGYEDIVNTQVLAFNGKPVKNLKSLANM  507

Query  346  VEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  206
            VE+   E ++FDL+ ++++VL    AK AT  IL  H IP A+S DL
Sbjct  508  VENCDDEFLKFDLEYDQIVVLRMKTAKEATVDILTTHCIPSAISDDL  554



>ref|XP_006281902.1| hypothetical protein CARUB_v10028106mg, partial [Capsella rubella]
 gb|EOA14800.1| hypothetical protein CARUB_v10028106mg, partial [Capsella rubella]
Length=466

 Score =   189 bits (481),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 108/230 (47%), Positives = 147/230 (64%), Gaps = 32/230 (14%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            +++I+PLS A  +LRKDD+IL+ DG+ I ND T+ FR +ERI F+HLV++KK  ET +LK
Sbjct  256  INEIYPLSSAQGILRKDDVILAIDGVPIGNDETILFRKKERINFEHLVTLKKSGETVLLK  315

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDK-LPSFFIFAGLVFIPLTQPYLHEYGEDWYNTS  527
            VLR G++HEF+I +   + LVP    D+ LPS++I AG VF+PL++PY         N+S
Sbjct  316  VLRKGKEHEFNIIVRHEQQLVP----DRYLPSYYILAGFVFVPLSKPYA--------NSS  363

Query  526  PRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKL  347
               +C  +L +   K GEQ+V++S                 QV KVNGVEV NL+HL  L
Sbjct  364  --NICNCSLDRKAKKAGEQIVMIS-----------------QVKKVNGVEVLNLRHLSDL  404

Query  346  VEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLIND  197
            +E  S+E +R DL+ ERVI +NY  AK AT  IL+ H IP AMS DL  D
Sbjct  405  IEKCSEEDLRLDLEKERVITVNYKSAKEATPWILEHHGIPSAMSKDLKED  454



>ref|XP_002885148.1| hypothetical protein ARALYDRAFT_479117 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61407.1| hypothetical protein ARALYDRAFT_479117 [Arabidopsis lyrata subsp. 
lyrata]
Length=494

 Score =   190 bits (482),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 109/245 (44%), Positives = 145/245 (59%), Gaps = 44/245 (18%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            ++KI+  S AYK+LRKDDIIL+ DG+ I ND  V F+N+ RI F +LVSMKKP E A++K
Sbjct  259  INKINSSSGAYKILRKDDIILAIDGVPIGNDEKVPFQNKRRIDFSYLVSMKKPGEKALVK  318

Query  703  VLRNGEKHEFS----------IKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLHE  554
            VLRNG+++E S           K+  +KP   V QF  LPS++IF G VF+PLT+ YL  
Sbjct  319  VLRNGKEYETSNINATISRMISKINSVKPNFTVQQFYNLPSYYIFGGFVFVPLTKTYLDS  378

Query  553  YGEDWYNTSPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEV  374
                                             Q+L DDIN GY+ L   QV KVNGVEV
Sbjct  379  EHH------------------------------QILADDINEGYQSLDGAQVEKVNGVEV  408

Query  373  ENLKHLRKLVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDE  194
            +NLKHL +L+E+ S E +R D  + +V+VLNY+ AK AT +IL+RH+I   +S D+    
Sbjct  409  KNLKHLCELIEECSTEDLRLDFKNHKVLVLNYETAKKATLQILERHKIKSFISKDI----  464

Query  193  CAPAL  179
            C P L
Sbjct  465  CLPML  469



>gb|KJB40784.1| hypothetical protein B456_007G077100 [Gossypium raimondii]
Length=590

 Score =   191 bits (484),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 103/227 (45%), Positives = 145/227 (64%), Gaps = 1/227 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            + +I P +    +L+  D+IL FDG+ +ANDGTV FR+ ERI F +LVS K   +TA++K
Sbjct  362  IRRIEPTAPESHLLKPSDVILRFDGVKVANDGTVPFRHGERIGFSYLVSQKYTGDTALVK  421

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTS  527
            VLR+ +  EF IKL   K L+P H   K PS++I AG VF  +T PYL  EYG+D+   +
Sbjct  422  VLRDSKILEFDIKLATHKRLIPAHTSAKPPSYYIIAGFVFTAVTVPYLRSEYGKDYEFDA  481

Query  526  PRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKL  347
            P +L ++ L  +     EQLV++SQVL+ DIN GYE +   QV   NG  V+NLK L  +
Sbjct  482  PVKLLDKHLHAMAESTDEQLVVISQVLVADINIGYEDIVNTQVLAFNGKPVKNLKSLANM  541

Query  346  VEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  206
            V++ + E +RFDL+ ++++VL+   AK AT  IL  H I  AMS DL
Sbjct  542  VDNCNDEYLRFDLEYQQIVVLHAKAAKAATLDILTTHCISSAMSDDL  588



>ref|XP_006339987.1| PREDICTED: protease Do-like 9-like [Solanum tuberosum]
Length=581

 Score =   190 bits (482),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 106/228 (46%), Positives = 143/228 (63%), Gaps = 2/228 (1%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            + +I P +    +L   D+ILSFDG+ IANDGTV FR+ ERI F +LVS K   ++A +K
Sbjct  352  IRRIDPTAPESMMLMPSDVILSFDGVDIANDGTVPFRHGERIGFSYLVSQKYSGDSAAVK  411

Query  703  VLR-NGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLH-EYGEDWYNT  530
            VLR N E   F IKL     L+P H   + PS++I AG VF  ++ PYL  EYG+D+   
Sbjct  412  VLRRNSEILNFIIKLATQMRLIPAHNKGRPPSYYIIAGFVFTTVSVPYLRSEYGKDYEYE  471

Query  529  SPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRK  350
            +P +L ++ L +    P EQ+V++SQVL+ DIN GYE +   QV   NG  V+NLK L  
Sbjct  472  APVKLLDKLLHEFRQSPDEQIVVVSQVLVADINIGYEEIVNTQVLAFNGERVKNLKSLAS  531

Query  349  LVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  206
            +VE  S E ++FDL+ ++V+VL    AK ATS IL  H IP AMS DL
Sbjct  532  MVEKCSDEFLKFDLEYQQVVVLQTKTAKSATSDILTTHCIPSAMSEDL  579



>ref|XP_009107927.1| PREDICTED: putative protease Do-like 12, mitochondrial [Brassica 
rapa]
Length=505

 Score =   188 bits (478),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 108/226 (48%), Positives = 151/226 (67%), Gaps = 26/226 (12%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            ++KI+  S AY +L+K+DIIL+ DG+ IAND TV F   ERI+F++L+SMKKP ET+++K
Sbjct  301  INKINMWSGAYGILKKNDIILAIDGVPIANDATVPFWENERISFNYLISMKKPGETSMIK  360

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSP  524
            VLR G++HE++I L P+KP V V Q+ K PS++IF G VF+P                  
Sbjct  361  VLRRGKEHEYNINLKPVKPHVRVQQYYKRPSYYIFGGFVFVP-----------------N  403

Query  523  RRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLV  344
              L E           EQ VI+S++L DDIN GYE   +LQV KVN V+V+NL+HL +L+
Sbjct  404  HNLSESE---------EQHVIISEILEDDINQGYESFKDLQVEKVNKVKVKNLRHLFELI  454

Query  343  EDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  206
            E+N  + +  DL+D++V+VLNY+ AK A S ILKRH I  A+S+DL
Sbjct  455  EENGTQNLSIDLEDDKVLVLNYESAKKADSIILKRHNITSAISNDL  500



>ref|XP_010424502.1| PREDICTED: putative protease Do-like 12, mitochondrial [Camelina 
sativa]
Length=511

 Score =   188 bits (477),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 105/223 (47%), Positives = 151/223 (68%), Gaps = 9/223 (4%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            ++KI+  S A+K+L+K+DIIL+ DG+ I ND  V F+N ERI+F+HLVSMKKP E  ++K
Sbjct  296  INKINSSSGAHKILKKNDIILAIDGVPIGNDAKVPFQNEERISFNHLVSMKKPYEKILIK  355

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSP  524
            VLR G++HE++I L P++P + V Q+  LPS++IF G VF+PLT+ Y+ +          
Sbjct  356  VLRKGKEHEYNISLKPVRPHITVQQYYNLPSYYIFGGFVFVPLTKSYIDDL---------  406

Query  523  RRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLV  344
              +C   L        EQ VI+SQV+ DDIN GY    +L+V KVNGV+V+N KHL +L+
Sbjct  407  SYMCACILHDEYKITDEQHVIISQVMSDDINQGYGDFKDLRVKKVNGVKVKNFKHLCELI  466

Query  343  EDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMS  215
            E    E +R DL++++V+VLNY+ AK AT  IL+RH I  A +
Sbjct  467  EGCCSENLRMDLENDKVMVLNYESAKKATFEILERHNIKSAWA  509



>gb|KHN48612.1| Protease Do-like 9 [Glycine soja]
Length=386

 Score =   185 bits (470),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 107/227 (47%), Positives = 146/227 (64%), Gaps = 1/227 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            + +I P +   KVL+  D+ILSFDG+ IANDGTV FR+ ERI F +L+S K   + A +K
Sbjct  158  IRRIDPTAPESKVLKPSDVILSFDGVDIANDGTVPFRHGERIGFSYLISQKYTGDNAAIK  217

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTS  527
            VLRN +  +F IKL   + L+P H   K PS++I AG VF  ++ PYL  EYG+D+   +
Sbjct  218  VLRNSDIFKFDIKLDSHRRLIPAHSKGKPPSYYIIAGFVFTTVSVPYLRSEYGKDYEYEA  277

Query  526  PRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKL  347
            P +L ++ L  +P  P EQLV++SQVL+ DIN GYE +   QV   NG  V+NLK L  +
Sbjct  278  PVKLLDKLLHSMPQSPDEQLVVVSQVLVADINIGYEDIVNTQVLAFNGQPVKNLKSLATM  337

Query  346  VEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  206
            VE  + E ++FDLD ++++VL    AK AT  IL  H IP AMS DL
Sbjct  338  VESCNDEYLKFDLDYDQIVVLRMKTAKAATLDILATHCIPSAMSDDL  384



>emb|CDY46469.1| BnaA08g06390D [Brassica napus]
Length=505

 Score =   188 bits (477),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 108/226 (48%), Positives = 151/226 (67%), Gaps = 26/226 (12%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            ++KI+  S AY +L+K+DIIL+ DG+ IAND TV F   ERI+F++L+SMKKP ET+++K
Sbjct  301  INKINLWSGAYGILKKNDIILAIDGVPIANDATVPFWESERISFNYLISMKKPGETSMIK  360

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSP  524
            VLR G++HE++I L P+KP V V Q+ K PS++IF G VF+P                  
Sbjct  361  VLRRGKEHEYNINLKPVKPHVRVQQYYKRPSYYIFGGFVFVP-----------------N  403

Query  523  RRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLV  344
              L E           EQ VI+S++L DDIN GYE   +LQV KVN V+V+NL+HL +L+
Sbjct  404  HNLSESE---------EQHVIISEILEDDINQGYESFKDLQVEKVNKVKVKNLRHLFELI  454

Query  343  EDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  206
            E+N  + +  DL+D++V+VLNY+ AK A S ILKRH I  A+S+DL
Sbjct  455  EENGTQNLSIDLEDDKVLVLNYESAKKADSIILKRHNITSAISNDL  500



>ref|XP_006655949.1| PREDICTED: protease Do-like 9-like, partial [Oryza brachyantha]
Length=504

 Score =   187 bits (476),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 107/227 (47%), Positives = 150/227 (66%), Gaps = 1/227 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            + ++ P +  Y+ L+  DI+LSFDG+ IANDGTV FR+ ERI F +LVS K   E A +K
Sbjct  276  IRRVEPTAPEYEFLQSSDIVLSFDGVDIANDGTVPFRHGERIGFSYLVSQKYTGEKAHVK  335

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLH-EYGEDWYNTS  527
            VLRN +  EF+IKL   K L+P H   K PS++I AG VF+ ++ PYL  EYG+++   +
Sbjct  336  VLRNSKVLEFNIKLATHKRLIPAHIKGKPPSYYIVAGFVFMAVSVPYLRSEYGKEYEYDA  395

Query  526  PRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKL  347
            P +L ++ L  +   P EQLV++SQVL+ DIN GYE +  +QV   NG  ++NLKHL  +
Sbjct  396  PVKLLDKHLHAMAQSPDEQLVVVSQVLVADINIGYEEIVNIQVLAFNGKTIKNLKHLATM  455

Query  346  VEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  206
            VE  S+E ++FD+D E+++VL    AK AT  IL  H IP A+S DL
Sbjct  456  VEACSEEFLKFDMDYEQLVVLETKTAKAATQDILTTHCIPSAISEDL  502



>ref|XP_009794183.1| PREDICTED: protease Do-like 9 [Nicotiana sylvestris]
Length=575

 Score =   189 bits (479),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 104/228 (46%), Positives = 145/228 (64%), Gaps = 2/228 (1%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            + +I P +    +L   D++LSFDG+ IANDGTV FR+ ERI F +LVS K   ++A +K
Sbjct  346  IRRIDPTAPESMLLMPSDVLLSFDGVDIANDGTVPFRHGERIGFSYLVSQKYSGDSAAVK  405

Query  703  VLR-NGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLH-EYGEDWYNT  530
            VLR N E   F IKL     LVP H   + PS++I AG VF  ++ PYL  EYG+D+   
Sbjct  406  VLRRNSEILNFKIKLATQMRLVPAHNKGRPPSYYIIAGFVFTTVSVPYLRSEYGKDYEYE  465

Query  529  SPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRK  350
            +P +L ++ L +    P EQ+V++SQVL+ DIN GYE +   QV   NG  V+NLK L +
Sbjct  466  APVKLLDKLLHEFRQSPDEQIVVVSQVLVADINIGYEEIVNTQVLAFNGKPVKNLKSLAR  525

Query  349  LVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  206
            +VE+ + E ++ DL+ ++V+VL  + AK ATS IL  H IP AMS DL
Sbjct  526  MVENCNDEFLKLDLEYQQVVVLQTETAKSATSDILTTHCIPSAMSEDL  573



>gb|KCW49312.1| hypothetical protein EUGRSUZ_K02868 [Eucalyptus grandis]
 gb|KCW49313.1| hypothetical protein EUGRSUZ_K02868 [Eucalyptus grandis]
Length=474

 Score =   187 bits (474),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 103/227 (45%), Positives = 145/227 (64%), Gaps = 3/227 (1%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            + +I P S    VL+  DIILSFDG+ IANDGTV  R+ ERI F +LVS K   +T+V+K
Sbjct  248  IRRIDPTSPESAVLKPSDIILSFDGVDIANDGTVPSRHGERIGFSYLVSQKYTGDTSVIK  307

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTS  527
            VLR+ +   F +KL   K ++P+H   + PS++I AG VF  ++ PYL  EY ++  + +
Sbjct  308  VLRDSKIFIFDVKLGMHKRVIPLHSEGRPPSYYIIAGFVFSTISVPYLRSEYKDE--SEA  365

Query  526  PRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKL  347
            P +L ++ L  +P  P EQLV++SQVL  DIN GYE +    V   NG  VENLK L  +
Sbjct  366  PVKLLDKLLHSMPQSPDEQLVVVSQVLAGDINVGYEDIVNTPVLAFNGKPVENLKSLASM  425

Query  346  VEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  206
            VE   +E ++FDL+ ++++VL  + A+ AT  ILK H IP AMS DL
Sbjct  426  VESCEEEFLKFDLEYQQIVVLRTETARAATLDILKTHCIPSAMSDDL  472



>ref|XP_002885149.1| DEGP12 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61408.1| DEGP12 [Arabidopsis lyrata subsp. lyrata]
Length=500

 Score =   187 bits (475),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 97/213 (46%), Positives = 140/213 (66%), Gaps = 13/213 (6%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            ++KI+  S A+K+LRKDDIIL+ DG+ I ND T  FRN ERI+F+H +SMKKP+E  ++K
Sbjct  293  INKINSSSGAHKILRKDDIILAIDGVPIGNDETCPFRNEERISFNHFISMKKPDEKILVK  352

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQ--FDKLPSFFIFAGLVFIPLTQPYLHEYGEDWYNT  530
            VLR G++HE++I L P+             LPS++IF G VF+PLT+ Y+ +   +    
Sbjct  353  VLRKGKEHEYNISLKPVSETTHASATILYNLPSYYIFGGFVFVPLTKSYIDDLSLECVLN  412

Query  529  SPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRK  350
               ++ +           EQ VI+SQV+ DDIN GY    +LQV KVNGV+V+NLKHLR+
Sbjct  413  DEYKITD-----------EQQVIISQVMPDDINKGYSNFKDLQVEKVNGVKVKNLKHLRE  461

Query  349  LVEDNSKERIRFDLDDERVIVLNYDLAKVATSR  251
            L+E    + +R DL++++V+VLNY+ AK A  R
Sbjct  462  LIEGCCGKDLRLDLENDKVMVLNYESAKKANLR  494



>dbj|GAM25013.1| hypothetical protein SAMD00019534_081880 [Acytostelium subglobosum 
LB1]
Length=505

 Score =   186 bits (473),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 96/228 (42%), Positives = 148/228 (65%), Gaps = 3/228 (1%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            +++IHPLS A  VL+K+DI+   + + IANDGTV FR RERI++++L+S     +   + 
Sbjct  281  INEIHPLSAAKNVLKKEDIVTHVNKVQIANDGTVAFRRRERISYEYLLSSHFIGDKVDVT  340

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSP  524
            V R G+  + ++ L P   +VP   +DK PS+F++AG +F+P+T P L E  ED  +T  
Sbjct  341  VFRKGQSLDVTVPLVPQHRVVPYQMYDKRPSYFVYAGFIFVPVTYPLLTEVSEDMASTF-  399

Query  523  RRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLV  344
            R++ E+A +   T P  Q+V++SQVL+D IN GY      +V KVNGV V NLKHL  L+
Sbjct  400  RKVFEKAEKI--TGPDSQVVVISQVLIDKINYGYSAFGLCEVRKVNGVPVRNLKHLVDLI  457

Query  343  EDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLIN  200
            E+ + + I   ++ + +++L+ D AK AT+RI+ +H IP A S DL+N
Sbjct  458  ENTTDQHIVITIEHDYLVILDKDEAKEATARIMTQHAIPSAKSVDLLN  505



>ref|XP_010111735.1| Protease Do-like 9 [Morus notabilis]
 gb|EXC31597.1| Protease Do-like 9 [Morus notabilis]
Length=590

 Score =   188 bits (477),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 104/227 (46%), Positives = 144/227 (63%), Gaps = 1/227 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            + +I P +    VLR  D+ILSFDGI IANDGTV FR+ ERI F +LVS K   +TA++K
Sbjct  362  IRRIEPTAPESNVLRPSDVILSFDGINIANDGTVPFRHGERIGFSYLVSQKYTGDTALVK  421

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLH-EYGEDWYNTS  527
            VLRN E  E++IKL   K L+P H   + PS++I AG VF  ++ PYL  EYG+++   +
Sbjct  422  VLRNSEILEYNIKLSTHKRLIPAHIKGRPPSYYIIAGFVFSAVSVPYLRSEYGKEYEFDA  481

Query  526  PRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKL  347
            P +L ++ L  +     EQ V++SQVL+ DIN GYE +   QV   NG  V NLK L  +
Sbjct  482  PVKLLDKHLHAMAQSVDEQAVVVSQVLVADINIGYEDIVNTQVLAFNGKPVRNLKTLASM  541

Query  346  VEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  206
            VE  + E ++F+L+ ++++VL    A+ AT  IL  H IP AMS DL
Sbjct  542  VESCNDEYLKFNLEYDQIVVLQTKTAREATLDILATHCIPSAMSDDL  588



>ref|XP_004508846.1| PREDICTED: protease Do-like 9-like [Cicer arietinum]
Length=582

 Score =   187 bits (476),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 110/227 (48%), Positives = 146/227 (64%), Gaps = 1/227 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            + +I P S  YKVL+  D+ILSFDG+ IANDGTV FR+ ERI F +L+S K   + A +K
Sbjct  354  IRRIDPTSPEYKVLKPSDVILSFDGVDIANDGTVPFRHGERIGFSYLISQKYTGDDAAIK  413

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLH-EYGEDWYNTS  527
            VLRN    +F+IKL   + L+P H   K PS++I AG VF  ++ PYL  EYG+D+   +
Sbjct  414  VLRNSNVLKFNIKLDGHRRLIPAHSKGKPPSYYIVAGFVFSTVSVPYLRSEYGKDYEYEA  473

Query  526  PRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKL  347
            P ++ E+ L  +P  P EQLV++SQVL+ DIN GYE +   QV   NG  V+NLK L  +
Sbjct  474  PVKILEKLLYAMPQSPDEQLVVVSQVLVADINIGYEDIVNTQVVAFNGKPVKNLKSLAAM  533

Query  346  VEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  206
            VE    E ++FDLD E+++VL    AK AT  IL  H IP AMS DL
Sbjct  534  VESCDDEYLKFDLDYEQIVVLRTKTAKAATLDILTTHCIPSAMSDDL  580



>gb|EFA82977.1| hypothetical protein PPL_03755 [Polysphondylium pallidum PN500]
Length=566

 Score =   187 bits (474),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 97/226 (43%), Positives = 144/226 (64%), Gaps = 3/226 (1%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            V+++HPLS A  +LRK+DII   +G+AIANDG++ FR RERIT+++L+S     +   + 
Sbjct  338  VNELHPLSAAKDILRKNDIITHINGVAIANDGSIAFRRRERITYEYLLSSHFIGDKINVT  397

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSP  524
            V R G+  + S+ L P   +VP   +DK PS+F +AG VF P+T P+L E  ED   T  
Sbjct  398  VFREGQSMDLSVPLVPQHRMVPYQTYDKRPSYFCYAGFVFTPVTHPFLTEIAEDLALTY-  456

Query  523  RRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLV  344
            RR+ E+  R   T P  Q+V++SQ+L+D IN GY      +V KVNG  + NL HL +L+
Sbjct  457  RRVFEKIERI--TSPSSQVVVISQILIDKINHGYSSFGFSEVKKVNGTPIRNLAHLVQLI  514

Query  343  EDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  206
            E+ +K  +   L++E +I+L+ + AK AT RI+K+H IP   S +L
Sbjct  515  EETTKPHVVITLENEYLIILDKEEAKEATIRIMKQHAIPSDRSEEL  560



>ref|XP_002968921.1| hypothetical protein SELMODRAFT_90340 [Selaginella moellendorffii]
 gb|EFJ30037.1| hypothetical protein SELMODRAFT_90340 [Selaginella moellendorffii]
Length=558

 Score =   186 bits (473),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 99/227 (44%), Positives = 145/227 (64%), Gaps = 1/227 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            + ++ P + A + LR  DI+LSFDG+ IANDGTV FR+ ERI F +LVS K   + A ++
Sbjct  330  IRRVEPTAPAARHLRSSDILLSFDGVDIANDGTVPFRSGERIGFTYLVSQKYTGQRARVR  389

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLH-EYGEDWYNTS  527
            VLR+G+  E ++++   K LVP H   + PS++I AG+VF  ++ PYL  EYG+D+   +
Sbjct  390  VLRSGQIIENAVEVTIPKRLVPAHNKGRPPSYYIVAGIVFAAVSVPYLRSEYGKDYDYDA  449

Query  526  PRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKL  347
            P +L ++ +        EQLV++SQVL  D N GYE +   Q+   NG  V NLKHL  +
Sbjct  450  PVKLLDKLMHNFAQTEDEQLVVISQVLAADANIGYEDIVNTQIIAFNGTAVRNLKHLAHM  509

Query  346  VEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  206
            V++ +   +RFDL+ +++IVL+  +AK AT  IL  H IP AMS DL
Sbjct  510  VDNCNDGFMRFDLEYQQMIVLDAQVAKSATPEILSMHCIPSAMSDDL  556



>ref|XP_010037587.1| PREDICTED: protease Do-like 9 [Eucalyptus grandis]
Length=579

 Score =   187 bits (474),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 103/227 (45%), Positives = 145/227 (64%), Gaps = 3/227 (1%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            + +I P S    VL+  DIILSFDG+ IANDGTV  R+ ERI F +LVS K   +T+V+K
Sbjct  353  IRRIDPTSPESAVLKPSDIILSFDGVDIANDGTVPSRHGERIGFSYLVSQKYTGDTSVIK  412

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTS  527
            VLR+ +   F +KL   K ++P+H   + PS++I AG VF  ++ PYL  EY ++  + +
Sbjct  413  VLRDSKIFIFDVKLGMHKRVIPLHSEGRPPSYYIIAGFVFSTISVPYLRSEYKDE--SEA  470

Query  526  PRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKL  347
            P +L ++ L  +P  P EQLV++SQVL  DIN GYE +    V   NG  VENLK L  +
Sbjct  471  PVKLLDKLLHSMPQSPDEQLVVVSQVLAGDINVGYEDIVNTPVLAFNGKPVENLKSLASM  530

Query  346  VEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  206
            VE   +E ++FDL+ ++++VL  + A+ AT  ILK H IP AMS DL
Sbjct  531  VESCEEEFLKFDLEYQQIVVLRTETARAATLDILKTHCIPSAMSDDL  577



>ref|XP_009609751.1| PREDICTED: protease Do-like 9 [Nicotiana tomentosiformis]
Length=577

 Score =   187 bits (474),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 104/228 (46%), Positives = 143/228 (63%), Gaps = 2/228 (1%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            + +I P +    +L   D++LSFDG+ IANDGTV FR+ ERI F +LVS K   ++A +K
Sbjct  348  IRRIDPTAPESMLLMPSDVLLSFDGVDIANDGTVPFRHGERIGFSYLVSQKYSGDSAAVK  407

Query  703  VLR-NGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLH-EYGEDWYNT  530
            VLR N E   F IKL     LVP H   + PS++I AG VF  ++ PYL  EYG+D+   
Sbjct  408  VLRRNSEILNFKIKLATQMRLVPAHNKGRPPSYYIVAGFVFTTVSVPYLRSEYGKDYEYE  467

Query  529  SPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRK  350
            +P +L ++ L +    P EQ+V++SQVL+ DIN GYE +   QV   NG  V+NLK L  
Sbjct  468  APVKLLDKLLHEFRQSPDEQIVVVSQVLVADINIGYEEIVNTQVLAFNGKPVKNLKSLAS  527

Query  349  LVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  206
            +VE+ + E ++ DL+ ++V+VL    AK ATS IL  H IP AMS DL
Sbjct  528  MVENCNDEFLKLDLEYQQVVVLQTKTAKSATSDILTTHCIPSAMSEDL  575



>gb|EMS45662.1| Protease Do-like 9 [Triticum urartu]
Length=510

 Score =   185 bits (470),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 109/227 (48%), Positives = 147/227 (65%), Gaps = 1/227 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            + +I P +     ++  DIILSFDGI IANDGTV FR+ ERI F +LVS K   E A +K
Sbjct  282  IRRIEPTAPESGCMQPSDIILSFDGIDIANDGTVPFRHGERIGFSYLVSQKYTGEKARVK  341

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLH-EYGEDWYNTS  527
            VLR+ + HEF+IKL   K L+P H   + PS++I AG VF+ ++ PYL  EYG+D+   +
Sbjct  342  VLRSSKIHEFNIKLSIHKKLIPAHIKGRPPSYYIVAGFVFMVVSVPYLRSEYGKDYEFDA  401

Query  526  PRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKL  347
            P +L ++ L  +   P EQLV++SQVL+ DIN GYE L   QV   NG  V NLK L  +
Sbjct  402  PVKLLDKHLHAMAQSPDEQLVVVSQVLVADINIGYEELVNTQVRAFNGKPVNNLKQLATM  461

Query  346  VEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  206
            VED ++E ++FD+D ++V+VL    A+ AT  IL  H IP AMS DL
Sbjct  462  VEDCNEEFLKFDMDYDQVVVLETKTARAATQDILTTHCIPSAMSDDL  508



>gb|KHN18478.1| Protease Do-like 9 [Glycine soja]
Length=464

 Score =   184 bits (467),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 107/227 (47%), Positives = 145/227 (64%), Gaps = 1/227 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            + +I P +   KVL+  D+ILSFDG+ IANDGTV FR+ ERI F +L+S K   + A +K
Sbjct  236  IRRIDPTAPESKVLKPSDVILSFDGVDIANDGTVPFRHGERIGFSYLISQKYTGDNAAIK  295

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTS  527
            VLRN +  +F IKL   + L+P H   K PS++I AG VF  ++ PYL  EYG+D+   +
Sbjct  296  VLRNSDILKFDIKLDSHRRLIPAHSKGKPPSYYIIAGFVFTTVSVPYLRSEYGKDYEYEA  355

Query  526  PRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKL  347
            P +L ++ L  +P  P EQLV++SQVL+ DIN GYE     QV   NG  V+NLK L  +
Sbjct  356  PVKLLDKLLHSMPQSPDEQLVVVSQVLVADINIGYEDFVNTQVLAFNGQPVKNLKSLATM  415

Query  346  VEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  206
            VE  + E ++FDLD ++++VL    AK AT  IL  H IP AMS DL
Sbjct  416  VESCNDEYLKFDLDYDQIVVLRTKTAKAATLDILSTHCIPSAMSDDL  462



>dbj|BAJ90442.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=601

 Score =   186 bits (472),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 109/227 (48%), Positives = 147/227 (65%), Gaps = 1/227 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            + +I P +     ++  DIILSFDGI IANDGTV FR+ ERI F +LVS K   E A +K
Sbjct  373  IRRIEPTAPESGCMQPSDIILSFDGIEIANDGTVPFRHGERIGFSYLVSQKYTGEKARVK  432

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLH-EYGEDWYNTS  527
            VLR+ + HEF+IKL   K L+P H   + PS++I AG VF+ ++ PYL  EYG+D+   +
Sbjct  433  VLRSSKIHEFNIKLSIHKKLIPAHIKGRPPSYYIVAGFVFMVVSVPYLRSEYGKDYEFDA  492

Query  526  PRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKL  347
            P +L ++ L  +   P EQLV++SQVL+ DIN GYE +   QV   NG  V NLK L  +
Sbjct  493  PVKLLDKHLHAMAQSPDEQLVVVSQVLVADINIGYEEIVNTQVRAFNGKPVNNLKQLATM  552

Query  346  VEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  206
            VED +KE ++FD+D ++V+VL    A+ AT  IL  H IP AMS DL
Sbjct  553  VEDCNKEFLKFDMDYDQVVVLETKTARAATQDILTTHCIPSAMSDDL  599



>ref|XP_008659079.1| PREDICTED: protease Do-like 9 [Zea mays]
 gb|AFW85217.1| hypothetical protein ZEAMMB73_653756 [Zea mays]
Length=249

 Score =   178 bits (451),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 106/227 (47%), Positives = 144/227 (63%), Gaps = 1/227 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            V ++ P +     L+  DI+LSFDGI IANDGTV FR  ERI F +LVS K   E A +K
Sbjct  21   VRRVEPTAPETGCLQPSDIVLSFDGIDIANDGTVPFRRGERIGFSYLVSQKYTGEKARVK  80

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLH-EYGEDWYNTS  527
            VL N   HEF+IKL   K L+P H   + PS++I AG VF+ ++ PYL  EYG+D+   +
Sbjct  81   VLPNSNVHEFNIKLAINKRLIPAHIKGRPPSYYIVAGFVFMVVSVPYLRSEYGKDYEYDA  140

Query  526  PRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKL  347
            P +L ++ L  +     EQLV++SQVL+ DIN GYE +  +QV   NG  V NLKHL  +
Sbjct  141  PVKLLDKHLHAMAQSSDEQLVVVSQVLVADINIGYEDIVNIQVLAFNGTPVTNLKHLATM  200

Query  346  VEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  206
            VE+ ++  ++FDLD ++V+VL    AK AT  I+  H IP A+S DL
Sbjct  201  VEECNEAFLKFDLDHDQVVVLETKTAKAATQDIVTTHCIPSAVSEDL  247



>ref|XP_002989968.1| hypothetical protein SELMODRAFT_130891 [Selaginella moellendorffii]
 gb|EFJ08981.1| hypothetical protein SELMODRAFT_130891 [Selaginella moellendorffii]
Length=558

 Score =   185 bits (470),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 98/227 (43%), Positives = 144/227 (63%), Gaps = 1/227 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            + ++ P + A + LR  DI+LSFDG+ IANDGTV FR+ ERI F +LVS K   + A ++
Sbjct  330  IRRVEPTAPAARHLRSSDILLSFDGVDIANDGTVPFRSGERIGFTYLVSQKYTGQRARVR  389

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLH-EYGEDWYNTS  527
            VLR+G+  E ++++   K LVP H   + PS++I AG+VF  ++ PYL  EYG+D+   +
Sbjct  390  VLRSGQIIENAVEVTIPKRLVPAHNKGRPPSYYIVAGIVFAAVSVPYLRSEYGKDYDYDA  449

Query  526  PRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKL  347
            P +L ++ +        EQLV++SQVL  D N GYE +   Q+   NG  V NLKHL  +
Sbjct  450  PVKLLDKLMHNFAQTEDEQLVVISQVLAADANIGYEDIVNTQIIAFNGTAVRNLKHLAHM  509

Query  346  VEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  206
            V++ +   +RFDL+ +++IVL+  +AK AT  IL  H IP  MS DL
Sbjct  510  VDNCNDGFMRFDLEYQQMIVLDAQVAKSATPEILSMHCIPSGMSDDL  556



>ref|XP_011402326.1| Protease Do-like 9 [Auxenochlorella protothecoides]
 gb|KFM29273.1| Protease Do-like 9 [Auxenochlorella protothecoides]
Length=542

 Score =   185 bits (469),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 99/227 (44%), Positives = 147/227 (65%), Gaps = 1/227 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            V ++ PLS+A  VL+  D+++ FD   IANDGTV FR+ ERI +  L S K   + A L+
Sbjct  302  VREVLPLSEAAGVLQPGDVLMQFDQTQIANDGTVGFRSNERIAYSFLTSQKFTGDVASLR  361

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTS  527
            VLR G++ +  IKL     LVP H F+K PS+F+ AGLVF  LT+PYL  E+G D+   +
Sbjct  362  VLREGKELDLCIKLMRPDFLVPHHLFNKDPSYFVVAGLVFTNLTEPYLASEFGPDYLREA  421

Query  526  PRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKL  347
            P +L +R L     +PG+Q+V+L+QVL  +   GYE ++  QV K N V+V +L+HL +L
Sbjct  422  PVKLLDRLLYTHKDRPGQQVVMLNQVLACEATIGYEDISNSQVAKFNDVKVNSLQHLVEL  481

Query  346  VEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  206
            V++N +  +RF+L+ + V+VL+  LA+  T  +   H IP+A+S DL
Sbjct  482  VQENREPFMRFNLESKEVLVLDASLAQACTEEMQVFHSIPHALSKDL  528



>gb|KIZ00510.1| hypothetical protein MNEG_7454 [Monoraphidium neglectum]
Length=605

 Score =   186 bits (472),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 96/227 (42%), Positives = 144/227 (63%), Gaps = 1/227 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            + +++  S A  VL+ DD++LSFDG AIANDGTV FR  ERI F +L+S K   + A L+
Sbjct  347  IRRVNATSHAASVLQSDDVLLSFDGTAIANDGTVPFRTGERIAFSYLISQKYVGDEAALE  406

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLH-EYGEDWYNTS  527
            VLR GE    + KL     LVP H  ++ PS+F+ +GLVF+  ++PYL  EYG D+ + +
Sbjct  407  VLRGGEVLSTTAKLSKPAALVPPHLGNRDPSYFLVSGLVFVACSEPYLESEYGADYASEA  466

Query  526  PRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKL  347
            P +L ++     PT+PG+Q+V+LSQVL  +   GYE +  ++V  +NG  V NL HL +L
Sbjct  467  PVKLLDKLYHGQPTEPGQQVVVLSQVLAAESTLGYEDVLNVEVLAINGAPVRNLAHLAEL  526

Query  346  VEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  206
            V    ++ +RFD +    +VL+ + A   T+ +L+ H IP A+S+DL
Sbjct  527  VAGCREQYLRFDCEYREAVVLDREEAFRDTAAVLEAHGIPAALSADL  573



>ref|NP_001057235.1| Os06g0234100 [Oryza sativa Japonica Group]
 dbj|BAD37774.1| putative DegP2 protease [Oryza sativa Japonica Group]
 dbj|BAD37915.1| putative DegP2 protease [Oryza sativa Japonica Group]
 dbj|BAF19149.1| Os06g0234100 [Oryza sativa Japonica Group]
 dbj|BAG99912.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC80287.1| hypothetical protein OsI_22290 [Oryza sativa Indica Group]
 gb|EEE65395.1| hypothetical protein OsJ_20719 [Oryza sativa Japonica Group]
Length=628

 Score =   186 bits (471),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 108/227 (48%), Positives = 149/227 (66%), Gaps = 1/227 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            V ++ P +     L+  DIILSFDGI IANDGTV FR+ ERI F +L+S K   E A +K
Sbjct  400  VRRVEPTAPESGCLQPSDIILSFDGIDIANDGTVPFRHGERIGFSYLISQKYTGEKAHVK  459

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLH-EYGEDWYNTS  527
            +LRN +  EF+IKL   K L+P H   + PS++I AG VF+ ++ PYL  EYG+D+   +
Sbjct  460  ILRNSKVLEFNIKLATHKRLIPAHIKGRPPSYYIVAGFVFMVVSVPYLRSEYGKDYEYDA  519

Query  526  PRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKL  347
            P +L ++ L  +   P EQLV++SQVL+ DIN GYE +  +QV   NG  V+NLKHL  +
Sbjct  520  PVKLLDKHLHAMAQSPDEQLVVVSQVLVADINIGYEEIVNIQVLSFNGKPVKNLKHLATM  579

Query  346  VEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  206
            VED ++E ++FD+D ++++VL    AK AT  IL  H IP AMS DL
Sbjct  580  VEDCNEEYLKFDMDYDQLVVLEAKTAKAATQDILTTHCIPSAMSEDL  626



>ref|XP_007514393.1| predicted protein [Bathycoccus prasinos]
 emb|CCO15830.1| predicted protein [Bathycoccus prasinos]
Length=555

 Score =   184 bits (468),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 102/228 (45%), Positives = 147/228 (64%), Gaps = 2/228 (1%)
 Frame = -2

Query  877  KIHPLSDAYKV-LRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLKV  701
            K+ P+S++ K  L+  D++ +FDG+A+A+DGTV FR  ERI+F HLVS K   E A +++
Sbjct  328  KLEPISNSAKSGLKTGDVLQNFDGVAVASDGTVPFRAGERISFSHLVSKKFVGENAEIEI  387

Query  700  LRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTSP  524
            LR+G+  +FS+ +   K LVPVH   K P +FI AGLVF  ++ PYL  E+G+DW   +P
Sbjct  388  LRDGKPMKFSVPMENKKRLVPVHMEGKTPEYFIIAGLVFTTVSCPYLKSEFGKDWEYDAP  447

Query  523  RRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLV  344
             +L  R   K  T+P ++LVI SQVL  +IN GYE  + L V K NG  ++NLK L  LV
Sbjct  448  VQLLSRMYLKDMTEPDQELVICSQVLAHEINIGYEDFSNLAVEKFNGKPIKNLKQLVDLV  507

Query  343  EDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLIN  200
            E  S+E + F+LD + ++VL+ + AK +T  IL  H IP   S +L +
Sbjct  508  ESCSEEYLTFELDMKTLVVLDNEKAKQSTREILDVHAIPSDKSKNLFS  555



>gb|KHF97497.1| Protease Do-like 9 [Gossypium arboreum]
Length=249

 Score =   177 bits (449),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 101/227 (44%), Positives = 147/227 (65%), Gaps = 1/227 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            + ++ P +    VL+  DI+LSFDG+ IANDGTV FR+ ERI F +LVS K   +++ +K
Sbjct  21   IRRVDPTAPESGVLKSSDIVLSFDGVDIANDGTVPFRHGERIGFSYLVSQKYAGDSSAIK  80

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLH-EYGEDWYNTS  527
            VLR+     F+IKL   + L+P H   + PS++I AG VF  ++ PYL  EYG+D+   +
Sbjct  81   VLRSSAILNFNIKLTSHRRLIPAHNKGRPPSYYIIAGFVFTTVSVPYLRSEYGKDYEYEA  140

Query  526  PRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKL  347
            P +L ++ L  +P  P EQLV++SQVL+ DIN GYE +   QV  +NG  ++NL+ L ++
Sbjct  141  PVKLLDKLLHSMPQSPDEQLVVVSQVLVSDINIGYEDIVNTQVLALNGKPMKNLRRLAEM  200

Query  346  VEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  206
            VE+   E ++FDL+ E+++VL    AK AT  IL  H IP AMS DL
Sbjct  201  VENCDDEFLKFDLEYEQIVVLRTKTAKAATPDILATHCIPSAMSVDL  247



>ref|XP_003525265.1| PREDICTED: protease Do-like 9-like [Glycine max]
Length=584

 Score =   185 bits (469),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 107/227 (47%), Positives = 146/227 (64%), Gaps = 1/227 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            + +I P +   KVL+  D+ILSFDG+ IANDGTV FR+ ERI F +L+S K   + A +K
Sbjct  356  IRRIDPTAPESKVLKPSDVILSFDGVDIANDGTVPFRHGERIGFSYLISQKYTGDNAAIK  415

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLH-EYGEDWYNTS  527
            VLRN +  +F IKL   + L+P H   K PS++I AG VF  ++ PYL  EYG+D+   +
Sbjct  416  VLRNSDIFKFDIKLDSHRRLIPAHSKGKPPSYYIIAGFVFTTVSVPYLRSEYGKDYEYEA  475

Query  526  PRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKL  347
            P +L ++ L  +P  P EQLV++SQVL+ DIN GYE +   QV   NG  V+NLK L  +
Sbjct  476  PVKLLDKLLHSMPQSPDEQLVVVSQVLVADINIGYEDIVNTQVLAFNGQPVKNLKSLATM  535

Query  346  VEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  206
            VE  + E ++FDLD ++++VL    AK AT  IL  H IP AMS DL
Sbjct  536  VESCNDEYLKFDLDYDQIVVLRMKTAKAATLDILATHCIPSAMSDDL  582



>ref|XP_008239730.1| PREDICTED: protease Do-like 9 [Prunus mume]
Length=587

 Score =   185 bits (469),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 108/227 (48%), Positives = 149/227 (66%), Gaps = 1/227 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            + +I P +   +VL+  DIILSFDG+ IANDGTV FR+ ERI F +L+S K   + +V+K
Sbjct  359  IRRIDPTAPESQVLKPSDIILSFDGVNIANDGTVPFRHGERIGFSYLISQKYTGDNSVVK  418

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLH-EYGEDWYNTS  527
            VLRN E   F IKL   K L+P H   + PS++I AG VF  ++ PYL  EYG+D+   +
Sbjct  419  VLRNSEILSFDIKLASHKRLIPAHNKGRPPSYYIIAGFVFTAVSVPYLRSEYGKDYEFEA  478

Query  526  PRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKL  347
            P +L ++ L  LP  P EQLV++SQVL+ DIN GYE +   QV  +NG  V+NLK+L  +
Sbjct  479  PVKLLDKMLHSLPQSPDEQLVVVSQVLVADINIGYEEIVNTQVLALNGKPVKNLKNLASM  538

Query  346  VEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  206
            VE+   E ++FDL+ ++++VL  + AK AT  IL  H IP AMS DL
Sbjct  539  VEECEDEFLKFDLEYQQMVVLRTNTAKEATLDILATHCIPSAMSDDL  585



>ref|XP_008438126.1| PREDICTED: protease Do-like 9 [Cucumis melo]
Length=586

 Score =   185 bits (469),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 107/227 (47%), Positives = 146/227 (64%), Gaps = 1/227 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            + +I P     KVL+  DIILSFDG+ IANDGTV FR+ ERI F +LVS K   ++A +K
Sbjct  358  IRRIDPTGPESKVLKPADIILSFDGVDIANDGTVPFRHGERIGFSYLVSQKYTGDSAAIK  417

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLH-EYGEDWYNTS  527
            VLRN E   F+ +L   + L+P H   + PS++I AG VF  ++ PYL  EYG+D+   +
Sbjct  418  VLRNSETLSFNYQLATYRRLIPAHNEGRPPSYYIVAGFVFSTVSVPYLRSEYGKDYEYEA  477

Query  526  PRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKL  347
            P +L ++ L  +P  P EQLV++SQVL+ DIN GYE +   QV   NG  V+NLK L  +
Sbjct  478  PVKLLDKLLHSMPQSPDEQLVVVSQVLVADINIGYEDIVNTQVLAFNGKPVKNLKSLANM  537

Query  346  VEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  206
            VE    E ++FDL+ ++++VL    AK ATS IL  H IP AMS+DL
Sbjct  538  VESCDDEFLKFDLEYQQIVVLRTSTAKAATSDILATHCIPSAMSNDL  584



>ref|XP_004152460.1| PREDICTED: protease Do-like 9 [Cucumis sativus]
 gb|KGN64293.1| hypothetical protein Csa_1G045910 [Cucumis sativus]
Length=586

 Score =   184 bits (468),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 107/227 (47%), Positives = 146/227 (64%), Gaps = 1/227 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            + +I P     KVL+  DIILSFDG+ IANDGTV FR+ ERI F +LVS K   ++A +K
Sbjct  358  IRRIDPTGPESKVLKPADIILSFDGVDIANDGTVPFRHGERIGFSYLVSQKYTGDSATIK  417

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLH-EYGEDWYNTS  527
            VLRN E   F+ +L   + L+P H   + PS++I AG VF  ++ PYL  EYG+D+   +
Sbjct  418  VLRNSETLSFNYQLATYRRLIPAHNEGRPPSYYIVAGFVFSTVSVPYLRSEYGKDYEYEA  477

Query  526  PRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKL  347
            P +L ++ L  +P  P EQLV++SQVL+ DIN GYE +   QV   NG  V+NLK L  +
Sbjct  478  PVKLLDKLLHSMPQSPDEQLVVVSQVLVADINIGYEDIVNTQVLAFNGKPVKNLKSLANM  537

Query  346  VEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  206
            VE    E ++FDL+ ++++VL    AK ATS IL  H IP AMS+DL
Sbjct  538  VESCDDEFLKFDLEYQQIVVLRTSTAKAATSDILATHCIPSAMSNDL  584



>ref|XP_010678716.1| PREDICTED: protease Do-like 9 isoform X1 [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010678717.1| PREDICTED: protease Do-like 9 isoform X1 [Beta vulgaris subsp. 
vulgaris]
Length=487

 Score =   183 bits (464),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 100/227 (44%), Positives = 141/227 (62%), Gaps = 3/227 (1%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            V+++   +    VL+  D+ILSFDG+ I NDGTV FR+ ERI F++L+S K   + A +K
Sbjct  257  VTRVEATAPEAVVLQPSDVILSFDGVGIGNDGTVPFRHGERIGFNYLISKKYTGDHAKIK  316

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTS  527
            +LR+   HEF IKL P K L+P    D  PS++IFAG VF  ++ PYL  EY ++  +  
Sbjct  317  LLRDSVMHEFDIKLDPYKKLIPACIKDGPPSYYIFAGFVFTAVSVPYLFSEYSDE--SDV  374

Query  526  PRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKL  347
            P  L  +    +     E+L+I+SQVL+ DIN GYE +  +QV  VNG  V+NLK    +
Sbjct  375  PVELLHKLHHSMADSKDEELLIISQVLVADINIGYENITNVQVTAVNGKPVKNLKSFTSM  434

Query  346  VEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  206
            VE  S+E ++FDL+  + +VL  + AK AT+ IL  H IP AMS DL
Sbjct  435  VESCSEEYLKFDLEFNKKVVLRTETAKAATADILATHCIPSAMSDDL  481



>ref|XP_005704063.1| serine-type endopeptidase isoform 2 [Galdieria sulphuraria]
 gb|EME27543.1| serine-type endopeptidase isoform 2 [Galdieria sulphuraria]
Length=584

 Score =   184 bits (467),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 97/220 (44%), Positives = 138/220 (63%), Gaps = 1/220 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            +++I P S   KVL+K D+I  FDG+ IANDGTV +R  ERI F +L+++K   E+  ++
Sbjct  356  IAQIAPTSPCSKVLQKGDVITHFDGVPIANDGTVSYRGGERINFHYLITLKFVGESCTVR  415

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLH-EYGEDWYNTS  527
            ++RNG   E S  LF L  LVP+H+   +P +   AGLVF+ L++PYL  EYGE W   +
Sbjct  416  IVRNGNIMEVSYPLFELPLLVPIHEKRPVPEYLTVAGLVFVALSEPYLRSEYGEKWDFEA  475

Query  526  PRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKL  347
            P +L ++ L        EQ+VILSQVL   IN GYE L   ++   NG  VENL HL  L
Sbjct  476  PVKLLDKLLYGYKRTANEQVVILSQVLNARINVGYECLTNTELLHFNGTRVENLCHLANL  535

Query  346  VEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIP  227
            +++ S+E +RFDL+ + VIV+    A   +S+IL +H IP
Sbjct  536  IDETSEEFLRFDLEFDEVIVIEKQAALEQSSQILVQHGIP  575



>ref|XP_004252189.1| PREDICTED: protease Do-like 9 [Solanum lycopersicum]
Length=584

 Score =   184 bits (466),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 104/228 (46%), Positives = 140/228 (61%), Gaps = 2/228 (1%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            + +I P +    +L   D+ILSFDG+ IANDGTV FR+ ERI F +LVS K   + A +K
Sbjct  355  IRRIDPTTPESMMLMPSDVILSFDGVDIANDGTVPFRHGERIGFSYLVSQKYSGDYAAVK  414

Query  703  VLR-NGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLH-EYGEDWYNT  530
            VLR N E   F IKL     L+P H   + PS++I AG VF  ++ PYL  EYG+D+   
Sbjct  415  VLRRNSEILNFIIKLATQMRLIPAHNKGRPPSYYIIAGFVFTTVSVPYLRSEYGKDYEYE  474

Query  529  SPRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRK  350
            +  +L ++ L +    P EQ+V++SQVL+ DIN GYE +   QV   NG  V+NLK L  
Sbjct  475  ASVKLLDKLLHEFRQSPDEQIVVVSQVLVADINIGYEEIVNTQVLSFNGEPVKNLKSLAS  534

Query  349  LVEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  206
            +VE    E ++FDL+ ++V+VL    AK ATS IL  H IP AMS DL
Sbjct  535  MVEKCKDEFLKFDLEYQQVVVLQTKTAKSATSDILTTHCIPSAMSEDL  582



>ref|XP_003550747.1| PREDICTED: protease Do-like 9-like [Glycine max]
Length=576

 Score =   183 bits (465),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 107/227 (47%), Positives = 145/227 (64%), Gaps = 1/227 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            + +I P +   KVL+  D+ILSFDG+ IANDGTV FR+ ERI F +L+S K   + A +K
Sbjct  348  IRRIDPTAPESKVLKPSDVILSFDGVDIANDGTVPFRHGERIGFSYLISQKYTGDNAAIK  407

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLH-EYGEDWYNTS  527
            VLRN +  +F IKL   + L+P H   K PS++I AG VF  ++ PYL  EYG+D+   +
Sbjct  408  VLRNSDILKFDIKLDSHRRLIPAHSKGKPPSYYIIAGFVFTTVSVPYLRSEYGKDYEYEA  467

Query  526  PRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKL  347
            P +L ++ L  +P  P EQLV++SQVL+ DIN GYE     QV   NG  V+NLK L  +
Sbjct  468  PVKLLDKLLHSMPQSPDEQLVVVSQVLVADINIGYEDFVNTQVLAFNGQPVKNLKSLATM  527

Query  346  VEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  206
            VE  + E ++FDLD ++++VL    AK AT  IL  H IP AMS DL
Sbjct  528  VESCNDEYLKFDLDYDQIVVLRTKTAKAATLDILSTHCIPSAMSDDL  574



>ref|XP_010272002.1| PREDICTED: protease Do-like 9 [Nelumbo nucifera]
Length=551

 Score =   183 bits (464),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 102/227 (45%), Positives = 139/227 (61%), Gaps = 1/227 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            V +I P S   +VL+  D+ILSFDG  I ND TV FRN E I F +LVS K   E AV+K
Sbjct  323  VRRIEPTSPLSQVLKPSDVILSFDGTDITNDETVSFRNGEHIGFSYLVSQKFMGENAVIK  382

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTS  527
            VLRN E  EF+I L   K L+P H   + P ++I AG VF  ++  YL  EYG+D+   +
Sbjct  383  VLRNSETFEFNIMLASHKRLIPAHIKGRPPPYYIIAGFVFTTVSVLYLRSEYGKDYECDA  442

Query  526  PRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKL  347
            P +L ++ L  +     E+LV++SQVL+ DIN GYE +   QV   NG  V+NLK L  +
Sbjct  443  PVKLLDKHLHAMAQSEDEELVVVSQVLVADINIGYENIVNTQVLACNGNPVKNLKSLASM  502

Query  346  VEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  206
            VE+   + ++F+L+ ++++VL    AK AT  IL  H IP AMS DL
Sbjct  503  VENCDDQFLKFELEYQQLVVLQTKTAKAATLDILTTHCIPSAMSDDL  549



>ref|XP_005704064.1| serine-type endopeptidase isoform 1 [Galdieria sulphuraria]
 gb|EME27544.1| serine-type endopeptidase isoform 1 [Galdieria sulphuraria]
Length=569

 Score =   183 bits (465),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 97/220 (44%), Positives = 137/220 (62%), Gaps = 1/220 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            + +I P S   KVL+K D+I  FDG+ IANDGTV +R  ERI F +L+++K   E+  ++
Sbjct  341  IKRIAPTSPCSKVLQKGDVITHFDGVPIANDGTVSYRGGERINFHYLITLKFVGESCTVR  400

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLH-EYGEDWYNTS  527
            ++RNG   E S  LF L  LVP+H+   +P +   AGLVF+ L++PYL  EYGE W   +
Sbjct  401  IVRNGNIMEVSYPLFELPLLVPIHEKRPVPEYLTVAGLVFVALSEPYLRSEYGEKWDFEA  460

Query  526  PRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKL  347
            P +L ++ L        EQ+VILSQVL   IN GYE L   ++   NG  VENL HL  L
Sbjct  461  PVKLLDKLLYGYKRTANEQVVILSQVLNARINVGYECLTNTELLHFNGTRVENLCHLANL  520

Query  346  VEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIP  227
            +++ S+E +RFDL+ + VIV+    A   +S+IL +H IP
Sbjct  521  IDETSEEFLRFDLEFDEVIVIEKQAALEQSSQILVQHGIP  560



>gb|EEE57793.1| hypothetical protein OsJ_08344 [Oryza sativa Japonica Group]
Length=440

 Score =   181 bits (458),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 109/227 (48%), Positives = 144/227 (63%), Gaps = 1/227 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            V ++ P +     L+  DIILSFDGI IANDGTV FR+ ERI F +LVS K   E A++K
Sbjct  212  VRRVEPTAPESGCLQPSDIILSFDGIDIANDGTVPFRHGERIGFSYLVSQKYTGEKALVK  271

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLH-EYGEDWYNTS  527
            VLRN + HEF IKL   K LV  H   + PS++I AG VF  ++ PYL  EYG+D+   +
Sbjct  272  VLRNSKVHEFKIKLATHKRLVAAHVKGRPPSYYIVAGFVFAAVSVPYLRSEYGKDYEYDA  331

Query  526  PRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKL  347
            P +L  + L  +   P EQLV++SQVL+ DIN GYE +   QV   NG  V+NLK+L  +
Sbjct  332  PVKLLVKHLHAMAQSPDEQLVVVSQVLVADINIGYEEIVNTQVLAFNGQPVKNLKNLVSM  391

Query  346  VEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  206
            VE+   E ++FDL+ ++++VL    AK AT  IL  H IP AMS DL
Sbjct  392  VENCKDEFLKFDLEYDQIVVLETKTAKAATQDILTTHCIPSAMSDDL  438



>ref|XP_003564034.1| PREDICTED: protease Do-like 9 [Brachypodium distachyon]
Length=599

 Score =   182 bits (463),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 109/227 (48%), Positives = 145/227 (64%), Gaps = 1/227 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            + +I P +     ++  DIILSFDGI IANDGTV FR+ ERI F +LVS K   E A +K
Sbjct  371  IRRIEPTAPESGCMQPSDIILSFDGIDIANDGTVPFRHGERIGFSYLVSQKYTGEKAHVK  430

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLH-EYGEDWYNTS  527
            VLR+ + HEF IKL   K L+P H   + PS++I AG VF+ ++ P+L  EYG+D+   +
Sbjct  431  VLRSSKIHEFKIKLAIHKKLIPAHIKGRPPSYYIVAGFVFMVVSVPFLRSEYGKDYEFDA  490

Query  526  PRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKL  347
            P +L ++ L  +   P EQLV++SQVL+ DIN GYE L   QV   NG  V NLK L  +
Sbjct  491  PVKLLDKHLHAMAQSPDEQLVVVSQVLVADINIGYEELVNTQVLAFNGKPVNNLKQLATM  550

Query  346  VEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  206
            VED  +E ++FD+D ++V+VL    AK AT  IL  H IP AMS DL
Sbjct  551  VEDCKEEFLKFDMDYDQVVVLETKTAKAATQDILATHCIPSAMSDDL  597



>ref|XP_010227815.1| PREDICTED: protease Do-like 9, partial [Brachypodium distachyon]
Length=473

 Score =   180 bits (457),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 107/226 (47%), Positives = 143/226 (63%), Gaps = 1/226 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            + +I P +     ++  DIILSFDGI IANDGTV FR+ ERI F +LVS K   E A +K
Sbjct  245  IRRIEPTAPESGCMQPSDIILSFDGIDIANDGTVPFRHGERIGFSYLVSQKYTGEKAHVK  304

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLH-EYGEDWYNTS  527
            VLR+ + HEF IKL   K L+P H   + PS++I AG VF+ ++ P+L  EYG+D+   +
Sbjct  305  VLRSSKIHEFKIKLAIHKKLIPAHIKGRPPSYYIVAGFVFMVVSVPFLRAEYGKDYEFDA  364

Query  526  PRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKL  347
            P +L ++ L  +   P EQLV++SQVL+ DIN GYE L   QV   NG  V NLK L  +
Sbjct  365  PVKLLDKHLHAMAQSPDEQLVVVSQVLVADINIGYEELVNTQVLAFNGKPVNNLKQLATM  424

Query  346  VEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSD  209
            VED  +E ++FD+D ++V+VL    AK AT  IL  H IP  MS D
Sbjct  425  VEDCKEELLKFDMDYDQVVVLETKTAKAATQDILATHCIPSVMSDD  470



>ref|XP_004965071.1| PREDICTED: protease Do-like 9-like [Setaria italica]
Length=604

 Score =   182 bits (462),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 108/227 (48%), Positives = 146/227 (64%), Gaps = 1/227 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            V ++ P +     L   DIILSFDGI IANDGTV FR+ ERI F +LVS K   E A +K
Sbjct  376  VRRVEPTAPESGCLHPSDIILSFDGIDIANDGTVPFRHGERIGFSYLVSQKYTGEKARVK  435

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLH-EYGEDWYNTS  527
            +LRN + HEF+IKL   K L+P H   + PS++I AG VF  ++ PYL  EYG+D+   +
Sbjct  436  LLRNSKIHEFNIKLATHKRLIPAHIKGRPPSYYIVAGFVFTVVSVPYLRSEYGKDYEYDA  495

Query  526  PRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKL  347
            P +L ++    +   P EQLV++SQVL+ DIN GYE +  +QV   NG  V+NLKHL  +
Sbjct  496  PVKLLDKHSHAMAQSPDEQLVVVSQVLVSDINIGYEDIVNIQVLAFNGTPVKNLKHLATM  555

Query  346  VEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  206
            VE+ ++  ++FDLD ++++VL    AK AT  IL  H IP AMS DL
Sbjct  556  VEECNEAFLKFDLDYDQLVVLETKTAKAATQDILTTHCIPSAMSEDL  602



>ref|XP_001774430.1| predicted protein [Physcomitrella patens]
 gb|EDQ60793.1| predicted protein [Physcomitrella patens]
Length=467

 Score =   179 bits (455),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 106/227 (47%), Positives = 142/227 (63%), Gaps = 1/227 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            + ++ P + A+  LR  DI++SFDGI IANDGTV FR+ ERI F +LVS K   E A +K
Sbjct  237  IRRVEPTAPAFAQLRASDILMSFDGIDIANDGTVPFRHGERIGFSYLVSKKYSGECAKVK  296

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLH-EYGEDWYNTS  527
            +LR+G+  EF I L   K LVP H   K PS++I AG+VF  ++ PYL  EYG+D+   +
Sbjct  297  ILRDGKSKEFDIDLVNHKRLVPAHIKGKPPSYYILAGIVFAAISVPYLRSEYGKDYDYDA  356

Query  526  PRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKL  347
            P +L ++ L  +     EQLV++SQVL+ DIN GYE +   QV   N   V NLKHL  L
Sbjct  357  PVKLLDKLLHSMSQSEDEQLVVVSQVLVADINIGYEDIVNTQVVAFNDTPVRNLKHLANL  416

Query  346  VEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  206
            VE  +   +RF LD +++++L    AK AT  IL  H IP AMS DL
Sbjct  417  VEKCTDPFLRFGLDYQQIVILETQTAKAATPEILATHCIPSAMSHDL  463



>ref|XP_010678718.1| PREDICTED: protease Do-like 9 isoform X2 [Beta vulgaris subsp. 
vulgaris]
Length=486

 Score =   180 bits (456),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 101/227 (44%), Positives = 141/227 (62%), Gaps = 4/227 (2%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            V+++   +    VL+  D+ILSFDG+ I NDGTV FR+ ERI F++L+S K   + A +K
Sbjct  257  VTRVEATAPEAVVLQPSDVILSFDGVGIGNDGTVPFRHGERIGFNYLISKKYTGDHAKIK  316

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTS  527
            +LR+   HEF IKL P K L+P    D  PS++IFAG VF  ++ PYL  EY ++  +  
Sbjct  317  LLRDSVMHEFDIKLDPYKKLIPACIKDGPPSYYIFAGFVFTAVSVPYLFSEYSDE--SDV  374

Query  526  PRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKL  347
            P  L  +    +     E+L+I+SQVL+ DIN GYE +  +QV  VNG  V+NLK    +
Sbjct  375  PVELLHKLHHSMADSKDEELLIISQVLVADINIGYENITNVQVTAVNGKPVKNLKSFTSM  434

Query  346  VEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  206
            VE  S+E ++FDL+  +V VL  + AK AT+ IL  H IP AMS DL
Sbjct  435  VESCSEEYLKFDLEFNKV-VLRTETAKAATADILATHCIPSAMSDDL  480



>gb|KCW54110.1| hypothetical protein EUGRSUZ_I000922, partial [Eucalyptus grandis]
Length=153

 Score =   171 bits (432),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 85/151 (56%), Positives = 108/151 (72%), Gaps = 2/151 (1%)
 Frame = -2

Query  655  LKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRKLPTKPG  476
            L+PLVPVHQFDK PS++IF GL+F  LTQPYLHEY  D Y+  PRRLC+ A R       
Sbjct  1    LQPLVPVHQFDKHPSYYIFGGLIFTSLTQPYLHEYA-DRYSVWPRRLCQLAQRT-SKNAD  58

Query  475  EQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERIRFDLDDER  296
            +++VI+S VL+DDI  GY  LA LQV KVN ++++NL+HL + +E  +   IRFDLD+ER
Sbjct  59   QEIVIISMVLMDDITEGYGNLAALQVRKVNEIDIQNLRHLYEFLEHCTATSIRFDLDEER  118

Query  295  VIVLNYDLAKVATSRILKRHRIPYAMSSDLI  203
            VIV  Y  AK+ATS IL R+ IP   S+DLI
Sbjct  119  VIVFKYREAKIATSTILTRYNIPSIASADLI  149



>ref|XP_007155398.1| hypothetical protein PHAVU_003G198000g [Phaseolus vulgaris]
 gb|ESW27392.1| hypothetical protein PHAVU_003G198000g [Phaseolus vulgaris]
Length=588

 Score =   181 bits (460),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 108/227 (48%), Positives = 145/227 (64%), Gaps = 1/227 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            + +I P +   KVL   D+ILSFDGI IANDGTV FR+ ERI F +L+S K   + A +K
Sbjct  360  IRRIDPTAPESKVLEPSDVILSFDGIDIANDGTVPFRHGERIGFSYLISQKYTGDNAAIK  419

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLH-EYGEDWYNTS  527
            VLRN +  +F IKL   + L+P H   K PS++I AG VF  ++ PYL  EYG+D+   +
Sbjct  420  VLRNPDILKFDIKLDSHRRLIPSHSKGKPPSYYIIAGFVFTTVSVPYLRSEYGKDYEYEA  479

Query  526  PRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKL  347
            P +L ++ L  LP  P EQLV++SQVL+ DIN GYE +  +QV   NG  V+NLK L  +
Sbjct  480  PVKLLDKLLHSLPQSPDEQLVVVSQVLVADINIGYEDIVNIQVLAFNGKPVKNLKSLATM  539

Query  346  VEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  206
            VE  + E ++FDLD ++++VL    AK  T  IL  H IP AMS DL
Sbjct  540  VESCNDEYLKFDLDYDQIVVLRSKTAKATTLDILATHCIPSAMSDDL  586



>ref|XP_007036141.1| Protease Do-like 9 isoform 1 [Theobroma cacao]
 ref|XP_007036142.1| Protease Do-like 9 isoform 1 [Theobroma cacao]
 ref|XP_007036143.1| Protease Do-like 9 isoform 1 [Theobroma cacao]
 ref|XP_007036144.1| Protease Do-like 9 isoform 1 [Theobroma cacao]
 ref|XP_007036145.1| Protease Do-like 9 isoform 1 [Theobroma cacao]
 ref|XP_007036146.1| Protease Do-like 9 isoform 1 [Theobroma cacao]
 gb|EOY20642.1| Protease Do-like 9 isoform 1 [Theobroma cacao]
 gb|EOY20643.1| Protease Do-like 9 isoform 1 [Theobroma cacao]
 gb|EOY20644.1| Protease Do-like 9 isoform 1 [Theobroma cacao]
 gb|EOY20645.1| Protease Do-like 9 isoform 1 [Theobroma cacao]
 gb|EOY20646.1| Protease Do-like 9 isoform 1 [Theobroma cacao]
 gb|EOY20647.1| Protease Do-like 9 isoform 1 [Theobroma cacao]
Length=589

 Score =   181 bits (460),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 105/227 (46%), Positives = 146/227 (64%), Gaps = 1/227 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            + ++ P +    VL+  DIILSFDG+ IANDGTV FR+ ERI F +LVS K   +++ +K
Sbjct  361  IRRVDPTAPESGVLKSSDIILSFDGVDIANDGTVPFRHGERIGFSYLVSQKYAGDSSAIK  420

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLH-EYGEDWYNTS  527
            VLRN E   F+IKL   + L+P H   + PS++I AG VF  ++ PYL  EYG+D+   +
Sbjct  421  VLRNSEILNFNIKLASHRRLIPAHNKGRPPSYYIIAGFVFTTVSVPYLRSEYGKDYEYEA  480

Query  526  PRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKL  347
            P +L ++ L  +P  P EQLV++SQVL+ D N GYE +   QV   NG  V+NLK L ++
Sbjct  481  PVKLLDKLLHSMPQSPDEQLVVVSQVLVADTNIGYEDIVNTQVLAFNGKPVKNLKSLAEM  540

Query  346  VEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  206
            VE+   E ++FDL+ E+++VL    AK AT  IL  H IP AMS DL
Sbjct  541  VENCEDEFLKFDLEYEQMVVLRTKTAKAATPDILAMHCIPSAMSEDL  587



>ref|XP_010029214.1| PREDICTED: protease Do-like 9 [Eucalyptus grandis]
Length=589

 Score =   181 bits (460),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 110/227 (48%), Positives = 146/227 (64%), Gaps = 1/227 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            + +I P +    VL+  D+ILSFDGI IANDGTV FR+ ERI F +LVS K   + A ++
Sbjct  361  IRRIEPTAPESHVLKPSDVILSFDGINIANDGTVPFRHGERIGFGYLVSQKYTGDKAHVQ  420

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLH-EYGEDWYNTS  527
            VLRN +  EF IKL   K L+P H   K PS++I AG VF  ++ PYL  EYG+D+   +
Sbjct  421  VLRNSKILEFDIKLATHKRLIPAHISGKSPSYYIIAGFVFTAVSVPYLRSEYGKDYEFDA  480

Query  526  PRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKL  347
            P +L ++ L  +     EQLV++SQVL+ DIN GYE +   QV   NG  V+NLK L  +
Sbjct  481  PVKLLDKLLHSMAGSVNEQLVVVSQVLVADINIGYEDIVNTQVLAFNGEPVKNLKSLANM  540

Query  346  VEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  206
            VE+   E +RFDL+ ++V+VL    AKVATS IL  H IP AMS+DL
Sbjct  541  VENCEDEYLRFDLEYQQVVVLRTKTAKVATSDILTTHCIPSAMSNDL  587



>ref|XP_006649039.1| PREDICTED: protease Do-like 9-like, partial [Oryza brachyantha]
Length=477

 Score =   179 bits (454),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 108/227 (48%), Positives = 144/227 (63%), Gaps = 1/227 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            V ++ P +     L+  DIILSFDGI IANDGTV FR+ ERI F +LVS K   E A++K
Sbjct  249  VRRVEPTAPESGCLQPSDIILSFDGIDIANDGTVPFRHGERIGFSYLVSQKYTGEKALVK  308

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLH-EYGEDWYNTS  527
            VLRN + HEF IKL   K LV  H   + PS++I AG VF  ++ PYL  EYG+D+   +
Sbjct  309  VLRNSKIHEFKIKLATHKRLVAAHVKGRPPSYYIVAGFVFAAVSVPYLRSEYGKDYEYDA  368

Query  526  PRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKL  347
            P +L  + L  +   P EQLV++SQVL+ +IN GYE +   QV   NG  V+NLK+L  +
Sbjct  369  PVKLLVKHLHAMAQSPDEQLVVVSQVLVANINIGYEEIVNTQVLAFNGQPVKNLKNLASM  428

Query  346  VEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  206
            VE+   E ++FDL+ ++++VL    AK AT  IL  H IP AMS DL
Sbjct  429  VENCKDEFLKFDLEYDQIVVLETKTAKAATRDILTTHCIPSAMSDDL  475



>gb|EAY87490.1| hypothetical protein OsI_08898 [Oryza sativa Indica Group]
Length=567

 Score =   180 bits (457),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 109/227 (48%), Positives = 144/227 (63%), Gaps = 1/227 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            V ++ P +     L+  DIILSFDGI IANDGTV FR+ ERI F +LVS K   E A++K
Sbjct  339  VRRVEPTAPESGCLQPSDIILSFDGIDIANDGTVPFRHGERIGFSYLVSQKYTGEKALVK  398

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLH-EYGEDWYNTS  527
            VLRN + HEF IKL   K LV  H   + PS++I AG VF  ++ PYL  EYG+D+   +
Sbjct  399  VLRNSKVHEFKIKLATHKRLVAAHVKGRPPSYYIVAGFVFAAVSVPYLRSEYGKDYEYDA  458

Query  526  PRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKL  347
            P +L  + L  +   P EQLV++SQVL+ DIN GYE +   QV   NG  V+NLK+L  +
Sbjct  459  PVKLLVKHLHAMAQSPDEQLVVVSQVLVADINIGYEEIVNTQVLAFNGQPVKNLKNLVSM  518

Query  346  VEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  206
            VE+   E ++FDL+ ++++VL    AK AT  IL  H IP AMS DL
Sbjct  519  VENCKDEFLKFDLEYDQIVVLETKTAKAATQDILTTHCIPSAMSDDL  565



>ref|XP_006836679.1| PREDICTED: protease Do-like 9 [Amborella trichopoda]
 ref|XP_011620896.1| PREDICTED: protease Do-like 9 [Amborella trichopoda]
 ref|XP_011620897.1| PREDICTED: protease Do-like 9 [Amborella trichopoda]
 gb|ERM99532.1| hypothetical protein AMTR_s00088p00077590 [Amborella trichopoda]
Length=594

 Score =   181 bits (458),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 107/227 (47%), Positives = 147/227 (65%), Gaps = 1/227 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            + ++ P + A+K L++ DIILSFD I IANDGTV FR+ ERI F +LVS K   ETA +K
Sbjct  366  IRRVEPTAPAFKFLKQSDIILSFDDIDIANDGTVPFRHGERIGFSYLVSQKYTGETAKIK  425

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLH-EYGEDWYNTS  527
            +LRN +  E+ ++L   K LVP H   K PS++I AG VF  ++ PYL  EYG+D+   S
Sbjct  426  ILRNAKILEYKVELATHKRLVPAHIKGKPPSYYIIAGFVFSAISVPYLRSEYGKDYDYDS  485

Query  526  PRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKL  347
            P +L ++ L  +     EQLV++SQVL+ DIN GYE +   QV   NG  ++NLKHL  L
Sbjct  486  PVKLLDKLLHSMSQTEDEQLVVVSQVLVADINIGYEDIVNTQVLAFNGQPIKNLKHLANL  545

Query  346  VEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  206
            VE+   E ++F+LD ++++VL    A+ AT  IL  H IP AMS DL
Sbjct  546  VENYEGEFLQFNLDYQQIVVLETKTARAATVDILTTHCIPAAMSDDL  592



>ref|NP_568577.1| DegP protease 9 [Arabidopsis thaliana]
 sp|Q9FL12.1|DEGP9_ARATH RecName: Full=Protease Do-like 9 [Arabidopsis thaliana]
 dbj|BAB10901.1| serine protease-like protein [Arabidopsis thaliana]
 gb|AAK76697.1| putative DegP protease [Arabidopsis thaliana]
 gb|AAN13177.1| putative DegP protease [Arabidopsis thaliana]
 gb|AED94519.1| DegP protease 9 [Arabidopsis thaliana]
Length=592

 Score =   180 bits (457),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 109/231 (47%), Positives = 150/231 (65%), Gaps = 1/231 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            + +I P +   +VL+  DIILSFDG+ IANDGTV FR+ ERI F +L+S K   ++A++K
Sbjct  360  IRRIEPTAPESQVLKPSDIILSFDGVNIANDGTVPFRHGERIGFSYLISQKYTGDSALVK  419

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLH-EYGEDWYNTS  527
            VLRN E  EF+IKL   K L+P H   K PS+FI AG VF  ++ PYL  EYG+++   +
Sbjct  420  VLRNKEILEFNIKLAIHKRLIPAHISGKPPSYFIVAGFVFTTVSVPYLRSEYGKEYEFDA  479

Query  526  PRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKL  347
            P +L E+ L  +     EQLV++SQVL+ DIN GYE +   QV   NG  V+NLK L  +
Sbjct  480  PVKLLEKHLHAMAQSVDEQLVVVSQVLVSDINIGYEEIVNTQVVAFNGKPVKNLKGLAGM  539

Query  346  VEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDE  194
            VE+   E ++F+LD ++++VL+   AK AT  IL  H IP AMS DL  +E
Sbjct  540  VENCEDEYMKFNLDYDQIVVLDTKTAKEATLDILTTHCIPSAMSDDLKTEE  590



>dbj|BAD15737.1| putative DegP2 protease [Oryza sativa Japonica Group]
Length=567

 Score =   180 bits (456),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 109/227 (48%), Positives = 144/227 (63%), Gaps = 1/227 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            V ++ P +     L+  DIILSFDGI IANDGTV FR+ ERI F +LVS K   E A++K
Sbjct  339  VRRVEPTAPESGCLQPSDIILSFDGIDIANDGTVPFRHGERIGFSYLVSQKYTGEKALVK  398

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLH-EYGEDWYNTS  527
            VLRN + HEF IKL   K LV  H   + PS++I AG VF  ++ PYL  EYG+D+   +
Sbjct  399  VLRNSKVHEFKIKLATHKRLVAAHVKGRPPSYYIVAGFVFAAVSVPYLRSEYGKDYEYDA  458

Query  526  PRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKL  347
            P +L  + L  +   P EQLV++SQVL+ DIN GYE +   QV   NG  V+NLK+L  +
Sbjct  459  PVKLLVKHLHAMAQSPDEQLVVVSQVLVADINIGYEEIVNTQVLAFNGQPVKNLKNLVSM  518

Query  346  VEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  206
            VE+   E ++FDL+ ++++VL    AK AT  IL  H IP AMS DL
Sbjct  519  VENCKDEFLKFDLEYDQIVVLETKTAKAATQDILTTHCIPSAMSDDL  565



>ref|XP_001753311.1| predicted protein [Physcomitrella patens]
 gb|EDQ81940.1| predicted protein [Physcomitrella patens]
Length=851

 Score =   182 bits (462),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 97/234 (41%), Positives = 145/234 (62%), Gaps = 1/234 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            V ++ P S A++ +++ D++LSFD I +AN+GTV FR  ERI+F  L+S K   +TA  K
Sbjct  604  VRRVEPTSPAFQAIKEGDVLLSFDNIPVANEGTVPFRAGERISFGFLISQKFSGDTAKCK  663

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLH-EYGEDWYNTS  527
            +LR+GE  E    L     LVPVH   KLPS+ I AGLVF P+  PYL  EYG+D+   +
Sbjct  664  MLRDGEVIEIETTLKAPVHLVPVHIEGKLPSYLIVAGLVFTPVCNPYLESEYGQDFEYDA  723

Query  526  PRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKL  347
            P ++ E++   +     EQLV++SQVL +D+N GYE +A   V   NGV++ NL+HL  L
Sbjct  724  PVKILEKSRHGMAEFDDEQLVVVSQVLANDVNIGYEEIANTLVKTFNGVKIRNLRHLADL  783

Query  346  VEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDECAP  185
            ++  + + +RF+LD   ++VL   +A+  T +IL+ + +P   S DLI     P
Sbjct  784  IDTCTDDFMRFELDYCSLVVLETKVARSVTPKILEDNCVPTDRSQDLITSAALP  837



>ref|XP_010913540.1| PREDICTED: protease Do-like 9 isoform X2 [Elaeis guineensis]
Length=403

 Score =   176 bits (447),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 106/227 (47%), Positives = 146/227 (64%), Gaps = 1/227 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            V ++ P +   + ++  DIILSFDG+ IANDGTV FR+ ERI F +LVS K   E AV+K
Sbjct  175  VRRVEPTAPESEFIKPSDIILSFDGVDIANDGTVPFRHGERIGFSYLVSQKYTGENAVVK  234

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTS  527
            VLR  + +EF+IKL   K L+P H   K PS++I AG VF  ++ PYL  EYG+D+   +
Sbjct  235  VLREKKVYEFNIKLATHKRLIPAHIRGKPPSYYIIAGFVFAAISVPYLRSEYGKDYEYDA  294

Query  526  PRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKL  347
            P +L ++ L  +     EQLV++SQVL+ DIN GYE +   QV   NG  V+NLK L  +
Sbjct  295  PVKLLDKHLHSMAQSHDEQLVVVSQVLVADINIGYEDIVNTQVLAFNGKPVKNLKSLATM  354

Query  346  VEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  206
            VE+  +E +RFDL+ ++++VL    AK AT  IL  H IP A+S DL
Sbjct  355  VENCDEEFLRFDLEYQQIVVLQTKTAKAATKDILLTHCIPSAVSDDL  401



>ref|XP_002981859.1| hypothetical protein SELMODRAFT_154815 [Selaginella moellendorffii]
 gb|EFJ16952.1| hypothetical protein SELMODRAFT_154815 [Selaginella moellendorffii]
Length=466

 Score =   177 bits (450),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 106/227 (47%), Positives = 144/227 (63%), Gaps = 1/227 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            + ++ P + A + LR  DI+LSFD +AIANDGTV FR  ERI+F +LVS K   E A +K
Sbjct  236  IRRVEPTAPAAQYLRHSDILLSFDDVAIANDGTVPFRLGERISFSYLVSQKYTGELAKVK  295

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLH-EYGEDWYNTS  527
            +LR+G  +E++++L   K LVP H     PS++I AG+VF  +T PYL  EYG+D+   +
Sbjct  296  ILRDGNVNEYNLELRYHKRLVPAHIKGITPSYYIVAGVVFAAITVPYLRSEYGKDYDYDA  355

Query  526  PRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKL  347
            P +L  + L  +     EQLV++SQVL+ D+N GYE +   QV   NG  V NLKHL  +
Sbjct  356  PVKLLNKLLHSMAKTQDEQLVVVSQVLVADVNIGYEDIVNTQVLAFNGTSVTNLKHLANM  415

Query  346  VEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  206
            VE    E ++FDLD ++V+VL    AK AT  IL  H IP  MSSDL
Sbjct  416  VESCKDEFLKFDLDHQQVLVLETQRAKAATPAILATHCIPSPMSSDL  462



>ref|XP_002982828.1| hypothetical protein SELMODRAFT_116969 [Selaginella moellendorffii]
 gb|EFJ16073.1| hypothetical protein SELMODRAFT_116969 [Selaginella moellendorffii]
Length=494

 Score =   178 bits (451),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 106/227 (47%), Positives = 145/227 (64%), Gaps = 1/227 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            + ++ P + A + LR  DI+LSFD +AIANDGTV FR  ERI+F +LVS K   E+A +K
Sbjct  263  IRRVEPTAPAAQYLRHSDILLSFDDVAIANDGTVPFRLGERISFSYLVSQKYTGESAKVK  322

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLH-EYGEDWYNTS  527
            +LR+G  +E++++L   K LVP H     PS++I AG+VF  +T PYL  EYG+D+   +
Sbjct  323  ILRDGSVNEYNLELRYHKRLVPAHIKGIPPSYYIVAGVVFAAITVPYLRSEYGKDYDYDA  382

Query  526  PRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKL  347
            P +L  + L  +     EQLV++SQVL+ D+N GYE +   QV   NG  V NLKHL  +
Sbjct  383  PVKLLNKLLHSMAKTEDEQLVVVSQVLVADVNIGYEDIVNTQVLAFNGTSVTNLKHLANM  442

Query  346  VEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  206
            VE    E ++FDLD ++V+VL    AK AT  IL  H IP  MSSDL
Sbjct  443  VESCKDEFLKFDLDHQQVLVLETQRAKAATPAILATHCIPSPMSSDL  489



>ref|XP_005831529.1| hypothetical protein GUITHDRAFT_72154 [Guillardia theta CCMP2712]
 gb|EKX44549.1| hypothetical protein GUITHDRAFT_72154 [Guillardia theta CCMP2712]
Length=393

 Score =   176 bits (445),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 84/162 (52%), Positives = 112/162 (69%), Gaps = 6/162 (4%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            + KI PL+D+ + L++ D+IL  DG  + NDGTV FRNRERI+FD+++S K   ++ +  
Sbjct  235  ICKIRPLTDSAQKLKEHDVILEIDGQVVGNDGTVVFRNRERISFDYVLSRKFAGQSRLQD  294

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSP  524
            V        +S++  PLK LVP+ Q+D LP +FI+AGLVF PL+QPYLHEYG+DWYNTSP
Sbjct  295  V------QLYSVEAQPLKHLVPIQQYDLLPRYFIYAGLVFTPLSQPYLHEYGDDWYNTSP  348

Query  523  RRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQV  398
            RRLC+RAL        ++ VILSQVL D  N GYE L  +Q 
Sbjct  349  RRLCDRALMGEQQIEDQEAVILSQVLQDSTNAGYEALCNMQA  390



>gb|AFW76813.1| hypothetical protein ZEAMMB73_778886 [Zea mays]
Length=596

 Score =   179 bits (454),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 106/227 (47%), Positives = 146/227 (64%), Gaps = 1/227 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            + ++ P +     L   DIILSFDGI IANDGTV FR+ ERI F +LVS K   E A +K
Sbjct  368  IRRVEPTAPESGCLEPSDIILSFDGIDIANDGTVPFRHGERIGFTYLVSQKYTGEKARVK  427

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTS  527
            VLRN + HEF+IKL   K L+P H   + PS++I AG VF+ ++ PYL  EYG+++   +
Sbjct  428  VLRNSKIHEFNIKLATHKRLIPAHIKGRPPSYYIVAGFVFMAVSVPYLRSEYGKEYEYDA  487

Query  526  PRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKL  347
            P +L ++ L  +     EQLV++SQVL+ DIN GYE +  +QV   NG  V+NLKHL  +
Sbjct  488  PVKLLDKHLHAMAQSSDEQLVVVSQVLVADINIGYEDIVNIQVLAFNGTPVKNLKHLATM  547

Query  346  VEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  206
            VE+ ++  ++FDLD ++V+VL    AK AT  IL  H IP A S +L
Sbjct  548  VEECNEAFLKFDLDFDQVVVLETKTAKAATQDILTTHCIPSAASEEL  594



>ref|XP_002511438.1| serine endopeptidase degp2, putative [Ricinus communis]
 gb|EEF52040.1| serine endopeptidase degp2, putative [Ricinus communis]
Length=569

 Score =   179 bits (453),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 105/227 (46%), Positives = 145/227 (64%), Gaps = 1/227 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            + +I P +   +VLR  DIILSFDG+ IANDGTV FR+ ERI F +L+S K   + A +K
Sbjct  341  IRRIDPTAPESEVLRPSDIILSFDGVDIANDGTVPFRHGERIGFSYLISQKYTGDNAAIK  400

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTS  527
            VLRN     F IKL   + L+P H   + PS++I AGLVF  ++ PYL  EYG+++   +
Sbjct  401  VLRNSAALNFDIKLSTHRKLIPSHVKGRPPSYYIIAGLVFSTVSVPYLRSEYGKEYEFEA  460

Query  526  PRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKL  347
            P +L ++ +  +P  P EQLV++SQVL+ DIN GYE +   QV   NG  V+NLK L  +
Sbjct  461  PVKLLDKLMHAMPQSPDEQLVVVSQVLVADINIGYEDIVNTQVLAFNGKPVKNLKSLANM  520

Query  346  VEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  206
            VE  + E ++F+L+ E+++VL    AK AT  IL  H IP AMS DL
Sbjct  521  VESCNDEFLKFELEYEQIVVLRTKTAKAATVDILTTHCIPSAMSEDL  567



>ref|XP_008647464.1| PREDICTED: uncharacterized protein LOC100217136 isoform X1 [Zea 
mays]
 gb|AFW76815.1| hypothetical protein ZEAMMB73_778886 [Zea mays]
Length=608

 Score =   179 bits (454),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 106/227 (47%), Positives = 146/227 (64%), Gaps = 1/227 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            + ++ P +     L   DIILSFDGI IANDGTV FR+ ERI F +LVS K   E A +K
Sbjct  380  IRRVEPTAPESGCLEPSDIILSFDGIDIANDGTVPFRHGERIGFTYLVSQKYTGEKARVK  439

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLH-EYGEDWYNTS  527
            VLRN + HEF+IKL   K L+P H   + PS++I AG VF+ ++ PYL  EYG+++   +
Sbjct  440  VLRNSKIHEFNIKLATHKRLIPAHIKGRPPSYYIVAGFVFMAVSVPYLRSEYGKEYEYDA  499

Query  526  PRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKL  347
            P +L ++ L  +     EQLV++SQVL+ DIN GYE +  +QV   NG  V+NLKHL  +
Sbjct  500  PVKLLDKHLHAMAQSSDEQLVVVSQVLVADINIGYEDIVNIQVLAFNGTPVKNLKHLATM  559

Query  346  VEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  206
            VE+ ++  ++FDLD ++V+VL    AK AT  IL  H IP A S +L
Sbjct  560  VEECNEAFLKFDLDFDQVVVLETKTAKAATQDILTTHCIPSAASEEL  606



>emb|CDX99642.1| BnaC04g33990D [Brassica napus]
Length=560

 Score =   178 bits (452),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 106/227 (47%), Positives = 147/227 (65%), Gaps = 1/227 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            + +I P +   +VL+  DIILSFDG+ IANDGTV FR+ ERI F +L+S K   ++A++K
Sbjct  332  IRRIEPTAPESQVLKPSDIILSFDGVNIANDGTVPFRHGERIGFSYLISQKYTGDSALVK  391

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLH-EYGEDWYNTS  527
            +LRN E  EF++KL   K L+P H   K PS+FI AG VF  ++ PYL  EYG+++   +
Sbjct  392  ILRNKEILEFNVKLAIHKKLIPAHISGKPPSYFIVAGFVFTTVSVPYLRSEYGKEYEYDA  451

Query  526  PRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKL  347
            P +L E+ L  +     EQLV++SQVL+ DIN GYE +   QV   NG  V+NLK L ++
Sbjct  452  PVKLLEKHLHAMTQSVDEQLVVVSQVLVSDINIGYEEIVNTQVVAFNGKPVKNLKCLAEM  511

Query  346  VEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  206
            VE+   E + F+LD  +++VL    AK+AT  IL  H IP AMS DL
Sbjct  512  VENCEDEYMEFNLDYHQIVVLQTKTAKMATLDILTTHCIPSAMSDDL  558



>ref|XP_004953885.1| PREDICTED: protease Do-like 9-like [Setaria italica]
Length=565

 Score =   178 bits (452),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 107/227 (47%), Positives = 144/227 (63%), Gaps = 1/227 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            V ++ P +     L+  DIILSFDG+ IANDGTV FR+ ERI F +LVS K   E A++K
Sbjct  337  VRRVEPTAPESGCLQPSDIILSFDGVDIANDGTVPFRHGERIGFSYLVSQKYTGEKALVK  396

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLH-EYGEDWYNTS  527
            VLRN + HEF I+L   K LV  H   + PS++I AG VF  ++ PYL  EYG+D+   +
Sbjct  397  VLRNSKVHEFKIRLATHKRLVAAHVKGRPPSYYIVAGFVFAAVSVPYLRSEYGKDYEYDA  456

Query  526  PRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKL  347
            P +L  + L  +   P EQLV++SQVL+ DIN GYE +   QV   NG  V+NLK+L  +
Sbjct  457  PVKLLVKHLHAMAESPDEQLVVVSQVLVADINIGYEEIVNTQVLAFNGQPVKNLKNLVTM  516

Query  346  VEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  206
            VE+   E ++FDL+ ++++VL    AK AT  IL  H IP AMS DL
Sbjct  517  VENCKDEFLKFDLEYDQIVVLETKTAKAATQDILTTHCIPSAMSDDL  563



>ref|XP_004960292.1| PREDICTED: protease Do-like 2, chloroplastic-like [Setaria italica]
Length=599

 Score =   179 bits (453),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 97/226 (43%), Positives = 137/226 (61%), Gaps = 3/226 (1%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            V ++ P + A  VLRK D+I+SFDG+A+  + TV FR+ ERI F +L S K   + A L 
Sbjct  341  VRRVEPTAPASSVLRKGDVIVSFDGVAVGCEATVPFRSTERIAFRYLTSQKYAGDIAQLG  400

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSP  524
            ++R+G   +    L P K LVP H     PS+ I AGLVF PLT+P++ E  ED   T  
Sbjct  401  IIRDGNSMKVQTILQPRKHLVPFHVEGGQPSYLIVAGLVFTPLTEPFIEEECED---TLG  457

Query  523  RRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLV  344
             +L  +A   L T  GEQ+VI+SQVL  ++N GYE +   Q+ K+NG  V+N+ HL  LV
Sbjct  458  LKLLAKARYSLATFEGEQIVIVSQVLAHEVNIGYEHMGNQQLIKLNGTAVKNIHHLAHLV  517

Query  343  EDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  206
            +    + + F+ +D+ ++VLN + A  A+S ILK H IP   SSDL
Sbjct  518  DTCKDKFLTFEFEDDFLVVLNREEATAASSDILKEHAIPSVRSSDL  563



>gb|AFW57620.1| hypothetical protein ZEAMMB73_444319 [Zea mays]
Length=458

 Score =   176 bits (447),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 96/226 (42%), Positives = 137/226 (61%), Gaps = 3/226 (1%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            V ++ P + A  VLRK D+I+SFDGIA+  + TV FR+ ERI F +L S K   + A L 
Sbjct  199  VRRVEPTAPASSVLRKGDVIVSFDGIAVGCEATVPFRSTERIAFRYLTSQKYAGDIAQLG  258

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSP  524
            ++R+G   +    L P K LVP H     PS+ I AGLVF PLT+P++ E  ED   T  
Sbjct  259  IIRDGNSMKVQTILQPRKHLVPFHVEGGQPSYLIVAGLVFTPLTEPFIEEECED---TLG  315

Query  523  RRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLV  344
             +L  +A   L T  GE++VI+SQVL  ++N GYE +   QV K+NG  ++N+ HL  LV
Sbjct  316  LKLLAKARYSLATFEGEEIVIVSQVLAHEVNIGYEHMGNQQVMKLNGTTIKNIHHLAHLV  375

Query  343  EDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  206
            +    + + F+ +D+ ++VL+ + A  A+S ILK H IP   SSDL
Sbjct  376  DTCKDKFLTFEFEDDFLVVLHREEADAASSDILKEHAIPSIRSSDL  421



>ref|XP_006476740.1| PREDICTED: protease Do-like 9-like isoform X2 [Citrus sinensis]
Length=430

 Score =   176 bits (445),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 105/229 (46%), Positives = 147/229 (64%), Gaps = 1/229 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            + ++ P +   +VL+  DIILSFDGI IANDGTV FR+ ERI F +LVS K   ++A +K
Sbjct  202  IRRVDPTAPESEVLKPSDIILSFDGIDIANDGTVPFRHGERIGFSYLVSQKYTGDSAAVK  261

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTS  527
            VLR+ +   F+I L   + L+P H   + PS++I AG VF  ++ PYL  EYG+D+   +
Sbjct  262  VLRDSKILNFNITLATHRRLIPSHNKGRPPSYYIIAGFVFSTVSVPYLRSEYGKDYEYEA  321

Query  526  PRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKL  347
            P +L ++ L  +P  P EQLV++SQVL+ DIN GYE +   QV   NG  V+NLK L  +
Sbjct  322  PVKLLDKLLYSMPQLPDEQLVVVSQVLVADINIGYEEIVNTQVLAFNGNPVKNLKSLANM  381

Query  346  VEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLIN  200
            VE+   E ++FDL+ ++V+VL    +K AT  IL  H IP AMS DL N
Sbjct  382  VENCDDEFLKFDLEYDQVVVLRTKTSKAATLDILATHCIPSAMSDDLKN  430



>ref|XP_010254399.1| PREDICTED: protease Do-like 9 isoform X1 [Nelumbo nucifera]
 ref|XP_010254407.1| PREDICTED: protease Do-like 9 isoform X1 [Nelumbo nucifera]
Length=585

 Score =   178 bits (452),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 105/227 (46%), Positives = 147/227 (65%), Gaps = 1/227 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            + ++ P +   +VL+  DI+LSFDGI IANDGTV FR+ ERI F +LVS K   E +V+K
Sbjct  358  IRRVEPTAPESQVLKPSDILLSFDGIDIANDGTVPFRHGERIGFSYLVSQKYTGENSVVK  417

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLH-EYGEDWYNTS  527
            VLRN E  EF+IKL   K L+P H   + PS++I AG VF  ++ PYL  EYG+D+   +
Sbjct  418  VLRNSEIFEFNIKLATYKRLIPAHIKGRPPSYYIIAGFVFTTVSVPYLRSEYGKDYEYDA  477

Query  526  PRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKL  347
            P +L ++ L  +     EQLV++SQVL+ DIN GYE +   QV   NG  V+NLK L  +
Sbjct  478  PVKLLDKHLHAMAQSEDEQLVVVSQVLVADINIGYEDIVNTQVLAFNGKPVKNLKSLASM  537

Query  346  VEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  206
            VE+   E ++F+L+ ++++VL   +AK AT  I+  H IP AMS DL
Sbjct  538  VENCDDEFLKFELEYQQLVVLQTKIAKAATLDIVTTHCIPSAMSEDL  584



>ref|XP_006283387.1| hypothetical protein CARUB_v10004432mg [Capsella rubella]
 gb|EOA16285.1| hypothetical protein CARUB_v10004432mg [Capsella rubella]
Length=590

 Score =   178 bits (452),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 109/231 (47%), Positives = 150/231 (65%), Gaps = 1/231 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            + +I P +   +VL+  DIILSFDG+ IANDGTV FR+ ERI F +L+S K   ++A++K
Sbjct  358  IRRIEPTAPESQVLKPSDIILSFDGVNIANDGTVPFRHGERIGFSYLISQKYTGDSALVK  417

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLH-EYGEDWYNTS  527
            VLRN E  EF+IKL   K L+P H   K PS+FI AG VF  ++ PYL  EYG+++   +
Sbjct  418  VLRNKEILEFNIKLAIHKRLIPAHISGKPPSYFIVAGFVFTTVSVPYLRSEYGKEYEFDA  477

Query  526  PRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKL  347
            P +L E+ L  +     EQLV++SQVL+ DIN GYE +   QV   NG  V+NLK L ++
Sbjct  478  PVKLLEKHLHAMAQSVDEQLVVVSQVLVSDINIGYEEIVNTQVLAFNGKPVKNLKGLVEM  537

Query  346  VEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDE  194
            VE+   E ++F+LD  +++VL+   AK AT  IL  H IP AMS DL  +E
Sbjct  538  VENCEDEYMKFNLDYNQIVVLDTKTAKEATLDILTTHCIPSAMSDDLKAEE  588



>ref|XP_010450719.1| PREDICTED: protease Do-like 9 [Camelina sativa]
Length=588

 Score =   178 bits (452),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 109/231 (47%), Positives = 149/231 (65%), Gaps = 1/231 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            + +I P +   +VL+  DIILSFDG+ IANDGTV FR+ ERI F +L+S K   ++A++K
Sbjct  356  IRRIEPTAPESQVLKPSDIILSFDGVNIANDGTVPFRHGERIGFSYLISQKYTGDSALVK  415

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLH-EYGEDWYNTS  527
            VLRN E  EF+IKL   K L+P H   K PS+FI AG VF  ++ PYL  EYG+++   +
Sbjct  416  VLRNKEILEFNIKLAIHKRLIPAHISGKPPSYFIVAGFVFTTVSVPYLRSEYGKEYEFDA  475

Query  526  PRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKL  347
            P +L E+ L  +     EQLV++SQVL+ DIN GYE +   QV   NG  V+NLK L ++
Sbjct  476  PVKLLEKHLHAMAQSVDEQLVVVSQVLVSDINIGYEEIVNTQVVAFNGKPVKNLKGLAEM  535

Query  346  VEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDE  194
            VE    E ++F+LD  +++VL+   AK AT  IL  H IP AMS DL  +E
Sbjct  536  VEKCEDEYMKFNLDYNQIVVLSTKTAKEATLDILTTHCIPSAMSDDLKAEE  586



>ref|XP_007217173.1| hypothetical protein PRUPE_ppa003383mg [Prunus persica]
 gb|EMJ18372.1| hypothetical protein PRUPE_ppa003383mg [Prunus persica]
Length=579

 Score =   177 bits (450),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 108/227 (48%), Positives = 145/227 (64%), Gaps = 1/227 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            + +I P +    VL+  DIILSFDG+ IANDGTV FR+ ERI F +LVS K   + A++K
Sbjct  351  IRRIEPTAPESHVLKPSDIILSFDGVNIANDGTVPFRHGERIGFSYLVSQKYTGDNALVK  410

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTS  527
            VLRN E  E+SIKL   K L+P H   K PS++I AG VF  ++ PYL  EYG+D+   +
Sbjct  411  VLRNSEILEYSIKLSTHKRLIPAHINGKPPSYYIIAGFVFAAVSVPYLRSEYGKDYEFDA  470

Query  526  PRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKL  347
            P +L ++ L  +     EQLV++SQVL+ DIN GYE +   QV   NG  V NLK+L  +
Sbjct  471  PVKLLDKHLHSMAQSIDEQLVVVSQVLVADINIGYEDIVNTQVLAFNGKPVNNLKNLASM  530

Query  346  VEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  206
            VE+   E ++FDL+ ++++VL    AK AT  IL  H IP AMS DL
Sbjct  531  VENCDDEYLKFDLEYDQMVVLQTKTAKAATLDILLTHCIPSAMSDDL  577



>ref|XP_002452567.1| hypothetical protein SORBIDRAFT_04g028270 [Sorghum bicolor]
 gb|EES05543.1| hypothetical protein SORBIDRAFT_04g028270 [Sorghum bicolor]
Length=565

 Score =   177 bits (449),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 106/227 (47%), Positives = 144/227 (63%), Gaps = 1/227 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            V ++ P +     L+  DIILSFDG+ IANDGTV FR+ ERI F +LVS K   E A++K
Sbjct  337  VRRVEPTAPESGCLQPSDIILSFDGVDIANDGTVPFRHGERIGFSYLVSQKYTGEKALVK  396

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLH-EYGEDWYNTS  527
            VLR+ + HEF I+L   K LV  H   + PS++I AG VF  ++ PYL  EYG+D+   +
Sbjct  397  VLRDSKVHEFKIRLATHKRLVAAHVKGRPPSYYIVAGFVFAAVSVPYLRSEYGKDYEYDA  456

Query  526  PRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKL  347
            P +L  + L  +   P EQLV++SQVL+ DIN GYE +   QV   NG  V+NLK+L  +
Sbjct  457  PVKLLVKHLHAMAESPDEQLVVVSQVLVSDINIGYEEIVNTQVLAFNGQPVKNLKNLATM  516

Query  346  VEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  206
            VE+   E ++FDL+ ++++VL    AK AT  IL  H IP AMS DL
Sbjct  517  VENCKDEFLKFDLEYDQIVVLETKTAKAATQDILTTHCIPSAMSDDL  563



>ref|XP_012081992.1| PREDICTED: protease Do-like 9 [Jatropha curcas]
 gb|KDP45394.1| hypothetical protein JCGZ_09643 [Jatropha curcas]
Length=585

 Score =   177 bits (449),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 105/227 (46%), Positives = 147/227 (65%), Gaps = 1/227 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            + +I P +    +L+  D+ILSFDG+ IANDGT+ FR+ ERI+F +LVS K   + AV+K
Sbjct  357  IRRIEPTAPESHLLKPSDVILSFDGVKIANDGTIPFRHGERISFSYLVSQKYTGDKAVVK  416

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLH-EYGEDWYNTS  527
            VLRN E  EF+IKL   K L+P H   K PS+FI AG VF  ++ PYL  EYG+D+   +
Sbjct  417  VLRNSEILEFNIKLAAHKRLIPAHIKGKPPSYFIIAGFVFTSVSVPYLRSEYGKDYEFDA  476

Query  526  PRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKL  347
            P ++ ++ L  +     EQ+V++SQVL+ DIN GYE +   QV   NG  V+NLK+L  +
Sbjct  477  PVKILDKHLHAMAQSVDEQVVVVSQVLVADINIGYEEIVNTQVLSFNGKPVKNLKNLADM  536

Query  346  VEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  206
            VE+   E ++FDL+ ++++VL    AK AT  IL  H IP AMS DL
Sbjct  537  VENCDDEYLKFDLEYQQIVVLQTSNAKAATLGILATHCIPSAMSDDL  583



>gb|EMT18472.1| Protease Do-like protein 9 [Aegilops tauschii]
Length=496

 Score =   176 bits (445),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 106/227 (47%), Positives = 143/227 (63%), Gaps = 1/227 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            V ++ P +     L+  DIILSFDG+ IANDGTV FR+ ERI F +LVS K   + A++K
Sbjct  268  VRRVEPTAPESGCLQPSDIILSFDGVDIANDGTVPFRHGERIGFSYLVSQKYTGDKALIK  327

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLH-EYGEDWYNTS  527
            VLRN + HEF IKL   K L+  H   + PS++I AG VF  ++ PYL  EYG+D+   +
Sbjct  328  VLRNSKVHEFKIKLATHKRLIAAHVKGRPPSYYIVAGFVFAAVSVPYLRSEYGKDYEYDA  387

Query  526  PRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKL  347
            P +L  + L  +   P EQLV++SQVL+ DIN GYE +   QV  VNG  V+NL+ L   
Sbjct  388  PVKLLVKHLHSMAESPDEQLVVVSQVLVADINIGYEDIVNTQVLAVNGHPVKNLRDLVTT  447

Query  346  VEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  206
            VE+   E ++FDL+ ++++VL    AK AT  IL  H IP AMS DL
Sbjct  448  VENCKDEFLKFDLEYDQIVVLERKTAKAATEDILTTHCIPSAMSDDL  494



>ref|XP_010913539.1| PREDICTED: protease Do-like 9 isoform X1 [Elaeis guineensis]
Length=582

 Score =   176 bits (447),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 106/227 (47%), Positives = 146/227 (64%), Gaps = 1/227 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            V ++ P +   + ++  DIILSFDG+ IANDGTV FR+ ERI F +LVS K   E AV+K
Sbjct  354  VRRVEPTAPESEFIKPSDIILSFDGVDIANDGTVPFRHGERIGFSYLVSQKYTGENAVVK  413

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTS  527
            VLR  + +EF+IKL   K L+P H   K PS++I AG VF  ++ PYL  EYG+D+   +
Sbjct  414  VLREKKVYEFNIKLATHKRLIPAHIRGKPPSYYIIAGFVFAAISVPYLRSEYGKDYEYDA  473

Query  526  PRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKL  347
            P +L ++ L  +     EQLV++SQVL+ DIN GYE +   QV   NG  V+NLK L  +
Sbjct  474  PVKLLDKHLHSMAQSHDEQLVVVSQVLVADINIGYEDIVNTQVLAFNGKPVKNLKSLATM  533

Query  346  VEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  206
            VE+  +E +RFDL+ ++++VL    AK AT  IL  H IP A+S DL
Sbjct  534  VENCDEEFLRFDLEYQQIVVLQTKTAKAATKDILLTHCIPSAVSDDL  580



>ref|XP_008230646.1| PREDICTED: protease Do-like 9 [Prunus mume]
Length=579

 Score =   176 bits (447),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 107/227 (47%), Positives = 144/227 (63%), Gaps = 1/227 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            + +I P +    VL+  DIILSFDG+ IANDGTV FR+ ERI F +LVS K   + A++K
Sbjct  351  IRRIEPTAPESHVLKPSDIILSFDGVNIANDGTVQFRHGERIGFSYLVSQKYTGDNALVK  410

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTS  527
            VLRN E  E++IKL   K L+P H   K PS++I AG VF  ++ PYL  EYG+D+   +
Sbjct  411  VLRNSEILEYNIKLSTHKRLIPAHINGKPPSYYIIAGFVFAAVSVPYLRSEYGKDYEFDA  470

Query  526  PRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKL  347
            P +L ++ L  +     EQLV++SQVL+ DIN GYE +   QV   NG  V NLK L  +
Sbjct  471  PVKLLDKHLHSMAQSIDEQLVVVSQVLVADINIGYEDIVNTQVLAFNGKPVNNLKKLASM  530

Query  346  VEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  206
            VE+   E ++FDL+ ++++VL    AK AT  IL  H IP AMS DL
Sbjct  531  VENCDDEYLKFDLEYDQMVVLQTKTAKAATLDILLTHCIPSAMSDDL  577



>ref|XP_008793849.1| PREDICTED: protease Do-like 9 [Phoenix dactylifera]
Length=586

 Score =   176 bits (447),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 108/227 (48%), Positives = 145/227 (64%), Gaps = 1/227 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            V ++ P +     L+  DIILSFDG+ IANDGTV FR+ ERI F +LVS K   E AV+K
Sbjct  358  VRRVEPTAPESDFLKPSDIILSFDGVDIANDGTVPFRHGERIGFSYLVSQKYTGENAVVK  417

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLH-EYGEDWYNTS  527
            VLR    +EF+IKL   K LVP H   K PS++I AG VF  ++ PYL  EYG+D+   +
Sbjct  418  VLREKRVYEFNIKLATHKRLVPAHIRGKPPSYYIIAGFVFTTISVPYLRSEYGKDYEYDA  477

Query  526  PRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKL  347
            P +L ++ L  +     EQLV++SQVL+ DIN GYE +   QV   NG  V+NLK L  +
Sbjct  478  PVKLLDKHLHAMAQSHDEQLVVVSQVLVADINIGYEDIVNNQVLSFNGQPVKNLKTLASM  537

Query  346  VEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  206
            VE+  +E ++FDL+ ++++VL  + AK AT  IL  H IP AMS DL
Sbjct  538  VENCDEEFLQFDLEYQQIVVLKTETAKAATKDILLTHCIPSAMSDDL  584



>emb|CBI15070.3| unnamed protein product [Vitis vinifera]
Length=464

 Score =   174 bits (442),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 104/227 (46%), Positives = 144/227 (63%), Gaps = 1/227 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            V +I P +   KVL+  DIILSFDG+ IANDGTV FR+ ERI F +LVS K   + A + 
Sbjct  236  VRRIDPTAPESKVLKPSDIILSFDGVDIANDGTVPFRHGERIGFSYLVSQKYTGDNATIT  295

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTS  527
            VLR+ +  +F+IKL   + ++P H   K PS++I AG VF  ++ PYL  EYG+D+   +
Sbjct  296  VLRDSKMLKFNIKLATHRRIIPAHNKGKPPSYYIIAGFVFSTVSVPYLRSEYGKDYEYEA  355

Query  526  PRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKL  347
            P +L ++ L  +P    EQLV++SQVL+ DIN GYE +   QV  +NG  V+NLK L  +
Sbjct  356  PVKLLDKLLHSMPQSEDEQLVVVSQVLVADINIGYEDIVNTQVLALNGKPVKNLKSLANM  415

Query  346  VEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  206
            VE    E ++FDL+ ++++VL    AK AT  IL  H IP  MS DL
Sbjct  416  VESCDDEFLKFDLEYQQIVVLRTKTAKAATLDILTTHCIPSKMSDDL  462



>ref|XP_008643959.1| PREDICTED: uncharacterized protein LOC100381831 isoform X1 [Zea 
mays]
Length=563

 Score =   176 bits (446),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 106/227 (47%), Positives = 143/227 (63%), Gaps = 1/227 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            V ++ P +     LR  DIILSFDG+ IANDGTV FR+ ERI F +LVS K   E A++K
Sbjct  335  VRRVEPTAPESGCLRPSDIILSFDGVDIANDGTVPFRHGERIGFSYLVSQKYTGEKALVK  394

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLH-EYGEDWYNTS  527
            VLR+ + HEF I+L   K LV  H   + PS++I AG VF  ++ PYL  EYG+D+   +
Sbjct  395  VLRDSKVHEFKIRLATHKRLVAAHVKGRPPSYYIVAGFVFAAISVPYLRSEYGKDYEYDA  454

Query  526  PRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKL  347
            P +L  + L  +   P EQLV++SQVL+ DIN GYE +   QV   NG  V+NLK+L  +
Sbjct  455  PVKLLVKHLHAMAESPDEQLVVVSQVLVSDINIGYEEIVNTQVLAFNGQPVKNLKNLATM  514

Query  346  VEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  206
            VE+   E ++FDL+ ++++VL    AK AT  IL  H IP A S DL
Sbjct  515  VENCKDEFLKFDLEYDQIVVLETKTAKAATQDILTTHCIPSATSDDL  561



>ref|XP_011399889.1| Protease Do-like 9 [Auxenochlorella protothecoides]
 gb|KFM26933.1| Protease Do-like 9 [Auxenochlorella protothecoides]
Length=465

 Score =   174 bits (441),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 91/227 (40%), Positives = 134/227 (59%), Gaps = 1/227 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            V +I P S   KV+ + D++L+FDGI I  DGTV FR+ ERI F +L+S K   + A L+
Sbjct  234  VRRIEPTSPVSKVVCQGDVLLAFDGIEIGTDGTVPFRSGERIGFSYLISQKYTGDMATLR  293

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLH-EYGEDWYNTS  527
            VL  G   + ++ L     L+PVH  ++ PS+FI  GLVF P+T P L  EYG+++   +
Sbjct  294  VLHEGAARQVTVPLTTPFKLIPVHIHNRPPSYFILGGLVFTPVTVPLLRSEYGKEFDYDA  353

Query  526  PRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKL  347
            P +L ++ +  +   PG+Q+V+L+QVL  D+N GYE +   QV+ VNG  V  L  L   
Sbjct  354  PVKLLDKMMHAMADAPGQQIVVLAQVLAADVNVGYEDIVNTQVHAVNGQRVTCLAELVAA  413

Query  346  VEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  206
             E  + E IR DL+  +V++L  + A  A   IL++H I    S DL
Sbjct  414  AEGGAGEYIRLDLEYNQVVILGKEEAAAAMPAILEQHCIAADRSEDL  460



>gb|EMS48865.1| Protease Do-like 9 [Triticum urartu]
Length=429

 Score =   173 bits (439),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 106/227 (47%), Positives = 142/227 (63%), Gaps = 1/227 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            V ++ P +     L+  DIILSFD + IANDGTV FR+ ERI F +LVS K   + A++K
Sbjct  201  VRRVEPTAPESGCLQPSDIILSFDEVDIANDGTVPFRHGERIGFSYLVSQKYTGDKALIK  260

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTS  527
            VLRN + HEF IKL   K L+  H   + PS++I AG VF  ++ PYL  EYG+D+   +
Sbjct  261  VLRNSKVHEFKIKLATHKRLIAAHVKGRPPSYYIVAGFVFAAVSVPYLRSEYGKDYEYDA  320

Query  526  PRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKL  347
            P +L  + L  +   P EQLV++SQVL+ DIN GYE +   QV  VNG  V+NLK L   
Sbjct  321  PVKLLVKHLHSMAESPDEQLVVVSQVLVADINIGYEDIVNTQVLAVNGHPVKNLKDLVTT  380

Query  346  VEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  206
            VE+   E ++FDL+ ++++VL    AK AT  IL  H IP AMS DL
Sbjct  381  VENCKDEFLKFDLEYDQIVVLETKTAKAATEDILTTHCIPSAMSDDL  427



>gb|KFK33145.1| hypothetical protein AALP_AA6G336800 [Arabis alpina]
Length=581

 Score =   176 bits (446),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 108/227 (48%), Positives = 146/227 (64%), Gaps = 1/227 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            + +I P +   +VL+  DIILSFDG+ IANDGTV FR+ ERI F +L+S K   ++A++K
Sbjct  353  IRRIEPTAPESQVLKPSDIILSFDGVNIANDGTVPFRHGERIGFSYLISQKYTGDSALVK  412

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLH-EYGEDWYNTS  527
            VLRN E  EF+IKL   K L+P H   K PS+FI AG VF  ++ PYL  EYG+++   +
Sbjct  413  VLRNKEILEFNIKLAIHKRLIPAHISGKPPSYFIVAGFVFTTVSVPYLRSEYGKEYEFDA  472

Query  526  PRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKL  347
            P +L E+ L  +     EQLV++SQVL+ DIN GYE +   QV   NG  V+NLK L ++
Sbjct  473  PVKLLEKHLHAMAQSMDEQLVVVSQVLVSDINIGYEEIVNTQVLAFNGKPVKNLKGLAEM  532

Query  346  VEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  206
            VE    E + F+LD E+++VL+   AK  T  IL  H IP AMS DL
Sbjct  533  VEKCDDEYMEFNLDYEQLVVLHTKTAKETTLDILTTHCIPSAMSDDL  579



>ref|NP_001146551.1| hypothetical protein [Zea mays]
 gb|ACL54269.1| unknown [Zea mays]
 gb|AFW57621.1| hypothetical protein ZEAMMB73_444319 [Zea mays]
Length=601

 Score =   176 bits (446),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 96/226 (42%), Positives = 137/226 (61%), Gaps = 3/226 (1%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            V ++ P + A  VLRK D+I+SFDGIA+  + TV FR+ ERI F +L S K   + A L 
Sbjct  342  VRRVEPTAPASSVLRKGDVIVSFDGIAVGCEATVPFRSTERIAFRYLTSQKYAGDIAQLG  401

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSP  524
            ++R+G   +    L P K LVP H     PS+ I AGLVF PLT+P++ E  ED   T  
Sbjct  402  IIRDGNSMKVQTILQPRKHLVPFHVEGGQPSYLIVAGLVFTPLTEPFIEEECED---TLG  458

Query  523  RRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLV  344
             +L  +A   L T  GE++VI+SQVL  ++N GYE +   QV K+NG  ++N+ HL  LV
Sbjct  459  LKLLAKARYSLATFEGEEIVIVSQVLAHEVNIGYEHMGNQQVMKLNGTTIKNIHHLAHLV  518

Query  343  EDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  206
            +    + + F+ +D+ ++VL+ + A  A+S ILK H IP   SSDL
Sbjct  519  DTCKDKFLTFEFEDDFLVVLHREEADAASSDILKEHAIPSIRSSDL  564



>ref|XP_009139975.1| PREDICTED: protease Do-like 9 [Brassica rapa]
Length=581

 Score =   176 bits (445),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 107/229 (47%), Positives = 147/229 (64%), Gaps = 1/229 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            + +I P +   +VL+  DIILSFDG+ IANDGTV FR+ ERI F +L+S K   ++A++K
Sbjct  353  IRRIEPTAPESQVLKPSDIILSFDGVNIANDGTVPFRHGERIGFSYLISQKYTGDSALVK  412

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTS  527
            +LRN E  EF+IKL   K L+P H   K PS+FI AG VF  ++ PYL  EYG+++   +
Sbjct  413  ILRNKEILEFNIKLAIHKKLIPGHIGGKPPSYFIVAGFVFTTVSVPYLRSEYGKEYEFDA  472

Query  526  PRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKL  347
            P +L ++ L  +     EQLV++SQVL+ DIN GYE +   QV   NG  V+NLK L ++
Sbjct  473  PVKLLDKHLHAMAQSVDEQLVVVSQVLVSDINIGYEEIVNTQVLAFNGKPVKNLKCLAEM  532

Query  346  VEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLIN  200
            VE+   E + F LD ++++VL    AK AT  IL  H IP AMS DL N
Sbjct  533  VENCDDEYMEFSLDYDQIVVLQTKTAKEATLDILTTHCIPSAMSDDLKN  581



>ref|XP_010233342.1| PREDICTED: protease Do-like 2, chloroplastic [Brachypodium distachyon]
Length=616

 Score =   176 bits (446),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 97/226 (43%), Positives = 135/226 (60%), Gaps = 3/226 (1%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            V ++ P + A  VLRK D+I SFDG+ +  +GTV FR+ ERI F +L S K   + A L 
Sbjct  358  VRRVEPTAPASCVLRKGDVIASFDGVPVGCEGTVPFRSTERIAFRYLTSQKYAGDVAELG  417

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSP  524
            ++R G   +    L P K LVP H     PS+ I AGLVF PLT+P++ E  ED   T  
Sbjct  418  IIREGNFMKVQTTLHPRKHLVPFHVEGGQPSYLIVAGLVFTPLTEPFIEEECED---TLG  474

Query  523  RRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLV  344
             +L  +A   L T  GEQ+VI+SQVL +D+N GYE +   QV K+NG  V+N+ HL  LV
Sbjct  475  LKLLAKARYSLSTFEGEQIVIVSQVLANDVNIGYEHMGNQQVIKLNGTMVKNIHHLAHLV  534

Query  343  EDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  206
            +    + + F+ +D+ ++VL+ + A  A+S I K H IP   SSDL
Sbjct  535  DTCQDKFLTFEFEDDFLVVLDREEAMAASSDIQKEHAIPSVRSSDL  580



>ref|XP_002868670.1| hypothetical protein ARALYDRAFT_493972 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44929.1| hypothetical protein ARALYDRAFT_493972 [Arabidopsis lyrata subsp. 
lyrata]
Length=592

 Score =   176 bits (445),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 108/231 (47%), Positives = 148/231 (64%), Gaps = 1/231 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            + +I P +   +VL+  DIILSFDG+ IANDGTV FR+ ERI F +L+S K   ++A++K
Sbjct  360  IRRIEPTAPESQVLKPSDIILSFDGVNIANDGTVPFRHGERIGFSYLISQKYTGDSALVK  419

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLH-EYGEDWYNTS  527
            VLRN E  EF+IKL   K L+P H   K PS+FI AG VF  ++ PYL  EYG+++   +
Sbjct  420  VLRNTEILEFNIKLAIHKRLIPAHISGKPPSYFIVAGFVFTTVSVPYLRSEYGKEYEFDA  479

Query  526  PRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKL  347
            P +L E+ L  +     EQLV++SQVL+ DIN GYE +   QV   NG  V+NLK L ++
Sbjct  480  PVKLLEKHLHAMAQSVDEQLVVVSQVLVSDINIGYEEIVNTQVLAFNGKPVKNLKGLAEM  539

Query  346  VEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDE  194
            VE    E ++F+LD ++++ L    AK AT  IL  H IP AMS DL  +E
Sbjct  540  VEKCEDEYMKFNLDYDQLVTLETKRAKEATLDILTTHCIPSAMSDDLKAEE  590



>emb|CDY53116.1| BnaCnng24440D [Brassica napus]
Length=581

 Score =   176 bits (445),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 107/229 (47%), Positives = 147/229 (64%), Gaps = 1/229 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            + +I P +   +VL+  DIILSFDG+ IANDGTV FR+ ERI F +L+S K   ++A++K
Sbjct  353  IRRIEPTAPESQVLKPSDIILSFDGVNIANDGTVPFRHGERIGFSYLISQKYTGDSALVK  412

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTS  527
            +LRN E  EF+IKL   K L+P H   K PS+FI AG VF  ++ PYL  EYG+++   +
Sbjct  413  ILRNKEILEFNIKLAIHKKLIPGHIGGKPPSYFIVAGFVFTTVSVPYLRSEYGKEYEFDA  472

Query  526  PRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKL  347
            P +L ++ L  +     EQLV++SQVL+ DIN GYE +   QV   NG  V+NLK L ++
Sbjct  473  PVKLLDKHLHAMAQSVDEQLVVVSQVLVSDINIGYEEIVNTQVLAFNGKPVKNLKCLAEM  532

Query  346  VEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLIN  200
            VE+   E + F LD ++++VL    AK AT  IL  H IP AMS DL N
Sbjct  533  VENCDDEYMEFSLDYDQIVVLQTKTAKEATLDILTTHCIPSAMSDDLKN  581



>ref|XP_010528270.1| PREDICTED: protease Do-like 9 [Tarenaya hassleriana]
Length=604

 Score =   176 bits (446),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 104/227 (46%), Positives = 149/227 (66%), Gaps = 1/227 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            + +I P +   +VL+  D+ILSFDG+ IANDGTV FR+ ERI F +L+S K   ++A++K
Sbjct  376  IRRIEPTAPESQVLKPSDVILSFDGVNIANDGTVPFRHGERIGFSYLISQKYTGDSALVK  435

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLH-EYGEDWYNTS  527
            VLRN +  EF+IKL   K L+P H   K PS+FI AG VF  ++ PYL  EYG+++   +
Sbjct  436  VLRNKQILEFNIKLSSHKRLIPAHINGKPPSYFIIAGFVFTTVSVPYLRSEYGKEYEFDA  495

Query  526  PRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKL  347
            P +L ++ L  +     EQLV++SQVL+ DIN GYE +   QV   NG  V+NLK L ++
Sbjct  496  PVKLLDKHLHSMAQSVDEQLVVVSQVLVSDINIGYEEIVNTQVLAFNGKPVKNLKSLAEM  555

Query  346  VEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  206
            VE+ + E ++F+L+ E+++VL    AK AT  +L  H IP AMS DL
Sbjct  556  VENCNDEYMKFELEYEQIVVLQTKTAKDATLDVLTTHCIPSAMSDDL  602



>emb|CDY44585.1| BnaA04g10050D [Brassica napus]
Length=581

 Score =   176 bits (445),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 107/229 (47%), Positives = 147/229 (64%), Gaps = 1/229 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            + +I P +   +VL+  DIILSFDG+ IANDGTV FR+ ERI F +L+S K   ++A++K
Sbjct  353  IRRIEPTAPESQVLKPSDIILSFDGVNIANDGTVPFRHGERIGFSYLISQKYTGDSALVK  412

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTS  527
            +LRN E  EF+IKL   K L+P H   K PS+FI AG VF  ++ PYL  EYG+++   +
Sbjct  413  ILRNKEILEFNIKLAIHKKLIPGHIGGKPPSYFIVAGFVFTTVSVPYLRSEYGKEYEFDA  472

Query  526  PRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKL  347
            P +L ++ L  +     EQLV++SQVL+ DIN GYE +   QV   NG  V+NLK L ++
Sbjct  473  PVKLLDKHLHAMAQSVDEQLVVVSQVLVSDINIGYEEIVNTQVLAFNGKPVKNLKCLAEM  532

Query  346  VEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLIN  200
            VE+   E + F LD ++++VL    AK AT  IL  H IP AMS DL N
Sbjct  533  VENCDDEYMEFSLDYDQIVVLQTKTAKEATLDILTTHCIPSAMSDDLKN  581



>ref|XP_010678715.1| PREDICTED: protease Do-like 9 [Beta vulgaris subsp. vulgaris]
Length=487

 Score =   174 bits (441),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 95/228 (42%), Positives = 138/228 (61%), Gaps = 3/228 (1%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            V+++   +   ++L+  D+ILSFDG+ I NDGTV FR+ ERI F++L+S K   +   +K
Sbjct  257  VTRVEAAALGSEILQPSDVILSFDGVDIGNDGTVVFRHGERIGFNYLISQKYTGDNTKIK  316

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTS  527
            +LR+ E HEF IK  P K L+P    D+ PS++I AG VF  ++  YL  EY     +  
Sbjct  317  LLRDSEMHEFDIKFDPHKKLIPTCTDDRPPSYYILAGFVFTAVSVSYLFSEYSS--MSDF  374

Query  526  PRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKL  347
            P  L  +    +     E+L+I+SQVL+ DIN GYE L  +QV  VNG  V+NLK  + +
Sbjct  375  PVELLYKLHYSMAKSNDEELIIISQVLVADINIGYEDLTNVQVIAVNGNPVKNLKSFKNM  434

Query  346  VEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLI  203
            VE  + E ++FDL+   ++VL  + AK  T+ IL  H IP AMS DL+
Sbjct  435  VESCNSEFLKFDLEFNMMVVLRTETAKATTAEILATHCIPSAMSDDLL  482



>dbj|BAK07966.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=563

 Score =   175 bits (443),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 106/227 (47%), Positives = 143/227 (63%), Gaps = 1/227 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            V ++ P +     L+  DIILSFDG+ IANDGTV FR+ ERI F +LVS K   + A++K
Sbjct  335  VRRVEPTAPESGCLQPSDIILSFDGVDIANDGTVPFRHGERIGFSYLVSQKYTGDKALIK  394

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLH-EYGEDWYNTS  527
            VLR+ + HEF IKL   K L+  H   + PS++I AG VF  ++ PYL  EYG+D+   +
Sbjct  395  VLRDSKVHEFKIKLATHKRLIAAHVKGRPPSYYIVAGFVFAAVSVPYLRSEYGKDYEYDA  454

Query  526  PRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKL  347
            P +L  + L  +   P EQLV++SQVL+ DIN GYE +   QV  VNG  V+NLK L   
Sbjct  455  PVKLLVKHLHSMVESPDEQLVVVSQVLVADINIGYEEIVNTQVLAVNGHPVKNLKDLVTT  514

Query  346  VEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  206
            VE+   E ++FDL+ ++++VL    AK AT  IL  H IP AMS DL
Sbjct  515  VENCKDEFLKFDLEYDQIVVLETKTAKAATQDILTTHCIPSAMSDDL  561



>ref|XP_008341479.1| PREDICTED: protease Do-like 9 [Malus domestica]
Length=564

 Score =   175 bits (443),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 99/231 (43%), Positives = 143/231 (62%), Gaps = 3/231 (1%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            + ++ P +   ++L+  D+ILSFDG+ IA+DGTV FRN ERI F +LV+ K   + A++K
Sbjct  309  IRRLEPTAPESQLLKPSDVILSFDGVNIASDGTVPFRNGERIGFSYLVTQKYIRDNALIK  368

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTS  527
            VLRN E  EF+IKL   K L+P H   K PSF+I AG VF  ++ PYL  E+G  +    
Sbjct  369  VLRNFETLEFNIKLAKHKELIPSHIEGKPPSFYIIAGFVFTAVSVPYLRSEFGNIF--DV  426

Query  526  PRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKL  347
            P +L ++ L  +     EQL+++SQVL+ DIN GYE +   QV   NG+ V+NLK+L  +
Sbjct  427  PIKLLDKHLHAMAQSIDEQLIVVSQVLVADINIGYEDIVNNQVLTFNGMPVKNLKNLASM  486

Query  346  VEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDE  194
            +E+   E ++F L+  +++VL    AK AT  IL  H I  +MS DL   E
Sbjct  487  IENCDDEYLKFGLEYNQMVVLQTKTAKAATLDILTTHCISSSMSDDLKTKE  537



>ref|XP_004252664.1| PREDICTED: protease Do-like 9 [Solanum lycopersicum]
Length=582

 Score =   175 bits (443),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 107/227 (47%), Positives = 142/227 (63%), Gaps = 1/227 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            + ++ P +    VL+  D+ILSFDG+ IANDGTV FR+ ERI F +LVS K   + A +K
Sbjct  354  IRRVEPTAPESNVLKPSDVILSFDGVDIANDGTVPFRHGERIGFSYLVSQKYTGDDAQVK  413

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLH-EYGEDWYNTS  527
            VLR  +  EF IKL   K L+P H   K PS++I  G VF  ++ PYL  EYG+D+   +
Sbjct  414  VLRKSKTLEFKIKLNAHKRLIPAHIKGKPPSYYIVGGFVFSAVSVPYLRSEYGKDYEFDA  473

Query  526  PRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKL  347
            P +L ++ L  +     EQLV++SQVL+ DIN GYE L   QV   NG  V+NLK L K+
Sbjct  474  PVKLLDKLLHAMAQSMDEQLVVVSQVLVADINIGYEELVNTQVIAFNGKPVKNLKSLAKM  533

Query  346  VEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  206
            VE   +E ++FDLD  +++VL    AK ATS IL  H IP AMS DL
Sbjct  534  VEACKEEYMKFDLDYNQIVVLQTTNAKAATSDILAMHCIPSAMSDDL  580



>ref|XP_006476739.1| PREDICTED: protease Do-like 9-like isoform X1 [Citrus sinensis]
Length=585

 Score =   175 bits (443),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 105/229 (46%), Positives = 147/229 (64%), Gaps = 1/229 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            + ++ P +   +VL+  DIILSFDGI IANDGTV FR+ ERI F +LVS K   ++A +K
Sbjct  357  IRRVDPTAPESEVLKPSDIILSFDGIDIANDGTVPFRHGERIGFSYLVSQKYTGDSAAVK  416

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLH-EYGEDWYNTS  527
            VLR+ +   F+I L   + L+P H   + PS++I AG VF  ++ PYL  EYG+D+   +
Sbjct  417  VLRDSKILNFNITLATHRRLIPSHNKGRPPSYYIIAGFVFSTVSVPYLRSEYGKDYEYEA  476

Query  526  PRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKL  347
            P +L ++ L  +P  P EQLV++SQVL+ DIN GYE +   QV   NG  V+NLK L  +
Sbjct  477  PVKLLDKLLYSMPQLPDEQLVVVSQVLVADINIGYEEIVNTQVLAFNGNPVKNLKSLANM  536

Query  346  VEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLIN  200
            VE+   E ++FDL+ ++V+VL    +K AT  IL  H IP AMS DL N
Sbjct  537  VENCDDEFLKFDLEYDQVVVLRTKTSKAATLDILATHCIPSAMSDDLKN  585



>ref|XP_009348028.1| PREDICTED: protease Do-like 9 [Pyrus x bretschneideri]
Length=563

 Score =   174 bits (442),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 100/231 (43%), Positives = 143/231 (62%), Gaps = 3/231 (1%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            + ++ P +   ++L+  D+ILSFDG+ IANDGTV F++ ERI F +LVS K   + A++K
Sbjct  309  IRRLEPTAPESQLLKPSDVILSFDGVNIANDGTVPFKHGERIGFSYLVSQKYLGDNALIK  368

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTS  527
            VLRN E  EF+IKL   K L+P H   K PSF+I AG VF  ++ PYL  E+G  +    
Sbjct  369  VLRNFETLEFNIKLAKHKELIPSHIEGKPPSFYIIAGFVFTAVSVPYLRSEFGNIF--DV  426

Query  526  PRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKL  347
            P +L ++ L  +     EQL+++SQVL+ DIN GYE +   QV   NG+ V+NLK+L  +
Sbjct  427  PIKLLDKHLHAMARSIDEQLIVVSQVLVADINIGYEDIVNNQVLTFNGMPVKNLKNLVSM  486

Query  346  VEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDE  194
            VE+   E ++F L+  +++VL    AK AT  IL  H I  +MS DL   E
Sbjct  487  VENCDDEYLKFGLECNQMVVLQTKTAKAATLDILTTHCISSSMSDDLKTKE  537



>ref|XP_002280249.1| PREDICTED: protease Do-like 9 [Vitis vinifera]
Length=575

 Score =   174 bits (442),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 104/227 (46%), Positives = 144/227 (63%), Gaps = 1/227 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            V +I P +   KVL+  DIILSFDG+ IANDGTV FR+ ERI F +LVS K   + A + 
Sbjct  347  VRRIDPTAPESKVLKPSDIILSFDGVDIANDGTVPFRHGERIGFSYLVSQKYTGDNATIT  406

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLH-EYGEDWYNTS  527
            VLR+ +  +F+IKL   + ++P H   K PS++I AG VF  ++ PYL  EYG+D+   +
Sbjct  407  VLRDSKMLKFNIKLATHRRIIPAHNKGKPPSYYIIAGFVFSTVSVPYLRSEYGKDYEYEA  466

Query  526  PRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKL  347
            P +L ++ L  +P    EQLV++SQVL+ DIN GYE +   QV  +NG  V+NLK L  +
Sbjct  467  PVKLLDKLLHSMPQSEDEQLVVVSQVLVADINIGYEDIVNTQVLALNGKPVKNLKSLANM  526

Query  346  VEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  206
            VE    E ++FDL+ ++++VL    AK AT  IL  H IP  MS DL
Sbjct  527  VESCDDEFLKFDLEYQQIVVLRTKTAKAATLDILTTHCIPSKMSDDL  573



>ref|XP_007140930.1| hypothetical protein PHAVU_008G153200g [Phaseolus vulgaris]
 gb|ESW12924.1| hypothetical protein PHAVU_008G153200g [Phaseolus vulgaris]
Length=568

 Score =   174 bits (441),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 106/227 (47%), Positives = 143/227 (63%), Gaps = 1/227 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            + +I P +    VL+  DIILSFDG+ IANDGTV FR+ ERI F +LVS K   + A +K
Sbjct  340  IRRIEPTAPESHVLKPSDIILSFDGVNIANDGTVPFRHGERIGFSYLVSQKYTGDRAQVK  399

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLH-EYGEDWYNTS  527
            VLR+ +  EF+IKL   K LVP H   + PS++I AG VF  ++ PYL  EYG+D+   +
Sbjct  400  VLRDSQILEFNIKLATHKRLVPAHIKGRPPSYYIIAGFVFTAVSVPYLRSEYGKDYEFDA  459

Query  526  PRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKL  347
            P +L  + L  +     EQLV++SQVL+ DIN GYE +   QV   NG  V+NLK+L  +
Sbjct  460  PVKLLNKHLHSMAQSVDEQLVVVSQVLVSDINIGYEEIVNTQVLAFNGKPVKNLKNLASM  519

Query  346  VEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  206
            VE    E ++FDL+ ++++VL    AK AT  IL  H IP AMS DL
Sbjct  520  VESCDDEYLKFDLEYQQIVVLKASTAKAATLDILTTHCIPSAMSEDL  566



>emb|CAN74170.1| hypothetical protein VITISV_013882 [Vitis vinifera]
Length=576

 Score =   174 bits (442),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 104/227 (46%), Positives = 144/227 (63%), Gaps = 1/227 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            V +I P +   KVL+  DIILSFDG+ IANDGTV FR+ ERI F +LVS K   + A + 
Sbjct  348  VRRIDPTAPESKVLKPSDIILSFDGVDIANDGTVPFRHGERIGFSYLVSQKYTGDNATIT  407

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLH-EYGEDWYNTS  527
            VLR+ +  +F+IKL   + ++P H   K PS++I AG VF  ++ PYL  EYG+D+   +
Sbjct  408  VLRDSKMLKFNIKLATHRRIIPAHNKGKPPSYYIIAGFVFSTVSVPYLRSEYGKDYEYEA  467

Query  526  PRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKL  347
            P +L ++ L  +P    EQLV++SQVL+ DIN GYE +   QV  +NG  V+NLK L  +
Sbjct  468  PVKLLDKLLHSMPQSEDEQLVVVSQVLVADINIGYEDIVNTQVLALNGKPVKNLKSLANM  527

Query  346  VEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  206
            VE    E ++FDL+ ++++VL    AK AT  IL  H IP  MS DL
Sbjct  528  VESCDDEFLKFDLEYQQIVVLRTKTAKAATLDILTTHCIPSKMSDDL  574



>ref|XP_006405537.1| hypothetical protein EUTSA_v10027697mg [Eutrema salsugineum]
 gb|ESQ46990.1| hypothetical protein EUTSA_v10027697mg [Eutrema salsugineum]
Length=589

 Score =   174 bits (442),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 106/227 (47%), Positives = 147/227 (65%), Gaps = 1/227 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            + +I P +   +VL+  DIILSFDG+ IANDGTV FR+ ERI F +L+S K   ++A++K
Sbjct  361  IRRIEPTAPESQVLKPSDIILSFDGVNIANDGTVPFRHGERIGFSYLISQKYTGDSALVK  420

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTS  527
            VLRN E  EF+IKL   K L+P H   K PS++I AG VF  ++ PYL  EYG+++   +
Sbjct  421  VLRNKEILEFNIKLAIHKKLIPAHISGKPPSYYIVAGFVFTTVSVPYLRSEYGKEYEFDA  480

Query  526  PRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKL  347
            P +L ++ L  +     EQLV++SQVL+ DIN GYE +   QV   NG  V+NLK L ++
Sbjct  481  PVKLLDKHLHAMAQSVDEQLVVVSQVLVSDINIGYEDIVNTQVLAFNGKPVKNLKSLAEM  540

Query  346  VEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  206
            VE+   E + F+LD ++++VL    AK AT  IL  H IP AMS DL
Sbjct  541  VENCDDEYMEFNLDYDQLVVLQTKTAKEATLDILTTHCIPSAMSDDL  587



>ref|XP_002439270.1| hypothetical protein SORBIDRAFT_09g003540 [Sorghum bicolor]
 gb|EES17700.1| hypothetical protein SORBIDRAFT_09g003540 [Sorghum bicolor]
Length=604

 Score =   174 bits (442),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 95/226 (42%), Positives = 136/226 (60%), Gaps = 3/226 (1%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            V ++ P + A  VLRK D+I+SFDG ++  + TV FR+ ERI F +L S K   + A L 
Sbjct  346  VRRVEPTAPASSVLRKGDVIVSFDGTSVGCEATVPFRSTERIAFRYLTSQKYAGDIAQLG  405

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSP  524
            ++R+G   +    L P K LVP H     PS+ I AGLVF PLT+P++ E  ED   T  
Sbjct  406  IIRDGNSMKVQTILQPRKHLVPFHVEGGQPSYLIVAGLVFTPLTEPFIEEECED---TLG  462

Query  523  RRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLV  344
             +L  +A   L T  GEQ+VI+SQVL  ++N GYE +   QV K+NG  ++N+ HL  LV
Sbjct  463  LKLLAKARYSLATFEGEQIVIVSQVLAHEVNIGYEHMGNQQVMKLNGTTIKNIHHLAHLV  522

Query  343  EDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  206
            +    + + F+ +D+ ++VL+ + A  A+S ILK H IP   SSDL
Sbjct  523  DTCKDKFLTFEFEDDFLVVLHREEAAAASSDILKEHAIPSIRSSDL  568



>ref|XP_009140230.1| PREDICTED: protease Do-like 9 [Brassica rapa]
Length=584

 Score =   174 bits (441),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 106/227 (47%), Positives = 145/227 (64%), Gaps = 1/227 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            + +I P +   +VL+  DIILSFDG+ IANDGTV FR+ ERI F +L+S K   ++A++K
Sbjct  356  IRRIEPTAPESQVLKPSDIILSFDGVNIANDGTVPFRHGERIGFSYLISQKYTGDSALVK  415

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLH-EYGEDWYNTS  527
            +LRN E  EF++KL   K L+P H   K PS+FI AG VF  ++ PYL  EYG+++   +
Sbjct  416  ILRNREILEFNVKLAIHKKLIPAHISGKPPSYFIVAGFVFTTVSVPYLRSEYGKEYEYDA  475

Query  526  PRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKL  347
            P +L E+ L  +     EQLV++SQVL+ DIN GYE +   QV   NG  V+NLK L ++
Sbjct  476  PVKLLEKHLHAMTQSVDEQLVVVSQVLVSDINIGYEEIVNTQVVAFNGKPVKNLKCLAEM  535

Query  346  VEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  206
            VE+   E + F LD  +++VL    AK AT  IL  H IP AMS DL
Sbjct  536  VENCVDEYMEFYLDYHQIVVLQTKTAKEATLDILTTHCIPSAMSDDL  582



>ref|XP_011028602.1| PREDICTED: protease Do-like 9 [Populus euphratica]
Length=556

 Score =   173 bits (439),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 103/227 (45%), Positives = 145/227 (64%), Gaps = 1/227 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            + ++ P +   +VL+  DIILSFDG+ IANDGTV FR+ ERI F +L+S K   + A +K
Sbjct  328  IRRVDPTALESEVLQPSDIILSFDGVDIANDGTVPFRHGERIGFSYLISQKYTGDNAAIK  387

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLH-EYGEDWYNTS  527
            V RN +  EF IKL   + L+P H   K PS++I AG VF  ++ PYL  EYG+++   +
Sbjct  388  VFRNSKTLEFVIKLSTHRRLIPPHVKGKPPSYYIIAGFVFTTVSVPYLRSEYGKEYEFEA  447

Query  526  PRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKL  347
            P +L ++ L  +P  P EQLV++SQVL+ DIN GYE +   QV   NG  V+NLK L  +
Sbjct  448  PVKLLDKLLHSMPQSPDEQLVVVSQVLVADINIGYEDIVNTQVLAFNGKPVKNLKSLASM  507

Query  346  VEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  206
            VE+   E ++FDL+ ++++VL    AK AT  IL  H IP A+S DL
Sbjct  508  VENCDDEFLKFDLEYDQIVVLRMKTAKEATVDILTTHCIPSAISDDL  554



>ref|XP_009349862.1| PREDICTED: protease Do-like 9 [Pyrus x bretschneideri]
Length=562

 Score =   173 bits (439),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 99/231 (43%), Positives = 142/231 (61%), Gaps = 3/231 (1%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            + ++ P +   ++L+  D+ILSFDG+ IANDGTV F++ ERI F +LVS K   + A++K
Sbjct  308  IRRLEPTAPESQLLKPSDVILSFDGVNIANDGTVPFKHGERIGFSYLVSQKYLGDNALIK  367

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTS  527
            VLRN E  EF+IKL   K L+P H   K PSF+I AG +F  ++ PYL  E+G  +    
Sbjct  368  VLRNFETLEFNIKLAKHKELIPSHIEGKPPSFYIIAGFIFTAVSVPYLRSEFGNIF--DV  425

Query  526  PRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKL  347
            P +L ++ L  +     EQL+++SQVL+ DIN GYE +   QV   NG  V+NLK+L  +
Sbjct  426  PIKLLDKHLHAMARSIDEQLIVVSQVLVADINIGYEDIVNNQVLTFNGTPVKNLKNLVSM  485

Query  346  VEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDE  194
            VE+   E ++F L+  +++VL    AK AT  IL  H I  +MS DL   E
Sbjct  486  VENCDDEYLKFGLECNQMVVLQTKTAKAATLDILTTHCISSSMSDDLKTKE  536



>ref|XP_008780936.1| PREDICTED: protease Do-like 9 [Phoenix dactylifera]
Length=582

 Score =   173 bits (439),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 105/227 (46%), Positives = 147/227 (65%), Gaps = 1/227 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            V ++ P +   + ++  DIILSFDG+ IANDGTV FR+ ERI F +LVS K   E AV+K
Sbjct  354  VRRVEPTAPESEFIKPSDIILSFDGVDIANDGTVPFRHGERIGFSYLVSQKYTGEHAVVK  413

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLH-EYGEDWYNTS  527
            VLR  + +EF+IKL   K L+P H   K PS++I AG VF  ++ PYL  EYG+++   +
Sbjct  414  VLREKKVYEFNIKLATHKRLIPAHIKGKPPSYYIIAGFVFSAISVPYLRSEYGKEYEYDA  473

Query  526  PRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKL  347
            P +L E+ L  +     EQLV++SQVL+ DIN GYE +   QV   NG  V+NLK L  +
Sbjct  474  PVKLLEKHLHAMAQSHDEQLVVVSQVLVADINIGYEDIVNTQVLAFNGKPVKNLKSLATM  533

Query  346  VEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  206
            VE+  +E ++FDL+ ++++VL    AK AT  IL  H IP A+S+DL
Sbjct  534  VENCDEEFLQFDLEYQQIVVLQTKTAKAATKDILLTHCIPSAVSNDL  580



>gb|KFG58629.1| trypsin domain-containing protein [Toxoplasma gondii RUB]
Length=252

 Score =   166 bits (421),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 92/218 (42%), Positives = 131/218 (60%), Gaps = 1/218 (0%)
 Frame = -2

Query  856  AYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLKVLRNGEKHE  677
            A  VL+K DI+L   G  IA+DGTV FRN ERI F  ++S     +   +K+LR   +  
Sbjct  35   AKAVLQKGDILLEIGGKRIASDGTVAFRNGERILFTWILSQMFVGDRCSVKLLRQNRERR  94

Query  676  FSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTSPRRLCERAL  500
             S  +  L  LVP +   + P + I  GLVF+PL++P+L  EYGED+ + +P RL ++  
Sbjct  95   ESFSVGKLNLLVPANSDLRRPQYLIVGGLVFVPLSEPFLKSEYGEDFESRAPVRLLDKWQ  154

Query  499  RKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLVEDNSKERI  320
                + PGEQ V+LS VL  D+  GYE L  +QV + NG  V+ LKHL +LVE++++E  
Sbjct  155  HGFQSFPGEQFVLLSHVLAHDVTVGYEHLHNVQVQQFNGTSVKTLKHLAELVENSTEEYW  214

Query  319  RFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  206
            RFDLD + V+VL  D A+ A   IL+R+ I    S D+
Sbjct  215  RFDLDHDEVVVLEADAARRALPHILQRNMIRSCKSEDV  252



>ref|XP_010236127.1| PREDICTED: protease Do-like 9 isoform X2 [Brachypodium distachyon]
Length=436

 Score =   171 bits (433),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 109/227 (48%), Positives = 145/227 (64%), Gaps = 1/227 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            V ++ P +     LR  DIILSFDGI IANDGTV FR+ ERI F +LVS K   E AV+K
Sbjct  208  VRRVEPTAPESGYLRPSDIILSFDGIDIANDGTVPFRHGERIGFSYLVSQKYTGEKAVVK  267

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLH-EYGEDWYNTS  527
            VLR+ + HEF +KL   K L+  H   + PS++I AG VF  ++ PYL  EYG+D+   +
Sbjct  268  VLRDSKVHEFRMKLATHKRLIAAHVKGRPPSYYIVAGFVFAAVSVPYLRSEYGKDYEYDA  327

Query  526  PRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKL  347
            P +L  + L  +   P EQLV++SQVL+ DIN GYE +   QV  VNG  V+NLK+L  +
Sbjct  328  PVKLLVKHLHAMAESPDEQLVVVSQVLVADINIGYEEIVNTQVLAVNGQPVKNLKNLVTM  387

Query  346  VEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  206
            VE+   E ++FDL+ ++++VL    AK AT  IL  H IP AMS DL
Sbjct  388  VENCKDEFLKFDLEYDQIVVLKTKTAKAATKDILTTHCIPSAMSDDL  434



>gb|AAT93972.1| putative DegP2 protease [Oryza sativa Japonica Group]
 gb|EEC78515.1| hypothetical protein OsI_18450 [Oryza sativa Indica Group]
 gb|EEE62322.1| hypothetical protein OsJ_17111 [Oryza sativa Japonica Group]
Length=596

 Score =   173 bits (439),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 97/226 (43%), Positives = 136/226 (60%), Gaps = 3/226 (1%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            V ++ P + A KVLRK D+I SFDG+A+  +GTV FR+ ERI F +L S K   + A L 
Sbjct  338  VRRVEPTAPASKVLRKGDVITSFDGVAVGCEGTVPFRSTERIAFRYLTSQKYAGDVAQLG  397

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSP  524
            ++R G   +    L P K LVP H     PS+ I AGLVF PLT+P++ E       T  
Sbjct  398  IIRAGNTMKVQTVLQPRKHLVPFHVEGGQPSYLIVAGLVFTPLTEPFIEEE---CEETLG  454

Query  523  RRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLV  344
             +L  +A   L T  GEQ+VI+SQVL  ++N GYE +   QV K+NG  V+N+ HL  LV
Sbjct  455  LKLLAKARYSLSTFEGEQIVIVSQVLAHEVNIGYEHMGNQQVIKLNGTVVKNIHHLAHLV  514

Query  343  EDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  206
            ++   + + F+ +D+ ++VL+ + A  A+S ILK H IP   SSDL
Sbjct  515  DNCKDKFLTFEFEDDFLVVLDREEATTASSDILKEHAIPSVRSSDL  560



>emb|CDX91770.1| BnaC08g06890D [Brassica napus]
Length=280

 Score =   167 bits (422),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 102/226 (45%), Positives = 144/226 (64%), Gaps = 32/226 (14%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            ++KI   S AY +L+K+DIIL+ DG+ I          R+RI+F +L+SMKKP ET+++K
Sbjct  82   INKISLWSGAYGILKKNDIILAIDGVPILQ------MMRQRISFYYLISMKKPGETSMIK  135

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSP  524
            VLR G++HE++I L P+KP V V Q+ K PS++IF G VF+P      H   E       
Sbjct  136  VLRRGKEHEYNINLKPVKPHVRVQQYYKRPSYYIFGGFVFVPN-----HNLSES------  184

Query  523  RRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLV  344
                            EQ VI+S++L DDIN GYE   +LQV KVN V+V+NL+HL +L+
Sbjct  185  ---------------EEQHVIISEILEDDINQGYESFKDLQVEKVNKVKVKNLRHLFELI  229

Query  343  EDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  206
            E+N  + +  DL+D++V+VLNY+ AK A S ILKRH I  A+S+DL
Sbjct  230  EENGTQNLSIDLEDDKVLVLNYESAKKADSIILKRHNITSAISNDL  275



>ref|XP_004298924.1| PREDICTED: protease Do-like 9 [Fragaria vesca subsp. vesca]
Length=567

 Score =   172 bits (437),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 106/227 (47%), Positives = 143/227 (63%), Gaps = 1/227 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            + +I P +   +VL+  DI+LSFDG+ IANDGTV FR+ ERI F +L+S K   + + +K
Sbjct  339  IRRIDPTALESQVLKPSDILLSFDGVNIANDGTVPFRHGERIGFSYLISQKYTGDNSKVK  398

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLH-EYGEDWYNTS  527
            VLRN E   F IKL   K L+P H   + PS++I AG VF  ++ PYL  EYG+D+   +
Sbjct  399  VLRNSEILSFDIKLASHKRLIPSHIKGRPPSYYIVAGFVFTAVSVPYLRSEYGKDYEFEA  458

Query  526  PRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKL  347
            P +L ++ L  L   P EQLV++SQVL+ DIN GYE +   QV   NG  V+NLK L  +
Sbjct  459  PVKLLDKMLHSLRQSPDEQLVVVSQVLVADINIGYEDIVNTQVLAFNGKPVKNLKSLASM  518

Query  346  VEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  206
            VE+   E ++FDL+ ++V VL    AK AT  IL  H IP AMS DL
Sbjct  519  VENCDDEFLKFDLEYQQVAVLQTKTAKAATLDILATHCIPSAMSDDL  565



>ref|XP_002502087.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO63345.1| predicted protein [Micromonas sp. RCC299]
Length=463

 Score =   171 bits (432),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 97/227 (43%), Positives = 138/227 (61%), Gaps = 1/227 (0%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            +S + PL      L+K+D+++S DG  IA+DGTV FR  E ITF++LVS K   E+A ++
Sbjct  236  ISAVEPLMKDKINLKKNDVLVSIDGTDIASDGTVPFRAGEPITFNYLVSEKYVGESAQVR  295

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYL-HEYGEDWYNTS  527
             LR+G+  E SI    +K LVP H     PS+FI  GLVF  +  P+L +EYG+D+   +
Sbjct  296  YLRDGKMQECSITFNAMKRLVPWHIEGTPPSYFIAGGLVFTTVCVPFLKNEYGKDYDFDA  355

Query  526  PRRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKL  347
            P +L E+       + G+Q+VI +QVL  ++N GYE L    V   NGV++ NLK L + 
Sbjct  356  PVKLLEKFCHGRVEEEGQQVVICAQVLAAEVNRGYEDLHNTIVQSFNGVKIFNLKQLAQA  415

Query  346  VEDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDL  206
            VE +  E +RF+LD E  +V++   A  AT  ILK H IP A S+DL
Sbjct  416  VESSKDEFMRFELDHEISVVMDTKAANSATKAILKTHAIPSAKSADL  462



>ref|XP_010437094.1| PREDICTED: putative protease Do-like 11, mitochondrial [Camelina 
sativa]
Length=556

 Score =   172 bits (436),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 104/235 (44%), Positives = 143/235 (61%), Gaps = 37/235 (16%)
 Frame = -2

Query  883  VSKIHPLSDAYKVLRKDDIILSFDGIAIANDGTVHFRNRERITFDHLVSMKKPNETAVLK  704
            ++K++  S A+K+LRK DIIL+ DG+ I ND  V F+N+ RI F HLVS+KKP E A++K
Sbjct  335  INKVYSSSGAHKILRKYDIILAIDGVPIGNDEKVPFQNKNRINFSHLVSLKKPGEKALVK  394

Query  703  VLRNGEKHEFSIKLFPLKPLVPVHQFDKLPSFFIFAGLVFIPLTQPYLHEYGEDWYNTSP  524
            VLR G++HE++I L P+KP V V QF  LPS++IF G VF+PLT+ Y             
Sbjct  395  VLRKGKEHEYNITLKPVKPNVKVQQFYNLPSYYIFGGFVFVPLTKAYSDNLS--------  446

Query  523  RRLCERALRKLPTKPGEQLVILSQVLLDDINTGYERLAELQVNKVNGVEVENLKHLRKLV  344
                                     L DDIN GYE L +LQV KVN V+V+NLKHL +L+
Sbjct  447  -------------------------LSDDINKGYESLDDLQVKKVNSVKVKNLKHLCELI  481

Query  343  EDNSKERIRFDLDDERVIVLNYDLAKVATSRILKRHRIPYAMSSDLINDECAPAL  179
            E  S + +R  L+D +V+VLN + AK AT +I++RH+I   +S D+    C P L
Sbjct  482  EKCSTKDLRLVLEDNKVMVLNTESAKKATLKIMERHKIKSVISKDI----CLPML  532



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2118266961610