BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig11137

Length=1042
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004238176.1|  PREDICTED: patatin-like protein 2                  124   1e-28   Solanum lycopersicum
ref|XP_006354913.1|  PREDICTED: patatin-3-Kuras 1-like                  124   1e-28   Solanum tuberosum [potatoes]
emb|CBI19558.3|  unnamed protein product                                123   4e-28   Vitis vinifera
ref|XP_006354911.1|  PREDICTED: patatin-3-Kuras 1-like                  122   1e-27   Solanum tuberosum [potatoes]
emb|CBI19557.3|  unnamed protein product                                124   2e-27   Vitis vinifera
ref|XP_009801077.1|  PREDICTED: patatin-like protein 2                  120   2e-27   Nicotiana sylvestris
emb|CAN81920.1|  hypothetical protein VITISV_021802                     120   3e-27   Vitis vinifera
ref|XP_002282432.1|  PREDICTED: patatin-like protein 2                  120   3e-27   Vitis vinifera
ref|XP_002282415.2|  PREDICTED: patatin-like protein 2                  120   3e-27   Vitis vinifera
ref|XP_002282440.1|  PREDICTED: patatin-like protein 2                  120   3e-27   Vitis vinifera
emb|CAN71271.1|  hypothetical protein VITISV_001907                     120   4e-27   Vitis vinifera
ref|XP_010664934.1|  PREDICTED: patatin-like protein 2                  118   1e-26   
emb|CBI19560.3|  unnamed protein product                                119   1e-26   Vitis vinifera
ref|XP_002282391.3|  PREDICTED: uncharacterized protein LOC100264244    122   2e-26   
ref|XP_002282366.2|  PREDICTED: patatin-like protein 2                  118   2e-26   Vitis vinifera
emb|CAN68798.1|  hypothetical protein VITISV_008805                     117   3e-26   Vitis vinifera
emb|CBI19549.3|  unnamed protein product                                117   3e-26   Vitis vinifera
ref|XP_010664933.1|  PREDICTED: patatin-like protein 2                  117   3e-26   
ref|XP_011081971.1|  PREDICTED: patatin-like protein 1                  117   3e-26   Sesamum indicum [beniseed]
gb|EYU21992.1|  hypothetical protein MIMGU_mgv1a024079mg                113   3e-26   Erythranthe guttata [common monkey flower]
ref|XP_009617802.1|  PREDICTED: patatin-like protein 2 isoform X2       116   4e-26   
ref|XP_006354914.1|  PREDICTED: patatin-3-Kuras 1-like                  117   5e-26   Solanum tuberosum [potatoes]
gb|KCW66180.1|  hypothetical protein EUGRSUZ_F00017                     116   6e-26   Eucalyptus grandis [rose gum]
ref|XP_009617797.1|  PREDICTED: patatin-like protein 2 isoform X1       116   9e-26   Nicotiana tomentosiformis
gb|AAF98368.1|AF158027_1  patatin-like protein 1                        116   9e-26   Nicotiana tabacum [American tobacco]
ref|XP_006354912.1|  PREDICTED: patatin-3-Kuras 1-like                  116   9e-26   
ref|XP_010064190.1|  PREDICTED: patatin-like protein 2                  115   9e-26   
ref|XP_004238177.1|  PREDICTED: patatin-like protein 2                  115   1e-25   Solanum lycopersicum
gb|KCW66171.1|  hypothetical protein EUGRSUZ_F00007                     115   2e-25   Eucalyptus grandis [rose gum]
ref|XP_010064132.1|  PREDICTED: patatin-like protein 2                  115   2e-25   
ref|XP_003538815.1|  PREDICTED: patatin group D-2-like                  115   2e-25   Glycine max [soybeans]
ref|XP_010064139.1|  PREDICTED: patatin-like protein 2                  115   2e-25   Eucalyptus grandis [rose gum]
gb|AFK45940.1|  unknown                                                 109   2e-25   Lotus japonicus
ref|XP_010064137.1|  PREDICTED: patatin-like protein 2                  115   3e-25   Eucalyptus grandis [rose gum]
gb|ERM97116.1|  hypothetical protein AMTR_s00126p00056890               110   5e-25   Amborella trichopoda
ref|XP_007017305.1|  Phospholipase A 2A, IIA,PLA2A                      114   5e-25   
ref|XP_010268982.1|  PREDICTED: patatin-like protein 2                  114   5e-25   
ref|XP_006387005.1|  hypothetical protein POPTR_2250s00200g             109   6e-25   
ref|XP_010064188.1|  PREDICTED: patatin-like protein 2                  113   9e-25   Eucalyptus grandis [rose gum]
gb|ERM97113.1|  hypothetical protein AMTR_s00126p00052700               113   1e-24   Amborella trichopoda
ref|XP_010269013.1|  PREDICTED: patatin-like protein 2 isoform X1       112   2e-24   Nelumbo nucifera [Indian lotus]
gb|KGN62058.1|  hypothetical protein Csa_2G293860                       110   2e-24   Cucumis sativus [cucumbers]
ref|XP_008378189.1|  PREDICTED: patatin-like protein 2                  112   2e-24   
ref|XP_008779158.1|  PREDICTED: patatin-like protein 2                  111   3e-24   Phoenix dactylifera
emb|CDP11077.1|  unnamed protein product                                111   4e-24   Coffea canephora [robusta coffee]
ref|XP_004148052.1|  PREDICTED: patatin-like protein 3                  110   7e-24   Cucumis sativus [cucumbers]
ref|XP_006829698.2|  PREDICTED: patatin-like protein 2                  110   7e-24   Amborella trichopoda
ref|XP_004501587.1|  PREDICTED: patatin-3-Kuras 1-like isoform X2       110   7e-24   
ref|XP_003603014.1|  Patatin-like protein                               110   8e-24   Medicago truncatula
ref|XP_004501586.1|  PREDICTED: patatin-3-Kuras 1-like isoform X1       110   9e-24   Cicer arietinum [garbanzo]
gb|EPS59074.1|  hypothetical protein M569_15736                         109   1e-23   Genlisea aurea
ref|XP_011629237.1|  PREDICTED: patatin-like protein 2                  110   1e-23   Amborella trichopoda
ref|XP_009627385.1|  PREDICTED: patatin-like protein 2                  108   1e-23   
gb|KJB29505.1|  hypothetical protein B456_005G103900                    109   1e-23   Gossypium raimondii
ref|XP_004979715.1|  PREDICTED: patatin-2-Kuras 1-like                  109   1e-23   Setaria italica
ref|XP_008378197.1|  PREDICTED: patatin-like protein 2                  109   2e-23   
ref|XP_007156813.1|  hypothetical protein PHAVU_002G019700g             109   2e-23   Phaseolus vulgaris [French bean]
emb|CDP07844.1|  unnamed protein product                                109   2e-23   Coffea canephora [robusta coffee]
emb|CDP01337.1|  unnamed protein product                                109   2e-23   Coffea canephora [robusta coffee]
gb|ERM97111.1|  hypothetical protein AMTR_s00126p00051100               105   2e-23   Amborella trichopoda
ref|XP_003544452.1|  PREDICTED: patatin-3-Kuras 1-like                  109   2e-23   Glycine max [soybeans]
ref|XP_007017306.1|  Phospholipase A 2A, IIA,PLA2A                      109   2e-23   
ref|XP_010268994.1|  PREDICTED: patatin-like protein 2 isoform X1       109   2e-23   Nelumbo nucifera [Indian lotus]
gb|KJB58445.1|  hypothetical protein B456_009G210500                    109   2e-23   Gossypium raimondii
ref|XP_004958340.1|  PREDICTED: patatin-3-Kuras 1-like                  109   2e-23   Setaria italica
ref|XP_008220196.1|  PREDICTED: patatin-like protein 2 isoform X1       108   2e-23   Prunus mume [ume]
ref|XP_010065725.1|  PREDICTED: patatin-like protein 2                  108   2e-23   Eucalyptus grandis [rose gum]
ref|XP_011629236.1|  PREDICTED: patatin-like protein 2                  108   3e-23   
ref|XP_002449853.1|  hypothetical protein SORBIDRAFT_05g024430          108   3e-23   Sorghum bicolor [broomcorn]
ref|XP_007156814.1|  hypothetical protein PHAVU_002G019800g             108   3e-23   Phaseolus vulgaris [French bean]
gb|KCW54973.1|  hypothetical protein EUGRSUZ_I00941                     108   3e-23   Eucalyptus grandis [rose gum]
gb|KHN12765.1|  Patatin group A-3                                       108   3e-23   Glycine soja [wild soybean]
ref|XP_010098699.1|  Patatin group A-3                                  108   3e-23   
ref|XP_003549405.1|  PREDICTED: patatin-3-Kuras 1                       108   3e-23   Glycine max [soybeans]
ref|XP_008664528.1|  PREDICTED: patatin-like protein 2                  108   4e-23   Zea mays [maize]
tpg|DAA48470.1|  TPA: hypothetical protein ZEAMMB73_976536              108   4e-23   
gb|AAD22149.1|AF061282_2  patatin-like protein                          108   4e-23   Sorghum bicolor [broomcorn]
ref|XP_009419098.1|  PREDICTED: patatin-like protein 2                  108   4e-23   Musa acuminata subsp. malaccensis [pisang utan]
gb|KCW66175.1|  hypothetical protein EUGRSUZ_F00011                     107   4e-23   Eucalyptus grandis [rose gum]
ref|XP_009611848.1|  PREDICTED: patatin-like protein 2                  102   4e-23   Nicotiana tomentosiformis
ref|XP_009631601.1|  PREDICTED: patatin-like protein 3                  103   4e-23   
ref|XP_009769117.1|  PREDICTED: patatin-like protein 2 isoform X1       108   4e-23   Nicotiana sylvestris
ref|XP_007227369.1|  hypothetical protein PRUPE_ppa026872mg             108   5e-23   Prunus persica
ref|XP_004499077.1|  PREDICTED: patatin-2-Kuras 3-like isoform X3       107   5e-23   
gb|EMT13605.1|  Patatin group A-3                                       108   5e-23   
ref|XP_006387188.1|  hypothetical protein POPTR_1581s00200g             108   5e-23   Populus trichocarpa [western balsam poplar]
ref|XP_006388385.1|  hypothetical protein POPTR_0202s00220g             107   5e-23   
ref|XP_002324124.2|  hypothetical protein POPTR_0017s02550g             107   6e-23   
ref|XP_009797490.1|  PREDICTED: patatin-like protein 2                  107   7e-23   Nicotiana sylvestris
ref|XP_010059971.1|  PREDICTED: patatin-like protein 2 isoform X2       107   7e-23   
ref|XP_004499075.1|  PREDICTED: patatin-2-Kuras 3-like isoform X1       107   7e-23   Cicer arietinum [garbanzo]
ref|XP_003589237.1|  Patatin-like protein                               106   7e-23   
ref|XP_010064136.1|  PREDICTED: patatin-like protein 2                  107   8e-23   Eucalyptus grandis [rose gum]
ref|XP_006388384.1|  hypothetical protein POPTR_0202s00210g             107   8e-23   
emb|CDP01332.1|  unnamed protein product                                107   9e-23   Coffea canephora [robusta coffee]
ref|XP_010269035.1|  PREDICTED: patatin-like protein 2 isoform X1       107   9e-23   Nelumbo nucifera [Indian lotus]
ref|XP_008457886.1|  PREDICTED: patatin-like protein 2                  107   9e-23   Cucumis melo [Oriental melon]
ref|XP_006365363.1|  PREDICTED: patatin group M-2-like                  107   1e-22   Solanum tuberosum [potatoes]
ref|XP_006354909.1|  PREDICTED: patatin-3-Kuras 1-like                  107   1e-22   Solanum tuberosum [potatoes]
ref|XP_002445639.1|  hypothetical protein SORBIDRAFT_07g023210          107   1e-22   Sorghum bicolor [broomcorn]
ref|XP_009370196.1|  PREDICTED: patatin-like protein 2                  107   1e-22   Pyrus x bretschneideri [bai li]
gb|AFS33545.1|  patatin-like protein                                    102   1e-22   Nicotiana tabacum [American tobacco]
ref|XP_009794733.1|  PREDICTED: patatin-like protein 2                  107   1e-22   Nicotiana sylvestris
ref|XP_008220198.1|  PREDICTED: patatin-like protein 2                  107   1e-22   
ref|XP_010320346.1|  PREDICTED: patatin-like protein 2 isoform X1       107   1e-22   Solanum lycopersicum
gb|KHN04516.1|  Patatin group A-3                                       107   1e-22   Glycine soja [wild soybean]
ref|XP_004291128.2|  PREDICTED: patatin-like protein 2                  107   1e-22   Fragaria vesca subsp. vesca
gb|AAK18751.1|  patatin-like protein                                    106   2e-22   Vigna unguiculata
ref|XP_010059970.1|  PREDICTED: patatin-like protein 2 isoform X1       106   2e-22   Eucalyptus grandis [rose gum]
ref|XP_011038246.1|  PREDICTED: patatin-like protein 2 isoform X2       106   2e-22   Populus euphratica
ref|XP_011038245.1|  PREDICTED: patatin-like protein 2 isoform X1       106   2e-22   Populus euphratica
gb|EMT08201.1|  Patatin-T5                                              105   2e-22   
emb|CDP04311.1|  unnamed protein product                                106   2e-22   Coffea canephora [robusta coffee]
ref|XP_002510258.1|  Patatin T5 precursor, putative                     106   2e-22   
gb|AFK35290.1|  unknown                                                 106   2e-22   Medicago truncatula
ref|XP_010064191.1|  PREDICTED: patatin-like protein 2                  106   2e-22   Eucalyptus grandis [rose gum]
ref|XP_010028264.1|  PREDICTED: patatin-like protein 1                  106   2e-22   Eucalyptus grandis [rose gum]
ref|XP_003603015.1|  Patatin-like protein                               106   2e-22   Medicago truncatula
ref|XP_011038242.1|  PREDICTED: patatin-like protein 2                  105   3e-22   Populus euphratica
ref|XP_010041051.1|  PREDICTED: patatin-like protein 2                  105   3e-22   Eucalyptus grandis [rose gum]
ref|XP_010059969.1|  PREDICTED: patatin-like protein 2 isoform X2       105   3e-22   Eucalyptus grandis [rose gum]
ref|XP_003589238.1|  Patatin-like protein                               105   3e-22   
ref|XP_003589236.1|  Patatin-like protein                               105   3e-22   Medicago truncatula
ref|XP_008393828.1|  PREDICTED: patatin-like protein 2 isoform X2       105   3e-22   
ref|XP_006829702.1|  PREDICTED: patatin-like protein 2                  105   3e-22   Amborella trichopoda
ref|XP_008457871.1|  PREDICTED: patatin-like protein 3                  105   4e-22   Cucumis melo [Oriental melon]
ref|XP_006601293.1|  PREDICTED: patatin-11-like                         105   4e-22   Glycine max [soybeans]
gb|EMS45954.1|  Patatin group A-3                                       105   4e-22   Triticum urartu
ref|XP_010942708.1|  PREDICTED: patatin-like protein 2                  105   4e-22   Elaeis guineensis
ref|XP_003577355.1|  PREDICTED: patatin-like protein 1                  105   4e-22   Brachypodium distachyon [annual false brome]
ref|XP_003527713.1|  PREDICTED: patatin-like                            105   4e-22   Glycine max [soybeans]
ref|XP_002463192.1|  hypothetical protein SORBIDRAFT_02g039470          105   5e-22   
ref|NP_001068268.1|  Os11g0614400                                       105   5e-22   
ref|XP_003577354.1|  PREDICTED: patatin-like protein 1                  105   5e-22   Brachypodium distachyon [annual false brome]
gb|EAY88437.1|  hypothetical protein OsI_09902                          105   5e-22   Oryza sativa Indica Group [Indian rice]
gb|EMT07292.1|  Patatin-11                                              103   5e-22   
dbj|BAJ99822.1|  predicted protein                                      105   5e-22   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CBI25858.3|  unnamed protein product                                104   6e-22   Vitis vinifera
emb|CDM80597.1|  unnamed protein product                                105   6e-22   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010680418.1|  PREDICTED: patatin-like protein 1                  105   6e-22   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_001140826.1|  uncharacterized protein LOC100272901               105   6e-22   Zea mays [maize]
ref|XP_009383171.1|  PREDICTED: patatin-like protein 2                  105   7e-22   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003611772.1|  Patatin-like protein                               104   7e-22   Medicago truncatula
ref|XP_009403085.1|  PREDICTED: patatin-like protein 2                  104   7e-22   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002262942.1|  PREDICTED: patatin-like protein 2                  104   7e-22   Vitis vinifera
ref|NP_001062043.1|  Os08g0477100                                       105   8e-22   
ref|XP_011038243.1|  PREDICTED: patatin-like protein 2 isoform X1       104   8e-22   Populus euphratica
ref|XP_009629882.1|  PREDICTED: patatin-like protein 2                  102   8e-22   Nicotiana tomentosiformis
ref|XP_011038244.1|  PREDICTED: patatin-like protein 2 isoform X2       104   8e-22   Populus euphratica
ref|XP_009367484.1|  PREDICTED: patatin-like protein 2                  104   8e-22   Pyrus x bretschneideri [bai li]
emb|CAN62059.1|  hypothetical protein VITISV_024099                     104   9e-22   Vitis vinifera
emb|CDP01335.1|  unnamed protein product                                104   9e-22   Coffea canephora [robusta coffee]
ref|XP_010317808.1|  PREDICTED: patatin-like protein 2 isoform X1       104   1e-21   Solanum lycopersicum
ref|XP_012071992.1|  PREDICTED: patatin-like protein 2                  104   1e-21   Jatropha curcas
ref|XP_007160832.1|  hypothetical protein PHAVU_001G020300g             104   1e-21   Phaseolus vulgaris [French bean]
ref|XP_004234672.1|  PREDICTED: patatin-like protein 3 isoform X2       104   1e-21   Solanum lycopersicum
ref|XP_007047215.1|  Uncharacterized protein TCM_000589                 104   1e-21   
ref|XP_006354910.1|  PREDICTED: LOW QUALITY PROTEIN: patatin grou...    104   1e-21   
emb|CDM80590.1|  unnamed protein product                                102   1e-21   Triticum aestivum [Canadian hard winter wheat]
gb|KCW66177.1|  hypothetical protein EUGRSUZ_F00013                     100   1e-21   Eucalyptus grandis [rose gum]
gb|EAZ07350.1|  hypothetical protein OsI_29600                          104   1e-21   Oryza sativa Indica Group [Indian rice]
gb|ABK94710.1|  unknown                                                 102   1e-21   Populus trichocarpa [western balsam poplar]
gb|KGN62064.1|  hypothetical protein Csa_2G294910                       103   1e-21   Cucumis sativus [cucumbers]
ref|XP_007136666.1|  hypothetical protein PHAVU_009G063500g             103   1e-21   Phaseolus vulgaris [French bean]
gb|KHN42072.1|  Patatin group A-3                                       104   1e-21   Glycine soja [wild soybean]
ref|XP_010509133.1|  PREDICTED: patatin-like protein 2                99.0    1e-21   Camelina sativa [gold-of-pleasure]
ref|XP_006660213.1|  PREDICTED: patatin-3-Kuras 1-like                  103   1e-21   Oryza brachyantha
ref|XP_009380972.1|  PREDICTED: patatin-like protein 2                  103   2e-21   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004979713.1|  PREDICTED: patatin-3-Kuras 1-like                  103   2e-21   Setaria italica
gb|KDO79282.1|  hypothetical protein CISIN_1g015720mg                   103   2e-21   Citrus sinensis [apfelsine]
ref|XP_011070718.1|  PREDICTED: patatin-like protein 2                  103   2e-21   
gb|AEF30538.1|  patatin-like phospholipase 1                            103   2e-21   Capsicum annuum
ref|XP_010238243.1|  PREDICTED: patatin-like protein 2 isoform X3       102   2e-21   Brachypodium distachyon [annual false brome]
gb|EMS54202.1|  Patatin group A-3                                       105   2e-21   Triticum urartu
gb|KJB58444.1|  hypothetical protein B456_009G210400                    103   2e-21   Gossypium raimondii
emb|CBI19551.3|  unnamed protein product                              85.9    2e-21   Vitis vinifera
ref|XP_004973692.1|  PREDICTED: patatin-3-Kuras 1-like                  103   2e-21   Setaria italica
gb|KGN62540.1|  hypothetical protein Csa_2G360570                       102   2e-21   Cucumis sativus [cucumbers]
ref|XP_008241509.1|  PREDICTED: patatin-like protein 3                  103   3e-21   Prunus mume [ume]
ref|XP_008393826.1|  PREDICTED: patatin-like protein 2                  103   3e-21   
gb|KGN62057.1|  Patatin-like protein                                  97.8    3e-21   Cucumis sativus [cucumbers]
ref|XP_010926367.1|  PREDICTED: patatin-like protein 2                  102   3e-21   Elaeis guineensis
ref|XP_003576611.1|  PREDICTED: patatin-like protein 2 isoform X1       102   3e-21   Brachypodium distachyon [annual false brome]
ref|XP_007160830.1|  hypothetical protein PHAVU_001G020100g             102   3e-21   Phaseolus vulgaris [French bean]
ref|XP_009792908.1|  PREDICTED: patatin-like protein 1                  102   3e-21   Nicotiana sylvestris
ref|XP_011649370.1|  PREDICTED: patatin-like protein 3                  102   3e-21   Cucumis sativus [cucumbers]
emb|CAA73328.1|  patatin-like protein                                   102   4e-21   Cucumis sativus [cucumbers]
ref|XP_003572284.1|  PREDICTED: patatin-like protein 2                  103   4e-21   Brachypodium distachyon [annual false brome]
ref|XP_007222710.1|  hypothetical protein PRUPE_ppa006466mg             102   4e-21   Prunus persica
gb|EMS52853.1|  Patatin group M-3                                       102   4e-21   Triticum urartu
gb|KJB29508.1|  hypothetical protein B456_005G104200                    102   4e-21   Gossypium raimondii
ref|XP_008393827.1|  PREDICTED: patatin-like protein 2 isoform X1       102   5e-21   
ref|XP_009367378.1|  PREDICTED: patatin-like protein 2                  102   5e-21   
ref|XP_010525997.1|  PREDICTED: patatin-like protein 2                  102   5e-21   Tarenaya hassleriana [spider flower]
ref|XP_007160175.1|  hypothetical protein PHAVU_002G299200g             100   5e-21   Phaseolus vulgaris [French bean]
ref|XP_011071103.1|  PREDICTED: patatin-like protein 2                  102   5e-21   Sesamum indicum [beniseed]
ref|XP_002445641.1|  hypothetical protein SORBIDRAFT_07g023230          102   5e-21   
gb|EMT30617.1|  Patatin group A-3                                       102   6e-21   
ref|XP_004152794.1|  PREDICTED: patatin-like protein 2                  102   6e-21   Cucumis sativus [cucumbers]
ref|NP_001149326.1|  patatin class 1                                    102   6e-21   
ref|XP_011099181.1|  PREDICTED: patatin-like protein 1                  102   6e-21   Sesamum indicum [beniseed]
tpg|DAA48471.1|  TPA: patatin class 1                                   102   6e-21   
emb|CDP02483.1|  unnamed protein product                                102   6e-21   Coffea canephora [robusta coffee]
ref|XP_008670247.1|  PREDICTED: patatin-like protein 2 isoform X2       102   7e-21   Zea mays [maize]
ref|XP_006339912.1|  PREDICTED: patatin-05-like                         102   7e-21   Solanum tuberosum [potatoes]
ref|XP_010064133.1|  PREDICTED: patatin-like protein 2                  101   7e-21   Eucalyptus grandis [rose gum]
emb|CDM80622.1|  unnamed protein product                                100   7e-21   Triticum aestivum [Canadian hard winter wheat]
ref|XP_004233432.1|  PREDICTED: patatin-like protein 1                  102   7e-21   Solanum lycopersicum
gb|AAF98369.1|AF158253_1  patatin-like protein 3                        102   7e-21   Nicotiana tabacum [American tobacco]
ref|XP_010028281.1|  PREDICTED: patatin-like protein 2                  101   8e-21   Eucalyptus grandis [rose gum]
gb|KJB58443.1|  hypothetical protein B456_009G210300                    100   8e-21   Gossypium raimondii
ref|XP_002310157.1|  hypothetical protein POPTR_0007s11360g             101   8e-21   Populus trichocarpa [western balsam poplar]
ref|XP_009603683.1|  PREDICTED: patatin-like protein 1                  101   9e-21   Nicotiana tomentosiformis
ref|XP_010229387.1|  PREDICTED: patatin-like protein 1                  100   9e-21   
emb|CBI25856.3|  unnamed protein product                              97.4    1e-20   Vitis vinifera
ref|XP_006829694.1|  PREDICTED: patatin-like protein 1                  101   1e-20   Amborella trichopoda
ref|XP_006466736.1|  PREDICTED: patatin-11-like                         101   1e-20   
ref|XP_008357460.1|  PREDICTED: LOW QUALITY PROTEIN: patatin-like...    103   1e-20   
emb|CDP02475.1|  unnamed protein product                                101   1e-20   Coffea canephora [robusta coffee]
ref|XP_006354908.1|  PREDICTED: patatin-3-Kuras 1-like                  101   1e-20   Solanum tuberosum [potatoes]
ref|XP_011008336.1|  PREDICTED: patatin-like protein 3                  101   1e-20   Populus euphratica
gb|KCW66469.1|  hypothetical protein EUGRSUZ_F002673                  99.4    1e-20   Eucalyptus grandis [rose gum]
ref|XP_006360228.1|  PREDICTED: patatin-3-Kuras 1-like                  101   1e-20   Solanum tuberosum [potatoes]
ref|XP_008457870.1|  PREDICTED: patatin-like protein 2 isoform X2       100   1e-20   Cucumis melo [Oriental melon]
ref|XP_010059967.1|  PREDICTED: patatin-like protein 2                  101   1e-20   Eucalyptus grandis [rose gum]
ref|XP_009589625.1|  PREDICTED: patatin-like protein 3                  101   1e-20   Nicotiana tomentosiformis
ref|XP_003574632.1|  PREDICTED: patatin-like protein 2                  100   1e-20   
ref|XP_009390266.1|  PREDICTED: patatin-like protein 2 isoform X2       101   1e-20   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006338216.1|  PREDICTED: patatin-3-Kuras 1-like                  100   1e-20   Solanum tuberosum [potatoes]
ref|XP_008670872.1|  PREDICTED: patatin-like protein 1                  100   1e-20   
ref|XP_004511941.1|  PREDICTED: patatin-05-like                         100   1e-20   Cicer arietinum [garbanzo]
ref|XP_006659498.1|  PREDICTED: patatin-T5-like                         101   2e-20   Oryza brachyantha
ref|XP_009390265.1|  PREDICTED: patatin-like protein 2 isoform X1       100   2e-20   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008776828.1|  PREDICTED: patatin-like protein 2                  100   2e-20   
ref|XP_010269056.1|  PREDICTED: patatin-like protein 2 isoform X1       100   2e-20   Nelumbo nucifera [Indian lotus]
ref|XP_006291236.1|  hypothetical protein CARUB_v10017367mg             100   2e-20   Capsella rubella
ref|XP_002281798.1|  PREDICTED: patatin-like protein 1                  100   2e-20   Vitis vinifera
ref|XP_010059972.1|  PREDICTED: patatin-like protein 2                  100   2e-20   Eucalyptus grandis [rose gum]
ref|XP_010652820.1|  PREDICTED: patatin-like protein 1                  100   2e-20   
ref|XP_003611771.1|  Patatin-like protein                               100   2e-20   Medicago truncatula
ref|XP_009349524.1|  PREDICTED: patatin-like protein 2                  100   2e-20   Pyrus x bretschneideri [bai li]
ref|XP_008457877.1|  PREDICTED: LOW QUALITY PROTEIN: patatin-like...    100   2e-20   
emb|CBI21444.3|  unnamed protein product                                100   2e-20   Vitis vinifera
ref|XP_009780403.1|  PREDICTED: patatin-like protein 2                  100   2e-20   Nicotiana sylvestris
ref|XP_011099197.1|  PREDICTED: patatin-like protein 2                  100   2e-20   Sesamum indicum [beniseed]
ref|XP_008777430.1|  PREDICTED: patatin-like protein 2                  100   2e-20   Phoenix dactylifera
ref|XP_006660709.1|  PREDICTED: patatin-2-Kuras 2-like isoform X1     99.8    2e-20   
ref|XP_006380722.1|  hypothetical protein POPTR_0007s11370g             100   2e-20   
ref|XP_009626816.1|  PREDICTED: patatin-like protein 3                  100   2e-20   Nicotiana tomentosiformis
gb|KFK30329.1|  hypothetical protein AALP_AA7G247700                    100   2e-20   Arabis alpina [alpine rockcress]
ref|XP_007226924.1|  hypothetical protein PRUPE_ppa015844mg             100   2e-20   
gb|EYU30123.1|  hypothetical protein MIMGU_mgv1a005982mg                100   2e-20   Erythranthe guttata [common monkey flower]
ref|XP_007202991.1|  hypothetical protein PRUPE_ppa019010mg             100   2e-20   Prunus persica
ref|XP_006294513.1|  hypothetical protein CARUB_v10023546mg           99.8    3e-20   
ref|XP_002510257.1|  Patatin T5 precursor, putative                     100   3e-20   Ricinus communis
ref|XP_006374978.1|  hypothetical protein POPTR_0014s03290g             100   3e-20   
gb|KJB63809.1|  hypothetical protein B456_010G0176001                 97.1    3e-20   Gossypium raimondii
ref|XP_002467750.1|  hypothetical protein SORBIDRAFT_01g033380          100   3e-20   Sorghum bicolor [broomcorn]
ref|XP_011039207.1|  PREDICTED: patatin-like protein 2                  100   3e-20   Populus euphratica
ref|XP_006663045.1|  PREDICTED: patatin-2-Kuras 1-like                  100   3e-20   Oryza brachyantha
ref|XP_008457869.1|  PREDICTED: patatin-like protein 2 isoform X1       100   3e-20   Cucumis melo [Oriental melon]
ref|XP_010059968.1|  PREDICTED: patatin-like protein 2 isoform X1       100   3e-20   Eucalyptus grandis [rose gum]
ref|XP_004232051.1|  PREDICTED: patatin-like protein 3                  100   3e-20   Solanum lycopersicum
ref|XP_002523555.1|  Patatin precursor, putative                        100   3e-20   Ricinus communis
ref|XP_011030334.1|  PREDICTED: patatin-like protein 2 isoform X2       100   3e-20   Populus euphratica
ref|XP_009781952.1|  PREDICTED: patatin-like protein 3                  100   3e-20   Nicotiana sylvestris
ref|XP_002510255.1|  Patatin precursor, putative                        100   3e-20   Ricinus communis
ref|XP_007017303.1|  Phospholipase A 2A, IIA,PLA2A isoform 1            100   3e-20   
ref|XP_008354710.1|  PREDICTED: LOW QUALITY PROTEIN: patatin-like...    100   3e-20   
ref|XP_006339914.1|  PREDICTED: patatin-05-like                         100   3e-20   Solanum tuberosum [potatoes]
ref|XP_008668146.1|  PREDICTED: patatin T5 isoform X1                   100   3e-20   
emb|CAN71554.1|  hypothetical protein VITISV_034739                     101   3e-20   Vitis vinifera
ref|XP_011030324.1|  PREDICTED: patatin-like protein 2 isoform X1       100   3e-20   Populus euphratica
ref|XP_009370176.1|  PREDICTED: patatin-like protein 2                  100   3e-20   Pyrus x bretschneideri [bai li]
tpg|DAA42306.1|  TPA: patatin T5                                        100   3e-20   
ref|XP_012079210.1|  PREDICTED: patatin-like protein 1                  100   3e-20   
ref|XP_007017307.1|  Phospholipase A 2A, IIA,PLA2A isoform 1            100   3e-20   
gb|KJB58442.1|  hypothetical protein B456_009G210300                    100   4e-20   Gossypium raimondii
gb|KGN62054.1|  hypothetical protein Csa_2G292840                     99.4    4e-20   Cucumis sativus [cucumbers]
ref|XP_006374974.1|  hypothetical protein POPTR_0014s03260g           99.8    4e-20   
ref|XP_010942711.1|  PREDICTED: patatin-like protein 2                96.7    4e-20   
gb|ACN33435.1|  unknown                                                 100   4e-20   
gb|EAZ07347.1|  hypothetical protein OsI_29596                          100   4e-20   
ref|XP_008241529.1|  PREDICTED: patatin-like protein 3                99.4    4e-20   
ref|XP_008801795.1|  PREDICTED: patatin-like protein 2                99.0    4e-20   
ref|XP_010320535.1|  PREDICTED: patatin-like protein 2                99.4    4e-20   
ref|XP_008797306.1|  PREDICTED: patatin-like protein 2                99.8    5e-20   
ref|XP_010101001.1|  Patatin group A-3                                99.8    5e-20   
ref|XP_010548401.1|  PREDICTED: patatin-like protein 1                99.4    5e-20   
gb|KGN62071.1|  hypothetical protein Csa_2G295960                     97.8    5e-20   
ref|XP_009589750.1|  PREDICTED: patatin-like protein 2                99.8    5e-20   
tpg|DAA42302.1|  TPA: hypothetical protein ZEAMMB73_996038              100   5e-20   
ref|XP_008357456.1|  PREDICTED: patatin-like protein 2                97.4    5e-20   
emb|CDP07842.1|  unnamed protein product                              99.4    5e-20   
ref|XP_004233636.1|  PREDICTED: patatin-like protein 1                  101   6e-20   
ref|XP_010503027.1|  PREDICTED: patatin-like protein 2                99.4    6e-20   
gb|KCW66172.1|  hypothetical protein EUGRSUZ_F00008                   93.6    6e-20   
gb|KGN62063.1|  hypothetical protein Csa_2G294900                     98.2    6e-20   
ref|XP_002445640.1|  hypothetical protein SORBIDRAFT_07g023220          100   6e-20   
ref|XP_003577353.1|  PREDICTED: patatin-like protein 1                99.0    6e-20   
ref|XP_008241530.1|  PREDICTED: patatin-like protein 2                99.0    6e-20   
ref|XP_006374976.1|  hypothetical protein POPTR_0014s03280g           99.4    6e-20   
ref|XP_009370175.1|  PREDICTED: patatin-like protein 2                99.4    6e-20   
ref|XP_002880809.1|  hypothetical protein ARALYDRAFT_344337           99.4    6e-20   
emb|CDP11080.1|  unnamed protein product                              98.6    6e-20   
ref|XP_002277305.1|  PREDICTED: patatin-like protein 1                99.0    6e-20   
gb|AAX99411.1|  patatin-like protein                                  99.4    7e-20   
ref|XP_006374977.1|  hypothetical protein POPTR_0014s03280g           99.4    7e-20   
ref|XP_004148073.1|  PREDICTED: patatin-like protein 2                99.0    7e-20   
ref|XP_008220192.1|  PREDICTED: patatin-like protein 2                99.4    7e-20   
gb|EMS63453.1|  Patatin-3-Kuras 1                                     98.2    7e-20   
gb|KHN12766.1|  Patatin-3-Kuras 1                                     97.8    7e-20   
ref|XP_006659497.1|  PREDICTED: patatin-3-Kuras 1-like                99.4    7e-20   
ref|XP_009799007.1|  PREDICTED: patatin-like protein 3                99.0    8e-20   
gb|AFJ92643.2|  phospholipase A2                                      99.0    8e-20   
gb|KJB63808.1|  hypothetical protein B456_010G0176001                 96.7    8e-20   
gb|KCW66178.1|  hypothetical protein EUGRSUZ_F00014                   98.6    9e-20   
gb|EMT32376.1|  Patatin group A-3                                     98.6    9e-20   
ref|XP_010109903.1|  Patatin group A-3                                98.6    1e-19   
ref|XP_004980751.1|  PREDICTED: patatin group D-2-like                97.4    1e-19   
gb|KCW88897.1|  hypothetical protein EUGRSUZ_A01223                   98.6    1e-19   
ref|XP_008671927.1|  PREDICTED: patatin-like protein 3                97.4    1e-19   
ref|XP_009370177.1|  PREDICTED: patatin-like protein 2                98.6    1e-19   
ref|XP_010068219.1|  PREDICTED: patatin-like protein 2                98.6    1e-19   
ref|XP_008457873.1|  PREDICTED: patatin-like protein 2                98.2    1e-19   
ref|XP_008777593.1|  PREDICTED: patatin-like protein 3                95.5    1e-19   
ref|XP_008444643.1|  PREDICTED: patatin-like protein 2                98.6    1e-19   
ref|XP_008337062.1|  PREDICTED: patatin-like protein 2                98.2    1e-19   
ref|XP_006374973.1|  hypothetical protein POPTR_0014s03250g           98.2    1e-19   
ref|XP_008813725.1|  PREDICTED: patatin-like protein 2 isoform X2     97.4    1e-19   
ref|XP_010509131.1|  PREDICTED: patatin-like protein 2                98.2    2e-19   
tpg|DAA42305.1|  TPA: hypothetical protein ZEAMMB73_127435            99.4    2e-19   
ref|XP_007017304.1|  Phospholipase A 2A, IIA,PLA2A isoform 2          98.2    2e-19   
gb|KGN62055.1|  hypothetical protein Csa_2G292850                     97.1    2e-19   
ref|XP_009590385.1|  PREDICTED: patatin-like protein 2                97.1    2e-19   
ref|XP_011649374.1|  PREDICTED: LOW QUALITY PROTEIN: patatin-like...  97.8    2e-19   
tpg|DAA42304.1|  TPA: hypothetical protein ZEAMMB73_137328            97.1    2e-19   
ref|XP_008220193.1|  PREDICTED: patatin-like protein 2 isoform X1     98.2    2e-19   
ref|XP_008220177.1|  PREDICTED: patatin-like protein 2                97.8    2e-19   
ref|XP_008790455.1|  PREDICTED: patatin-like protein 3                95.9    2e-19   
ref|XP_008220195.1|  PREDICTED: patatin-like protein 2 isoform X2     97.8    2e-19   
ref|XP_010028265.1|  PREDICTED: patatin-like protein 3                97.4    2e-19   
ref|XP_002305891.2|  hypothetical protein POPTR_0004s08270g           97.8    2e-19   
ref|XP_011649368.1|  PREDICTED: patatin-like protein 3                97.8    2e-19   
emb|CDP01331.1|  unnamed protein product                              97.8    2e-19   
tpg|DAA45677.1|  TPA: hypothetical protein ZEAMMB73_598493            97.4    2e-19   
ref|XP_002284571.1|  PREDICTED: patatin-like protein 2                97.8    2e-19   
ref|XP_010926529.1|  PREDICTED: patatin-like protein 2                98.6    2e-19   
gb|KJB40252.1|  hypothetical protein B456_007G053800                  97.4    2e-19   
emb|CDX72620.1|  BnaC07g46420D                                        97.8    2e-19   
ref|XP_004511942.1|  PREDICTED: patatin-05-like                       97.4    2e-19   
gb|KHG27256.1|  Patatin group M-3                                     97.4    3e-19   
ref|XP_010268755.1|  PREDICTED: patatin-like protein 2                97.1    3e-19   
emb|CBI19544.3|  unnamed protein product                              98.2    3e-19   
sp|Q6ZJD3.1|PLP2_ORYSJ  RecName: Full=Patatin-like protein 2; Sho...  97.4    3e-19   
emb|CBI21441.3|  unnamed protein product                              99.4    3e-19   
ref|XP_008813724.1|  PREDICTED: patatin-like protein 2 isoform X1     97.4    3e-19   
ref|XP_010907851.1|  PREDICTED: patatin-like protein 2                97.4    3e-19   
ref|XP_004288052.1|  PREDICTED: patatin-like protein 1                97.4    3e-19   
ref|XP_004973687.1|  PREDICTED: patatin-2-Kuras 1-like isoform X1     97.8    3e-19   
ref|XP_010061770.1|  PREDICTED: patatin-like protein 2 isoform X1     97.4    3e-19   
ref|XP_006466737.1|  PREDICTED: patatin-14-like                       97.1    3e-19   
ref|XP_011649366.1|  PREDICTED: patatin-like protein 2                97.1    3e-19   
ref|XP_009138468.1|  PREDICTED: patatin-like protein 3                97.4    3e-19   
ref|XP_007227189.1|  hypothetical protein PRUPE_ppa019532mg           97.4    3e-19   
ref|XP_007227183.1|  hypothetical protein PRUPE_ppa019615mg           97.1    3e-19   
emb|CDX75621.1|  BnaA01g00810D                                        97.1    3e-19   
ref|XP_008656522.1|  PREDICTED: patatin-like protein 1                97.4    3e-19   
ref|XP_009139093.1|  PREDICTED: patatin-like protein 3                97.1    3e-19   
ref|XP_004973688.1|  PREDICTED: patatin-2-Kuras 1-like isoform X2     97.4    3e-19   
ref|XP_002277318.1|  PREDICTED: patatin-like protein 1                97.1    3e-19   
ref|XP_008457875.1|  PREDICTED: patatin-like protein 2 isoform X1     97.1    3e-19   
ref|XP_011017228.1|  PREDICTED: patatin-like protein 2                97.1    4e-19   
ref|XP_002523558.1|  Patatin precursor, putative                      97.1    4e-19   
ref|XP_008457876.1|  PREDICTED: patatin-like protein 2 isoform X2     97.1    4e-19   
ref|XP_009589751.1|  PREDICTED: patatin-like protein 1                97.1    4e-19   
ref|XP_010547841.1|  PREDICTED: patatin-like protein 2                97.1    4e-19   
ref|XP_008808514.1|  PREDICTED: patatin-like protein 2                97.8    4e-19   
ref|XP_004973689.1|  PREDICTED: LOW QUALITY PROTEIN: patatin-2-Ku...  97.1    4e-19   
ref|XP_010269022.1|  PREDICTED: patatin-like protein 2 isoform X2     96.3    4e-19   
gb|KCW78409.1|  hypothetical protein EUGRSUZ_D02575                   96.7    5e-19   
ref|XP_006380710.1|  hypothetical protein POPTR_0007s11200g           95.9    5e-19   
ref|XP_010102581.1|  Patatin group A-3                                96.7    5e-19   
ref|NP_001151996.1|  patatin T5                                       96.7    5e-19   
ref|XP_008670246.1|  PREDICTED: patatin-like protein 2 isoform X1     96.7    5e-19   
ref|XP_010548404.1|  PREDICTED: patatin-like protein 1 isoform X1     96.7    5e-19   
ref|XP_010068174.1|  PREDICTED: patatin-like protein 2                96.7    5e-19   
ref|XP_006473887.1|  PREDICTED: patatin-05-like                       96.7    5e-19   
ref|XP_002445638.1|  hypothetical protein SORBIDRAFT_07g023200        97.1    6e-19   
ref|XP_008228777.1|  PREDICTED: LOW QUALITY PROTEIN: patatin-like...  96.3    6e-19   
ref|XP_002869006.1|  hypothetical protein ARALYDRAFT_490916           96.7    6e-19   
ref|XP_010054916.1|  PREDICTED: patatin-like protein 2                96.7    6e-19   
ref|XP_006374982.1|  hypothetical protein POPTR_0014s03330g           96.3    6e-19   
ref|XP_006374981.1|  hypothetical protein POPTR_0014s03320g           96.3    6e-19   
ref|XP_006411934.1|  hypothetical protein EUTSA_v10025319mg           96.3    7e-19   
gb|KCW66458.1|  hypothetical protein EUGRSUZ_F00254                   96.3    7e-19   
ref|XP_009367377.1|  PREDICTED: patatin-like protein 2                95.9    8e-19   
gb|AAM20447.1|  patatin-like protein                                  95.1    8e-19   
ref|XP_010102583.1|  Patatin group A-3                                95.9    8e-19   
ref|XP_006434812.1|  hypothetical protein CICLE_v10001337mg           94.7    8e-19   
ref|XP_010064186.1|  PREDICTED: patatin-like protein 2                96.3    8e-19   
ref|XP_009773110.1|  PREDICTED: patatin-like protein 2                96.3    8e-19   
ref|XP_002310732.1|  patatin family protein                           95.9    8e-19   
ref|XP_006434817.1|  hypothetical protein CICLE_v10003658mg           95.9    8e-19   
ref|XP_010089434.1|  Patatin group A-3                                95.9    9e-19   
ref|XP_007224534.1|  hypothetical protein PRUPE_ppa024261mg           95.9    9e-19   
ref|XP_008664527.1|  PREDICTED: patatin-like protein 2                96.3    9e-19   
ref|XP_007226655.1|  hypothetical protein PRUPE_ppa021897mg           95.9    9e-19   
ref|XP_011099198.1|  PREDICTED: patatin-like protein 2                95.9    9e-19   
ref|XP_006488152.1|  PREDICTED: patatin-05-like                       95.9    1e-18   
ref|XP_006424637.1|  hypothetical protein CICLE_v10030027mg           95.9    1e-18   
ref|XP_009409669.1|  PREDICTED: patatin-like protein 1                96.3    1e-18   
ref|XP_004288050.1|  PREDICTED: patatin-like protein 1                95.9    1e-18   
ref|XP_010270650.1|  PREDICTED: patatin-like protein 2                95.9    1e-18   
ref|XP_009797488.1|  PREDICTED: patatin-like protein 2 isoform X1     95.5    1e-18   
ref|XP_010514711.1|  PREDICTED: patatin-like protein 2                95.5    1e-18   
emb|CDX69271.1|  BnaC01g01820D                                        95.5    1e-18   
ref|XP_004291131.1|  PREDICTED: patatin-like protein 2                95.5    1e-18   
ref|XP_011458947.1|  PREDICTED: patatin-like protein 2                90.1    1e-18   
ref|XP_009589752.1|  PREDICTED: patatin-like protein 2                95.5    1e-18   
ref|XP_008801772.1|  PREDICTED: patatin-like protein 2                95.1    1e-18   
gb|KFK32501.1|  hypothetical protein AALP_AA6G250900                  95.1    1e-18   
ref|XP_010064187.1|  PREDICTED: patatin-like protein 2                95.5    2e-18   
ref|XP_009393655.1|  PREDICTED: patatin-like protein 2                95.1    2e-18   
emb|CAA11041.1|  latex allergen                                       94.7    2e-18   
ref|XP_002510259.1|  Patatin T5 precursor, putative                   95.1    2e-18   
emb|CAE85467.1|  putative latex allergen hev b 7.02                   94.7    2e-18   
ref|XP_009780402.1|  PREDICTED: patatin-like protein 2                95.1    2e-18   
ref|XP_006360248.1|  PREDICTED: patatin-05-like                       95.1    2e-18   
gb|EMS48649.1|  Patatin group A-3                                     96.3    2e-18   
ref|XP_008228776.1|  PREDICTED: patatin-like protein 2                95.1    2e-18   
ref|XP_002449852.1|  hypothetical protein SORBIDRAFT_05g024390        95.1    2e-18   
ref|XP_009612649.1|  PREDICTED: patatin-like protein 2                95.1    2e-18   
gb|KCW54997.1|  hypothetical protein EUGRSUZ_I00973                   93.6    2e-18   
gb|EMT18762.1|  Patatin group A-3                                     95.1    2e-18   
ref|NP_195422.3|  PATATIN-like protein 4                              95.1    2e-18   
gb|AAD22169.1|AF061282_23  patatin-like protein                       95.1    2e-18   
ref|XP_004288058.1|  PREDICTED: patatin-like protein 2                94.7    2e-18   
ref|XP_007203278.1|  hypothetical protein PRUPE_ppa025529mg           94.4    2e-18   
ref|XP_008777590.1|  PREDICTED: patatin-like protein 2                94.7    2e-18   
ref|XP_002510260.1|  Patatin T5 precursor, putative                   94.7    3e-18   
ref|XP_010446706.1|  PREDICTED: patatin-like protein 3                94.7    3e-18   
ref|XP_003572295.1|  PREDICTED: patatin-like protein 2                93.6    3e-18   
ref|XP_011007290.1|  PREDICTED: patatin-like protein 3                94.4    3e-18   
ref|XP_010269043.1|  PREDICTED: patatin-like protein 2 isoform X2     94.4    3e-18   
ref|XP_008777592.1|  PREDICTED: patatin-like protein 2                95.5    3e-18   
gb|EMT28251.1|  Patatin group A-3                                     94.7    3e-18   
ref|XP_006434815.1|  hypothetical protein CICLE_v10001337mg           94.4    3e-18   
dbj|BAJ98020.1|  predicted protein                                    94.7    3e-18   
emb|CAA11042.1|  latex allergen                                       94.4    3e-18   
ref|XP_006488153.1|  PREDICTED: patatin-3-Kuras 1-like                94.4    3e-18   
ref|XP_002282481.1|  PREDICTED: patatin-like protein 2                94.4    3e-18   
gb|AAF25553.1|AF113546_1  latex protein allergen Hev b 7              94.0    3e-18   
ref|XP_010939456.1|  PREDICTED: patatin-like protein 2 isoform X1     94.4    3e-18   
emb|CBI19552.3|  unnamed protein product                              95.1    3e-18   
ref|XP_010028279.1|  PREDICTED: patatin-like protein 2 isoform X2     93.2    3e-18   
ref|XP_002880810.1|  hypothetical protein ARALYDRAFT_481516           94.4    3e-18   
ref|XP_003544453.1|  PREDICTED: patatin-05                            94.4    3e-18   
ref|XP_008361010.1|  PREDICTED: patatin-like protein 2                94.0    3e-18   
emb|CDP01333.1|  unnamed protein product                              94.0    4e-18   
ref|XP_009367379.1|  PREDICTED: patatin-like protein 2                94.0    4e-18   
ref|XP_010664584.1|  PREDICTED: patatin-like protein 2 isoform X2     94.4    4e-18   
ref|XP_002451118.1|  hypothetical protein SORBIDRAFT_05g024380        94.0    4e-18   
ref|XP_004973691.1|  PREDICTED: patatin-3-Kuras 1-like isoform X2     93.6    4e-18   
gb|EMT12539.1|  Patatin group A-3                                     94.0    4e-18   
gb|EMS46263.1|  Patatin group A-3                                     94.0    4e-18   
ref|XP_009769118.1|  PREDICTED: patatin-like protein 2 isoform X2     93.6    5e-18   
gb|KCW66471.1|  hypothetical protein EUGRSUZ_F00268                   93.6    5e-18   
ref|XP_009367381.1|  PREDICTED: patatin-like protein 2                93.6    5e-18   
gb|AFW60364.1|  hypothetical protein ZEAMMB73_848325                  90.1    5e-18   
ref|XP_002301194.1|  patatin-like family protein                      94.0    5e-18   
ref|XP_004973690.1|  PREDICTED: patatin-3-Kuras 1-like isoform X1     94.0    5e-18   
ref|XP_012079211.1|  PREDICTED: patatin-like protein 5                93.6    6e-18   
ref|XP_004291130.1|  PREDICTED: patatin-like protein 2                93.6    6e-18   
ref|XP_009410116.1|  PREDICTED: patatin-like protein 2                93.6    6e-18   
ref|XP_009409647.1|  PREDICTED: patatin-like protein 2                92.4    6e-18   
ref|XP_010030595.1|  PREDICTED: patatin-like protein 2                93.2    7e-18   
sp|B8AQW7.1|PLP1_ORYSI  RecName: Full=Patatin-like protein 1          93.6    7e-18   
ref|XP_008384958.1|  PREDICTED: patatin-like protein 2                93.2    7e-18   
ref|NP_001050287.1|  Os03g0393900                                     93.6    8e-18   
gb|EMT06575.1|  Patatin-15                                            93.6    8e-18   
ref|XP_010028278.1|  PREDICTED: patatin-like protein 2 isoform X1     92.8    8e-18   
ref|XP_010417357.1|  PREDICTED: patatin-like protein 2                93.2    8e-18   
ref|XP_010061769.1|  PREDICTED: patatin-like protein 2                92.8    9e-18   
ref|XP_004310193.1|  PREDICTED: patatin-like protein 2                93.2    9e-18   
gb|ERM97117.1|  hypothetical protein AMTR_s00126p00059430             92.4    9e-18   
ref|XP_004499076.1|  PREDICTED: patatin-2-Kuras 3-like isoform X2     92.8    9e-18   
ref|XP_009368084.1|  PREDICTED: patatin-like protein 3                92.8    9e-18   
ref|XP_007203506.1|  hypothetical protein PRUPE_ppa024781mg           92.8    9e-18   
ref|XP_006651467.1|  PREDICTED: patatin-3-Kuras 1-like                93.2    9e-18   
ref|XP_010472600.1|  PREDICTED: patatin-like protein 2                93.2    9e-18   
dbj|BAK02816.1|  predicted protein                                    93.2    1e-17   
gb|EMS35749.1|  Patatin-3-Kuras 1                                     90.1    1e-17   
ref|XP_010429587.1|  PREDICTED: patatin-like protein 2                92.8    1e-17   
gb|EAZ07346.1|  hypothetical protein OsI_29595                        92.8    1e-17   
ref|XP_002282597.1|  PREDICTED: patatin-like protein 2 isoform X1     92.8    1e-17   
ref|XP_010238242.1|  PREDICTED: patatin-like protein 2 isoform X2     92.4    1e-17   
ref|XP_010942710.1|  PREDICTED: patatin-like protein 2                93.6    1e-17   
gb|KJB58441.1|  hypothetical protein B456_009G210000                  92.8    1e-17   
gb|KDP38381.1|  hypothetical protein JCGZ_04306                       92.0    1e-17   



>ref|XP_004238176.1| PREDICTED: patatin-like protein 2 [Solanum lycopersicum]
Length=405

 Score =   124 bits (312),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 67/107 (63%), Positives = 87/107 (81%), Gaps = 0/107 (0%)
 Frame = -1

Query  544  NPLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEE  365
            NPLI+VF+ +SADMVDYH + +FQAL++ D+YLRIQED+L G+ ASVDV TKENL+ L E
Sbjct  288  NPLIEVFTQSSADMVDYHNSVVFQALRSEDSYLRIQEDELSGTEASVDVATKENLERLVE  347

Query  364  VGkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
            +G+ LL KP+ ++NL TG +EP+PK GTN++ALKR A LL  ERR R
Sbjct  348  IGENLLKKPLSRVNLETGLSEPIPKGGTNEEALKRFATLLVNERRLR  394


 Score = 67.4 bits (163),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 37/59 (63%), Gaps = 2/59 (3%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPS--AGIFEVVRDATSLLAGPK*DGNPLIDV  527
            +APD+N RPLYA KDI PFY EH PKIFP    G+F  + +    L GPK DG  L  V
Sbjct  74   TAPDENNRPLYAAKDITPFYLEHCPKIFPQKKCGLFAPIGNIVQTLIGPKYDGKYLHQV  132


 Score = 43.9 bits (102),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 43/51 (84%), Gaps = 2/51 (4%)
 Frame = -3

Query  884  PP--GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            PP  G +IT+LSIDGGGIRGIIP TI+++LE +LQ LDG +AR ADYFDVI
Sbjct  10   PPTYGDLITVLSIDGGGIRGIIPATILSFLESQLQELDGKEARLADYFDVI  60



>ref|XP_006354913.1| PREDICTED: patatin-3-Kuras 1-like [Solanum tuberosum]
Length=406

 Score =   124 bits (312),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 67/107 (63%), Positives = 87/107 (81%), Gaps = 0/107 (0%)
 Frame = -1

Query  544  NPLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEE  365
            NPLI+VF+ +SADMVDYH + +FQAL++ D+YLRIQED+L G+ ASVDV TKENL+ L E
Sbjct  287  NPLIEVFTQSSADMVDYHNSVVFQALRSEDSYLRIQEDELSGTEASVDVATKENLERLVE  346

Query  364  VGkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
            +G+ LL KP+ ++NL TG +EP+PK GTN++ALKR A LL  ERR R
Sbjct  347  IGENLLKKPLSRVNLETGLSEPIPKGGTNEEALKRFATLLVNERRLR  393


 Score = 68.2 bits (165),  Expect(2) = 5e-16, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 39/58 (67%), Gaps = 1/58 (2%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPS-AGIFEVVRDATSLLAGPK*DGNPLIDV  527
            +APD+N RPLYA KDI PFY EH PKIFP  +G+F  +R+    L G K DG  L +V
Sbjct  74   TAPDENNRPLYAAKDITPFYLEHCPKIFPQKSGLFAPIRNIVQTLIGSKYDGKYLHEV  131


 Score = 44.7 bits (104),  Expect(2) = 5e-16, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 43/51 (84%), Gaps = 2/51 (4%)
 Frame = -3

Query  884  PP--GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            PP  G +IT+LSIDGGGIRGIIP TI+++LE +LQ LDG DAR ADYFDV+
Sbjct  10   PPTYGDLITVLSIDGGGIRGIIPATILSFLESQLQELDGSDARLADYFDVM  60



>emb|CBI19558.3| unnamed protein product [Vitis vinifera]
Length=423

 Score =   123 bits (309),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 71/120 (59%), Positives = 90/120 (75%), Gaps = 0/120 (0%)
 Frame = -1

Query  544  NPLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEE  365
             PL+DVF  ASADMVD+HI+ +FQAL + DNYLRIQ+D L+G  ASVDVTT+ENLD L +
Sbjct  288  TPLVDVFMQASADMVDFHISMVFQALHSEDNYLRIQDDTLRGKDASVDVTTEENLDNLVK  347

Query  364  VGkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRRTIAALNGGK*LSY  185
            +G++LL KPV ++NL TG +EPV   GTN++ALKR A LLS+E+R R     N  K L Y
Sbjct  348  IGERLLKKPVSRVNLETGLSEPVENGGTNEEALKRFAKLLSDEKRLRETRLPNPKKDLKY  407


 Score = 65.1 bits (157),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 36/52 (69%), Gaps = 1/52 (2%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFP-SAGIFEVVRDATSLLAGPK*DG  545
            +APD  KRPL+A K+I+PFY EHGPKIFP + GIF  +      L GPK DG
Sbjct  75   TAPDDQKRPLFAAKEIMPFYLEHGPKIFPETRGIFGWIMSIVRSLIGPKYDG  126



>ref|XP_006354911.1| PREDICTED: patatin-3-Kuras 1-like [Solanum tuberosum]
Length=406

 Score =   122 bits (305),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 66/107 (62%), Positives = 85/107 (79%), Gaps = 0/107 (0%)
 Frame = -1

Query  544  NPLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEE  365
            NPLI+VF+ +SADMVDYH + +FQAL++ D+YLRIQED+L G+ ASVDV TKENL+ L E
Sbjct  287  NPLIEVFTQSSADMVDYHNSVVFQALRSEDSYLRIQEDELSGTEASVDVATKENLERLVE  346

Query  364  VGkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
            +G+ LL KP+ ++NL TG  EP+PK GTN++AL R A LL  ERR R
Sbjct  347  IGENLLKKPLSRINLETGLTEPIPKGGTNEEALTRFATLLVNERRLR  393


 Score = 65.1 bits (157),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 39/58 (67%), Gaps = 1/58 (2%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPS-AGIFEVVRDATSLLAGPK*DGNPLIDV  527
            +APD+N RPLYA KDI PFY E+ PKIFP  +G+F  +R+    L G K DG  L +V
Sbjct  74   TAPDENNRPLYAAKDITPFYLENCPKIFPQKSGLFTPIRNIVQTLIGSKCDGKYLHEV  131


 Score = 44.7 bits (104),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 43/51 (84%), Gaps = 2/51 (4%)
 Frame = -3

Query  884  PP--GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            PP  G +IT+LSIDGGGIRGIIP TI+++LE +LQ LDG DAR ADYFDV+
Sbjct  10   PPTYGDLITVLSIDGGGIRGIIPATILSFLESQLQELDGSDARLADYFDVM  60



>emb|CBI19557.3| unnamed protein product [Vitis vinifera]
Length=849

 Score =   124 bits (311),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 71/119 (60%), Positives = 91/119 (76%), Gaps = 0/119 (0%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            PL+DVF  ASADMVD+HI+ +FQAL + DNYLRIQ+D L+G  ASVDVTT+ENLD L ++
Sbjct  289  PLVDVFMQASADMVDFHISMVFQALHSEDNYLRIQDDTLRGKDASVDVTTEENLDNLVKI  348

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRRTIAALNGGK*LSY  185
            G++LL KPV ++NL TG +EPV   GTN++ALKR A LLS+E+R R   + N  K L Y
Sbjct  349  GERLLKKPVSRVNLETGLSEPVENGGTNEEALKRFATLLSDEKRLRDARSPNPKKSLKY  407


 Score = 65.9 bits (159),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 35/55 (64%), Gaps = 1/55 (2%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPSA-GIFEVVRDATSLLAGPK*DGNPL  536
            +APD  KRPL+A KDI PFY EHGPKIFP   GIF  +      + GPK DG  L
Sbjct  75   TAPDDQKRPLFAAKDIKPFYLEHGPKIFPQTRGIFGWIMSILRSIVGPKYDGKYL  129



>ref|XP_009801077.1| PREDICTED: patatin-like protein 2 [Nicotiana sylvestris]
Length=403

 Score =   120 bits (302),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 65/106 (61%), Positives = 84/106 (79%), Gaps = 0/106 (0%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            PLI+VF+ +SAD+VDYH + +FQAL+  DNYLRIQED+L G+ ASVD+ TKENL+ L E+
Sbjct  289  PLIEVFTQSSADLVDYHNSVVFQALRCDDNYLRIQEDELNGTEASVDIATKENLERLVEI  348

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
            G+ LL KP+ ++NL TG  EP+PK GTN++ALKR A LL  ERR R
Sbjct  349  GQNLLKKPLSRVNLETGLAEPIPKGGTNEEALKRFARLLVNERRLR  394


 Score = 66.2 bits (160),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 38/59 (64%), Gaps = 2/59 (3%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPS--AGIFEVVRDATSLLAGPK*DGNPLIDV  527
            +APD+N RPLYA KDI PFY EH PKIFP    G+F  + +    + GPK DG  L +V
Sbjct  74   TAPDENDRPLYAAKDITPFYLEHCPKIFPQKKCGLFAPIGNMVQAIIGPKYDGKYLHEV  132


 Score = 44.7 bits (104),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 43/51 (84%), Gaps = 2/51 (4%)
 Frame = -3

Query  884  PP--GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            PP  G +IT+LSIDGGGIRGIIP TI+++LE +LQ LDG DAR ADYFDVI
Sbjct  10   PPTYGDLITVLSIDGGGIRGIIPATILSFLEAQLQELDGNDARLADYFDVI  60



>emb|CAN81920.1| hypothetical protein VITISV_021802 [Vitis vinifera]
Length=407

 Score =   120 bits (302),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 69/116 (59%), Positives = 89/116 (77%), Gaps = 0/116 (0%)
 Frame = -1

Query  544  NPLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEE  365
             PL+DVF  ASADMVD+HI+ +FQAL + DNYLRIQ+D L+G  ASVDVTT+ENLD L +
Sbjct  289  TPLVDVFMQASADMVDFHISMVFQALHSEDNYLRIQDDTLRGKDASVDVTTEENLDNLVK  348

Query  364  VGkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRRTIAALNGGK  197
            +G++LL KPV ++NL TG +EPV   GTN++ALKR A LLS+E+R R   + N  K
Sbjct  349  IGERLLKKPVSRVNLETGLSEPVENGGTNEEALKRFATLLSDEKRLRDARSPNPKK  404


 Score = 46.2 bits (108),  Expect(2) = 4e-09, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 25/42 (60%), Gaps = 1/42 (2%)
 Frame = -1

Query  658  KDIVPFYKEHGPKIFPSA-GIFEVVRDATSLLAGPK*DGNPL  536
            KDI PFY EHGPKIFP   GIF  +      + GPK DG  L
Sbjct  69   KDIKPFYLEHGPKIFPQTRGIFGWIMSILRSIVGPKYDGKYL  110


 Score = 43.1 bits (100),  Expect(2) = 4e-09, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 41/51 (80%), Gaps = 2/51 (4%)
 Frame = -3

Query  884  PP--GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            PP  G ++TILSIDGGGIRGIIP TI+A LE  LQ LDG DAR ADYFDVI
Sbjct  11   PPTYGNLVTILSIDGGGIRGIIPATILARLETRLQELDGDDARIADYFDVI  61



>ref|XP_002282432.1| PREDICTED: patatin-like protein 2 [Vitis vinifera]
 emb|CBI19556.3| unnamed protein product [Vitis vinifera]
Length=406

 Score =   120 bits (302),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 69/116 (59%), Positives = 89/116 (77%), Gaps = 0/116 (0%)
 Frame = -1

Query  544  NPLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEE  365
             PL+DVF  ASADMVD+HI+ +FQAL + DNYLRIQ+D L+G  ASVDVTT+ENLD L +
Sbjct  288  TPLVDVFMQASADMVDFHISMVFQALHSEDNYLRIQDDTLRGKDASVDVTTEENLDNLVK  347

Query  364  VGkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRRTIAALNGGK  197
            +G++LL KPV ++NL TG +EPV   GTN++ALKR A LLS+E+R R   + N  K
Sbjct  348  IGERLLKKPVSRVNLETGLSEPVENGGTNEEALKRFATLLSDEKRLRDARSPNPKK  403


 Score = 64.3 bits (155),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 35/55 (64%), Gaps = 1/55 (2%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPSA-GIFEVVRDATSLLAGPK*DGNPL  536
            +APD  KRPL+A KDI PFY EHGPKIFP   GIF  +      + GPK DG  L
Sbjct  75   TAPDDQKRPLFAAKDIKPFYLEHGPKIFPQTRGIFGWIMSILRSIVGPKYDGKYL  129



>ref|XP_002282415.2| PREDICTED: patatin-like protein 2 [Vitis vinifera]
Length=406

 Score =   120 bits (302),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 69/116 (59%), Positives = 89/116 (77%), Gaps = 0/116 (0%)
 Frame = -1

Query  544  NPLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEE  365
             PL+DVF  ASADMVD+HI+ +FQAL + DNYLRIQ+D L+G  ASVDVTT+ENLD L +
Sbjct  288  TPLVDVFMQASADMVDFHISMVFQALHSEDNYLRIQDDTLRGKDASVDVTTEENLDNLVK  347

Query  364  VGkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRRTIAALNGGK  197
            +G++LL KPV ++NL TG +EPV   GTN++ALKR A LLS+E+R R   + N  K
Sbjct  348  IGERLLKKPVSRVNLETGLSEPVENGGTNEEALKRFATLLSDEKRLRDARSPNPKK  403


 Score = 64.3 bits (155),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 35/55 (64%), Gaps = 1/55 (2%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPSA-GIFEVVRDATSLLAGPK*DGNPL  536
            +APD  KRPL+A KDI PFY EHGPKIFP   GIF  +      + GPK DG  L
Sbjct  75   TAPDDQKRPLFAAKDIKPFYLEHGPKIFPQTRGIFGWIMSILRSIVGPKYDGKYL  129



>ref|XP_002282440.1| PREDICTED: patatin-like protein 2 [Vitis vinifera]
 emb|CBI19555.3| unnamed protein product [Vitis vinifera]
Length=406

 Score =   120 bits (301),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 69/115 (60%), Positives = 89/115 (77%), Gaps = 0/115 (0%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            PL+DVF  ASADMVD+HI+ +FQAL + DNYLRIQ+D L+G  ASVDVTT+ENLD L ++
Sbjct  289  PLVDVFMQASADMVDFHISMVFQALHSEDNYLRIQDDTLRGKDASVDVTTEENLDNLVKI  348

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRRTIAALNGGK  197
            G++LL KPV ++NL TG +EPV   GTN++ALKR A LLS+E+R R   + N  K
Sbjct  349  GERLLKKPVSRVNLETGLSEPVENGGTNEEALKRFAKLLSDEKRLRETRSPNPMK  403


 Score = 64.3 bits (155),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 35/55 (64%), Gaps = 1/55 (2%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPSA-GIFEVVRDATSLLAGPK*DGNPL  536
            +APD  KRPL+A KDI PFY EHGPKIFP   GIF  +      + GPK DG  L
Sbjct  75   TAPDDQKRPLFAAKDIRPFYLEHGPKIFPQIRGIFGWIMSILRSIVGPKYDGKYL  129



>emb|CAN71271.1| hypothetical protein VITISV_001907 [Vitis vinifera]
Length=446

 Score =   120 bits (302),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 69/116 (59%), Positives = 89/116 (77%), Gaps = 0/116 (0%)
 Frame = -1

Query  544  NPLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEE  365
             PL+DVF  ASADMVD+HI+ +FQAL + DNYLRIQ+D L+G  ASVDVTT+ENLD L +
Sbjct  328  TPLVDVFMQASADMVDFHISMVFQALHSEDNYLRIQDDTLRGKDASVDVTTEENLDNLVK  387

Query  364  VGkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRRTIAALNGGK  197
            +G++LL KPV ++NL TG +EPV   GTN++ALKR A LLS+E+R R   + N  K
Sbjct  388  IGERLLKKPVSRVNLETGLSEPVENGGTNEEALKRFAKLLSDEKRLRETRSPNPMK  443


 Score = 64.7 bits (156),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 35/55 (64%), Gaps = 1/55 (2%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPSA-GIFEVVRDATSLLAGPK*DGNPL  536
            +APD  KRPL+A KDI PFY EHGPKIFP   GIF  +      + GPK DG  L
Sbjct  75   TAPDDQKRPLFAAKDIRPFYLEHGPKIFPQIRGIFGWIMSILRSIVGPKYDGKYL  129



>ref|XP_010664934.1| PREDICTED: patatin-like protein 2 [Vitis vinifera]
Length=407

 Score =   118 bits (296),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 68/115 (59%), Positives = 88/115 (77%), Gaps = 0/115 (0%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            PL+DVF+ ASADMVD+HI+ +FQAL + DNYLRIQ+D L G+ ASVDVTTKENL  L ++
Sbjct  290  PLVDVFTQASADMVDFHISVVFQALHSEDNYLRIQDDTLHGTDASVDVTTKENLGNLVKI  349

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRRTIAALNGGK  197
            G++LL KPV ++NL TG + PV   GTN++ALKR A LLS+E+R R   + N  K
Sbjct  350  GERLLKKPVSRVNLETGLSVPVENCGTNEEALKRFAKLLSDEKRLRETRSPNPKK  404


 Score = 58.9 bits (141),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/53 (51%), Positives = 34/53 (64%), Gaps = 2/53 (4%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPS--AGIFEVVRDATSLLAGPK*DG  545
            +AP+  KRPL+A KDI PFY +HGPKIFP    GIF  + +    + GP  DG
Sbjct  75   TAPNDEKRPLFAAKDIKPFYLKHGPKIFPQRRWGIFGWIMNIFRSIVGPNYDG  127



>emb|CBI19560.3| unnamed protein product [Vitis vinifera]
Length=489

 Score =   119 bits (298),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 85/106 (80%), Gaps = 0/106 (0%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            PL+DVF  ASADMVD+HI+ +FQAL + DNYLRIQ+D L+G  ASVDV T+ENLD L ++
Sbjct  320  PLVDVFMQASADMVDFHISMVFQALHSEDNYLRIQDDTLRGKDASVDVATEENLDNLVKI  379

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
            G++LL KPV ++NL TG +EPV   GTN++ALKR A LLS+E+R R
Sbjct  380  GERLLKKPVSRVNLETGLSEPVENGGTNEEALKRFAKLLSDEKRLR  425


 Score = 65.5 bits (158),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 37/55 (67%), Gaps = 1/55 (2%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFP-SAGIFEVVRDATSLLAGPK*DGNPL  536
            +APD  KRPL+A K+I+PFY EHGPKIFP + GIF  +      L GPK DG  L
Sbjct  106  TAPDDQKRPLFAAKEIMPFYLEHGPKIFPQTRGIFGWIMSIVRSLIGPKYDGKYL  160



>ref|XP_002282391.3| PREDICTED: uncharacterized protein LOC100264244 [Vitis vinifera]
Length=1152

 Score =   122 bits (305),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 67/106 (63%), Positives = 86/106 (81%), Gaps = 0/106 (0%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            PL+DVF  ASADMVD+HI+ +FQAL + DNYLRIQ+D L+G  ASVDVTT+ENLD L ++
Sbjct  289  PLVDVFMQASADMVDFHISMVFQALHSEDNYLRIQDDTLRGKDASVDVTTEENLDNLVKI  348

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
            G++LL KPV ++NL TG +EPV   GTN++ALKR A LLS+E+R R
Sbjct  349  GERLLKKPVSRVNLETGLSEPVENGGTNEEALKRFAKLLSDEKRLR  394


 Score = 64.3 bits (155),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 31/55 (56%), Positives = 37/55 (67%), Gaps = 1/55 (2%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFP-SAGIFEVVRDATSLLAGPK*DGNPL  536
            +APD  KRPL+A K+I+PFY EHGPKIFP + GIF  +      L GPK DG  L
Sbjct  75   TAPDDQKRPLFAAKEIMPFYLEHGPKIFPETRGIFGWIMSIVRSLIGPKYDGKYL  129



>ref|XP_002282366.2| PREDICTED: patatin-like protein 2 [Vitis vinifera]
Length=411

 Score =   118 bits (295),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 66/107 (62%), Positives = 85/107 (79%), Gaps = 0/107 (0%)
 Frame = -1

Query  544  NPLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEE  365
             PL+DVF  ASADMVD+HI+ +FQAL + DNYLRIQ+D L+G  ASVDV T+ENLD L +
Sbjct  293  TPLVDVFMQASADMVDFHISMVFQALHSEDNYLRIQDDTLRGKDASVDVATEENLDNLVK  352

Query  364  VGkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
            +G++LL KPV ++NL TG +EPV   GTN++ALKR A LLS+E+R R
Sbjct  353  IGERLLKKPVSRVNLETGLSEPVENGGTNEEALKRFAKLLSDEKRLR  399


 Score = 65.5 bits (158),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 36/55 (65%), Gaps = 1/55 (2%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPSA-GIFEVVRDATSLLAGPK*DGNPL  536
            +APD  KRPL+A K+I+PFY EHGPKIFP   GIF  +      L GPK DG  L
Sbjct  80   TAPDDQKRPLFAAKEIMPFYLEHGPKIFPQTRGIFGWIMSIVRSLIGPKYDGKYL  134



>emb|CAN68798.1| hypothetical protein VITISV_008805 [Vitis vinifera]
Length=400

 Score =   117 bits (294),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 66/107 (62%), Positives = 85/107 (79%), Gaps = 0/107 (0%)
 Frame = -1

Query  544  NPLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEE  365
             PL+DVF  ASADMVD+HI+ +FQAL + DNYLRIQ+D L+G  ASVDV T+ENLD L +
Sbjct  282  TPLVDVFMQASADMVDFHISMVFQALHSEDNYLRIQDDTLRGKDASVDVATEENLDNLVK  341

Query  364  VGkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
            +G++LL KPV ++NL TG +EPV   GTN++ALKR A LLS+E+R R
Sbjct  342  IGERLLKKPVSRVNLETGLSEPVENGGTNEEALKRFAKLLSDEKRLR  388


 Score = 65.1 bits (157),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 37/55 (67%), Gaps = 1/55 (2%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFP-SAGIFEVVRDATSLLAGPK*DGNPL  536
            +APD  KRPL+A K+I+PFY EHGPKIFP + GIF  +      L GPK DG  L
Sbjct  69   TAPDDQKRPLFAAKEIMPFYLEHGPKIFPZTRGIFGWIMSIVRSLIGPKYDGKYL  123



>emb|CBI19549.3| unnamed protein product [Vitis vinifera]
Length=406

 Score =   117 bits (294),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 67/115 (58%), Positives = 88/115 (77%), Gaps = 0/115 (0%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            PL+DVF+ ASADMVD+HI+ +FQAL + DNYLRIQ+D L G+ A+VDVTTKENL  L ++
Sbjct  289  PLVDVFTQASADMVDFHISVVFQALHSEDNYLRIQDDTLHGTNATVDVTTKENLGNLVKI  348

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRRTIAALNGGK  197
            G++LL KPV ++NL TG + PV   GTN++ALKR A LLS+E+R R   + N  K
Sbjct  349  GERLLKKPVSRVNLETGLSVPVENCGTNEEALKRFAKLLSDEKRLRETRSPNPKK  403


 Score = 60.5 bits (145),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 35/55 (64%), Gaps = 1/55 (2%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPS-AGIFEVVRDATSLLAGPK*DGNPL  536
            +AP+  KRPL+A KDI PFY EHGPKIFP   GIF  + +    + GP  DG  L
Sbjct  75   TAPNDEKRPLFAAKDIKPFYLEHGPKIFPHRRGIFGWIMNIFRSIVGPNYDGKYL  129



>ref|XP_010664933.1| PREDICTED: patatin-like protein 2 [Vitis vinifera]
Length=407

 Score =   117 bits (294),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 67/115 (58%), Positives = 88/115 (77%), Gaps = 0/115 (0%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            PL+DVF+ ASADMVD+HI+ +FQAL + DNYLRIQ+D L G+ A+VDVTTKENL  L ++
Sbjct  290  PLVDVFTQASADMVDFHISVVFQALHSEDNYLRIQDDTLHGTNATVDVTTKENLGNLVKI  349

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRRTIAALNGGK  197
            G++LL KPV ++NL TG + PV   GTN++ALKR A LLS+E+R R   + N  K
Sbjct  350  GERLLKKPVSRVNLETGLSVPVENCGTNEEALKRFAKLLSDEKRLRETRSPNPKK  404


 Score = 45.4 bits (106),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 32/53 (60%), Gaps = 2/53 (4%)
 Frame = -1

Query  697  SAPDKNK-RPLYAGKDIVPFYKEHGPKIFPSA-GIFEVVRDATSLLAGPK*DG  545
            + P++N  RPL++ KDI  FY +H PKIFP   GIF  + +    + GP  DG
Sbjct  75   TTPNENTGRPLFSAKDIKDFYLDHCPKIFPQHRGIFGWIMNIFRSIVGPNYDG  127


 Score = 45.1 bits (105),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 43/51 (84%), Gaps = 2/51 (4%)
 Frame = -3

Query  884  PP--GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            PP  G +ITILSIDGGGIRG+IPGT++ +LE ELQ LDG DAR +DYFDVI
Sbjct  11   PPTYGNLITILSIDGGGIRGLIPGTVLGFLESELQKLDGEDARISDYFDVI  61



>ref|XP_011081971.1| PREDICTED: patatin-like protein 1 [Sesamum indicum]
Length=403

 Score =   117 bits (294),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 62/109 (57%), Positives = 84/109 (77%), Gaps = 0/109 (0%)
 Frame = -1

Query  550  DGNPLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDAL  371
            +  P++DVF+ AS DMVDY +  IFQ+L + DNYLRIQ+D L G+ ASVDVTTK+NL  L
Sbjct  286  NNTPILDVFNQASKDMVDYFLCVIFQSLHSEDNYLRIQDDSLTGANASVDVTTKQNLSEL  345

Query  370  EEVGkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
             ++G+ LL  P+ ++NLLTG +EP+P  GTN+DALK+ A LLS+ER+ R
Sbjct  346  AKIGENLLKGPISRVNLLTGNSEPIPNGGTNEDALKKFAKLLSDERKLR  394


 Score = 54.7 bits (130),  Expect(2) = 5e-12, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAG  602
            +APD N RPLYA KDI  FY +HGPKIFP  G
Sbjct  75   TAPDANNRPLYAAKDIAAFYVKHGPKIFPHKG  106


 Score = 44.3 bits (103),  Expect(2) = 5e-12, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 40/51 (78%), Gaps = 2/51 (4%)
 Frame = -3

Query  884  PP--GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            PP  G +ITILSIDGGGIRGIIP  I+  LE ELQ LDG DAR ADYFDVI
Sbjct  11   PPVNGNLITILSIDGGGIRGIIPAKILESLESELQKLDGQDARIADYFDVI  61



>gb|EYU21992.1| hypothetical protein MIMGU_mgv1a024079mg, partial [Erythranthe 
guttata]
Length=181

 Score =   113 bits (283),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 59/109 (54%), Positives = 83/109 (76%), Gaps = 0/109 (0%)
 Frame = -1

Query  550  DGNPLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDAL  371
            +  P+IDVFS ++ DMVDY+++ +FQALQ+ DNY+RIQ+  L GST+SVDV+TK NL+ L
Sbjct  64   NSTPIIDVFSQSNQDMVDYYLSVVFQALQSQDNYIRIQDQSLTGSTSSVDVSTKRNLNDL  123

Query  370  EEVGkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
              +G+ LL  P  ++NL TG +EPV   GTN+DALK+ A LLS+E++ R
Sbjct  124  INIGQNLLKAPFSRVNLQTGNSEPVINGGTNEDALKKFAKLLSDEQKLR  172



>ref|XP_009617802.1| PREDICTED: patatin-like protein 2 isoform X2 [Nicotiana tomentosiformis]
Length=343

 Score =   116 bits (291),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 82/106 (77%), Gaps = 0/106 (0%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            PLI+VF  +SAD+VDYH + +FQAL + +NYLRIQED+L G+ ASVD+ TKENL+ L E+
Sbjct  218  PLIEVFFQSSADLVDYHNSVVFQALHSDNNYLRIQEDELSGTEASVDIATKENLERLVEI  277

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
            G+ LL KP+ ++NL TG  EP+PK GTN++AL R A LL  ERR R
Sbjct  278  GQNLLKKPLSRVNLETGLTEPIPKGGTNEEALIRFARLLVNERRLR  323


 Score = 66.2 bits (160),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 38/59 (64%), Gaps = 2/59 (3%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPS--AGIFEVVRDATSLLAGPK*DGNPLIDV  527
            +APD+N RPLYA KDI PFY EH PKIFP    G+F  + +    + GPK DG  L +V
Sbjct  3    TAPDENDRPLYAAKDITPFYLEHCPKIFPQKKCGLFAPIGNMVQAIIGPKYDGKYLHEV  61



>ref|XP_006354914.1| PREDICTED: patatin-3-Kuras 1-like [Solanum tuberosum]
Length=406

 Score =   117 bits (292),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 86/106 (81%), Gaps = 0/106 (0%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            PL++VF+ +SADMVDYH + +FQAL++ ++YLRIQED+L G+ ASVDV TK+NL+ L E+
Sbjct  289  PLVEVFTQSSADMVDYHNSVVFQALRSENSYLRIQEDELIGTEASVDVATKKNLERLVEI  348

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
            G+KLL KP+ ++NL TG  EP+PK GTN++ALKR A LL  ERR R
Sbjct  349  GEKLLKKPLSRVNLETGLTEPIPKGGTNEEALKRFATLLVNERRLR  394


 Score = 65.1 bits (157),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 36/59 (61%), Gaps = 2/59 (3%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPS--AGIFEVVRDATSLLAGPK*DGNPLIDV  527
            ++PD+N RPLYA KDI PFY EH PKIFP    G+F  +      L GPK DG  L  V
Sbjct  74   TSPDENHRPLYAAKDITPFYLEHCPKIFPQKKCGLFAPIGKMVQALIGPKYDGKYLHKV  132


 Score = 42.0 bits (97),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 41/51 (80%), Gaps = 2/51 (4%)
 Frame = -3

Query  884  PP--GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            PP  G  ITILSIDGGGIRGIIP TI+++LE +LQ LDG DA  ADYFDVI
Sbjct  10   PPTYGDFITILSIDGGGIRGIIPATILSFLELQLQELDGKDATLADYFDVI  60



>gb|KCW66180.1| hypothetical protein EUGRSUZ_F00017 [Eucalyptus grandis]
Length=334

 Score =   116 bits (290),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 66/115 (57%), Positives = 85/115 (74%), Gaps = 0/115 (0%)
 Frame = -1

Query  547  GNPLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALE  368
            G+PLIDVFS ASADMVD+HI+ +FQAL   DNYLRIQ+D L G  +SVDV TK+NL+ L 
Sbjct  214  GSPLIDVFSQASADMVDFHISAVFQALHLHDNYLRIQDDTLTGDLSSVDVATKKNLNDLV  273

Query  367  EVGkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRRTIAALNG  203
            + G+ LL KPV ++NL TG  EP P   TN++AL+R A LLS+ER+ R   + +G
Sbjct  274  KTGEALLKKPVSRVNLETGACEPTPNQETNEEALRRFAKLLSQERQLRLARSPHG  328


 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 35/58 (60%), Gaps = 1/58 (2%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPS-AGIFEVVRDATSLLAGPK*DGNPLIDV  527
            + P++N RP++A KDI  FY  H PKIFP  +  F++V      +AGPK DG  L  V
Sbjct  3    TTPNENNRPVFAAKDIKDFYLNHCPKIFPQDSCSFKLVTKMIKAMAGPKYDGKYLHSV  60



>ref|XP_009617797.1| PREDICTED: patatin-like protein 2 isoform X1 [Nicotiana tomentosiformis]
Length=420

 Score =   116 bits (291),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 82/106 (77%), Gaps = 0/106 (0%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            PLI+VF  +SAD+VDYH + +FQAL + +NYLRIQED+L G+ ASVD+ TKENL+ L E+
Sbjct  295  PLIEVFFQSSADLVDYHNSVVFQALHSDNNYLRIQEDELSGTEASVDIATKENLERLVEI  354

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
            G+ LL KP+ ++NL TG  EP+PK GTN++AL R A LL  ERR R
Sbjct  355  GQNLLKKPLSRVNLETGLTEPIPKGGTNEEALIRFARLLVNERRLR  400


 Score = 66.6 bits (161),  Expect(2) = 7e-16, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 38/59 (64%), Gaps = 2/59 (3%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPS--AGIFEVVRDATSLLAGPK*DGNPLIDV  527
            +APD+N RPLYA KDI PFY EH PKIFP    G+F  + +    + GPK DG  L +V
Sbjct  80   TAPDENDRPLYAAKDITPFYLEHCPKIFPQKKCGLFAPIGNMVQAIIGPKYDGKYLHEV  138


 Score = 45.8 bits (107),  Expect(2) = 7e-16, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 46/59 (78%), Gaps = 3/59 (5%)
 Frame = -3

Query  905  EYNAASIPP---GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            E  A+ I P   G +IT+LSIDGGGIRGIIP TI+++LE +LQ LDG DAR ADYFDVI
Sbjct  8    ERKASQIQPPTYGDLITVLSIDGGGIRGIIPATILSFLESQLQELDGNDARLADYFDVI  66



>gb|AAF98368.1|AF158027_1 patatin-like protein 1 [Nicotiana tabacum]
Length=420

 Score =   116 bits (290),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 82/106 (77%), Gaps = 0/106 (0%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            PLI+VF  +SAD+VDYH + +FQAL + +NYLRIQED+L G+ ASVD+ TKENL+ L E+
Sbjct  295  PLIEVFFQSSADLVDYHNSVVFQALHSDNNYLRIQEDELSGTEASVDIATKENLERLVEI  354

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
            G+ LL KP+ ++NL TG  EP+PK GTN++AL R A LL  ERR R
Sbjct  355  GQNLLKKPLSRVNLETGLTEPIPKGGTNEEALIRFARLLVNERRLR  400


 Score = 66.6 bits (161),  Expect(2) = 6e-16, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 38/59 (64%), Gaps = 2/59 (3%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPS--AGIFEVVRDATSLLAGPK*DGNPLIDV  527
            +APD+N RPLYA KDI PFY EH PKIFP    G+F  + +    + GPK DG  L +V
Sbjct  80   TAPDENDRPLYAAKDITPFYLEHCPKIFPQKKCGLFAPIGNMVQAIIGPKYDGKYLHEV  138


 Score = 45.8 bits (107),  Expect(2) = 6e-16, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 46/59 (78%), Gaps = 3/59 (5%)
 Frame = -3

Query  905  EYNAASIPP---GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            E  A+ I P   G +IT+LSIDGGGIRGIIP TI+++LE +LQ LDG DAR ADYFDVI
Sbjct  8    ERKASQIQPPTYGDLITVLSIDGGGIRGIIPATILSFLESQLQELDGNDARLADYFDVI  66



>ref|XP_006354912.1| PREDICTED: patatin-3-Kuras 1-like [Solanum tuberosum]
Length=404

 Score =   116 bits (290),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 63/109 (58%), Positives = 87/109 (80%), Gaps = 0/109 (0%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            PL++VF+ +SADMVDYH + +FQAL++ D+YLRIQED+L G+ ASVDV TKENL+ L E+
Sbjct  289  PLVEVFTQSSADMVDYHNSVVFQALRSEDSYLRIQEDELSGTEASVDVATKENLERLVEI  348

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRRTIA  215
            G+KLL KP+ ++NL TG  EP+PK GTN++ALKR A LL   + R +++
Sbjct  349  GEKLLKKPLSRVNLETGLTEPIPKGGTNEEALKRFATLLVVSQGRHSLS  397


 Score = 64.7 bits (156),  Expect(2) = 6e-15, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 37/59 (63%), Gaps = 2/59 (3%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPS--AGIFEVVRDATSLLAGPK*DGNPLIDV  527
            +APD+N RPLYA KDI PFY EH PKIFP    G+F  + +    L G K DG  L +V
Sbjct  74   TAPDENNRPLYAAKDITPFYLEHCPKIFPQKKCGLFAPIGNIVQTLIGSKYDGKYLHEV  132


 Score = 44.7 bits (104),  Expect(2) = 6e-15, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 43/51 (84%), Gaps = 2/51 (4%)
 Frame = -3

Query  884  PP--GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            PP  G +IT+LSIDGGGIRGIIP TI+++LE +LQ LDG DAR ADYFDV+
Sbjct  10   PPTYGDLITVLSIDGGGIRGIIPATILSFLESQLQELDGSDARLADYFDVM  60



>ref|XP_010064190.1| PREDICTED: patatin-like protein 2 [Eucalyptus grandis]
Length=328

 Score =   115 bits (288),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 66/115 (57%), Positives = 85/115 (74%), Gaps = 0/115 (0%)
 Frame = -1

Query  547  GNPLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALE  368
            G+PLIDVFS ASADMVD+HI+ +FQAL   DNYLRIQ+D L G  +SVDV TK+NL+ L 
Sbjct  208  GSPLIDVFSQASADMVDFHISAVFQALHLHDNYLRIQDDTLTGDLSSVDVATKKNLNDLV  267

Query  367  EVGkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRRTIAALNG  203
            + G+ LL KPV ++NL TG  EP P   TN++AL+R A LLS+ER+ R   + +G
Sbjct  268  KTGEALLKKPVSRVNLETGACEPTPNQETNEEALRRFAKLLSQERQLRLARSPHG  322



>ref|XP_004238177.1| PREDICTED: patatin-like protein 2 [Solanum lycopersicum]
Length=406

 Score =   115 bits (289),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 87/108 (81%), Gaps = 0/108 (0%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            PL++VF+ +SADMVDYH + +FQAL++ ++YLRIQED+L G+ ASVDV TK+NL+ L E+
Sbjct  289  PLVEVFTQSSADMVDYHNSIVFQALRSENSYLRIQEDELIGTEASVDVATKKNLERLVEI  348

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRRTI  218
            G++LL KP+ ++NL TG +EP PK GTN++ALKR A LL  ERR R +
Sbjct  349  GEQLLKKPLSRVNLETGLSEPTPKGGTNEEALKRFARLLVNERRLREL  396


 Score = 67.0 bits (162),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 37/59 (63%), Gaps = 2/59 (3%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPS--AGIFEVVRDATSLLAGPK*DGNPLIDV  527
            +APD+N RPLYA KDI PFY EH PKIFP    G+F  +      L GPK DG  L +V
Sbjct  74   TAPDENHRPLYAAKDITPFYLEHCPKIFPQKKCGLFAPIGKMVQALIGPKYDGKYLHEV  132


 Score = 43.5 bits (101),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 41/51 (80%), Gaps = 2/51 (4%)
 Frame = -3

Query  884  PP--GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            PP  G  ITILSIDGGGIRGIIP TI+ +LE +LQ LDG +AR ADYFDVI
Sbjct  10   PPTYGDFITILSIDGGGIRGIIPATILTFLESQLQELDGKNARIADYFDVI  60



>gb|KCW66171.1| hypothetical protein EUGRSUZ_F00007, partial [Eucalyptus grandis]
Length=403

 Score =   115 bits (288),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 73/145 (50%), Positives = 96/145 (66%), Gaps = 7/145 (5%)
 Frame = -1

Query  637  KEHGPKIFPSAGIFEVVRDATSLLAGPK*DGNPLIDVFSVASADMVDYHIATIFQALQAG  458
            K  G    P A  + V+R  TS        G+PLIDVFS ASADMVDYH++ +FQALQ  
Sbjct  260  KAEGKYTAPEAAKWGVLRWLTS-------GGSPLIDVFSHASADMVDYHLSAVFQALQLH  312

Query  457  DNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnlLTGKNEPVPKAGTN  278
            DNYLRIQ+D L G  +SVDV TK+NL+ L ++G+ LL KPV ++NL T  +EP     TN
Sbjct  313  DNYLRIQDDTLSGVLSSVDVATKKNLNDLVKIGEALLKKPVSRVNLETSVSEPTSSQETN  372

Query  277  KDALKRLAGLLSEERRRRTIAALNG  203
            ++AL+R A LLS+ER+ R   + +G
Sbjct  373  EEALRRFAKLLSQERQLRHARSPHG  397


 Score = 48.1 bits (113),  Expect(2) = 6e-09, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 32/58 (55%), Gaps = 1/58 (2%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAGI-FEVVRDATSLLAGPK*DGNPLIDV  527
            + PD+N RP+ A KDI  FY  H PKIFP     F+ V      +AGPK +G  L  V
Sbjct  72   ATPDENNRPVVAAKDIKDFYLNHCPKIFPQDSCPFKPVTKRIKAMAGPKYNGKYLHSV  129


 Score = 40.8 bits (94),  Expect(2) = 6e-09, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 40/51 (78%), Gaps = 2/51 (4%)
 Frame = -3

Query  884  PP--GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            PP  G  ITILSIDGGGIRG+IPGTI+  LE ELQ LDG DAR  DYFDVI
Sbjct  8    PPTYGNSITILSIDGGGIRGLIPGTILHLLESELQKLDGEDARIVDYFDVI  58



>ref|XP_010064132.1| PREDICTED: patatin-like protein 2 [Eucalyptus grandis]
Length=406

 Score =   115 bits (288),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 73/145 (50%), Positives = 96/145 (66%), Gaps = 7/145 (5%)
 Frame = -1

Query  637  KEHGPKIFPSAGIFEVVRDATSLLAGPK*DGNPLIDVFSVASADMVDYHIATIFQALQAG  458
            K  G    P A  + V+R  TS        G+PLIDVFS ASADMVDYH++ +FQALQ  
Sbjct  263  KAEGKYTAPEAAKWGVLRWLTS-------GGSPLIDVFSHASADMVDYHLSAVFQALQLH  315

Query  457  DNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnlLTGKNEPVPKAGTN  278
            DNYLRIQ+D L G  +SVDV TK+NL+ L ++G+ LL KPV ++NL T  +EP     TN
Sbjct  316  DNYLRIQDDTLSGVLSSVDVATKKNLNDLVKIGEALLKKPVSRVNLETSVSEPTSSQETN  375

Query  277  KDALKRLAGLLSEERRRRTIAALNG  203
            ++AL+R A LLS+ER+ R   + +G
Sbjct  376  EEALRRFAKLLSQERQLRHARSPHG  400


 Score = 48.1 bits (113),  Expect(2) = 5e-09, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 32/58 (55%), Gaps = 1/58 (2%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAGI-FEVVRDATSLLAGPK*DGNPLIDV  527
            + PD+N RP+ A KDI  FY  H PKIFP     F+ V      +AGPK +G  L  V
Sbjct  75   ATPDENNRPVVAAKDIKDFYLNHCPKIFPQDSCPFKPVTKRIKAMAGPKYNGKYLHSV  132


 Score = 40.8 bits (94),  Expect(2) = 5e-09, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 40/51 (78%), Gaps = 2/51 (4%)
 Frame = -3

Query  884  PP--GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            PP  G  ITILSIDGGGIRG+IPGTI+  LE ELQ LDG DAR  DYFDVI
Sbjct  11   PPTYGNSITILSIDGGGIRGLIPGTILHLLESELQKLDGEDARIVDYFDVI  61



>ref|XP_003538815.1| PREDICTED: patatin group D-2-like [Glycine max]
Length=403

 Score =   115 bits (288),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 65/106 (61%), Positives = 78/106 (74%), Gaps = 0/106 (0%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            P++D FS AS DMVDYH   +F ALQ+ DNYLRIQ++ LKG  ASVDV TKENLD L +V
Sbjct  293  PILDCFSEASFDMVDYHNCVVFSALQSEDNYLRIQDNTLKGDLASVDVATKENLDNLVKV  352

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
            G++LL   V ++NL TG  EPVP  GTN +ALKR A LLSE R+ R
Sbjct  353  GQQLLKNTVTRVNLDTGLYEPVPDKGTNVEALKRFAKLLSEARKGR  398


 Score = 53.9 bits (128),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 31/51 (61%), Gaps = 2/51 (4%)
 Frame = -1

Query  691  PDKNKRPLYAGKDIVPFYKEHGPKIFPS--AGIFEVVRDATSLLAGPK*DG  545
            P  N RPL+A  +IVPFY E+ P+IFP    GIF  + +    L GPK DG
Sbjct  79   PKANNRPLFAANEIVPFYLENSPQIFPQKRGGIFAPLVNIGKALTGPKYDG  129


 Score = 43.1 bits (100),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/45 (78%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = -3

Query  872  VITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            +IT+LSIDGGGIRGIIPG I+ YLE +LQ LDG DAR ADYFDVI
Sbjct  17   LITVLSIDGGGIRGIIPGVILDYLESQLQELDGEDARLADYFDVI  61



>ref|XP_010064139.1| PREDICTED: patatin-like protein 2 [Eucalyptus grandis]
Length=420

 Score =   115 bits (288),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 66/115 (57%), Positives = 85/115 (74%), Gaps = 0/115 (0%)
 Frame = -1

Query  547  GNPLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALE  368
            G+PLIDVFS ASADMVD+HI+ +FQAL   DNYLRIQ+D L G  +SVDV TK+NL+ L 
Sbjct  300  GSPLIDVFSQASADMVDFHISAVFQALHLHDNYLRIQDDTLTGDLSSVDVATKKNLNDLV  359

Query  367  EVGkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRRTIAALNG  203
            + G+ LL KPV ++NL TG  EP P   TN++AL+R A LLS+ER+ R   + +G
Sbjct  360  KTGEALLKKPVSRVNLETGACEPTPNQETNEEALRRFAKLLSQERQLRLARSPHG  414


 Score = 53.1 bits (126),  Expect(2) = 7e-11, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 35/58 (60%), Gaps = 1/58 (2%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPS-AGIFEVVRDATSLLAGPK*DGNPLIDV  527
            + P++N RP++A KDI  FY  H PKIFP  +  F++V      +AGPK DG  L  V
Sbjct  89   TTPNENNRPVFAAKDIKDFYLNHCPKIFPQDSCSFKLVTKMIKAMAGPKYDGKYLHSV  146


 Score = 42.4 bits (98),  Expect(2) = 7e-11, Method: Compositional matrix adjust.
 Identities = 36/46 (78%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = -3

Query  875  GVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            G I ILSIDGGGIRG+IPGTI+ +LE ELQ LDG DAR ADYFDVI
Sbjct  30   GTIFILSIDGGGIRGLIPGTILHFLESELQKLDGEDARLADYFDVI  75



>gb|AFK45940.1| unknown [Lotus japonicus]
Length=136

 Score =   109 bits (273),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 83/112 (74%), Gaps = 0/112 (0%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            PLID+FS +S DMVD+H++T+ QA  + DNYLRIQ+D L G+ +SVD++TKENL+ L ++
Sbjct  24   PLIDMFSQSSGDMVDFHLSTVTQAHHSEDNYLRIQDDTLAGTDSSVDISTKENLERLSQI  83

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRRTIAALN  206
            G  LL KPV K+NL +G  E +P A TN+DA KR A  LS+ERR R + + N
Sbjct  84   GISLLKKPVSKVNLDSGLCETMPNAETNEDAFKRFAKTLSQERRLRELRSPN  135



>ref|XP_010064137.1| PREDICTED: patatin-like protein 2 [Eucalyptus grandis]
 gb|KCW66176.1| hypothetical protein EUGRSUZ_F00012 [Eucalyptus grandis]
Length=406

 Score =   115 bits (287),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 66/115 (57%), Positives = 83/115 (72%), Gaps = 0/115 (0%)
 Frame = -1

Query  547  GNPLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALE  368
            G PLIDVF+ ASADMVDYH+  +FQALQ  DNYLRIQ+D L G  +SVDV TK+NL  L 
Sbjct  286  GTPLIDVFTQASADMVDYHLFAVFQALQLHDNYLRIQDDTLSGVLSSVDVATKKNLTDLV  345

Query  367  EVGkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRRTIAALNG  203
            + G+ LL KPV ++NL TG  EP P   TN++AL R A LLS+ER+ R + + +G
Sbjct  346  KTGEALLKKPVSRVNLETGVCEPTPNQETNEEALMRFAKLLSQERQLRHVKSPHG  400


 Score = 47.8 bits (112),  Expect(2) = 4e-10, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 34/58 (59%), Gaps = 1/58 (2%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPS-AGIFEVVRDATSLLAGPK*DGNPLIDV  527
            + P++  RP++A KD+  FY +H PKIFP  +  F+ V      +AGPK DG  L  V
Sbjct  75   TTPNEKNRPVFAAKDVKDFYLKHCPKIFPQDSCPFKPVTKMIKAVAGPKYDGKYLHKV  132


 Score = 44.7 bits (104),  Expect(2) = 4e-10, Method: Compositional matrix adjust.
 Identities = 39/51 (76%), Positives = 43/51 (84%), Gaps = 2/51 (4%)
 Frame = -3

Query  884  PP--GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            PP  G +ITILSIDGGGIRG+IPGTI+ +LE ELQ LDG DAR ADYFDVI
Sbjct  11   PPTYGNLITILSIDGGGIRGLIPGTILNFLESELQKLDGEDARIADYFDVI  61



>gb|ERM97116.1| hypothetical protein AMTR_s00126p00056890 [Amborella trichopoda]
Length=179

 Score =   110 bits (274),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 64/108 (59%), Positives = 76/108 (70%), Gaps = 0/108 (0%)
 Frame = -1

Query  547  GNPLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALE  368
            G PLID F  ASADM D HI+ +FQAL +  NYLRIQ+D L G T+S D+ T +NL  L 
Sbjct  61   GTPLIDTFQQASADMADIHISVVFQALHSQRNYLRIQDDTLMGDTSSTDIATDKNLKELV  120

Query  367  EVGkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
            +VG+ LL KPV ++NL TGK EPVP  GTN+ AL R A LLS ERR R
Sbjct  121  KVGEGLLQKPVSRVNLETGKFEPVPNEGTNEQALVRFAKLLSSERRTR  168



>ref|XP_007017305.1| Phospholipase A 2A, IIA,PLA2A [Theobroma cacao]
 gb|EOY14530.1| Phospholipase A 2A, IIA,PLA2A [Theobroma cacao]
Length=420

 Score =   114 bits (284),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 65/113 (58%), Positives = 87/113 (77%), Gaps = 0/113 (0%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            PL+DVF  AS+DMVD+HIAT+FQALQ+ D YLRIQ+D L G+ +SVD+ TKENL+ L +V
Sbjct  301  PLMDVFMQASSDMVDFHIATVFQALQSEDRYLRIQDDTLCGTISSVDIATKENLENLVQV  360

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRRTIAALNG  203
            G++LL KPV ++NL  GK EP+    TN+DAL RLA +LS+E+R R + +  G
Sbjct  361  GEELLKKPVSRVNLDNGKFEPIKNQDTNEDALIRLAKVLSQEKRLRDMKSPAG  413


 Score = 47.4 bits (111),  Expect(2) = 9e-10, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 33/60 (55%), Gaps = 3/60 (5%)
 Frame = -1

Query  697  SAPDKNK--RPLYAGKDIVPFYKEHGPKIFPS-AGIFEVVRDATSLLAGPK*DGNPLIDV  527
            + P++N+  RPL+A KDI  FY EH PKIFP     F    +      GPK DG  L ++
Sbjct  85   TTPNQNEGNRPLFAAKDINKFYLEHCPKIFPQDCSPFAPAANLVKSFTGPKYDGRYLQNI  144


 Score = 44.3 bits (103),  Expect(2) = 9e-10, Method: Compositional matrix adjust.
 Identities = 36/47 (77%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = -3

Query  878  GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            G +IT+LSIDGGGIRGIIPGTI+A+LE ELQ LDG + R ADYFDVI
Sbjct  25   GDLITVLSIDGGGIRGIIPGTILAFLEAELQKLDGEEVRLADYFDVI  71



>ref|XP_010268982.1| PREDICTED: patatin-like protein 2 [Nelumbo nucifera]
Length=407

 Score =   114 bits (284),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 64/112 (57%), Positives = 87/112 (78%), Gaps = 0/112 (0%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            PL+DVF+ A ADMVD+HIA +FQAL++  NYLRIQ+D L G+ ASVD+ TK+NL+ L +V
Sbjct  293  PLVDVFTQAGADMVDFHIAVVFQALKSESNYLRIQDDTLTGAVASVDIATKKNLENLVKV  352

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRRTIAALN  206
            G++LL KPV ++NL TG +EPV   G N++ALK+ A LLS+ER+ R   +LN
Sbjct  353  GEELLKKPVSRINLETGLSEPVANGGINEEALKKFAKLLSDERKLRQERSLN  404


 Score = 52.8 bits (125),  Expect(2) = 4e-12, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 36/56 (64%), Gaps = 2/56 (4%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPS-AGIF-EVVRDATSLLAGPK*DGNPL  536
            +AP++N RPL+A +D+  FY ++ PKIFP   GIF  V +   S+  GPK +G  L
Sbjct  78   TAPNENNRPLFAAQDVTAFYLDNCPKIFPQMCGIFGSVAKTLRSIFVGPKYNGKYL  133


 Score = 47.0 bits (110),  Expect(2) = 4e-12, Method: Compositional matrix adjust.
 Identities = 39/51 (76%), Positives = 44/51 (86%), Gaps = 2/51 (4%)
 Frame = -3

Query  884  PP--GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            PP  G +IT+LSIDGGGIRGIIPGTI+A+LE +LQ LDG DAR ADYFDVI
Sbjct  14   PPTYGNLITVLSIDGGGIRGIIPGTILAFLESQLQELDGEDARIADYFDVI  64



>ref|XP_006387005.1| hypothetical protein POPTR_2250s00200g [Populus trichocarpa]
 gb|ERP45919.1| hypothetical protein POPTR_2250s00200g [Populus trichocarpa]
Length=158

 Score =   109 bits (272),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 85/106 (80%), Gaps = 1/106 (1%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            PL+DVF+ ASADMVD+HI+T+FQAL + +NYLRIQ+D L G+ +SVDV TKENL+ L +V
Sbjct  46   PLVDVFTQASADMVDFHISTVFQALNSEENYLRIQDDTLTGTLSSVDVATKENLENLVKV  105

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
            G++LL KPV ++NL TG  EP+ K  TN++AL++LA LLS E+  R
Sbjct  106  GEELLKKPVSRVNLATGVFEPINKM-TNEEALRKLAKLLSREKHLR  150



>ref|XP_010064188.1| PREDICTED: patatin-like protein 2 [Eucalyptus grandis]
 gb|KCW66466.1| hypothetical protein EUGRSUZ_F00263 [Eucalyptus grandis]
Length=407

 Score =   113 bits (282),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 64/115 (56%), Positives = 82/115 (71%), Gaps = 0/115 (0%)
 Frame = -1

Query  547  GNPLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALE  368
            G PLIDVF+ ASADMVDYH++ +FQALQ  DNYLRIQ+D L G  +SVDV TK+NL  L 
Sbjct  286  GTPLIDVFTQASADMVDYHLSAVFQALQLHDNYLRIQDDTLSGVLSSVDVATKKNLTDLV  345

Query  367  EVGkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRRTIAALNG  203
            + G+ LL KP  ++NL  G  EP P   TN++AL R A LLS+ER+ R + + +G
Sbjct  346  KTGEALLKKPASRVNLENGVCEPTPNQETNEEALIRFAKLLSQERQLRHVKSPHG  400


 Score = 48.5 bits (114),  Expect(2) = 3e-10, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 34/58 (59%), Gaps = 1/58 (2%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPS-AGIFEVVRDATSLLAGPK*DGNPLIDV  527
            + P++  RP++A KDI  FY +H PKIFP  +  F+ V      +AGPK DG  L  V
Sbjct  75   TTPNEKNRPVFAAKDIKDFYLKHCPKIFPQDSCPFKPVTKMIKAVAGPKYDGKYLHKV  132


 Score = 44.7 bits (104),  Expect(2) = 3e-10, Method: Compositional matrix adjust.
 Identities = 39/51 (76%), Positives = 43/51 (84%), Gaps = 2/51 (4%)
 Frame = -3

Query  884  PP--GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            PP  G +ITILSIDGGGIRG+IPGTI+ +LE ELQ LDG DAR ADYFDVI
Sbjct  11   PPTYGNLITILSIDGGGIRGLIPGTILNFLESELQKLDGEDARIADYFDVI  61



>gb|ERM97113.1| hypothetical protein AMTR_s00126p00052700 [Amborella trichopoda]
Length=404

 Score =   113 bits (282),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 64/108 (59%), Positives = 79/108 (73%), Gaps = 0/108 (0%)
 Frame = -1

Query  547  GNPLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALE  368
            G PLID F  ASADMVD HI+ +FQAL +  +YLRIQ+D L G T+SVD+ T++NL  L 
Sbjct  287  GTPLIDTFQQASADMVDIHISNVFQALHSEQSYLRIQDDTLTGDTSSVDIATEKNLKDLV  346

Query  367  EVGkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
            +VG +LL K V ++NL TGK EPVP  GTN+ AL R A LLS+ERR R
Sbjct  347  KVGTELLQKQVSRVNLETGKFEPVPNEGTNEQALIRFAKLLSKERRTR  394


 Score = 55.8 bits (133),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 34/55 (62%), Gaps = 1/55 (2%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFP-SAGIFEVVRDATSLLAGPK*DGNPL  536
            +AP  N RPLYA KDI  FY +H PKIF  ++G+   VR   S + GPK DG  L
Sbjct  75   TAPGDNNRPLYAAKDITSFYLDHCPKIFSQTSGLLGSVRKFVSAVTGPKYDGKYL  129


 Score = 41.2 bits (95),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/51 (69%), Positives = 41/51 (80%), Gaps = 2/51 (4%)
 Frame = -3

Query  884  PP--GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            PP  G +ITILSIDGGGIRGIIP TI+++LE ELQ LDG + R  DYFDV+
Sbjct  11   PPSFGDLITILSIDGGGIRGIIPATILSFLESELQNLDGEEVRLVDYFDVM  61



>ref|XP_010269013.1| PREDICTED: patatin-like protein 2 isoform X1 [Nelumbo nucifera]
Length=404

 Score =   112 bits (280),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 85/114 (75%), Gaps = 0/114 (0%)
 Frame = -1

Query  544  NPLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEE  365
            +PL+DVF+ AS DMVDYH++ +FQAL + DNYLRIQ+D L G+ +SVD  +KENLD L +
Sbjct  286  SPLVDVFTQASGDMVDYHVSAVFQALSSKDNYLRIQDDTLGGTVSSVDFASKENLDNLVK  345

Query  364  VGkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRRTIAALNG  203
            VG+ LL KPV ++NL TG  EP  +  TN++AL+R A LLSEE++ R   + NG
Sbjct  346  VGEALLKKPVSRVNLDTGIYEPCKEQITNEEALRRFAKLLSEEKKLRDSKSPNG  399


 Score = 43.5 bits (101),  Expect(2) = 6e-08, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 41/51 (80%), Gaps = 2/51 (4%)
 Frame = -3

Query  884  PP--GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            PP  G +ITILSIDGGGIRGIIPG I+ +LE +LQ LDG D R ADYFDVI
Sbjct  10   PPTHGNLITILSIDGGGIRGIIPGIILGFLESQLQELDGEDVRLADYFDVI  60


 Score = 42.0 bits (97),  Expect(2) = 6e-08, Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 29/52 (56%), Gaps = 1/52 (2%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAGI-FEVVRDATSLLAGPK*DG  545
            + P++ KRPL++ KDI  FY E+ P+IFP     F         L+GP+  G
Sbjct  74   TTPNEKKRPLFSAKDIKNFYLENAPRIFPQQSCPFAHAAKVIKSLSGPRYKG  125



>gb|KGN62058.1| hypothetical protein Csa_2G293860 [Cucumis sativus]
Length=288

 Score =   110 bits (276),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 63/107 (59%), Positives = 79/107 (74%), Gaps = 0/107 (0%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            P+ID+FS ASADMVDYHIA+IFQ+     NYLRIQ+D L G  ASVDV T+ENL  L EV
Sbjct  180  PIIDIFSDASADMVDYHIASIFQSEHHQKNYLRIQDDTLSGVVASVDVATEENLLKLIEV  239

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRRT  221
            G+ LL K + ++NL +GK EP+   GTN+DAL   A +LSEER+ R+
Sbjct  240  GEDLLKKQLSRVNLESGKFEPLDGHGTNEDALVEFASMLSEERKLRS  286



>ref|XP_008378189.1| PREDICTED: patatin-like protein 2 [Malus domestica]
Length=398

 Score =   112 bits (279),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 62/107 (58%), Positives = 87/107 (81%), Gaps = 0/107 (0%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            PL+D+FS AS+DMVD+H+AT+F+AL + DNYLRIQ+D L G+ ASVD+ T ENL+ L ++
Sbjct  283  PLVDIFSQASSDMVDFHLATVFZALGSPDNYLRIQDDTLSGTLASVDIATSENLNDLVKI  342

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRRT  221
            G+KLLTKPV +++L TGK +PV    TN++AL R+AG+LS ER +R+
Sbjct  343  GEKLLTKPVSRVDLDTGKTKPVHPEITNQEALIRVAGVLSRERGKRS  389


 Score = 50.4 bits (119),  Expect(2) = 1e-11, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 33/54 (61%), Gaps = 3/54 (6%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAGIFEVVRDATSLLAGPK*DGNPL  536
            + PD+NKRPLYA KDI  FY E+ PKIFP      +V +   +L  PK DG  L
Sbjct  72   TXPDENKRPLYAAKDITAFYLENCPKIFPQDS--SIVAN-LKVLGKPKYDGKYL  122


 Score = 47.8 bits (112),  Expect(2) = 1e-11, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = -3

Query  890  SIPPGGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            S   G +IT+LSIDGGGIRGIIPGTI+++LE ELQ LDG DAR ADYFDVI
Sbjct  8    STTNGSLITVLSIDGGGIRGIIPGTILSFLESELQKLDGKDARLADYFDVI  58



>ref|XP_008779158.1| PREDICTED: patatin-like protein 2 [Phoenix dactylifera]
Length=404

 Score =   111 bits (278),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 67/116 (58%), Positives = 86/116 (74%), Gaps = 4/116 (3%)
 Frame = -1

Query  571  LLAGPK*DGNPLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTT  392
            LL+G     NPL+D F+ AS+DMVD HI+ +FQAL +   YLRIQ+D LKG+ +SVDV T
Sbjct  280  LLSG---GSNPLVDAFTQASSDMVDIHISVVFQALHSDSKYLRIQDDTLKGTVSSVDVAT  336

Query  391  KENLDALEEVGkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
            KENLD+L ++G++LL KP  ++NL TG  EPV K  TN+ ALKR A +LSEERR R
Sbjct  337  KENLDSLVKIGEELLKKPTSRINLETGVYEPVDKE-TNEQALKRFAKILSEERRLR  391


 Score = 51.2 bits (121),  Expect(2) = 1e-10, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 33/55 (60%), Gaps = 1/55 (2%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPSA-GIFEVVRDATSLLAGPK*DGNPL  536
            +AP++  RP++  KDI  FY EH PKIFP   G  +   +A  L +GPK DG  L
Sbjct  73   TAPNEKNRPIFEAKDIKAFYLEHSPKIFPQPRGPIDGAFNAFRLFSGPKYDGKYL  127


 Score = 43.5 bits (101),  Expect(2) = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/47 (74%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = -3

Query  878  GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            G +IT+LSIDGGGIRGIIP TI+A+LE +LQ  DG DAR ADYFDVI
Sbjct  13   GNLITVLSIDGGGIRGIIPATILAFLESQLQEHDGVDARLADYFDVI  59



>emb|CDP11077.1| unnamed protein product [Coffea canephora]
Length=394

 Score =   111 bits (277),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 67/113 (59%), Positives = 87/113 (77%), Gaps = 1/113 (1%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            PL+DVFS AS+DMVD+H++TIFQ LQ+ +NYLRIQ+D L G  ASVDV T+ENL  L +V
Sbjct  276  PLVDVFSQASSDMVDFHLSTIFQTLQSEENYLRIQDDTLTGDLASVDVATEENLQNLVKV  335

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRRTIAALNG  203
            G+ LL KPV ++NL TG  EP+ K GTN++ALKRLA  LS+E+R R + +  G
Sbjct  336  GENLLKKPVSRINLQTGVFEPLNK-GTNEEALKRLAETLSKEKRLRDLRSPTG  387



>ref|XP_004148052.1| PREDICTED: patatin-like protein 3 [Cucumis sativus]
Length=394

 Score =   110 bits (275),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 63/107 (59%), Positives = 79/107 (74%), Gaps = 0/107 (0%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            P+ID+FS ASADMVDYHIA+IFQ+     NYLRIQ+D L G  ASVDV T+ENL  L EV
Sbjct  286  PIIDIFSDASADMVDYHIASIFQSEHHQKNYLRIQDDTLSGVVASVDVATEENLLKLIEV  345

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRRT  221
            G+ LL K + ++NL +GK EP+   GTN+DAL   A +LSEER+ R+
Sbjct  346  GEDLLKKQLSRVNLESGKFEPLDGHGTNEDALVEFASMLSEERKLRS  392


 Score = 61.2 bits (147),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 34/55 (62%), Gaps = 1/55 (2%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAGIF-EVVRDATSLLAGPK*DGNPL  536
            +APD+N RPLYA KD+  FY EHGPKIFP    F   V D    + GPK DG  L
Sbjct  69   TAPDENNRPLYAAKDLTRFYIEHGPKIFPQRNHFLSSVMDIFGKVTGPKYDGKYL  123


 Score = 47.4 bits (111),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/47 (81%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = -3

Query  878  GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            G  ITILSIDGGGIRGIIPGTI+A+LE +LQ LDGPD R ADYFDVI
Sbjct  9    GKRITILSIDGGGIRGIIPGTILAFLESKLQELDGPDVRIADYFDVI  55



>ref|XP_006829698.2| PREDICTED: patatin-like protein 2 [Amborella trichopoda]
Length=404

 Score =   110 bits (275),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 79/108 (73%), Gaps = 0/108 (0%)
 Frame = -1

Query  547  GNPLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALE  368
            G PLID F  ASADMVD HI+ +F+AL +  +YLRIQ+D L G T+SVD+ T++NL  L 
Sbjct  287  GTPLIDTFQQASADMVDIHISVVFKALDSEQSYLRIQDDTLTGDTSSVDIATEKNLKDLV  346

Query  367  EVGkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
            +VG +LL K V ++NL TGK EPVP  GTN+ AL R A LLS+ERR R
Sbjct  347  KVGTELLQKQVSRVNLETGKFEPVPNEGTNEQALIRFAKLLSKERRTR  394


 Score = 55.8 bits (133),  Expect(2) = 9e-12, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 32/55 (58%), Gaps = 1/55 (2%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFP-SAGIFEVVRDATSLLAGPK*DGNPL  536
            + P  N RPLYA KDI  FY +H PKIFP S+G        TS + GPK DG  L
Sbjct  75   TTPGNNDRPLYAAKDITTFYLDHCPKIFPQSSGFLGSAFKFTSAVTGPKYDGKYL  129


 Score = 42.7 bits (99),  Expect(2) = 9e-12, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 41/51 (80%), Gaps = 2/51 (4%)
 Frame = -3

Query  884  PP--GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            PP  G  +TILSIDGGGIRGIIP TI+++LE ELQ LDG + R ADYFDVI
Sbjct  11   PPTYGDYVTILSIDGGGIRGIIPATILSFLESELQKLDGEEVRLADYFDVI  61



>ref|XP_004501587.1| PREDICTED: patatin-3-Kuras 1-like isoform X2 [Cicer arietinum]
Length=402

 Score =   110 bits (275),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 63/110 (57%), Positives = 82/110 (75%), Gaps = 0/110 (0%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            PLID+FS +S DMVDY++AT+ QAL + DNYLRIQ+D L G  +SVD+ TKENLD L ++
Sbjct  286  PLIDMFSQSSGDMVDYNLATVTQALNSQDNYLRIQDDTLTGIDSSVDIATKENLDKLCQI  345

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRRTIAA  212
            G++LL KP+  +NL TG  EP     TN+DALKR A +LS+ERR R I +
Sbjct  346  GERLLKKPLSNVNLETGVFEPTQNRETNQDALKRFAKILSQERRLREIKS  395


 Score = 58.2 bits (139),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 36/57 (63%), Gaps = 6/57 (11%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAGIFEVVRDATSLLAGPK*DGNPLIDV  527
            +AP+ N+RPL+A KDI PFY EH PKIFP      + R     LAGPK DG  L D+
Sbjct  79   TAPNHNQRPLFAAKDIKPFYLEHCPKIFPQHKY--LFRS----LAGPKYDGKYLHDM  129


 Score = 43.1 bits (100),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 41/51 (80%), Gaps = 2/51 (4%)
 Frame = -3

Query  884  PP--GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            PP  G ++TILSIDGGGIRGIIP TI+ YLE +LQ LDG  AR ADYFDVI
Sbjct  15   PPTYGKLVTILSIDGGGIRGIIPATILEYLETQLQELDGESARLADYFDVI  65



>ref|XP_003603014.1| Patatin-like protein [Medicago truncatula]
 gb|AES73265.1| patatin-like phospholipase [Medicago truncatula]
Length=408

 Score =   110 bits (275),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 60/110 (55%), Positives = 83/110 (75%), Gaps = 0/110 (0%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            PLID+FS +S DMVD+H+AT+ QAL   DNYLRIQ+D L G+ +SVD++TKENL+ L ++
Sbjct  291  PLIDIFSQSSGDMVDFHLATVTQALNCQDNYLRIQDDTLTGTDSSVDISTKENLEKLCQI  350

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRRTIAA  212
            G +LL KPV K+NL  G  EP+    TN++ALKR A +LS+ER+ R + +
Sbjct  351  GDRLLKKPVSKVNLENGMFEPIENGETNQEALKRFAKILSQERKLRELTS  400


 Score = 58.9 bits (141),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 35/58 (60%), Gaps = 1/58 (2%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPSA-GIFEVVRDATSLLAGPK*DGNPLIDV  527
            SAP+  +RPL+A KDI PFY EH PKIFP    +   V      LAGPK DGN L  V
Sbjct  77   SAPNDKQRPLFAAKDIKPFYLEHCPKIFPQQKHMLGSVGKLFKSLAGPKYDGNYLHSV  134



>ref|XP_004501586.1| PREDICTED: patatin-3-Kuras 1-like isoform X1 [Cicer arietinum]
Length=409

 Score =   110 bits (275),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 63/110 (57%), Positives = 82/110 (75%), Gaps = 0/110 (0%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            PLID+FS +S DMVDY++AT+ QAL + DNYLRIQ+D L G  +SVD+ TKENLD L ++
Sbjct  293  PLIDMFSQSSGDMVDYNLATVTQALNSQDNYLRIQDDTLTGIDSSVDIATKENLDKLCQI  352

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRRTIAA  212
            G++LL KP+  +NL TG  EP     TN+DALKR A +LS+ERR R I +
Sbjct  353  GERLLKKPLSNVNLETGVFEPTQNRETNQDALKRFAKILSQERRLREIKS  402


 Score = 62.0 bits (149),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 37/58 (64%), Gaps = 1/58 (2%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAG-IFEVVRDATSLLAGPK*DGNPLIDV  527
            +AP+ N+RPL+A KDI PFY EH PKIFP    +F  V      LAGPK DG  L D+
Sbjct  79   TAPNHNQRPLFAAKDIKPFYLEHCPKIFPQHKDLFGSVTKLFRSLAGPKYDGKYLHDM  136



>gb|EPS59074.1| hypothetical protein M569_15736, partial [Genlisea aurea]
Length=355

 Score =   109 bits (273),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 59/106 (56%), Positives = 77/106 (73%), Gaps = 0/106 (0%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            P+I+VFS AS DMVDY ++ +FQA  + DNYLRIQ+D L G  +S DV TK+N+D L  +
Sbjct  248  PIIEVFSQASVDMVDYFLSVVFQAFHSQDNYLRIQDDALPGDNSSSDVATKKNMDDLVGI  307

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
            G+ LL K V + +L TG  E +PK GTN+DALKR A LLS+ER+ R
Sbjct  308  GEDLLKKSVSRFDLQTGNYEAIPKGGTNEDALKRFAKLLSDERKLR  353


 Score = 55.8 bits (133),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 33/53 (62%), Gaps = 2/53 (4%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAGIFEVVRDATSL--LAGPK*DG  545
            +APD N RPLYA KDIVPFY  HGP+IF   G   +    T +  L GPK +G
Sbjct  32   TAPDDNNRPLYAAKDIVPFYLTHGPQIFQQYGSGWLGSMMTRIRQLLGPKYNG  84


 Score = 30.4 bits (67),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 13/18 (72%), Positives = 14/18 (78%), Gaps = 0/18 (0%)
 Frame = -3

Query  791  LQALDGPDARAADYFDVI  738
            +Q LDG  AR ADYFDVI
Sbjct  1    MQELDGDSARIADYFDVI  18



>ref|XP_011629237.1| PREDICTED: patatin-like protein 2 [Amborella trichopoda]
Length=405

 Score =   110 bits (274),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 64/108 (59%), Positives = 76/108 (70%), Gaps = 0/108 (0%)
 Frame = -1

Query  547  GNPLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALE  368
            G PLID F  ASADM D HI+ +FQAL +  NYLRIQ+D L G T+S D+ T +NL  L 
Sbjct  287  GTPLIDTFQQASADMADIHISVVFQALHSQRNYLRIQDDTLMGDTSSTDIATDKNLKELV  346

Query  367  EVGkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
            +VG+ LL KPV ++NL TGK EPVP  GTN+ AL R A LLS ERR R
Sbjct  347  KVGEGLLQKPVSRVNLETGKFEPVPNEGTNEQALVRFAKLLSSERRTR  394


 Score = 56.2 bits (134),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 34/55 (62%), Gaps = 1/55 (2%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFP-SAGIFEVVRDATSLLAGPK*DGNPL  536
            +AP  N RPLYA KDI  FY +H PKIF  ++G+   VR   S + GPK DG  L
Sbjct  75   TAPGDNNRPLYAAKDITSFYLDHCPKIFSQTSGLLGSVRKFVSAVTGPKYDGKYL  129


 Score = 40.8 bits (94),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/51 (69%), Positives = 41/51 (80%), Gaps = 2/51 (4%)
 Frame = -3

Query  884  PP--GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            PP  G +ITILSIDGGGIRGIIP TI+++LE ELQ LDG + R  DYFDV+
Sbjct  11   PPSFGDLITILSIDGGGIRGIIPATILSFLESELQNLDGEEVRLVDYFDVM  61



>ref|XP_009627385.1| PREDICTED: patatin-like protein 2 [Nicotiana tomentosiformis]
Length=254

 Score =   108 bits (269),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 59/106 (56%), Positives = 80/106 (75%), Gaps = 0/106 (0%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            P++DVF+ AS DMVD HI+ +FQ+L + +NYLRIQ+D L G+ +SVD+ TKEN+D L E+
Sbjct  118  PIVDVFTQASGDMVDLHISVVFQSLHSEENYLRIQDDTLTGTDSSVDIATKENMDKLVEI  177

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
            GK LL KPV ++NL TG +E     GTN++ LKR A +LSEE+R R
Sbjct  178  GKTLLKKPVSRVNLQTGLSEQCKNGGTNEETLKRFAKVLSEEKRLR  223



>gb|KJB29505.1| hypothetical protein B456_005G103900 [Gossypium raimondii]
Length=408

 Score =   109 bits (273),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 64/114 (56%), Positives = 91/114 (80%), Gaps = 1/114 (1%)
 Frame = -1

Query  544  NPLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEE  365
            +PLIDVF  AS+DMVD+H+AT+F+AL +  +YLRIQ+D L G+  SVD++TKENL+ L +
Sbjct  289  SPLIDVFMQASSDMVDFHLATVFRALHSEHSYLRIQDDTLSGAVTSVDISTKENLENLVK  348

Query  364  VGkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRRTIAALNG  203
            +G++LL KPV ++NL TGK EPV + GTN++AL RLA +LSEE+R R + + +G
Sbjct  349  LGEELLKKPVSRVNLETGKFEPVDQ-GTNEEALIRLAEVLSEEKRLREMRSPHG  401


 Score = 50.1 bits (118),  Expect(2) = 4e-09, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 33/56 (59%), Gaps = 1/56 (2%)
 Frame = -1

Query  691  PDKNKRPLYAGKDIVPFYKEHGPKIFPSAG-IFEVVRDATSLLAGPK*DGNPLIDV  527
            P++  RPL+A KDI  FY +H PKIFP  G  F  V +    L GPK DG  L ++
Sbjct  78   PNEGHRPLFAAKDINDFYLQHCPKIFPQDGSPFAPVANLVKSLTGPKYDGEYLRNI  133


 Score = 39.3 bits (90),  Expect(2) = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/51 (69%), Positives = 41/51 (80%), Gaps = 2/51 (4%)
 Frame = -3

Query  884  PP--GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            PP  G +IT+LSIDGG IRG+IPGTI+A+LE +LQ LDG  AR ADYF VI
Sbjct  10   PPTSGNLITVLSIDGGAIRGLIPGTILAFLESQLQKLDGEGARLADYFVVI  60



>ref|XP_004979715.1| PREDICTED: patatin-2-Kuras 1-like [Setaria italica]
Length=410

 Score =   109 bits (273),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 61/106 (58%), Positives = 80/106 (75%), Gaps = 0/106 (0%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            P+ID+FS AS+DMVD H A +F+AL    NYLRIQ+D L G T+SVD+TTKEN++AL  +
Sbjct  298  PIIDIFSHASSDMVDIHAAVLFEALHCEKNYLRIQDDSLTGDTSSVDITTKENMEALIRI  357

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
            G +LL KPV ++N+ TG  EPV   GTN++AL R A +LS+ERR R
Sbjct  358  GHELLKKPVSRVNIDTGMYEPVNGEGTNEEALARFAKILSDERRLR  403


 Score = 48.1 bits (113),  Expect(2) = 4e-10, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 30/53 (57%), Gaps = 2/53 (4%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFP--SAGIFEVVRDATSLLAGPK*DG  545
            +APDKN RPL+  KD+  FY ++GP IFP   AG           + GPK DG
Sbjct  83   AAPDKNNRPLFTAKDLNTFYLKNGPNIFPEKKAGFLTPAAKLLGAVRGPKYDG  135


 Score = 44.7 bits (104),  Expect(2) = 4e-10, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 43/51 (84%), Gaps = 2/51 (4%)
 Frame = -3

Query  884  PP--GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            PP  G +IT+LSIDGGGIRG+IP TI+A+LE +LQ LDG DAR ADYFDVI
Sbjct  19   PPSTGKLITVLSIDGGGIRGLIPATIIAFLEAKLQELDGLDARIADYFDVI  69



>ref|XP_008378197.1| PREDICTED: patatin-like protein 2 [Malus domestica]
Length=412

 Score =   109 bits (273),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 64/120 (53%), Positives = 88/120 (73%), Gaps = 1/120 (1%)
 Frame = -1

Query  580  ATSLLAGPK*DGNPLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVD  401
            A   L GP     PL+D+F+ AS+DMVD+H+AT+FQAL++ DNYLRIQ+D L G+ ASVD
Sbjct  276  ALGWLIGPD-FAAPLLDIFTQASSDMVDFHLATVFQALESPDNYLRIQDDTLSGTLASVD  334

Query  400  VTTKENLDALEEVGkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRRT  221
            + T ENL+ L +VG+KLL KPV +++  TGK +PV    TN++ L R+AG+LS ER  R+
Sbjct  335  IATSENLNDLIKVGEKLLKKPVSRVDFGTGKGKPVHPDITNQEVLIRVAGVLSRERAERS  394


 Score = 49.3 bits (116),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 32/55 (58%), Gaps = 1/55 (2%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPS-AGIFEVVRDATSLLAGPK*DGNPL  536
            + PD+N RPLYA KDI  FY E+ PKIFP  + I   +     +L  PK DG  L
Sbjct  72   TTPDENNRPLYAAKDITAFYLENCPKIFPQDSSIVANLAMNLKVLGXPKYDGKYL  126


 Score = 47.8 bits (112),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 37/47 (79%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = -3

Query  878  GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            G +IT+LSIDGGGIRGIIPGTI+++LE ELQ LDG DAR ADYFDVI
Sbjct  12   GSLITVLSIDGGGIRGIIPGTILSFLESELQKLDGKDARLADYFDVI  58



>ref|XP_007156813.1| hypothetical protein PHAVU_002G019700g [Phaseolus vulgaris]
 gb|ESW28807.1| hypothetical protein PHAVU_002G019700g [Phaseolus vulgaris]
Length=406

 Score =   109 bits (273),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 79/106 (75%), Gaps = 0/106 (0%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            P+ID FS AS+DMVDYH   +F+ALQ+ DNYLRIQ+D LKG  ASV + T ENL+ L  V
Sbjct  291  PIIDCFSEASSDMVDYHNCVVFRALQSEDNYLRIQDDTLKGDLASVHIATTENLNNLVNV  350

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
            GK+LL K V ++NL TG  EPVP  GTN++ALKR A  LS+ R+++
Sbjct  351  GKQLLKKRVTRVNLDTGLYEPVPDKGTNEEALKRFAKSLSDVRKKK  396


 Score = 55.1 bits (131),  Expect(2) = 3e-12, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 34/53 (64%), Gaps = 1/53 (2%)
 Frame = -1

Query  691  PDKNKRPLYAGKDIVPFYKEHGPKIFPSA-GIFEVVRDATSLLAGPK*DGNPL  536
            P+ NK PL+A  +IVPFY ++ P+IFP   G+F  +++    L GPK DG  L
Sbjct  79   PNANKHPLFAANEIVPFYLQNSPQIFPQTRGLFGWLKNIVKALTGPKYDGKYL  131


 Score = 45.1 bits (105),  Expect(2) = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -3

Query  869  ITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            IT+LSIDGGGIRGIIP  ++AYLE +LQ LDG DAR ADYFDVI
Sbjct  18   ITVLSIDGGGIRGIIPSVLLAYLESQLQELDGEDARLADYFDVI  61



>emb|CDP07844.1| unnamed protein product [Coffea canephora]
Length=404

 Score =   109 bits (273),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 80/106 (75%), Gaps = 0/106 (0%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            PL+++F+ AS DMVDY I+ IFQAL +  NYLRIQ+D L G +ASVDV TKEN++ L E+
Sbjct  291  PLVEMFAQASGDMVDYQISVIFQALHSEANYLRIQDDTLTGQSASVDVATKENMEKLGEI  350

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
            G  LL KPV ++NLLTG  E V   GTN++ALKR A LLS+ERR R
Sbjct  351  GSNLLKKPVSRVNLLTGAVEQVENGGTNEEALKRFAKLLSDERRLR  396


 Score = 55.5 bits (132),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 35/52 (67%), Gaps = 1/52 (2%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPS-AGIFEVVRDATSLLAGPK*DG  545
            +AP++  RPLYA K+I PFY  +GPKIFP  +GI  +++   + + GP  DG
Sbjct  77   TAPNEKNRPLYAAKEIKPFYLGNGPKIFPQKSGILGLIKPVQNFIPGPLYDG  128



>emb|CDP01337.1| unnamed protein product [Coffea canephora]
Length=407

 Score =   109 bits (272),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 65/106 (61%), Positives = 84/106 (79%), Gaps = 1/106 (1%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            PL+DVFS AS+DMVD+H++T+FQ LQ+ +NYLRIQ+D L G  ASVDV T+ENL  L +V
Sbjct  289  PLVDVFSQASSDMVDFHLSTVFQTLQSEENYLRIQDDTLTGDLASVDVATEENLQNLVKV  348

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
            G+ LL KPV ++NL TG  EP+ K GTN++ALKRLA  LS+E+R R
Sbjct  349  GENLLKKPVSRINLETGVFEPLNK-GTNEEALKRLAETLSKEKRLR  393


 Score = 47.0 bits (110),  Expect(2) = 6e-08, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 43/57 (75%), Gaps = 2/57 (4%)
 Frame = -3

Query  902  YNAASIPP--GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            Y +   PP  G  ITILSIDGGGIRGIIPG I+ +LE ELQ LDG DAR ADYFDVI
Sbjct  4    YRSFLQPPTYGNSITILSIDGGGIRGIIPGVILGFLESELQKLDGEDARLADYFDVI  60


 Score = 38.1 bits (87),  Expect(2) = 6e-08, Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 34/61 (56%), Gaps = 4/61 (7%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAGIFEVVRDATSLL---AGPK*DGNPLIDV  527
            +AP+   RPL+A K+I  FY ++ P+IFP      ++  A  L+    GPK DG  L ++
Sbjct  74   AAPNDKNRPLFAAKEIKDFYLDNCPQIFPQETHL-MLGQAEKLIKAVTGPKYDGKYLHNL  132

Query  526  F  524
             
Sbjct  133  L  133



>gb|ERM97111.1| hypothetical protein AMTR_s00126p00051100 [Amborella trichopoda]
Length=166

 Score =   105 bits (262),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 60/106 (57%), Positives = 78/106 (74%), Gaps = 0/106 (0%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            PL+D F  ASADMVD  ++ +FQAL +  +YLRIQ+D+L G+T+SVD+ TKENL+ L ++
Sbjct  52   PLVDTFQQASADMVDIQMSVVFQALYSERSYLRIQDDNLTGTTSSVDIATKENLEKLVQI  111

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
            GK LL K V ++NL TG  EPV   GTN+ AL R A LLS+ERR R
Sbjct  112  GKDLLKKSVSRVNLETGLFEPVENEGTNEQALIRFARLLSKERRLR  157



>ref|XP_003544452.1| PREDICTED: patatin-3-Kuras 1-like [Glycine max]
 gb|KHN46308.1| Patatin group A-3 [Glycine soja]
Length=408

 Score =   109 bits (272),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 63/107 (59%), Positives = 82/107 (77%), Gaps = 0/107 (0%)
 Frame = -1

Query  544  NPLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEE  365
            NPLIDVFS +S+DMVD+H++ + QAL + DNYLRIQ+D L G+ +SVD+ TKENL+ L  
Sbjct  291  NPLIDVFSQSSSDMVDFHLSAVTQALHSEDNYLRIQDDTLTGTDSSVDIATKENLEKLCH  350

Query  364  VGkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
            VG+KLL KPV ++NL  G  EP+    TN+DALKR A +LS+ERR R
Sbjct  351  VGEKLLKKPVSRINLENGLFEPLKNRETNEDALKRFAKILSQERRLR  397


 Score = 56.2 bits (134),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 34/59 (58%), Gaps = 2/59 (3%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAGIF--EVVRDATSLLAGPK*DGNPLIDV  527
            +APD N RPL+A KDI PFY +H PKIFP        ++      L GPK DG  L +V
Sbjct  77   TAPDNNNRPLFAAKDIKPFYMDHCPKIFPQHSGLGGTILAKMIRSLGGPKYDGKYLHEV  135


 Score = 47.8 bits (112),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 43/51 (84%), Gaps = 2/51 (4%)
 Frame = -3

Query  884  PP--GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            PP  G ++TILSIDGGGIRGIIP TI+ +LE +LQ LDGP+AR ADYFDVI
Sbjct  13   PPTYGNLVTILSIDGGGIRGIIPATIIGFLESQLQELDGPEARLADYFDVI  63



>ref|XP_007017306.1| Phospholipase A 2A, IIA,PLA2A [Theobroma cacao]
 gb|EOY14531.1| Phospholipase A 2A, IIA,PLA2A [Theobroma cacao]
Length=420

 Score =   109 bits (272),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 84/106 (79%), Gaps = 0/106 (0%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            PL+DVF  AS+DMVD+HIAT+FQALQ+ + YLRIQ+D L G+ +SVD+ TKENL+ L +V
Sbjct  301  PLMDVFMQASSDMVDFHIATVFQALQSEEKYLRIQDDTLCGTVSSVDIATKENLENLVKV  360

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
            G++LL KPV ++NL  GK EP+    TN++AL RLA +LS+E+R R
Sbjct  361  GEELLKKPVSRVNLDNGKFEPINNEDTNENALIRLAKVLSQEKRLR  406


 Score = 48.5 bits (114),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 31/56 (55%), Gaps = 1/56 (2%)
 Frame = -1

Query  691  PDKNKRPLYAGKDIVPFYKEHGPKIFPS-AGIFEVVRDATSLLAGPK*DGNPLIDV  527
            P++  RPL+A KDI  FY EH PKIFP     F    +    L GPK DG  L ++
Sbjct  89   PNEGNRPLFAAKDINEFYLEHCPKIFPQDRSPFAPAENLVKSLIGPKYDGRYLHNI  144


 Score = 42.7 bits (99),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/47 (74%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = -3

Query  878  GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            G +IT+LSIDGGGIRGIIPGTI+A+LE +LQ LD  +AR ADYFDVI
Sbjct  25   GNLITVLSIDGGGIRGIIPGTILAFLESQLQKLDDEEARLADYFDVI  71



>ref|XP_010268994.1| PREDICTED: patatin-like protein 2 isoform X1 [Nelumbo nucifera]
Length=409

 Score =   109 bits (272),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 78/106 (74%), Gaps = 0/106 (0%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            PL+DVF+ AS DMVDYH A +FQAL++G +YLRIQ+D L G  +SVD+ TKENLD L + 
Sbjct  290  PLVDVFTQASGDMVDYHNAVVFQALKSGSSYLRIQDDTLVGEISSVDIATKENLDNLVKA  349

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
            G+ LL KPV  +NL TG  EP+   GTN++ALK+ A  LS ERR R
Sbjct  350  GEALLKKPVSGVNLQTGIFEPITNGGTNEEALKKFAKQLSVERRLR  395


 Score = 63.2 bits (152),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 38/55 (69%), Gaps = 1/55 (2%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFP-SAGIFEVVRDATSLLAGPK*DGNPL  536
            +AP++N RPL+A KDIVPFY E  PKIFP ++GIF    +   L+ GPK DG  L
Sbjct  76   TAPNENNRPLFAAKDIVPFYLEDCPKIFPQTSGIFGSALNLIKLMNGPKYDGKYL  130


 Score = 47.4 bits (111),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/51 (76%), Positives = 44/51 (86%), Gaps = 2/51 (4%)
 Frame = -3

Query  884  PP--GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            PP  G ++TILSIDGGGIRGIIPGTI+A+LE +LQ LDG DAR ADYFDVI
Sbjct  12   PPTYGNLVTILSIDGGGIRGIIPGTILAFLESQLQKLDGEDARLADYFDVI  62



>gb|KJB58445.1| hypothetical protein B456_009G210500 [Gossypium raimondii]
Length=406

 Score =   109 bits (272),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 89/116 (77%), Gaps = 1/116 (1%)
 Frame = -1

Query  550  DGNPLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDAL  371
            + +PL+DVF+ AS+DM +YH+A +FQA Q+ ++YLRIQ+D L+G  ASVD++TKENL+ L
Sbjct  280  NSSPLVDVFTQASSDMAEYHLAAVFQAFQSENSYLRIQDDTLEGPLASVDISTKENLENL  339

Query  370  EEVGkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRRTIAALNG  203
             +VG+ LL KPV ++NL TGK EP    GTN++AL R+A +LS+E+R R + A  G
Sbjct  340  VKVGEDLLKKPVSRVNLETGKFEPC-NQGTNEEALIRMAKVLSKEKRLRDMKAPRG  394


 Score = 49.3 bits (116),  Expect(2) = 2e-10, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 30/55 (55%), Gaps = 1/55 (2%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPS-AGIFEVVRDATSLLAGPK*DGNPL  536
            +AP++  RPL+A KDI  FY  H PKIFP     F         +AGPK DG  L
Sbjct  69   TAPNEKNRPLFAAKDIKDFYLGHCPKIFPQDTSPFAAAASLMKTMAGPKYDGKYL  123


 Score = 44.7 bits (104),  Expect(2) = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/47 (77%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = -3

Query  878  GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            G +ITILSIDGGGIRGIIPGTI+A+LE +LQ LDG +AR ADYFD+I
Sbjct  9    GEIITILSIDGGGIRGIIPGTILAFLEAQLQKLDGEEARLADYFDII  55



>ref|XP_004958340.1| PREDICTED: patatin-3-Kuras 1-like [Setaria italica]
Length=412

 Score =   109 bits (272),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 56/116 (48%), Positives = 88/116 (76%), Gaps = 0/116 (0%)
 Frame = -1

Query  544  NPLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEE  365
             P++D+FS +SA +VDY+++ +FQAL++  NYLRIQED L G+ A+VDV T+EN++ L  
Sbjct  290  TPIVDMFSYSSAALVDYNVSILFQALRSEKNYLRIQEDSLMGAAATVDVATRENMEELVR  349

Query  364  VGkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRRTIAALNGGK  197
            +G+++L K V ++++ TGK+ PV + GTN DAL R A +LS+ER+ RT ++ + GK
Sbjct  350  IGERMLAKTVSRVDMETGKHVPVLEEGTNADALARFAEMLSQERKARTSSSSSQGK  405


 Score = 48.5 bits (114),  Expect(2) = 4e-09, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 31/51 (61%), Gaps = 1/51 (2%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAGIFEVVRDATSLLAGPK*DG  545
            +AP K+KRPL++ K I  FY E+GP IFP     EVV      + GPK DG
Sbjct  77   AAPGKDKRPLFSAKKINEFYTENGPHIFPQRPWPEVVNTLIE-IKGPKYDG  126


 Score = 41.2 bits (95),  Expect(2) = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 44/53 (83%), Gaps = 3/53 (6%)
 Frame = -3

Query  887  IPPGGV---ITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            +PP  V   +T+L+IDGGGIRG+IPGTI+A+LE++LQ  DGPDAR ADYFD I
Sbjct  11   VPPPAVGRRVTVLTIDGGGIRGLIPGTILAFLEKKLQEHDGPDARLADYFDYI  63



>ref|XP_008220196.1| PREDICTED: patatin-like protein 2 isoform X1 [Prunus mume]
Length=403

 Score =   108 bits (271),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 85/107 (79%), Gaps = 0/107 (0%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            PL+D+F+ A +DMVD+H+ATIFQALQ+ DNYLRIQ+D L G+ AS D+ T++NL+ L +V
Sbjct  290  PLVDIFTHAGSDMVDFHLATIFQALQSHDNYLRIQDDTLSGTLASADIATEQNLNDLVKV  349

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRRT  221
            G+ LL KPV +LN  TGK++PV    TN++AL R+A +LS+ER +R+
Sbjct  350  GEALLKKPVSRLNFDTGKSKPVRPEVTNEEALVRIASVLSKERAQRS  396


 Score = 50.4 bits (119),  Expect(2) = 3e-11, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 33/55 (60%), Gaps = 1/55 (2%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFP-SAGIFEVVRDATSLLAGPK*DGNPL  536
            + P++N RPLYA KDI PFY E+ PKIFP S+     V +    L  PK DG  L
Sbjct  74   TTPNENNRPLYAAKDINPFYLENCPKIFPQSSSPLINVEENLKGLGRPKYDGKYL  128


 Score = 46.2 bits (108),  Expect(2) = 3e-11, Method: Compositional matrix adjust.
 Identities = 37/47 (79%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = -3

Query  878  GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            G +IT+LSIDGGGIRGIIPGTI+ +LE ELQ LDG DAR ADYFDVI
Sbjct  14   GSLITVLSIDGGGIRGIIPGTILNFLESELQKLDGQDARLADYFDVI  60



>ref|XP_010065725.1| PREDICTED: patatin-like protein 2 [Eucalyptus grandis]
 gb|KCW88150.1| hypothetical protein EUGRSUZ_A00540 [Eucalyptus grandis]
Length=406

 Score =   108 bits (271),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 64/108 (59%), Positives = 78/108 (72%), Gaps = 0/108 (0%)
 Frame = -1

Query  547  GNPLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALE  368
            G PLIDVF+ ASADMVDYH+  +FQALQ  DNYLRIQ+D L G  +SVDV TK+NL  L 
Sbjct  286  GTPLIDVFTQASADMVDYHLCAVFQALQLHDNYLRIQDDTLSGVLSSVDVATKKNLTDLV  345

Query  367  EVGkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
            + G+ LL KPV ++NL TG  EP     TN++AL R A LLS+ER+ R
Sbjct  346  KTGEALLKKPVSRVNLETGVGEPTTNQETNEEALIRFAKLLSQERQLR  393


 Score = 50.8 bits (120),  Expect(2) = 1e-10, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 35/58 (60%), Gaps = 1/58 (2%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPS-AGIFEVVRDATSLLAGPK*DGNPLIDV  527
            + P++  RP++A KDI  FY EH PKIFP  +  F+ V      +AGPK DG  L +V
Sbjct  75   ATPNEKNRPVFAAKDIKDFYLEHCPKIFPQDSCPFKPVTKMIKAVAGPKYDGKYLHNV  132


 Score = 43.9 bits (102),  Expect(2) = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/51 (76%), Positives = 43/51 (84%), Gaps = 2/51 (4%)
 Frame = -3

Query  884  PP--GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            PP  G +ITILSIDGGGIRG+IPGTI+ +LE ELQ LDG DAR ADYFDVI
Sbjct  11   PPTFGNLITILSIDGGGIRGLIPGTILNFLECELQKLDGEDARIADYFDVI  61



>ref|XP_011629236.1| PREDICTED: patatin-like protein 2 [Amborella trichopoda]
Length=406

 Score =   108 bits (271),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 65/108 (60%), Positives = 79/108 (73%), Gaps = 0/108 (0%)
 Frame = -1

Query  547  GNPLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALE  368
            G PLID F  ASADMVD HI+ +FQAL +  +YLRIQ+D L G T+SVD+ T++NL  L 
Sbjct  288  GTPLIDTFQQASADMVDIHISNVFQALHSEQSYLRIQDDTLTGDTSSVDIATEKNLKELV  347

Query  367  EVGkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
            +VGK+LL KPV ++NL TGK E VP  GTN+ AL R A LLS ERR R
Sbjct  348  KVGKELLQKPVSRVNLETGKFEAVPNEGTNEQALIRFAKLLSNERRTR  395


 Score = 55.5 bits (132),  Expect(2) = 4e-12, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 32/56 (57%), Gaps = 2/56 (4%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPS--AGIFEVVRDATSLLAGPK*DGNPL  536
            +AP  N RPLYA KDI  FY +H PKIFP    G+    R   S + GPK +G  L
Sbjct  75   TAPGDNNRPLYAAKDITSFYLDHCPKIFPQQRCGLLGSARKFVSAITGPKYNGKYL  130


 Score = 44.3 bits (103),  Expect(2) = 4e-12, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 42/51 (82%), Gaps = 2/51 (4%)
 Frame = -3

Query  884  PP--GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            PP  G +ITILSIDGGGIRGIIP TI+++LE ELQ LDG + R ADYFDVI
Sbjct  11   PPTYGDLITILSIDGGGIRGIIPSTILSFLESELQKLDGEEVRLADYFDVI  61



>ref|XP_002449853.1| hypothetical protein SORBIDRAFT_05g024430 [Sorghum bicolor]
 gb|EES08841.1| hypothetical protein SORBIDRAFT_05g024430 [Sorghum bicolor]
Length=413

 Score =   108 bits (271),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 79/106 (75%), Gaps = 0/106 (0%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            P+ID+FS ASADMVD H A +F+AL    NYLRIQ+D L G  +SVD+ TKEN++AL  +
Sbjct  301  PIIDIFSHASADMVDIHAAVLFEALHCEKNYLRIQDDSLTGHASSVDIATKENMEALIGI  360

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
            GKKLL KPV ++N+ TG  EPV   GTN+DAL R A +LS+ERR R
Sbjct  361  GKKLLKKPVARVNIDTGMYEPVAGEGTNEDALARFAKMLSDERRLR  406


 Score = 53.1 bits (126),  Expect(2) = 1e-11, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 33/53 (62%), Gaps = 2/53 (4%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPS--AGIFEVVRDATSLLAGPK*DG  545
            +APD+N+RPL+A KD+  FY E+GP IFP    G    V +    + GPK DG
Sbjct  82   AAPDENRRPLFAAKDLTTFYLENGPNIFPQRKVGWLTPVANLIGTMRGPKYDG  134


 Score = 44.7 bits (104),  Expect(2) = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 42/51 (82%), Gaps = 2/51 (4%)
 Frame = -3

Query  884  PP--GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            PP  G +IT+LSIDGGGIRG+IP TI+  LE +LQ LDGPDAR ADYFDVI
Sbjct  18   PPSQGRLITVLSIDGGGIRGLIPATIITCLETKLQELDGPDARIADYFDVI  68



>ref|XP_007156814.1| hypothetical protein PHAVU_002G019800g [Phaseolus vulgaris]
 gb|ESW28808.1| hypothetical protein PHAVU_002G019800g [Phaseolus vulgaris]
Length=401

 Score =   108 bits (270),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 61/106 (58%), Positives = 76/106 (72%), Gaps = 0/106 (0%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            P+ID FS AS DMVDYH   +F +LQ+ DNYLRIQE+ LKG  ASVD+ T ENL+ L +V
Sbjct  290  PIIDCFSEASTDMVDYHNVVVFSSLQSEDNYLRIQENTLKGDLASVDIATTENLNNLVKV  349

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
            G+ LL K V ++NL TG  EP P  GTN++ALKR A  LSE R+ +
Sbjct  350  GENLLKKTVTRVNLDTGLYEPAPDKGTNEEALKRFAKSLSEARKNK  395


 Score = 54.3 bits (129),  Expect(2) = 7e-12, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 32/50 (64%), Gaps = 1/50 (2%)
 Frame = -1

Query  691  PDKNKRPLYAGKDIVPFYKEHGPKIFPSA-GIFEVVRDATSLLAGPK*DG  545
            P  N RPL++ KDIVPFY ++ P+IFP   GIF  + +    L GPK DG
Sbjct  78   PKANNRPLFSAKDIVPFYLKNSPQIFPQKRGIFTPLVNIGKALMGPKYDG  127


 Score = 44.3 bits (103),  Expect(2) = 7e-12, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -3

Query  884  PPGGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            P    IT+LSIDGGGIRGIIPG ++AYLE ELQ LDG +AR ADYFDV+
Sbjct  12   PKYDTITVLSIDGGGIRGIIPGVVLAYLESELQELDGDNARLADYFDVM  60



>gb|KCW54973.1| hypothetical protein EUGRSUZ_I00941 [Eucalyptus grandis]
Length=403

 Score =   108 bits (270),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 83/107 (78%), Gaps = 0/107 (0%)
 Frame = -1

Query  544  NPLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEE  365
            +PLID++S  S+D+VDYH + +F+A Q+  NYLRI +D LKG+ +SVD +TKENL+ L +
Sbjct  286  SPLIDIYSQGSSDLVDYHNSVVFKAYQSEKNYLRINDDSLKGTLSSVDTSTKENLEGLVK  345

Query  364  VGkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
            VG+ LL KPV + +L TG+ E +P AGTN++ALKR A LLS+E++ R
Sbjct  346  VGEHLLKKPVSRFDLDTGRYESIPNAGTNEEALKRFAKLLSDEKKLR  392


 Score = 58.2 bits (139),  Expect(2) = 7e-12, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 33/52 (63%), Gaps = 1/52 (2%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFP-SAGIFEVVRDATSLLAGPK*DG  545
            SAPD + RPL+A KDIVPFY E+ PKIFP   G    V      LAGPK +G
Sbjct  76   SAPDADNRPLFAAKDIVPFYLENCPKIFPQGCGCLGSVVSTLRSLAGPKYNG  127


 Score = 40.8 bits (94),  Expect(2) = 7e-12, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 41/51 (80%), Gaps = 2/51 (4%)
 Frame = -3

Query  884  PP--GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            PP  G +ITILSIDGGG+RGIIPG I+ YLE +LQ LDG  AR ADYFDVI
Sbjct  12   PPKYGKLITILSIDGGGVRGIIPGVILDYLEAQLQELDGEGARLADYFDVI  62



>gb|KHN12765.1| Patatin group A-3 [Glycine soja]
Length=409

 Score =   108 bits (271),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 61/110 (55%), Positives = 84/110 (76%), Gaps = 0/110 (0%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            PLIDVF+ +SADMVD+H++ + QAL + DNYLRIQ+D L G+ +SVD+ TKENL+ L ++
Sbjct  293  PLIDVFTQSSADMVDFHLSAVTQALHSQDNYLRIQDDTLTGTDSSVDIATKENLEKLSQI  352

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRRTIAA  212
            G+KLL KPV ++NL  G  EP+    TN+DALKR A +LS+ERR R + +
Sbjct  353  GEKLLKKPVSRVNLENGLFEPLKNRETNEDALKRFAKILSQERRLREMKS  402


 Score = 59.7 bits (143),  Expect(2) = 8e-15, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 34/54 (63%), Gaps = 3/54 (6%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPSA---GIFEVVRDATSLLAGPK*DG  545
            +APD N RPL+A KDI PFY +H PKIFP     G   + +   SLL GPK DG
Sbjct  77   TAPDNNNRPLFAAKDIKPFYMDHCPKIFPQHSGLGGTILAKVVKSLLGGPKYDG  130


 Score = 48.9 bits (115),  Expect(2) = 8e-15, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 43/51 (84%), Gaps = 2/51 (4%)
 Frame = -3

Query  884  PP--GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            PP  G ++TILSIDGGGIRGIIP TI+ +LE +LQ LDGPDAR ADYFDVI
Sbjct  13   PPTYGNLVTILSIDGGGIRGIIPATIIDFLESQLQELDGPDARLADYFDVI  63



>ref|XP_010098699.1| Patatin group A-3 [Morus notabilis]
 gb|EXB75602.1| Patatin group A-3 [Morus notabilis]
Length=434

 Score =   108 bits (271),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 60/106 (57%), Positives = 81/106 (76%), Gaps = 0/106 (0%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            P++DV+S AS+DMVD H++ IFQAL + D YLRIQ+D+L G  + VD+ TKENLD L ++
Sbjct  320  PIVDVYSQASSDMVDLHMSVIFQALHSQDRYLRIQDDELAGEESLVDIATKENLDKLVQI  379

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
            G++LL KP+ ++NL TG +EP+    TNKDALKR A LLS E+R R
Sbjct  380  GEQLLKKPLARVNLETGLSEPLENGVTNKDALKRFAKLLSSEKRLR  425


 Score = 56.6 bits (135),  Expect(2) = 5e-12, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 33/51 (65%), Gaps = 1/51 (2%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIF-PSAGIFEVVRDATSLLAGPK*D  548
            +APD+NKRP  A KDI PFY EH  KIF  ++G  + VR     LAGPK D
Sbjct  106  AAPDENKRPCIAAKDITPFYLEHASKIFQQTSGFLKSVRSFLGNLAGPKYD  156


 Score = 42.4 bits (98),  Expect(2) = 5e-12, Method: Compositional matrix adjust.
 Identities = 35/51 (69%), Positives = 42/51 (82%), Gaps = 2/51 (4%)
 Frame = -3

Query  884  PP--GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            PP  G +IT+LSIDGGGIRGIIP TI+++ E +LQ LDG +AR ADYFDVI
Sbjct  42   PPNYGNLITVLSIDGGGIRGIIPATILSFFESQLQELDGEEARLADYFDVI  92



>ref|XP_003549405.1| PREDICTED: patatin-3-Kuras 1 [Glycine max]
Length=409

 Score =   108 bits (270),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 61/110 (55%), Positives = 84/110 (76%), Gaps = 0/110 (0%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            PLIDVF+ +SADMVD+H++ + QAL + DNYLRIQ+D L G+ +SVD+ TKENL+ L ++
Sbjct  293  PLIDVFTQSSADMVDFHLSAVTQALHSQDNYLRIQDDTLTGTDSSVDIATKENLEKLSQI  352

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRRTIAA  212
            G+KLL KPV ++NL  G  EP+    TN+DALKR A +LS+ERR R + +
Sbjct  353  GEKLLKKPVSRVNLENGLFEPLKNRETNEDALKRFAKILSQERRLREMKS  402


 Score = 59.7 bits (143),  Expect(2) = 7e-15, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 34/54 (63%), Gaps = 3/54 (6%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPSA---GIFEVVRDATSLLAGPK*DG  545
            +APD N RPL+A KDI PFY +H PKIFP     G   + +   SLL GPK DG
Sbjct  77   TAPDNNNRPLFAAKDIKPFYMDHSPKIFPQHSGLGGTILAKVVKSLLGGPKYDG  130


 Score = 48.9 bits (115),  Expect(2) = 7e-15, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 43/51 (84%), Gaps = 2/51 (4%)
 Frame = -3

Query  884  PP--GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            PP  G ++TILSIDGGGIRGIIP TI+ +LE +LQ LDGPDAR ADYFDVI
Sbjct  13   PPTYGNLVTILSIDGGGIRGIIPATIIDFLESQLQELDGPDARLADYFDVI  63



>ref|XP_008664528.1| PREDICTED: patatin-like protein 2 [Zea mays]
Length=405

 Score =   108 bits (270),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 63/139 (45%), Positives = 90/139 (65%), Gaps = 11/139 (8%)
 Frame = -1

Query  637  KEHGPKIFPSAGIFE-VVRDATSLLAGPK*DGNPLIDVFSVASADMVDYHIATIFQALQA  461
            + +  K     GIF  +++D T+          P+ID+F+ ASADMVD H+  +F+AL +
Sbjct  272  RRYSAKAAAKWGIFNWLIKDGTA----------PIIDMFNSASADMVDIHLCVLFRALHS  321

Query  460  GDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnlLTGKNEPVPKAGT  281
             +NYLRIQ D L GS  S+D  +KEN+D L ++GK LL++ V +++L TGKN  VP AGT
Sbjct  322  SENYLRIQYDQLTGSAGSIDDCSKENMDKLVQIGKDLLSQNVSRVDLETGKNMDVPSAGT  381

Query  280  NKDALKRLAGLLSEERRRR  224
            N + L + A  LS+ERRRR
Sbjct  382  NAEQLAKFAKQLSDERRRR  400


 Score = 46.6 bits (109),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/45 (76%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = -3

Query  872  VITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            ++T+LSIDGGG+RGIIP TI+A+LEE+LQ LDGPDAR ADYFDV+
Sbjct  20   LVTVLSIDGGGVRGIIPATILAFLEEKLQELDGPDARIADYFDVV  64


 Score = 43.9 bits (102),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 23/63 (37%), Positives = 31/63 (49%), Gaps = 1/63 (2%)
 Frame = -1

Query  688  DKNKRPLYAGKDIVPFYKEHGPKIFPSAG-IFEVVRDATSLLAGPK*DGNPLIDVFSVAS  512
            D  +RPL+  KD+  FY +H PKIFP    I   +     ++ GPK DG  L  +     
Sbjct  85   DGRRRPLFDAKDLAQFYIDHSPKIFPQKNWILSKIAGTLRMVRGPKYDGKYLHGLLRQHL  144

Query  511  ADM  503
             DM
Sbjct  145  GDM  147



>tpg|DAA48470.1| TPA: hypothetical protein ZEAMMB73_976536 [Zea mays]
Length=439

 Score =   108 bits (271),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 63/139 (45%), Positives = 90/139 (65%), Gaps = 11/139 (8%)
 Frame = -1

Query  637  KEHGPKIFPSAGIFE-VVRDATSLLAGPK*DGNPLIDVFSVASADMVDYHIATIFQALQA  461
            + +  K     GIF  +++D T+          P+ID+F+ ASADMVD H+  +F+AL +
Sbjct  306  RRYSAKAAAKWGIFNWLIKDGTA----------PIIDMFNSASADMVDIHLCVLFRALHS  355

Query  460  GDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnlLTGKNEPVPKAGT  281
             +NYLRIQ D L GS  S+D  +KEN+D L ++GK LL++ V +++L TGKN  VP AGT
Sbjct  356  SENYLRIQYDQLTGSAGSIDDCSKENMDKLVQIGKDLLSQNVSRVDLETGKNMDVPSAGT  415

Query  280  NKDALKRLAGLLSEERRRR  224
            N + L + A  LS+ERRRR
Sbjct  416  NAEQLAKFAKQLSDERRRR  434


 Score = 46.6 bits (109),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/45 (76%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = -3

Query  872  VITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            ++T+LSIDGGG+RGIIP TI+A+LEE+LQ LDGPDAR ADYFDV+
Sbjct  20   LVTVLSIDGGGVRGIIPATILAFLEEKLQELDGPDARIADYFDVV  64


 Score = 44.3 bits (103),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 23/63 (37%), Positives = 31/63 (49%), Gaps = 1/63 (2%)
 Frame = -1

Query  688  DKNKRPLYAGKDIVPFYKEHGPKIFPSAG-IFEVVRDATSLLAGPK*DGNPLIDVFSVAS  512
            D  +RPL+  KD+  FY +H PKIFP    I   +     ++ GPK DG  L  +     
Sbjct  85   DGRRRPLFDAKDLAQFYIDHSPKIFPQKNWILSKIAGTLRMVRGPKYDGKYLHGLLRQHL  144

Query  511  ADM  503
             DM
Sbjct  145  GDM  147



>gb|AAD22149.1|AF061282_2 patatin-like protein [Sorghum bicolor]
Length=438

 Score =   108 bits (271),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 79/106 (75%), Gaps = 0/106 (0%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            P+ID+FS ASADMVD H A +F+AL    NYLRIQ+D L G  +SVD+ TKEN++AL  +
Sbjct  326  PIIDIFSHASADMVDIHAAVLFEALHCEKNYLRIQDDSLTGHASSVDIATKENMEALIGI  385

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
            GKKLL KPV ++N+ TG  EPV   GTN+DAL R A +LS+ERR R
Sbjct  386  GKKLLKKPVARVNIDTGMYEPVAGEGTNEDALARFAKMLSDERRLR  431


 Score = 47.4 bits (111),  Expect(2) = 8e-10, Method: Compositional matrix adjust.
 Identities = 18/29 (62%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFP  611
            +APD+N+RPL+A KD+  FY E+GP IFP
Sbjct  82   AAPDENRRPLFAAKDLTTFYLENGPNIFP  110


 Score = 44.3 bits (103),  Expect(2) = 8e-10, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 42/51 (82%), Gaps = 2/51 (4%)
 Frame = -3

Query  884  PP--GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            PP  G +IT+LSIDGGGIRG+IP TI+  LE +LQ LDGPDAR ADYFDVI
Sbjct  18   PPSQGRLITVLSIDGGGIRGLIPATIITCLETKLQELDGPDARIADYFDVI  68



>ref|XP_009419098.1| PREDICTED: patatin-like protein 2 [Musa acuminata subsp. malaccensis]
Length=407

 Score =   108 bits (270),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 64/110 (58%), Positives = 83/110 (75%), Gaps = 1/110 (1%)
 Frame = -1

Query  544  NPLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEE  365
            NPL DVF  +SADMVD H++ +FQALQ+  NYLRI++D L G+ +SVD++TKENL  L  
Sbjct  290  NPLFDVFMQSSADMVDIHLSVVFQALQSKSNYLRIEDDTLSGTVSSVDISTKENLADLVN  349

Query  364  VGkklltkpvlklnlLTGKNEPVPKA-GTNKDALKRLAGLLSEERRRRTI  218
            VG++LL KPV ++NL TG  EPV    GTN+DALKR A +LS+ERR R +
Sbjct  350  VGEQLLKKPVSRVNLETGIYEPVGNGEGTNEDALKRFARILSDERRLREL  399


 Score = 52.8 bits (125),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 32/55 (58%), Gaps = 1/55 (2%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPS-AGIFEVVRDATSLLAGPK*DGNPL  536
            +APD N RPL+A KDI  FY EH  KIFP   G+   VR     + GPK +G  L
Sbjct  77   TAPDDNNRPLFAAKDIKSFYLEHSSKIFPQIGGLLAGVRRMFQAVWGPKYNGKYL  131


 Score = 47.4 bits (111),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/47 (79%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = -3

Query  878  GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            G +ITILSIDGGGIRGIIP TI+++LE ELQ LDG DAR ADYFDVI
Sbjct  17   GNLITILSIDGGGIRGIIPATILSFLESELQKLDGEDARIADYFDVI  63



>gb|KCW66175.1| hypothetical protein EUGRSUZ_F00011 [Eucalyptus grandis]
Length=334

 Score =   107 bits (268),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 63/115 (55%), Positives = 84/115 (73%), Gaps = 0/115 (0%)
 Frame = -1

Query  547  GNPLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALE  368
            G+PLIDVFS ASADMVD+H++ +FQAL   DNYLRIQ+D L G  +SVDV TK+NL+ L 
Sbjct  214  GSPLIDVFSQASADMVDFHLSAVFQALNLQDNYLRIQDDTLSGVLSSVDVATKKNLNDLV  273

Query  367  EVGkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRRTIAALNG  203
            + G+ LL KPV ++NL +G  +P     TN++ALKR A LLS+ER+ R   + +G
Sbjct  274  KTGEALLKKPVSRVNLESGVCDPTSNQETNEEALKRFAKLLSQERQLRLARSPHG  328


 Score = 53.9 bits (128),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 34/58 (59%), Gaps = 1/58 (2%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPS-AGIFEVVRDATSLLAGPK*DGNPLIDV  527
            + PD N RP++A KDI  FY  H PKIFP  +  F+ V      +AGPK DG  L DV
Sbjct  3    TTPDGNNRPVFAAKDIKDFYLNHCPKIFPQDSCPFKPVTKIIKAVAGPKYDGKYLHDV  60



>ref|XP_009611848.1| PREDICTED: patatin-like protein 2, partial [Nicotiana tomentosiformis]
Length=114

 Score =   102 bits (255),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 58/102 (57%), Positives = 76/102 (75%), Gaps = 0/102 (0%)
 Frame = -1

Query  529  VFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkkl  350
            VF+ AS DMVD HI+ +FQAL + +NYLRIQ+D L G+ +SVD+ TKEN+D L E+GK L
Sbjct  1    VFTQASGDMVDLHISVVFQALHSEENYLRIQDDTLTGTDSSVDIATKENMDKLVEIGKAL  60

Query  349  ltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
            L KPV ++NL TG +E     GTN++ LKR A +LSEE+R R
Sbjct  61   LKKPVSRVNLQTGLSEQCKNGGTNEETLKRFAKVLSEEKRLR  102



>ref|XP_009631601.1| PREDICTED: patatin-like protein 3 [Nicotiana tomentosiformis]
Length=137

 Score =   103 bits (257),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 75/94 (80%), Gaps = 0/94 (0%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            P+I+VF  +SAD+VDYH + +FQAL + +NYLRIQED+L G+ ASVD+ TKENL+ L E+
Sbjct  43   PVIEVFFQSSADLVDYHNSVVFQALHSDNNYLRIQEDELSGTEASVDIATKENLERLVEI  102

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKR  260
            G+ LL KP+ ++NL TG  EP+P+ GTN++AL R
Sbjct  103  GQNLLKKPLSRVNLETGLTEPIPRGGTNEEALIR  136



>ref|XP_009769117.1| PREDICTED: patatin-like protein 2 isoform X1 [Nicotiana sylvestris]
Length=410

 Score =   108 bits (270),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 61/106 (58%), Positives = 81/106 (76%), Gaps = 0/106 (0%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            P++DVF+ AS DMVD HI+ +FQAL + +NYLRIQ+D L G+ +SVD++TKEN+D L E+
Sbjct  293  PIVDVFTQASGDMVDLHISVVFQALHSEENYLRIQDDTLTGTDSSVDISTKENMDKLVEI  352

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
            GK LL KPV ++NL TG +E     GTN++ LKR A LLSEE+R R
Sbjct  353  GKTLLKKPVSRVNLQTGLSEQSKNDGTNEETLKRFAMLLSEEKRLR  398


 Score = 62.8 bits (151),  Expect(2) = 9e-15, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 37/58 (64%), Gaps = 1/58 (2%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAG-IFEVVRDATSLLAGPK*DGNPLIDV  527
            +APDK+KRPL+A KDI PFY EHGPKIFP    +F  +      L GPK +G  L  V
Sbjct  79   TAPDKDKRPLFAAKDIKPFYLEHGPKIFPQKKMVFGSIVKTLKSLIGPKYNGKYLHQV  136


 Score = 45.8 bits (107),  Expect(2) = 9e-15, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 42/51 (82%), Gaps = 2/51 (4%)
 Frame = -3

Query  884  PP--GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            PP  G +ITILSIDGGGIRGIIP TI+ YLE +LQ LDG DAR ADYFD+I
Sbjct  15   PPTYGKLITILSIDGGGIRGIIPATILEYLESQLQELDGEDARLADYFDII  65



>ref|XP_007227369.1| hypothetical protein PRUPE_ppa026872mg [Prunus persica]
 gb|EMJ28568.1| hypothetical protein PRUPE_ppa026872mg [Prunus persica]
Length=403

 Score =   108 bits (269),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 84/107 (79%), Gaps = 0/107 (0%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            PL+D+F+ A +DMVD+H+ATIFQALQ+ DNYLRIQ+D L G+ ASVD+ T++NL+ L +V
Sbjct  290  PLVDIFTHAGSDMVDFHLATIFQALQSHDNYLRIQDDTLSGTLASVDIATEQNLNDLVKV  349

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRRT  221
            G+ LL KPV ++N  T K++PV    TN +AL R+A +LS+ER +R+
Sbjct  350  GEALLKKPVSRVNFDTNKSKPVRPEVTNAEALVRIASVLSKERAQRS  396


 Score = 50.8 bits (120),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 36/56 (64%), Gaps = 3/56 (5%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFP--SAGIFEVVRDATSLLAGPK*DGNPL  536
            + P++N RPLYA KDI PFY E+ PKIFP  S+ + +V  +  S L  PK DG  L
Sbjct  74   TTPNENNRPLYAAKDINPFYLENCPKIFPQSSSPLADVAENLES-LRRPKYDGKYL  128


 Score = 46.2 bits (108),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 37/47 (79%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = -3

Query  878  GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            G +IT+LSIDGGGIRGIIPGTI+ +LE ELQ LDG DAR ADYFDVI
Sbjct  14   GSLITVLSIDGGGIRGIIPGTILNFLESELQKLDGQDARLADYFDVI  60



>ref|XP_004499077.1| PREDICTED: patatin-2-Kuras 3-like isoform X3 [Cicer arietinum]
Length=372

 Score =   107 bits (268),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 63/116 (54%), Positives = 83/116 (72%), Gaps = 0/116 (0%)
 Frame = -1

Query  544  NPLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEE  365
            NPLIDVF+ +S DMVD+H++ + QAL + DNYLRIQ+D L G  +SVD+ T+ENL+ L E
Sbjct  246  NPLIDVFTQSSGDMVDFHLSCVTQALHSQDNYLRIQDDTLTGDVSSVDIATEENLEKLCE  305

Query  364  VGkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRRTIAALNGGK  197
            +G KLL KPV ++NL  G  EPV    TN+ ALKRLA  LS+ERR R + + +  K
Sbjct  306  IGDKLLKKPVSRVNLENGHFEPVIDGETNEQALKRLAKTLSQERRLRDMRSPHTNK  361


 Score = 63.2 bits (152),  Expect(2) = 4e-11, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 39/63 (62%), Gaps = 10/63 (16%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPS----AGIF--EVVRDATSLLAGPK*DGNPL  536
            +APDKN RPL+A KDI PFY EH PKIFP      GI   +VVR     L GPK DG  L
Sbjct  32   AAPDKNNRPLFAAKDIKPFYLEHCPKIFPQHRGLGGIMLAKVVRS----LGGPKYDGKYL  87

Query  535  IDV  527
             DV
Sbjct  88   HDV  90


 Score = 33.1 bits (74),  Expect(2) = 4e-11, Method: Compositional matrix adjust.
 Identities = 14/18 (78%), Positives = 15/18 (83%), Gaps = 0/18 (0%)
 Frame = -3

Query  791  LQALDGPDARAADYFDVI  738
            +Q LDG DAR ADYFDVI
Sbjct  1    MQELDGEDARLADYFDVI  18



>gb|EMT13605.1| Patatin group A-3 [Aegilops tauschii]
Length=397

 Score =   108 bits (269),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 60/106 (57%), Positives = 78/106 (74%), Gaps = 0/106 (0%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            PL+D+FS ASADMVD H A +FQ+L+   NYLRIQ+D L G T+SVD++TKEN+ AL E+
Sbjct  286  PLLDIFSHASADMVDIHAAVLFQSLRVEKNYLRIQDDSLTGHTSSVDISTKENMQALIEI  345

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
            G KLL   V ++N+ TG  EPV   GTN++AL R A  LS+ER+ R
Sbjct  346  GNKLLKMSVARVNIDTGMYEPVDGEGTNEEALARFAKKLSDERKLR  391


 Score = 52.8 bits (125),  Expect(2) = 7e-12, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 35/58 (60%), Gaps = 2/58 (3%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPS--AGIFEVVRDATSLLAGPK*DGNPLID  530
            +AP +NKRPL+A KDI  FY ++GPKIFP    G    V +    + GPK DG  L D
Sbjct  69   AAPGENKRPLFAAKDINQFYLDNGPKIFPQRRWGFLTPVANLLGAVMGPKYDGKFLHD  126


 Score = 45.8 bits (107),  Expect(2) = 7e-12, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 43/51 (84%), Gaps = 2/51 (4%)
 Frame = -3

Query  884  PP--GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            PP  G +IT+LSIDGGGIRG+IP TI+A LE +LQ LDGPDAR ADYFDVI
Sbjct  5    PPSQGRLITVLSIDGGGIRGLIPSTILACLESKLQELDGPDARIADYFDVI  55



>ref|XP_006387188.1| hypothetical protein POPTR_1581s00200g [Populus trichocarpa]
 gb|ERP46102.1| hypothetical protein POPTR_1581s00200g [Populus trichocarpa]
Length=403

 Score =   108 bits (269),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 85/106 (80%), Gaps = 1/106 (1%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            PL+DVF+ ASADMVD+HI+T+FQAL + +NYLRIQ+D L G+ +SVDV TKENL+ L +V
Sbjct  291  PLVDVFTQASADMVDFHISTVFQALNSEENYLRIQDDTLTGTLSSVDVATKENLENLVKV  350

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
            G++LL KPV ++NL TG  EP+ K  TN++AL++LA LLS E+  R
Sbjct  351  GEELLKKPVSRVNLATGVFEPINKM-TNEEALRKLAKLLSREKHLR  395


 Score = 50.1 bits (118),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 31/52 (60%), Gaps = 1/52 (2%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPS-AGIFEVVRDATSLLAGPK*DG  545
            +AP+K  RPL+A KDI  FY E+ PKIFP  +  F    +    L GPK DG
Sbjct  77   AAPNKQNRPLFAAKDINDFYLENCPKIFPQDSSKFASAANLVKTLGGPKYDG  128


 Score = 47.0 bits (110),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/47 (81%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = -3

Query  878  GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            G  IT+LSIDGGGIRGIIPGTI+A+LE ELQ LDG DAR ADYFDVI
Sbjct  17   GNQITVLSIDGGGIRGIIPGTILAFLESELQKLDGADARLADYFDVI  63



>ref|XP_006388385.1| hypothetical protein POPTR_0202s00220g [Populus trichocarpa]
 gb|ERP47299.1| hypothetical protein POPTR_0202s00220g [Populus trichocarpa]
Length=390

 Score =   107 bits (268),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 85/106 (80%), Gaps = 1/106 (1%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            PL+DVF+ ASADMVD+HI+T+FQAL + +NYLRIQ+D L G+ +SVDV TKENL+ L +V
Sbjct  278  PLVDVFTQASADMVDFHISTVFQALNSEENYLRIQDDTLTGTLSSVDVATKENLENLVKV  337

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
            G++LL KPV ++NL TG  EP+ K  TN++AL++LA LLS E+  R
Sbjct  338  GEELLKKPVSRVNLATGVFEPINKM-TNEEALRKLAKLLSREKHLR  382


 Score = 50.1 bits (118),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 31/52 (60%), Gaps = 1/52 (2%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPS-AGIFEVVRDATSLLAGPK*DG  545
            +AP+K  RPL+A KDI  FY E+ PKIFP  +  F    +    L GPK DG
Sbjct  77   AAPNKQNRPLFAAKDINDFYLENCPKIFPQDSSKFASAANLVKTLGGPKYDG  128


 Score = 47.0 bits (110),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/47 (81%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = -3

Query  878  GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            G  IT+LSIDGGGIRGIIPGTI+A+LE ELQ LDG DAR ADYFDVI
Sbjct  17   GNQITVLSIDGGGIRGIIPGTILAFLESELQKLDGADARLADYFDVI  63



>ref|XP_002324124.2| hypothetical protein POPTR_0017s02550g [Populus trichocarpa]
 gb|EEF04257.2| hypothetical protein POPTR_0017s02550g [Populus trichocarpa]
Length=335

 Score =   107 bits (267),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 65/115 (57%), Positives = 88/115 (77%), Gaps = 1/115 (1%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            PL+DVF+ AS DMVD+HI+T+FQAL + +NYLRIQ+D L G+ +SVDV TKENL+ L +V
Sbjct  216  PLVDVFTQASGDMVDFHISTVFQALNSEENYLRIQDDTLTGTLSSVDVATKENLENLVKV  275

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRRTIAALNGGK  197
            G+KLL KPV ++NL TG  EP+ K  TN++AL +LA LLS E++ R + +   GK
Sbjct  276  GEKLLEKPVSRVNLATGVYEPINKM-TNEEALTKLAKLLSREKQLREVRSSFLGK  329



>ref|XP_009797490.1| PREDICTED: patatin-like protein 2 [Nicotiana sylvestris]
Length=412

 Score =   107 bits (268),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 59/106 (56%), Positives = 79/106 (75%), Gaps = 0/106 (0%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            P++DVF+ AS DMVD HI+ +FQAL + +NYLRIQ+D L G+ +SVD+ TKEN++ L E+
Sbjct  295  PIVDVFTQASGDMVDLHISVVFQALHSEENYLRIQDDTLTGTNSSVDIATKENMNKLVEI  354

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
            GK LL KPV ++NL TG +E     GTN++ LKR   LLSEE+R R
Sbjct  355  GKTLLKKPVSRVNLQTGLSEQCKNGGTNEETLKRFVKLLSEEKRLR  400


 Score = 61.6 bits (148),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 37/60 (62%), Gaps = 3/60 (5%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFP---SAGIFEVVRDATSLLAGPK*DGNPLIDV  527
            +AP K+KRPL+A KDI PFY EHGPKIFP   S  +F  V      L GPK +G  L  V
Sbjct  79   TAPHKDKRPLFAAKDIKPFYLEHGPKIFPQKKSMILFGSVMKTLKSLMGPKYNGKYLHQV  138


 Score = 46.2 bits (108),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 42/51 (82%), Gaps = 2/51 (4%)
 Frame = -3

Query  884  PP--GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            PP  G +ITILSIDGGGIRGIIP TI+ YLE +LQ LDG DAR ADYFD+I
Sbjct  15   PPTYGKLITILSIDGGGIRGIIPATILEYLESQLQELDGEDARLADYFDII  65



>ref|XP_010059971.1| PREDICTED: patatin-like protein 2 isoform X2 [Eucalyptus grandis]
 gb|KCW66465.1| hypothetical protein EUGRSUZ_F00262 [Eucalyptus grandis]
Length=334

 Score =   107 bits (266),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 63/115 (55%), Positives = 83/115 (72%), Gaps = 0/115 (0%)
 Frame = -1

Query  547  GNPLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALE  368
            G+PLIDVFS ASADMVD+H++ +FQAL   DNYLRIQ+D L G  +SVDV TK+NL+ L 
Sbjct  214  GSPLIDVFSQASADMVDFHLSAVFQALNLQDNYLRIQDDTLSGVLSSVDVATKKNLNDLV  273

Query  367  EVGkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRRTIAALNG  203
            + G+ LL KPV ++NL +G  +P     TN++ALKR A LLS+ER  R   + +G
Sbjct  274  KTGEALLKKPVSRVNLESGVCDPTSNQETNEEALKRFAKLLSQERLLRLAKSPHG  328


 Score = 53.9 bits (128),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 34/58 (59%), Gaps = 1/58 (2%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPS-AGIFEVVRDATSLLAGPK*DGNPLIDV  527
            + PD N RP++A KDI  FY  H PKIFP  +  F+ V      +AGPK DG  L DV
Sbjct  3    TTPDGNNRPVFAAKDIKDFYLNHCPKIFPQDSCPFKPVTKIIKAVAGPKYDGKYLHDV  60



>ref|XP_004499075.1| PREDICTED: patatin-2-Kuras 3-like isoform X1 [Cicer arietinum]
Length=418

 Score =   107 bits (268),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 62/107 (58%), Positives = 79/107 (74%), Gaps = 0/107 (0%)
 Frame = -1

Query  544  NPLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEE  365
            NPLIDVF+ +S DMVD+H++ + QAL + DNYLRIQ+D L G  +SVD+ T+ENL+ L E
Sbjct  292  NPLIDVFTQSSGDMVDFHLSCVTQALHSQDNYLRIQDDTLTGDVSSVDIATEENLEKLCE  351

Query  364  VGkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
            +G KLL KPV ++NL  G  EPV    TN+ ALKRLA  LS+ERR R
Sbjct  352  IGDKLLKKPVSRVNLENGHFEPVIDGETNEQALKRLAKTLSQERRLR  398


 Score = 63.2 bits (152),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 39/63 (62%), Gaps = 10/63 (16%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPS----AGIF--EVVRDATSLLAGPK*DGNPL  536
            +APDKN RPL+A KDI PFY EH PKIFP      GI   +VVR     L GPK DG  L
Sbjct  78   AAPDKNNRPLFAAKDIKPFYLEHCPKIFPQHRGLGGIMLAKVVRS----LGGPKYDGKYL  133

Query  535  IDV  527
             DV
Sbjct  134  HDV  136


 Score = 43.9 bits (102),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 42/51 (82%), Gaps = 2/51 (4%)
 Frame = -3

Query  884  PP--GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            PP  G ++TILSIDGGGIRG+IP TI+ +LE +LQ LDG DAR ADYFDVI
Sbjct  14   PPTYGNLVTILSIDGGGIRGLIPATIIEFLESQLQELDGEDARLADYFDVI  64



>ref|XP_003589237.1| Patatin-like protein [Medicago truncatula]
 gb|AES59488.1| patatin-like phospholipase [Medicago truncatula]
Length=298

 Score =   106 bits (265),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 80/107 (75%), Gaps = 0/107 (0%)
 Frame = -1

Query  544  NPLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEE  365
            NPLIDVF+ +S DMVD+H++ + QAL + DNYLRIQ+D L G  +SVD+ T+ENL  L +
Sbjct  174  NPLIDVFTQSSGDMVDFHLSAVTQALHSADNYLRIQDDTLTGIDSSVDIATEENLKKLCQ  233

Query  364  VGkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
            +G+ LL KPV ++NL  G  EP+    TN++ALKRLA +LS+ERR R
Sbjct  234  IGENLLKKPVSRVNLENGHFEPLTNGETNEEALKRLAKILSQERRLR  280



>ref|XP_010064136.1| PREDICTED: patatin-like protein 2 [Eucalyptus grandis]
Length=428

 Score =   107 bits (268),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 63/115 (55%), Positives = 84/115 (73%), Gaps = 0/115 (0%)
 Frame = -1

Query  547  GNPLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALE  368
            G+PLIDVFS ASADMVD+H++ +FQAL   DNYLRIQ+D L G  +SVDV TK+NL+ L 
Sbjct  308  GSPLIDVFSQASADMVDFHLSAVFQALNLQDNYLRIQDDTLSGVLSSVDVATKKNLNDLV  367

Query  367  EVGkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRRTIAALNG  203
            + G+ LL KPV ++NL +G  +P     TN++ALKR A LLS+ER+ R   + +G
Sbjct  368  KTGEALLKKPVSRVNLESGVCDPTSNQETNEEALKRFAKLLSQERQLRLARSPHG  422


 Score = 54.3 bits (129),  Expect(2) = 6e-11, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 34/58 (59%), Gaps = 1/58 (2%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPS-AGIFEVVRDATSLLAGPK*DGNPLIDV  527
            + PD N RP++A KDI  FY  H PKIFP  +  F+ V      +AGPK DG  L DV
Sbjct  97   TTPDGNNRPVFAAKDIKDFYLNHCPKIFPQDSCPFKPVTKIIKAVAGPKYDGKYLHDV  154


 Score = 41.2 bits (95),  Expect(2) = 6e-11, Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = -3

Query  872  VITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            +IT+LSIDGGGIRG+IPGT++ +LE ELQ LDG DAR  DYFDVI
Sbjct  39   LITVLSIDGGGIRGLIPGTVLNFLESELQKLDGKDARIVDYFDVI  83



>ref|XP_006388384.1| hypothetical protein POPTR_0202s00210g [Populus trichocarpa]
 gb|ERP47298.1| hypothetical protein POPTR_0202s00210g [Populus trichocarpa]
Length=332

 Score =   107 bits (266),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 64/117 (55%), Positives = 88/117 (75%), Gaps = 1/117 (1%)
 Frame = -1

Query  547  GNPLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALE  368
             +PL+DVF+ AS DMVD+HI+T+FQAL + +NYLRIQ+D L G+ +SVDV TKENL+ L 
Sbjct  211  SSPLVDVFTQASGDMVDFHISTVFQALNSEENYLRIQDDTLTGTLSSVDVATKENLENLV  270

Query  367  EVGkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRRTIAALNGGK  197
            +VG+KLL KPV ++NL TG  EP+ K  TN++AL + A LLS E++ R + +   GK
Sbjct  271  KVGEKLLQKPVSRVNLATGVFEPINKM-TNEEALTKFAKLLSREKQLREVRSSFFGK  326



>emb|CDP01332.1| unnamed protein product [Coffea canephora]
Length=413

 Score =   107 bits (267),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 79/108 (73%), Gaps = 0/108 (0%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            PL+DVF+ ASADMVD H++ +FQAL + DNYLRIQ+D L G+ +SVD+ TK+NLD L   
Sbjct  291  PLVDVFTQASADMVDLHLSEVFQALHSEDNYLRIQDDTLIGTVSSVDIATKKNLDNLVIT  350

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRRTI  218
            G +LL KPV ++N   G  E +   GTN++ALKR A LLSEERR R +
Sbjct  351  GTQLLKKPVSRVNQQNGAVETIANGGTNEEALKRFARLLSEERRLREL  398


 Score = 63.9 bits (154),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 38/58 (66%), Gaps = 1/58 (2%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPS-AGIFEVVRDATSLLAGPK*DGNPLIDV  527
            +APD+NKRPL+A KDI PFY E+GPKIFP   G    VR A   + GPK DG  L  V
Sbjct  77   AAPDENKRPLFAAKDIKPFYLENGPKIFPQKWGRLASVRSALKAVFGPKYDGRYLHQV  134


 Score = 43.9 bits (102),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/47 (77%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = -3

Query  878  GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            G +ITILSIDGGGIRG+IPG I+ YLE +LQ LDG DAR ADYFDVI
Sbjct  17   GNLITILSIDGGGIRGLIPGVILEYLESQLQELDGEDARLADYFDVI  63



>ref|XP_010269035.1| PREDICTED: patatin-like protein 2 isoform X1 [Nelumbo nucifera]
Length=405

 Score =   107 bits (267),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 61/106 (58%), Positives = 79/106 (75%), Gaps = 0/106 (0%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            PL+DVF+ AS DMVD HI+ +FQAL++ DNYLRIQ+D L  + +SVDV TKENLD L +V
Sbjct  288  PLVDVFTHASGDMVDLHISVVFQALRSEDNYLRIQDDTLGSTVSSVDVATKENLDNLVKV  347

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
            G+ LL  PV ++NL TG  EP    GTN++ L+R A LLS+E+R R
Sbjct  348  GEALLKNPVSRVNLDTGIYEPSKTKGTNEEELRRFAKLLSDEKRLR  393


 Score = 46.6 bits (109),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/51 (76%), Positives = 42/51 (82%), Gaps = 2/51 (4%)
 Frame = -3

Query  884  PP--GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            PP  G +ITILSIDGGGIRGIIPG I+ YLE +LQ LDG DAR ADYFDVI
Sbjct  10   PPTYGNLITILSIDGGGIRGIIPGIILGYLESQLQELDGKDARLADYFDVI  60


 Score = 40.8 bits (94),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 28/55 (51%), Gaps = 1/55 (2%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAGI-FEVVRDATSLLAGPK*DGNPL  536
            +AP++  RPL++ +DI  FY E  P+IFP               L GPK DG  L
Sbjct  74   TAPNEKNRPLFSAEDIKAFYLEQCPRIFPQLSCPLAPAAKVMKALIGPKYDGKYL  128



>ref|XP_008457886.1| PREDICTED: patatin-like protein 2 [Cucumis melo]
Length=398

 Score =   107 bits (267),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 64/108 (59%), Positives = 79/108 (73%), Gaps = 1/108 (1%)
 Frame = -1

Query  547  GNPLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALE  368
            G P++D F  ASADMVDYH++T FQ+L +  NYLRIQ+D L G  ASVDV TKENL+ L 
Sbjct  289  GTPIVDFFGHASADMVDYHVSTFFQSLHSKHNYLRIQDDTLTGDLASVDVATKENLNKLV  348

Query  367  EVGkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
            E G+ LL KPV ++NL TGK E V + GTN++AL   A LLSEER+ R
Sbjct  349  ETGEALLKKPVSRVNLETGKFEAVDE-GTNEEALTEFARLLSEERKLR  395


 Score = 55.5 bits (132),  Expect(2) = 4e-12, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 36/61 (59%), Gaps = 7/61 (11%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFP----SAGIFEVVRDATSLLA---GPK*DGNP  539
            +APDK+ RPL+A KDIV FY +H P IFP      G+  ++   T+      GP+ DGN 
Sbjct  68   TAPDKDNRPLFAAKDIVKFYLDHAPYIFPQKKSCYGMSNLISKVTNFFGQATGPRYDGNY  127

Query  538  L  536
            L
Sbjct  128  L  128


 Score = 43.9 bits (102),  Expect(2) = 4e-12, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = -3

Query  893  ASIPPGGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            A+   G +IT+LSIDGGGIRGIIPGT++ +LE++LQ LDG  AR ADYFDVI
Sbjct  3    ANFAKGKMITVLSIDGGGIRGIIPGTVLKFLEQKLQDLDGTQARIADYFDVI  54



>ref|XP_006365363.1| PREDICTED: patatin group M-2-like [Solanum tuberosum]
Length=409

 Score =   107 bits (267),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 59/108 (55%), Positives = 81/108 (75%), Gaps = 0/108 (0%)
 Frame = -1

Query  544  NPLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEE  365
            +P+IDV+S ASADMVD H++T+FQ L  G NYLRIQ+D+L G  AS+D+ T EN++ L +
Sbjct  302  SPIIDVYSDASADMVDIHVSTMFQTLHNGKNYLRIQDDNLIGDAASMDIATTENMETLVQ  361

Query  364  VGkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRRT  221
            +G  LL KPV ++NL TG+ EPV   GTN++AL R A LLS E++ R+
Sbjct  362  IGNNLLKKPVSRVNLETGQYEPVHGEGTNEEALIRFAYLLSHEKKLRS  409


 Score = 57.8 bits (138),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 32/54 (59%), Gaps = 0/54 (0%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAGIFEVVRDATSLLAGPK*DGNPL  536
            +AP+++ RPLYA KDI  FY EH P IFP +     V +   L  GPK DG  L
Sbjct  90   TAPNRDNRPLYAAKDISTFYMEHCPHIFPQSRRKNFVNNIAHLFGGPKYDGEYL  143


 Score = 43.5 bits (101),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = -3

Query  872  VITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            ++T+LSIDGGGIRGIIPGT++A+LE +LQ +DGP+AR ADYFDV+
Sbjct  32   LVTVLSIDGGGIRGIIPGTLLAFLESKLQEVDGPNARIADYFDVV  76



>ref|XP_006354909.1| PREDICTED: patatin-3-Kuras 1-like [Solanum tuberosum]
Length=408

 Score =   107 bits (267),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 80/107 (75%), Gaps = 0/107 (0%)
 Frame = -1

Query  544  NPLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEE  365
            NP+ID F+ AS DMVDYHI+ +FQ++ +   YLRIQ+D L G+ +SVD++TKEN+D L E
Sbjct  292  NPIIDAFADASDDMVDYHISVVFQSISSQKQYLRIQDDTLSGADSSVDISTKENMDKLVE  351

Query  364  VGkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
            +G  LL KPV ++NL TG  E +   GTN++ALKR A LLSEE+R R
Sbjct  352  IGTNLLKKPVSRVNLKTGLFEQLDTGGTNEEALKRFAKLLSEEKRIR  398


 Score = 59.7 bits (143),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 37/59 (63%), Gaps = 2/59 (3%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAGIFEV--VRDATSLLAGPK*DGNPLIDV  527
            +AP+K+ RPL+A KDI PFY EHGPKIFP   +  +  +    + L GPK +G  L  V
Sbjct  75   TAPNKDNRPLFAAKDIKPFYLEHGPKIFPQNNMILIGSIIKGWTFLTGPKYNGKYLHQV  133


 Score = 43.9 bits (102),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 41/51 (80%), Gaps = 2/51 (4%)
 Frame = -3

Query  884  PP--GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            PP  G  ITILSIDGGGIRG+IP TI+ YLE +LQ LDG DAR ADYFD+I
Sbjct  11   PPINGKFITILSIDGGGIRGLIPATILEYLESQLQELDGEDARLADYFDII  61



>ref|XP_002445639.1| hypothetical protein SORBIDRAFT_07g023210 [Sorghum bicolor]
 gb|EES15134.1| hypothetical protein SORBIDRAFT_07g023210 [Sorghum bicolor]
Length=435

 Score =   107 bits (267),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 76/173 (44%), Positives = 101/173 (58%), Gaps = 11/173 (6%)
 Frame = -1

Query  709  PPCYSAPDKNKRPLYAGKDIVPFY-KEHGPKIFPSAGI--------FEVVRDATSLLAG-  560
            P   +  D +K+ L   +D  P    ++G  +  S G         F+ V+ +   L G 
Sbjct  254  PTLLAMTDVSKQILLGNQDFFPIKPADYGKFMVLSLGTGTAKAEEKFDAVQSSKWGLLGW  313

Query  559  -PK*DGNPLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKEN  383
                D  P+ID FS ASAD+VD H + +FQAL +   YLRIQ+D+L G T+SVDV+T EN
Sbjct  314  LSNKDTTPIIDSFSQASADLVDIHASVLFQALHSERQYLRIQDDELTGETSSVDVSTMEN  373

Query  382  LDALEEVGkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
            L+ L +VGK LL KP  K+N+ TGKNEP  K GTN+D L R A +L  ERR R
Sbjct  374  LNRLVDVGKGLLKKPACKVNIETGKNEPDVKRGTNEDELIRFAKMLVRERRAR  426


 Score = 43.1 bits (100),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 34/57 (60%), Gaps = 7/57 (12%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFP---SAGIFEVVRDATSLLAGPK*DGNPL  536
            +AP+K  RPL+A KDI  FY ++ PKIFP   S G   + +     L+GPK DG  L
Sbjct  109  TAPNKEGRPLFAAKDINDFYLKNCPKIFPPNSSGGPLGLFKK----LSGPKYDGKYL  161


 Score = 40.0 bits (92),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/56 (64%), Positives = 46/56 (82%), Gaps = 3/56 (5%)
 Frame = -3

Query  896  AASIPP--GGVITILSidgggirgiipgtIVAYLEEELQALD-GPDARAADYFDVI  738
            ++S PP  G ++T+LSIDGGG+RGIIPGTI+ +LEE+LQ  D  P+AR ADYFDVI
Sbjct  40   SSSTPPAYGNIVTVLSIDGGGVRGIIPGTILGFLEEKLQEFDERPEARLADYFDVI  95



>ref|XP_009370196.1| PREDICTED: patatin-like protein 2 [Pyrus x bretschneideri]
Length=412

 Score =   107 bits (266),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 64/120 (53%), Positives = 87/120 (73%), Gaps = 1/120 (1%)
 Frame = -1

Query  580  ATSLLAGPK*DGNPLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVD  401
            A   L GP     PL+D+F+ AS+DMV +H+AT+FQAL++ DNYLRIQ+D L G+ ASVD
Sbjct  276  ALGWLIGPDFSA-PLVDIFTQASSDMVGFHLATVFQALESPDNYLRIQDDTLSGTLASVD  334

Query  400  VTTKENLDALEEVGkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRRT  221
              T ENL+ L +VG+KLL KPV +++  TGK +PV    TN++AL R+AG+LS ER  R+
Sbjct  335  NATSENLNDLVKVGEKLLKKPVSRVDFGTGKGKPVHPDITNQEALIRVAGVLSRERAERS  394


 Score = 50.1 bits (118),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 32/55 (58%), Gaps = 1/55 (2%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPS-AGIFEVVRDATSLLAGPK*DGNPL  536
            + PD+N RPLYA KDI  FY E+ PKIFP  + I   +     +L  PK DG  L
Sbjct  72   TTPDENNRPLYAAKDITAFYLENCPKIFPQDSSIVANLAMNVKVLGKPKYDGKYL  126


 Score = 47.4 bits (111),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 37/47 (79%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = -3

Query  878  GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            G +IT+LSIDGGGIRGIIPGTI+++LE ELQ LDG DAR ADYFDVI
Sbjct  12   GSLITVLSIDGGGIRGIIPGTILSFLESELQKLDGQDARLADYFDVI  58



>gb|AFS33545.1| patatin-like protein, partial [Nicotiana tabacum]
Length=136

 Score =   102 bits (253),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 58/106 (55%), Positives = 78/106 (74%), Gaps = 0/106 (0%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            PLIDV++ ASADMVD H++T+FQ L +  NY+RIQ+D+L G  AS+D+ T EN+  L ++
Sbjct  28   PLIDVYADASADMVDIHVSTMFQTLASEKNYIRIQDDNLTGEAASMDIATIENMGRLVQI  87

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
            G  LL KPV ++NL TG+ EPV   GTN+ A+ R A LLSEER+ R
Sbjct  88   GNDLLKKPVSRVNLETGRYEPVVAEGTNEAAIIRFAQLLSEERKLR  133



>ref|XP_009794733.1| PREDICTED: patatin-like protein 2 [Nicotiana sylvestris]
Length=410

 Score =   107 bits (266),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 61/115 (53%), Positives = 86/115 (75%), Gaps = 1/115 (1%)
 Frame = -1

Query  544  NPLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEE  365
            +P++D+ + AS DMVD+HI+ + QAL + +NYLRIQ+D L G+ +SVD++TK N+  L E
Sbjct  292  SPILDLLTHASDDMVDFHISALLQALHSENNYLRIQDDTLNGTDSSVDISTKVNMKKLVE  351

Query  364  VGkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERR-RRTIAALNG  203
            +GK LL K V ++NL TG  EP   +G+N++ALKR A LLSEERR R++ AAL G
Sbjct  352  IGKILLKKTVSRINLQTGLLEPCQHSGSNEEALKRFAKLLSEERRLRKSKAALTG  406


 Score = 63.9 bits (154),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 37/58 (64%), Gaps = 1/58 (2%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFP-SAGIFEVVRDATSLLAGPK*DGNPLIDV  527
            +APDK  RPL+A KDIVPFY EHGPKIFP + G+   ++     L  PK DG  L  V
Sbjct  78   TAPDKEGRPLFAAKDIVPFYLEHGPKIFPHNGGLLGSIKRMLKSLVRPKYDGKYLHKV  135



>ref|XP_008220198.1| PREDICTED: patatin-like protein 2 [Prunus mume]
Length=413

 Score =   107 bits (266),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 59/113 (52%), Positives = 86/113 (76%), Gaps = 0/113 (0%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            PL+D+F+ A +DMVD+H+AT+FQALQ+ DNYLRIQ+D L G+ ASVD+ T++NL+ L +V
Sbjct  290  PLVDIFTHAGSDMVDFHLATVFQALQSHDNYLRIQDDTLSGTLASVDIATEQNLNDLVKV  349

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRRTIAALNG  203
            G+ LL KPV ++N  T K++PV    TN +AL R+A +LS ER+ R + + +G
Sbjct  350  GEALLKKPVSRVNFDTDKSKPVRPEVTNAEALVRVAQILSRERKVREMRSPHG  402


 Score = 50.4 bits (119),  Expect(2) = 3e-11, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 33/55 (60%), Gaps = 1/55 (2%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFP-SAGIFEVVRDATSLLAGPK*DGNPL  536
            + P++N RPLYA KDI PFY E+ PKIFP S+     V +    L  PK DG  L
Sbjct  74   TTPNENNRPLYAAKDINPFYLENCPKIFPQSSSPLINVEENLKGLGRPKYDGKYL  128


 Score = 46.2 bits (108),  Expect(2) = 3e-11, Method: Compositional matrix adjust.
 Identities = 37/47 (79%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = -3

Query  878  GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            G +IT+LSIDGGGIRGIIPGTI+ +LE ELQ LDG DAR ADYFDVI
Sbjct  14   GSLITVLSIDGGGIRGIIPGTILNFLESELQKLDGQDARLADYFDVI  60



>ref|XP_010320346.1| PREDICTED: patatin-like protein 2 isoform X1 [Solanum lycopersicum]
Length=412

 Score =   107 bits (266),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 58/106 (55%), Positives = 80/106 (75%), Gaps = 0/106 (0%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            P++DVF+ AS DMVD+HI+ +FQAL + +NYLR+Q+D L G+ +SVD++TKEN++ L E+
Sbjct  295  PIVDVFTQASGDMVDFHISVVFQALHSEENYLRVQDDTLSGTDSSVDISTKENMNKLVEI  354

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
            G  LL KPV ++NL TG  E   K  TN++ LKR A LLSEE+R R
Sbjct  355  GTNLLKKPVSRVNLQTGLFEECKKDDTNEETLKRFAKLLSEEKRLR  400


 Score = 62.8 bits (151),  Expect(2) = 8e-15, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 41/60 (68%), Gaps = 4/60 (7%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAGIF---EVVRDATSLLAGPK*DGNPLIDV  527
            +AP+K+KRP++A KDI PFY EHGPKIFP  G+     +++   SL+ GPK +G  L  V
Sbjct  80   TAPNKDKRPIFAAKDIKPFYLEHGPKIFPQKGMLFFGSIIKTLKSLI-GPKYNGKYLHQV  138


 Score = 46.2 bits (108),  Expect(2) = 8e-15, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 41/51 (80%), Gaps = 2/51 (4%)
 Frame = -3

Query  884  PP--GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            PP  G +ITILSIDGGGIRGIIP  I+ YLE +LQ LDG DAR ADYFD+I
Sbjct  16   PPTYGKLITILSIDGGGIRGIIPAIILEYLESQLQELDGEDARLADYFDII  66



>gb|KHN04516.1| Patatin group A-3 [Glycine soja]
Length=414

 Score =   107 bits (266),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 61/110 (55%), Positives = 83/110 (75%), Gaps = 0/110 (0%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            PLIDVF+ +SADMVD+H+AT+ QAL + +NYLRIQ+D L G+  SVD+ TKENL+ L ++
Sbjct  291  PLIDVFTQSSADMVDFHLATVTQALHSENNYLRIQDDTLTGTDYSVDIATKENLEKLSQI  350

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRRTIAA  212
            G++LL KPV ++NL  G  EPV    TN+DALKR A +L +ERR R + +
Sbjct  351  GERLLKKPVSQINLEDGLFEPVGNGETNEDALKRFAKILLKERRLRELKS  400


 Score = 59.3 bits (142),  Expect(2) = 5e-14, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 38/58 (66%), Gaps = 1/58 (2%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPS-AGIFEVVRDATSLLAGPK*DGNPLIDV  527
            +AP+ N+RPL+A KDI PFY EH PKIFP  +G++  V      L GPK +G  L +V
Sbjct  77   TAPNDNQRPLFAAKDIKPFYLEHCPKIFPQHSGLWGSVGKLLRSLGGPKYNGKYLQEV  134


 Score = 46.6 bits (109),  Expect(2) = 5e-14, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 43/51 (84%), Gaps = 2/51 (4%)
 Frame = -3

Query  884  PP--GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            PP  G ++TILSIDGGGIRGIIP TI+A+LE +LQ LDG DAR ADYFDVI
Sbjct  13   PPTYGNLVTILSIDGGGIRGIIPATILAFLEAQLQELDGEDARLADYFDVI  63



>ref|XP_004291128.2| PREDICTED: patatin-like protein 2 [Fragaria vesca subsp. vesca]
Length=438

 Score =   107 bits (266),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 60/113 (53%), Positives = 87/113 (77%), Gaps = 1/113 (1%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            PL+DVF+ AS+DMVDYH++T+FQAL +  NYLRIQ+D L+ +  SVD+ T ENL+ L +V
Sbjct  294  PLVDVFTQASSDMVDYHLSTVFQALHSEKNYLRIQDDTLEKTVCSVDIATHENLNNLVKV  353

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRRTIAALNG  203
            G++LL KPV ++N+ TG  EP  ++ TN++AL R+AG+LS ERR R + + +G
Sbjct  354  GEELLKKPVSRVNMETGMFEPAHQS-TNEEALVRVAGILSRERRVREMRSPHG  405


 Score = 52.8 bits (125),  Expect(2) = 3e-12, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 37/60 (62%), Gaps = 4/60 (7%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAGIFEVVRDATSLL---AGPK*DGNPLIDV  527
            +APD+N RPL+A KDI  FY EH PK+FP      ++ +A  +L    GPK +G  L D+
Sbjct  78   TAPDENNRPLFAAKDINDFYLEHCPKMFPQHST-PLIGEAVEMLKAVKGPKYNGKYLHDI  136


 Score = 47.0 bits (110),  Expect(2) = 3e-12, Method: Compositional matrix adjust.
 Identities = 35/47 (74%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = -3

Query  878  GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            G ++T+LSIDGGGIRGIIPGT++++LE ELQ LDG DAR ADYFDVI
Sbjct  18   GNLVTVLSIDGGGIRGIIPGTMLSFLESELQKLDGEDARLADYFDVI  64



>gb|AAK18751.1| patatin-like protein [Vigna unguiculata]
 gb|AAK27797.1| patatin-like protein [Vigna unguiculata]
Length=400

 Score =   106 bits (265),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 78/108 (72%), Gaps = 0/108 (0%)
 Frame = -1

Query  547  GNPLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALE  368
            G PLIDVFS AS+DMVD+HI+++FQA  A  NYLRIQ+D L G   SVDV T++NL+ L 
Sbjct  287  GTPLIDVFSHASSDMVDFHISSVFQARHAEQNYLRIQDDTLTGDLGSVDVATEKNLNGLV  346

Query  367  EVGkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
            +V + LL KPV K+NL TG +EPV    TN +ALKR A  LS +RR R
Sbjct  347  QVAEALLKKPVSKINLRTGIHEPVESNETNAEALKRFAARLSNQRRFR  394


 Score = 55.8 bits (133),  Expect(2) = 8e-14, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 35/57 (61%), Gaps = 3/57 (5%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAGIFEVVRDATS---LLAGPK*DGNPL  536
            +AP++N RPLYA KDI  FY EH PKIFP +  + ++  A      L GP+ DG  L
Sbjct  73   TAPNENNRPLYAAKDIKDFYLEHTPKIFPQSSSWNLIATAMKKGRSLMGPQYDGKYL  129


 Score = 49.3 bits (116),  Expect(2) = 8e-14, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = -3

Query  893  ASIPPGGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            + +  G +IT+LSIDGGGIRGIIPG ++A+LE ELQ LDG DAR ADYFDVI
Sbjct  8    SKVDDGALITVLSIDGGGIRGIIPGILLAFLESELQKLDGADARLADYFDVI  59



>ref|XP_010059970.1| PREDICTED: patatin-like protein 2 isoform X1 [Eucalyptus grandis]
 gb|KCW66464.1| hypothetical protein EUGRSUZ_F00262 [Eucalyptus grandis]
Length=406

 Score =   106 bits (265),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 63/115 (55%), Positives = 83/115 (72%), Gaps = 0/115 (0%)
 Frame = -1

Query  547  GNPLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALE  368
            G+PLIDVFS ASADMVD+H++ +FQAL   DNYLRIQ+D L G  +SVDV TK+NL+ L 
Sbjct  286  GSPLIDVFSQASADMVDFHLSAVFQALNLQDNYLRIQDDTLSGVLSSVDVATKKNLNDLV  345

Query  367  EVGkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRRTIAALNG  203
            + G+ LL KPV ++NL +G  +P     TN++ALKR A LLS+ER  R   + +G
Sbjct  346  KTGEALLKKPVSRVNLESGVCDPTSNQETNEEALKRFAKLLSQERLLRLAKSPHG  400


 Score = 53.9 bits (128),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 34/58 (59%), Gaps = 1/58 (2%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPS-AGIFEVVRDATSLLAGPK*DGNPLIDV  527
            + PD N RP++A KDI  FY  H PKIFP  +  F+ V      +AGPK DG  L DV
Sbjct  75   TTPDGNNRPVFAAKDIKDFYLNHCPKIFPQDSCPFKPVTKIIKAVAGPKYDGKYLHDV  132


 Score = 43.1 bits (100),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 42/51 (82%), Gaps = 2/51 (4%)
 Frame = -3

Query  884  PP--GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            PP  G +IT+LSIDGGGIRG+IPGT++ +LE ELQ LDG DAR  DYFDVI
Sbjct  11   PPTYGNLITVLSIDGGGIRGLIPGTVLNFLESELQRLDGKDARIVDYFDVI  61



>ref|XP_011038246.1| PREDICTED: patatin-like protein 2 isoform X2 [Populus euphratica]
Length=403

 Score =   106 bits (265),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 84/106 (79%), Gaps = 1/106 (1%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            PL+DVF+ AS DMVD+HI+T+FQAL + +NYLRIQ+D L G+ +SVDV TKENL+ L +V
Sbjct  291  PLVDVFTQASGDMVDFHISTVFQALSSEENYLRIQDDTLTGTLSSVDVATKENLENLVKV  350

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
            G++LL KPV ++NL TG  EP+ K  TN++AL++LA LLS E+  R
Sbjct  351  GEELLKKPVSRVNLATGVFEPINKM-TNEEALRKLAKLLSREKHLR  395


 Score = 50.4 bits (119),  Expect(2) = 4e-12, Method: Compositional matrix adjust.
 Identities = 39/47 (83%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = -3

Query  878  GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            G  IT+LSIDGGGIRGIIPGTI+A+LE ELQ LDGPDAR ADYFDVI
Sbjct  17   GNHITVLSIDGGGIRGIIPGTILAFLESELQKLDGPDARLADYFDVI  63


 Score = 49.3 bits (116),  Expect(2) = 4e-12, Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 31/52 (60%), Gaps = 1/52 (2%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPS-AGIFEVVRDATSLLAGPK*DG  545
            +AP+K  RPL+A KDI  FY E+ PKIFP  +  F    +    L GPK DG
Sbjct  77   AAPNKQNRPLFAAKDINDFYLENCPKIFPQDSSKFASAANLVKTLRGPKYDG  128



>ref|XP_011038245.1| PREDICTED: patatin-like protein 2 isoform X1 [Populus euphratica]
Length=404

 Score =   106 bits (265),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 84/106 (79%), Gaps = 1/106 (1%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            PL+DVF+ AS DMVD+HI+T+FQAL + +NYLRIQ+D L G+ +SVDV TKENL+ L +V
Sbjct  292  PLVDVFTQASGDMVDFHISTVFQALSSEENYLRIQDDTLTGTLSSVDVATKENLENLVKV  351

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
            G++LL KPV ++NL TG  EP+ K  TN++AL++LA LLS E+  R
Sbjct  352  GEELLKKPVSRVNLATGVFEPINKM-TNEEALRKLAKLLSREKHLR  396


 Score = 50.4 bits (119),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 39/47 (83%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = -3

Query  878  GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            G  IT+LSIDGGGIRGIIPGTI+A+LE ELQ LDGPDAR ADYFDVI
Sbjct  17   GNHITVLSIDGGGIRGIIPGTILAFLESELQKLDGPDARLADYFDVI  63


 Score = 50.4 bits (119),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 32/53 (60%), Gaps = 2/53 (4%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFP--SAGIFEVVRDATSLLAGPK*DG  545
            +AP+K  RPL+A KDI  FY E+ PKIFP  S+  F    +    L GPK DG
Sbjct  77   AAPNKQNRPLFAAKDINDFYLENCPKIFPQDSSSKFASAANLVKTLRGPKYDG  129



>gb|EMT08201.1| Patatin-T5 [Aegilops tauschii]
Length=292

 Score =   105 bits (262),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 77/106 (73%), Gaps = 0/106 (0%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            PLID+FS ASADMVD H A +FQAL+   NYLRIQ+D L G T+SVD+ TKEN++AL  +
Sbjct  180  PLIDIFSHASADMVDIHAAVLFQALRIEKNYLRIQDDSLTGHTSSVDIATKENMEALIGI  239

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
            GK LL K V ++N+ TG  E V   GTN++AL R A  LSEER+ R
Sbjct  240  GKNLLKKNVSRVNIDTGMYESVEGEGTNEEALTRFARKLSEERKLR  285



>emb|CDP04311.1| unnamed protein product [Coffea canephora]
Length=405

 Score =   106 bits (265),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 64/114 (56%), Positives = 85/114 (75%), Gaps = 1/114 (1%)
 Frame = -1

Query  544  NPLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEE  365
            +PL+DVF+ AS+DMVD+H+ATIFQ LQ   NYLRIQ+D L G  +SVD+ TK NL+ L +
Sbjct  288  SPLVDVFTEASSDMVDFHLATIFQTLQCEANYLRIQDDTLTGDLSSVDIATKTNLENLVQ  347

Query  364  VGkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRRTIAALNG  203
            VG+KLL KPV ++NL +G  EP+   GTN+DALK+ A  LS+E+R R I +  G
Sbjct  348  VGEKLLKKPVSRVNLQSGVFEPL-NQGTNEDALKKFAETLSKEKRLRDIRSKEG  400


 Score = 53.1 bits (126),  Expect(2) = 3e-12, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 34/55 (62%), Gaps = 1/55 (2%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAGIF-EVVRDATSLLAGPK*DGNPL  536
            +AP++N RPLYA KDI  FY E+ PKIFP    F    +    LL+GPK DG  L
Sbjct  75   AAPNENNRPLYAAKDIKDFYLENCPKIFPQESNFLGQAQQELRLLSGPKYDGKYL  129


 Score = 46.6 bits (109),  Expect(2) = 3e-12, Method: Compositional matrix adjust.
 Identities = 35/47 (74%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = -3

Query  878  GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            G  +TILSIDGGGIRGIIP  I+ +LE ELQ LDG DAR ADYFDVI
Sbjct  15   GNTVTILSIDGGGIRGIIPSVILGFLESELQKLDGKDARLADYFDVI  61



>ref|XP_002510258.1| Patatin T5 precursor, putative [Ricinus communis]
 gb|EEF52445.1| Patatin T5 precursor, putative [Ricinus communis]
Length=411

 Score =   106 bits (264),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 59/113 (52%), Positives = 87/113 (77%), Gaps = 1/113 (1%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            PL+DVF+ AS+DMVDYH++ +FQAL +  +YLRIQ+D L G  +SVD+ TK NL  L ++
Sbjct  293  PLVDVFTQASSDMVDYHLSAVFQALHSEQHYLRIQDDTLNGKESSVDIATKSNLKNLVKI  352

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRRTIAALNG  203
            G++LL KPV ++NL TG+ EP+ + GTN++AL+R A +LSEE+R R + + +G
Sbjct  353  GERLLKKPVSRVNLETGRFEPIDQ-GTNEEALERFARILSEEKRLRHVRSPHG  404


 Score = 53.1 bits (126),  Expect(2) = 8e-12, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 34/56 (61%), Gaps = 2/56 (4%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPSA--GIFEVVRDATSLLAGPK*DGNPL  536
            +APD+N RPL+A KDI  FY  H PKIFP     +F  V+     ++GPK +G  L
Sbjct  77   TAPDENNRPLFAAKDIKDFYLNHCPKIFPQPKWPLFSQVKKVVKGISGPKYNGKYL  132


 Score = 45.4 bits (106),  Expect(2) = 8e-12, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 43/51 (84%), Gaps = 2/51 (4%)
 Frame = -3

Query  884  PP--GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            PP  G V+TILSIDGGGIRG+IP TI+++LE ELQ LDG +AR ADYFDVI
Sbjct  13   PPTYGNVVTILSIDGGGIRGLIPTTILSFLESELQKLDGEEARIADYFDVI  63



>gb|AFK35290.1| unknown [Medicago truncatula]
Length=417

 Score =   106 bits (264),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 80/107 (75%), Gaps = 0/107 (0%)
 Frame = -1

Query  544  NPLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEE  365
            NPLIDVF+ +S DMVD+H++ + QAL + DNYLRIQ+D L G  +SVD+ T+ENL  L +
Sbjct  293  NPLIDVFTQSSGDMVDFHLSAVTQALHSADNYLRIQDDTLTGIDSSVDIATEENLKKLYQ  352

Query  364  VGkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
            +G+ LL KPV ++NL  G  EP+    TN++ALKRLA +LS+ERR R
Sbjct  353  IGENLLKKPVSRVNLENGHFEPLTNGETNEEALKRLAKILSQERRLR  399


 Score = 55.5 bits (132),  Expect(2) = 5e-12, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 38/63 (60%), Gaps = 10/63 (16%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFP-----SAGIF-EVVRDATSLLAGPK*DGNPL  536
            +APDKN RPL+A KDI PF  EH PKIFP     SA +  +V+R     L GPK DG  L
Sbjct  78   AAPDKNNRPLFAAKDIKPFCLEHCPKIFPQHRGLSATLLAKVMRS----LGGPKYDGKYL  133

Query  535  IDV  527
              V
Sbjct  134  HQV  136


 Score = 43.9 bits (102),  Expect(2) = 5e-12, Method: Compositional matrix adjust.
 Identities = 35/51 (69%), Positives = 40/51 (78%), Gaps = 2/51 (4%)
 Frame = -3

Query  884  PP--GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            PP  G ++TILSIDGGGIRG+IP  I+ +LE  LQ LDG DAR ADYFDVI
Sbjct  14   PPTYGNLVTILSIDGGGIRGLIPAAIIEFLESHLQELDGEDARLADYFDVI  64



>ref|XP_010064191.1| PREDICTED: patatin-like protein 2 [Eucalyptus grandis]
Length=422

 Score =   106 bits (264),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 78/106 (74%), Gaps = 0/106 (0%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            PL+DVF+ ASADMVD HI+  FQAL   DNYLRIQ+D L    + VD+ TKENL+ L  +
Sbjct  287  PLVDVFTTASADMVDLHISATFQALHFEDNYLRIQDDTLTRKDSFVDIATKENLENLVWI  346

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
            G++LL KPV ++NL TG +EP+ K  TN DALKR+A  LSEERR R
Sbjct  347  GERLLKKPVSRVNLETGLSEPITKGTTNADALKRVAKKLSEERRFR  392


 Score = 53.5 bits (127),  Expect(2) = 5e-13, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 34/55 (62%), Gaps = 1/55 (2%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPSA-GIFEVVRDATSLLAGPK*DGNPL  536
            +AP++  R L+A KDI  FY EH PKIFP   G++  VR+    L GPK DG  L
Sbjct  73   TAPNEKNRSLFAAKDIRSFYLEHSPKIFPQKRGLWGRVRNLVKSLTGPKYDGKYL  127


 Score = 49.3 bits (116),  Expect(2) = 5e-13, Method: Compositional matrix adjust.
 Identities = 40/51 (78%), Positives = 43/51 (84%), Gaps = 2/51 (4%)
 Frame = -3

Query  884  PP--GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            PP  G +ITILSIDGGGIRGIIP TI+A+LE ELQ LDG DAR ADYFDVI
Sbjct  9    PPTYGNIITILSIDGGGIRGIIPATILAFLESELQELDGEDARLADYFDVI  59



>ref|XP_010028264.1| PREDICTED: patatin-like protein 1 [Eucalyptus grandis]
 gb|KCW54972.1| hypothetical protein EUGRSUZ_I00938 [Eucalyptus grandis]
Length=407

 Score =   106 bits (264),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 81/107 (76%), Gaps = 0/107 (0%)
 Frame = -1

Query  544  NPLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEE  365
            +PLID ++  SAD+VDYH +  F+  Q+ DNYLRI +D LKG+ +SVD +TK+NL+ L +
Sbjct  290  SPLIDAYTQGSADLVDYHNSVAFKTYQSEDNYLRINDDTLKGTLSSVDTSTKKNLEDLVK  349

Query  364  VGkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
            VG+ LL K V ++NL TG  EP+P AGTN++ALKR A LLS+E++ R
Sbjct  350  VGEDLLRKAVSRVNLDTGHYEPIPNAGTNEEALKRFAKLLSDEKKLR  396


 Score = 56.6 bits (135),  Expect(2) = 1e-11, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 33/52 (63%), Gaps = 1/52 (2%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFP-SAGIFEVVRDATSLLAGPK*DG  545
            SAPD + RPL+A KDIVPFY E+ PKIFP   G    V +    L GPK +G
Sbjct  76   SAPDAHNRPLFAAKDIVPFYLENCPKIFPQGCGSLGSVLNTIKSLTGPKYNG  127


 Score = 41.6 bits (96),  Expect(2) = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 41/51 (80%), Gaps = 2/51 (4%)
 Frame = -3

Query  884  PP--GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            PP  G +ITILSIDGGG+RGIIPG I+ YLE +LQ LDG  AR ADYFDVI
Sbjct  12   PPTYGKLITILSIDGGGVRGIIPGVILGYLEAQLQELDGEGARLADYFDVI  62



>ref|XP_003603015.1| Patatin-like protein [Medicago truncatula]
 gb|AES73266.1| patatin-like phospholipase [Medicago truncatula]
Length=409

 Score =   106 bits (264),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 61/110 (55%), Positives = 83/110 (75%), Gaps = 0/110 (0%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            PLID+FS +SADMVD+H+A + +AL +  NYLRIQ+D L G+ +SVD++T ENL+ L ++
Sbjct  291  PLIDMFSQSSADMVDFHLAAVTRALNSQHNYLRIQDDTLTGTDSSVDISTTENLEKLCQI  350

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRRTIAA  212
            G KLL KPV K+NL  G  EP+ K  TN+DALKR A +LS+ERR R + +
Sbjct  351  GDKLLKKPVSKVNLENGMFEPMEKGETNEDALKRFAKILSQERRLRELKS  400


 Score = 57.8 bits (138),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 34/58 (59%), Gaps = 1/58 (2%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAG-IFEVVRDATSLLAGPK*DGNPLIDV  527
            SAP+  KRPL+A KDI PFY EH PKIFP    +F         L GPK DG  L +V
Sbjct  77   SAPNDKKRPLFAAKDIKPFYLEHSPKIFPQQKDLFGSFGKLFRSLVGPKYDGKYLHEV  134


 Score = 42.7 bits (99),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 41/51 (80%), Gaps = 2/51 (4%)
 Frame = -3

Query  884  PP--GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            PP  G ++TILSIDGGGIRGIIP TI+ +LE +LQ LDG  AR ADYFDVI
Sbjct  13   PPTYGNLVTILSIDGGGIRGIIPATILEFLESQLQELDGESARLADYFDVI  63



>ref|XP_011038242.1| PREDICTED: patatin-like protein 2 [Populus euphratica]
Length=403

 Score =   105 bits (263),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 82/106 (77%), Gaps = 1/106 (1%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            PL+DVF+ AS DMVD+HI+T+FQAL + +NYLRIQ+D L G  +SVDV TKENL+ L +V
Sbjct  291  PLVDVFTQASGDMVDFHISTVFQALSSEENYLRIQDDTLTGKLSSVDVATKENLENLVKV  350

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
            G +LL KPV ++NL TG  EP+ K  TN++AL++LA LLS E+  R
Sbjct  351  GVELLKKPVSRVNLATGVFEPINKM-TNEEALRKLAKLLSREKHLR  395


 Score = 50.4 bits (119),  Expect(2) = 2e-10, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 31/52 (60%), Gaps = 1/52 (2%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAGI-FEVVRDATSLLAGPK*DG  545
            +AP+K  RPL+A KDI  FY E+ PKIFP  G  F    +    L GPK DG
Sbjct  77   AAPNKQNRPLFAAKDINDFYLENCPKIFPQDGSPFASAANLVKTLRGPKYDG  128


 Score = 43.5 bits (101),  Expect(2) = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/44 (82%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -3

Query  869  ITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            ITILSIDGGGIRGIIPG+I+A+LE ELQ LDG  AR ADYFDVI
Sbjct  20   ITILSIDGGGIRGIIPGSILAFLESELQKLDGAAARLADYFDVI  63



>ref|XP_010041051.1| PREDICTED: patatin-like protein 2 [Eucalyptus grandis]
 gb|KCW44683.1| hypothetical protein EUGRSUZ_L01783 [Eucalyptus grandis]
Length=405

 Score =   105 bits (263),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 78/106 (74%), Gaps = 0/106 (0%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            PL+DVF+ ASADMVD++I+  FQAL   DNYLRI +D L G  +SVD+ TKENL+ L  +
Sbjct  287  PLVDVFTKASADMVDFYISAAFQALHFEDNYLRIHDDTLTGKDSSVDIATKENLENLVRI  346

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
            G++LL KPV ++NL  G +EP+ K  TN DALKR A  LSEERR R
Sbjct  347  GERLLKKPVSRVNLEMGLSEPIAKGITNADALKRFAKKLSEERRFR  392


 Score = 57.0 bits (136),  Expect(2) = 8e-13, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 35/55 (64%), Gaps = 1/55 (2%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPSA-GIFEVVRDATSLLAGPK*DGNPL  536
            +AP++  RPL+A KDI  FY EH PKIFP   G++  VR+    L GPK DG  L
Sbjct  73   TAPNEKNRPLFAAKDIRSFYLEHSPKIFPQKRGLWGRVRNLVKSLTGPKYDGKYL  127


 Score = 44.7 bits (104),  Expect(2) = 8e-13, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 41/51 (80%), Gaps = 2/51 (4%)
 Frame = -3

Query  884  PP--GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            PP  G +ITILSIDGGG+RGII  TI+A LE EL+ LDG DAR ADYFDVI
Sbjct  9    PPTDGNIITILSIDGGGVRGIIAATILASLESELEELDGEDARLADYFDVI  59



>ref|XP_010059969.1| PREDICTED: patatin-like protein 2 isoform X2 [Eucalyptus grandis]
Length=407

 Score =   105 bits (263),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 83/115 (72%), Gaps = 0/115 (0%)
 Frame = -1

Query  547  GNPLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALE  368
            G+PLIDV   ASADMVD+H++ +FQAL    NYLRIQ+D L G+ ASVD+  K+N++ L 
Sbjct  287  GSPLIDVLMQASADMVDFHLSVVFQALLIEANYLRIQDDTLSGAVASVDIAMKKNMNDLV  346

Query  367  EVGkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRRTIAALNG  203
            + G+ LL KPV ++NL TG+ EP P   TN++AL+R A LLS+ER+ R   + +G
Sbjct  347  KTGEALLKKPVSRVNLETGRYEPTPNQETNEEALRRFAKLLSQERQLRLARSPHG  401


 Score = 47.4 bits (111),  Expect(2) = 9e-10, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 43/51 (84%), Gaps = 2/51 (4%)
 Frame = -3

Query  884  PP--GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            PP  G +ITILSIDGGG+RG++PG I+A+LE ELQ LDG DAR ADYFDVI
Sbjct  11   PPTYGNLITILSIDGGGMRGLVPGAILAFLESELQKLDGEDARLADYFDVI  61


 Score = 43.9 bits (102),  Expect(2) = 9e-10, Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 31/55 (56%), Gaps = 1/55 (2%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPS-AGIFEVVRDATSLLAGPK*DGNPL  536
            ++PDK+ RPL+  KDI  F+  + PKIFP  +  F    +    + GPK DG  L
Sbjct  75   TSPDKHNRPLFTAKDIKDFFLNNCPKIFPQDSCPFAPATNMIKAVTGPKYDGKYL  129



>ref|XP_003589238.1| Patatin-like protein [Medicago truncatula]
 gb|AES59489.1| patatin-like phospholipase [Medicago truncatula]
Length=415

 Score =   105 bits (263),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 80/107 (75%), Gaps = 0/107 (0%)
 Frame = -1

Query  544  NPLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEE  365
            NPLIDVF+ +S DMVD+H++ + QAL + DNYLRIQ+D L G  +SVD+ T+ENL  L +
Sbjct  291  NPLIDVFTQSSGDMVDFHLSAVTQALHSADNYLRIQDDTLTGIDSSVDIATEENLKKLCQ  350

Query  364  VGkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
            +G+ LL KPV ++NL  G  EP+    TN++ALKRLA +LS+ERR R
Sbjct  351  IGENLLKKPVSRVNLENGHFEPLTNGETNEEALKRLAKILSQERRLR  397


 Score = 58.2 bits (139),  Expect(2) = 7e-13, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 38/63 (60%), Gaps = 10/63 (16%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFP------SAGIFEVVRDATSLLAGPK*DGNPL  536
            +APDKN RPL+A KDI PFY EH PKIFP      +  + +V+R     L GPK DG  L
Sbjct  78   AAPDKNNRPLFAAKDIKPFYLEHCPKIFPQHRGLGATLLAKVMRS----LGGPKYDGKYL  133

Query  535  IDV  527
              V
Sbjct  134  HQV  136


 Score = 43.9 bits (102),  Expect(2) = 7e-13, Method: Compositional matrix adjust.
 Identities = 35/51 (69%), Positives = 40/51 (78%), Gaps = 2/51 (4%)
 Frame = -3

Query  884  PP--GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            PP  G ++TILSIDGGGIRG+IP  I+ +LE  LQ LDG DAR ADYFDVI
Sbjct  14   PPTYGNLVTILSIDGGGIRGLIPAAIIEFLESHLQELDGEDARLADYFDVI  64



>ref|XP_003589236.1| Patatin-like protein [Medicago truncatula]
 gb|AES59487.1| patatin-like phospholipase [Medicago truncatula]
Length=417

 Score =   105 bits (263),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 80/107 (75%), Gaps = 0/107 (0%)
 Frame = -1

Query  544  NPLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEE  365
            NPLIDVF+ +S DMVD+H++ + QAL + DNYLRIQ+D L G  +SVD+ T+ENL  L +
Sbjct  293  NPLIDVFTQSSGDMVDFHLSAVTQALHSADNYLRIQDDTLTGIDSSVDIATEENLKKLCQ  352

Query  364  VGkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
            +G+ LL KPV ++NL  G  EP+    TN++ALKRLA +LS+ERR R
Sbjct  353  IGENLLKKPVSRVNLENGHFEPLTNGETNEEALKRLAKILSQERRLR  399


 Score = 58.2 bits (139),  Expect(2) = 7e-13, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 38/63 (60%), Gaps = 10/63 (16%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFP------SAGIFEVVRDATSLLAGPK*DGNPL  536
            +APDKN RPL+A KDI PFY EH PKIFP      +  + +V+R     L GPK DG  L
Sbjct  78   AAPDKNNRPLFAAKDIKPFYLEHCPKIFPQHRGLGATLLAKVMRS----LGGPKYDGKYL  133

Query  535  IDV  527
              V
Sbjct  134  HQV  136


 Score = 43.9 bits (102),  Expect(2) = 7e-13, Method: Compositional matrix adjust.
 Identities = 35/51 (69%), Positives = 40/51 (78%), Gaps = 2/51 (4%)
 Frame = -3

Query  884  PP--GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            PP  G ++TILSIDGGGIRG+IP  I+ +LE  LQ LDG DAR ADYFDVI
Sbjct  14   PPTYGNLVTILSIDGGGIRGLIPAAIIEFLESHLQELDGEDARLADYFDVI  64



>ref|XP_008393828.1| PREDICTED: patatin-like protein 2 isoform X2 [Malus domestica]
Length=408

 Score =   105 bits (263),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 62/115 (54%), Positives = 85/115 (74%), Gaps = 1/115 (1%)
 Frame = -1

Query  547  GNPLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALE  368
            G P+IDVFS +S+DMVDYH++ +FQAL + +NYLRIQ+D L G  +SVD+  K+NLD L 
Sbjct  288  GTPIIDVFSQSSSDMVDYHLSVVFQALHSENNYLRIQDDTLTGQVSSVDIADKKNLDDLL  347

Query  367  EVGkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRRTIAALNG  203
            +VG+ LL KPV ++NL TG+ EP  K  +N++AL R A LLSEE+R R   + +G
Sbjct  348  KVGEGLLKKPVSRVNLETGRVEPS-KHESNEEALTRFAKLLSEEKRLRLAKSPHG  401


 Score = 50.1 bits (118),  Expect(2) = 3e-11, Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 33/59 (56%), Gaps = 2/59 (3%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPS--AGIFEVVRDATSLLAGPK*DGNPLIDV  527
            + PD N RP+++ KDI  FY  H PKIFP     +F  +      L+GPK DG  L D+
Sbjct  75   ATPDDNNRPVFSAKDIKDFYLTHCPKIFPQKHCPLFPKMTKIIKALSGPKYDGKYLHDL  133


 Score = 46.6 bits (109),  Expect(2) = 3e-11, Method: Compositional matrix adjust.
 Identities = 38/47 (81%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = -3

Query  878  GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            G +ITILSIDGGGIRG+IPGTI+ YLE ELQ LDG DAR ADYFDVI
Sbjct  15   GNLITILSIDGGGIRGLIPGTILGYLESELQKLDGEDARIADYFDVI  61



>ref|XP_006829702.1| PREDICTED: patatin-like protein 2 [Amborella trichopoda]
 gb|ERM97118.1| hypothetical protein AMTR_s00126p00063230 [Amborella trichopoda]
Length=407

 Score =   105 bits (263),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 77/108 (71%), Gaps = 0/108 (0%)
 Frame = -1

Query  547  GNPLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALE  368
            G PLID F+ AS+DMVD+H++ +F+AL +  NYLRIQ D L G  +SVD+ TKENL+ L 
Sbjct  289  GTPLIDTFTHASSDMVDFHLSVVFRALHSERNYLRIQGDTLTGHASSVDIATKENLENLV  348

Query  367  EVGkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
             +G  LL KPV +LN+ TG  EPV   GTN+ AL R A LLS+ERR R
Sbjct  349  MIGSDLLKKPVSRLNMETGLFEPVEGEGTNEQALTRFAKLLSDERRLR  396


 Score = 53.5 bits (127),  Expect(2) = 3e-11, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 35/58 (60%), Gaps = 1/58 (2%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFP-SAGIFEVVRDATSLLAGPK*DGNPLIDV  527
            + P K+ RPLYA KDI  FY EH PKIFP S+G+         +++ PK DG  L D+
Sbjct  77   ATPGKDNRPLYAAKDIPTFYLEHCPKIFPQSSGVLASTTKLWGVVSRPKYDGKYLHDL  134


 Score = 43.1 bits (100),  Expect(2) = 3e-11, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 41/51 (80%), Gaps = 2/51 (4%)
 Frame = -3

Query  884  PP--GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            PP  G +ITILSIDGGGIRG IP TI+++LE +LQ LDG D R ADYFDVI
Sbjct  13   PPTYGEMITILSIDGGGIRGTIPATILSFLEHQLQILDGEDVRIADYFDVI  63



>ref|XP_008457871.1| PREDICTED: patatin-like protein 3 [Cucumis melo]
Length=394

 Score =   105 bits (262),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 59/106 (56%), Positives = 78/106 (74%), Gaps = 0/106 (0%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            P+ID+F+ ASADMVDYHIA++FQ+     NYLRIQ+D L G  +SVDV T+ENL  L EV
Sbjct  286  PIIDIFTDASADMVDYHIASVFQSEHHQKNYLRIQDDTLTGDVSSVDVATEENLLKLIEV  345

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
            G+ LL K + ++NL +GK EP+   GTN++AL   A +LSEER+ R
Sbjct  346  GENLLKKQLSRVNLESGKFEPLDGHGTNEEALIEFAAMLSEERKLR  391


 Score = 58.9 bits (141),  Expect(2) = 5e-14, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 34/55 (62%), Gaps = 1/55 (2%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAGIF-EVVRDATSLLAGPK*DGNPL  536
            +APDKN RPLYA KD+  FY EH PKIFP    F   V ++   + GP+ DG  L
Sbjct  69   TAPDKNNRPLYAAKDLTRFYVEHAPKIFPQRNHFLSSVMNSLGKVMGPRYDGKYL  123


 Score = 47.4 bits (111),  Expect(2) = 5e-14, Method: Compositional matrix adjust.
 Identities = 38/47 (81%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = -3

Query  878  GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            G  ITILSIDGGGIRGIIPGTI+A+LE +LQ LDGPD R ADYFDVI
Sbjct  9    GKRITILSIDGGGIRGIIPGTILAFLESKLQELDGPDVRIADYFDVI  55



>ref|XP_006601293.1| PREDICTED: patatin-11-like [Glycine max]
 gb|KHN12763.1| Patatin group A-3 [Glycine soja]
Length=408

 Score =   105 bits (262),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 64/116 (55%), Positives = 85/116 (73%), Gaps = 1/116 (1%)
 Frame = -1

Query  547  GNPLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALE  368
            G PLID FS AS+DMVD+HI ++FQAL +  NYLRIQ+D L G  +SVD+ T++NL+ L 
Sbjct  291  GTPLIDAFSHASSDMVDFHITSLFQALNSEHNYLRIQDDSLNGDMSSVDLATEKNLNDLV  350

Query  367  EVGkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERR-RRTIAALNG  203
            +VG+ LL KPV K+NL TG +EPV    TN +ALKR A  LS++RR R++  + NG
Sbjct  351  KVGESLLKKPVSKINLQTGVHEPVNSHETNGEALKRFAERLSKQRRFRKSQMSANG  406


 Score = 53.1 bits (126),  Expect(2) = 1e-10, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 34/55 (62%), Gaps = 1/55 (2%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFP-SAGIFEVVRDATSLLAGPK*DGNPL  536
            +APD+N RPLYA KDI  FY +H PKIFP +  +F  +      L GP+ +G  L
Sbjct  78   TAPDENNRPLYAAKDIKDFYLDHTPKIFPQNNNLFSPILKLGRTLFGPQYNGKYL  132


 Score = 41.2 bits (95),  Expect(2) = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = -3

Query  878  GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            G ++T+LSIDGGGIRGIIPG I+ +LE ELQ LDG   R ADYFDVI
Sbjct  18   GHLVTVLSIDGGGIRGIIPGIILGFLESELQKLDGDHVRLADYFDVI  64



>gb|EMS45954.1| Patatin group A-3 [Triticum urartu]
Length=398

 Score =   105 bits (262),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 59/106 (56%), Positives = 77/106 (73%), Gaps = 0/106 (0%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            PL+D+FS ASADMVD H A +FQ+L+   NYLRIQ+D L G T+SVD++TKEN++AL  +
Sbjct  286  PLLDIFSHASADMVDIHAAVLFQSLRVEKNYLRIQDDSLTGHTSSVDISTKENMEALIGI  345

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
            G KLL   V ++N+ TG  EPV   GTN++AL R A  LS ER+ R
Sbjct  346  GNKLLKMSVARVNIDTGMYEPVDDEGTNEEALARFAKKLSNERKLR  391


 Score = 52.8 bits (125),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 35/58 (60%), Gaps = 2/58 (3%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPS--AGIFEVVRDATSLLAGPK*DGNPLID  530
            +AP +NKRPL+A KDI  FY ++GPKIFP    G    V +    + GPK DG  L D
Sbjct  69   AAPGENKRPLFAAKDINQFYLDNGPKIFPQRRWGFLTPVANLLGAVMGPKYDGKFLHD  126


 Score = 47.8 bits (112),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 44/51 (86%), Gaps = 2/51 (4%)
 Frame = -3

Query  884  PP--GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            PP  G +IT+LSIDGGGIRG+IP TI+A+LE +LQ LDGPDAR ADYFDVI
Sbjct  5    PPSQGRLITVLSIDGGGIRGLIPSTILAFLESKLQELDGPDARIADYFDVI  55



>ref|XP_010942708.1| PREDICTED: patatin-like protein 2 [Elaeis guineensis]
Length=411

 Score =   105 bits (262),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 62/107 (58%), Positives = 78/107 (73%), Gaps = 0/107 (0%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            PLI+VF+ ASADMVD H + +FQAL + +NYLRIQ+D L GST+SVD++TKENL  L ++
Sbjct  290  PLINVFTQASADMVDIHTSAVFQALYSKENYLRIQDDTLIGSTSSVDISTKENLLKLVQI  349

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRRT  221
            G  LL K V ++NL TG  E V   GTN++AL   A LLSEERR R 
Sbjct  350  GNDLLKKHVSRVNLETGLFELVEGEGTNEEALTHFAKLLSEERRLRC  396


 Score = 53.9 bits (128),  Expect(2) = 3e-11, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 34/55 (62%), Gaps = 1/55 (2%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPSA-GIFEVVRDATSLLAGPK*DGNPL  536
            +AP+KN RPL+A KDI  FY E+  KIFP   GIF  + +  + + GPK  G  L
Sbjct  76   TAPNKNNRPLFAAKDITKFYLENSSKIFPQKNGIFSSIFNLFTAVTGPKYSGKYL  130


 Score = 42.4 bits (98),  Expect(2) = 3e-11, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 43/51 (84%), Gaps = 2/51 (4%)
 Frame = -3

Query  884  PP--GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            PP  G ++T+LSIDGGG+RGIIPGTI+A+LE +LQ LDG DAR  DYFDVI
Sbjct  12   PPCKGRLVTVLSIDGGGVRGIIPGTILAFLESKLQELDGEDARIVDYFDVI  62



>ref|XP_003577355.1| PREDICTED: patatin-like protein 1 [Brachypodium distachyon]
Length=413

 Score =   105 bits (262),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 60/106 (57%), Positives = 79/106 (75%), Gaps = 0/106 (0%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            PLID+FS ASADMVD H A +F+AL+  +NYLRIQ+D L+G T+SVD+ TK+N++AL E+
Sbjct  301  PLIDIFSHASADMVDIHAAVLFKALRVKENYLRIQDDSLEGDTSSVDIATKKNMEALIEI  360

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
            G  LL K V ++N+ TG  E V   GTN++ALKR A  LS ER+ R
Sbjct  361  GNGLLQKKVARVNIDTGMYETVEGEGTNEEALKRFAVKLSNERKLR  406


 Score = 48.1 bits (113),  Expect(2) = 5e-11, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 46/59 (78%), Gaps = 3/59 (5%)
 Frame = -3

Query  905  EYNAASIPP---GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            E+  A  PP   G +IT+LSIDGGGIRG+IP TI+A LE +LQ +DGPDAR ADYFDVI
Sbjct  10   EHATAPCPPPSQGRLITVLSIDGGGIRGLIPSTIIACLESKLQEIDGPDARIADYFDVI  68


 Score = 47.8 bits (112),  Expect(2) = 5e-11, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 33/58 (57%), Gaps = 2/58 (3%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPSA--GIFEVVRDATSLLAGPK*DGNPLID  530
            +AP +NKRPL+A  ++  FY E+GPKIFP    G      +    + GPK DG  L D
Sbjct  82   AAPGENKRPLFAASELKDFYLENGPKIFPQKKLGFLNPAANLFGAVMGPKYDGKFLHD  139



>ref|XP_003527713.1| PREDICTED: patatin-like [Glycine max]
 gb|KHN22305.1| Patatin group A-3 [Glycine soja]
Length=414

 Score =   105 bits (262),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 60/106 (57%), Positives = 82/106 (77%), Gaps = 0/106 (0%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            PLIDVF+ +SADMVD+H+AT+ QAL + +NYLRIQ+D L G+ +SVD+ TKENL+ L ++
Sbjct  291  PLIDVFTQSSADMVDFHLATVTQALHSENNYLRIQDDTLTGTDSSVDIATKENLEKLSQI  350

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
            G++LL KPV ++NL  G  E V    TN++ALKR A +LS+ERR R
Sbjct  351  GERLLKKPVSQINLEDGLFESVGNGETNENALKRFAKILSQERRLR  396


 Score = 62.4 bits (150),  Expect(2) = 6e-15, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 38/58 (66%), Gaps = 1/58 (2%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPS-AGIFEVVRDATSLLAGPK*DGNPLIDV  527
            SAP+ N+RPL+A KDI PFY EH PKIFP  +G++  V      L GPK DG  L +V
Sbjct  77   SAPNDNQRPLFAAKDIKPFYLEHCPKIFPQHSGLWGSVGKLLGSLGGPKYDGKYLKEV  134


 Score = 46.6 bits (109),  Expect(2) = 6e-15, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 43/51 (84%), Gaps = 2/51 (4%)
 Frame = -3

Query  884  PP--GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            PP  G ++TILSIDGGGIRGIIP TI+A+LE +LQ LDG DAR ADYFDVI
Sbjct  13   PPTYGNLVTILSIDGGGIRGIIPATILAFLEAQLQELDGEDARLADYFDVI  63



>ref|XP_002463192.1| hypothetical protein SORBIDRAFT_02g039470 [Sorghum bicolor]
 gb|EER99713.1| hypothetical protein SORBIDRAFT_02g039470 [Sorghum bicolor]
Length=403

 Score =   105 bits (261),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 53/107 (50%), Positives = 82/107 (77%), Gaps = 0/107 (0%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            P++D+FS +SA +VDY+++ +FQAL++  NYLRIQ+D LKG+ A+VDV T+EN+  L E+
Sbjct  282  PIVDMFSYSSAALVDYNVSILFQALRSEKNYLRIQDDSLKGTEATVDVATEENMKKLIEI  341

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRRT  221
            G+++L   V ++++ TGK   VP+ GTN +AL R A +LS+ER+ RT
Sbjct  342  GERMLATTVSRVDMETGKPVAVPEEGTNAEALTRFAKMLSDERKART  388


 Score = 45.8 bits (107),  Expect(2) = 6e-08, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 33/53 (62%), Gaps = 7/53 (13%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAGIFEVVRDATSL--LAGPK*DG  545
            +AP+K+KRPL+  + I  FY E+GPKIFP    F     A +L  L GPK DG
Sbjct  66   AAPNKDKRPLFTAEGINKFYLENGPKIFPQRPDF-----ANTLLELKGPKYDG  113


 Score = 39.7 bits (91),  Expect(2) = 6e-08, Method: Compositional matrix adjust.
 Identities = 16/25 (64%), Positives = 21/25 (84%), Gaps = 0/25 (0%)
 Frame = -3

Query  812  VAYLEEELQALDGPDARAADYFDVI  738
            + +LE++LQ LDGP+AR ADYFD I
Sbjct  28   LTFLEKKLQELDGPNARLADYFDYI  52



>ref|NP_001068268.1| Os11g0614400 [Oryza sativa Japonica Group]
 gb|ABA94817.1| Patatin-like phospholipase family protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF28631.1| Os11g0614400 [Oryza sativa Japonica Group]
 gb|EAZ18421.1| hypothetical protein OsJ_33950 [Oryza sativa Japonica Group]
 dbj|BAG86724.1| unnamed protein product [Oryza sativa Japonica Group]
Length=417

 Score =   105 bits (262),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 61/106 (58%), Positives = 80/106 (75%), Gaps = 0/106 (0%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            PLID+F+ ASADMVD H + +FQ+L    +YLRIQ+D L+G T+SVD+ TKEN++AL ++
Sbjct  305  PLIDIFTHASADMVDIHASVLFQSLCCEKSYLRIQDDSLEGHTSSVDIATKENMEALIKI  364

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
            GK LLTK V ++N+ TG  EPV   GTN++AL R A  LSEERR R
Sbjct  365  GKDLLTKRVARVNIDTGVYEPVDGEGTNEEALARFAKKLSEERRLR  410


 Score = 53.1 bits (126),  Expect(2) = 4e-11, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 36/58 (62%), Gaps = 2/58 (3%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPS--AGIFEVVRDATSLLAGPK*DGNPLID  530
            +APD ++RPL+A  D+  FY E+GPKIFP    G    V +   ++ GPK DG+ L D
Sbjct  89   AAPDDDRRPLFAAGDLTNFYLENGPKIFPQRRVGFLTPVANLIGVVRGPKYDGSFLHD  146


 Score = 43.1 bits (100),  Expect(2) = 4e-11, Method: Compositional matrix adjust.
 Identities = 35/47 (74%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = -3

Query  878  GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            G +IT+LSIDGGGIRG+IP TI+A LE +LQ LDGP+AR ADYFDVI
Sbjct  29   GRLITVLSIDGGGIRGLIPATILACLEAKLQELDGPEARIADYFDVI  75



>ref|XP_003577354.1| PREDICTED: patatin-like protein 1 [Brachypodium distachyon]
Length=403

 Score =   105 bits (261),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 58/106 (55%), Positives = 79/106 (75%), Gaps = 0/106 (0%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            PLID+FS ASADMVD H+  +F+AL+  +NYLRIQ D LKG T+S+D+ T +N+ AL  +
Sbjct  291  PLIDIFSHASADMVDIHVNVLFKALRMEENYLRIQHDFLKGDTSSMDLATNKNMHALIGI  350

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
            G+KLL   V ++N+ TG +EPV   GTN++AL R A  L+EER+RR
Sbjct  351  GEKLLKSKVARVNINTGVHEPVEGKGTNEEALARFATKLAEERKRR  396


 Score = 46.6 bits (109),  Expect(2) = 6e-09, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = -3

Query  908  GEYNAASIPPGGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            G  + A+ P   +IT+LSIDGGGIRG+IP TI+A LE +LQA+DGP AR ADYFDVI
Sbjct  7    GNSDQATAPSKKLITVLSIDGGGIRGLIPSTILACLETKLQAIDGPKARIADYFDVI  63


 Score = 42.0 bits (97),  Expect(2) = 6e-09, Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 28/55 (51%), Gaps = 2/55 (4%)
 Frame = -1

Query  694  APDKNKRPLYAGKDIVPFYKEHGPKIFPSA--GIFEVVRDATSLLAGPK*DGNPL  536
            +P  NK P+ A  ++  FY EHGPKIFP    G      +    + GPK DG  L
Sbjct  80   SPGDNKLPVKAASELNEFYLEHGPKIFPQKKLGFLNKAANMVGAVMGPKYDGKVL  134



>gb|EAY88437.1| hypothetical protein OsI_09902 [Oryza sativa Indica Group]
Length=417

 Score =   105 bits (261),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 61/106 (58%), Positives = 80/106 (75%), Gaps = 0/106 (0%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            PLID+F+ ASADMVD H + +FQ+L    +YLRIQ+D L+G T+SVD+ TKEN++AL ++
Sbjct  305  PLIDIFTHASADMVDIHASILFQSLCCEKSYLRIQDDSLEGHTSSVDIATKENMEALIKI  364

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
            GK LLTK V ++N+ TG  EPV   GTN++AL R A  LSEERR R
Sbjct  365  GKDLLTKRVARVNIDTGVYEPVDGEGTNEEALARFAKKLSEERRLR  410


 Score = 53.1 bits (126),  Expect(2) = 4e-11, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 36/58 (62%), Gaps = 2/58 (3%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPS--AGIFEVVRDATSLLAGPK*DGNPLID  530
            +APD ++RPL+A  D+  FY E+GPKIFP    G    V +   ++ GPK DG+ L D
Sbjct  89   AAPDDDRRPLFAAGDLTNFYLENGPKIFPQRRVGFLTPVANLIGVVRGPKYDGSFLHD  146


 Score = 43.1 bits (100),  Expect(2) = 4e-11, Method: Compositional matrix adjust.
 Identities = 35/47 (74%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = -3

Query  878  GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            G +IT+LSIDGGGIRG+IP TI+A LE +LQ LDGP+AR ADYFDVI
Sbjct  29   GRLITVLSIDGGGIRGLIPATILACLEAKLQELDGPEARIADYFDVI  75



>gb|EMT07292.1| Patatin-11 [Aegilops tauschii]
Length=293

 Score =   103 bits (258),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 60/106 (57%), Positives = 76/106 (72%), Gaps = 0/106 (0%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            P+ID FS ASAD+VD H + +FQAL     YLRIQ+D+LKG TASVDV+T ENL+ L ++
Sbjct  179  PIIDSFSQASADLVDIHASVLFQALHCEKRYLRIQDDELKGETASVDVSTPENLNRLVDI  238

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
            GK LL + V K+N  TGKNEP    GTN++ L   A +LSEER+ R
Sbjct  239  GKALLKRQVCKVNAETGKNEPDQNRGTNEEELVNFARMLSEERKAR  284



>dbj|BAJ99822.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=382

 Score =   105 bits (261),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 60/109 (55%), Positives = 79/109 (72%), Gaps = 0/109 (0%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            P+ID FS ASAD+VD   + +FQALQ  + YLRIQ D+L G  ASVDV+T +NL+ L +V
Sbjct  270  PIIDSFSEASADLVDIQASVLFQALQCNNCYLRIQHDELTGEMASVDVSTSKNLNGLIDV  329

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRRTIA  215
            GK LL + V K+N+ TGKNEP  K GTN++ L R A +LS+ER+ R +A
Sbjct  330  GKALLKRQVCKVNVETGKNEPDLKRGTNEEELDRFARMLSKERKARQVA  378



>emb|CBI25858.3| unnamed protein product [Vitis vinifera]
Length=378

 Score =   104 bits (260),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 59/108 (55%), Positives = 81/108 (75%), Gaps = 0/108 (0%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            PL+D+FS AS+DMVD H++T+FQ+L    NYLRIQ+D L G  +SVDV T ENL  L E+
Sbjct  269  PLLDIFSHASSDMVDIHVSTVFQSLGCEKNYLRIQDDTLTGEESSVDVATTENLQRLGEI  328

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRRTI  218
            GK+LL KP+ ++NL TG++E +   GTN++AL + A LLSEER+ R +
Sbjct  329  GKELLAKPLSRVNLETGRHEQLEGEGTNQEALTQFAKLLSEERKFRQV  376


 Score = 49.3 bits (116),  Expect(2) = 3e-09, Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 34/54 (63%), Gaps = 3/54 (6%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAGIFEVVRDATSLLAGPK*DGNPL  536
            +AP+K+ RP++A KDI  FY +H P+IFP    F  + DA   + GPK +G  L
Sbjct  59   TAPNKDNRPVFAAKDINSFYLDHCPEIFPQNSRFGSLIDA---VRGPKYNGKYL  109


 Score = 40.8 bits (94),  Expect(2) = 3e-09, Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = -3

Query  872  VITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            ++T+LSIDGGG+RGIIPGT++A+LE + Q LDG DAR ADYFDVI
Sbjct  1    MVTVLSIDGGGVRGIIPGTLLAFLESKFQELDGDDARIADYFDVI  45



>emb|CDM80597.1| unnamed protein product [Triticum aestivum]
Length=434

 Score =   105 bits (261),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 61/106 (58%), Positives = 77/106 (73%), Gaps = 0/106 (0%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            P+ID FS ASAD+VD H + +FQAL     YLRIQ+D+LKG TASVDV+T+ENL+ L +V
Sbjct  320  PIIDSFSQASADLVDIHASVLFQALHCEKRYLRIQDDELKGETASVDVSTQENLNRLIDV  379

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
            GK LL + V K+N  TGKNEP    GTN++ L   A +LSEER+ R
Sbjct  380  GKALLKRQVCKVNAETGKNEPDQNRGTNEEELVNFAHMLSEERKAR  425


 Score = 50.1 bits (118),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 36/67 (54%), Gaps = 6/67 (9%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPSA--GIFEVVRDATSLLAGPK*DGNPLIDVF  524
            SAPD   RPL+A KDI  FY +H P IFP A  G F ++R     + GPK +G  L  V 
Sbjct  109  SAPDDAGRPLFAAKDINQFYLDHCPNIFPQASKGPFGLMRS----MMGPKYNGEYLHSVV  164

Query  523  SVASADM  503
                 DM
Sbjct  165  KELLGDM  171


 Score = 47.4 bits (111),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 47/53 (89%), Gaps = 2/53 (4%)
 Frame = -3

Query  890  SIPP--GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            S PP  G ++T+LSIDGGG+RGIIPGTI+A+LEE+LQ LDGP+AR +DYFDVI
Sbjct  43   SPPPSYGSIVTVLSIDGGGVRGIIPGTILAFLEEKLQDLDGPEARISDYFDVI  95



>ref|XP_010680418.1| PREDICTED: patatin-like protein 1 [Beta vulgaris subsp. vulgaris]
Length=407

 Score =   105 bits (261),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 61/110 (55%), Positives = 80/110 (73%), Gaps = 1/110 (1%)
 Frame = -1

Query  550  DGN-PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDA  374
            +GN PL+D F+ + ADMVD+H +  FQA  + DNYLRIQ+D LKG +ASVDV T ENL  
Sbjct  289  NGNTPLLDAFNQSKADMVDFHNSVAFQAYGSLDNYLRIQDDTLKGVSASVDVATTENLAN  348

Query  373  LEEVGkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
            L  +GK LL KPV ++N  TG+ +P+P  GTN++AL R A LL+EE+ RR
Sbjct  349  LVTIGKALLKKPVSRINFDTGRYQPIPNGGTNEEALIRFAKLLTEEKSRR  398


 Score = 59.3 bits (142),  Expect(2) = 4e-13, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 35/53 (66%), Gaps = 3/53 (6%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIF--PSAGIFEVVRDATSLLAGPK*DG  545
            +AP+   RPLYA K+I PFY EH PKIF  PS GIF  +     LL+GPK DG
Sbjct  79   TAPNDKTRPLYAAKEITPFYLEHCPKIFRQPS-GIFGSIGTLMKLLSGPKYDG  130


 Score = 43.5 bits (101),  Expect(2) = 4e-13, Method: Compositional matrix adjust.
 Identities = 35/51 (69%), Positives = 41/51 (80%), Gaps = 2/51 (4%)
 Frame = -3

Query  884  PP--GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            PP  G +ITILSIDGGGIRGIIP  ++ +LE +LQ LDG +AR ADYFDVI
Sbjct  15   PPNHGNLITILSIDGGGIRGIIPAVMLEFLESQLQKLDGEEARLADYFDVI  65



>ref|NP_001140826.1| uncharacterized protein LOC100272901 [Zea mays]
 gb|ACF84735.1| unknown [Zea mays]
 tpg|DAA48469.1| TPA: hypothetical protein ZEAMMB73_502492 [Zea mays]
Length=435

 Score =   105 bits (261),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 62/109 (57%), Positives = 79/109 (72%), Gaps = 0/109 (0%)
 Frame = -1

Query  550  DGNPLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDAL  371
            D  P+ID FS ASAD+VD H + +FQAL +   YLRIQ+D+L G T+SVDV+T+ENL+ L
Sbjct  317  DTTPIIDSFSQASADLVDIHASVLFQALHSERQYLRIQDDELTGQTSSVDVSTEENLNRL  376

Query  370  EEVGkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
             +VG+ LL KP  K+N+ TGKNEP  K GTN+D L R A +L  ERR R
Sbjct  377  VDVGRGLLKKPACKVNIETGKNEPDGKRGTNEDELVRFAKMLVRERRAR  425


 Score = 46.6 bits (109),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 32/54 (59%), Gaps = 0/54 (0%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAGIFEVVRDATSLLAGPK*DGNPL  536
            +AP+K+ RPL+A KDI  FY +H P+IFP  G           L+GPK DG  L
Sbjct  107  TAPNKDGRPLFAAKDINGFYLDHCPRIFPPGGGAGGPLGLLKKLSGPKYDGKYL  160


 Score = 39.7 bits (91),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 42/48 (88%), Gaps = 1/48 (2%)
 Frame = -3

Query  878  GGVITILSidgggirgiipgtIVAYLEEELQALD-GPDARAADYFDVI  738
            G ++T+LSIDGGG+RGIIPGTI+A+LEE+LQ  D  PDAR ADYFDVI
Sbjct  46   GSIVTVLSIDGGGVRGIIPGTILAFLEEKLQEYDERPDARLADYFDVI  93



>ref|XP_009383171.1| PREDICTED: patatin-like protein 2 [Musa acuminata subsp. malaccensis]
 ref|XP_009383172.1| PREDICTED: patatin-like protein 2 [Musa acuminata subsp. malaccensis]
Length=409

 Score =   105 bits (261),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 65/109 (60%), Positives = 81/109 (74%), Gaps = 1/109 (1%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            PL+D F  ASADMVD HI+  FQAL +G NYLRI++D L G  ASVD +TKENL+ L +V
Sbjct  289  PLVDAFMQASADMVDIHISEAFQALHSGKNYLRIEDDALSGILASVDTSTKENLENLVKV  348

Query  361  GkklltkpvlklnlLTGKNEPVPKA-GTNKDALKRLAGLLSEERRRRTI  218
            G+ LL KPV ++NL TG  EPV +  GTN++AL RLA LLS+ERR R +
Sbjct  349  GEMLLKKPVSRVNLETGHVEPVSEGEGTNEEALIRLAKLLSDERRLREM  397


 Score = 50.4 bits (119),  Expect(2) = 4e-11, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 30/55 (55%), Gaps = 1/55 (2%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFP-SAGIFEVVRDATSLLAGPK*DGNPL  536
            +AP+   RPLYA KDI  FY  H PKIFP S+  F         + GP+ DG  L
Sbjct  76   TAPNMQNRPLYAAKDIKEFYLNHSPKIFPQSSWPFNTAAKVIRAIIGPRYDGKYL  130


 Score = 45.8 bits (107),  Expect(2) = 4e-11, Method: Compositional matrix adjust.
 Identities = 35/47 (74%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = -3

Query  878  GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            G +ITILSIDGGGI+GIIP TI+A+LE ELQ LDG DAR ADYFD +
Sbjct  16   GNLITILSIDGGGIKGIIPATILAFLESELQKLDGEDARLADYFDAM  62



>ref|XP_003611772.1| Patatin-like protein [Medicago truncatula]
 gb|AES94730.1| patatin-like phospholipase [Medicago truncatula]
Length=396

 Score =   104 bits (260),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 61/113 (54%), Positives = 80/113 (71%), Gaps = 0/113 (0%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            P++D F+ AS DMVDYH A +F ALQ+ DNYLRIQ+D L+G  ASVD++TKENL+ L +V
Sbjct  283  PILDCFNEASNDMVDYHNAVLFTALQSQDNYLRIQDDTLQGELASVDISTKENLNNLVKV  342

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRRTIAALNG  203
            G++LL K   ++NL TG  E VP  GT ++ LKR A LLSE R+ +     NG
Sbjct  343  GEQLLKKKFTRVNLDTGIYEIVPYKGTIEEELKRFANLLSEIRKCKKSNPQNG  395


 Score = 48.1 bits (113),  Expect(2) = 3e-10, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 31/50 (62%), Gaps = 1/50 (2%)
 Frame = -1

Query  682  NKRPLYAGKDIVPFYKEHGPKIFP-SAGIFEVVRDATSLLAGPK*DGNPL  536
            N RPL+A K+IVPFY ++ P IFP  +GIF  +   T  L G K +G  L
Sbjct  74   NNRPLFAAKEIVPFYLQNLPNIFPQQSGIFAPLISTTKALTGSKYNGEYL  123


 Score = 45.1 bits (105),  Expect(2) = 3e-10, Method: Compositional matrix adjust.
 Identities = 35/51 (69%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -3

Query  890  SIPPGGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            ++ P   IT+LSIDGGG+RGIIPG I+AYLE +LQ +DG DAR ADYFDVI
Sbjct  3    AVKPVNFITVLSIDGGGVRGIIPGVILAYLESQLQEIDGEDARIADYFDVI  53



>ref|XP_009403085.1| PREDICTED: patatin-like protein 2 [Musa acuminata subsp. malaccensis]
Length=413

 Score =   104 bits (260),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 64/113 (57%), Positives = 83/113 (73%), Gaps = 1/113 (1%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            PLID FS ASAD+VD H++++FQ+L    NYLRIQ++ L G  +SVDV+TKENL  L ++
Sbjct  301  PLIDSFSHASADIVDVHMSSVFQSLHCEQNYLRIQDETLMGQASSVDVSTKENLLELVKI  360

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEER-RRRTIAALN  206
            G+ LL KPV ++NL TG  E V   GTN +AL RLA +LSEER RR+ + ALN
Sbjct  361  GESLLKKPVSRVNLETGDFEEVKGEGTNAEALTRLAKILSEERHRRKGVMALN  413


 Score = 55.1 bits (131),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 35/55 (64%), Gaps = 1/55 (2%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFP-SAGIFEVVRDATSLLAGPK*DGNPL  536
            +APD+ +RPL++ KDI+ FY ++ PKIFP  +G    VR     + GPK DG  L
Sbjct  87   TAPDEKQRPLFSAKDIIDFYLQNCPKIFPQGSGFLSSVRKLAGAIMGPKYDGKYL  141


 Score = 46.2 bits (108),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 44/51 (86%), Gaps = 2/51 (4%)
 Frame = -3

Query  884  PP--GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            PP  G +IT+LSIDGGG+RGIIPGTI+ +LE +LQ LDGPDAR ADYFDV+
Sbjct  23   PPCKGKLITVLSIDGGGVRGIIPGTIINFLETKLQELDGPDARVADYFDVV  73



>ref|XP_002262942.1| PREDICTED: patatin-like protein 2 [Vitis vinifera]
Length=397

 Score =   104 bits (260),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 59/108 (55%), Positives = 81/108 (75%), Gaps = 0/108 (0%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            PL+D+FS AS+DMVD H++T+FQ+L    NYLRIQ+D L G  +SVDV T ENL  L E+
Sbjct  288  PLLDIFSHASSDMVDIHVSTVFQSLGCEKNYLRIQDDTLTGEESSVDVATTENLQRLGEI  347

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRRTI  218
            GK+LL KP+ ++NL TG++E +   GTN++AL + A LLSEER+ R +
Sbjct  348  GKELLAKPLSRVNLETGRHEQLEGEGTNQEALTQFAKLLSEERKFRQV  395


 Score = 44.7 bits (104),  Expect(2) = 6e-09, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = -3

Query  896  AASIPPGGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            A S   G ++T+LSIDGGG+RGIIPGT++A+LE + Q LDG DAR ADYFDVI
Sbjct  2    ATSFGKGRMVTVLSIDGGGVRGIIPGTLLAFLESKFQELDGDDARIADYFDVI  54


 Score = 44.3 bits (103),  Expect(2) = 6e-09, Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFP  611
            +AP+K+ RP++A KDI  FY +H P+IFP
Sbjct  68   TAPNKDNRPVFAAKDINSFYLDHCPEIFP  96



>ref|NP_001062043.1| Os08g0477100 [Oryza sativa Japonica Group]
 dbj|BAD09208.1| putative latex protein allergen [Oryza sativa Japonica Group]
 dbj|BAF23957.1| Os08g0477100 [Oryza sativa Japonica Group]
 gb|EAZ43080.1| hypothetical protein OsJ_27670 [Oryza sativa Japonica Group]
 dbj|BAG98488.1| unnamed protein product [Oryza sativa Japonica Group]
Length=431

 Score =   105 bits (261),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 62/107 (58%), Positives = 78/107 (73%), Gaps = 0/107 (0%)
 Frame = -1

Query  544  NPLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEE  365
            +PLID FS ASAD+VD H + +FQAL    +YLRIQ+D+L G TASVDV+T ENL+ L +
Sbjct  317  SPLIDSFSQASADLVDIHASVLFQALHCEKSYLRIQDDELTGDTASVDVSTPENLNRLVD  376

Query  364  VGkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
            VGK LL K   K+NL TGKNEP    GTN++ L+  A +LSEER+ R
Sbjct  377  VGKALLKKRACKVNLETGKNEPDMSRGTNEEELENFAKMLSEERKAR  423


 Score = 47.0 bits (110),  Expect(2) = 4e-10, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 34/62 (55%), Gaps = 12/62 (19%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPS-----AGIFEVVRDATSLLAGPK*DGNPLI  533
            +AP+   RPL+A KDI  FY +H PKIFP       G+F+        +AGPK DG  L 
Sbjct  106  TAPNDQGRPLFAAKDINDFYLKHCPKIFPPRSIPIVGLFQS-------MAGPKYDGKYLH  158

Query  532  DV  527
             V
Sbjct  159  SV  160


 Score = 45.4 bits (106),  Expect(2) = 4e-10, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 45/53 (85%), Gaps = 2/53 (4%)
 Frame = -3

Query  890  SIPP--GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            S PP  G ++T+LSIDGGG+RGIIPGTI+A LEE+LQ LDG DAR ADYFDVI
Sbjct  40   SPPPSYGSIVTVLSIDGGGVRGIIPGTILASLEEKLQKLDGADARIADYFDVI  92



>ref|XP_011038243.1| PREDICTED: patatin-like protein 2 isoform X1 [Populus euphratica]
Length=404

 Score =   104 bits (260),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 61/106 (58%), Positives = 83/106 (78%), Gaps = 1/106 (1%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            PL+DVF+ AS DMVD+HI+T+FQAL + +NYLRIQ+D L G+ +SVDV T ENL+ L +V
Sbjct  292  PLVDVFTQASGDMVDFHISTVFQALNSEENYLRIQDDTLTGTLSSVDVATNENLENLGKV  351

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
            G++LL KPV ++NL TG  EP+ K  TN++AL++LA LLS E+  R
Sbjct  352  GEELLKKPVSRVNLATGIFEPINKM-TNEEALRKLAKLLSREKHLR  396


 Score = 50.8 bits (120),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 32/53 (60%), Gaps = 2/53 (4%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFP--SAGIFEVVRDATSLLAGPK*DG  545
            +AP+K  RPL+A KDI  FY E+ PKIFP  S+  F    +    L GPK DG
Sbjct  77   AAPNKQNRPLFAAKDINEFYLENCPKIFPQDSSSKFASAANLVKTLRGPKYDG  129


 Score = 50.4 bits (119),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 39/47 (83%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = -3

Query  878  GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            G  IT+LSIDGGGIRGIIPGTI+A+LE ELQ LDGPDAR ADYFDVI
Sbjct  17   GNQITVLSIDGGGIRGIIPGTILAFLESELQKLDGPDARLADYFDVI  63



>ref|XP_009629882.1| PREDICTED: patatin-like protein 2 [Nicotiana tomentosiformis]
Length=232

 Score =   102 bits (254),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 57/104 (55%), Positives = 78/104 (75%), Gaps = 0/104 (0%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            P++DVF+ AS D+VD HI+ +FQALQ+ +NYLRIQ D L G+ +SVD+ TKEN+D L ++
Sbjct  115  PIVDVFTQASGDLVDLHISVVFQALQSEENYLRIQNDTLIGTDSSVDIATKENMDKLVKI  174

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERR  230
            GK LL KPV ++NL TG +E     GTN++ LKR A +L EE+R
Sbjct  175  GKTLLKKPVSRVNLQTGLSEQCENGGTNEETLKRFAKVLLEEKR  218



>ref|XP_011038244.1| PREDICTED: patatin-like protein 2 isoform X2 [Populus euphratica]
Length=403

 Score =   104 bits (260),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 61/106 (58%), Positives = 83/106 (78%), Gaps = 1/106 (1%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            PL+DVF+ AS DMVD+HI+T+FQAL + +NYLRIQ+D L G+ +SVDV T ENL+ L +V
Sbjct  291  PLVDVFTQASGDMVDFHISTVFQALNSEENYLRIQDDTLTGTLSSVDVATNENLENLGKV  350

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
            G++LL KPV ++NL TG  EP+ K  TN++AL++LA LLS E+  R
Sbjct  351  GEELLKKPVSRVNLATGIFEPINKM-TNEEALRKLAKLLSREKHLR  395


 Score = 50.4 bits (119),  Expect(2) = 3e-12, Method: Compositional matrix adjust.
 Identities = 39/47 (83%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = -3

Query  878  GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            G  IT+LSIDGGGIRGIIPGTI+A+LE ELQ LDGPDAR ADYFDVI
Sbjct  17   GNQITVLSIDGGGIRGIIPGTILAFLESELQKLDGPDARLADYFDVI  63


 Score = 49.7 bits (117),  Expect(2) = 3e-12, Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 31/52 (60%), Gaps = 1/52 (2%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPS-AGIFEVVRDATSLLAGPK*DG  545
            +AP+K  RPL+A KDI  FY E+ PKIFP  +  F    +    L GPK DG
Sbjct  77   AAPNKQNRPLFAAKDINEFYLENCPKIFPQDSSKFASAANLVKTLRGPKYDG  128



>ref|XP_009367484.1| PREDICTED: patatin-like protein 2 [Pyrus x bretschneideri]
Length=415

 Score =   104 bits (260),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 62/113 (55%), Positives = 86/113 (76%), Gaps = 1/113 (1%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            PLIDVF+ AS+DMVD+H+AT+FQAL    +YLRIQ+D L+   +SVD+ TKENLD L +V
Sbjct  296  PLIDVFTQASSDMVDFHLATVFQALNCEKSYLRIQDDTLEKIVSSVDIATKENLDNLVKV  355

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRRTIAALNG  203
            G+KLL KPV ++N+ TG  EP  ++ TN++AL R+AG+LS ER+ R   + +G
Sbjct  356  GEKLLKKPVSRVNMDTGAFEPAHQS-TNEEALVRVAGILSRERKVRETQSPHG  407


 Score = 55.5 bits (132),  Expect(2) = 6e-13, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 35/59 (59%), Gaps = 2/59 (3%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFP--SAGIFEVVRDATSLLAGPK*DGNPLIDV  527
            + PD+N RPL++ KDI  FY EH PKIFP  SA +     D    L GPK DG  L ++
Sbjct  80   TTPDENNRPLFSAKDINAFYLEHCPKIFPQGSAPLIGEAVDMVKNLTGPKYDGKYLHNI  138


 Score = 47.0 bits (110),  Expect(2) = 6e-13, Method: Compositional matrix adjust.
 Identities = 36/47 (77%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = -3

Query  878  GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            G ++T+LSIDGGGIRGIIPGTI+++LE ELQ LDG DAR ADYFDVI
Sbjct  20   GNLVTVLSIDGGGIRGIIPGTILSFLESELQKLDGEDARLADYFDVI  66



>emb|CAN62059.1| hypothetical protein VITISV_024099 [Vitis vinifera]
Length=397

 Score =   104 bits (259),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 59/108 (55%), Positives = 81/108 (75%), Gaps = 0/108 (0%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            PL+D+FS AS+DMVD H++T+FQ+L    NYLRIQ+D L G  +SVDV T ENL  L E+
Sbjct  288  PLLDIFSHASSDMVDIHVSTVFQSLGCEKNYLRIQDDTLTGEESSVDVATTENLQRLGEI  347

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRRTI  218
            GK+LL KP+ ++NL TG++E +   GTN++AL + A LLSEER+ R +
Sbjct  348  GKELLXKPLSRVNLETGRHEQLEGEGTNQEALTQFAKLLSEERKFRQV  395


 Score = 44.7 bits (104),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = -3

Query  896  AASIPPGGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            A S   G ++T+LSIDGGG+RGIIPGT++A+LE + Q LDG DAR ADYFDVI
Sbjct  2    ATSFGKGRMVTVLSIDGGGVRGIIPGTLLAFLESKFQELDGDDARIADYFDVI  54


 Score = 43.5 bits (101),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFP  611
            +AP+K+ RP +A KDI  FY +H P+IFP
Sbjct  68   TAPNKDNRPXFAAKDINSFYLDHCPEIFP  96



>emb|CDP01335.1| unnamed protein product [Coffea canephora]
Length=431

 Score =   104 bits (260),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 60/106 (57%), Positives = 79/106 (75%), Gaps = 1/106 (1%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            P+ID+++ AS D+ D H++TIFQ +Q  +NYLRIQ+D + G   SVD+ TKENL  L +V
Sbjct  311  PIIDIYTQASGDIADLHLSTIFQTMQCEENYLRIQDDTISGDLGSVDLATKENLKNLVKV  370

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
            G+ LL KPV + NL TG +EPV + GTN++ALKRLA  LSEERR R
Sbjct  371  GENLLKKPVSRTNLKTGASEPVNR-GTNEEALKRLAAALSEERRLR  415


 Score = 55.8 bits (133),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 33/55 (60%), Gaps = 1/55 (2%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFP-SAGIFEVVRDATSLLAGPK*DGNPL  536
            +AP++NKRPLYA KDI  FY E  PKIFP S  +F  +      + GP  DG  L
Sbjct  98   TAPNENKRPLYAAKDIKDFYLEECPKIFPQSNHLFSCIERVVKSMTGPTYDGKYL  152


 Score = 45.4 bits (106),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/47 (77%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = -3

Query  878  GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            G  +TILSIDGGGIRGIIPG I+ YLE ELQ LDG DAR A YFDVI
Sbjct  38   GNCVTILSIDGGGIRGIIPGVILGYLETELQKLDGSDARLAGYFDVI  84



>ref|XP_010317808.1| PREDICTED: patatin-like protein 2 isoform X1 [Solanum lycopersicum]
 ref|XP_010317809.1| PREDICTED: patatin-like protein 2 isoform X1 [Solanum lycopersicum]
Length=416

 Score =   104 bits (259),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 79/107 (74%), Gaps = 0/107 (0%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            P+IDV+S ASADMVD H++T+FQ L    NYLRIQ+D+L G  AS+D+ T EN++ L ++
Sbjct  310  PIIDVYSDASADMVDIHVSTMFQTLHNEKNYLRIQDDNLIGDAASMDIATTENMETLVQI  369

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRRT  221
            G  LL KPV ++NL TG+ EPV   GTN++AL R A LLS E++ R+
Sbjct  370  GNNLLKKPVSRVNLETGQYEPVHGEGTNEEALIRFANLLSHEKKLRS  416


 Score = 61.2 bits (147),  Expect(2) = 5e-14, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 32/54 (59%), Gaps = 0/54 (0%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAGIFEVVRDATSLLAGPK*DGNPL  536
            +AP+++ RPLYA KDI  FY EHGP IFP       V +   L  GPK DG  L
Sbjct  91   TAPNRDNRPLYAAKDISTFYMEHGPHIFPQTRRRNFVNNVAHLFGGPKYDGEYL  144


 Score = 45.1 bits (105),  Expect(2) = 5e-14, Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = -3

Query  872  VITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            ++T+LSIDGGGIRGIIPGT++A+LE +LQ LDGP+AR ADYFDV+
Sbjct  33   LVTVLSIDGGGIRGIIPGTLLAFLESKLQELDGPNARIADYFDVV  77



>ref|XP_012071992.1| PREDICTED: patatin-like protein 2 [Jatropha curcas]
 gb|KDP38383.1| hypothetical protein JCGZ_04308 [Jatropha curcas]
Length=412

 Score =   104 bits (259),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 82/113 (73%), Gaps = 1/113 (1%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            PL+DVF+ ASADMVD+HI+ +FQAL+   NYLRIQ+D L  + +SVDV TKENLD L +V
Sbjct  291  PLVDVFTHASADMVDFHISVVFQALRCESNYLRIQDDTLSKTVSSVDVATKENLDNLVKV  350

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRRTIAALNG  203
            G+ LL KPV ++N  TG  E + K  TN++AL R A LLS+ERR R   + +G
Sbjct  351  GEGLLKKPVSRVNSETGIYESLTKE-TNEEALIRFAKLLSQERRLRHAKSPHG  402


 Score = 48.9 bits (115),  Expect(2) = 4e-11, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 48/57 (84%), Gaps = 3/57 (5%)
 Frame = -3

Query  899  NAASIPP---GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            NAA++ P   G +IT+LSIDGGGIRGIIPGTI+++LE +LQ LDG DAR ADYFDVI
Sbjct  5    NAAALQPPTYGNLITVLSIDGGGIRGIIPGTILSFLESQLQKLDGEDARIADYFDVI  61


 Score = 47.0 bits (110),  Expect(2) = 4e-11, Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 31/56 (55%), Gaps = 2/56 (4%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFP--SAGIFEVVRDATSLLAGPK*DGNPL  536
            +AP++  RP++A KDI  FY    PKIFP  S  +F         ++GPK DG  L
Sbjct  75   AAPNEKNRPVFAAKDIKDFYLNECPKIFPQRSCALFPQTTKVIKAISGPKYDGKYL  130



>ref|XP_007160832.1| hypothetical protein PHAVU_001G020300g [Phaseolus vulgaris]
 gb|ESW32826.1| hypothetical protein PHAVU_001G020300g [Phaseolus vulgaris]
Length=413

 Score =   104 bits (259),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 57/106 (54%), Positives = 76/106 (72%), Gaps = 0/106 (0%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            PL DVF+ +SADMVD+H++ + QAL + DNYLRIQ+D L G+ +SVD+ TKENL  L E+
Sbjct  292  PLTDVFTQSSADMVDFHLSAVTQALHSEDNYLRIQDDTLSGTESSVDIATKENLQKLSEI  351

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
            G+ LL K V ++NL  G  EP+    TN+ AL R A +LS+ERR R
Sbjct  352  GQNLLKKSVSRVNLENGLFEPLANGETNQHALTRFAKILSQERRLR  397


 Score = 62.4 bits (150),  Expect(2) = 5e-15, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 36/59 (61%), Gaps = 2/59 (3%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAGIF--EVVRDATSLLAGPK*DGNPLIDV  527
            +APD N RPL+A KDI PFY EHGPKIFP        ++ +    L GPK DG  L +V
Sbjct  77   TAPDNNHRPLFAAKDIKPFYLEHGPKIFPHHSGLGGTIIANLVRSLGGPKYDGKYLHEV  135


 Score = 47.0 bits (110),  Expect(2) = 5e-15, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 43/51 (84%), Gaps = 2/51 (4%)
 Frame = -3

Query  884  PP--GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            PP  G ++TILSIDGGGIRGIIP TI+ +LE +LQ LDGP+AR ADYFDVI
Sbjct  13   PPTYGNLVTILSIDGGGIRGIIPATIIDFLESQLQELDGPEARLADYFDVI  63



>ref|XP_004234672.1| PREDICTED: patatin-like protein 3 isoform X2 [Solanum lycopersicum]
Length=410

 Score =   104 bits (259),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 79/107 (74%), Gaps = 0/107 (0%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            P+IDV+S ASADMVD H++T+FQ L    NYLRIQ+D+L G  AS+D+ T EN++ L ++
Sbjct  304  PIIDVYSDASADMVDIHVSTMFQTLHNEKNYLRIQDDNLIGDAASMDIATTENMETLVQI  363

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRRT  221
            G  LL KPV ++NL TG+ EPV   GTN++AL R A LLS E++ R+
Sbjct  364  GNNLLKKPVSRVNLETGQYEPVHGEGTNEEALIRFANLLSHEKKLRS  410


 Score = 61.2 bits (147),  Expect(2) = 5e-14, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 32/54 (59%), Gaps = 0/54 (0%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAGIFEVVRDATSLLAGPK*DGNPL  536
            +AP+++ RPLYA KDI  FY EHGP IFP       V +   L  GPK DG  L
Sbjct  91   TAPNRDNRPLYAAKDISTFYMEHGPHIFPQTRRRNFVNNVAHLFGGPKYDGEYL  144


 Score = 45.1 bits (105),  Expect(2) = 5e-14, Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = -3

Query  872  VITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            ++T+LSIDGGGIRGIIPGT++A+LE +LQ LDGP+AR ADYFDV+
Sbjct  33   LVTVLSIDGGGIRGIIPGTLLAFLESKLQELDGPNARIADYFDVV  77



>ref|XP_007047215.1| Uncharacterized protein TCM_000589 [Theobroma cacao]
 gb|EOX91372.1| Uncharacterized protein TCM_000589 [Theobroma cacao]
Length=401

 Score =   104 bits (259),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 58/106 (55%), Positives = 78/106 (74%), Gaps = 0/106 (0%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            P+ID +S AS DMVDYH + +F+AL + D YLRI +D L+G  ASVDV TKEN+D L +V
Sbjct  285  PIIDCYSEASKDMVDYHNSVVFEALHSEDKYLRIDDDTLRGELASVDVATKENMDNLVKV  344

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
            G+ LL K V ++NL TG  EP+   GTN++AL+R A LLS+E++ R
Sbjct  345  GEDLLKKTVTRINLDTGLYEPIENGGTNEEALRRFAKLLSDEKKVR  390


 Score = 57.8 bits (138),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 35/55 (64%), Gaps = 1/55 (2%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPS-AGIFEVVRDATSLLAGPK*DGNPL  536
            +AP++N RPLYA KDIVPFY E+ PKIFP  +G+          L GP+ DG  L
Sbjct  76   AAPNENDRPLYAAKDIVPFYLENSPKIFPQMSGVLGWAAKLLKALTGPRYDGKYL  130


 Score = 43.1 bits (100),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 42/51 (82%), Gaps = 2/51 (4%)
 Frame = -3

Query  884  PP--GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            PP  G +ITILSIDGGG+RGIIPG I+A LE ELQ +DG DAR ADYFDVI
Sbjct  12   PPTYGNLITILSIDGGGVRGIIPGVILAKLESELQNIDGEDARLADYFDVI  62



>ref|XP_006354910.1| PREDICTED: LOW QUALITY PROTEIN: patatin group M-3-like [Solanum 
tuberosum]
Length=405

 Score =   104 bits (259),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 60/106 (57%), Positives = 79/106 (75%), Gaps = 1/106 (1%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            PL +VF+ +SADM+DYH + +FQAL + D+YLRIQED L G+ A      KENL+ L E+
Sbjct  289  PLFEVFTQSSADMIDYHNSVVFQALHSEDSYLRIQEDGLSGTEAQXGCGYKENLERLVEI  348

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
            G+KLL KP+ ++NL TG  EP+PK GTN++ALKR A LL +ERR R
Sbjct  349  GEKLLXKPLSRVNLETGL-EPIPKGGTNEEALKRFAKLLVDERRLR  393


 Score = 68.2 bits (165),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 37/59 (63%), Gaps = 2/59 (3%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPS--AGIFEVVRDATSLLAGPK*DGNPLIDV  527
            +APD+N RP YA KDI PFY EH PKIFP    G+F  +R     L GPK DG  L +V
Sbjct  74   TAPDENNRPFYAAKDITPFYLEHCPKIFPQNKCGLFASMRKMVQALIGPKYDGKYLHEV  132


 Score = 42.0 bits (97),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 35/51 (69%), Positives = 41/51 (80%), Gaps = 2/51 (4%)
 Frame = -3

Query  884  PP--GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            PP  G  IT+LSIDGGGIRGIIP TI+++LE +LQ  DG DAR A+YFDVI
Sbjct  10   PPTYGDFITVLSIDGGGIRGIIPATILSFLESQLQEFDGKDARLAEYFDVI  60



>emb|CDM80590.1| unnamed protein product [Triticum aestivum]
Length=272

 Score =   102 bits (255),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 60/106 (57%), Positives = 76/106 (72%), Gaps = 0/106 (0%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            P+ID FS ASAD+VD H + +FQAL     YLRIQ+D+LKG TASVDV+T ENL+ L +V
Sbjct  158  PIIDSFSQASADLVDIHASVLFQALHCKKRYLRIQDDELKGETASVDVSTPENLNRLVDV  217

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
            GK LL + V K+N  TGKNEP    GTN++ L   A +LS+ER+ R
Sbjct  218  GKALLKRQVCKVNAETGKNEPDQNRGTNEEELVIFARMLSKERKAR  263



>gb|KCW66177.1| hypothetical protein EUGRSUZ_F00013 [Eucalyptus grandis]
Length=190

 Score =   100 bits (250),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 73/96 (76%), Gaps = 0/96 (0%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            PL+DVF+ ASADMVD+HI+  FQAL   DNYLRIQ+D L G  +SVD+ TKENL+ L  +
Sbjct  87   PLVDVFTTASADMVDFHISATFQALPFEDNYLRIQDDTLTGKDSSVDIATKENLENLLRI  146

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLA  254
            G++LL KPV ++NL TG +EP+ K  TN DALKR +
Sbjct  147  GERLLKKPVSRVNLETGLSEPIAKGTTNADALKRCS  182



>gb|EAZ07350.1| hypothetical protein OsI_29600 [Oryza sativa Indica Group]
Length=429

 Score =   104 bits (259),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 63/107 (59%), Positives = 79/107 (74%), Gaps = 0/107 (0%)
 Frame = -1

Query  544  NPLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEE  365
            +PLID FS ASAD+VD H + +FQAL+   +YLRIQ+D+L G TASVDV+T ENL+ L E
Sbjct  315  SPLIDSFSQASADLVDIHASVLFQALRCEKSYLRIQDDELTGDTASVDVSTPENLNRLVE  374

Query  364  VGkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
            VGK LL K V K+NL TGKNEP    GTN++ L   A +LS+ER+ R
Sbjct  375  VGKALLKKRVCKVNLETGKNEPDMSRGTNEEELDHFAKMLSDERKAR  421


 Score = 51.2 bits (121),  Expect(2) = 5e-11, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 33/57 (58%), Gaps = 4/57 (7%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAGIFEVVRDATSLLAGPK*DGNPLIDV  527
            +AP+   RPL+A KDI  FY EH PKIFP   I  + +     +AGPK DG  L  V
Sbjct  106  TAPNDQGRPLFAAKDINDFYLEHCPKIFPPRSIMGLFQS----MAGPKYDGKYLHSV  158


 Score = 44.3 bits (103),  Expect(2) = 5e-11, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 45/53 (85%), Gaps = 2/53 (4%)
 Frame = -3

Query  890  SIPP--GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            S PP  G ++T+LSIDGGG+RGIIPGTI+A LEE+LQ +DG DAR ADYFDVI
Sbjct  40   SPPPSYGSIVTVLSIDGGGVRGIIPGTILASLEEKLQRIDGADARIADYFDVI  92



>gb|ABK94710.1| unknown [Populus trichocarpa]
Length=243

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 55/106 (52%), Positives = 77/106 (73%), Gaps = 0/106 (0%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            P+ID+FS AS+DMVDYHI+T+FQ+L + + YLRIQ+D L G  ASVD+ T +NL  L+E+
Sbjct  135  PIIDMFSSASSDMVDYHISTLFQSLDSKECYLRIQDDKLSGDAASVDIATPQNLQRLKEI  194

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
            G +LL K   ++NL TGK E +    TN+ AL + A LLS+E++ R
Sbjct  195  GAELLKKTESRVNLDTGKYEEIEGGRTNEAALAKFAQLLSDEKKHR  240



>gb|KGN62064.1| hypothetical protein Csa_2G294910 [Cucumis sativus]
Length=301

 Score =   103 bits (256),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 58/108 (54%), Positives = 77/108 (71%), Gaps = 0/108 (0%)
 Frame = -1

Query  547  GNPLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALE  368
            G P++D+FS ASADMVDYHI++IFQ+     NYLRIQ+D L G  +SVD+ T+ENL  L 
Sbjct  191  GTPIVDIFSDASADMVDYHISSIFQSDHCHKNYLRIQDDTLSGEVSSVDIATEENLLNLI  250

Query  367  EVGkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
             VG+ LL KP+ ++NL +GK EP+   GTN+ AL   A +LS ER+ R
Sbjct  251  YVGENLLKKPLSRVNLESGKFEPLDAKGTNEQALAEFAKMLSNERKLR  298



>ref|XP_007136666.1| hypothetical protein PHAVU_009G063500g [Phaseolus vulgaris]
 gb|ESW08660.1| hypothetical protein PHAVU_009G063500g [Phaseolus vulgaris]
Length=408

 Score =   103 bits (258),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 59/115 (51%), Positives = 84/115 (73%), Gaps = 0/115 (0%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            PLIDV + +SADMVD+H+AT+ QAL + +NYLRIQ+D L G  AS+D+ TKEN++ L ++
Sbjct  291  PLIDVLTHSSADMVDFHLATVTQALHSKNNYLRIQDDTLTGVDASLDIATKENMEKLSQI  350

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRRTIAALNGGK  197
            G +LL KPV ++NL TG  EP+    TN+DAL+R A +LS+ER  R + + +  K
Sbjct  351  GDRLLKKPVSQINLETGLFEPMGDGETNEDALRRFAKMLSDERSFRELKSPHTNK  405


 Score = 55.1 bits (131),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 35/55 (64%), Gaps = 1/55 (2%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPS-AGIFEVVRDATSLLAGPK*DGNPL  536
            SAP+ ++RPL+A KDI PFY +H PKIFP  + I+  ++     L GPK D   L
Sbjct  77   SAPNDHQRPLFAAKDIRPFYLDHSPKIFPQRSSIWGWIQKLLRSLGGPKYDAKYL  131



>gb|KHN42072.1| Patatin group A-3 [Glycine soja]
Length=434

 Score =   104 bits (259),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 59/99 (60%), Positives = 72/99 (73%), Gaps = 0/99 (0%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            P++D FS AS DMVDYH   +F ALQ+ DNYLRIQ++ LKG  ASVDV TKENLD L +V
Sbjct  293  PILDCFSEASFDMVDYHNCVVFSALQSEDNYLRIQDNTLKGDLASVDVATKENLDNLVKV  352

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLL  245
            G++LL   V ++NL TG  EPVP  GTN +ALKR A + 
Sbjct  353  GQQLLKNTVTRVNLDTGLYEPVPDKGTNVEALKRKASIF  391


 Score = 53.1 bits (126),  Expect(2) = 4e-11, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 31/51 (61%), Gaps = 2/51 (4%)
 Frame = -1

Query  691  PDKNKRPLYAGKDIVPFYKEHGPKIFPS--AGIFEVVRDATSLLAGPK*DG  545
            P  N RPL+A  +IVPFY E+ P+IFP    GIF  + +    L GPK DG
Sbjct  79   PKANNRPLFAANEIVPFYLENSPQIFPQKRGGIFAPLVNIGKALTGPKYDG  129


 Score = 43.1 bits (100),  Expect(2) = 4e-11, Method: Compositional matrix adjust.
 Identities = 35/45 (78%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = -3

Query  872  VITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            +IT+LSIDGGGIRGIIPG I+ YLE +LQ LDG DAR ADYFDVI
Sbjct  17   LITVLSIDGGGIRGIIPGVILDYLESQLQELDGEDARLADYFDVI  61



>ref|XP_010509133.1| PREDICTED: patatin-like protein 2 [Camelina sativa]
Length=129

 Score = 99.0 bits (245),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 58/116 (50%), Positives = 84/116 (72%), Gaps = 1/116 (1%)
 Frame = -1

Query  550  DGNPLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDAL  371
            +  PLIDVF+ AS+DMVD+H++ +F+AL +G NY+RIQ+D L G  ASVD+ T ENLD L
Sbjct  9    NSTPLIDVFTHASSDMVDFHLSCVFRALHSGANYIRIQDDTLTGDAASVDIATIENLDNL  68

Query  370  EEVGkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRRTIAALNG  203
              +G +LL KPV ++NL +G NE   +  TN+ AL +LAG+LS+E++ R + +  G
Sbjct  69   ANIGDELLKKPVSRVNLDSGCNENAYQM-TNEKALIKLAGILSKEKKIRDMRSPQG  123



>ref|XP_006660213.1| PREDICTED: patatin-3-Kuras 1-like, partial [Oryza brachyantha]
Length=412

 Score =   103 bits (258),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 63/116 (54%), Positives = 82/116 (71%), Gaps = 1/116 (1%)
 Frame = -1

Query  550  DGN-PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDA  374
            DG+ PLID FS ASAD+VD H + +FQAL+   +YLRIQ+D+L G  ASVDV+T ENL  
Sbjct  295  DGSTPLIDSFSQASADLVDIHASVLFQALRCQRSYLRIQDDELTGDAASVDVSTPENLRR  354

Query  373  LEEVGkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRRTIAALN  206
            L +VG+ LL KP  K+N+ TG+NEP    GTN++ LK  A +LSEER+ R +   N
Sbjct  355  LVDVGRALLKKPACKVNVETGRNEPDMDRGTNEEELKHFAEMLSEERKARLLKKFN  410


 Score = 48.1 bits (113),  Expect(2) = 8e-11, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 35/61 (57%), Gaps = 10/61 (16%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFP----SAGIFEVVRDATSLLAGPK*DGNPLID  530
            +APD   RPL+A K I  FY EH PKIFP    + G+ +      SL++GPK DG  L  
Sbjct  88   TAPDDQGRPLFAAKGINDFYLEHSPKIFPPRRSNLGLIK------SLMSGPKYDGKYLHS  141

Query  529  V  527
            V
Sbjct  142  V  142


 Score = 47.0 bits (110),  Expect(2) = 8e-11, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 47/53 (89%), Gaps = 2/53 (4%)
 Frame = -3

Query  890  SIPP--GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            S PP  G ++T+LSIDGGG+RGIIPGTI+A+LEE+LQ +DGP+AR ADYFDV+
Sbjct  22   SPPPSYGSIVTVLSIDGGGVRGIIPGTILAFLEEKLQEIDGPEARIADYFDVV  74



>ref|XP_009380972.1| PREDICTED: patatin-like protein 2 [Musa acuminata subsp. malaccensis]
Length=402

 Score =   103 bits (257),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 76/106 (72%), Gaps = 0/106 (0%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            P+ID+FS ASADMVD H + +FQAL +  +YLRIQED L G TASVDV+T+ENL+ L EV
Sbjct  291  PIIDIFSQASADMVDIHASVLFQALHSEQHYLRIQEDALVGDTASVDVSTRENLEKLMEV  350

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
            G  LL KPV ++NL  G  EP    GTN++AL R A  LS ER+ R
Sbjct  351  GGNLLKKPVSRVNLENGTFEPCDGEGTNEEALTRFARRLSSERKLR  396


 Score = 52.0 bits (123),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 35/56 (63%), Gaps = 2/56 (4%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFP--SAGIFEVVRDATSLLAGPK*DGNPL  536
            +APDK+KRPL+  K I+ FY ++ PKIFP   AG+   + +    + GPK DG  L
Sbjct  76   TAPDKDKRPLFTAKQIIQFYLDNCPKIFPRKKAGLLNPLLNLFGAVTGPKYDGKYL  131


 Score = 45.4 bits (106),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 46/55 (84%), Gaps = 2/55 (4%)
 Frame = -3

Query  896  AASIPP--GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            +A+ PP  G ++T+LSIDGGG+RG+IP T++A+LE +LQ LDG DAR ADYFDVI
Sbjct  8    SANPPPALGKLVTVLSIDGGGVRGLIPATLLAFLESKLQELDGADARIADYFDVI  62



>ref|XP_004979713.1| PREDICTED: patatin-3-Kuras 1-like [Setaria italica]
Length=408

 Score =   103 bits (257),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 60/106 (57%), Positives = 78/106 (74%), Gaps = 0/106 (0%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            P+ID+FS ASADMVD H A +F++L    NYLRIQ+D L G  +SVD+ TKEN++AL  +
Sbjct  296  PIIDIFSHASADMVDIHAAVLFESLHCQKNYLRIQDDSLTGDASSVDIATKENMEALIGI  355

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
            GK+LL KPV ++N+ TG  E V   GTN+DAL R A +LSEER+ R
Sbjct  356  GKELLRKPVARVNIDTGMYEAVAGEGTNEDALARFARMLSEERKLR  401


 Score = 56.6 bits (135),  Expect(2) = 5e-13, Method: Compositional matrix adjust.
 Identities = 27/53 (51%), Positives = 33/53 (62%), Gaps = 2/53 (4%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPS--AGIFEVVRDATSLLAGPK*DG  545
            +APD+NKRPLYA KD+  FY E+GPKIFP    G      +    + GPK DG
Sbjct  81   AAPDENKRPLYAAKDLTTFYLENGPKIFPQRKLGWLTSAMNLVGTMRGPKYDG  133


 Score = 45.8 bits (107),  Expect(2) = 5e-13, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 43/51 (84%), Gaps = 2/51 (4%)
 Frame = -3

Query  884  PP--GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            PP  G +IT+LSIDGGGIRG+IP TI+A LE +LQ LDGPDAR ADYFDVI
Sbjct  17   PPSQGRLITVLSIDGGGIRGLIPATIIACLEAKLQELDGPDARIADYFDVI  67



>gb|KDO79282.1| hypothetical protein CISIN_1g015720mg [Citrus sinensis]
Length=402

 Score =   103 bits (257),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 59/108 (55%), Positives = 79/108 (73%), Gaps = 2/108 (2%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            PL+D +  A  DMVDYHI+ +FQALQ+ DNYLRI++D L+G   S+D+TTKEN + L   
Sbjct  289  PLLDCYGRAIGDMVDYHISVVFQALQSEDNYLRIEDDTLQGDVTSIDLTTKENFENLVRA  348

Query  361  GkklltkpvlklnlLTGKNEPVPK--AGTNKDALKRLAGLLSEERRRR  224
            G+ LL KPV ++NL TG  EP+    AGTN++ALKR A +LS+ER+ R
Sbjct  349  GETLLKKPVSRINLDTGLYEPIENGSAGTNEEALKRFAKMLSDERKLR  396


 Score = 52.8 bits (125),  Expect(2) = 4e-12, Method: Compositional matrix adjust.
 Identities = 20/29 (69%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFP  611
            +AP +  RP+YA KDIVPFY  HGPKIFP
Sbjct  75   TAPSEQNRPMYAAKDIVPFYIRHGPKIFP  103


 Score = 46.6 bits (109),  Expect(2) = 4e-12, Method: Compositional matrix adjust.
 Identities = 40/54 (74%), Positives = 44/54 (81%), Gaps = 2/54 (4%)
 Frame = -3

Query  893  ASIPP--GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            A+ PP    +ITILSIDGGGIRGIIPG I+AYLE +LQ LDG DAR ADYFDVI
Sbjct  8    ANQPPTYANLITILSIDGGGIRGIIPGVILAYLESQLQELDGEDARLADYFDVI  61



>ref|XP_011070718.1| PREDICTED: patatin-like protein 2 [Sesamum indicum]
Length=428

 Score =   103 bits (257),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 56/106 (53%), Positives = 79/106 (75%), Gaps = 0/106 (0%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            PL+++F+ ASADMVD+H + +FQAL + DNYLRIQ+D L G  +SVDV T+ENLD L  +
Sbjct  290  PLLEIFTQASADMVDFHTSLLFQALFSEDNYLRIQDDTLCGIESSVDVATRENLDRLVTI  349

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
            G++LL  PV +++  TG ++P+   GTN+DA+ R A LLS ER+ R
Sbjct  350  GERLLKGPVSRVDFSTGLSQPLQNGGTNEDAIIRFARLLSTERKLR  395


 Score = 55.1 bits (131),  Expect(2) = 3e-10, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 36/55 (65%), Gaps = 2/55 (4%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFP-SAGIFEVVRDATSLLAGPK*DGNPL  536
            ++PD+N RPLYA KDI PFY E+ PKIFP +   F   ++  SLL GP  DG  L
Sbjct  77   TSPDENNRPLYAAKDIKPFYLENCPKIFPQTHSWFPFGQELKSLL-GPLYDGKHL  130


 Score = 38.1 bits (87),  Expect(2) = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = -3

Query  887  IPPGGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            +P    IT+LSIDGGGI+GIIP  I+ +LE +LQ LDG   R ADYFDVI
Sbjct  14   LPHDRYITVLSIDGGGIKGIIPAVILDFLESQLQELDGKQTRLADYFDVI  63



>gb|AEF30538.1| patatin-like phospholipase 1 [Capsicum annuum]
Length=413

 Score =   103 bits (257),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 56/106 (53%), Positives = 78/106 (74%), Gaps = 0/106 (0%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            PLID+F  ASADMVD H++T+FQ   +  NY+RIQ+D+L G  AS+D+ T+EN++ L ++
Sbjct  305  PLIDIFGDASADMVDIHVSTMFQTFGSEKNYVRIQDDNLVGEAASMDIATRENMETLVQI  364

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
            G  LL KP+ ++NL TG+ EPV   GTN+ A+ R A LLSEER+ R
Sbjct  365  GNGLLKKPISRVNLETGRYEPVVGEGTNEAAMVRFAQLLSEERKLR  410


 Score = 60.8 bits (146),  Expect(2) = 9e-15, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 35/54 (65%), Gaps = 0/54 (0%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAGIFEVVRDATSLLAGPK*DGNPL  536
            +AP+K+ RPLY  K+I  FY +HGP+IFP +     +R  T+L  GPK DG  L
Sbjct  92   TAPNKDNRPLYQAKEISSFYMQHGPQIFPQSRRNSFLRRVTNLFGGPKYDGKYL  145


 Score = 47.8 bits (112),  Expect(2) = 9e-15, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = -3

Query  878  GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            G ++T+LSIDGGGIRGIIPGT++A+LE +LQ LDGP+AR ADYFDV+
Sbjct  32   GKMVTVLSIDGGGIRGIIPGTLLAFLESKLQELDGPNARVADYFDVV  78



>ref|XP_010238243.1| PREDICTED: patatin-like protein 2 isoform X3 [Brachypodium distachyon]
Length=331

 Score =   102 bits (255),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 62/110 (56%), Positives = 79/110 (72%), Gaps = 6/110 (5%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            PL+D+F+ ASADMVD HIA +F+AL +  NYLRIQ+D L+G+ +SVDV TK+NL+ L  V
Sbjct  218  PLVDIFTRASADMVDIHIAAVFKALHSEQNYLRIQDDTLQGTLSSVDVATKDNLEKLVNV  277

Query  361  GkklltkpvlklnlLTGKNEPVPKAG----TNKDALKRLAGLLSEERRRR  224
            G+ LL K V + NL TG  + VP  G    TN+ AL+R A LLSEERR R
Sbjct  278  GEMLLKKSVSRANLETG--QMVPTCGDSEMTNEKALERFANLLSEERRIR  325


 Score = 55.5 bits (132),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 36/58 (62%), Gaps = 1/58 (2%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPSA-GIFEVVRDATSLLAGPK*DGNPLIDV  527
            +AP+K++RPL+A KDI  FY +H PKIFP   G F  +      L+GP  DG  L +V
Sbjct  3    TAPNKDRRPLFAAKDIQAFYMDHAPKIFPQLRGAFGRIMKVLRSLSGPSYDGKYLHEV  60



>gb|EMS54202.1| Patatin group A-3 [Triticum urartu]
Length=591

 Score =   105 bits (261),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 61/106 (58%), Positives = 76/106 (72%), Gaps = 0/106 (0%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            P+ID FS ASAD+VD H + +FQAL     YLRIQ+D+LKG TASVDV+T ENL+ L +V
Sbjct  477  PIIDSFSQASADLVDIHASVLFQALHCEKRYLRIQDDELKGETASVDVSTPENLNRLVDV  536

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
            GK LL + V K+N  TGKNEP    GTN++ L   A +LSEER+ R
Sbjct  537  GKALLKRQVCKVNAETGKNEPDQNRGTNQEELVNFARMLSEERKAR  582


 Score = 47.8 bits (112),  Expect(2) = 9e-10, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 47/53 (89%), Gaps = 2/53 (4%)
 Frame = -3

Query  890  SIPP--GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            S PP  G ++T+LSIDGGG+RGIIPGTI+A+LEE+LQ LDGP+AR +DYFDVI
Sbjct  208  SPPPSYGSIVTVLSIDGGGVRGIIPGTILAFLEEKLQELDGPEARISDYFDVI  260


 Score = 43.9 bits (102),  Expect(2) = 9e-10, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 21/31 (68%), Gaps = 0/31 (0%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPSA  605
            SAPD   RPL+A KDI  FY +H P IFP A
Sbjct  274  SAPDDAGRPLFAAKDINQFYLDHCPNIFPQA  304



>gb|KJB58444.1| hypothetical protein B456_009G210400 [Gossypium raimondii]
Length=417

 Score =   103 bits (257),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 63/110 (57%), Positives = 84/110 (76%), Gaps = 1/110 (1%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            PLIDVF  AS+DMVD+H AT+F+AL++  +YLRIQ+D L G+ ASVD+ TKENL+ L +V
Sbjct  300  PLIDVFMQASSDMVDFHNATVFKALKSEKSYLRIQDDTLSGTVASVDIATKENLENLVKV  359

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRRTIAA  212
            G+ LL KPV K+NL  GK EP    GTN++AL RLA +LS+E+R R + +
Sbjct  360  GESLLKKPVSKVNLENGKFEPS-NQGTNEEALVRLAQVLSKEKRLRDMTS  408


 Score = 51.2 bits (121),  Expect(2) = 1e-10, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 28/50 (56%), Gaps = 1/50 (2%)
 Frame = -1

Query  691  PDKNKRPLYAGKDIVPFYKEHGPKIFPS-AGIFEVVRDATSLLAGPK*DG  545
            P+   RPL+A KDI  FY EH PKIFP     F    +   LL GPK DG
Sbjct  88   PNNGNRPLFAAKDISDFYLEHCPKIFPQDCTPFAPATNLVKLLTGPKYDG  137


 Score = 43.1 bits (100),  Expect(2) = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/47 (74%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = -3

Query  878  GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            G +IT+LSIDGGGIRG+IPGTI+A+LE +LQ LDG +AR ADYFDVI
Sbjct  24   GNLITVLSIDGGGIRGLIPGTILAFLESQLQKLDGEEARLADYFDVI  70



>emb|CBI19551.3| unnamed protein product [Vitis vinifera]
Length=216

 Score = 85.9 bits (211),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 63/166 (38%), Positives = 90/166 (54%), Gaps = 36/166 (22%)
 Frame = -1

Query  697  SAPDKNK-RPLYAGKDIVPFYKEHGPKIFPSAGIFEVVRDATSLLAGPK*DGNPLIDVFS  521
            + P++N  RPL++ KDI  FY +H PKIFP                              
Sbjct  75   TTPNENTGRPLFSAKDIKDFYLDHCPKIFPQH----------------------------  106

Query  520  VASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltk  341
              S D + +    +FQA  +  +YLRIQ+D L G T+SVD+ TKENLD L ++G++LL K
Sbjct  107  --SHDPIPH----LFQAFHSEKSYLRIQDDTLSGITSSVDIATKENLDDLVKIGEELLKK  160

Query  340  pvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRRTIAALNG  203
             V ++NL TG  EP     TN++AL   A LLS+E++RR   + +G
Sbjct  161  RVSRVNLDTGIFEPS-NHETNEEALTSFARLLSQEKQRRDTRSPHG  205


 Score = 45.1 bits (105),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 43/51 (84%), Gaps = 2/51 (4%)
 Frame = -3

Query  884  PP--GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            PP  G +ITILSIDGGGIRG+IPGT++ +LE ELQ LDG DAR +DYFDVI
Sbjct  11   PPTYGNLITILSIDGGGIRGLIPGTVLGFLESELQKLDGEDARISDYFDVI  61



>ref|XP_004973692.1| PREDICTED: patatin-3-Kuras 1-like [Setaria italica]
Length=401

 Score =   103 bits (256),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 61/139 (44%), Positives = 88/139 (63%), Gaps = 11/139 (8%)
 Frame = -1

Query  637  KEHGPKIFPSAGIFE-VVRDATSLLAGPK*DGNPLIDVFSVASADMVDYHIATIFQALQA  461
            +++  K     GIF  +++D T+          P+ID+F+ AS DMVD H+  +F+AL++
Sbjct  268  RKYSAKAAAKWGIFNWLIKDGTA----------PIIDMFNSASGDMVDIHLCVLFRALRS  317

Query  460  GDNYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnlLTGKNEPVPKAGT  281
              NYLRIQ D L GS  S+D  +KEN+D L ++GK LL + V +++L TG+N  VP  GT
Sbjct  318  SRNYLRIQYDQLTGSAGSIDDCSKENMDKLVKIGKDLLGQTVSRVDLETGRNVDVPGEGT  377

Query  280  NKDALKRLAGLLSEERRRR  224
            N + L + A  LSEERRRR
Sbjct  378  NAEQLAKFAKQLSEERRRR  396


 Score = 49.3 bits (116),  Expect(2) = 3e-11, Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 34/66 (52%), Gaps = 1/66 (2%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAG-IFEVVRDATSLLAGPK*DGNPLIDVFS  521
            +AP KN RPL+  KD+  FY +H PKIFP    I   +     ++ GPK DG  L  +  
Sbjct  78   AAPGKNGRPLFNAKDLAQFYIDHSPKIFPQKNWILSKIFGTLRMVRGPKYDGKYLHALLG  137

Query  520  VASADM  503
                DM
Sbjct  138  QYLGDM  143


 Score = 47.8 bits (112),  Expect(2) = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = -3

Query  872  VITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            ++T+LSIDGGG+RGIIP  ++A+LEE+LQ LDGPDAR ADYFDVI
Sbjct  20   LVTVLSIDGGGVRGIIPAVVLAFLEEKLQELDGPDARIADYFDVI  64



>gb|KGN62540.1| hypothetical protein Csa_2G360570 [Cucumis sativus]
Length=321

 Score =   102 bits (254),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 62/107 (58%), Positives = 78/107 (73%), Gaps = 1/107 (1%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            P+IDVFS AS+DMVD+H++ IFQAL   DNYLRIQ+D L G  +SVDV T++NL+ L +V
Sbjct  192  PIIDVFSQASSDMVDFHLSVIFQALHCEDNYLRIQDDTLSGDLSSVDVATQKNLNDLVKV  251

Query  361  GkklltkpvlklnlLTGKNEPVPK-AGTNKDALKRLAGLLSEERRRR  224
            G+ LL KPV ++NL TG  E  P  + TN  AL R A LLS+ERR R
Sbjct  252  GESLLKKPVSRVNLQTGVFEDCPSNSETNDQALTRFAKLLSDERRLR  298



>ref|XP_008241509.1| PREDICTED: patatin-like protein 3 [Prunus mume]
Length=405

 Score =   103 bits (256),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 78/107 (73%), Gaps = 0/107 (0%)
 Frame = -1

Query  544  NPLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEE  365
            +PL++ F  ASA MVDYH + +FQAL + +NYLRI+ED LKG+ AS D  T+ENL+ L E
Sbjct  291  SPLLECFDEASACMVDYHNSVVFQALHSEENYLRIEEDTLKGNLASADKATQENLENLVE  350

Query  364  VGkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
            VG +LL KP+  ++L TG  EPV   GTN+ AL+R A LLS+E++ R
Sbjct  351  VGNQLLQKPISTMDLDTGLYEPVENGGTNQQALQRFAKLLSDEKKLR  397


 Score = 59.3 bits (142),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 35/52 (67%), Gaps = 1/52 (2%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPSA-GIFEVVRDATSLLAGPK*DG  545
            +AP+ N RPLYA KDIVPFY ++ PKIFP   G+   + +   +L GPK DG
Sbjct  77   AAPNDNNRPLYAAKDIVPFYLDNCPKIFPQPRGLCAQIVELVKVLTGPKYDG  128


 Score = 48.1 bits (113),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 43/51 (84%), Gaps = 2/51 (4%)
 Frame = -3

Query  884  PP--GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            PP  G +IT+LSIDGGGIRGIIPG ++AYLE +LQ LDG DAR ADYFDVI
Sbjct  13   PPKYGNLITVLSIDGGGIRGIIPGVLLAYLESQLQELDGEDARLADYFDVI  63



>ref|XP_008393826.1| PREDICTED: patatin-like protein 2 [Malus domestica]
Length=415

 Score =   103 bits (256),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 61/113 (54%), Positives = 86/113 (76%), Gaps = 1/113 (1%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            PLIDVF+ AS+DMVD+H+AT+FQAL    +YLRIQ+D L+ + +SVD+ TKENLD L +V
Sbjct  296  PLIDVFTQASSDMVDFHLATVFQALNCEKSYLRIQDDTLEKTVSSVDIATKENLDNLVKV  355

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRRTIAALNG  203
            G+KLL KPV ++N+ TG  EP  ++ TN++AL R+A +LS ER+ R   + +G
Sbjct  356  GEKLLKKPVSRVNMDTGAFEPAHQS-TNEEALVRIARILSRERKVRETQSPHG  407


 Score = 52.4 bits (124),  Expect(2) = 5e-12, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 34/59 (58%), Gaps = 2/59 (3%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFP--SAGIFEVVRDATSLLAGPK*DGNPLIDV  527
            + PD+N RPL++ KDI  FY EH PKIFP  SA +     D    L GPK D   L ++
Sbjct  80   TTPDENNRPLFSAKDINAFYLEHCPKIFPQDSAPLIGEAVDMVKNLTGPKYDXKYLHNI  138


 Score = 47.0 bits (110),  Expect(2) = 5e-12, Method: Compositional matrix adjust.
 Identities = 36/47 (77%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = -3

Query  878  GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            G ++T+LSIDGGGIRGIIPGTI+++LE ELQ LDG DAR ADYFDVI
Sbjct  20   GNLVTVLSIDGGGIRGIIPGTILSFLESELQKLDGEDARLADYFDVI  66



>gb|KGN62057.1| Patatin-like protein [Cucumis sativus]
Length=126

 Score = 97.8 bits (242),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 56/106 (53%), Positives = 77/106 (73%), Gaps = 0/106 (0%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            P++D+FS ASADMVDYHI++IFQ+     NYLRIQ+D L G  +SVD+ T++NL  L EV
Sbjct  18   PIVDIFSDASADMVDYHISSIFQSEHNDRNYLRIQDDTLSGDVSSVDIATQQNLLKLIEV  77

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
            G+ LL KP+ ++NL +GK E +   GTN+ AL   A +LS+ER+ R
Sbjct  78   GESLLKKPLSRVNLESGKFEALDGEGTNEKALAEFAQMLSDERKLR  123



>ref|XP_010926367.1| PREDICTED: patatin-like protein 2 [Elaeis guineensis]
Length=402

 Score =   102 bits (255),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 61/106 (58%), Positives = 79/106 (75%), Gaps = 0/106 (0%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            P+ID+FS +SADMVD H + +FQAL++  NYLRIQ+D L+G TASVDV+T ENL  L +V
Sbjct  290  PIIDIFSQSSADMVDIHASILFQALRSEKNYLRIQDDTLEGDTASVDVSTSENLRKLVQV  349

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
            G+ LL KPV ++NL TG +E     GTN+DAL R A +LS ER+ R
Sbjct  350  GQDLLKKPVSRVNLETGVSEACDVEGTNEDALIRFAKMLSNERKSR  395


 Score = 50.4 bits (119),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 34/52 (65%), Gaps = 1/52 (2%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPS-AGIFEVVRDATSLLAGPK*DG  545
            +AP+K+ RPL++ KDI+ FY E+ PKIFP   G+     +    ++GPK DG
Sbjct  76   TAPNKDNRPLFSAKDIIQFYLENCPKIFPQRTGLLAGALNLFGAVSGPKYDG  127


 Score = 46.6 bits (109),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 47/58 (81%), Gaps = 2/58 (3%)
 Frame = -3

Query  905  EYNAASIPP--GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            E   A+ PP  G V+TILSIDGGG+RGIIPGTI+ +LE +LQ LDGPDAR ADYFD+I
Sbjct  5    ESPVANPPPCKGKVVTILSIDGGGVRGIIPGTILEFLEAKLQELDGPDARIADYFDII  62



>ref|XP_003576611.1| PREDICTED: patatin-like protein 2 isoform X1 [Brachypodium distachyon]
Length=404

 Score =   102 bits (255),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 62/110 (56%), Positives = 79/110 (72%), Gaps = 6/110 (5%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            PL+D+F+ ASADMVD HIA +F+AL +  NYLRIQ+D L+G+ +SVDV TK+NL+ L  V
Sbjct  291  PLVDIFTRASADMVDIHIAAVFKALHSEQNYLRIQDDTLQGTLSSVDVATKDNLEKLVNV  350

Query  361  GkklltkpvlklnlLTGKNEPVPKAG----TNKDALKRLAGLLSEERRRR  224
            G+ LL K V + NL TG+   VP  G    TN+ AL+R A LLSEERR R
Sbjct  351  GEMLLKKSVSRANLETGQM--VPTCGDSEMTNEKALERFANLLSEERRIR  398


 Score = 55.8 bits (133),  Expect(2) = 6e-13, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 36/58 (62%), Gaps = 1/58 (2%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPSA-GIFEVVRDATSLLAGPK*DGNPLIDV  527
            +AP+K++RPL+A KDI  FY +H PKIFP   G F  +      L+GP  DG  L +V
Sbjct  76   TAPNKDRRPLFAAKDIQAFYMDHAPKIFPQLRGAFGRIMKVLRSLSGPSYDGKYLHEV  133


 Score = 46.6 bits (109),  Expect(2) = 6e-13, Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 42/58 (72%), Gaps = 2/58 (3%)
 Frame = -3

Query  905  EYNAASIPPGGV--ITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            ++N    PP  V  IT+LSIDGGGIRGII    +A+LE ELQ LDG +AR ADYFDVI
Sbjct  5    KHNLCRQPPTYVNLITVLSIDGGGIRGIIAAVALAFLETELQKLDGEEARLADYFDVI  62



>ref|XP_007160830.1| hypothetical protein PHAVU_001G020100g [Phaseolus vulgaris]
 gb|ESW32824.1| hypothetical protein PHAVU_001G020100g [Phaseolus vulgaris]
Length=407

 Score =   102 bits (255),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 80/108 (74%), Gaps = 0/108 (0%)
 Frame = -1

Query  547  GNPLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALE  368
            GNPLID FS AS+DMVD+HI+++FQA ++  NYLRIQ+D L G  +SVD+ T++NL  L 
Sbjct  292  GNPLIDAFSHASSDMVDFHISSVFQARRSEHNYLRIQDDTLTGDLSSVDMATEKNLKGLV  351

Query  367  EVGkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
            +V ++LL KPV K+NL+TG +EP     TN DALKR A  LS +RR R
Sbjct  352  QVAEELLKKPVSKINLMTGIHEPADSHETNADALKRFAERLSRQRRFR  399


 Score = 55.1 bits (131),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 34/57 (60%), Gaps = 3/57 (5%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAGIFEVVRDATSL---LAGPK*DGNPL  536
            +AP++N RPLYA KDI  FY EH PKIFP    + ++     L   L GP+ DG  L
Sbjct  78   TAPNENNRPLYAAKDIKDFYLEHTPKIFPQNKGWNLISSVMKLSRTLLGPQYDGKYL  134


 Score = 45.8 bits (107),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/47 (74%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = -3

Query  878  GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            G ++T+LSIDGGGIRGIIPG I+ +LE ELQ LDG DAR ADYFDVI
Sbjct  18   GHMVTLLSIDGGGIRGIIPGVILGFLESELQKLDGDDARLADYFDVI  64



>ref|XP_009792908.1| PREDICTED: patatin-like protein 1 [Nicotiana sylvestris]
Length=406

 Score =   102 bits (255),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 61/109 (56%), Positives = 79/109 (72%), Gaps = 0/109 (0%)
 Frame = -1

Query  550  DGNPLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDAL  371
            +  P+ID F+ ASADMVDYH   +F+AL + D YLRIQ+D L G+ ASVD+ TKENL +L
Sbjct  289  NSTPIIDAFNQASADMVDYHNFVVFKALHSDDKYLRIQDDTLTGNLASVDIATKENLQSL  348

Query  370  EEVGkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
             +VG+ LL KPV K+NL  G  E V   GTNK+AL+R A +LS+ER+ R
Sbjct  349  VKVGEHLLEKPVSKINLDKGVYEAVENGGTNKEALQRFAKILSDERKFR  397


 Score = 63.2 bits (152),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 36/55 (65%), Gaps = 1/55 (2%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPS-AGIFEVVRDATSLLAGPK*DGNPL  536
            +AP+K+KRPLYA KDI PFY EH PKIFP   G    + + T  + GPK DG  L
Sbjct  78   AAPNKDKRPLYAAKDITPFYLEHSPKIFPQMGGPLAGIINLTKAMGGPKYDGKYL  132



>ref|XP_011649370.1| PREDICTED: patatin-like protein 3 [Cucumis sativus]
Length=392

 Score =   102 bits (255),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 58/108 (54%), Positives = 77/108 (71%), Gaps = 0/108 (0%)
 Frame = -1

Query  547  GNPLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALE  368
            G P++D+FS ASADMVDYHI++IFQ+     NYLRIQ+D L G  +SVD+ T+ENL  L 
Sbjct  282  GTPIVDIFSDASADMVDYHISSIFQSDHCHKNYLRIQDDTLSGEVSSVDIATEENLLNLI  341

Query  367  EVGkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
             VG+ LL KP+ ++NL +GK EP+   GTN+ AL   A +LS ER+ R
Sbjct  342  YVGENLLKKPLSRVNLESGKFEPLDAKGTNEQALAEFAKMLSNERKLR  389


 Score = 51.6 bits (122),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 31/52 (60%), Gaps = 1/52 (2%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAGIFEV-VRDATSLLAGPK*DG  545
            +APDKN RPLY+  D+  FY EH PKIFP    F   + +    + GPK +G
Sbjct  68   TAPDKNNRPLYSASDLALFYIEHAPKIFPQRNYFLCSLVNFFGKVMGPKYNG  119


 Score = 49.3 bits (116),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = -3

Query  896  AASIPPGGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
             A    G +ITILSIDGGGIRGIIP  I+A+LE +LQ LDGPD R ADYFDVI
Sbjct  2    VADFAKGKMITILSIDGGGIRGIIPSIILAFLESKLQELDGPDVRIADYFDVI  54



>emb|CAA73328.1| patatin-like protein [Cucumis sativus]
Length=405

 Score =   102 bits (255),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 58/108 (54%), Positives = 77/108 (71%), Gaps = 0/108 (0%)
 Frame = -1

Query  547  GNPLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALE  368
            G P++D+FS ASADMVDYHI++IFQ+     NYLRIQ+D L G  +SVD+ T+ENL  L 
Sbjct  295  GTPIVDIFSDASADMVDYHISSIFQSDHCHKNYLRIQDDTLSGEVSSVDIATEENLLNLI  354

Query  367  EVGkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
             VG+ LL KP+ ++NL +GK EP+   GTN+ AL   A +LS ER+ R
Sbjct  355  YVGENLLKKPLSRVNLESGKFEPLDAKGTNEQALAEFAKMLSNERKLR  402


 Score = 51.6 bits (122),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 31/52 (60%), Gaps = 1/52 (2%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAGIFEV-VRDATSLLAGPK*DG  545
            +APDKN RPLY+  D+  FY EH PKIFP    F   + +    + GPK +G
Sbjct  81   TAPDKNNRPLYSASDLALFYIEHAPKIFPQRNYFLCSLVNFFGKVMGPKYNG  132


 Score = 49.3 bits (116),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = -3

Query  896  AASIPPGGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
             A    G +ITILSIDGGGIRGIIP  I+A+LE +LQ LDGPD R ADYFDVI
Sbjct  15   VADFAKGKMITILSIDGGGIRGIIPSIILAFLESKLQELDGPDVRIADYFDVI  67



>ref|XP_003572284.1| PREDICTED: patatin-like protein 2 [Brachypodium distachyon]
Length=429

 Score =   103 bits (256),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 59/106 (56%), Positives = 77/106 (73%), Gaps = 0/106 (0%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            P+ID FS AS+D+VD H + +FQAL     YLRIQ+D+LKG TASVDV+  ENL+ L +V
Sbjct  316  PIIDSFSQASSDLVDIHASVLFQALHCEKRYLRIQDDELKGETASVDVSAPENLNRLVDV  375

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
            GK LL + + K+N+ TGKNEP  K GTN++ L   A +LSEER+ R
Sbjct  376  GKALLKRKMCKVNVETGKNEPDLKRGTNEEELIHFAKMLSEERKAR  421


 Score = 48.1 bits (113),  Expect(2) = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/47 (77%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = -3

Query  878  GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            G ++T+LSIDGGG+RGIIPGTI+A+LEE+LQ LDGP+AR ADYFDVI
Sbjct  44   GSIVTVLSIDGGGVRGIIPGTILAFLEEKLQELDGPEARIADYFDVI  90


 Score = 46.6 bits (109),  Expect(2) = 1e-10, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 35/54 (65%), Gaps = 7/54 (13%)
 Frame = -1

Query  697  SAP-DKNKRPLYAGKDIVPFYKEHGPKIFP--SAGIFEVVRDATSLLAGPK*DG  545
            +AP D + RPL+A KDI  FY +H PKIFP  S G F +++     +AGPK DG
Sbjct  104  TAPNDVDGRPLFAAKDINSFYLDHCPKIFPPISKGPFGLLKS----MAGPKYDG  153



>ref|XP_007222710.1| hypothetical protein PRUPE_ppa006466mg [Prunus persica]
 gb|EMJ23909.1| hypothetical protein PRUPE_ppa006466mg [Prunus persica]
Length=410

 Score =   102 bits (255),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 62/115 (54%), Positives = 83/115 (72%), Gaps = 1/115 (1%)
 Frame = -1

Query  547  GNPLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALE  368
            G P+IDVFS +SADMVDYH++ +FQAL + +NYLRIQ+D L G  +SVD+  K+NLD L 
Sbjct  288  GTPIIDVFSQSSADMVDYHLSVVFQALHSENNYLRIQDDTLTGHVSSVDIADKKNLDDLL  347

Query  367  EVGkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRRTIAALNG  203
             VG+ LL KPV ++NL TG+ EP  K  +N++AL R A LLSEE+  R   + +G
Sbjct  348  IVGEGLLKKPVSRVNLETGRVEPS-KHESNEEALTRFAKLLSEEKWLRLARSPHG  401


 Score = 53.9 bits (128),  Expect(2) = 5e-12, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 33/59 (56%), Gaps = 2/59 (3%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPS--AGIFEVVRDATSLLAGPK*DGNPLIDV  527
            + PD+N RP++A KDI  FY  H PKIFP     IF         LAGPK DG  L D+
Sbjct  75   ATPDENNRPVFAAKDIKDFYLTHCPKIFPQKHCPIFPYTTKIIKALAGPKYDGKYLHDL  133


 Score = 45.4 bits (106),  Expect(2) = 5e-12, Method: Compositional matrix adjust.
 Identities = 37/47 (79%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = -3

Query  878  GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            G +IT+LSIDGGGIRG+IPGTI+ YLE ELQ LDG DAR ADYFDVI
Sbjct  15   GNLITVLSIDGGGIRGLIPGTILGYLEAELQKLDGEDARIADYFDVI  61



>gb|EMS52853.1| Patatin group M-3 [Triticum urartu]
Length=411

 Score =   102 bits (255),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 59/106 (56%), Positives = 75/106 (71%), Gaps = 0/106 (0%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            PLID+FS ASADMVD H A +FQAL    NYLRIQ+D L G T+SVD++TK N++AL  +
Sbjct  297  PLIDIFSHASADMVDIHAAILFQALNIEKNYLRIQDDSLTGHTSSVDISTKANMEALIGI  356

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
            G  LL K V ++N+ TG  EPV   GTN++AL   A  LS+ER+ R
Sbjct  357  GNMLLKKKVARVNIDTGVYEPVDNEGTNEEALAHFAKKLSDERKLR  402


 Score = 51.2 bits (121),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 37/67 (55%), Gaps = 2/67 (3%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPS--AGIFEVVRDATSLLAGPK*DGNPLIDVF  524
            +AP +NKRPL+  KDI  FY E+GPKIFP    G    + +    + GPK DG  L D  
Sbjct  80   AAPGENKRPLFEAKDINTFYLENGPKIFPQRRLGFLTPMANLFGAVKGPKYDGKFLHDKI  139

Query  523  SVASADM  503
               + D+
Sbjct  140  KCLTNDV  146


 Score = 35.4 bits (80),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 15/17 (88%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = -3

Query  788  QALDGPDARAADYFDVI  738
            Q LDGPDAR ADYFDVI
Sbjct  50   QELDGPDARIADYFDVI  66



>gb|KJB29508.1| hypothetical protein B456_005G104200 [Gossypium raimondii]
Length=401

 Score =   102 bits (254),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 79/115 (69%), Gaps = 0/115 (0%)
 Frame = -1

Query  550  DGNPLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDAL  371
            +  PLI+ FS  SADMVD+HI+ IF++L +  NYLRIQ+D LKG  +SVDV+T+EN+  L
Sbjct  287  NSTPLINAFSEGSADMVDFHISVIFKSLNSEQNYLRIQDDKLKGEVSSVDVSTEENMKIL  346

Query  370  EEVGkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRRTIAALN  206
             +V + LL KPV ++N  TG  EP     TN  AL R A LLSEE+RRR   +L+
Sbjct  347  AKVAENLLNKPVSRVNFETGNYEPSGDLETNAQALIRYAKLLSEEKRRRLKTSLH  401


 Score = 52.8 bits (125),  Expect(2) = 3e-11, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 33/59 (56%), Gaps = 1/59 (2%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAGI-FEVVRDATSLLAGPK*DGNPLIDVF  524
            ++P++  RPL+A KDI  FY EHGPKIFP     F  V      + GPK DG  L  V 
Sbjct  75   TSPNEKNRPLFAAKDIKAFYFEHGPKIFPQRRFPFSGVTKIIQSVMGPKYDGKYLHGVL  133


 Score = 43.5 bits (101),  Expect(2) = 3e-11, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 42/51 (82%), Gaps = 2/51 (4%)
 Frame = -3

Query  884  PP--GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            PP  G +IT+LSIDGGGIRGIIPG I+++LE ELQ LD  +AR ADYFDVI
Sbjct  11   PPCHGDLITVLSIDGGGIRGIIPGIILSFLESELQKLDSEEARIADYFDVI  61



>ref|XP_008393827.1| PREDICTED: patatin-like protein 2 isoform X1 [Malus domestica]
Length=407

 Score =   102 bits (254),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 60/108 (56%), Positives = 81/108 (75%), Gaps = 1/108 (1%)
 Frame = -1

Query  547  GNPLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALE  368
            G P+IDVFS +S+DMVDYH++ +FQAL + +NYLRIQ+D L G  +SVD+  K+NLD L 
Sbjct  288  GTPIIDVFSQSSSDMVDYHLSVVFQALHSENNYLRIQDDTLTGQVSSVDIADKKNLDDLL  347

Query  367  EVGkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
            +VG+ LL KPV ++NL TG+ EP  K  +N++AL R A LLSEE+  R
Sbjct  348  KVGEGLLKKPVSRVNLETGRVEPS-KHESNEEALTRFAKLLSEEKWLR  394


 Score = 49.7 bits (117),  Expect(2) = 4e-11, Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 33/59 (56%), Gaps = 2/59 (3%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPS--AGIFEVVRDATSLLAGPK*DGNPLIDV  527
            + PD N RP+++ KDI  FY  H PKIFP     +F  +      L+GPK DG  L D+
Sbjct  75   ATPDDNNRPVFSAKDIKDFYLTHCPKIFPQKHCPLFPKMTKIIKALSGPKYDGKYLHDL  133


 Score = 46.6 bits (109),  Expect(2) = 4e-11, Method: Compositional matrix adjust.
 Identities = 38/47 (81%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = -3

Query  878  GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            G +ITILSIDGGGIRG+IPGTI+ YLE ELQ LDG DAR ADYFDVI
Sbjct  15   GNLITILSIDGGGIRGLIPGTILGYLESELQKLDGEDARIADYFDVI  61



>ref|XP_009367378.1| PREDICTED: patatin-like protein 2 [Pyrus x bretschneideri]
Length=407

 Score =   102 bits (254),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 60/108 (56%), Positives = 81/108 (75%), Gaps = 1/108 (1%)
 Frame = -1

Query  547  GNPLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALE  368
            G P+IDVFS +S+DMVDYH++ +FQAL + +NYLRIQ+D L G  +SVD+  K+NLD L 
Sbjct  288  GTPIIDVFSQSSSDMVDYHLSVVFQALHSENNYLRIQDDTLTGQVSSVDIADKKNLDDLL  347

Query  367  EVGkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
            +VG+ LL KPV ++NL TG+ EP  K  +N++AL R A LLSEE+  R
Sbjct  348  KVGEGLLKKPVSRVNLETGRVEPS-KHESNEEALTRFAKLLSEEKWLR  394


 Score = 50.4 bits (119),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 33/59 (56%), Gaps = 2/59 (3%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPS--AGIFEVVRDATSLLAGPK*DGNPLIDV  527
            + PD N RP++A KDI  FY  H PKIFP     +F  +      L+GPK DG  L D+
Sbjct  75   ATPDDNNRPVFAAKDIKDFYLTHCPKIFPQKHCPLFPKMTKIIKALSGPKYDGKYLHDL  133


 Score = 46.6 bits (109),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/47 (81%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = -3

Query  878  GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            G +ITILSIDGGGIRG+IPGTI+ YLE ELQ LDG DAR ADYFDVI
Sbjct  15   GNLITILSIDGGGIRGLIPGTILGYLESELQKLDGEDARIADYFDVI  61



>ref|XP_010525997.1| PREDICTED: patatin-like protein 2 [Tarenaya hassleriana]
Length=406

 Score =   102 bits (254),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 60/116 (52%), Positives = 84/116 (72%), Gaps = 1/116 (1%)
 Frame = -1

Query  550  DGNPLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDAL  371
            +  PLID F  AS+DMVD+H++T+FQAL +  NYLRIQ+D L G  +SVD+ TKENLD L
Sbjct  286  NSTPLIDTFMQASSDMVDFHLSTVFQALHSDPNYLRIQDDTLTGDASSVDIATKENLDTL  345

Query  370  EEVGkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRRTIAALNG  203
             + G++LL KP+ K+NL TG NE   +  TN+ AL +LAG+LS E++ R + + +G
Sbjct  346  VKTGEQLLKKPISKVNLETGSNENAYEM-TNEKALIKLAGILSREKKLRVMRSPHG  400


 Score = 51.6 bits (122),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 31/55 (56%), Gaps = 1/55 (2%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAGI-FEVVRDATSLLAGPK*DGNPL  536
            +AP+K  RPL+A  +I  FY EH PKIFP     F   ++    L GPK DG  L
Sbjct  74   TAPNKQGRPLFAASEIKDFYLEHCPKIFPQEHFPFSAAKNLVKTLTGPKYDGKYL  128


 Score = 45.8 bits (107),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 43/51 (84%), Gaps = 2/51 (4%)
 Frame = -3

Query  884  PP--GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            PP  G +IT+LSIDGGGIRGIIP TI+++LE ELQ LDG +AR ADYFDVI
Sbjct  10   PPTYGSLITVLSIDGGGIRGIIPATILSFLESELQKLDGEEARLADYFDVI  60



>ref|XP_007160175.1| hypothetical protein PHAVU_002G299200g [Phaseolus vulgaris]
 gb|ESW32169.1| hypothetical protein PHAVU_002G299200g [Phaseolus vulgaris]
Length=282

 Score =   100 bits (250),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 56/106 (53%), Positives = 76/106 (72%), Gaps = 0/106 (0%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            PL DVF+ +SA MVD+H++ + QAL + DNYLRIQ+D L G+ +SVD+ TKENL  L E+
Sbjct  163  PLTDVFTQSSAYMVDFHLSAVTQALHSEDNYLRIQDDTLNGTDSSVDIATKENLQKLCEI  222

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
            G+ LL K V ++NL+ G  EP+    TN+ AL R A +LS+ERR R
Sbjct  223  GQNLLKKSVSRVNLVNGVFEPLANGETNQQALTRFAKILSQERRLR  268



>ref|XP_011071103.1| PREDICTED: patatin-like protein 2 [Sesamum indicum]
 ref|XP_011071104.1| PREDICTED: patatin-like protein 2 [Sesamum indicum]
Length=408

 Score =   102 bits (254),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 79/106 (75%), Gaps = 1/106 (1%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            PL DVF+ AS+DMVD+H  T FQAL + +NYLRIQ+D L G+ +SVDV TKENL+ L + 
Sbjct  290  PLFDVFNRASSDMVDFHTTTFFQALHSQNNYLRIQDDTLTGAMSSVDVATKENLEDLVKA  349

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
            G+KLL KPV ++N  TG  EP    GTN++AL RLA LLS+E+R R
Sbjct  350  GEKLLKKPVSRVNWETGIYEP-SNQGTNEEALIRLAELLSKEKRLR  394


 Score = 42.7 bits (99),  Expect(2) = 4e-07, Method: Compositional matrix adjust.
 Identities = 22/53 (42%), Positives = 32/53 (60%), Gaps = 3/53 (6%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFP--SAGIFEVVRDATSLLAGPK*DG  545
            +AP+++ RP++A KDI  FY +  PKIFP  S  +    +   S  +GPK DG
Sbjct  76   TAPNEDNRPMFAAKDIKAFYLDECPKIFPQQSHALGHAAKVIKS-FSGPKYDG  127


 Score = 40.0 bits (92),  Expect(2) = 4e-07, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = -3

Query  878  GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            G +I ILSIDGGGIRGIIPG I+A+LE  LQ LD  +AR ADYFDVI
Sbjct  16   GKLIRILSIDGGGIRGIIPGVILAFLESRLQMLDSEEARLADYFDVI  62



>ref|XP_002445641.1| hypothetical protein SORBIDRAFT_07g023230 [Sorghum bicolor]
 gb|EES15136.1| hypothetical protein SORBIDRAFT_07g023230 [Sorghum bicolor]
Length=382

 Score =   102 bits (253),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 58/110 (53%), Positives = 78/110 (71%), Gaps = 1/110 (1%)
 Frame = -1

Query  550  DGN-PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDA  374
            DGN P+ID+F+ ASADMVD ++  +F+AL +  NYLRIQ D L GS  S+D  +KEN+D 
Sbjct  268  DGNAPIIDMFNSASADMVDINLCVLFRALHSSQNYLRIQYDQLTGSAGSIDDCSKENMDK  327

Query  373  LEEVGkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
            L ++GK LL + V +++L TGKN  VP  GTN + L + A  LS+ERRRR
Sbjct  328  LVQIGKDLLGQNVSRVDLETGKNVDVPGVGTNAEQLAKFAKQLSDERRRR  377


 Score = 50.4 bits (119),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 25/66 (38%), Positives = 35/66 (53%), Gaps = 1/66 (2%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPSA-GIFEVVRDATSLLAGPK*DGNPLIDVFS  521
            +APD+N RPL+  K++  FY +H PKIFP    I   +     ++ GPK DG  L  +  
Sbjct  78   TAPDQNGRPLFDAKNLAQFYIDHSPKIFPQKNWILSKIASTLRMVRGPKYDGKYLHSLLR  137

Query  520  VASADM  503
                DM
Sbjct  138  QYLGDM  143


 Score = 47.0 bits (110),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/45 (76%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = -3

Query  872  VITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            ++T+LSIDGGG+RGIIP TI+A+LEE+LQ LDGPDAR ADYFDV+
Sbjct  20   LVTVLSIDGGGVRGIIPATILAFLEEKLQELDGPDARIADYFDVV  64



>gb|EMT30617.1| Patatin group A-3 [Aegilops tauschii]
Length=408

 Score =   102 bits (253),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 59/106 (56%), Positives = 75/106 (71%), Gaps = 0/106 (0%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            PLID+FS ASADMVD H A +FQAL    NYLRIQ+D L G T+SVD++TK N++AL  +
Sbjct  294  PLIDIFSHASADMVDIHAAILFQALNIEKNYLRIQDDSLTGHTSSVDISTKANMEALIGI  353

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
            G  LL K V ++N+ TG  EPV   GTN++AL   A  LS+ER+ R
Sbjct  354  GNMLLKKKVARVNIDTGVYEPVDDEGTNEEALAHFAKKLSDERKLR  399


 Score = 49.3 bits (116),  Expect(2) = 6e-11, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 34/58 (59%), Gaps = 2/58 (3%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPSA--GIFEVVRDATSLLAGPK*DGNPLID  530
            +AP +NKRPL+  KDI  FY ++GPKIFP    G    + +    + GPK DG  L D
Sbjct  77   AAPGENKRPLFEAKDINKFYLDNGPKIFPQKRLGFLTPMANLFGAVTGPKYDGKFLHD  134


 Score = 46.2 bits (108),  Expect(2) = 6e-11, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 44/54 (81%), Gaps = 3/54 (6%)
 Frame = -3

Query  890  SIPP---GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            + PP   G +IT+LSIDGGGIRG+IP TI+A LE +LQ LDGPDAR ADYFDVI
Sbjct  10   TCPPPSQGRLITVLSIDGGGIRGLIPSTILACLESKLQELDGPDARIADYFDVI  63



>ref|XP_004152794.1| PREDICTED: patatin-like protein 2 [Cucumis sativus]
Length=416

 Score =   102 bits (254),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 62/107 (58%), Positives = 78/107 (73%), Gaps = 1/107 (1%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            P+IDVFS AS+DMVD+H++ IFQAL   DNYLRIQ+D L G  +SVDV T++NL+ L +V
Sbjct  287  PIIDVFSQASSDMVDFHLSVIFQALHCEDNYLRIQDDTLSGDLSSVDVATQKNLNDLVKV  346

Query  361  GkklltkpvlklnlLTGKNEPVPK-AGTNKDALKRLAGLLSEERRRR  224
            G+ LL KPV ++NL TG  E  P  + TN  AL R A LLS+ERR R
Sbjct  347  GESLLKKPVSRVNLQTGVFEDCPSNSETNDQALTRFAKLLSDERRLR  393


 Score = 60.1 bits (144),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 36/54 (67%), Gaps = 1/54 (2%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAGIFEVVRDATSLLAGPK*DGNPL  536
            SAPD+N RPL++ KDI  FY +H PKIFP   I+ + R    LL+GPK DG  L
Sbjct  74   SAPDQNNRPLFSAKDINQFYLDHCPKIFPQNRIWPIGR-IVKLLSGPKYDGKYL  126


 Score = 44.3 bits (103),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 42/51 (82%), Gaps = 2/51 (4%)
 Frame = -3

Query  884  PP--GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            PP  G +ITILSIDGGGIRGIIPGTI+ +LE ELQ LDG + R ADYFDVI
Sbjct  10   PPTYGNLITILSIDGGGIRGIIPGTILNFLESELQKLDGKEVRVADYFDVI  60



>ref|NP_001149326.1| patatin class 1 [Zea mays]
 gb|ACG35038.1| patatin class 1 precursor [Zea mays]
Length=423

 Score =   102 bits (254),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 55/111 (50%), Positives = 81/111 (73%), Gaps = 1/111 (1%)
 Frame = -1

Query  550  DGN-PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDA  374
            DG+ P+ID+F+ ASADMVD H+  +F+AL++ +NYLRIQ D L GS  S+D ++++N+D 
Sbjct  288  DGSAPIIDMFNSASADMVDIHLCVLFRALRSSENYLRIQYDQLTGSAGSIDDSSRKNMDR  347

Query  373  LEEVGkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRRT  221
            L  +G KLL   V ++++ TG+N  VP AGTN + L + A  LS+ERRRR+
Sbjct  348  LVRIGNKLLDMNVSRVDMETGRNVEVPGAGTNAERLAKFARQLSDERRRRS  398


 Score = 46.2 bits (108),  Expect(2) = 5e-10, Method: Compositional matrix adjust.
 Identities = 35/45 (78%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = -3

Query  872  VITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            +IT+LSIDGGGIRGIIP TI+A+LE +LQ LDGPDAR ADYFDV+
Sbjct  21   LITVLSIDGGGIRGIIPATILAFLEAKLQELDGPDARIADYFDVV  65


 Score = 46.2 bits (108),  Expect(2) = 5e-10, Method: Compositional matrix adjust.
 Identities = 23/55 (42%), Positives = 31/55 (56%), Gaps = 1/55 (2%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPSA-GIFEVVRDATSLLAGPK*DGNPL  536
            +APD N+RPL+A KD+  FY +H PKIF     +   +     +  GPK DG  L
Sbjct  79   TAPDTNERPLFAAKDLARFYIQHSPKIFRQKNAMGSKLVGKLRMACGPKYDGKYL  133



>ref|XP_011099181.1| PREDICTED: patatin-like protein 1 [Sesamum indicum]
Length=399

 Score =   102 bits (253),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 78/107 (73%), Gaps = 0/107 (0%)
 Frame = -1

Query  544  NPLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEE  365
            +PL+  ++ A+ADMVD+H A +FQAL +  NYLRIQ++ L G  +S+D+ TKENL+ L +
Sbjct  285  SPLLKAYNQANADMVDFHNAVVFQALHSQHNYLRIQDETLTGDLSSMDIATKENLENLVK  344

Query  364  VGkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
            VG++LL KPV ++N  TG  EP+   GTN DALK  A LLSEER+ R
Sbjct  345  VGEELLKKPVARMNCQTGAYEPIENGGTNMDALKEFAKLLSEERKVR  391


 Score = 62.8 bits (151),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 35/56 (63%), Gaps = 9/56 (16%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPS-----AGIFEVVRDATSLLAGPK*DG  545
            +APD N RPLYA KDIVPFY EH PKIFP      AG+  ++R       GPK DG
Sbjct  78   TAPDTNNRPLYAAKDIVPFYLEHSPKIFPQPRGPFAGLISMMRG----FHGPKYDG  129


 Score = 45.8 bits (107),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 41/51 (80%), Gaps = 2/51 (4%)
 Frame = -3

Query  884  PP--GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            PP  G +ITILSIDGGG+RGIIP  ++AYLE +LQ LDG D R ADYFDVI
Sbjct  14   PPNKGNLITILSIDGGGVRGIIPAVLLAYLESQLQELDGEDVRIADYFDVI  64



>tpg|DAA48471.1| TPA: patatin class 1 [Zea mays]
Length=423

 Score =   102 bits (254),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 57/110 (52%), Positives = 80/110 (73%), Gaps = 1/110 (1%)
 Frame = -1

Query  550  DGN-PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDA  374
            DG+ P+ID+F+ ASADMVD H+  +F+AL++ +NYLRIQ D L GS  S+D ++K+N+D 
Sbjct  288  DGSAPIIDMFNSASADMVDIHLCVLFRALRSSENYLRIQYDQLTGSAGSIDDSSKKNMDR  347

Query  373  LEEVGkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
            L  +G KLL   V +++L TG+N  VP AGTN + L + A  LS+ERRRR
Sbjct  348  LVRIGNKLLDMNVSRVDLETGRNVEVPGAGTNAERLAKFARQLSDERRRR  397


 Score = 46.2 bits (108),  Expect(2) = 5e-10, Method: Compositional matrix adjust.
 Identities = 35/45 (78%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = -3

Query  872  VITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            +IT+LSIDGGGIRGIIP TI+A+LE +LQ LDGPDAR ADYFDV+
Sbjct  21   LITVLSIDGGGIRGIIPATILAFLEAKLQELDGPDARIADYFDVV  65


 Score = 46.2 bits (108),  Expect(2) = 5e-10, Method: Compositional matrix adjust.
 Identities = 23/55 (42%), Positives = 31/55 (56%), Gaps = 1/55 (2%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPSA-GIFEVVRDATSLLAGPK*DGNPL  536
            +APD N+RPL+A KD+  FY +H PKIF     +   +     +  GPK DG  L
Sbjct  79   TAPDTNERPLFAAKDLARFYIQHSPKIFRQKNAMGSKLVGKLRMACGPKYDGKYL  133



>emb|CDP02483.1| unnamed protein product [Coffea canephora]
Length=411

 Score =   102 bits (253),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 61/106 (58%), Positives = 79/106 (75%), Gaps = 0/106 (0%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            PLI   + ASADMVD+H + +FQAL + DNYLRIQ+D L G+ +SV   TK+NLD L +V
Sbjct  293  PLIKAVNQASADMVDFHNSVVFQALHSDDNYLRIQDDALTGTLSSVATATKQNLDNLVKV  352

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
            G++LL KPVL++NL +G +EPV   GTN DAL R A LLS+ER+ R
Sbjct  353  GEELLKKPVLRVNLTSGDHEPVENGGTNMDALTRFAKLLSDERKLR  398


 Score = 60.8 bits (146),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 35/52 (67%), Gaps = 1/52 (2%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPS-AGIFEVVRDATSLLAGPK*DG  545
            +AP++N RPLYA KDIVPFY E+ PKIFP   G F  V +A   L GP  DG
Sbjct  79   AAPNENHRPLYAAKDIVPFYLENSPKIFPQIGGPFGGVVNAFKTLIGPGYDG  130


 Score = 45.8 bits (107),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 43/51 (84%), Gaps = 2/51 (4%)
 Frame = -3

Query  884  PP--GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            PP  G ++TILSIDGGGIRGIIPG I+AYLE +LQ LDG +AR ADYFDVI
Sbjct  15   PPNCGNLVTILSIDGGGIRGIIPGVILAYLESQLQELDGEEARIADYFDVI  65



>ref|XP_008670247.1| PREDICTED: patatin-like protein 2 isoform X2 [Zea mays]
Length=402

 Score =   102 bits (253),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 60/108 (56%), Positives = 77/108 (71%), Gaps = 2/108 (2%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            PL+D+F+ ASADMVD HI+ +F+AL +  NYLRIQ+D L+G+ +SVDV TKEN++ L  V
Sbjct  289  PLVDIFTQASADMVDIHISAVFKALHSEQNYLRIQDDTLQGTLSSVDVATKENMEKLARV  348

Query  361  GkklltkpvlklnlLTGKNEPVPKAG--TNKDALKRLAGLLSEERRRR  224
            G  LL KPV + NL TG   P       TN++ALKR A LLS+ERR R
Sbjct  349  GDMLLKKPVSQANLETGHMVPACHRAEMTNEEALKRFAKLLSDERRLR  396


 Score = 52.0 bits (123),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 31/57 (54%), Gaps = 1/57 (2%)
 Frame = -1

Query  694  APDKNKRPLYAGKDIVPFYKEHGPKIFPSA-GIFEVVRDATSLLAGPK*DGNPLIDV  527
            AP+   RPL+A KDI  FY  H PKIFP   G F  V      L+GP  DG  L DV
Sbjct  74   APNNTNRPLFAAKDIQAFYMNHAPKIFPQQRGPFGRVMRIFRSLSGPSYDGKYLHDV  130


 Score = 45.1 bits (105),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/51 (69%), Positives = 41/51 (80%), Gaps = 2/51 (4%)
 Frame = -3

Query  884  PP--GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            PP  G ++TILSIDGGGIRGIIP  ++ +LE ELQ LDG +AR ADYFDVI
Sbjct  9    PPTYGNLVTILSIDGGGIRGIIPAVVLTFLESELQKLDGEEARLADYFDVI  59



>ref|XP_006339912.1| PREDICTED: patatin-05-like [Solanum tuberosum]
Length=399

 Score =   102 bits (253),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 60/109 (55%), Positives = 79/109 (72%), Gaps = 0/109 (0%)
 Frame = -1

Query  550  DGNPLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDAL  371
            +  P+I+ F+ ASADMVDYH   +F+ALQ+ D YLRIQ+D L G+ ASVD+ TKENL+ L
Sbjct  288  NSTPIIEAFNQASADMVDYHNFVVFKALQSDDQYLRIQDDTLTGNLASVDIATKENLEGL  347

Query  370  EEVGkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
             +VG++LL KP  K+NL  G  E V   GTNK+AL+R A  LS+ER+ R
Sbjct  348  VKVGERLLDKPASKINLDKGVYEAVENGGTNKEALRRFAKTLSDERKFR  396


 Score = 63.5 bits (153),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 37/55 (67%), Gaps = 1/55 (2%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIF-PSAGIFEVVRDATSLLAGPK*DGNPL  536
            +AP+K KRPLYA KDI PFY EH PKIF  + G F  V + T +L GPK DG  L
Sbjct  77   AAPNKAKRPLYAAKDITPFYLEHSPKIFHQTGGPFGGVINLTKMLNGPKYDGKYL  131


 Score = 47.8 bits (112),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 45/54 (83%), Gaps = 3/54 (6%)
 Frame = -3

Query  890  SIPP---GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            ++PP   G +ITILSIDGGGIRGIIPG I+AYLE +LQ LDG DAR ADYFD+I
Sbjct  10   AMPPPTTGKLITILSIDGGGIRGIIPGVILAYLESQLQELDGEDARIADYFDLI  63



>ref|XP_010064133.1| PREDICTED: patatin-like protein 2 [Eucalyptus grandis]
Length=361

 Score =   101 bits (252),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 63/121 (52%), Positives = 83/121 (69%), Gaps = 8/121 (7%)
 Frame = -1

Query  547  GNPLIDVFSV------ASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKE  386
            GNP  D F +      ASADMVDYH++ +FQAL   DNYLRIQ+D L G+ +SVDV TK+
Sbjct  237  GNP--DFFPIKPMDTQASADMVDYHLSAVFQALHLHDNYLRIQDDTLTGALSSVDVATKK  294

Query  385  NLDALEEVGkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRRTIAALN  206
            NL+ L + G+ LL KPV ++NL TG  EP P   TN++AL+R A LLS+ER+ R   + +
Sbjct  295  NLNDLVKTGEALLKKPVSRVNLETGVCEPTPNQETNEEALRRFAKLLSQERQLRLARSPH  354

Query  205  G  203
            G
Sbjct  355  G  355


 Score = 50.4 bits (119),  Expect(2) = 1e-10, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 33/58 (57%), Gaps = 1/58 (2%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAGI-FEVVRDATSLLAGPK*DGNPLIDV  527
            + P++N RP++A KDI  FY  H PKIFP     F+ V      +AGPK DG  L  V
Sbjct  75   TTPNENNRPVFAAKDIKDFYLNHCPKIFPQDSCPFKPVTKMIKAMAGPKYDGKYLHSV  132


 Score = 43.9 bits (102),  Expect(2) = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/51 (76%), Positives = 42/51 (82%), Gaps = 2/51 (4%)
 Frame = -3

Query  884  PP--GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            PP  G  ITILSIDGGGIRG+IPGTI+ +LE ELQ LDG DAR ADYFDVI
Sbjct  11   PPTYGNSITILSIDGGGIRGLIPGTILHFLESELQKLDGEDARLADYFDVI  61



>emb|CDM80622.1| unnamed protein product [Triticum aestivum]
Length=289

 Score =   100 bits (249),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 73/173 (42%), Positives = 98/173 (57%), Gaps = 12/173 (7%)
 Frame = -1

Query  709  PPCYSAPDKNKRPLYAGKDIVPFY-KEHGPKIFPSAGI--------FEVVRDATSLLAG-  560
            P   +  D +K+ L   KD  P    ++G  +  S G         F+ V  +   L G 
Sbjct  109  PTLLAMTDVSKQILMGNKDFFPIKPADYGKFMILSLGTGTAKIEEKFDAVECSKWGLLGW  168

Query  559  -PK*DGNPLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKEN  383
                   P+ID FS ASAD+VD H + +FQAL     YLRIQ+D+LKG TA VDV+T EN
Sbjct  169  LSNRGATPIIDSFSQASADLVDIHASVLFQALHCEKRYLRIQDDELKGETAFVDVSTPEN  228

Query  382  LDALEEVGkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
            L+ L +VG+ LL + V K+N+ TGKNEP    GTN++ L   A +LSEER+ R
Sbjct  229  LNRLVDVGQALLKRQVCKVNVETGKNEPDQNRGTNEE-LVNFAHMLSEERKTR  280



>ref|XP_004233432.1| PREDICTED: patatin-like protein 1 [Solanum lycopersicum]
Length=420

 Score =   102 bits (253),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 80/107 (75%), Gaps = 0/107 (0%)
 Frame = -1

Query  544  NPLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEE  365
            +PL+DV+  AS+D+VD H++TIFQ+L + +NYLRIQ+D L G  AS+DV TK+N++AL +
Sbjct  301  SPLLDVYGDASSDIVDVHLSTIFQSLDSQNNYLRIQDDSLSGEAASMDVATKKNMEALVQ  360

Query  364  VGkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
            +G   L K V ++NL TG+ E V   GTN++AL R A LLSE+R+ R
Sbjct  361  IGNDRLKKGVSRVNLDTGRYEEVSGEGTNEEALIRFAKLLSEQRKIR  407


 Score = 60.1 bits (144),  Expect(2) = 4e-14, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 35/54 (65%), Gaps = 0/54 (0%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAGIFEVVRDATSLLAGPK*DGNPL  536
            +AP+K+ RPLYA K+I  FY +HGPKIFP +     ++   ++  GPK DG  L
Sbjct  89   TAPNKDNRPLYAAKNITNFYMDHGPKIFPESSRTSFLKRLANIFGGPKYDGKYL  142


 Score = 46.2 bits (108),  Expect(2) = 4e-14, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -3

Query  896  AASIPPGGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            A +   G  ITILSIDGGGIRGIIPGTI+A+LE +LQ LDGP+AR ADYFDV+
Sbjct  23   AFAATTGKKITILSIDGGGIRGIIPGTILAFLESKLQELDGPNARIADYFDVV  75



>gb|AAF98369.1|AF158253_1 patatin-like protein 3 [Nicotiana tabacum]
Length=411

 Score =   102 bits (253),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 58/106 (55%), Positives = 78/106 (74%), Gaps = 0/106 (0%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            PLIDV++ ASADMVD H++T+FQ L +  NY+RIQ+D+L G  AS+D+ T EN+  L ++
Sbjct  303  PLIDVYADASADMVDIHVSTMFQTLASEKNYIRIQDDNLTGEAASMDIATIENMGRLVQI  362

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
            G  LL KPV ++NL TG+ EPV   GTN+ A+ R A LLSEER+ R
Sbjct  363  GNDLLKKPVSRVNLETGRYEPVVAEGTNEAAIIRFAQLLSEERKLR  408


 Score = 64.3 bits (155),  Expect(2) = 4e-16, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 35/54 (65%), Gaps = 0/54 (0%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAGIFEVVRDATSLLAGPK*DGNPL  536
            +AP+K+ RPLY  KDI  FY EHGP+IFP +     VR  T+L  GPK DG  L
Sbjct  90   TAPNKDNRPLYQAKDISNFYMEHGPQIFPQSRRNSFVRRVTNLFGGPKYDGKYL  143


 Score = 48.9 bits (115),  Expect(2) = 4e-16, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = -3

Query  896  AASIPPGGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            A ++  G ++T+LS+DGGGIRGIIPGT++A+LE +LQ LDGP+AR ADYFDV+
Sbjct  24   AFAVTKGKMVTVLSVDGGGIRGIIPGTVLAFLESKLQELDGPNARLADYFDVV  76



>ref|XP_010028281.1| PREDICTED: patatin-like protein 2 [Eucalyptus grandis]
Length=400

 Score =   101 bits (252),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 58/106 (55%), Positives = 79/106 (75%), Gaps = 0/106 (0%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            P+ID+F+ A +DMVD H++T FQ+L+   NYLRIQ+D L G  +S+D +T+ENL+ L E+
Sbjct  293  PIIDIFNEACSDMVDIHLSTHFQSLKCQKNYLRIQDDTLTGKESSLDNSTRENLERLVEI  352

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
            G+KLL K V ++NL TGK E +   GTN DAL+R A  LSEER+RR
Sbjct  353  GEKLLQKRVSRVNLETGKFEKIEGEGTNGDALRRFAIRLSEERKRR  398


 Score = 44.7 bits (104),  Expect(2) = 7e-09, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 33/55 (60%), Gaps = 6/55 (11%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAG----IFEVVRDATSLLAGPK*DG  545
            +AP K+ RP+YA  DI  FY EH P+IFP       IF+ +R +   + GPK DG
Sbjct  78   TAP-KDNRPIYAACDIKDFYYEHCPEIFPYKNCDNFIFK-LRSSAEAVKGPKYDG  130


 Score = 43.9 bits (102),  Expect(2) = 7e-09, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 43/51 (84%), Gaps = 2/51 (4%)
 Frame = -3

Query  884  PP--GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            PP  G +ITILSIDGGG+RGIIPG I+AYLE +LQ  DGPD+R A+YFD+I
Sbjct  14   PPANGKLITILSIDGGGVRGIIPGVILAYLEAQLQERDGPDSRIANYFDII  64



>gb|KJB58443.1| hypothetical protein B456_009G210300 [Gossypium raimondii]
Length=322

 Score =   100 bits (250),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 58/106 (55%), Positives = 81/106 (76%), Gaps = 1/106 (1%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            PL+D+F  AS+DMVD+HIAT+FQALQ+ ++YLRIQ+D L    +SVD+ TKENL+ L +V
Sbjct  193  PLVDIFMQASSDMVDFHIATVFQALQSENSYLRIQDDTLSQQISSVDIATKENLENLVKV  252

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
            G++LL K V ++NL  G+ EP  K  TN +AL RLA +LS+E++ R
Sbjct  253  GEELLNKSVSRVNLENGQFEPAGKV-TNGEALIRLAAVLSKEKQLR  297



>ref|XP_002310157.1| hypothetical protein POPTR_0007s11360g [Populus trichocarpa]
 gb|EEE90607.1| hypothetical protein POPTR_0007s11360g [Populus trichocarpa]
Length=388

 Score =   101 bits (252),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 55/106 (52%), Positives = 77/106 (73%), Gaps = 0/106 (0%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            P+ID+FS AS+DMVDYHI+T+FQ+L + + YLRIQ+D L G  ASVD+ T +NL  L+E+
Sbjct  280  PIIDMFSSASSDMVDYHISTLFQSLDSKECYLRIQDDKLSGDAASVDIATPQNLQRLKEI  339

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
            G +LL K   ++NL TGK E +    TN+ AL + A LLS+E++ R
Sbjct  340  GAELLKKTESRVNLDTGKYEEIEGGRTNEAALAKFAQLLSDEKKHR  385


 Score = 52.8 bits (125),  Expect(2) = 3e-10, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 31/54 (57%), Gaps = 2/54 (4%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAGIFEVVRDATSLLAGPK*DGNPL  536
            +AP+K  RPLYA KDI  FY EH PKIFP      ++   +    GPK DG  L
Sbjct  68   AAPNKENRPLYAAKDINGFYLEHTPKIFPQKS--NLLGPLSVFFGGPKYDGKYL  119


 Score = 40.8 bits (94),  Expect(2) = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = -3

Query  872  VITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            V T+LSIDGGGIRGIIPG+++A+LE +LQ LDG  AR ADYFD+I
Sbjct  10   VATVLSIDGGGIRGIIPGSLLAFLESKLQELDGSQARIADYFDII  54



>ref|XP_009603683.1| PREDICTED: patatin-like protein 1 [Nicotiana tomentosiformis]
Length=407

 Score =   101 bits (252),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 61/113 (54%), Positives = 79/113 (70%), Gaps = 0/113 (0%)
 Frame = -1

Query  550  DGNPLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDAL  371
            +  P+ID F+ ASADMVD+H   +F+AL + D YLRIQ+D L G+ ASVD+ TKENL  L
Sbjct  290  NSTPIIDAFNQASADMVDFHNFVVFKALHSDDKYLRIQDDTLTGNLASVDIATKENLQGL  349

Query  370  EEVGkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRRTIAA  212
             +VG+ LL KPV K+NL  G  E V   GTNK+AL+R A +LS+ER+ R   A
Sbjct  350  VKVGEHLLEKPVSKINLDKGVYEAVENGGTNKEALQRFAKILSDERKLREFNA  402


 Score = 63.5 bits (153),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 37/55 (67%), Gaps = 1/55 (2%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPS-AGIFEVVRDATSLLAGPK*DGNPL  536
            +AP+K+KRPLYA KDI PFY EH PKIFP  +G    + + T  + GPK DG  L
Sbjct  79   AAPNKDKRPLYAAKDITPFYLEHSPKIFPQISGPLAGIINLTKAMGGPKYDGKYL  133



>ref|XP_010229387.1| PREDICTED: patatin-like protein 1 [Brachypodium distachyon]
Length=329

 Score =   100 bits (250),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 57/106 (54%), Positives = 78/106 (74%), Gaps = 0/106 (0%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            PLID+FS AS+DMVD H+  +F+AL+  DNYLRIQ D LKG T+SVD+ TKEN++ L ++
Sbjct  215  PLIDIFSHASSDMVDIHVNVLFKALRMEDNYLRIQHDYLKGKTSSVDIATKENMEELIKI  274

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
            GK LLT+ V ++N+ TG +E V   GTN++ L+  A  L +ER RR
Sbjct  275  GKDLLTRKVARVNVNTGLHEAVKDKGTNEEELESFAAKLVKERNRR  320



>emb|CBI25856.3| unnamed protein product [Vitis vinifera]
Length=162

 Score = 97.4 bits (241),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 56/106 (53%), Positives = 78/106 (74%), Gaps = 0/106 (0%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            PL+D++  AS+DMVD H++T+FQ+ +   NYLRIQ+D L G  +SVD+ T ENL+ LEE+
Sbjct  54   PLLDIYGHASSDMVDIHVSTLFQSRRCQKNYLRIQDDTLTGDASSVDIATVENLERLEEI  113

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
            GK+LL KPV ++NL TGK E +   GTN+ AL + A LLS +R+ R
Sbjct  114  GKELLEKPVSRVNLETGKYEELVGEGTNRGALTQFAMLLSHQRKLR  159



>ref|XP_006829694.1| PREDICTED: patatin-like protein 1 [Amborella trichopoda]
 gb|ERM97110.1| hypothetical protein AMTR_s00126p00050070 [Amborella trichopoda]
Length=405

 Score =   101 bits (252),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 77/107 (72%), Gaps = 0/107 (0%)
 Frame = -1

Query  544  NPLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEE  365
            +PL++ F+  SADMVD+H + +FQAL + DNYLRIQEDDL    ASVD++TKENL  L  
Sbjct  289  SPLVESFTQGSADMVDFHNSVVFQALNSEDNYLRIQEDDLSNEAASVDISTKENLQNLVN  348

Query  364  VGkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
            +G++LL  PV ++N+ TG  EP+    TN++AL   A LLS+ERR R
Sbjct  349  IGQQLLKNPVSRVNVETGLFEPLKNQSTNEEALVIFAKLLSQERRLR  395


 Score = 67.4 bits (163),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 36/55 (65%), Gaps = 1/55 (2%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPSA-GIFEVVRDATSLLAGPK*DGNPL  536
            +APD+NKRPLYA KDIVPFY EH PKIFP   G F       S + GPK DG  L
Sbjct  75   TAPDENKRPLYAAKDIVPFYLEHCPKIFPHPRGPFSSALKVISAVIGPKYDGKYL  129


 Score = 40.4 bits (93),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = -3

Query  878  GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            G  ITILSIDGGG+RGIIPG I+++LE +LQALDG + R  DYFDVI
Sbjct  15   GDFITILSIDGGGVRGIIPGIILSFLESQLQALDGEEVRLVDYFDVI  61



>ref|XP_006466736.1| PREDICTED: patatin-11-like [Citrus sinensis]
Length=391

 Score =   101 bits (251),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 58/108 (54%), Positives = 78/108 (72%), Gaps = 2/108 (2%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            PL+D +  A  DMVDYHI+ +FQALQ+ DNYLRI++D L+G   S+D+TTKEN + L   
Sbjct  278  PLLDCYGRAIGDMVDYHISVVFQALQSEDNYLRIEDDTLQGDVTSIDLTTKENFENLVRA  337

Query  361  GkklltkpvlklnlLTGKNEPVPK--AGTNKDALKRLAGLLSEERRRR  224
            G+ LL KPV ++NL  G  EP+    AGTN++ALKR A +LS+ER+ R
Sbjct  338  GETLLKKPVSRINLDAGLYEPIENGSAGTNEEALKRFAKMLSDERKLR  385


 Score = 47.4 bits (111),  Expect(2) = 9e-06, Method: Compositional matrix adjust.
 Identities = 18/29 (62%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFP  611
            +AP +  RP+ A KDIVPFY  HGP+IFP
Sbjct  64   TAPKEQNRPMSAAKDIVPFYIRHGPQIFP  92


 Score = 30.8 bits (68),  Expect(2) = 9e-06, Method: Compositional matrix adjust.
 Identities = 13/15 (87%), Positives = 13/15 (87%), Gaps = 0/15 (0%)
 Frame = -3

Query  782  LDGPDARAADYFDVI  738
            LDG DAR ADYFDVI
Sbjct  36   LDGQDARLADYFDVI  50



>ref|XP_008357460.1| PREDICTED: LOW QUALITY PROTEIN: patatin-like protein 2 [Malus 
domestica]
Length=589

 Score =   103 bits (256),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 62/113 (55%), Positives = 83/113 (73%), Gaps = 1/113 (1%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            P+I+VFS AS DMVD H++ +FQAL + +NYLRIQ+D L+G+ ASVD+ TK+NL  L +V
Sbjct  470  PIINVFSQASNDMVDLHLSAVFQALHSEENYLRIQDDTLRGTIASVDIATKKNLTNLVKV  529

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRRTIAALNG  203
            G+ LL KPV ++NL +G+ E   K  TN +AL R A LLSEE+RRR   + NG
Sbjct  530  GEGLLKKPVSRVNLDSGRFEAT-KHETNAEALIRFAKLLSEEKRRRLAGSTNG  581


 Score = 52.8 bits (125),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 33/56 (59%), Gaps = 2/56 (4%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFP--SAGIFEVVRDATSLLAGPK*DGNPL  536
            +AP++N RPL+A KDI+ FY    PKIFP  +  IF         LAGPK +G  L
Sbjct  255  AAPNENNRPLFAAKDIIDFYFNQCPKIFPQXTWSIFSNTTKIIKALAGPKYNGKYL  310


 Score = 31.6 bits (70),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 13/17 (76%), Positives = 14/17 (82%), Gaps = 0/17 (0%)
 Frame = -3

Query  788  QALDGPDARAADYFDVI  738
            + LDG DAR ADYFDVI
Sbjct  225  EKLDGEDARIADYFDVI  241



>emb|CDP02475.1| unnamed protein product [Coffea canephora]
Length=411

 Score =   101 bits (251),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 56/106 (53%), Positives = 79/106 (75%), Gaps = 0/106 (0%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            PL+DVF  A++DMVD H++T+FQ+L +  NYLRIQE+ L G  +SVDV T EN++ L ++
Sbjct  303  PLLDVFGAATSDMVDIHVSTLFQSLGSEKNYLRIQEEGLTGDASSVDVATTENMETLVQI  362

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
            G  LL KPV ++NL TG++E V   GTN++AL + A LLS+ER+ R
Sbjct  363  GNSLLQKPVSRVNLETGRSEAVQGEGTNEEALTQFAKLLSDERKLR  408


 Score = 63.2 bits (152),  Expect(2) = 7e-15, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAGIFEVVRDATSLLAGPK*DGNPL  536
            +AP+K+ RPLYA KDI  FY ++ P+IFP +   +VV+  T+LL GPK DG  L
Sbjct  90   TAPNKDSRPLYAAKDITSFYLQNSPQIFPESSRKDVVKSLTNLLGGPKYDGKYL  143


 Score = 45.8 bits (107),  Expect(2) = 7e-15, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = -3

Query  890  SIPPGGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            +I  G + T+LSIDGGGIRGIIPGTI+A+LE +LQ LDGP+AR ADYFDV+
Sbjct  26   AITKGRLATVLSIDGGGIRGIIPGTILAFLEAKLQELDGPNARIADYFDVV  76



>ref|XP_006354908.1| PREDICTED: patatin-3-Kuras 1-like [Solanum tuberosum]
Length=409

 Score =   101 bits (251),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 65/138 (47%), Positives = 87/138 (63%), Gaps = 10/138 (7%)
 Frame = -1

Query  634  EHGPKIFPSAGIFEVVRDATSLLAGPK*DGNPLIDVFSVASADMVDYHIATIFQALQAGD  455
            ++  KI  + GIF  + D  S         NP+ID F+ AS DMVDYHI+ +FQ + +  
Sbjct  271  KYDAKIASNWGIFGWLSDGGS---------NPIIDAFADASNDMVDYHISVVFQCVCSQK  321

Query  454  NYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnlLTGKNEPV-PKAGTN  278
             YLRIQ+D L G   SVD++TKEN+D L E+G  LL KPV ++NL T   EP+    GTN
Sbjct  322  QYLRIQDDTLSGEDFSVDISTKENMDKLVEIGTNLLKKPVSRVNLKTCLFEPLGTTGGTN  381

Query  277  KDALKRLAGLLSEERRRR  224
            ++ALK  A LLSEE++ R
Sbjct  382  EEALKEFAKLLSEEKKFR  399


 Score = 59.7 bits (143),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 37/59 (63%), Gaps = 2/59 (3%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAGIFEV--VRDATSLLAGPK*DGNPLIDV  527
            +AP+K+ RPL+A KDI PFY EHGPKIFP   +  +  +      L GPK DG  L +V
Sbjct  75   TAPNKDNRPLFAAKDIKPFYLEHGPKIFPQNNMILIGSIIKGWRFLTGPKYDGKYLREV  133


 Score = 43.9 bits (102),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 41/51 (80%), Gaps = 2/51 (4%)
 Frame = -3

Query  884  PP--GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            PP  G  ITILSIDGGGIRG+IP TI+ YLE +LQ LDG DAR ADYFD+I
Sbjct  11   PPINGKFITILSIDGGGIRGLIPATILEYLESQLQELDGEDARLADYFDII  61



>ref|XP_011008336.1| PREDICTED: patatin-like protein 3 [Populus euphratica]
 ref|XP_011015438.1| PREDICTED: patatin-like protein 3 [Populus euphratica]
Length=407

 Score =   101 bits (251),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 58/106 (55%), Positives = 76/106 (72%), Gaps = 0/106 (0%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            PLI  ++ AS+DMVDYH + +FQA  + + YLRI ED L+G   SVD+ TKENL+ L +V
Sbjct  290  PLITCYNNASSDMVDYHNSVVFQAFHSENYYLRIDEDKLQGDLYSVDIATKENLENLVKV  349

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
            G+ LL  PV ++NL TG  EPV   GTN++AL+R A LLSEER+ R
Sbjct  350  GEDLLKSPVSRINLDTGGYEPVEDGGTNEEALQRFAKLLSEERKLR  395


 Score = 57.0 bits (136),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 37/52 (71%), Gaps = 1/52 (2%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFP-SAGIFEVVRDATSLLAGPK*DG  545
            +AP++ +RPL+  KDIVPFY  + PKIFP ++G+F   ++    ++GPK DG
Sbjct  76   AAPNEQQRPLFEAKDIVPFYLNNSPKIFPQTSGMFAWPKNVWKAISGPKYDG  127



>gb|KCW66469.1| hypothetical protein EUGRSUZ_F002673, partial [Eucalyptus grandis]
Length=249

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 57/95 (60%), Positives = 72/95 (76%), Gaps = 0/95 (0%)
 Frame = -1

Query  547  GNPLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALE  368
            G+PLIDVFS ASADMVD+HI+ +FQAL   DNYLRIQ+D L G  +SVDV TK+NL+ L 
Sbjct  155  GSPLIDVFSQASADMVDFHISAVFQALHLHDNYLRIQDDTLTGDLSSVDVATKKNLNDLV  214

Query  367  EVGkklltkpvlklnlLTGKNEPVPKAGTNKDALK  263
            + G+ LL KPV ++NL TG  EP P   TN++AL+
Sbjct  215  KTGEALLKKPVSRVNLETGACEPTPNQETNEEALR  249



>ref|XP_006360228.1| PREDICTED: patatin-3-Kuras 1-like [Solanum tuberosum]
Length=420

 Score =   101 bits (251),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 80/107 (75%), Gaps = 0/107 (0%)
 Frame = -1

Query  544  NPLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEE  365
            +PL+DV+  ASAD+VD H++TIFQ+L++  NYLRIQ+D L G  +S+DV T++N++AL +
Sbjct  301  SPLLDVYGDASADIVDVHLSTIFQSLESEKNYLRIQDDSLSGEASSMDVATRKNMEALVQ  360

Query  364  VGkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
            +G   L K V ++NL TG+ E V   GTN++AL R A LLSE+R+ R
Sbjct  361  IGNDRLKKAVSRVNLDTGRYEEVSGEGTNEEALIRFAKLLSEQRKIR  407


 Score = 62.8 bits (151),  Expect(2) = 9e-15, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAGIFEVVRDATSLLAGPK*DGNPL  536
            +AP+K+ RPLYA K+I  FY +HGPKIFP +     ++  T+L  GPK DG  L
Sbjct  89   TAPNKDNRPLYAAKNITNFYMDHGPKIFPESSRSSFLKRLTNLFGGPKYDGKYL  142


 Score = 45.8 bits (107),  Expect(2) = 9e-15, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -3

Query  896  AASIPPGGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            A +   G  +TILSIDGGGIRGIIPGT++A+LE +LQ LDGP+AR ADYFDV+
Sbjct  23   AFAATTGKKLTILSIDGGGIRGIIPGTLLAFLESKLQELDGPNARIADYFDVV  75



>ref|XP_008457870.1| PREDICTED: patatin-like protein 2 isoform X2 [Cucumis melo]
Length=330

 Score =   100 bits (249),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 59/106 (56%), Positives = 76/106 (72%), Gaps = 0/106 (0%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            P+ID FS AS+DMVDYH++T+FQ+  A  NYLRIQED L G  A VD+ T ENL  L ++
Sbjct  221  PIIDFFSDASSDMVDYHVSTLFQSSNAQQNYLRIQEDSLTGDAALVDIATPENLLKLVKI  280

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
            G+ LL KPV ++NL TGK E V   G+N+DAL + A LL +ER+ R
Sbjct  281  GEDLLKKPVSRVNLETGKYEIVDGEGSNEDALTKFAKLLHQERKLR  326



>ref|XP_010059967.1| PREDICTED: patatin-like protein 2 [Eucalyptus grandis]
 gb|KCW66459.1| hypothetical protein EUGRSUZ_F00255 [Eucalyptus grandis]
Length=409

 Score =   101 bits (251),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 61/115 (53%), Positives = 83/115 (72%), Gaps = 1/115 (1%)
 Frame = -1

Query  547  GNPLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALE  368
            G+PL+DVF  ASADMVD+H++ +FQAL    NYLRIQ+D L GS ASVD+ TK+NL+ L 
Sbjct  287  GSPLVDVFMQASADMVDFHLSAVFQALHLEANYLRIQDDTLSGSVASVDIATKKNLNDLV  346

Query  367  EVGkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRRTIAALNG  203
            + G+ LL KPV K++L TG++    K  TN++AL+R A LLS ER+ R   + +G
Sbjct  347  KTGEALLKKPVSKVDLETGQHNAC-KLETNEEALRRFAKLLSNERQLRHARSPHG  400


 Score = 47.4 bits (111),  Expect(2) = 1e-10, Method: Compositional matrix adjust.
 Identities = 40/51 (78%), Positives = 44/51 (86%), Gaps = 2/51 (4%)
 Frame = -3

Query  884  PP--GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            PP  G +ITILSIDGGGIRG+IPGTI+A+LE ELQ LDG DAR ADYFDVI
Sbjct  11   PPTYGNLITILSIDGGGIRGLIPGTILAFLESELQKLDGEDARIADYFDVI  61


 Score = 47.4 bits (111),  Expect(2) = 1e-10, Method: Compositional matrix adjust.
 Identities = 24/55 (44%), Positives = 32/55 (58%), Gaps = 1/55 (2%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPS-AGIFEVVRDATSLLAGPK*DGNPL  536
            ++PD+N RPL+A KDI  FY ++ PKIFP  +  F         + GPK DG  L
Sbjct  75   TSPDENNRPLFAAKDIKDFYLDNCPKIFPQDSCPFAPATKMIKAVTGPKYDGKYL  129



>ref|XP_009589625.1| PREDICTED: patatin-like protein 3 [Nicotiana tomentosiformis]
Length=411

 Score =   101 bits (251),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 57/106 (54%), Positives = 78/106 (74%), Gaps = 0/106 (0%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            PLIDV++ ASADMVD H++T+FQ L +  NY+RIQ+D+L G  AS+D+ T EN++ L ++
Sbjct  303  PLIDVYADASADMVDIHVSTMFQTLASEKNYIRIQDDNLTGEAASMDIATIENMERLVQI  362

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
            G  LL KPV ++NL TG+ EPV   GTN+ A+   A LLSEER+ R
Sbjct  363  GNDLLKKPVSRVNLETGRYEPVVAEGTNEAAIIHFAQLLSEERKLR  408


 Score = 58.9 bits (141),  Expect(2) = 5e-14, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 33/54 (61%), Gaps = 0/54 (0%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAGIFEVVRDATSLLAGPK*DGNPL  536
            +AP+ + RPLY  KDI  FY EHGP+IF  +     VR  T+L  GPK DG  L
Sbjct  90   TAPNMDNRPLYQAKDISNFYMEHGPQIFSQSRRNSFVRRVTNLFGGPKYDGKYL  143


 Score = 47.0 bits (110),  Expect(2) = 5e-14, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = -3

Query  896  AASIPPGGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            A +   G ++T+LS+DGGGIRGIIPGT++A+LE +LQ LDGP+AR ADYFDV+
Sbjct  24   AFAATKGKMVTVLSVDGGGIRGIIPGTVLAFLESKLQELDGPNARLADYFDVV  76



>ref|XP_003574632.1| PREDICTED: patatin-like protein 2 [Brachypodium distachyon]
Length=402

 Score =   100 bits (250),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 54/106 (51%), Positives = 77/106 (73%), Gaps = 0/106 (0%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            P++D+F+ ASADMVD H++ +F AL++  +YLRIQ D L GS  S+D  +KEN+D L E+
Sbjct  290  PIVDMFNAASADMVDIHLSVLFGALRSSHHYLRIQYDQLSGSAGSIDDCSKENMDRLVEI  349

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
            G++LL K V +++L TG+N  +P  GTN   L + A LLS+ERRRR
Sbjct  350  GEELLRKNVSRVDLETGRNVEMPGEGTNAQQLTKFAKLLSDERRRR  395


 Score = 47.0 bits (110),  Expect(2) = 5e-10, Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = -3

Query  872  VITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            +IT+LSIDGGG+RGIIP T++A+LEEEL+ LDGPD+R ADYFDV+
Sbjct  20   LITVLSIDGGGVRGIIPATVLAFLEEELKKLDGPDSRIADYFDVV  64


 Score = 45.4 bits (106),  Expect(2) = 5e-10, Method: Compositional matrix adjust.
 Identities = 24/55 (44%), Positives = 31/55 (56%), Gaps = 2/55 (4%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPSA-GIFEVVRDATSLLAGPK*DGNPL  536
            +AP KN RPL+  KD+  FY +  PKIFP   G F  +  A  ++  PK DG  L
Sbjct  78   TAP-KNGRPLFDAKDLAQFYIDESPKIFPQKNGFFSKIGTALKMVGAPKYDGKYL  131



>ref|XP_009390266.1| PREDICTED: patatin-like protein 2 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=416

 Score =   101 bits (251),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 59/106 (56%), Positives = 77/106 (73%), Gaps = 0/106 (0%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            PLID+F+ ASADMVD H + +FQAL  G NYLRI++D L G T+SVDV+TK+NL  L ++
Sbjct  298  PLIDIFTQASADMVDIHASVLFQALNKGKNYLRIEDDTLTGQTSSVDVSTKKNLQDLVDI  357

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
            G  LL KPV ++N+ TG +E V   GTN+ AL   A  LS+E+RRR
Sbjct  358  GNSLLKKPVSRVNIETGHSEAVDGEGTNEAALTGFAKKLSDEKRRR  403


 Score = 57.8 bits (138),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 38/56 (68%), Gaps = 2/56 (4%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFP--SAGIFEVVRDATSLLAGPK*DGNPL  536
            +AP+K KRPL+A KDIV FY ++ PKIFP  +AG+F    +    ++GPK DG  L
Sbjct  83   TAPNKEKRPLFAAKDIVQFYLDNSPKIFPQKNAGLFNSALNLVGAVSGPKYDGKYL  138


 Score = 45.8 bits (107),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 43/54 (80%), Gaps = 3/54 (6%)
 Frame = -3

Query  890  SIPP---GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            S PP   G  +T+L IDGGG+RG+IP TI+A+LE ELQ LDGP+AR ADYFDVI
Sbjct  16   STPPPSFGKRVTVLCIDGGGVRGLIPATIIAFLEAELQKLDGPEARIADYFDVI  69



>ref|XP_006338216.1| PREDICTED: patatin-3-Kuras 1-like [Solanum tuberosum]
Length=412

 Score =   100 bits (250),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 55/106 (52%), Positives = 78/106 (74%), Gaps = 0/106 (0%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            PLID++  ASADMVD H++T+FQ L +  NY+RIQ+D+L G  AS+D+ T +N++ L ++
Sbjct  305  PLIDIYGDASADMVDIHVSTMFQTLGSEKNYIRIQDDNLTGEAASMDIATTKNMETLVQI  364

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
            G  LL KP+ ++NL TG+ EPV   GTN+ A+ R A LLSEER+ R
Sbjct  365  GNDLLKKPISRVNLETGRYEPVVGEGTNEAAIVRFAQLLSEERKLR  410


 Score = 63.9 bits (154),  Expect(2) = 7e-15, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAGIFEVVRDATSLLAGPK*DG  545
            +AP+K+ RPLY  KDI  FY EHGP+IFP +     VR  T+L  GPK DG
Sbjct  92   TAPNKDNRPLYQAKDISNFYMEHGPQIFPQSRRNSFVRRVTNLFGGPKYDG  142


 Score = 45.1 bits (105),  Expect(2) = 7e-15, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = -3

Query  878  GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            G  +TILSIDGGGIRG+IPGT++A+LE +LQ LDGP+AR ADYFDV+
Sbjct  32   GKTVTILSIDGGGIRGVIPGTLLAFLESKLQELDGPNARLADYFDVV  78



>ref|XP_008670872.1| PREDICTED: patatin-like protein 1 [Zea mays]
Length=330

 Score =   100 bits (248),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 57/106 (54%), Positives = 76/106 (72%), Gaps = 0/106 (0%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            P+ID+FS AS+DMVD H A +FQAL    NYLRIQ+D L G+T+SVD+ TKEN+++L  +
Sbjct  218  PIIDIFSHASSDMVDIHAAVLFQALHCEKNYLRIQDDTLIGNTSSVDIATKENMESLIGI  277

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
            G+ LL KPV ++N+ TG  EP    GTN +AL   A  LS+ER+ R
Sbjct  278  GQDLLKKPVARVNIDTGVYEPCSGEGTNAEALAHFAKKLSDERKLR  323


 Score = 57.8 bits (138),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 35/53 (66%), Gaps = 2/53 (4%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPS--AGIFEVVRDATSLLAGPK*DG  545
            +APD+N RPL+A KD+  FY E+GPKIFP   AG    V +   L+ GPK DG
Sbjct  3    AAPDQNNRPLFAAKDLNTFYLENGPKIFPQKKAGFLTPVANLLGLVRGPKYDG  55



>ref|XP_004511941.1| PREDICTED: patatin-05-like [Cicer arietinum]
Length=401

 Score =   100 bits (250),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 58/106 (55%), Positives = 78/106 (74%), Gaps = 0/106 (0%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            P++D F+ AS DMVDYH + +F ALQ+ DNYLRIQ+D L+G  ASVDV++KENL+ L +V
Sbjct  288  PILDCFNEASTDMVDYHNSVLFTALQSQDNYLRIQDDTLQGELASVDVSSKENLNNLVKV  347

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
            G++LL K V ++NL TG  E VP  GT ++ LKR A LLS  R+ +
Sbjct  348  GEQLLKKKVTRVNLDTGIYESVPHKGTIEEELKRFANLLSGLRKHK  393


 Score = 50.4 bits (119),  Expect(2) = 7e-09, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 32/50 (64%), Gaps = 1/50 (2%)
 Frame = -1

Query  691  PDKNKRPLYAGKDIVPFYKEHGPKIFPS-AGIFEVVRDATSLLAGPK*DG  545
            P  N RP++A K+IVPFY ++ P IFP  +GIF  + + T    GPK +G
Sbjct  79   PKANDRPIFAAKEIVPFYLQNLPFIFPQKSGIFAPLLNITKAFTGPKYNG  128


 Score = 38.5 bits (88),  Expect(2) = 7e-09, Method: Compositional matrix adjust.
 Identities = 17/25 (68%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = -3

Query  812  VAYLEEELQALDGPDARAADYFDVI  738
            +A LE +LQ +DG DAR ADYFDVI
Sbjct  37   LAKLESQLQEIDGEDARIADYFDVI  61



>ref|XP_006659498.1| PREDICTED: patatin-T5-like [Oryza brachyantha]
Length=422

 Score =   101 bits (251),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 56/106 (53%), Positives = 77/106 (73%), Gaps = 0/106 (0%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            P+ID+ + ASA+MVD H+  +F AL + +NYLRIQ D LKGS  S+D ++KENLD L  +
Sbjct  310  PIIDMLTTASANMVDIHLCVLFSALHSEENYLRIQYDQLKGSAGSIDDSSKENLDNLVRI  369

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
            G++LL K V +++L TG+   VP  GTN+  L +LA LLS+ERRRR
Sbjct  370  GEELLKKNVSRVDLETGRYVDVPGEGTNEQQLTKLAKLLSDERRRR  415


 Score = 44.3 bits (103),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 33/56 (59%), Gaps = 2/56 (4%)
 Frame = -1

Query  697  SAPDKNK-RPLYAGKDIVPFYKEHGPKIFPSAG-IFEVVRDATSLLAGPK*DGNPL  536
            +APDK+  RPL+A KD+  FY ++ P IFP    +   +     +++GPK DG  L
Sbjct  80   TAPDKSSGRPLFAAKDLAKFYVDNSPNIFPQKNWVLSKIAGTLRMVSGPKYDGKYL  135


 Score = 37.0 bits (84),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 41/46 (89%), Gaps = 1/46 (2%)
 Frame = -3

Query  872  VITILSidgggirgiipgtIVAYLEEELQALD-GPDARAADYFDVI  738
            ++T+LSIDGGG+RGIIP T++A+LE++LQ +D  PDAR ADYFDV+
Sbjct  21   LVTVLSIDGGGVRGIIPATVLAFLEKKLQEVDENPDARIADYFDVV  66



>ref|XP_009390265.1| PREDICTED: patatin-like protein 2 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=420

 Score =   100 bits (250),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 59/106 (56%), Positives = 77/106 (73%), Gaps = 0/106 (0%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            PLID+F+ ASADMVD H + +FQAL  G NYLRI++D L G T+SVDV+TK+NL  L ++
Sbjct  302  PLIDIFTQASADMVDIHASVLFQALNKGKNYLRIEDDTLTGQTSSVDVSTKKNLQDLVDI  361

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
            G  LL KPV ++N+ TG +E V   GTN+ AL   A  LS+E+RRR
Sbjct  362  GNSLLKKPVSRVNIETGHSEAVDGEGTNEAALTGFAKKLSDEKRRR  407


 Score = 57.8 bits (138),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 38/60 (63%), Gaps = 6/60 (10%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFP------SAGIFEVVRDATSLLAGPK*DGNPL  536
            +AP+K KRPL+A KDIV FY ++ PKIFP      SAG+F    +    ++GPK DG  L
Sbjct  83   TAPNKEKRPLFAAKDIVQFYLDNSPKIFPQKKFGCSAGLFNSALNLVGAVSGPKYDGKYL  142


 Score = 45.8 bits (107),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 43/54 (80%), Gaps = 3/54 (6%)
 Frame = -3

Query  890  SIPP---GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            S PP   G  +T+L IDGGG+RG+IP TI+A+LE ELQ LDGP+AR ADYFDVI
Sbjct  16   STPPPSFGKRVTVLCIDGGGVRGLIPATIIAFLEAELQKLDGPEARIADYFDVI  69



>ref|XP_008776828.1| PREDICTED: patatin-like protein 2 [Phoenix dactylifera]
Length=386

 Score =   100 bits (249),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 77/106 (73%), Gaps = 0/106 (0%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            PLID FS AS+DMVD H + IFQAL    NYLRIQ+D L G TASVDV++KENL  L ++
Sbjct  274  PLIDSFSQASSDMVDIHASVIFQALHCESNYLRIQDDTLIGDTASVDVSSKENLLKLVQI  333

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
            GK+LL KPV ++NL +G  E V  AGTN++ L R A +LS ER+ R
Sbjct  334  GKELLKKPVSRVNLESGMYEAVQMAGTNEEELIRFAKMLSSERQLR  379


 Score = 54.7 bits (130),  Expect(2) = 1e-10, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 35/56 (63%), Gaps = 2/56 (4%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFP--SAGIFEVVRDATSLLAGPK*DGNPL  536
            +APD+N RPL+A K+I  FY E+ PKIFP    GI   V+     +AGPK DG  L
Sbjct  59   AAPDENNRPLFAAKEINDFYLENCPKIFPKNGNGILGSVKSLLGSIAGPKYDGKYL  114


 Score = 40.0 bits (92),  Expect(2) = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = -3

Query  872  VITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            ++T+LSIDGGG+RGIIPGTI+A+LE +LQ LDG D R ADYFDV+
Sbjct  1    MVTVLSIDGGGVRGIIPGTILAFLESKLQELDGEDVRIADYFDVV  45



>ref|XP_010269056.1| PREDICTED: patatin-like protein 2 isoform X1 [Nelumbo nucifera]
 ref|XP_010269064.1| PREDICTED: patatin-like protein 2 isoform X1 [Nelumbo nucifera]
Length=408

 Score =   100 bits (250),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 60/106 (57%), Positives = 76/106 (72%), Gaps = 0/106 (0%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            PL+DVF+ AS DMVD+ I+ +FQAL +  NYLRIQ+D L  + ASVD+ TKENL+ L +V
Sbjct  289  PLVDVFTQASGDMVDFQISVVFQALHSEINYLRIQDDTLNETLASVDIATKENLENLVKV  348

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
            G+ LL KPV ++NL TG    +   GTN+ ALKR A LLS ERR R
Sbjct  349  GEALLKKPVSRVNLETGSCVHIESEGTNEQALKRFAKLLSNERRVR  394


 Score = 58.2 bits (139),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 34/55 (62%), Gaps = 1/55 (2%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPSA-GIFEVVRDATSLLAGPK*DGNPL  536
            +APDK+ RPL+A KDI  FY EH PKIFP   G F   +     LAGPK +G  L
Sbjct  74   TAPDKDNRPLFAAKDIQAFYLEHCPKIFPQCKGPFSSAKKIIRQLAGPKYNGKYL  128


 Score = 45.1 bits (105),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 41/51 (80%), Gaps = 2/51 (4%)
 Frame = -3

Query  884  PP--GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            PP  G +ITILSIDGGGIRGIIP  I+ +LE +LQ LDG DAR ADYFDVI
Sbjct  10   PPTYGNLITILSIDGGGIRGIIPAAILNFLESQLQELDGEDARLADYFDVI  60



>ref|XP_006291236.1| hypothetical protein CARUB_v10017367mg [Capsella rubella]
 gb|EOA24134.1| hypothetical protein CARUB_v10017367mg [Capsella rubella]
Length=405

 Score =   100 bits (250),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 58/116 (50%), Positives = 84/116 (72%), Gaps = 1/116 (1%)
 Frame = -1

Query  550  DGNPLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDAL  371
            +  PLIDVF+ AS+DMVD+H++ +F+AL +G NY+RIQ+D L G TASVD+ T ENLD L
Sbjct  285  NSTPLIDVFTHASSDMVDFHLSCVFRALHSGANYIRIQDDTLTGDTASVDIATVENLDNL  344

Query  370  EEVGkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRRTIAALNG  203
             ++G +LL KPV  +NL +G NE      TN+ AL + AG+L++E++ R + + NG
Sbjct  345  TKIGDELLKKPVSIVNLDSGCNESAYHM-TNEKALIKFAGILAKEKKIRDMRSPNG  399


 Score = 46.6 bits (109),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 30/52 (58%), Gaps = 1/52 (2%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAGI-FEVVRDATSLLAGPK*DG  545
            SAP+K  RPL+A  +I  FY E+ PKIFP         ++    L+GPK DG
Sbjct  74   SAPNKEGRPLFAASEIKQFYLENCPKIFPQNHFPLSAAKNLVKSLSGPKYDG  125


 Score = 43.5 bits (101),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/51 (69%), Positives = 41/51 (80%), Gaps = 2/51 (4%)
 Frame = -3

Query  884  PP--GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            PP  G ++TILSIDGGGIRGIIP  I+ +LE ELQ LDG +AR ADYFDV+
Sbjct  10   PPTYGNLVTILSIDGGGIRGIIPAVILGFLESELQKLDGQEARLADYFDVM  60



>ref|XP_002281798.1| PREDICTED: patatin-like protein 1 [Vitis vinifera]
 emb|CBI21445.3| unnamed protein product [Vitis vinifera]
Length=407

 Score =   100 bits (250),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 60/113 (53%), Positives = 81/113 (72%), Gaps = 0/113 (0%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            PL+D F+ ASADMVDYH A +FQAL   +NYLRI E  L G  AS D+ TK+N++ L +V
Sbjct  291  PLVDSFTQASADMVDYHNAVVFQALGCQENYLRIDEATLTGDLASTDIATKKNMNELVKV  350

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRRTIAALNG  203
            G++LL KPV ++NL TG+ E +   GTN++AL+R A LLS+ER+ R   A +G
Sbjct  351  GEELLKKPVSRVNLDTGEYEAIKNGGTNEEALRRFAKLLSDERKLRESNAQDG  403


 Score = 57.4 bits (137),  Expect(2) = 4e-13, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 35/55 (64%), Gaps = 1/55 (2%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPS-AGIFEVVRDATSLLAGPK*DGNPL  536
            +AP++N RPLYA  +I PF  EH PKIFP  +GI   V +   +L GPK DG  L
Sbjct  77   AAPNQNNRPLYAASEIKPFLFEHSPKIFPPRSGIIGSVVNFFKILTGPKYDGKYL  131


 Score = 45.4 bits (106),  Expect(2) = 4e-13, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 47/62 (76%), Gaps = 5/62 (8%)
 Frame = -3

Query  908  GEYNAASI---PP--GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFD  744
            GE  ++S+   PP  G +ITILSIDGGG+RGII G I+A LE ELQ LDG DAR +DYFD
Sbjct  2    GEGTSSSLQIKPPSRGSLITILSIDGGGVRGIISGIILASLESELQKLDGEDARLSDYFD  61

Query  743  VI  738
            VI
Sbjct  62   VI  63



>ref|XP_010059972.1| PREDICTED: patatin-like protein 2 [Eucalyptus grandis]
 gb|KCW66467.1| hypothetical protein EUGRSUZ_F00264 [Eucalyptus grandis]
Length=409

 Score =   100 bits (250),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 61/115 (53%), Positives = 83/115 (72%), Gaps = 1/115 (1%)
 Frame = -1

Query  547  GNPLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALE  368
            G+PL+DVF  ASADMVD+H++ +FQAL    NYLRIQ+D L GS ASVD+ TK+NL+ L 
Sbjct  287  GSPLVDVFMQASADMVDFHLSAVFQALHLEANYLRIQDDTLSGSVASVDIATKKNLNDLV  346

Query  367  EVGkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRRTIAALNG  203
            + G+ LL KPV K++L TG+ +   K  TN++AL+R A LLS ER+ R   + +G
Sbjct  347  KTGEALLKKPVSKVDLETGQYDAC-KLETNEEALRRFAKLLSNERQLRHARSPHG  400


 Score = 47.4 bits (111),  Expect(2) = 1e-10, Method: Compositional matrix adjust.
 Identities = 40/51 (78%), Positives = 44/51 (86%), Gaps = 2/51 (4%)
 Frame = -3

Query  884  PP--GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            PP  G +ITILSIDGGGIRG+IPGTI+A+LE ELQ LDG DAR ADYFDVI
Sbjct  11   PPTYGNLITILSIDGGGIRGLIPGTILAFLESELQKLDGEDARIADYFDVI  61


 Score = 47.4 bits (111),  Expect(2) = 1e-10, Method: Compositional matrix adjust.
 Identities = 24/55 (44%), Positives = 32/55 (58%), Gaps = 1/55 (2%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPS-AGIFEVVRDATSLLAGPK*DGNPL  536
            ++PD+N RPL+A KDI  FY ++ PKIFP  +  F         + GPK DG  L
Sbjct  75   TSPDENNRPLFAAKDIKDFYLDNCPKIFPQDSCPFAPATKMIKAVTGPKYDGKYL  129



>ref|XP_010652820.1| PREDICTED: patatin-like protein 1 [Vitis vinifera]
Length=370

 Score =   100 bits (249),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 80/107 (75%), Gaps = 0/107 (0%)
 Frame = -1

Query  544  NPLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEE  365
            +PL+D F+ AS DMVD H++ IF++++   NYLRIQ+D L G T+S D  T++N++AL +
Sbjct  257  SPLVDAFTFASGDMVDLHMSLIFRSIRCEHNYLRIQDDTLSGDTSSTDKATRKNMEALVK  316

Query  364  VGkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
            +GK+LL KPV ++NL  G  EPV  AGTN++AL R A LLS+ERR R
Sbjct  317  IGKELLQKPVSRMNLDNGIFEPVENAGTNEEALTRFAKLLSDERRLR  363


 Score = 54.3 bits (129),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 34/54 (63%), Gaps = 8/54 (15%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAGIFEVVRDATSLLAGPK*DGNPL  536
            +APD+N+RPL+  +DIVPFY +H P+IFP + +          L GPK +G  L
Sbjct  53   TAPDENQRPLFMARDIVPFYLQHCPRIFPQSQL--------QTLTGPKYNGKYL  98



>ref|XP_003611771.1| Patatin-like protein [Medicago truncatula]
 gb|AES94729.1| patatin-like phospholipase [Medicago truncatula]
Length=399

 Score =   100 bits (249),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 60/113 (53%), Positives = 77/113 (68%), Gaps = 0/113 (0%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            P+ID F+ AS DMVDYH + +F ALQ+ DNYLRIQ+D L+G  ASVDV+TK NL+ L +V
Sbjct  286  PIIDCFNEASTDMVDYHNSVLFTALQSQDNYLRIQDDTLQGELASVDVSTKNNLNNLVKV  345

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRRTIAALNG  203
            G+ LL K   ++NL TG  E VP  GT ++ LKR A LLSE  + +     NG
Sbjct  346  GENLLKKKFTRVNLDTGIYETVPDKGTIEEELKRFARLLSEIAKEKKSKLQNG  398


 Score = 48.9 bits (115),  Expect(2) = 2e-10, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 37/56 (66%), Gaps = 2/56 (4%)
 Frame = -1

Query  697  SAPD-KNKRPLYAGKDIVPFYKEHGPKIFPS-AGIFEVVRDATSLLAGPK*DGNPL  536
            +AP+ K+ RPL+A K+IVPFY ++ P IFP  +GIF  + + T  L G K +G  L
Sbjct  73   AAPNPKDNRPLFAAKEIVPFYLQNLPSIFPQKSGIFAPLINITKALTGAKYNGEYL  128


 Score = 45.1 bits (105),  Expect(2) = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = -3

Query  887  IPPGGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            I P   IT+LSIDGGG+RGIIPG I+AYLE +LQ +DG DAR ADYFDVI
Sbjct  10   IKPVNFITVLSIDGGGVRGIIPGVILAYLESQLQEIDGEDARIADYFDVI  59



>ref|XP_009349524.1| PREDICTED: patatin-like protein 2 [Pyrus x bretschneideri]
Length=412

 Score =   100 bits (250),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 62/120 (52%), Positives = 86/120 (72%), Gaps = 1/120 (1%)
 Frame = -1

Query  580  ATSLLAGPK*DGNPLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVD  401
            A   L GP     PL+D+F+ AS+DMV +++AT+FQAL++ DNYLRIQ+D L  + ASVD
Sbjct  276  ALGWLIGPDFSA-PLVDIFTEASSDMVGFYLATVFQALESPDNYLRIQDDTLSRTLASVD  334

Query  400  VTTKENLDALEEVGkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRRT  221
              T ENL+ L +VG+KLL KPV +++  TGK +PV    TN++AL R+AG+LS ER  R+
Sbjct  335  NATSENLNDLVKVGEKLLKKPVSRVDFGTGKGKPVHPDITNQEALIRVAGVLSRERAERS  394


 Score = 55.8 bits (133),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 33/52 (63%), Gaps = 1/52 (2%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPS-AGIFEVVRDATSLLAGPK*DG  545
            + PD+N RPLYA KDI PFY E+GPKIFP  + I   +     +L  PK DG
Sbjct  72   TTPDENNRPLYAAKDITPFYLENGPKIFPQDSSIVANLAMNVKVLGRPKYDG  123


 Score = 48.1 bits (113),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 43/51 (84%), Gaps = 2/51 (4%)
 Frame = -3

Query  884  PP--GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            PP  G +IT+LSIDGGGIRGIIPG I+++LE ELQ LDG DAR ADYFDVI
Sbjct  8    PPTNGSLITVLSIDGGGIRGIIPGIILSFLESELQKLDGKDARLADYFDVI  58



>ref|XP_008457877.1| PREDICTED: LOW QUALITY PROTEIN: patatin-like protein 2 [Cucumis 
melo]
Length=392

 Score =   100 bits (249),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 57/108 (53%), Positives = 76/108 (70%), Gaps = 0/108 (0%)
 Frame = -1

Query  547  GNPLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALE  368
              P++D+FS ASADMVDYHI++IFQ+     NYLRIQ+D L G  +SVD+ T ENL  L 
Sbjct  282  ATPIVDIFSDASADMVDYHISSIFQSDHCHKNYLRIQDDTLSGEVSSVDIATAENLLKLI  341

Query  367  EVGkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
             VG+ LL KP+ ++NL +GK EP+   GTN+ AL   A +LS+ER+ R
Sbjct  342  YVGEDLLKKPLSRVNLESGKFEPLDAQGTNEQALTEFAKMLSDERKLR  389


 Score = 52.4 bits (124),  Expect(2) = 4e-12, Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 29/52 (56%), Gaps = 1/52 (2%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAGIFEV-VRDATSLLAGPK*DG  545
            +APDKN RPLY   D+  FY EH PKIFP    F   +      + GPK DG
Sbjct  68   TAPDKNNRPLYTASDVALFYIEHAPKIFPQRNYFLCSLVXFFGKVMGPKYDG  119


 Score = 47.4 bits (111),  Expect(2) = 4e-12, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
 Frame = -3

Query  896  AASIPPGGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
             A    G  ITILSIDGGGIRGIIP  I+A+LE +LQ LDGPD R ADYFDVI
Sbjct  2    VADFTKGKXITILSIDGGGIRGIIPSIILAFLELKLQELDGPDVRIADYFDVI  54



>emb|CBI21444.3| unnamed protein product [Vitis vinifera]
Length=432

 Score =   100 bits (250),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 63/141 (45%), Positives = 92/141 (65%), Gaps = 9/141 (6%)
 Frame = -1

Query  634  EHGPKIFPSAGIFEVVRDATSLLAGPK*DGNPLIDVFSVASADMVDYHIATIFQALQAGD  455
            ++  K+    G+   + D  S L  P+  G         ASADMVD+H   +F+AL + +
Sbjct  270  KYTAKMAAKWGVLGWLYDNGSTLLSPRVSG---------ASADMVDFHNCVVFEALHSEE  320

Query  454  NYLRIQEDDLKGSTASVDVTTKENLDALEEVGkklltkpvlklnlLTGKNEPVPKAGTNK  275
            NYLRI +D LKG+ ASV++ TK+NLD+L ++G++LL KPV ++NL TGK EP+   GTN+
Sbjct  321  NYLRIDDDTLKGTVASVNIATKKNLDSLVKLGEELLKKPVSRVNLDTGKYEPIKNGGTNE  380

Query  274  DALKRLAGLLSEERRRRTIAA  212
            +AL R A LLS+E+R R  +A
Sbjct  381  EALIRFAKLLSDEKRLRESSA  401


 Score = 55.1 bits (131),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 35/55 (64%), Gaps = 1/55 (2%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIF-PSAGIFEVVRDATSLLAGPK*DGNPL  536
            +AP++  RPLYA   I PFY E+ PKIF P +GIF  + +   +L GPK DG  L
Sbjct  78   TAPNQENRPLYAASGIKPFYLENCPKIFPPRSGIFGTIVNLFKVLTGPKYDGKYL  132


 Score = 51.6 bits (122),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 67/94 (71%), Gaps = 5/94 (5%)
 Frame = -3

Query  908  GEYNAASI---PP--GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFD  744
            GE  ++S+   PP  G +ITILSIDGGG+RGIIPG I+A+LE ELQ LDG DAR ADYFD
Sbjct  3    GETTSSSLQIKPPARGNLITILSIDGGGVRGIIPGIILAFLESELQKLDGEDARLADYFD  62

Query  743  VIagtstgglmttmlfgaGQEQAPPLRRQGYCPF  642
            VIAGTSTGGL+T ML    QE  P     G  PF
Sbjct  63   VIAGTSTGGLITAMLTAPNQENRPLYAASGIKPF  96



>ref|XP_009780403.1| PREDICTED: patatin-like protein 2 [Nicotiana sylvestris]
Length=427

 Score =   100 bits (250),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 58/109 (53%), Positives = 79/109 (72%), Gaps = 0/109 (0%)
 Frame = -1

Query  544  NPLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEE  365
            +PL+DVF  ASAD+VD H++T+FQ+LQ   NYLRIQ+D L G  AS+DV+T EN+  L +
Sbjct  301  SPLLDVFGDASADIVDIHLSTMFQSLQNEKNYLRIQDDSLTGEAASMDVSTTENMKTLVQ  360

Query  364  VGkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRRTI  218
            +G  LL KPV ++NL TG+ E V   GTN++A  R A LLSE+R+ R +
Sbjct  361  IGNDLLKKPVSRVNLDTGRYEEVSGEGTNEEAFIRFAKLLSEQRKLRQL  409


 Score = 65.9 bits (159),  Expect(2) = 7e-16, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAGIFEVVRDATSLLAGPK*DGNPL  536
            +AP+K+ RPLYA K+I  FY +HGPKIFP +     V+  T+L  GPK DGN L
Sbjct  89   TAPNKDNRPLYAAKNITNFYMDHGPKIFPESSRSGFVKRITNLFGGPKYDGNYL  142


 Score = 46.2 bits (108),  Expect(2) = 7e-16, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = -3

Query  878  GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            G ++T+LSIDGGGIRGIIPGT++A+LE +LQ +DGP+AR ADYFDV+
Sbjct  29   GKIVTVLSIDGGGIRGIIPGTLLAFLESKLQDIDGPNARIADYFDVV  75



>ref|XP_011099197.1| PREDICTED: patatin-like protein 2 [Sesamum indicum]
Length=433

 Score =   100 bits (250),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 56/109 (51%), Positives = 81/109 (74%), Gaps = 0/109 (0%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            PL+D++  AS+DMVD H++T+FQ+L+   NYLRIQED L G  +S+D++T +N+  L ++
Sbjct  304  PLLDIYGDASSDMVDIHVSTLFQSLRNEQNYLRIQEDRLAGDASSLDISTIKNMQTLVQI  363

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRRTIA  215
            G+ LL KPV ++NL TG+ EPV   GTN+ AL R A LLS+ER+ R+ A
Sbjct  364  GESLLKKPVSRVNLETGRPEPVHGEGTNEQALARFAKLLSDERKLRSPA  412


 Score = 54.3 bits (129),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 33/54 (61%), Gaps = 0/54 (0%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAGIFEVVRDATSLLAGPK*DGNPL  536
            SAP K+ RP++A  +I  FY EH P IFP +     V   T+L+AGPK DG  L
Sbjct  91   SAPGKDNRPVFAASNITNFYLEHCPNIFPESRRNNFVGTITNLVAGPKYDGKYL  144


 Score = 46.2 bits (108),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/47 (77%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = -3

Query  878  GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            G ++T+LSIDGGGIRGIIPGTI+A+LE +LQ LDGP+AR ADYFDVI
Sbjct  31   GRMVTVLSIDGGGIRGIIPGTILAHLESKLQELDGPNARIADYFDVI  77



>ref|XP_008777430.1| PREDICTED: patatin-like protein 2 [Phoenix dactylifera]
Length=402

 Score =   100 bits (249),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 61/106 (58%), Positives = 77/106 (73%), Gaps = 0/106 (0%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            PLI+ F+ ASADMVD H+  +FQAL   +NYLRIQ+D+L GST+SVDV+TKENL  L ++
Sbjct  290  PLINAFTQASADMVDIHLCAMFQALACRENYLRIQDDNLIGSTSSVDVSTKENLLKLVQI  349

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
            G  LL K V ++NL TG  E V    TN++AL RLA  LS+ERR R
Sbjct  350  GSDLLKKHVSRVNLETGLFEEVKGDVTNEEALTRLAKRLSDERRLR  395


 Score = 55.8 bits (133),  Expect(2) = 4e-12, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 33/55 (60%), Gaps = 1/55 (2%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPS-AGIFEVVRDATSLLAGPK*DGNPL  536
            + P+K+ RPL+A KDI  FY EH PKIFP   GI   +    + + GPK DG  L
Sbjct  76   TTPNKDNRPLFAAKDITKFYLEHCPKIFPQKTGILSSITKLFTAVTGPKYDGKYL  130


 Score = 43.5 bits (101),  Expect(2) = 4e-12, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 44/51 (86%), Gaps = 2/51 (4%)
 Frame = -3

Query  884  PP--GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            PP  G ++T+LSIDGGG+RGIIPGTI+A+LE +LQ LDG DAR ADYFD+I
Sbjct  12   PPCKGRLVTVLSIDGGGVRGIIPGTILAFLESKLQDLDGKDARIADYFDII  62



>ref|XP_006660709.1| PREDICTED: patatin-2-Kuras 2-like isoform X1 [Oryza brachyantha]
Length=344

 Score = 99.8 bits (247),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 60/109 (55%), Positives = 80/109 (73%), Gaps = 4/109 (4%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            PL+D+F+ ASADMVD HIA +F+ L +  NYLRIQ+D L+G+ ASVDV T++NL+ L  V
Sbjct  231  PLVDIFTQASADMVDIHIAAVFKVLHSEQNYLRIQDDTLQGTVASVDVATRDNLEKLANV  290

Query  361  GkklltkpvlklnlLTGKNEPV---PKAGTNKDALKRLAGLLSEERRRR  224
            G+ LL KPV + NL TG+  P    P+  TN++ALKR A LLS+E+R R
Sbjct  291  GEILLNKPVSRANLETGQMVPACDDPEM-TNREALKRFAKLLSDEKRIR  338


 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 34/58 (59%), Gaps = 1/58 (2%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPSA-GIFEVVRDATSLLAGPK*DGNPLIDV  527
            + P+KN+RPL+A KDI  FY  H PKIFP   G F  +      ++GP  DG  L +V
Sbjct  15   ATPNKNRRPLFAAKDIKEFYMNHSPKIFPQLRGPFGRMMRIVRSMSGPSYDGKHLHEV  72



>ref|XP_006380722.1| hypothetical protein POPTR_0007s11370g [Populus trichocarpa]
 gb|ERP58519.1| hypothetical protein POPTR_0007s11370g [Populus trichocarpa]
Length=387

 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 54/106 (51%), Positives = 75/106 (71%), Gaps = 0/106 (0%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            P+ID+FS AS+DMVDYHI+T+FQ+L + + YLRIQ+D L G  ASVD+ T +NL  L+E+
Sbjct  279  PIIDMFSSASSDMVDYHISTLFQSLDSKEWYLRIQDDKLSGDAASVDIATPQNLQRLKEI  338

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
            G  LL K   ++NL TGK E +    TN+ AL + A  LS+E++ R
Sbjct  339  GAALLKKTESRVNLDTGKYEEIEGGRTNEAALAKFAQFLSDEKKHR  384


 Score = 53.1 bits (126),  Expect(2) = 2e-10, Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 32/54 (59%), Gaps = 2/54 (4%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAGIFEVVRDATSLLAGPK*DGNPL  536
            +AP+K  RP+YA KDI+ FY +H PKIFP      ++   +    GPK DG  L
Sbjct  68   AAPNKENRPMYAAKDIIDFYLDHSPKIFPQKS--NLLGPLSIFFGGPKYDGKYL  119


 Score = 40.8 bits (94),  Expect(2) = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = -3

Query  872  VITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            V T+LSIDGGGIRGIIPG+++A+LE +LQ LDG  AR ADYFD+I
Sbjct  10   VATVLSIDGGGIRGIIPGSLLAFLESKLQELDGSQARIADYFDII  54



>ref|XP_009626816.1| PREDICTED: patatin-like protein 3 [Nicotiana tomentosiformis]
Length=412

 Score =   100 bits (249),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 55/106 (52%), Positives = 79/106 (75%), Gaps = 0/106 (0%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            P++DV++ ASADMVD H++T+FQ L++  NYLRIQED+L G   S+D+ T +N+  L ++
Sbjct  304  PILDVYNDASADMVDIHVSTMFQTLRSEKNYLRIQEDNLIGDATSMDIATTKNMQTLVQI  363

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
            G  LL KPV ++NL TG+ EPV   GTN++AL R A LLS+E++ R
Sbjct  364  GNNLLKKPVSRVNLETGQYEPVQGEGTNEEALIRFAKLLSQEKKLR  409


 Score = 58.9 bits (141),  Expect(2) = 9e-12, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 33/54 (61%), Gaps = 0/54 (0%)
 Frame = -1

Query  697  SAPDKNKRPLYAGKDIVPFYKEHGPKIFPSAGIFEVVRDATSLLAGPK*DGNPL  536
            +AP+++ RPLYA KDI  FY EH P IFP+      V    +L  GPK DGN L
Sbjct  92   TAPNRDNRPLYAAKDISNFYMEHCPHIFPANRRNSFVHRIFNLFGGPKYDGNYL  145


 Score = 39.3 bits (90),  Expect(2) = 9e-12, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = -3

Query  902  YNAASIPPGGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            +  A+      IT+LSIDGGGIRGIIPGT++A+LE +LQ +DG +AR  DYFDV+
Sbjct  24   FVCAATKGKNFITVLSIDGGGIRGIIPGTLLAFLESKLQEVDGRNARIIDYFDVV  78



>gb|KFK30329.1| hypothetical protein AALP_AA7G247700 [Arabis alpina]
Length=415

 Score =   100 bits (249),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 55/106 (52%), Positives = 77/106 (73%), Gaps = 0/106 (0%)
 Frame = -1

Query  541  PLIDVFSVASADMVDYHIATIFQALQAGDNYLRIQEDDLKGSTASVDVTTKENLDALEEV  362
            P++D ++ A  DMVDY  + +FQAL++  NYLRI +D LKG   SVD++T+EN++ L EV
Sbjct  301  PILDCYNEAIHDMVDYQSSVVFQALRSEKNYLRIDDDTLKGDLGSVDISTEENMEGLVEV  360

Query  361  GkklltkpvlklnlLTGKNEPVPKAGTNKDALKRLAGLLSEERRRR  224
            G+ LL K V ++NL TG  EP+P   TN++ALKR A +LS+ERR R
Sbjct  361  GEALLKKRVSRVNLETGHYEPIPDHVTNEEALKRFAKVLSDERRLR  406


 Score = 49.3 bits (116),  Expect(2) = 7e-11, Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 30/51 (59%), Gaps = 1/51 (2%)
 Frame = -1

Query  685  KNKRPLYAGKDIVPFYKEHGPKIFPSA-GIFEVVRDATSLLAGPK*DGNPL  536
            +  RPL+A K+IVPFY  H P+IFP   G+   V     L+ GPK +G  L
Sbjct  91   RRNRPLFAAKEIVPFYLNHSPRIFPQPRGMCSWVDTIVRLVRGPKYNGKYL  141


 Score = 45.8 bits (107),  Expect(2) = 7e-11, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 45/55 (82%), Gaps = 2/55 (4%)
 Frame = -3

Query  896  AASIPP--GGVITILSidgggirgiipgtIVAYLEEELQALDGPDARAADYFDVI  738
            +  +PP  G ++TILSIDGGGIRGIIPGTI+AYLE +LQ LDG +AR  DYFDVI
Sbjct  9    SCCLPPSYGQLVTILSIDGGGIRGIIPGTILAYLESQLQELDGEEARLVDYFDVI  63



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2679384764527