BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig11102

Length=761
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006363899.1|  PREDICTED: histone-lysine N-methyltransferas...    219   2e-64   Solanum tuberosum [potatoes]
ref|XP_010322911.1|  PREDICTED: histone-lysine N-methyltransferas...    219   2e-64   
ref|XP_006363898.1|  PREDICTED: histone-lysine N-methyltransferas...    219   2e-64   Solanum tuberosum [potatoes]
ref|XP_004242023.1|  PREDICTED: histone-lysine N-methyltransferas...    219   3e-64   Solanum lycopersicum
ref|XP_009618109.1|  PREDICTED: histone-lysine N-methyltransferas...    219   4e-64   Nicotiana tomentosiformis
ref|XP_012078167.1|  PREDICTED: histone-lysine N-methyltransferas...    214   2e-62   Jatropha curcas
ref|XP_011097714.1|  PREDICTED: histone-lysine N-methyltransferas...    214   5e-62   Sesamum indicum [beniseed]
gb|KJB29250.1|  hypothetical protein B456_005G091200                    209   7e-62   Gossypium raimondii
ref|XP_010664253.1|  PREDICTED: histone-lysine N-methyltransferas...    211   2e-61   
gb|KDO80753.1|  hypothetical protein CISIN_1g011626mg                   207   3e-61   Citrus sinensis [apfelsine]
ref|XP_010664252.1|  PREDICTED: histone-lysine N-methyltransferas...    211   5e-61   Vitis vinifera
emb|CDP12437.1|  unnamed protein product                                203   5e-61   Coffea canephora [robusta coffee]
gb|KDO80752.1|  hypothetical protein CISIN_1g011626mg                   207   7e-61   Citrus sinensis [apfelsine]
ref|XP_006434126.1|  hypothetical protein CICLE_v10001105mg             209   1e-60   
ref|XP_009764580.1|  PREDICTED: histone-lysine N-methyltransferas...    210   1e-60   Nicotiana sylvestris
gb|KJB29253.1|  hypothetical protein B456_005G091200                    209   2e-60   Gossypium raimondii
gb|KJB29249.1|  hypothetical protein B456_005G091200                    209   2e-60   Gossypium raimondii
ref|XP_008233908.1|  PREDICTED: histone-lysine N-methyltransferas...    209   2e-60   Prunus mume [ume]
gb|KJB29252.1|  hypothetical protein B456_005G091200                    209   2e-60   Gossypium raimondii
gb|KDO80749.1|  hypothetical protein CISIN_1g011626mg                   207   2e-60   Citrus sinensis [apfelsine]
gb|KDO80750.1|  hypothetical protein CISIN_1g011626mg                   207   4e-60   Citrus sinensis [apfelsine]
ref|XP_008361556.1|  PREDICTED: histone-lysine N-methyltransferas...    197   5e-60   
ref|XP_006472718.1|  PREDICTED: histone-lysine N-methyltransferas...    208   5e-60   Citrus sinensis [apfelsine]
gb|KDO80748.1|  hypothetical protein CISIN_1g011626mg                   207   8e-60   Citrus sinensis [apfelsine]
gb|KDO80751.1|  hypothetical protein CISIN_1g011626mg                   207   8e-60   Citrus sinensis [apfelsine]
ref|XP_002513816.1|  protein with unknown function                      206   4e-59   Ricinus communis
ref|XP_006409221.1|  hypothetical protein EUTSA_v10022664mg             204   3e-58   Eutrema salsugineum [saltwater cress]
ref|XP_009366986.1|  PREDICTED: histone-lysine N-methyltransferas...    203   5e-58   Pyrus x bretschneideri [bai li]
ref|XP_009366987.1|  PREDICTED: histone-lysine N-methyltransferas...    203   5e-58   Pyrus x bretschneideri [bai li]
ref|XP_007222803.1|  hypothetical protein PRUPE_ppa005026mg             203   5e-58   Prunus persica
ref|XP_010272881.1|  PREDICTED: histone-lysine N-methyltransferas...    203   6e-58   Nelumbo nucifera [Indian lotus]
ref|XP_009121063.1|  PREDICTED: histone-lysine N-methyltransferas...    202   1e-57   
ref|XP_009764587.1|  PREDICTED: histone-lysine N-methyltransferas...    201   3e-57   Nicotiana sylvestris
ref|XP_004500596.1|  PREDICTED: histone-lysine N-methyltransferas...    200   3e-57   
ref|XP_007018969.1|  SET domain protein isoform 2                       201   4e-57   
emb|CDY38142.1|  BnaA07g02410D                                          200   5e-57   Brassica napus [oilseed rape]
gb|KHG02872.1|  Histone-lysine N-methyltransferase ASHR1 -like pr...    199   9e-57   Gossypium arboreum [tree cotton]
ref|XP_004500595.1|  PREDICTED: histone-lysine N-methyltransferas...    199   1e-56   Cicer arietinum [garbanzo]
ref|XP_002886136.1|  hypothetical protein ARALYDRAFT_319740             199   2e-56   
ref|XP_009121064.1|  PREDICTED: histone-lysine N-methyltransferas...    198   3e-56   
gb|KEH34847.1|  histone-lysine N-methyltransferase                      197   3e-56   Medicago truncatula
ref|XP_009121061.1|  PREDICTED: histone-lysine N-methyltransferas...    198   3e-56   Brassica rapa
ref|XP_008338790.1|  PREDICTED: histone-lysine N-methyltransferas...    198   4e-56   
gb|AES71348.2|  histone-lysine N-methyltransferase                      197   4e-56   Medicago truncatula
gb|AFK47176.1|  unknown                                                 197   6e-56   Medicago truncatula
ref|XP_010230948.1|  PREDICTED: histone-lysine N-methyltransferas...    196   1e-55   
ref|XP_008782266.1|  PREDICTED: histone-lysine N-methyltransferas...    195   1e-55   
ref|XP_003560708.1|  PREDICTED: histone-lysine N-methyltransferas...    196   1e-55   Brachypodium distachyon [annual false brome]
ref|XP_011012502.1|  PREDICTED: histone-lysine N-methyltransferas...    196   2e-55   Populus euphratica
ref|XP_008782264.1|  PREDICTED: histone-lysine N-methyltransferas...    196   2e-55   Phoenix dactylifera
ref|XP_011012501.1|  PREDICTED: histone-lysine N-methyltransferas...    196   3e-55   Populus euphratica
ref|XP_011001421.1|  PREDICTED: histone-lysine N-methyltransferas...    196   3e-55   Populus euphratica
ref|XP_011012500.1|  PREDICTED: histone-lysine N-methyltransferas...    196   3e-55   Populus euphratica
ref|XP_002464022.1|  hypothetical protein SORBIDRAFT_01g010740          196   3e-55   Sorghum bicolor [broomcorn]
ref|XP_007018970.1|  SET domain protein isoform 3                       196   3e-55   
ref|XP_011001420.1|  PREDICTED: histone-lysine N-methyltransferas...    196   3e-55   Populus euphratica
ref|XP_011001419.1|  PREDICTED: histone-lysine N-methyltransferas...    196   3e-55   Populus euphratica
ref|XP_011001418.1|  PREDICTED: histone-lysine N-methyltransferas...    196   4e-55   Populus euphratica
ref|XP_011655179.1|  PREDICTED: histone-lysine N-methyltransferas...    192   5e-55   Cucumis sativus [cucumbers]
ref|XP_010489431.1|  PREDICTED: histone-lysine N-methyltransferas...    194   1e-54   Camelina sativa [gold-of-pleasure]
dbj|BAJ98467.1|  predicted protein                                      184   1e-54   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002306611.1|  zinc finger family protein                         193   1e-54   
ref|XP_006578981.1|  PREDICTED: histone-lysine N-methyltransferas...    194   1e-54   Glycine max [soybeans]
ref|XP_007018968.1|  SET domain protein isoform 1                       193   2e-54   
ref|XP_010065502.1|  PREDICTED: histone-lysine N-methyltransferas...    193   3e-54   Eucalyptus grandis [rose gum]
ref|NP_849969.1|  SET domain group protein 37                           192   4e-54   
ref|XP_010065503.1|  PREDICTED: histone-lysine N-methyltransferas...    186   5e-54   Eucalyptus grandis [rose gum]
ref|XP_006297545.1|  hypothetical protein CARUB_v10013566mg             192   5e-54   Capsella rubella
ref|XP_011655178.1|  PREDICTED: histone-lysine N-methyltransferas...    191   5e-54   Cucumis sativus [cucumbers]
ref|XP_010467589.1|  PREDICTED: histone-lysine N-methyltransferas...    192   6e-54   Camelina sativa [gold-of-pleasure]
ref|XP_004982043.1|  PREDICTED: histone-lysine N-methyltransferas...    192   6e-54   Setaria italica
ref|NP_001131420.1|  histone-lysine N-methyltransferase ASHR1           192   7e-54   Zea mays [maize]
gb|ACG37550.1|  histone-lysine N-methyltransferase ASHR1                192   7e-54   Zea mays [maize]
ref|XP_011655177.1|  PREDICTED: histone-lysine N-methyltransferas...    192   8e-54   Cucumis sativus [cucumbers]
gb|KGN50970.1|  hypothetical protein Csa_5G376270                       192   1e-53   Cucumis sativus [cucumbers]
gb|AAS07242.1|  putative MYND finger protein                            191   1e-53   Oryza sativa Japonica Group [Japonica rice]
emb|CDY63757.1|  BnaCnng42550D                                          191   1e-53   Brassica napus [oilseed rape]
gb|KHN09175.1|  Histone-lysine N-methyltransferase ASHR1-like pro...    186   2e-53   Glycine soja [wild soybean]
ref|XP_010926454.1|  PREDICTED: histone-lysine N-methyltransferas...    189   2e-53   Elaeis guineensis
ref|XP_010538974.1|  PREDICTED: histone-lysine N-methyltransferas...    191   2e-53   Tarenaya hassleriana [spider flower]
ref|XP_010926453.1|  PREDICTED: histone-lysine N-methyltransferas...    188   5e-53   Elaeis guineensis
ref|XP_003601097.1|  Histone-lysine N-methyltransferase ASHR1           190   5e-53   
ref|XP_010666085.1|  PREDICTED: histone-lysine N-methyltransferas...    189   6e-53   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010926451.1|  PREDICTED: histone-lysine N-methyltransferas...    189   8e-53   
ref|XP_010694872.1|  PREDICTED: histone-lysine N-methyltransferas...    189   8e-53   
ref|XP_010926450.1|  PREDICTED: histone-lysine N-methyltransferas...    189   1e-52   Elaeis guineensis
gb|EYU22920.1|  hypothetical protein MIMGU_mgv1a005471mg                188   2e-52   Erythranthe guttata [common monkey flower]
ref|XP_009390922.1|  PREDICTED: histone-lysine N-methyltransferas...    188   2e-52   Musa acuminata subsp. malaccensis [pisang utan]
gb|EEC76031.1|  hypothetical protein OsI_13199                          187   5e-52   Oryza sativa Indica Group [Indian rice]
gb|ABF98444.1|  MYND finger family protein, expressed                   187   5e-52   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008465815.1|  PREDICTED: histone-lysine N-methyltransferas...    186   2e-51   Cucumis melo [Oriental melon]
ref|XP_008465808.1|  PREDICTED: histone-lysine N-methyltransferas...    186   2e-51   
ref|XP_006650467.1|  PREDICTED: histone-lysine N-methyltransferas...    184   9e-51   Oryza brachyantha
ref|XP_007137368.1|  hypothetical protein PHAVU_009G121500g             182   3e-50   Phaseolus vulgaris [French bean]
ref|XP_008465812.1|  PREDICTED: histone-lysine N-methyltransferas...    176   3e-48   Cucumis melo [Oriental melon]
gb|AGZ15368.1|  histone-lysine N-methyltransferase ASHR1-like pro...    176   1e-47   Phaseolus vulgaris [French bean]
ref|XP_008465811.1|  PREDICTED: histone-lysine N-methyltransferas...    176   1e-47   Cucumis melo [Oriental melon]
ref|XP_008465809.1|  PREDICTED: histone-lysine N-methyltransferas...    176   1e-47   Cucumis melo [Oriental melon]
ref|XP_008465807.1|  PREDICTED: histone-lysine N-methyltransferas...    176   1e-47   Cucumis melo [Oriental melon]
gb|EPS73138.1|  hypothetical protein M569_01616                         173   7e-47   Genlisea aurea
gb|EMT19769.1|  Histone-lysine N-methyltransferase ASHR1                168   6e-45   
ref|XP_004290832.1|  PREDICTED: histone-lysine N-methyltransferas...    167   1e-44   Fragaria vesca subsp. vesca
ref|XP_008782265.1|  PREDICTED: histone-lysine N-methyltransferas...    157   4e-41   
gb|ERM95321.1|  hypothetical protein AMTR_s00008p00145610               154   1e-39   Amborella trichopoda
gb|EYU22918.1|  hypothetical protein MIMGU_mgv1a007180mg                152   2e-39   Erythranthe guttata [common monkey flower]
ref|XP_011626691.1|  PREDICTED: histone-lysine N-methyltransferas...    154   2e-39   
ref|XP_010926452.1|  PREDICTED: histone-lysine N-methyltransferas...    151   1e-38   
ref|XP_010322913.1|  PREDICTED: histone-lysine N-methyltransferas...    145   1e-36   
gb|ABR16570.1|  unknown                                                 144   3e-36   Picea sitchensis
ref|XP_001778213.1|  predicted protein                                  140   1e-34   
gb|ADP02224.1|  zf-MYND domain-containing protein                       136   2e-33   Triticum aestivum [Canadian hard winter wheat]
ref|XP_012078168.1|  PREDICTED: histone-lysine N-methyltransferas...    134   1e-32   
gb|AAL75997.1|AF466646_5  putative SET-domain transcriptional reg...    131   6e-32   Zea mays [maize]
gb|AFW67882.1|  hypothetical protein ZEAMMB73_219813                    127   2e-30   
ref|XP_010091345.1|  Histone-lysine N-methyltransferase                 127   3e-30   
gb|AAM97151.1|  unknown protein,3'-partial                              126   7e-30   Oryza sativa Japonica Group [Japonica rice]
gb|ACN35999.1|  unknown                                                 119   8e-30   Zea mays [maize]
ref|XP_008660114.1|  PREDICTED: histone-lysine N-methyltransferas...    124   2e-29   Zea mays [maize]
ref|XP_008660108.1|  PREDICTED: SET and MYND domain-containing pr...    124   2e-29   Zea mays [maize]
ref|XP_008660115.1|  PREDICTED: uncharacterized protein LOC103639...    121   2e-28   Zea mays [maize]
gb|EYU22919.1|  hypothetical protein MIMGU_mgv1a006005mg                119   1e-27   Erythranthe guttata [common monkey flower]
ref|XP_010666643.1|  PREDICTED: histone-lysine N-methyltransferas...    117   7e-27   
ref|XP_002981276.1|  hypothetical protein SELMODRAFT_114558             117   8e-27   
ref|XP_002969663.1|  hypothetical protein SELMODRAFT_231366             117   8e-27   Selaginella moellendorffii
gb|EEE59772.1|  hypothetical protein OsJ_12271                          116   1e-26   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007018976.1|  Histone-lysine N-methyltransferase ASHR1           114   7e-26   
ref|XP_009618110.1|  PREDICTED: histone-lysine N-methyltransferas...    105   8e-23   Nicotiana tomentosiformis
gb|KDP32757.1|  hypothetical protein JCGZ_12049                         104   1e-22   Jatropha curcas
ref|XP_009764594.1|  PREDICTED: histone-lysine N-methyltransferas...    103   7e-22   Nicotiana sylvestris
ref|XP_007018979.1|  Histone-lysine N-methyltransferase ASHR1 iso...  96.7    7e-20   
ref|XP_007018978.1|  Histone-lysine N-methyltransferase ASHR1 iso...  96.3    9e-20   
ref|XP_007018977.1|  Histone-lysine N-methyltransferase ASHR1 iso...  95.5    6e-19   
ref|XP_007018973.1|  Histone-lysine N-methyltransferase ASHR1         92.8    1e-18   
gb|KJB29251.1|  hypothetical protein B456_005G091200                  88.2    1e-16   Gossypium raimondii
ref|XP_011012503.1|  PREDICTED: histone-lysine N-methyltransferas...  84.3    2e-15   Populus euphratica
gb|AFW88215.1|  hypothetical protein ZEAMMB73_999877                  77.8    5e-13   
gb|AFW88214.1|  hypothetical protein ZEAMMB73_999877                  77.8    6e-13   
gb|EFN69720.1|  Histone-lysine N-methyltransferase ASHR1              72.4    2e-12   Camponotus floridanus
ref|XP_003969594.1|  PREDICTED: histone-lysine N-methyltransferas...  74.7    6e-12   
ref|XP_011174680.1|  PREDICTED: histone-lysine N-methyltransferas...  70.5    2e-11   
ref|XP_004367850.1|  SET and MYND domain containing 3, putative       70.9    9e-11   Acanthamoeba castellanii str. Neff
ref|XP_011345715.1|  PREDICTED: histone-lysine N-methyltransferas...  70.5    1e-10   Ooceraea biroi
ref|XP_011345713.1|  PREDICTED: histone-lysine N-methyltransferas...  70.5    1e-10   Ooceraea biroi
ref|XP_011345714.1|  PREDICTED: histone-lysine N-methyltransferas...  70.5    1e-10   Ooceraea biroi
ref|XP_011254247.1|  PREDICTED: histone-lysine N-methyltransferas...  70.1    2e-10   Camponotus floridanus
ref|XP_007540471.1|  PREDICTED: histone-lysine N-methyltransferas...  69.7    3e-10   Poecilia formosa
ref|XP_011875678.1|  PREDICTED: histone-lysine N-methyltransferas...  69.7    3e-10   Vollenhovia emeryi
ref|XP_006779990.1|  PREDICTED: histone-lysine N-methyltransferas...  69.3    3e-10   Neolamprologus brichardi [lyretail cichlid]
ref|XP_011506257.1|  PREDICTED: histone-lysine N-methyltransferas...  69.3    4e-10   Ceratosolen solmsi marchali
gb|EGI64301.1|  SET and MYND domain-containing protein 3              69.3    4e-10   Acromyrmex echinatior
ref|XP_011056400.1|  PREDICTED: histone-lysine N-methyltransferas...  69.3    4e-10   Acromyrmex echinatior
ref|XP_011056401.1|  PREDICTED: histone-lysine N-methyltransferas...  69.3    4e-10   Acromyrmex echinatior
ref|XP_008293366.1|  PREDICTED: histone-lysine N-methyltransferas...  68.9    4e-10   Stegastes partitus
ref|XP_006779989.1|  PREDICTED: histone-lysine N-methyltransferas...  68.9    4e-10   Neolamprologus brichardi [lyretail cichlid]
ref|XP_011704687.1|  PREDICTED: histone-lysine N-methyltransferas...  68.2    8e-10   Wasmannia auropunctata
ref|XP_012056540.1|  PREDICTED: histone-lysine N-methyltransferas...  68.2    8e-10   Atta cephalotes
ref|XP_011704686.1|  PREDICTED: histone-lysine N-methyltransferas...  68.2    9e-10   Wasmannia auropunctata
ref|XP_010781250.1|  PREDICTED: histone-lysine N-methyltransferas...  67.8    9e-10   Notothenia coriiceps [yellowbelly rockcod]
ref|XP_005915117.1|  PREDICTED: histone-lysine N-methyltransferas...  67.8    1e-09   Haplochromis burtoni
ref|XP_005459017.1|  PREDICTED: histone-lysine N-methyltransferas...  67.4    1e-09   
ref|XP_004539562.1|  PREDICTED: histone-lysine N-methyltransferas...  67.8    1e-09   Maylandia zebra
ref|XP_005733360.1|  PREDICTED: histone-lysine N-methyltransferas...  67.4    1e-09   Pundamilia nyererei
ref|XP_004530439.1|  PREDICTED: histone-lysine N-methyltransferas...  67.8    1e-09   Ceratitis capitata [medfly]
ref|XP_003454545.1|  PREDICTED: histone-lysine N-methyltransferas...  67.4    2e-09   Oreochromis niloticus
ref|XP_005043339.1|  PREDICTED: histone-lysine N-methyltransferas...  67.4    2e-09   Ficedula albicollis
ref|XP_008403993.1|  PREDICTED: histone-lysine N-methyltransferas...  67.4    2e-09   Poecilia reticulata
ref|XP_002188283.2|  PREDICTED: SET and MYND domain-containing pr...  65.9    3e-09   
ref|XP_010755099.1|  PREDICTED: histone-lysine N-methyltransferas...  65.9    4e-09   
ref|XP_009090154.1|  PREDICTED: histone-lysine N-methyltransferas...  65.1    5e-09   
gb|KFO53608.1|  Histone-lysine N-methyltransferase SMYD3              64.7    5e-09   Corvus brachyrhynchos
gb|EFN77865.1|  SET and MYND domain-containing protein 3              65.5    5e-09   Harpegnathos saltator
ref|XP_005489779.1|  PREDICTED: histone-lysine N-methyltransferas...  65.5    6e-09   Zonotrichia albicollis
ref|XP_005489778.1|  PREDICTED: histone-lysine N-methyltransferas...  65.5    7e-09   Zonotrichia albicollis
ref|XP_004700019.1|  PREDICTED: histone-lysine N-methyltransferas...  65.5    8e-09   Echinops telfairi [lesser hedgehog tenrec]
ref|XP_011149470.1|  PREDICTED: histone-lysine N-methyltransferas...  65.1    8e-09   
gb|ESA08452.1|  hypothetical protein GLOINDRAFT_210128                65.5    8e-09   
gb|EXX52497.1|  Set6p                                                 65.1    8e-09   Rhizophagus irregularis DAOM 197198w
ref|XP_009985112.1|  PREDICTED: histone-lysine N-methyltransferas...  61.2    1e-08   Tauraco erythrolophus
ref|XP_008308612.1|  PREDICTED: histone-lysine N-methyltransferas...  65.1    1e-08   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_011491788.1|  PREDICTED: histone-lysine N-methyltransferas...  64.7    1e-08   
ref|XP_319707.4|  AGAP008954-PA                                       64.3    2e-08   Anopheles gambiae str. PEST
ref|XP_009811023.1|  PREDICTED: histone-lysine N-methyltransferas...  60.8    2e-08   Gavia stellata
gb|KFP00980.1|  Histone-lysine N-methyltransferase SMYD3              63.2    2e-08   Calypte anna
gb|KGM00140.1|  Histone-lysine N-methyltransferase SMYD3              62.8    2e-08   Charadrius vociferus
ref|XP_008638455.1|  PREDICTED: LOW QUALITY PROTEIN: histone-lysi...  63.9    2e-08   
ref|XP_005796279.1|  PREDICTED: histone-lysine N-methyltransferas...  63.9    2e-08   
ref|XP_010664254.1|  PREDICTED: histone-lysine N-methyltransferas...  55.8    3e-08   Vitis vinifera
gb|KFV18406.1|  Histone-lysine N-methyltransferase SMYD3              61.2    3e-08   Tauraco erythrolophus
ref|XP_005416292.1|  PREDICTED: histone-lysine N-methyltransferas...  63.5    3e-08   
ref|XP_005526931.1|  PREDICTED: histone-lysine N-methyltransferas...  63.5    3e-08   Pseudopodoces humilis [Tibetan ground-jay]
ref|XP_010390163.1|  PREDICTED: histone-lysine N-methyltransferas...  63.5    3e-08   
gb|KFU94882.1|  SET and MYND domain-containing protein 3              62.4    4e-08   Chaetura pelagica
ref|XP_011163573.1|  PREDICTED: histone-lysine N-methyltransferas...  60.5    4e-08   
ref|XP_009891966.1|  PREDICTED: histone-lysine N-methyltransferas...  63.2    4e-08   Charadrius vociferus
ref|XP_002109888.1|  hypothetical protein TRIADDRAFT_53251            63.2    4e-08   Trichoplax adhaerens
gb|KFW86090.1|  Histone-lysine N-methyltransferase SMYD3              62.0    5e-08   Manacus vitellinus
ref|XP_008492237.1|  PREDICTED: histone-lysine N-methyltransferas...  62.8    5e-08   Calypte anna
ref|XP_009840545.1|  hypothetical protein H257_14434                  62.8    5e-08   Aphanomyces astaci
ref|XP_010002917.1|  PREDICTED: histone-lysine N-methyltransferas...  62.4    7e-08   Chaetura pelagica
ref|XP_008928311.1|  PREDICTED: histone-lysine N-methyltransferas...  62.0    7e-08   
ref|XP_006626128.1|  PREDICTED: histone-lysine N-methyltransferas...  62.4    8e-08   Lepisosteus oculatus
ref|XP_011212036.1|  PREDICTED: histone-lysine N-methyltransferas...  62.4    9e-08   
ref|XP_003490836.1|  PREDICTED: SET and MYND domain-containing pr...  62.0    9e-08   Bombus impatiens
ref|XP_009506851.1|  PREDICTED: histone-lysine N-methyltransferas...  61.2    1e-07   Phalacrocorax carbo [common cormorant]
gb|KFV67688.1|  Histone-lysine N-methyltransferase SMYD3              60.8    1e-07   Picoides pubescens
gb|KFQ82155.1|  Histone-lysine N-methyltransferase SMYD3              60.8    1e-07   Phaethon lepturus
ref|XP_010705249.1|  PREDICTED: histone-lysine N-methyltransferas...  60.1    2e-07   Meleagris gallopavo [common turkey]
ref|XP_010292649.1|  PREDICTED: histone-lysine N-methyltransferas...  60.5    2e-07   Phaethon lepturus
ref|XP_009899229.1|  PREDICTED: LOW QUALITY PROTEIN: histone-lysi...  61.2    2e-07   Picoides pubescens
ref|XP_011419033.1|  PREDICTED: histone-lysine N-methyltransferas...  60.8    2e-07   Crassostrea gigas
ref|XP_007422322.1|  PREDICTED: histone-lysine N-methyltransferas...  60.8    2e-07   Python bivittatus
ref|XP_005146080.1|  PREDICTED: histone-lysine N-methyltransferas...  60.8    2e-07   Melopsittacus undulatus
gb|KFR16655.1|  Histone-lysine N-methyltransferase SMYD3              60.1    2e-07   Opisthocomus hoazin [hoatzin]
ref|XP_008184392.1|  PREDICTED: histone-lysine N-methyltransferas...  60.8    3e-07   Acyrthosiphon pisum
ref|XP_009319544.1|  PREDICTED: histone-lysine N-methyltransferas...  60.8    3e-07   Pygoscelis adeliae
ref|XP_003394366.1|  PREDICTED: SET and MYND domain-containing pr...  60.5    3e-07   Bombus terrestris [large earth bumblebee]
ref|XP_005508782.1|  PREDICTED: histone-lysine N-methyltransferas...  60.5    4e-07   
ref|XP_009940480.1|  PREDICTED: histone-lysine N-methyltransferas...  59.7    5e-07   Opisthocomus hoazin [hoatzin]
ref|XP_009461995.1|  PREDICTED: histone-lysine N-methyltransferas...  60.1    5e-07   Nipponia nippon
ref|XP_008908858.1|  hypothetical protein, variant 1                  60.1    5e-07   Phytophthora parasitica INRA-310
ref|XP_009910221.1|  PREDICTED: histone-lysine N-methyltransferas...  59.3    5e-07   Haliaeetus albicilla
gb|KFP98686.1|  Histone-lysine N-methyltransferase SMYD3              59.3    5e-07   Haliaeetus albicilla
ref|XP_011573182.1|  PREDICTED: histone-lysine N-methyltransferas...  59.7    5e-07   Aquila chrysaetos canadensis
ref|XP_008908860.1|  hypothetical protein, variant 3                  59.7    5e-07   Phytophthora parasitica INRA-310
gb|KFW93105.1|  Histone-lysine N-methyltransferase SMYD3              58.9    6e-07   Phalacrocorax carbo [common cormorant]
ref|XP_008908857.1|  hypothetical protein PPTG_13178                  59.7    6e-07   Phytophthora parasitica INRA-310
ref|XP_008908859.1|  hypothetical protein, variant 2                  59.7    6e-07   Phytophthora parasitica INRA-310
ref|XP_009643004.1|  PREDICTED: histone-lysine N-methyltransferas...  59.7    6e-07   Egretta garzetta
gb|KDR23505.1|  SET and MYND domain-containing protein 3              59.7    6e-07   Zootermopsis nevadensis
gb|KFP20822.1|  Histone-lysine N-methyltransferase SMYD3              58.9    6e-07   Egretta garzetta
gb|ETK82361.1|  hypothetical protein, variant 1                       59.7    6e-07   Phytophthora parasitica
ref|XP_002100247.1|  GE16937                                          59.7    6e-07   Drosophila yakuba
gb|ETK82363.1|  hypothetical protein, variant 3                       59.7    7e-07   Phytophthora parasitica
gb|AAM51103.1|  SD20045p                                              59.3    7e-07   Drosophila melanogaster
ref|XP_005827049.1|  hypothetical protein GUITHDRAFT_164767           59.7    7e-07   Guillardia theta CCMP2712
ref|XP_008877093.1|  hypothetical protein H310_11978                  59.3    7e-07   Aphanomyces invadans
ref|XP_419536.1|  PREDICTED: histone-lysine N-methyltransferase S...  59.3    8e-07   
gb|ETK82360.1|  hypothetical protein L915_12245                       59.3    8e-07   Phytophthora parasitica
ref|XP_004935489.1|  PREDICTED: histone-lysine N-methyltransferas...  59.3    8e-07   
ref|XP_004935490.1|  PREDICTED: histone-lysine N-methyltransferas...  59.3    8e-07   
gb|ETK82362.1|  hypothetical protein, variant 2                       59.3    8e-07   Phytophthora parasitica
gb|ELU10312.1|  hypothetical protein CAPTEDRAFT_158133                59.3    8e-07   Capitella teleta
ref|XP_010561240.1|  PREDICTED: histone-lysine N-methyltransferas...  59.3    8e-07   Haliaeetus leucocephalus
ref|XP_007534948.1|  PREDICTED: histone-lysine N-methyltransferas...  59.3    9e-07   Erinaceus europaeus [common hedgehog]
ref|XP_005435180.1|  PREDICTED: histone-lysine N-methyltransferas...  58.5    9e-07   
ref|XP_005232529.1|  PREDICTED: histone-lysine N-methyltransferas...  58.5    9e-07   
gb|KFW65195.1|  Histone-lysine N-methyltransferase SMYD3              58.5    9e-07   Pygoscelis adeliae
ref|XP_006871333.1|  PREDICTED: histone-lysine N-methyltransferas...  58.9    1e-06   Chrysochloris asiatica
ref|XP_006817722.1|  PREDICTED: histone-lysine N-methyltransferas...  56.2    1e-06   Saccoglossus kowalevskii
gb|KFV87334.1|  Histone-lysine N-methyltransferase SMYD3              58.2    1e-06   Struthio camelus australis
gb|KFO75240.1|  Histone-lysine N-methyltransferase SMYD3              58.2    1e-06   Cuculus canorus
ref|NP_524768.2|  buzidau                                             58.9    1e-06   Drosophila melanogaster
ref|XP_009557948.1|  PREDICTED: histone-lysine N-methyltransferas...  58.2    1e-06   Cuculus canorus
ref|XP_001982670.1|  GG12606                                          58.5    1e-06   Drosophila erecta
ref|XP_006135295.1|  PREDICTED: histone-lysine N-methyltransferas...  58.5    1e-06   
ref|XP_004375926.1|  PREDICTED: histone-lysine N-methyltransferas...  58.5    1e-06   Trichechus manatus latirostris
gb|KDO80754.1|  hypothetical protein CISIN_1g011626mg                 52.4    1e-06   Citrus sinensis [apfelsine]
gb|KFQ91065.1|  Histone-lysine N-methyltransferase SMYD3              57.8    1e-06   Nipponia nippon
ref|XP_011548612.1|  PREDICTED: histone-lysine N-methyltransferas...  58.5    2e-06   Plutella xylostella [cabbage moth]
ref|XP_009685015.1|  PREDICTED: histone-lysine N-methyltransferas...  58.2    2e-06   Struthio camelus australis
ref|XP_003698898.1|  PREDICTED: LOW QUALITY PROTEIN: SET and MYND...  58.2    2e-06   
ref|XP_009274560.1|  PREDICTED: histone-lysine N-methyltransferas...  58.2    2e-06   Aptenodytes forsteri
ref|NP_001133866.1|  SET and MYND domain-containing protein 3         57.8    3e-06   Salmo salar
ref|XP_002040530.1|  GM18871                                          57.8    3e-06   Drosophila sechellia
gb|KEH34848.1|  histone-lysine N-methyltransferase                    57.4    4e-06   Medicago truncatula
ref|XP_007670673.1|  PREDICTED: histone-lysine N-methyltransferas...  57.0    5e-06   
ref|XP_003767821.1|  PREDICTED: SET and MYND domain-containing pr...  57.0    5e-06   
ref|XP_625013.1|  PREDICTED: histone-lysine N-methyltransferase S...  57.0    5e-06   
gb|ETN62719.1|  Buzidau                                               56.6    7e-06   Anopheles darlingi [American malaria mosquito]
gb|EFZ09632.1|  hypothetical protein SINV_01274                       56.6    7e-06   
ref|XP_011172843.1|  PREDICTED: histone-lysine N-methyltransferas...  56.6    8e-06   
ref|XP_012152304.1|  PREDICTED: histone-lysine N-methyltransferas...  56.2    8e-06   Megachile rotundata
ref|XP_007058050.1|  PREDICTED: histone-lysine N-methyltransferas...  56.2    1e-05   
ref|XP_007896591.1|  PREDICTED: histone-lysine N-methyltransferas...  55.8    1e-05   Callorhinchus milii [Australian ghost shark]
ref|XP_011174281.1|  PREDICTED: uncharacterized protein LOC105206485  53.5    1e-05   
ref|NP_001290697.1|  SET and MYND domain containing 3                 55.8    1e-05   Esox lucius
ref|XP_006621993.1|  PREDICTED: histone-lysine N-methyltransferas...  55.8    1e-05   Apis dorsata [rock honeybee]
ref|XP_002998487.1|  conserved hypothetical protein                   55.8    1e-05   Phytophthora infestans T30-4
ref|XP_007896590.1|  PREDICTED: histone-lysine N-methyltransferas...  55.8    1e-05   Callorhinchus milii [Australian ghost shark]
ref|XP_011636441.1|  PREDICTED: histone-lysine N-methyltransferas...  55.8    1e-05   
ref|XP_012152302.1|  PREDICTED: histone-lysine N-methyltransferas...  55.5    1e-05   
ref|XP_007953905.1|  PREDICTED: histone-lysine N-methyltransferas...  55.5    1e-05   
ref|XP_003708212.2|  PREDICTED: histone-lysine N-methyltransferas...  55.5    1e-05   
ref|XP_001627600.1|  predicted protein                                55.5    1e-05   
ref|NP_001032477.1|  histone-lysine N-methyltransferase SMYD3         55.5    2e-05   
ref|XP_011636440.1|  PREDICTED: histone-lysine N-methyltransferas...  55.5    2e-05   
ref|XP_003411069.1|  PREDICTED: histone-lysine N-methyltransferas...  55.5    2e-05   
ref|XP_006621991.1|  PREDICTED: histone-lysine N-methyltransferas...  55.5    2e-05   
dbj|BAE39889.1|  unnamed protein product                              55.1    2e-05   
ref|XP_010212837.1|  PREDICTED: histone-lysine N-methyltransferas...  54.7    2e-05   
gb|KGL77171.1|  Histone-lysine N-methyltransferase SMYD3              54.3    2e-05   
gb|KFB52460.1|  AGAP008954-PA-like protein                            55.1    2e-05   
ref|XP_003798851.1|  PREDICTED: SET and MYND domain-containing pr...  55.1    2e-05   
ref|XP_011189668.1|  PREDICTED: histone-lysine N-methyltransferas...  54.7    3e-05   
ref|XP_006974285.1|  PREDICTED: histone-lysine N-methyltransferas...  54.7    3e-05   
ref|XP_009044509.1|  hypothetical protein LOTGIDRAFT_177746           54.7    3e-05   
ref|XP_002163555.2|  PREDICTED: uncharacterized protein LOC100200645  54.3    4e-05   
ref|XP_009534842.1|  hypothetical protein PHYSODRAFT_523060           53.9    5e-05   
ref|XP_001966527.1|  GF21943                                          53.9    6e-05   
ref|XP_004460541.1|  PREDICTED: histone-lysine N-methyltransferas...  52.4    1e-04   
ref|XP_001867383.1|  conserved hypothetical protein                   53.1    1e-04   
ref|XP_004460540.1|  PREDICTED: histone-lysine N-methyltransferas...  52.4    1e-04   
ref|XP_005992994.1|  PREDICTED: histone-lysine N-methyltransferas...  52.8    1e-04   
ref|XP_011406320.1|  PREDICTED: histone-lysine N-methyltransferas...  52.8    1e-04   
ref|XP_007481782.1|  PREDICTED: histone-lysine N-methyltransferas...  52.4    2e-04   
gb|KFM00841.1|  Histone-lysine N-methyltransferase SMYD3              51.6    2e-04   
ref|XP_006897801.1|  PREDICTED: histone-lysine N-methyltransferas...  52.0    2e-04   
ref|XP_002931556.2|  PREDICTED: histone-lysine N-methyltransferas...  52.0    2e-04   
ref|XP_004914684.1|  PREDICTED: histone-lysine N-methyltransferas...  52.0    2e-04   
ref|XP_004914683.1|  PREDICTED: histone-lysine N-methyltransferas...  52.0    2e-04   
ref|XP_009031592.1|  hypothetical protein HELRODRAFT_166414           51.6    3e-04   
ref|XP_001354964.1|  GA12511                                          51.6    3e-04   
gb|EEZ98820.1|  hypothetical protein TcasGA2_TC004426                 51.6    3e-04   
ref|XP_970424.2|  PREDICTED: histone-lysine N-methyltransferase S...  51.6    3e-04   
ref|XP_008115664.1|  PREDICTED: histone-lysine N-methyltransferas...  50.8    5e-04   
ref|XP_002594889.1|  hypothetical protein BRAFLDRAFT_124463           50.8    6e-04   
ref|XP_011163574.1|  PREDICTED: histone-lysine N-methyltransferas...  50.4    7e-04   
ref|XP_011368364.1|  PREDICTED: histone-lysine N-methyltransferas...  48.1    7e-04   
ref|XP_008156227.1|  PREDICTED: histone-lysine N-methyltransferas...  50.4    9e-04   



>ref|XP_006363899.1| PREDICTED: histone-lysine N-methyltransferase ASHR1-like isoform 
X2 [Solanum tuberosum]
Length=478

 Score =   219 bits (559),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 111/159 (70%), Positives = 134/159 (84%), Gaps = 0/159 (0%)
 Frame = -3

Query  759  KEEVMNLAGEIKsmseraslsssSGHKRDAIVMYKSIEELELRLFHAFSINLMRTRETLL  580
            KEE+ N   EI+S+SE+AS S S GH +D  VMYK IE L+L+L+H  SINLMRTRE LL
Sbjct  320  KEEIKNTVHEIQSLSEKASFSLSCGHNKDVSVMYKMIETLQLKLYHPLSINLMRTRENLL  379

Query  579  KMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLLGESEEAFKSLSK  400
            K+ MELQDWKEAL+YCRLTIPVYQRVY   HPLLGLQYYTCGKLEW LGE+EEA++SL+K
Sbjct  380  KILMELQDWKEALKYCRLTIPVYQRVYPECHPLLGLQYYTCGKLEWWLGETEEAYRSLAK  439

Query  399  AMDILRITHGTKSSFMKELSFKLEEARAEVSYKLSTRKE  283
            A ++LRITHGT ++FM+EL  KLEEARAE+SYK S+++E
Sbjct  440  AAEVLRITHGTNTTFMEELFVKLEEARAELSYKSSSKEE  478



>ref|XP_010322911.1| PREDICTED: histone-lysine N-methyltransferase ASHR1 isoform X1 
[Solanum lycopersicum]
Length=480

 Score =   219 bits (559),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 110/159 (69%), Positives = 136/159 (86%), Gaps = 0/159 (0%)
 Frame = -3

Query  759  KEEVMNLAGEIKsmseraslsssSGHKRDAIVMYKSIEELELRLFHAFSINLMRTRETLL  580
            KEE+ N   EI+S+SE+AS+S   GH +DA VMYK IE+L+L L+HA SINLMRTRE +L
Sbjct  322  KEEIKNTVHEIQSLSEKASISLPCGHNKDASVMYKMIEKLQLELYHASSINLMRTRENIL  381

Query  579  KMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLLGESEEAFKSLSK  400
            K+ MELQDWKEAL+YCRLTIP Y+RVY   HPLLGLQYYTCGKLEW LGE+EEA++SL+K
Sbjct  382  KILMELQDWKEALKYCRLTIPAYRRVYPECHPLLGLQYYTCGKLEWWLGETEEAYRSLAK  441

Query  399  AMDILRITHGTKSSFMKELSFKLEEARAEVSYKLSTRKE  283
            A ++LRITHGT ++FMKEL  KLEEARAE+SYK+S+++E
Sbjct  442  AAEVLRITHGTYTTFMKELFVKLEEARAELSYKISSKEE  480



>ref|XP_006363898.1| PREDICTED: histone-lysine N-methyltransferase ASHR1-like isoform 
X1 [Solanum tuberosum]
Length=480

 Score =   219 bits (559),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 111/159 (70%), Positives = 134/159 (84%), Gaps = 0/159 (0%)
 Frame = -3

Query  759  KEEVMNLAGEIKsmseraslsssSGHKRDAIVMYKSIEELELRLFHAFSINLMRTRETLL  580
            KEE+ N   EI+S+SE+AS S S GH +D  VMYK IE L+L+L+H  SINLMRTRE LL
Sbjct  322  KEEIKNTVHEIQSLSEKASFSLSCGHNKDVSVMYKMIETLQLKLYHPLSINLMRTRENLL  381

Query  579  KMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLLGESEEAFKSLSK  400
            K+ MELQDWKEAL+YCRLTIPVYQRVY   HPLLGLQYYTCGKLEW LGE+EEA++SL+K
Sbjct  382  KILMELQDWKEALKYCRLTIPVYQRVYPECHPLLGLQYYTCGKLEWWLGETEEAYRSLAK  441

Query  399  AMDILRITHGTKSSFMKELSFKLEEARAEVSYKLSTRKE  283
            A ++LRITHGT ++FM+EL  KLEEARAE+SYK S+++E
Sbjct  442  AAEVLRITHGTNTTFMEELFVKLEEARAELSYKSSSKEE  480



>ref|XP_004242023.1| PREDICTED: histone-lysine N-methyltransferase ASHR1 isoform X2 
[Solanum lycopersicum]
Length=478

 Score =   219 bits (558),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 110/159 (69%), Positives = 136/159 (86%), Gaps = 0/159 (0%)
 Frame = -3

Query  759  KEEVMNLAGEIKsmseraslsssSGHKRDAIVMYKSIEELELRLFHAFSINLMRTRETLL  580
            KEE+ N   EI+S+SE+AS+S   GH +DA VMYK IE+L+L L+HA SINLMRTRE +L
Sbjct  320  KEEIKNTVHEIQSLSEKASISLPCGHNKDASVMYKMIEKLQLELYHASSINLMRTRENIL  379

Query  579  KMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLLGESEEAFKSLSK  400
            K+ MELQDWKEAL+YCRLTIP Y+RVY   HPLLGLQYYTCGKLEW LGE+EEA++SL+K
Sbjct  380  KILMELQDWKEALKYCRLTIPAYRRVYPECHPLLGLQYYTCGKLEWWLGETEEAYRSLAK  439

Query  399  AMDILRITHGTKSSFMKELSFKLEEARAEVSYKLSTRKE  283
            A ++LRITHGT ++FMKEL  KLEEARAE+SYK+S+++E
Sbjct  440  AAEVLRITHGTYTTFMKELFVKLEEARAELSYKISSKEE  478



>ref|XP_009618109.1| PREDICTED: histone-lysine N-methyltransferase ASHR1 isoform X1 
[Nicotiana tomentosiformis]
Length=482

 Score =   219 bits (557),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 110/162 (68%), Positives = 138/162 (85%), Gaps = 0/162 (0%)
 Frame = -3

Query  759  KEEVMNLAGEIKsmseraslsssSGHKRDAIVMYKSIEELELRLFHAFSINLMRTRETLL  580
            KEE+  +  EI+++SE+AS S S+GHK+DA VMYK IE+L+ +L H FS+NLMRTRE LL
Sbjct  321  KEEIKIIVNEIETISEKASFSLSNGHKKDASVMYKMIEKLQQKLCHQFSVNLMRTRENLL  380

Query  579  KMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLLGESEEAFKSLSK  400
            K+ MELQDWKEAL+YCRLTIPVY+RVY   HPLLGLQYYTCGKLEW LGE+EEA++SL+K
Sbjct  381  KILMELQDWKEALKYCRLTIPVYKRVYPECHPLLGLQYYTCGKLEWWLGETEEAYRSLAK  440

Query  399  AMDILRITHGTKSSFMKELSFKLEEARAEVSYKLSTRKEDGE  274
            A +ILRITHGT ++FMKEL  KLEEAR E SYK+S+++E+ +
Sbjct  441  AAEILRITHGTNTNFMKELFVKLEEARGEFSYKISSKEEEND  482



>ref|XP_012078167.1| PREDICTED: histone-lysine N-methyltransferase ASHR1 isoform X1 
[Jatropha curcas]
 gb|KDP32756.1| hypothetical protein JCGZ_12048 [Jatropha curcas]
Length=482

 Score =   214 bits (546),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 108/160 (68%), Positives = 135/160 (84%), Gaps = 0/160 (0%)
 Frame = -3

Query  759  KEEVMNLAGEIKsmseraslsssSGHKRDAIVMYKSIEELELRLFHAFSINLMRTRETLL  580
            KEEV  +A EI++ S++AS S SSG+ ++AI MYK++E+L+ +L H FSI+LM+TRE LL
Sbjct  323  KEEVKKIAAEIQATSDKASKSVSSGNLQEAISMYKTVEKLQRKLCHPFSISLMQTREKLL  382

Query  579  KMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLLGESEEAFKSLSK  400
            KM MEL+DW+EAL YC+LTIPVYQ VY  FHPLLGLQYYT GKLEWLLGE+E+A +SL+K
Sbjct  383  KMLMELEDWREALSYCKLTIPVYQSVYPQFHPLLGLQYYTSGKLEWLLGETEDAIRSLTK  442

Query  399  AMDILRITHGTKSSFMKELSFKLEEARAEVSYKLSTRKED  280
            A+DILRITHGT S FMKEL  KLEEARAE SYKLS++ ++
Sbjct  443  AVDILRITHGTNSPFMKELIMKLEEARAEASYKLSSKDDE  482



>ref|XP_011097714.1| PREDICTED: histone-lysine N-methyltransferase ASHR1 [Sesamum 
indicum]
Length=486

 Score =   214 bits (544),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 111/160 (69%), Positives = 132/160 (83%), Gaps = 0/160 (0%)
 Frame = -3

Query  759  KEEVMNLAGEIKsmseraslsssSGHKRDAIVMYKSIEELELRLFHAFSINLMRTRETLL  580
            KEE+ N+  E+K +SE+AS S SSGHK +A V YK +EEL+++L+H FSINLMRTRETLL
Sbjct  327  KEEIKNITNEVKLISEKASTSFSSGHKAEASVAYKMVEELQMKLYHPFSINLMRTRETLL  386

Query  579  KMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLLGESEEAFKSLSK  400
            K+FMELQ+WKEAL YCRLTIPVY+RVY   HPLLGLQYY  GKLEWLLGE+E A +SL+K
Sbjct  387  KIFMELQEWKEALLYCRLTIPVYERVYPRCHPLLGLQYYMSGKLEWLLGETEAAVRSLTK  446

Query  399  AMDILRITHGTKSSFMKELSFKLEEARAEVSYKLSTRKED  280
            A+DILRITHGT + FM EL  KLEEARAE SY L ++ ED
Sbjct  447  ALDILRITHGTLTPFMLELLSKLEEARAEASYMLHSQDED  486



>gb|KJB29250.1| hypothetical protein B456_005G091200 [Gossypium raimondii]
Length=353

 Score =   209 bits (533),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 103/159 (65%), Positives = 135/159 (85%), Gaps = 0/159 (0%)
 Frame = -3

Query  759  KEEVMNLAGEIKsmseraslsssSGHKRDAIVMYKSIEELELRLFHAFSINLMRTRETLL  580
            KEE+  +A +IK++S++A   SSSG+ ++AIV+YK+IE+L+  + H FSI LMRTRE LL
Sbjct  190  KEEIRKIASDIKALSDKALKCSSSGNLQEAIVLYKNIEKLQKEVCHPFSIILMRTREKLL  249

Query  579  KMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLLGESEEAFKSLSK  400
            ++ M+L++WKEAL  CRLTIPVY+RVY GFHPLLGLQYY+CGKLEWLLGE+++A KS +K
Sbjct  250  EILMQLEEWKEALAICRLTIPVYERVYPGFHPLLGLQYYSCGKLEWLLGETDDAIKSFTK  309

Query  399  AMDILRITHGTKSSFMKELSFKLEEARAEVSYKLSTRKE  283
            A+DILRITHGT + FMKEL  KLEEARAE S+KLS+R++
Sbjct  310  AVDILRITHGTSTPFMKELLMKLEEARAEASFKLSSRED  348



>ref|XP_010664253.1| PREDICTED: histone-lysine N-methyltransferase ASHR1 isoform X2 
[Vitis vinifera]
Length=445

 Score =   211 bits (536),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 106/157 (68%), Positives = 132/157 (84%), Gaps = 1/157 (1%)
 Frame = -3

Query  759  KEEVMNLAGEIKsmseraslsssSGHKRDAIVMYKSIEELELRLFHAFSINLMRTRETLL  580
            KEE+  LA E+K +S++A++SSS  H  +A  +YK IE+L+ +LFH FSINLMRTRE +L
Sbjct  288  KEEIKRLASELKPLSDKATMSSS-SHYVEATSIYKMIEKLQTKLFHPFSINLMRTREAIL  346

Query  579  KMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLLGESEEAFKSLSK  400
            K+ ME++DW+ AL YC+LTIPVYQRVY GFHPLLGLQYYTCGKLEWLLGE+E+A KSL+K
Sbjct  347  KILMEMKDWRAALTYCKLTIPVYQRVYPGFHPLLGLQYYTCGKLEWLLGETEDAVKSLTK  406

Query  399  AMDILRITHGTKSSFMKELSFKLEEARAEVSYKLSTR  289
            A DIL+ITHGT + FMKEL FKLEEARAE S+K S++
Sbjct  407  AADILQITHGTNTPFMKELLFKLEEARAEASHKRSSK  443



>gb|KDO80753.1| hypothetical protein CISIN_1g011626mg [Citrus sinensis]
Length=335

 Score =   207 bits (527),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 97/159 (61%), Positives = 128/159 (81%), Gaps = 0/159 (0%)
 Frame = -3

Query  759  KEEVMNLAGEIKsmseraslsssSGHKRDAIVMYKSIEELELRLFHAFSINLMRTRETLL  580
            KEE+  +A E+  +S++    +S G+ ++ +  YK IE+L+ +L+H FS+NLM+TRE L+
Sbjct  177  KEEIKKIASEVNILSKKTLALTSCGNHQEVVSTYKMIEKLQKKLYHPFSVNLMQTREKLI  236

Query  579  KMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLLGESEEAFKSLSK  400
            K+ MEL+DWKEAL YC+LTIPVYQRVY  FHPLLGLQYYTCGKLEW LG++E A KS+++
Sbjct  237  KILMELEDWKEALAYCQLTIPVYQRVYPQFHPLLGLQYYTCGKLEWFLGDTENAIKSMTE  296

Query  399  AMDILRITHGTKSSFMKELSFKLEEARAEVSYKLSTRKE  283
            A++ILRITHGT S FMKEL  KLEEA+AE SYKLS++ E
Sbjct  297  AVEILRITHGTNSPFMKELILKLEEAQAEASYKLSSKDE  335



>ref|XP_010664252.1| PREDICTED: histone-lysine N-methyltransferase ASHR1 isoform X1 
[Vitis vinifera]
 emb|CBI19071.3| unnamed protein product [Vitis vinifera]
Length=480

 Score =   211 bits (537),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 106/157 (68%), Positives = 132/157 (84%), Gaps = 1/157 (1%)
 Frame = -3

Query  759  KEEVMNLAGEIKsmseraslsssSGHKRDAIVMYKSIEELELRLFHAFSINLMRTRETLL  580
            KEE+  LA E+K +S++A++SSS  H  +A  +YK IE+L+ +LFH FSINLMRTRE +L
Sbjct  323  KEEIKRLASELKPLSDKATMSSS-SHYVEATSIYKMIEKLQTKLFHPFSINLMRTREAIL  381

Query  579  KMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLLGESEEAFKSLSK  400
            K+ ME++DW+ AL YC+LTIPVYQRVY GFHPLLGLQYYTCGKLEWLLGE+E+A KSL+K
Sbjct  382  KILMEMKDWRAALTYCKLTIPVYQRVYPGFHPLLGLQYYTCGKLEWLLGETEDAVKSLTK  441

Query  399  AMDILRITHGTKSSFMKELSFKLEEARAEVSYKLSTR  289
            A DIL+ITHGT + FMKEL FKLEEARAE S+K S++
Sbjct  442  AADILQITHGTNTPFMKELLFKLEEARAEASHKRSSK  478



>emb|CDP12437.1| unnamed protein product [Coffea canephora]
Length=227

 Score =   203 bits (517),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 102/159 (64%), Positives = 130/159 (82%), Gaps = 1/159 (1%)
 Frame = -3

Query  759  KEEVMNLAGEIKsmseraslsssSGHKRDAIVMYKSIEELELRLFHAFSINLMRTRETLL  580
            KEE+ ++  E+K + E+AS+ SS G+K DA + YK++E+ +L L H FSINLMRTRETLL
Sbjct  69   KEEIKDIEWEVKYLIEKASICSS-GNKIDASLTYKAVEKQQLELCHPFSINLMRTRETLL  127

Query  579  KMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLLGESEEAFKSLSK  400
            K++MELQ+WKEAL YCR  IP+Y+RVY   HPL+GLQYYTCGKLEW LGE+ EA +SL+K
Sbjct  128  KIYMELQNWKEALAYCRFVIPIYERVYPRLHPLVGLQYYTCGKLEWFLGETNEAIQSLTK  187

Query  399  AMDILRITHGTKSSFMKELSFKLEEARAEVSYKLSTRKE  283
            A+D+LRITHGT +SFMKEL  KLEEARAE SY LS++ +
Sbjct  188  AVDVLRITHGTSTSFMKELLIKLEEARAEASYSLSSKDD  226



>gb|KDO80752.1| hypothetical protein CISIN_1g011626mg [Citrus sinensis]
Length=368

 Score =   207 bits (528),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 97/159 (61%), Positives = 128/159 (81%), Gaps = 0/159 (0%)
 Frame = -3

Query  759  KEEVMNLAGEIKsmseraslsssSGHKRDAIVMYKSIEELELRLFHAFSINLMRTRETLL  580
            KEE+  +A E+  +S++    +S G+ ++ +  YK IE+L+ +L+H FS+NLM+TRE L+
Sbjct  210  KEEIKKIASEVNILSKKTLALTSCGNHQEVVSTYKMIEKLQKKLYHPFSVNLMQTREKLI  269

Query  579  KMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLLGESEEAFKSLSK  400
            K+ MEL+DWKEAL YC+LTIPVYQRVY  FHPLLGLQYYTCGKLEW LG++E A KS+++
Sbjct  270  KILMELEDWKEALAYCQLTIPVYQRVYPQFHPLLGLQYYTCGKLEWFLGDTENAIKSMTE  329

Query  399  AMDILRITHGTKSSFMKELSFKLEEARAEVSYKLSTRKE  283
            A++ILRITHGT S FMKEL  KLEEA+AE SYKLS++ E
Sbjct  330  AVEILRITHGTNSPFMKELILKLEEAQAEASYKLSSKDE  368



>ref|XP_006434126.1| hypothetical protein CICLE_v10001105mg [Citrus clementina]
 gb|ESR47366.1| hypothetical protein CICLE_v10001105mg [Citrus clementina]
Length=455

 Score =   209 bits (532),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 98/159 (62%), Positives = 128/159 (81%), Gaps = 0/159 (0%)
 Frame = -3

Query  759  KEEVMNLAGEIKsmseraslsssSGHKRDAIVMYKSIEELELRLFHAFSINLMRTRETLL  580
            KEE+  +A E+  +S++    +S G+ ++ +  YK IE+L+ +L+H FS+NLM+TRE L+
Sbjct  297  KEEIKKIASEVNILSKKTLALTSCGNHQEVVSTYKMIEKLQKKLYHPFSVNLMQTREKLI  356

Query  579  KMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLLGESEEAFKSLSK  400
            K+ MEL+DWKEAL YCRLTIPVYQRVY  FHPLLGLQYYTCGKLEW LG++E A KS+++
Sbjct  357  KILMELEDWKEALAYCRLTIPVYQRVYPQFHPLLGLQYYTCGKLEWFLGDTENAIKSMTE  416

Query  399  AMDILRITHGTKSSFMKELSFKLEEARAEVSYKLSTRKE  283
            A++ILRITHGT S FMKEL  KLEEA+AE SYKLS++ E
Sbjct  417  AVEILRITHGTNSPFMKELILKLEEAQAEASYKLSSKDE  455



>ref|XP_009764580.1| PREDICTED: histone-lysine N-methyltransferase ASHR1 isoform X1 
[Nicotiana sylvestris]
Length=495

 Score =   210 bits (535),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 106/156 (68%), Positives = 133/156 (85%), Gaps = 0/156 (0%)
 Frame = -3

Query  759  KEEVMNLAGEIKsmseraslsssSGHKRDAIVMYKSIEELELRLFHAFSINLMRTRETLL  580
            +EE+  +  E++SMSE+AS S S+GH +DA VMYK IE+L+ +L+H FS+NLMRTRE LL
Sbjct  332  REEIKIVVNEMESMSEKASFSLSNGHNKDASVMYKMIEKLQQKLYHQFSVNLMRTRENLL  391

Query  579  KMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLLGESEEAFKSLSK  400
            K+ MELQDWKEAL+YCRLTIPVY+RVY   HPLLGLQYYTCGKLEW LGE+ EA++SL+K
Sbjct  392  KILMELQDWKEALKYCRLTIPVYKRVYPECHPLLGLQYYTCGKLEWWLGETGEAYRSLAK  451

Query  399  AMDILRITHGTKSSFMKELSFKLEEARAEVSYKLST  292
            A +ILRITHGT ++FMKEL  K+EEARAE SY++S+
Sbjct  452  AAEILRITHGTNTNFMKELFVKIEEARAEFSYRISS  487



>gb|KJB29253.1| hypothetical protein B456_005G091200 [Gossypium raimondii]
Length=484

 Score =   209 bits (533),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 103/159 (65%), Positives = 135/159 (85%), Gaps = 0/159 (0%)
 Frame = -3

Query  759  KEEVMNLAGEIKsmseraslsssSGHKRDAIVMYKSIEELELRLFHAFSINLMRTRETLL  580
            KEE+  +A +IK++S++A   SSSG+ ++AIV+YK+IE+L+  + H FSI LMRTRE LL
Sbjct  321  KEEIRKIASDIKALSDKALKCSSSGNLQEAIVLYKNIEKLQKEVCHPFSIILMRTREKLL  380

Query  579  KMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLLGESEEAFKSLSK  400
            ++ M+L++WKEAL  CRLTIPVY+RVY GFHPLLGLQYY+CGKLEWLLGE+++A KS +K
Sbjct  381  EILMQLEEWKEALAICRLTIPVYERVYPGFHPLLGLQYYSCGKLEWLLGETDDAIKSFTK  440

Query  399  AMDILRITHGTKSSFMKELSFKLEEARAEVSYKLSTRKE  283
            A+DILRITHGT + FMKEL  KLEEARAE S+KLS+R++
Sbjct  441  AVDILRITHGTSTPFMKELLMKLEEARAEASFKLSSRED  479



>gb|KJB29249.1| hypothetical protein B456_005G091200 [Gossypium raimondii]
Length=486

 Score =   209 bits (533),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 103/159 (65%), Positives = 135/159 (85%), Gaps = 0/159 (0%)
 Frame = -3

Query  759  KEEVMNLAGEIKsmseraslsssSGHKRDAIVMYKSIEELELRLFHAFSINLMRTRETLL  580
            KEE+  +A +IK++S++A   SSSG+ ++AIV+YK+IE+L+  + H FSI LMRTRE LL
Sbjct  323  KEEIRKIASDIKALSDKALKCSSSGNLQEAIVLYKNIEKLQKEVCHPFSIILMRTREKLL  382

Query  579  KMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLLGESEEAFKSLSK  400
            ++ M+L++WKEAL  CRLTIPVY+RVY GFHPLLGLQYY+CGKLEWLLGE+++A KS +K
Sbjct  383  EILMQLEEWKEALAICRLTIPVYERVYPGFHPLLGLQYYSCGKLEWLLGETDDAIKSFTK  442

Query  399  AMDILRITHGTKSSFMKELSFKLEEARAEVSYKLSTRKE  283
            A+DILRITHGT + FMKEL  KLEEARAE S+KLS+R++
Sbjct  443  AVDILRITHGTSTPFMKELLMKLEEARAEASFKLSSRED  481



>ref|XP_008233908.1| PREDICTED: histone-lysine N-methyltransferase ASHR1 [Prunus mume]
Length=480

 Score =   209 bits (532),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 103/156 (66%), Positives = 131/156 (84%), Gaps = 0/156 (0%)
 Frame = -3

Query  759  KEEVMNLAGEIKsmseraslsssSGHKRDAIVMYKSIEELELRLFHAFSINLMRTRETLL  580
            KEE+  +A E+KS+S++A +S+ S + ++AI +YK+IE L+ +L+H FSI+LM+TRE LL
Sbjct  323  KEEIKQIASELKSLSDKAPISTPSHNYQEAISVYKAIETLQKKLYHPFSISLMQTREKLL  382

Query  579  KMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLLGESEEAFKSLSK  400
            K+ MEL+DW EAL YCRLTIPVYQRVY G HPLLGLQYYTCGKLEWLLG++E A KSL+K
Sbjct  383  KILMELEDWSEALAYCRLTIPVYQRVYPGCHPLLGLQYYTCGKLEWLLGDTENAVKSLTK  442

Query  399  AMDILRITHGTKSSFMKELSFKLEEARAEVSYKLST  292
            A+DILRITHGT + FMK+L  +LEEARAE SYK S+
Sbjct  443  AVDILRITHGTSTPFMKDLYVRLEEARAEASYKFSS  478



>gb|KJB29252.1| hypothetical protein B456_005G091200 [Gossypium raimondii]
Length=496

 Score =   209 bits (533),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 103/159 (65%), Positives = 135/159 (85%), Gaps = 0/159 (0%)
 Frame = -3

Query  759  KEEVMNLAGEIKsmseraslsssSGHKRDAIVMYKSIEELELRLFHAFSINLMRTRETLL  580
            KEE+  +A +IK++S++A   SSSG+ ++AIV+YK+IE+L+  + H FSI LMRTRE LL
Sbjct  333  KEEIRKIASDIKALSDKALKCSSSGNLQEAIVLYKNIEKLQKEVCHPFSIILMRTREKLL  392

Query  579  KMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLLGESEEAFKSLSK  400
            ++ M+L++WKEAL  CRLTIPVY+RVY GFHPLLGLQYY+CGKLEWLLGE+++A KS +K
Sbjct  393  EILMQLEEWKEALAICRLTIPVYERVYPGFHPLLGLQYYSCGKLEWLLGETDDAIKSFTK  452

Query  399  AMDILRITHGTKSSFMKELSFKLEEARAEVSYKLSTRKE  283
            A+DILRITHGT + FMKEL  KLEEARAE S+KLS+R++
Sbjct  453  AVDILRITHGTSTPFMKELLMKLEEARAEASFKLSSRED  491



>gb|KDO80749.1| hypothetical protein CISIN_1g011626mg [Citrus sinensis]
Length=420

 Score =   207 bits (528),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 97/159 (61%), Positives = 128/159 (81%), Gaps = 0/159 (0%)
 Frame = -3

Query  759  KEEVMNLAGEIKsmseraslsssSGHKRDAIVMYKSIEELELRLFHAFSINLMRTRETLL  580
            KEE+  +A E+  +S++    +S G+ ++ +  YK IE+L+ +L+H FS+NLM+TRE L+
Sbjct  262  KEEIKKIASEVNILSKKTLALTSCGNHQEVVSTYKMIEKLQKKLYHPFSVNLMQTREKLI  321

Query  579  KMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLLGESEEAFKSLSK  400
            K+ MEL+DWKEAL YC+LTIPVYQRVY  FHPLLGLQYYTCGKLEW LG++E A KS+++
Sbjct  322  KILMELEDWKEALAYCQLTIPVYQRVYPQFHPLLGLQYYTCGKLEWFLGDTENAIKSMTE  381

Query  399  AMDILRITHGTKSSFMKELSFKLEEARAEVSYKLSTRKE  283
            A++ILRITHGT S FMKEL  KLEEA+AE SYKLS++ E
Sbjct  382  AVEILRITHGTNSPFMKELILKLEEAQAEASYKLSSKDE  420



>gb|KDO80750.1| hypothetical protein CISIN_1g011626mg [Citrus sinensis]
Length=455

 Score =   207 bits (528),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 97/159 (61%), Positives = 128/159 (81%), Gaps = 0/159 (0%)
 Frame = -3

Query  759  KEEVMNLAGEIKsmseraslsssSGHKRDAIVMYKSIEELELRLFHAFSINLMRTRETLL  580
            KEE+  +A E+  +S++    +S G+ ++ +  YK IE+L+ +L+H FS+NLM+TRE L+
Sbjct  297  KEEIKKIASEVNILSKKTLALTSCGNHQEVVSTYKMIEKLQKKLYHPFSVNLMQTREKLI  356

Query  579  KMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLLGESEEAFKSLSK  400
            K+ MEL+DWKEAL YC+LTIPVYQRVY  FHPLLGLQYYTCGKLEW LG++E A KS+++
Sbjct  357  KILMELEDWKEALAYCQLTIPVYQRVYPQFHPLLGLQYYTCGKLEWFLGDTENAIKSMTE  416

Query  399  AMDILRITHGTKSSFMKELSFKLEEARAEVSYKLSTRKE  283
            A++ILRITHGT S FMKEL  KLEEA+AE SYKLS++ E
Sbjct  417  AVEILRITHGTNSPFMKELILKLEEAQAEASYKLSSKDE  455



>ref|XP_008361556.1| PREDICTED: histone-lysine N-methyltransferase ASHR1-like, partial 
[Malus domestica]
Length=132

 Score =   197 bits (502),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 93/129 (72%), Positives = 110/129 (85%), Gaps = 0/129 (0%)
 Frame = -3

Query  678  RDAIVMYKSIEELELRLFHAFSINLMRTRETLLKMFMELQDWKEALEYCRLTIPVYQRVY  499
            ++AI   K+IE L+ +LFH FSI+LM+TRE LLK+ MEL+DW EAL YCRLTIPVYQRVY
Sbjct  2    QEAISGLKAIETLQKKLFHPFSISLMQTREKLLKILMELEDWNEALAYCRLTIPVYQRVY  61

Query  498  QGFHPLLGLQYYTCGKLEWLLGESEEAFKSLSKAMDILRITHGTKSSFMKELSFKLEEAR  319
             G HPLLGLQYYTCGKLEWLLG++E A KSL+KA+DILRITHGT + FMK+L  +LEEAR
Sbjct  62   PGCHPLLGLQYYTCGKLEWLLGDTENAVKSLTKAVDILRITHGTSTPFMKDLLMRLEEAR  121

Query  318  AEVSYKLST  292
            AE SYKLS+
Sbjct  122  AEASYKLSS  130



>ref|XP_006472718.1| PREDICTED: histone-lysine N-methyltransferase ASHR1-like [Citrus 
sinensis]
Length=481

 Score =   208 bits (530),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 98/158 (62%), Positives = 127/158 (80%), Gaps = 0/158 (0%)
 Frame = -3

Query  756  EEVMNLAGEIKsmseraslsssSGHKRDAIVMYKSIEELELRLFHAFSINLMRTRETLLK  577
            EE+  +A E+  +S++    +S G+ ++ +  YK IE+L+ +L+H FS+NLM+TRE L+K
Sbjct  324  EEIKKIASEVNILSKKTLALTSCGNHQEVVSTYKMIEKLQKKLYHPFSVNLMQTREKLIK  383

Query  576  MFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLLGESEEAFKSLSKA  397
            + MEL+DWKEAL YC+LTIPVYQRVY  FHPLLGLQYYTCGKLEW LG++E A KSL+KA
Sbjct  384  ILMELEDWKEALAYCQLTIPVYQRVYPQFHPLLGLQYYTCGKLEWFLGDTENAIKSLTKA  443

Query  396  MDILRITHGTKSSFMKELSFKLEEARAEVSYKLSTRKE  283
            ++ILRITHGT S FMKEL  KLEEA+AE SYKLS++ E
Sbjct  444  VEILRITHGTNSPFMKELILKLEEAQAEASYKLSSKDE  481



>gb|KDO80748.1| hypothetical protein CISIN_1g011626mg [Citrus sinensis]
Length=481

 Score =   207 bits (528),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 97/159 (61%), Positives = 128/159 (81%), Gaps = 0/159 (0%)
 Frame = -3

Query  759  KEEVMNLAGEIKsmseraslsssSGHKRDAIVMYKSIEELELRLFHAFSINLMRTRETLL  580
            KEE+  +A E+  +S++    +S G+ ++ +  YK IE+L+ +L+H FS+NLM+TRE L+
Sbjct  323  KEEIKKIASEVNILSKKTLALTSCGNHQEVVSTYKMIEKLQKKLYHPFSVNLMQTREKLI  382

Query  579  KMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLLGESEEAFKSLSK  400
            K+ MEL+DWKEAL YC+LTIPVYQRVY  FHPLLGLQYYTCGKLEW LG++E A KS+++
Sbjct  383  KILMELEDWKEALAYCQLTIPVYQRVYPQFHPLLGLQYYTCGKLEWFLGDTENAIKSMTE  442

Query  399  AMDILRITHGTKSSFMKELSFKLEEARAEVSYKLSTRKE  283
            A++ILRITHGT S FMKEL  KLEEA+AE SYKLS++ E
Sbjct  443  AVEILRITHGTNSPFMKELILKLEEAQAEASYKLSSKDE  481



>gb|KDO80751.1| hypothetical protein CISIN_1g011626mg [Citrus sinensis]
Length=456

 Score =   207 bits (527),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 97/159 (61%), Positives = 128/159 (81%), Gaps = 0/159 (0%)
 Frame = -3

Query  759  KEEVMNLAGEIKsmseraslsssSGHKRDAIVMYKSIEELELRLFHAFSINLMRTRETLL  580
            KEE+  +A E+  +S++    +S G+ ++ +  YK IE+L+ +L+H FS+NLM+TRE L+
Sbjct  298  KEEIKKIASEVNILSKKTLALTSCGNHQEVVSTYKMIEKLQKKLYHPFSVNLMQTREKLI  357

Query  579  KMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLLGESEEAFKSLSK  400
            K+ MEL+DWKEAL YC+LTIPVYQRVY  FHPLLGLQYYTCGKLEW LG++E A KS+++
Sbjct  358  KILMELEDWKEALAYCQLTIPVYQRVYPQFHPLLGLQYYTCGKLEWFLGDTENAIKSMTE  417

Query  399  AMDILRITHGTKSSFMKELSFKLEEARAEVSYKLSTRKE  283
            A++ILRITHGT S FMKEL  KLEEA+AE SYKLS++ E
Sbjct  418  AVEILRITHGTNSPFMKELILKLEEAQAEASYKLSSKDE  456



>ref|XP_002513816.1| protein with unknown function [Ricinus communis]
 gb|EEF48399.1| protein with unknown function [Ricinus communis]
Length=482

 Score =   206 bits (524),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 107/162 (66%), Positives = 132/162 (81%), Gaps = 2/162 (1%)
 Frame = -3

Query  759  KEEVMNLAGEIKsmseraslsssSGHKRDAIVMYKSIEELELRLFHAFSINLMRTRETLL  580
            KEEV   A EIK+ S++AS S SSG+ ++A+ +YK IE+L+ +L H FS +LM+TRE LL
Sbjct  323  KEEVKKSAAEIKATSDKASKSISSGNLQEAVSIYKLIEKLQRKLCHPFSTSLMQTREKLL  382

Query  579  KMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLLGESEEAFKSLSK  400
            KM MEL+DW EAL YC+LTIPVYQRVY  FHPLLGLQY++CGKLEWLLG++E A KSL+K
Sbjct  383  KMLMELEDWGEALSYCKLTIPVYQRVYPEFHPLLGLQYFSCGKLEWLLGDTEAAIKSLTK  442

Query  399  AMDILRITHGTKSSFMKELSFKLEEARAEVSYKLSTRKEDGE  274
            A+D+LRITHGTK+ FMKEL  KLEEARAEVSY  ++   DGE
Sbjct  443  ALDVLRITHGTKTPFMKELMMKLEEARAEVSYLRAS--NDGE  482



>ref|XP_006409221.1| hypothetical protein EUTSA_v10022664mg [Eutrema salsugineum]
 gb|ESQ50674.1| hypothetical protein EUTSA_v10022664mg [Eutrema salsugineum]
Length=484

 Score =   204 bits (518),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 101/159 (64%), Positives = 131/159 (82%), Gaps = 0/159 (0%)
 Frame = -3

Query  759  KEEVMNLAGEIKsmseraslsssSGHKRDAIVMYKSIEELELRLFHAFSINLMRTRETLL  580
            KEEV  LAG++K++SE+A  S S+ +K+DAI +YK++E+L +RL+H+FSI LMRTRE LL
Sbjct  320  KEEVKKLAGDVKTVSEKAPASPSAENKQDAIALYKAMEKLHIRLYHSFSITLMRTREKLL  379

Query  579  KMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLLGESEEAFKSLSK  400
            KM ME++ W+E L YCRL +PVYQR+Y   HPL+GLQ+YT GKLEWLLGE+EEA +SL+K
Sbjct  380  KMLMEVESWREVLNYCRLIVPVYQRIYPATHPLIGLQFYTQGKLEWLLGETEEAVRSLAK  439

Query  399  AMDILRITHGTKSSFMKELSFKLEEARAEVSYKLSTRKE  283
            A +ILRI+HGT + FMKELS KL+EARAE SYKL   K+
Sbjct  440  AFEILRISHGTSTHFMKELSEKLDEARAEASYKLLALKD  478



>ref|XP_009366986.1| PREDICTED: histone-lysine N-methyltransferase ASHR1 isoform X1 
[Pyrus x bretschneideri]
Length=480

 Score =   203 bits (516),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 103/156 (66%), Positives = 129/156 (83%), Gaps = 0/156 (0%)
 Frame = -3

Query  759  KEEVMNLAGEIKsmseraslsssSGHKRDAIVMYKSIEELELRLFHAFSINLMRTRETLL  580
            KEE+  +A E+KS+S++A +S+SS   ++AI   K+IE L+ +L+H FSI+LM+TRE LL
Sbjct  323  KEEIRKIASELKSLSDKAPISTSSCDYQEAISGLKAIETLQKKLYHPFSISLMQTREKLL  382

Query  579  KMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLLGESEEAFKSLSK  400
            K+ MEL+DW EAL YCRLTIPVYQRVY   HPLLGLQYYTCGKLEWLLG++E A KSL+K
Sbjct  383  KISMELEDWNEALAYCRLTIPVYQRVYPACHPLLGLQYYTCGKLEWLLGDTENAVKSLTK  442

Query  399  AMDILRITHGTKSSFMKELSFKLEEARAEVSYKLST  292
            A+DILRITHGT + FMK+L  +LEEARAE SYKLS+
Sbjct  443  AVDILRITHGTSTPFMKDLLMRLEEARAEASYKLSS  478



>ref|XP_009366987.1| PREDICTED: histone-lysine N-methyltransferase ASHR1 isoform X2 
[Pyrus x bretschneideri]
Length=478

 Score =   203 bits (516),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 103/156 (66%), Positives = 129/156 (83%), Gaps = 0/156 (0%)
 Frame = -3

Query  759  KEEVMNLAGEIKsmseraslsssSGHKRDAIVMYKSIEELELRLFHAFSINLMRTRETLL  580
            KEE+  +A E+KS+S++A +S+SS   ++AI   K+IE L+ +L+H FSI+LM+TRE LL
Sbjct  321  KEEIRKIASELKSLSDKAPISTSSCDYQEAISGLKAIETLQKKLYHPFSISLMQTREKLL  380

Query  579  KMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLLGESEEAFKSLSK  400
            K+ MEL+DW EAL YCRLTIPVYQRVY   HPLLGLQYYTCGKLEWLLG++E A KSL+K
Sbjct  381  KISMELEDWNEALAYCRLTIPVYQRVYPACHPLLGLQYYTCGKLEWLLGDTENAVKSLTK  440

Query  399  AMDILRITHGTKSSFMKELSFKLEEARAEVSYKLST  292
            A+DILRITHGT + FMK+L  +LEEARAE SYKLS+
Sbjct  441  AVDILRITHGTSTPFMKDLLMRLEEARAEASYKLSS  476



>ref|XP_007222803.1| hypothetical protein PRUPE_ppa005026mg [Prunus persica]
 gb|EMJ24002.1| hypothetical protein PRUPE_ppa005026mg [Prunus persica]
Length=480

 Score =   203 bits (516),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 99/156 (63%), Positives = 130/156 (83%), Gaps = 0/156 (0%)
 Frame = -3

Query  759  KEEVMNLAGEIKsmseraslsssSGHKRDAIVMYKSIEELELRLFHAFSINLMRTRETLL  580
            KEE+  +A E+KS+S++A +S+ S + ++++ +Y++IE L+ +L+H FSI+LM+TRE LL
Sbjct  323  KEEIKQIASELKSLSDKAPISTPSHNYQESVSVYRAIETLQRKLYHPFSISLMQTREKLL  382

Query  579  KMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLLGESEEAFKSLSK  400
            K+ MEL+DW EAL YCRLTIPVYQRVY G HPLLGLQYYTCGKLEWLLG++E A KSL K
Sbjct  383  KILMELEDWSEALAYCRLTIPVYQRVYPGCHPLLGLQYYTCGKLEWLLGDTENAVKSLIK  442

Query  399  AMDILRITHGTKSSFMKELSFKLEEARAEVSYKLST  292
            A+DIL+ITHGT + FMK+L  +LEEARAE SYK S+
Sbjct  443  AVDILQITHGTSTPFMKDLFVRLEEARAEASYKFSS  478



>ref|XP_010272881.1| PREDICTED: histone-lysine N-methyltransferase ASHR1 [Nelumbo 
nucifera]
 ref|XP_010272882.1| PREDICTED: histone-lysine N-methyltransferase ASHR1 [Nelumbo 
nucifera]
 ref|XP_010272883.1| PREDICTED: histone-lysine N-methyltransferase ASHR1 [Nelumbo 
nucifera]
 ref|XP_010272884.1| PREDICTED: histone-lysine N-methyltransferase ASHR1 [Nelumbo 
nucifera]
Length=483

 Score =   203 bits (516),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 103/158 (65%), Positives = 130/158 (82%), Gaps = 0/158 (0%)
 Frame = -3

Query  759  KEEVMNLAGEIKsmseraslsssSGHKRDAIVMYKSIEELELRLFHAFSINLMRTRETLL  580
            KEE+  +A E+KS+S++AS+S SSG+  +A  MYK+IE+L+++L H+ S+NLMRTRETLL
Sbjct  323  KEEIRKIASEVKSLSDKASISLSSGNYLEASSMYKTIEQLQMKLSHSLSVNLMRTRETLL  382

Query  579  KMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLLGESEEAFKSLSK  400
            K+ MEL+DW+ AL YCRLTI VYQRVY   HPLLGLQYYTCGKLEWLL E+E A +SL+K
Sbjct  383  KILMELKDWRGALHYCRLTITVYQRVYPAIHPLLGLQYYTCGKLEWLLEETENAIESLTK  442

Query  399  AMDILRITHGTKSSFMKELSFKLEEARAEVSYKLSTRK  286
            A+DILRITHGT + F+KEL  KLEEARAE +YK  + K
Sbjct  443  AIDILRITHGTNTPFIKELLLKLEEARAEAAYKTRSAK  480



>ref|XP_009121063.1| PREDICTED: histone-lysine N-methyltransferase ASHR1 isoform X3 
[Brassica rapa]
Length=483

 Score =   202 bits (514),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 102/162 (63%), Positives = 130/162 (80%), Gaps = 1/162 (1%)
 Frame = -3

Query  759  KEEVMNLAGEIKsmseraslsssSGHKRDAIVMYKSIEELELRLFHAFSINLMRTRETLL  580
            KEEV  LAG++K++S +A  S S+ +K+DAI +YK+ E+L+ +L+H+FSI LMRTRE LL
Sbjct  323  KEEVKKLAGDVKTVSAKALASPSAENKQDAIALYKTFEKLQEKLYHSFSITLMRTREKLL  382

Query  579  KMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLLGESEEAFKSLSK  400
            KM ME++ W+EAL+YC+L +PVYQRVY   HPL+GLQ+YT GKLEWLLG++EEA  SL K
Sbjct  383  KMLMEVESWREALDYCKLIVPVYQRVYPATHPLIGLQFYTQGKLEWLLGQTEEAVSSLIK  442

Query  399  AMDILRITHGTKSSFMKELSFKLEEARAEVSYKLSTRKEDGE  274
            A DILRI+HGT + FMKELS KL+EARAE SYKL   K DG 
Sbjct  443  AYDILRISHGTSTPFMKELSAKLDEARAEASYKLLALK-DGN  483



>ref|XP_009764587.1| PREDICTED: histone-lysine N-methyltransferase ASHR1 isoform X2 
[Nicotiana sylvestris]
Length=492

 Score =   201 bits (512),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 105/156 (67%), Positives = 131/156 (84%), Gaps = 3/156 (2%)
 Frame = -3

Query  759  KEEVMNLAGEIKsmseraslsssSGHKRDAIVMYKSIEELELRLFHAFSINLMRTRETLL  580
            +EE+  +  E++SMSE+AS S S+GH   A VMYK IE+L+ +L+H FS+NLMRTRE LL
Sbjct  332  REEIKIVVNEMESMSEKASFSLSNGH---ASVMYKMIEKLQQKLYHQFSVNLMRTRENLL  388

Query  579  KMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLLGESEEAFKSLSK  400
            K+ MELQDWKEAL+YCRLTIPVY+RVY   HPLLGLQYYTCGKLEW LGE+ EA++SL+K
Sbjct  389  KILMELQDWKEALKYCRLTIPVYKRVYPECHPLLGLQYYTCGKLEWWLGETGEAYRSLAK  448

Query  399  AMDILRITHGTKSSFMKELSFKLEEARAEVSYKLST  292
            A +ILRITHGT ++FMKEL  K+EEARAE SY++S+
Sbjct  449  AAEILRITHGTNTNFMKELFVKIEEARAEFSYRISS  484



>ref|XP_004500596.1| PREDICTED: histone-lysine N-methyltransferase ASHR1-like isoform 
X2 [Cicer arietinum]
 ref|XP_004500597.1| PREDICTED: histone-lysine N-methyltransferase ASHR1-like isoform 
X3 [Cicer arietinum]
Length=438

 Score =   200 bits (508),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 99/159 (62%), Positives = 129/159 (81%), Gaps = 0/159 (0%)
 Frame = -3

Query  759  KEEVMNLAGEIKsmseraslsssSGHKRDAIVMYKSIEELELRLFHAFSINLMRTRETLL  580
            KEE+  +A EIK +SE AS  SS G+ ++AI +Y  IE+L+++L+H FSINLM+TRE +L
Sbjct  280  KEEIKKIATEIKLLSEEASKPSSRGNYQEAITIYTMIEKLQVKLYHTFSINLMQTREMIL  339

Query  579  KMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLLGESEEAFKSLSK  400
            K  M+L+ W+EAL YC+LTIP+YQRVY   HP+LGLQYYTCGKLEW LG++EEA  SL+K
Sbjct  340  KSLMKLEHWREALAYCKLTIPIYQRVYPAVHPMLGLQYYTCGKLEWYLGDTEEAVISLTK  399

Query  399  AMDILRITHGTKSSFMKELSFKLEEARAEVSYKLSTRKE  283
            A+DILRITHGT + F+KEL   LEEARAE S+KLS+++E
Sbjct  400  AVDILRITHGTNTPFVKELLVMLEEARAEASFKLSSKEE  438



>ref|XP_007018969.1| SET domain protein isoform 2 [Theobroma cacao]
 gb|EOY16194.1| SET domain protein isoform 2 [Theobroma cacao]
Length=480

 Score =   201 bits (510),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 97/157 (62%), Positives = 131/157 (83%), Gaps = 0/157 (0%)
 Frame = -3

Query  759  KEEVMNLAGEIKsmseraslsssSGHKRDAIVMYKSIEELELRLFHAFSINLMRTRETLL  580
            KEE+   + +IK++ ++A  S+SSG+ +DA+++YK+IE+L+  + H FSI+LMRT E L 
Sbjct  323  KEEIRKKSRDIKALLDKAPKSTSSGNPQDAMILYKNIEKLQKEVCHPFSISLMRTWEKLH  382

Query  579  KMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLLGESEEAFKSLSK  400
            ++ ++L++WKEAL +CRLTIPVY+RVY GFHPLLGLQYY+CGKLEWLLGE+++A KSL+K
Sbjct  383  EILVQLEEWKEALTFCRLTIPVYERVYPGFHPLLGLQYYSCGKLEWLLGETDDAIKSLTK  442

Query  399  AMDILRITHGTKSSFMKELSFKLEEARAEVSYKLSTR  289
            A+DILRITHGT + FMKEL  KLEEARAE SY LS +
Sbjct  443  AVDILRITHGTNTPFMKELLMKLEEARAEASYTLSCK  479



>emb|CDY38142.1| BnaA07g02410D [Brassica napus]
Length=483

 Score =   200 bits (509),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 99/159 (62%), Positives = 128/159 (81%), Gaps = 0/159 (0%)
 Frame = -3

Query  759  KEEVMNLAGEIKsmseraslsssSGHKRDAIVMYKSIEELELRLFHAFSINLMRTRETLL  580
            KEEV  LAG++K++S +A  S S+ +K D I +YK++E+L+ +L+H+FSI LMRTRE LL
Sbjct  323  KEEVKKLAGDVKTVSAKALASPSAENKHDTIALYKTMEKLQEKLYHSFSITLMRTREKLL  382

Query  579  KMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLLGESEEAFKSLSK  400
            KM ME++ W+EAL+YC+L +PVYQRVY   HPL+GLQ+YT GKLEWLLG++EEA  SL K
Sbjct  383  KMLMEVESWREALDYCKLIVPVYQRVYPATHPLIGLQFYTQGKLEWLLGQTEEAVSSLIK  442

Query  399  AMDILRITHGTKSSFMKELSFKLEEARAEVSYKLSTRKE  283
            A DILRI+HGT + FMKELS KL+EARAE SYKL   K+
Sbjct  443  AYDILRISHGTSTPFMKELSAKLDEARAEASYKLLALKD  481



>gb|KHG02872.1| Histone-lysine N-methyltransferase ASHR1 -like protein [Gossypium 
arboreum]
Length=478

 Score =   199 bits (507),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 99/159 (62%), Positives = 133/159 (84%), Gaps = 3/159 (2%)
 Frame = -3

Query  759  KEEVMNLAGEIKsmseraslsssSGHKRDAIVMYKSIEELELRLFHAFSINLMRTRETLL  580
            KEE+  +A +IK++S++AS S   G+ ++AIV+YK+IE+L+  ++H FSI L+RTRE LL
Sbjct  322  KEEIRKIASDIKALSDKASSS---GNLQEAIVLYKNIEKLQKEVYHPFSIILLRTREKLL  378

Query  579  KMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLLGESEEAFKSLSK  400
            ++ M+L++WKEAL  CRLTIPVY+RVY GFHPLLGLQYY+CGKLEWLLGE+++A K  +K
Sbjct  379  EILMQLEEWKEALTICRLTIPVYERVYPGFHPLLGLQYYSCGKLEWLLGETDDAIKLFTK  438

Query  399  AMDILRITHGTKSSFMKELSFKLEEARAEVSYKLSTRKE  283
            A+DILRITHGT + FMKEL  KLEEARAE  +KLS+R++
Sbjct  439  AVDILRITHGTSTPFMKELLMKLEEARAEALFKLSSRED  477



>ref|XP_004500595.1| PREDICTED: histone-lysine N-methyltransferase ASHR1-like isoform 
X1 [Cicer arietinum]
Length=482

 Score =   199 bits (507),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 99/159 (62%), Positives = 129/159 (81%), Gaps = 0/159 (0%)
 Frame = -3

Query  759  KEEVMNLAGEIKsmseraslsssSGHKRDAIVMYKSIEELELRLFHAFSINLMRTRETLL  580
            KEE+  +A EIK +SE AS  SS G+ ++AI +Y  IE+L+++L+H FSINLM+TRE +L
Sbjct  324  KEEIKKIATEIKLLSEEASKPSSRGNYQEAITIYTMIEKLQVKLYHTFSINLMQTREMIL  383

Query  579  KMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLLGESEEAFKSLSK  400
            K  M+L+ W+EAL YC+LTIP+YQRVY   HP+LGLQYYTCGKLEW LG++EEA  SL+K
Sbjct  384  KSLMKLEHWREALAYCKLTIPIYQRVYPAVHPMLGLQYYTCGKLEWYLGDTEEAVISLTK  443

Query  399  AMDILRITHGTKSSFMKELSFKLEEARAEVSYKLSTRKE  283
            A+DILRITHGT + F+KEL   LEEARAE S+KLS+++E
Sbjct  444  AVDILRITHGTNTPFVKELLVMLEEARAEASFKLSSKEE  482



>ref|XP_002886136.1| hypothetical protein ARALYDRAFT_319740 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62395.1| hypothetical protein ARALYDRAFT_319740 [Arabidopsis lyrata subsp. 
lyrata]
Length=483

 Score =   199 bits (505),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 101/156 (65%), Positives = 128/156 (82%), Gaps = 0/156 (0%)
 Frame = -3

Query  759  KEEVMNLAGEIKsmseraslsssSGHKRDAIVMYKSIEELELRLFHAFSINLMRTRETLL  580
            KEEV  LA ++K++SE+A  S S+ +K+ AI +YK+IE+L+++L+H+FSI LMRTRE LL
Sbjct  323  KEEVKKLASDLKTVSEKAHASPSAENKQAAIELYKTIEKLQVKLYHSFSITLMRTREKLL  382

Query  579  KMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLLGESEEAFKSLSK  400
            KM M+L+ W+EAL YCRL +PVYQRVY   HPL+GLQ+YT GKLEWLLGE++EA  SL K
Sbjct  383  KMLMDLEIWREALNYCRLIVPVYQRVYPATHPLIGLQFYTQGKLEWLLGETKEAVSSLIK  442

Query  399  AMDILRITHGTKSSFMKELSFKLEEARAEVSYKLST  292
            A DILRI+HGT + FMKELS KLEEARAE SYKL+ 
Sbjct  443  AFDILRISHGTSTPFMKELSAKLEEARAEASYKLAC  478



>ref|XP_009121064.1| PREDICTED: histone-lysine N-methyltransferase ASHR1 isoform X4 
[Brassica rapa]
Length=475

 Score =   198 bits (504),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 101/164 (62%), Positives = 129/164 (79%), Gaps = 5/164 (3%)
 Frame = -3

Query  759  KEEVMNLAGEIKsmseraslsssSG-----HKRDAIVMYKSIEELELRLFHAFSINLMRT  595
            KEEV  LAG++K++S +A  S S+      HK+DAI +YK+ E+L+ +L+H+FSI LMRT
Sbjct  310  KEEVKKLAGDVKTVSAKALASPSAESICCLHKQDAIALYKTFEKLQEKLYHSFSITLMRT  369

Query  594  RETLLKMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLLGESEEAF  415
            RE LLKM ME++ W+EAL+YC+L +PVYQRVY   HPL+GLQ+YT GKLEWLLG++EEA 
Sbjct  370  REKLLKMLMEVESWREALDYCKLIVPVYQRVYPATHPLIGLQFYTQGKLEWLLGQTEEAV  429

Query  414  KSLSKAMDILRITHGTKSSFMKELSFKLEEARAEVSYKLSTRKE  283
             SL KA DILRI+HGT + FMKELS KL+EARAE SYKL   K+
Sbjct  430  SSLIKAYDILRISHGTSTPFMKELSAKLDEARAEASYKLLALKD  473



>gb|KEH34847.1| histone-lysine N-methyltransferase [Medicago truncatula]
Length=440

 Score =   197 bits (501),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 98/152 (64%), Positives = 124/152 (82%), Gaps = 0/152 (0%)
 Frame = -3

Query  759  KEEVMNLAGEIKsmseraslsssSGHKRDAIVMYKSIEELELRLFHAFSINLMRTRETLL  580
            KEE+  +A EIK + E AS  SS+G+  +AI ++K IE+L+ +L+H FSINLM+TRET+L
Sbjct  284  KEEIKQIATEIKFLLEEASKPSSNGNSHEAISIHKMIEKLQTKLYHPFSINLMQTRETIL  343

Query  579  KMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLLGESEEAFKSLSK  400
            K  M+L+ W+EAL YC+LTIP+YQRVY   HPLLGLQYYTCGKLEW LG++EEA KSL+K
Sbjct  344  KSLMKLEYWREALAYCKLTIPIYQRVYPAVHPLLGLQYYTCGKLEWYLGDTEEAIKSLTK  403

Query  399  AMDILRITHGTKSSFMKELSFKLEEARAEVSY  304
            A+DILRITHGTK+ F+KELS  L EARAE S+
Sbjct  404  AVDILRITHGTKTPFVKELSMMLVEARAEASF  435



>ref|XP_009121061.1| PREDICTED: histone-lysine N-methyltransferase ASHR1 isoform X1 
[Brassica rapa]
 ref|XP_009121062.1| PREDICTED: histone-lysine N-methyltransferase ASHR1 isoform X2 
[Brassica rapa]
Length=488

 Score =   198 bits (504),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 103/167 (62%), Positives = 130/167 (78%), Gaps = 6/167 (4%)
 Frame = -3

Query  759  KEEVMNLAGEIKsmseraslsssSG-----HKRDAIVMYKSIEELELRLFHAFSINLMRT  595
            KEEV  LAG++K++S +A  S S+      HK+DAI +YK+ E+L+ +L+H+FSI LMRT
Sbjct  323  KEEVKKLAGDVKTVSAKALASPSAESICCLHKQDAIALYKTFEKLQEKLYHSFSITLMRT  382

Query  594  RETLLKMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLLGESEEAF  415
            RE LLKM ME++ W+EAL+YC+L +PVYQRVY   HPL+GLQ+YT GKLEWLLG++EEA 
Sbjct  383  REKLLKMLMEVESWREALDYCKLIVPVYQRVYPATHPLIGLQFYTQGKLEWLLGQTEEAV  442

Query  414  KSLSKAMDILRITHGTKSSFMKELSFKLEEARAEVSYKLSTRKEDGE  274
             SL KA DILRI+HGT + FMKELS KL+EARAE SYKL   K DG 
Sbjct  443  SSLIKAYDILRISHGTSTPFMKELSAKLDEARAEASYKLLALK-DGN  488



>ref|XP_008338790.1| PREDICTED: histone-lysine N-methyltransferase ASHR1 [Malus domestica]
Length=480

 Score =   198 bits (503),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 103/156 (66%), Positives = 126/156 (81%), Gaps = 0/156 (0%)
 Frame = -3

Query  759  KEEVMNLAGEIKsmseraslsssSGHKRDAIVMYKSIEELELRLFHAFSINLMRTRETLL  580
            KEE+   A E+KS+S++A LS+SS   ++AI   K+IE L+ +L H  SI+LM+TRE LL
Sbjct  323  KEEIRKXASELKSLSDKAPLSTSSCDYQEAISGLKAIETLQKKLXHPXSISLMQTREKLL  382

Query  579  KMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLLGESEEAFKSLSK  400
            K+ MEL+DW  AL YCRLTIPVYQRVY G HPLLGLQYYTCGKLEWLLG++E A KSL+K
Sbjct  383  KILMELEDWNAALAYCRLTIPVYQRVYPGCHPLLGLQYYTCGKLEWLLGDTENAVKSLTK  442

Query  399  AMDILRITHGTKSSFMKELSFKLEEARAEVSYKLST  292
            A+DILRITHGT + FMK+L  +LEEARAE SYKLS+
Sbjct  443  AVDILRITHGTSTPFMKDLLMRLEEARAEASYKLSS  478



>gb|AES71348.2| histone-lysine N-methyltransferase [Medicago truncatula]
Length=475

 Score =   197 bits (502),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 98/152 (64%), Positives = 124/152 (82%), Gaps = 0/152 (0%)
 Frame = -3

Query  759  KEEVMNLAGEIKsmseraslsssSGHKRDAIVMYKSIEELELRLFHAFSINLMRTRETLL  580
            KEE+  +A EIK + E AS  SS+G+  +AI ++K IE+L+ +L+H FSINLM+TRET+L
Sbjct  319  KEEIKQIATEIKFLLEEASKPSSNGNSHEAISIHKMIEKLQTKLYHPFSINLMQTRETIL  378

Query  579  KMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLLGESEEAFKSLSK  400
            K  M+L+ W+EAL YC+LTIP+YQRVY   HPLLGLQYYTCGKLEW LG++EEA KSL+K
Sbjct  379  KSLMKLEYWREALAYCKLTIPIYQRVYPAVHPLLGLQYYTCGKLEWYLGDTEEAIKSLTK  438

Query  399  AMDILRITHGTKSSFMKELSFKLEEARAEVSY  304
            A+DILRITHGTK+ F+KELS  L EARAE S+
Sbjct  439  AVDILRITHGTKTPFVKELSMMLVEARAEASF  470



>gb|AFK47176.1| unknown [Medicago truncatula]
Length=477

 Score =   197 bits (501),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 98/152 (64%), Positives = 124/152 (82%), Gaps = 0/152 (0%)
 Frame = -3

Query  759  KEEVMNLAGEIKsmseraslsssSGHKRDAIVMYKSIEELELRLFHAFSINLMRTRETLL  580
            KEE+  +A EIK + E AS  SS+G+  +AI ++K IE+L+ +L+H FSINLM+TRET+L
Sbjct  321  KEEIKQIATEIKFLLEEASKPSSNGNSHEAISIHKMIEKLQTKLYHPFSINLMQTRETIL  380

Query  579  KMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLLGESEEAFKSLSK  400
            K  M+L+ W+EAL YC+LTIP+YQRVY   HPLLGLQYYTCGKLEW LG++EEA KSL+K
Sbjct  381  KSLMKLEYWREALAYCKLTIPIYQRVYPAVHPLLGLQYYTCGKLEWYLGDTEEAIKSLTK  440

Query  399  AMDILRITHGTKSSFMKELSFKLEEARAEVSY  304
            A+DILRITHGTK+ F+KELS  L EARAE S+
Sbjct  441  AVDILRITHGTKTPFVKELSMMLVEARAEASF  472



>ref|XP_010230948.1| PREDICTED: histone-lysine N-methyltransferase ASHR1 isoform X2 
[Brachypodium distachyon]
Length=449

 Score =   196 bits (498),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 100/158 (63%), Positives = 126/158 (80%), Gaps = 0/158 (0%)
 Frame = -3

Query  756  EEVMNLAGEIKsmseraslsssSGHKRDAIVMYKSIEELELRLFHAFSINLMRTRETLLK  577
            EEV  L+ EI  +S++AS   SSG+  +A  +YK IE+LE +L+H+FSI L+ TRETLLK
Sbjct  289  EEVKKLSSEILLLSDKASSFVSSGNNNEAGSVYKIIEQLERKLYHSFSITLLHTRETLLK  348

Query  576  MFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLLGESEEAFKSLSKA  397
            ++MELQDW+ AL YCR TIPVY+RVY  FHP++GLQ+YTCGKLEWLL  +E+A KSL++A
Sbjct  349  LYMELQDWRSALMYCRSTIPVYERVYPPFHPMVGLQFYTCGKLEWLLEYTEDALKSLTRA  408

Query  396  MDILRITHGTKSSFMKELSFKLEEARAEVSYKLSTRKE  283
             D+LRITHGT S FMKEL  KLEEARAEVS++LS   E
Sbjct  409  ADVLRITHGTNSQFMKELFGKLEEARAEVSFRLSPGNE  446



>ref|XP_008782266.1| PREDICTED: histone-lysine N-methyltransferase ASHR1 isoform X3 
[Phoenix dactylifera]
Length=423

 Score =   195 bits (496),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 95/155 (61%), Positives = 124/155 (80%), Gaps = 0/155 (0%)
 Frame = -3

Query  759  KEEVMNLAGEIKsmseraslsssSGHKRDAIVMYKSIEELELRLFHAFSINLMRTRETLL  580
            ++E+  +A E+  +SE+AS   SSG+  +A  +YK+IE+L+++L H FSINL+RTRE L+
Sbjct  266  QQEIKKIASEVAELSEKASTILSSGNYSEASAIYKTIEQLQVKLCHQFSINLLRTREILI  325

Query  579  KMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLLGESEEAFKSLSK  400
            K+ MEL+DW+ AL YCRLTIPVYQRVY   HPLLGLQ+  CGKLEW LG +E+A KS +K
Sbjct  326  KILMELKDWRGALTYCRLTIPVYQRVYPAVHPLLGLQFCACGKLEWALGCTEDALKSFAK  385

Query  399  AMDILRITHGTKSSFMKELSFKLEEARAEVSYKLS  295
            AMD+LRITHGT + FM++LS +LEEARAE SYKLS
Sbjct  386  AMDVLRITHGTGTPFMRDLSRQLEEARAEASYKLS  420



>ref|XP_003560708.1| PREDICTED: histone-lysine N-methyltransferase ASHR1 isoform X1 
[Brachypodium distachyon]
Length=482

 Score =   196 bits (499),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 100/158 (63%), Positives = 126/158 (80%), Gaps = 0/158 (0%)
 Frame = -3

Query  756  EEVMNLAGEIKsmseraslsssSGHKRDAIVMYKSIEELELRLFHAFSINLMRTRETLLK  577
            EEV  L+ EI  +S++AS   SSG+  +A  +YK IE+LE +L+H+FSI L+ TRETLLK
Sbjct  322  EEVKKLSSEILLLSDKASSFVSSGNNNEAGSVYKIIEQLERKLYHSFSITLLHTRETLLK  381

Query  576  MFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLLGESEEAFKSLSKA  397
            ++MELQDW+ AL YCR TIPVY+RVY  FHP++GLQ+YTCGKLEWLL  +E+A KSL++A
Sbjct  382  LYMELQDWRSALMYCRSTIPVYERVYPPFHPMVGLQFYTCGKLEWLLEYTEDALKSLTRA  441

Query  396  MDILRITHGTKSSFMKELSFKLEEARAEVSYKLSTRKE  283
             D+LRITHGT S FMKEL  KLEEARAEVS++LS   E
Sbjct  442  ADVLRITHGTNSQFMKELFGKLEEARAEVSFRLSPGNE  479



>ref|XP_011012502.1| PREDICTED: histone-lysine N-methyltransferase ASHR1-like isoform 
X3 [Populus euphratica]
Length=479

 Score =   196 bits (497),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 98/159 (62%), Positives = 124/159 (78%), Gaps = 0/159 (0%)
 Frame = -3

Query  759  KEEVMNLAGEIKsmseraslsssSGHKRDAIVMYKSIEELELRLFHAFSINLMRTRETLL  580
            KEEV  +  EI ++S++   S+S G+ ++ I +YK IE+L++ L H FSI+LMRT+E LL
Sbjct  321  KEEVKRIVCEITAISDKKLKSTSPGNHKEVISIYKMIEKLQMELCHPFSISLMRTQEELL  380

Query  579  KMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLLGESEEAFKSLSK  400
            K+ MEL DW+EAL YCRLTI  YQRVY   HPLLGLQYYTCGK+EWLLG +E+A KSL++
Sbjct  381  KILMELGDWREALAYCRLTITGYQRVYPELHPLLGLQYYTCGKIEWLLGYTEDAIKSLTR  440

Query  399  AMDILRITHGTKSSFMKELSFKLEEARAEVSYKLSTRKE  283
            A+DILRITHGT S FMKEL  KL+EA AE SY LS++ E
Sbjct  441  AVDILRITHGTNSPFMKELVMKLDEAHAEASYNLSSKDE  479



>ref|XP_008782264.1| PREDICTED: histone-lysine N-methyltransferase ASHR1 isoform X1 
[Phoenix dactylifera]
Length=481

 Score =   196 bits (497),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 95/155 (61%), Positives = 124/155 (80%), Gaps = 0/155 (0%)
 Frame = -3

Query  759  KEEVMNLAGEIKsmseraslsssSGHKRDAIVMYKSIEELELRLFHAFSINLMRTRETLL  580
            ++E+  +A E+  +SE+AS   SSG+  +A  +YK+IE+L+++L H FSINL+RTRE L+
Sbjct  324  QQEIKKIASEVAELSEKASTILSSGNYSEASAIYKTIEQLQVKLCHQFSINLLRTREILI  383

Query  579  KMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLLGESEEAFKSLSK  400
            K+ MEL+DW+ AL YCRLTIPVYQRVY   HPLLGLQ+  CGKLEW LG +E+A KS +K
Sbjct  384  KILMELKDWRGALTYCRLTIPVYQRVYPAVHPLLGLQFCACGKLEWALGCTEDALKSFAK  443

Query  399  AMDILRITHGTKSSFMKELSFKLEEARAEVSYKLS  295
            AMD+LRITHGT + FM++LS +LEEARAE SYKLS
Sbjct  444  AMDVLRITHGTGTPFMRDLSRQLEEARAEASYKLS  478



>ref|XP_011012501.1| PREDICTED: histone-lysine N-methyltransferase ASHR1-like isoform 
X2 [Populus euphratica]
Length=480

 Score =   196 bits (497),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 98/159 (62%), Positives = 124/159 (78%), Gaps = 0/159 (0%)
 Frame = -3

Query  759  KEEVMNLAGEIKsmseraslsssSGHKRDAIVMYKSIEELELRLFHAFSINLMRTRETLL  580
            KEEV  +  EI ++S++   S+S G+ ++ I +YK IE+L++ L H FSI+LMRT+E LL
Sbjct  322  KEEVKRIVCEITAISDKKLKSTSPGNHKEVISIYKMIEKLQMELCHPFSISLMRTQEELL  381

Query  579  KMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLLGESEEAFKSLSK  400
            K+ MEL DW+EAL YCRLTI  YQRVY   HPLLGLQYYTCGK+EWLLG +E+A KSL++
Sbjct  382  KILMELGDWREALAYCRLTITGYQRVYPELHPLLGLQYYTCGKIEWLLGYTEDAIKSLTR  441

Query  399  AMDILRITHGTKSSFMKELSFKLEEARAEVSYKLSTRKE  283
            A+DILRITHGT S FMKEL  KL+EA AE SY LS++ E
Sbjct  442  AVDILRITHGTNSPFMKELVMKLDEAHAEASYNLSSKDE  480



>ref|XP_011001421.1| PREDICTED: histone-lysine N-methyltransferase ASHR1-like isoform 
X4 [Populus euphratica]
Length=479

 Score =   196 bits (497),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 98/159 (62%), Positives = 124/159 (78%), Gaps = 0/159 (0%)
 Frame = -3

Query  759  KEEVMNLAGEIKsmseraslsssSGHKRDAIVMYKSIEELELRLFHAFSINLMRTRETLL  580
            KEEV  +  EI ++S++   S+S G+ ++ I +YK IE+L++ L H FSI+LMRT+E LL
Sbjct  321  KEEVKRIVCEITAISDKKLKSTSPGNHKEVISIYKMIEKLQMELCHPFSISLMRTQEELL  380

Query  579  KMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLLGESEEAFKSLSK  400
            K+ MEL DW+EAL YCRLTI  YQRVY   HPLLGLQYYTCGK+EWLLG +E+A KSL++
Sbjct  381  KILMELGDWREALAYCRLTITGYQRVYPELHPLLGLQYYTCGKIEWLLGYTEDAIKSLTR  440

Query  399  AMDILRITHGTKSSFMKELSFKLEEARAEVSYKLSTRKE  283
            A+DILRITHGT S FMKEL  KL+EA AE SY LS++ E
Sbjct  441  AVDILRITHGTNSPFMKELVMKLDEAHAEASYNLSSKDE  479



>ref|XP_011012500.1| PREDICTED: histone-lysine N-methyltransferase ASHR1-like isoform 
X1 [Populus euphratica]
Length=481

 Score =   196 bits (497),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 98/159 (62%), Positives = 124/159 (78%), Gaps = 0/159 (0%)
 Frame = -3

Query  759  KEEVMNLAGEIKsmseraslsssSGHKRDAIVMYKSIEELELRLFHAFSINLMRTRETLL  580
            KEEV  +  EI ++S++   S+S G+ ++ I +YK IE+L++ L H FSI+LMRT+E LL
Sbjct  323  KEEVKRIVCEITAISDKKLKSTSPGNHKEVISIYKMIEKLQMELCHPFSISLMRTQEELL  382

Query  579  KMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLLGESEEAFKSLSK  400
            K+ MEL DW+EAL YCRLTI  YQRVY   HPLLGLQYYTCGK+EWLLG +E+A KSL++
Sbjct  383  KILMELGDWREALAYCRLTITGYQRVYPELHPLLGLQYYTCGKIEWLLGYTEDAIKSLTR  442

Query  399  AMDILRITHGTKSSFMKELSFKLEEARAEVSYKLSTRKE  283
            A+DILRITHGT S FMKEL  KL+EA AE SY LS++ E
Sbjct  443  AVDILRITHGTNSPFMKELVMKLDEAHAEASYNLSSKDE  481



>ref|XP_002464022.1| hypothetical protein SORBIDRAFT_01g010740 [Sorghum bicolor]
 gb|EER91020.1| hypothetical protein SORBIDRAFT_01g010740 [Sorghum bicolor]
Length=482

 Score =   196 bits (497),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 97/157 (62%), Positives = 128/157 (82%), Gaps = 0/157 (0%)
 Frame = -3

Query  759  KEEVMNLAGEIKsmseraslsssSGHKRDAIVMYKSIEELELRLFHAFSINLMRTRETLL  580
            +EE+  +  EI  +S++AS   SSG+K +A  +YK+IE+LE  L+HAFS  L+ T ETLL
Sbjct  321  EEEIQKMRSEILQLSDKASSFLSSGNKAEAGSVYKTIEQLEQNLYHAFSTTLLHTCETLL  380

Query  579  KMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLLGESEEAFKSLSK  400
            K++MELQDW+ AL YCRLT+PVY+RVY  FHP++GLQ+YTCGKLEWLL  +E+A KSL++
Sbjct  381  KIYMELQDWRTALAYCRLTVPVYERVYPPFHPMIGLQFYTCGKLEWLLECTEDALKSLTR  440

Query  399  AMDILRITHGTKSSFMKELSFKLEEARAEVSYKLSTR  289
            A DIL++THGTKS FMKEL  KLEEARAEVS+++S+R
Sbjct  441  ATDILKVTHGTKSQFMKELFGKLEEARAEVSFRISSR  477



>ref|XP_007018970.1| SET domain protein isoform 3 [Theobroma cacao]
 gb|EOY16195.1| SET domain protein isoform 3 [Theobroma cacao]
Length=481

 Score =   196 bits (497),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 97/158 (61%), Positives = 131/158 (83%), Gaps = 1/158 (1%)
 Frame = -3

Query  759  KEEVMNLAGEIKsmseraslsssSGHKRDAIVMYKSIEELELRLFHAFSINLMRTRETLL  580
            KEE+   + +IK++ ++A  S+SSG+ +DA+++YK+IE+L+  + H FSI+LMRT E L 
Sbjct  323  KEEIRKKSRDIKALLDKAPKSTSSGNPQDAMILYKNIEKLQKEVCHPFSISLMRTWEKLH  382

Query  579  KMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEW-LLGESEEAFKSLS  403
            ++ ++L++WKEAL +CRLTIPVY+RVY GFHPLLGLQYY+CGKLEW LLGE+++A KSL+
Sbjct  383  EILVQLEEWKEALTFCRLTIPVYERVYPGFHPLLGLQYYSCGKLEWLLLGETDDAIKSLT  442

Query  402  KAMDILRITHGTKSSFMKELSFKLEEARAEVSYKLSTR  289
            KA+DILRITHGT + FMKEL  KLEEARAE SY LS +
Sbjct  443  KAVDILRITHGTNTPFMKELLMKLEEARAEASYTLSCK  480



>ref|XP_011001420.1| PREDICTED: histone-lysine N-methyltransferase ASHR1-like isoform 
X3 [Populus euphratica]
Length=481

 Score =   196 bits (497),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 98/159 (62%), Positives = 124/159 (78%), Gaps = 0/159 (0%)
 Frame = -3

Query  759  KEEVMNLAGEIKsmseraslsssSGHKRDAIVMYKSIEELELRLFHAFSINLMRTRETLL  580
            KEEV  +  EI ++S++   S+S G+ ++ I +YK IE+L++ L H FSI+LMRT+E LL
Sbjct  323  KEEVKRIVCEITAISDKKLKSTSPGNHKEVISIYKMIEKLQMELCHPFSISLMRTQEELL  382

Query  579  KMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLLGESEEAFKSLSK  400
            K+ MEL DW+EAL YCRLTI  YQRVY   HPLLGLQYYTCGK+EWLLG +E+A KSL++
Sbjct  383  KILMELGDWREALAYCRLTITGYQRVYPELHPLLGLQYYTCGKIEWLLGYTEDAIKSLTR  442

Query  399  AMDILRITHGTKSSFMKELSFKLEEARAEVSYKLSTRKE  283
            A+DILRITHGT S FMKEL  KL+EA AE SY LS++ E
Sbjct  443  AVDILRITHGTNSPFMKELVMKLDEAHAEASYNLSSKDE  481



>ref|XP_011001419.1| PREDICTED: histone-lysine N-methyltransferase ASHR1-like isoform 
X2 [Populus euphratica]
Length=490

 Score =   196 bits (497),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 98/159 (62%), Positives = 124/159 (78%), Gaps = 0/159 (0%)
 Frame = -3

Query  759  KEEVMNLAGEIKsmseraslsssSGHKRDAIVMYKSIEELELRLFHAFSINLMRTRETLL  580
            KEEV  +  EI ++S++   S+S G+ ++ I +YK IE+L++ L H FSI+LMRT+E LL
Sbjct  332  KEEVKRIVCEITAISDKKLKSTSPGNHKEVISIYKMIEKLQMELCHPFSISLMRTQEELL  391

Query  579  KMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLLGESEEAFKSLSK  400
            K+ MEL DW+EAL YCRLTI  YQRVY   HPLLGLQYYTCGK+EWLLG +E+A KSL++
Sbjct  392  KILMELGDWREALAYCRLTITGYQRVYPELHPLLGLQYYTCGKIEWLLGYTEDAIKSLTR  451

Query  399  AMDILRITHGTKSSFMKELSFKLEEARAEVSYKLSTRKE  283
            A+DILRITHGT S FMKEL  KL+EA AE SY LS++ E
Sbjct  452  AVDILRITHGTNSPFMKELVMKLDEAHAEASYNLSSKDE  490



>ref|XP_011001418.1| PREDICTED: histone-lysine N-methyltransferase ASHR1-like isoform 
X1 [Populus euphratica]
Length=491

 Score =   196 bits (497),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 98/159 (62%), Positives = 124/159 (78%), Gaps = 0/159 (0%)
 Frame = -3

Query  759  KEEVMNLAGEIKsmseraslsssSGHKRDAIVMYKSIEELELRLFHAFSINLMRTRETLL  580
            KEEV  +  EI ++S++   S+S G+ ++ I +YK IE+L++ L H FSI+LMRT+E LL
Sbjct  333  KEEVKRIVCEITAISDKKLKSTSPGNHKEVISIYKMIEKLQMELCHPFSISLMRTQEELL  392

Query  579  KMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLLGESEEAFKSLSK  400
            K+ MEL DW+EAL YCRLTI  YQRVY   HPLLGLQYYTCGK+EWLLG +E+A KSL++
Sbjct  393  KILMELGDWREALAYCRLTITGYQRVYPELHPLLGLQYYTCGKIEWLLGYTEDAIKSLTR  452

Query  399  AMDILRITHGTKSSFMKELSFKLEEARAEVSYKLSTRKE  283
            A+DILRITHGT S FMKEL  KL+EA AE SY LS++ E
Sbjct  453  AVDILRITHGTNSPFMKELVMKLDEAHAEASYNLSSKDE  491



>ref|XP_011655179.1| PREDICTED: histone-lysine N-methyltransferase ASHR1 isoform X3 
[Cucumis sativus]
 ref|XP_011655180.1| PREDICTED: histone-lysine N-methyltransferase ASHR1 isoform X3 
[Cucumis sativus]
Length=368

 Score =   192 bits (488),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 99/160 (62%), Positives = 128/160 (80%), Gaps = 0/160 (0%)
 Frame = -3

Query  759  KEEVMNLAGEIKsmseraslsssSGHKRDAIVMYKSIEELELRLFHAFSINLMRTRETLL  580
            KE++ N+A +IKS+S+ AS S SS    +A+ MY+ +E+L+  L H +SI+LM+TRE LL
Sbjct  209  KEDIKNIASKIKSISDEASTSLSSQSYAEALFMYEKVEKLQRILCHPYSISLMQTREKLL  268

Query  579  KMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLLGESEEAFKSLSK  400
            K+ MEL++W +AL YC+LTI VYQ++Y G HPLLGLQ+YTCGKLEWLLG +E+A KS +K
Sbjct  269  KISMELENWTKALTYCKLTISVYQKLYPGIHPLLGLQFYTCGKLEWLLGHTEDAIKSYTK  328

Query  399  AMDILRITHGTKSSFMKELSFKLEEARAEVSYKLSTRKED  280
            A DILRITHGT SSFMKEL  KLEEARAE SYKLS+  ++
Sbjct  329  AFDILRITHGTNSSFMKELLLKLEEARAEASYKLSSTDDE  368



>ref|XP_010489431.1| PREDICTED: histone-lysine N-methyltransferase ASHR1 [Camelina 
sativa]
Length=498

 Score =   194 bits (494),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 97/152 (64%), Positives = 123/152 (81%), Gaps = 0/152 (0%)
 Frame = -3

Query  759  KEEVMNLAGEIKsmseraslsssSGHKRDAIVMYKSIEELELRLFHAFSINLMRTRETLL  580
            KEEV  LA E+K +SE A  S S+ +K+ AI +YK+IE+L++ L+++FSI LMRTRE LL
Sbjct  337  KEEVKKLASEVKRVSENAPASPSAENKQGAIELYKTIEKLQVTLYNSFSITLMRTREKLL  396

Query  579  KMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLLGESEEAFKSLSK  400
            KM M+++ W+EAL YCRL +PVYQRVY   HPL+GLQ+YT GKLEWLLGE++EA  SL+K
Sbjct  397  KMLMDVESWREALNYCRLIVPVYQRVYPATHPLIGLQFYTQGKLEWLLGETKEAVSSLTK  456

Query  399  AMDILRITHGTKSSFMKELSFKLEEARAEVSY  304
            A D+LRI+HGT + FMKELS KLEEARAE SY
Sbjct  457  AFDVLRISHGTSTPFMKELSAKLEEARAEASY  488



>dbj|BAJ98467.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=153

 Score =   184 bits (468),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 87/131 (66%), Positives = 111/131 (85%), Gaps = 0/131 (0%)
 Frame = -3

Query  675  DAIVMYKSIEELELRLFHAFSINLMRTRETLLKMFMELQDWKEALEYCRLTIPVYQRVYQ  496
            +A  +YK IE+LE + +H+FSI L+ TRETLLK++MELQDW+ AL YCRLTIPVY+RVY 
Sbjct  20   EAGSVYKIIEQLEQKHYHSFSITLLHTRETLLKIYMELQDWQTALMYCRLTIPVYERVYP  79

Query  495  GFHPLLGLQYYTCGKLEWLLGESEEAFKSLSKAMDILRITHGTKSSFMKELSFKLEEARA  316
             FHP++GLQ+YTCGKLEWLL  +E+A K L++A D+LRITHGT+S FMKEL  KLEEARA
Sbjct  80   PFHPMVGLQFYTCGKLEWLLEYTEDALKLLTRAADVLRITHGTQSQFMKELFGKLEEARA  139

Query  315  EVSYKLSTRKE  283
            EVS++LS+ +E
Sbjct  140  EVSFRLSSGEE  150



>ref|XP_002306611.1| zinc finger family protein [Populus trichocarpa]
 gb|EEE93607.1| zinc finger family protein [Populus trichocarpa]
Length=458

 Score =   193 bits (491),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 98/159 (62%), Positives = 123/159 (77%), Gaps = 0/159 (0%)
 Frame = -3

Query  759  KEEVMNLAGEIKsmseraslsssSGHKRDAIVMYKSIEELELRLFHAFSINLMRTRETLL  580
            KEEV  +  EI ++S++   S+S G+  + I +YK IE+L++ L H FSI+LMRT+E LL
Sbjct  300  KEEVKRIVCEITAISDKKLKSTSPGNHEEVISLYKMIEKLQMELCHPFSISLMRTQEELL  359

Query  579  KMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLLGESEEAFKSLSK  400
            K+ MEL DW+EAL YCRLTI  YQRVY   HPLLGLQYYTCGK+EWLLG +E+A KSL++
Sbjct  360  KILMELGDWREALAYCRLTITGYQRVYPEPHPLLGLQYYTCGKIEWLLGYTEDAIKSLTR  419

Query  399  AMDILRITHGTKSSFMKELSFKLEEARAEVSYKLSTRKE  283
            A+DILRITHGT S FMKEL  KL+EA AE SY LS++ E
Sbjct  420  AVDILRITHGTNSPFMKELMMKLDEAHAEASYNLSSKDE  458



>ref|XP_006578981.1| PREDICTED: histone-lysine N-methyltransferase ASHR1-like [Glycine 
max]
 gb|KHN47053.1| Histone-lysine N-methyltransferase ASHR1 [Glycine soja]
Length=485

 Score =   194 bits (493),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 98/158 (62%), Positives = 121/158 (77%), Gaps = 0/158 (0%)
 Frame = -3

Query  759  KEEVMNLAGEIKsmseraslsssSGHKRDAIVMYKSIEELELRLFHAFSINLMRTRETLL  580
            KEE+  +  EIK +SE AS  S++ + ++AI +YK IE+L+  LFH  SINLM TRE +L
Sbjct  328  KEEIKRITTEIKLLSEDASKPSATCNYQEAISIYKRIEKLQTELFHPLSINLMHTREKIL  387

Query  579  KMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLLGESEEAFKSLSK  400
            K  MEL+ W EAL YC+LTIP YQRVY   HPL GLQYYTCGKLEW LG++EEA KSL+K
Sbjct  388  KSLMELEHWTEALAYCKLTIPFYQRVYPAVHPLPGLQYYTCGKLEWYLGDTEEAVKSLTK  447

Query  399  AMDILRITHGTKSSFMKELSFKLEEARAEVSYKLSTRK  286
            A+DILRITHGT + FMK+L  KLEEAR E SYK S+++
Sbjct  448  AVDILRITHGTNTPFMKDLLMKLEEARTEASYKFSSKE  485



>ref|XP_007018968.1| SET domain protein isoform 1 [Theobroma cacao]
 gb|EOY16193.1| SET domain protein isoform 1 [Theobroma cacao]
Length=479

 Score =   193 bits (491),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 87/130 (67%), Positives = 112/130 (86%), Gaps = 0/130 (0%)
 Frame = -3

Query  678  RDAIVMYKSIEELELRLFHAFSINLMRTRETLLKMFMELQDWKEALEYCRLTIPVYQRVY  499
            +DA+++YK+IE+L+  + H FSI+LMRT E L ++ ++L++WKEAL +CRLTIPVY+RVY
Sbjct  349  QDAMILYKNIEKLQKEVCHPFSISLMRTWEKLHEILVQLEEWKEALTFCRLTIPVYERVY  408

Query  498  QGFHPLLGLQYYTCGKLEWLLGESEEAFKSLSKAMDILRITHGTKSSFMKELSFKLEEAR  319
             GFHPLLGLQYY+CGKLEWLLGE+++A KSL+KA+DILRITHGT + FMKEL  KLEEAR
Sbjct  409  PGFHPLLGLQYYSCGKLEWLLGETDDAIKSLTKAVDILRITHGTNTPFMKELLMKLEEAR  468

Query  318  AEVSYKLSTR  289
            AE SY LS +
Sbjct  469  AEASYTLSCK  478



>ref|XP_010065502.1| PREDICTED: histone-lysine N-methyltransferase ASHR1 [Eucalyptus 
grandis]
 gb|KCW63013.1| hypothetical protein EUGRSUZ_G00611 [Eucalyptus grandis]
Length=479

 Score =   193 bits (490),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 99/159 (62%), Positives = 127/159 (80%), Gaps = 1/159 (1%)
 Frame = -3

Query  759  KEEVMNLAGEIKsmseraslsssSGHKRDAIVMYKSIEELELRLFHAFSINLMRTRETLL  580
            KEE+ ++A EIK MSER S S+S GHK +A+ +YK IE L+ +L+H  SI L++TRE +L
Sbjct  322  KEEIRDIASEIKLMSERTSSSTSPGHK-EAVSIYKMIENLQGKLYHPSSIILLQTREKIL  380

Query  579  KMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLLGESEEAFKSLSK  400
            K+ M+L+DWKEAL YC+LTIPVY+RVY G+HPLLGLQYYT GKLEWLLG++  A KSL+K
Sbjct  381  KILMDLEDWKEALVYCKLTIPVYERVYPGYHPLLGLQYYTSGKLEWLLGDTVNAIKSLTK  440

Query  399  AMDILRITHGTKSSFMKELSFKLEEARAEVSYKLSTRKE  283
            A+DILR+THG  + F++EL  KLEEARAE S+ LS   E
Sbjct  441  AIDILRVTHGMNTEFVRELVMKLEEARAEASHNLSCADE  479



>ref|NP_849969.1| SET domain group protein 37 [Arabidopsis thaliana]
 sp|Q7XJS0.2|ASHR1_ARATH RecName: Full=Histone-lysine N-methyltransferase ASHR1; AltName: 
Full=ASH1-related protein 1; AltName: Full=Protein SET DOMAIN 
GROUP 37 [Arabidopsis thaliana]
 gb|ABP88121.1| At2g17900 [Arabidopsis thaliana]
 gb|AEC06700.1| SET domain group protein 37 [Arabidopsis thaliana]
Length=480

 Score =   192 bits (489),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 98/153 (64%), Positives = 124/153 (81%), Gaps = 0/153 (0%)
 Frame = -3

Query  759  KEEVMNLAGEIKsmseraslsssSGHKRDAIVMYKSIEELELRLFHAFSINLMRTRETLL  580
            KEEV  LA ++K++SE+A  S S+  K+ AI +YK+IE+L+++L+H+FSI LMRTRE LL
Sbjct  323  KEEVKKLASDLKTVSEKAPTSPSAEDKQAAIELYKTIEKLQVKLYHSFSIPLMRTREKLL  382

Query  579  KMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLLGESEEAFKSLSK  400
            KM M+++ W+EAL YCRL +PVYQRVY   HPL+GLQ+YT GKLEWLLGE++EA  SL K
Sbjct  383  KMLMDVEIWREALNYCRLIVPVYQRVYPATHPLIGLQFYTQGKLEWLLGETKEAVSSLIK  442

Query  399  AMDILRITHGTKSSFMKELSFKLEEARAEVSYK  301
            A DILRI+HG  + FMKELS KLEEARAE SYK
Sbjct  443  AFDILRISHGISTPFMKELSAKLEEARAEASYK  475



>ref|XP_010065503.1| PREDICTED: histone-lysine N-methyltransferase ASHR1-like [Eucalyptus 
grandis]
Length=253

 Score =   186 bits (473),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 98/159 (62%), Positives = 122/159 (77%), Gaps = 3/159 (2%)
 Frame = -3

Query  759  KEEVMNLAGEIKsmseraslsssSGHKRDAIVMYKSIEELELRLFHAFSINLMRTRETLL  580
            KEE+  +A EIK MSER S S+S      A+ +YK IE L+ +L+H  SI L++TRE +L
Sbjct  98   KEEIRGIASEIKLMSERTSSSTSPSQ---AVSIYKMIENLQGKLYHPSSIILLQTREKIL  154

Query  579  KMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLLGESEEAFKSLSK  400
            K  M+LQDWKEAL YC+LTIPVY+RVY G+HPLLGLQYYT GKLEWLLG++  A KSL+K
Sbjct  155  KTLMDLQDWKEALVYCKLTIPVYERVYPGYHPLLGLQYYTSGKLEWLLGDTGNAIKSLTK  214

Query  399  AMDILRITHGTKSSFMKELSFKLEEARAEVSYKLSTRKE  283
            A+DILR+THGT + F++EL  KLEEARAE S+ LS   E
Sbjct  215  AVDILRVTHGTNTEFVRELVMKLEEARAEASHNLSCADE  253



>ref|XP_006297545.1| hypothetical protein CARUB_v10013566mg [Capsella rubella]
 gb|EOA30443.1| hypothetical protein CARUB_v10013566mg [Capsella rubella]
Length=484

 Score =   192 bits (489),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 96/152 (63%), Positives = 122/152 (80%), Gaps = 0/152 (0%)
 Frame = -3

Query  759  KEEVMNLAGEIKsmseraslsssSGHKRDAIVMYKSIEELELRLFHAFSINLMRTRETLL  580
            KEEV  +A +IK +SE+A  S S   K+ +I ++K+IE+L+ +L+H+FSI LMRTRE LL
Sbjct  328  KEEVKKIASDIKRVSEKALASPSEEDKQASIELHKTIEKLQFKLYHSFSITLMRTREKLL  387

Query  579  KMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLLGESEEAFKSLSK  400
            KM M+++ W+EAL YCRL +PVYQRVY   HPL+GLQ+YT GKLEWLLGE++EA  SL+K
Sbjct  388  KMLMDVESWREALNYCRLIVPVYQRVYPATHPLIGLQFYTQGKLEWLLGETKEAVSSLTK  447

Query  399  AMDILRITHGTKSSFMKELSFKLEEARAEVSY  304
            A DILRI+HGT + FMKELS KLEEARAE SY
Sbjct  448  AFDILRISHGTSTPFMKELSAKLEEARAEASY  479



>ref|XP_011655178.1| PREDICTED: histone-lysine N-methyltransferase ASHR1 isoform X2 
[Cucumis sativus]
Length=447

 Score =   191 bits (486),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 99/160 (62%), Positives = 128/160 (80%), Gaps = 0/160 (0%)
 Frame = -3

Query  759  KEEVMNLAGEIKsmseraslsssSGHKRDAIVMYKSIEELELRLFHAFSINLMRTRETLL  580
            KE++ N+A +IKS+S+ AS S SS    +A+ MY+ +E+L+  L H +SI+LM+TRE LL
Sbjct  288  KEDIKNIASKIKSISDEASTSLSSQSYAEALFMYEKVEKLQRILCHPYSISLMQTREKLL  347

Query  579  KMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLLGESEEAFKSLSK  400
            K+ MEL++W +AL YC+LTI VYQ++Y G HPLLGLQ+YTCGKLEWLLG +E+A KS +K
Sbjct  348  KISMELENWTKALTYCKLTISVYQKLYPGIHPLLGLQFYTCGKLEWLLGHTEDAIKSYTK  407

Query  399  AMDILRITHGTKSSFMKELSFKLEEARAEVSYKLSTRKED  280
            A DILRITHGT SSFMKEL  KLEEARAE SYKLS+  ++
Sbjct  408  AFDILRITHGTNSSFMKELLLKLEEARAEASYKLSSTDDE  447



>ref|XP_010467589.1| PREDICTED: histone-lysine N-methyltransferase ASHR1 [Camelina 
sativa]
Length=489

 Score =   192 bits (488),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 95/152 (63%), Positives = 124/152 (82%), Gaps = 0/152 (0%)
 Frame = -3

Query  759  KEEVMNLAGEIKsmseraslsssSGHKRDAIVMYKSIEELELRLFHAFSINLMRTRETLL  580
            KEEV  LA +IK +SE+A  S S+ +K+  I +YK+IE L+++L+++FSI LMRTRE LL
Sbjct  328  KEEVKKLASDIKRVSEKAPASPSAENKQATIELYKTIERLQVKLYNSFSITLMRTREKLL  387

Query  579  KMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLLGESEEAFKSLSK  400
            K+ M+++ W+EAL YCRL +PVYQRVY   HPL+GLQ+YT GKLEWLLGE++EA  SL+K
Sbjct  388  KILMDVESWREALNYCRLIVPVYQRVYPATHPLIGLQFYTQGKLEWLLGETKEAVSSLTK  447

Query  399  AMDILRITHGTKSSFMKELSFKLEEARAEVSY  304
            A D+LRI+HGT ++FMKELS KLEEARAE SY
Sbjct  448  AFDVLRISHGTSTAFMKELSAKLEEARAEASY  479



>ref|XP_004982043.1| PREDICTED: histone-lysine N-methyltransferase ASHR1-like [Setaria 
italica]
Length=485

 Score =   192 bits (488),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 101/164 (62%), Positives = 127/164 (77%), Gaps = 0/164 (0%)
 Frame = -3

Query  759  KEEVMNLAGEIKsmseraslsssSGHKRDAIVMYKSIEELELRLFHAFSINLMRTRETLL  580
            +EE+  +  EI  +S++AS   SSG+  +A  +Y+ IE+LE  L+HAFSI L+ TRETLL
Sbjct  321  EEEIKKMTREILLLSDKASSFVSSGNTTEAGSIYEKIEQLEQNLYHAFSITLLHTRETLL  380

Query  579  KMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLLGESEEAFKSLSK  400
            K+ MELQDW+ AL YCRLTIPVY+RVY   HP++GLQ+YTCGKLEWLL  +E+A KSL++
Sbjct  381  KVHMELQDWQTALTYCRLTIPVYERVYPPSHPMIGLQFYTCGKLEWLLECTEDALKSLTR  440

Query  399  AMDILRITHGTKSSFMKELSFKLEEARAEVSYKLSTRKEDGEGF  268
            A DIL ITHGTKS FMKEL  KLEEARAEVS+KLS+ +   E F
Sbjct  441  AADILGITHGTKSQFMKELFGKLEEARAEVSFKLSSSRGHDEQF  484



>ref|NP_001131420.1| histone-lysine N-methyltransferase ASHR1 [Zea mays]
 gb|ACF79818.1| unknown [Zea mays]
 gb|AFW67881.1| histone-lysine N-methyltransferase ASHR1 [Zea mays]
Length=482

 Score =   192 bits (488),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 98/156 (63%), Positives = 125/156 (80%), Gaps = 0/156 (0%)
 Frame = -3

Query  756  EEVMNLAGEIKsmseraslsssSGHKRDAIVMYKSIEELELRLFHAFSINLMRTRETLLK  577
            EE+ N+  EI  +S++AS   SSG+K +A  +YK IE+LE  L+HAFS  L+ T ETLLK
Sbjct  322  EEIKNMRSEILQLSDKASSFLSSGNKAEAGSIYKIIEQLERNLYHAFSTTLLHTCETLLK  381

Query  576  MFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLLGESEEAFKSLSKA  397
            +++ELQDW  AL YCRLTIPVY+RVY  FHP++GLQ+YTCGKLEWLL  +E+A KSL++A
Sbjct  382  IYLELQDWWTALTYCRLTIPVYERVYPPFHPMIGLQFYTCGKLEWLLEFTEDALKSLTRA  441

Query  396  MDILRITHGTKSSFMKELSFKLEEARAEVSYKLSTR  289
             DIL++THG KS FMKEL  KLEEARAEVS++LS+R
Sbjct  442  ADILKVTHGVKSQFMKELFGKLEEARAEVSFRLSSR  477



>gb|ACG37550.1| histone-lysine N-methyltransferase ASHR1 [Zea mays]
Length=482

 Score =   192 bits (488),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 98/156 (63%), Positives = 125/156 (80%), Gaps = 0/156 (0%)
 Frame = -3

Query  756  EEVMNLAGEIKsmseraslsssSGHKRDAIVMYKSIEELELRLFHAFSINLMRTRETLLK  577
            EE+ N+  EI  +S++AS   SSG+K +A  +YK IE+LE  L+HAFS  L+ T ETLLK
Sbjct  322  EEIKNMRSEILQLSDKASSFLSSGNKAEAGSIYKIIEQLERNLYHAFSTTLLHTCETLLK  381

Query  576  MFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLLGESEEAFKSLSKA  397
            +++ELQDW  AL YCRLTIPVY+RVY  FHP++GLQ+YTCGKLEWLL  +E+A KSL++A
Sbjct  382  IYLELQDWWTALTYCRLTIPVYERVYPPFHPMIGLQFYTCGKLEWLLEFTEDALKSLTRA  441

Query  396  MDILRITHGTKSSFMKELSFKLEEARAEVSYKLSTR  289
             DIL++THG KS FMKEL  KLEEARAEVS++LS+R
Sbjct  442  ADILKVTHGVKSQFMKELFGKLEEARAEVSFRLSSR  477



>ref|XP_011655177.1| PREDICTED: histone-lysine N-methyltransferase ASHR1 isoform X1 
[Cucumis sativus]
Length=481

 Score =   192 bits (487),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 99/160 (62%), Positives = 128/160 (80%), Gaps = 0/160 (0%)
 Frame = -3

Query  759  KEEVMNLAGEIKsmseraslsssSGHKRDAIVMYKSIEELELRLFHAFSINLMRTRETLL  580
            KE++ N+A +IKS+S+ AS S SS    +A+ MY+ +E+L+  L H +SI+LM+TRE LL
Sbjct  322  KEDIKNIASKIKSISDEASTSLSSQSYAEALFMYEKVEKLQRILCHPYSISLMQTREKLL  381

Query  579  KMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLLGESEEAFKSLSK  400
            K+ MEL++W +AL YC+LTI VYQ++Y G HPLLGLQ+YTCGKLEWLLG +E+A KS +K
Sbjct  382  KISMELENWTKALTYCKLTISVYQKLYPGIHPLLGLQFYTCGKLEWLLGHTEDAIKSYTK  441

Query  399  AMDILRITHGTKSSFMKELSFKLEEARAEVSYKLSTRKED  280
            A DILRITHGT SSFMKEL  KLEEARAE SYKLS+  ++
Sbjct  442  AFDILRITHGTNSSFMKELLLKLEEARAEASYKLSSTDDE  481



>gb|KGN50970.1| hypothetical protein Csa_5G376270 [Cucumis sativus]
Length=496

 Score =   192 bits (487),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 99/160 (62%), Positives = 128/160 (80%), Gaps = 0/160 (0%)
 Frame = -3

Query  759  KEEVMNLAGEIKsmseraslsssSGHKRDAIVMYKSIEELELRLFHAFSINLMRTRETLL  580
            KE++ N+A +IKS+S+ AS S SS    +A+ MY+ +E+L+  L H +SI+LM+TRE LL
Sbjct  337  KEDIKNIASKIKSISDEASTSLSSQSYAEALFMYEKVEKLQRILCHPYSISLMQTREKLL  396

Query  579  KMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLLGESEEAFKSLSK  400
            K+ MEL++W +AL YC+LTI VYQ++Y G HPLLGLQ+YTCGKLEWLLG +E+A KS +K
Sbjct  397  KISMELENWTKALTYCKLTISVYQKLYPGIHPLLGLQFYTCGKLEWLLGHTEDAIKSYTK  456

Query  399  AMDILRITHGTKSSFMKELSFKLEEARAEVSYKLSTRKED  280
            A DILRITHGT SSFMKEL  KLEEARAE SYKLS+  ++
Sbjct  457  AFDILRITHGTNSSFMKELLLKLEEARAEASYKLSSTDDE  496



>gb|AAS07242.1| putative MYND finger protein [Oryza sativa Japonica Group]
 gb|ABF98445.1| MYND finger family protein, expressed [Oryza sativa Japonica 
Group]
Length=480

 Score =   191 bits (485),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 95/158 (60%), Positives = 122/158 (77%), Gaps = 0/158 (0%)
 Frame = -3

Query  756  EEVMNLAGEIKsmseraslsssSGHKRDAIVMYKSIEELELRLFHAFSINLMRTRETLLK  577
            EE+  +A ++  +S++ S   SSG+  +   MYK+IEELE +L+H  SI L+ TRETLLK
Sbjct  322  EELQKMASDVLLLSDKVSSLVSSGNNSEVGSMYKTIEELERKLYHPLSITLLHTRETLLK  381

Query  576  MFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLLGESEEAFKSLSKA  397
            ++MELQDW+ AL YCRLTIPVY+R+Y  FHP++GLQ+YTCGKLEWLL  +E+A  SL++A
Sbjct  382  IYMELQDWQTALMYCRLTIPVYERIYPPFHPMIGLQFYTCGKLEWLLEYTEDALMSLTRA  441

Query  396  MDILRITHGTKSSFMKELSFKLEEARAEVSYKLSTRKE  283
             DILRITHGTKS FMKEL  KLEE RAE S++LS   E
Sbjct  442  ADILRITHGTKSEFMKELLGKLEEVRAEASFRLSAGDE  479



>emb|CDY63757.1| BnaCnng42550D [Brassica napus]
Length=483

 Score =   191 bits (485),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 97/162 (60%), Positives = 126/162 (78%), Gaps = 1/162 (1%)
 Frame = -3

Query  759  KEEVMNLAGEIKsmseraslsssSGHKRDAIVMYKSIEELELRLFHAFSINLMRTRETLL  580
            KEEV  LAG++K++  +A  S S+ + +DAI +YK++E+ + +L+H+FSI LMRTRE LL
Sbjct  323  KEEVKKLAGDVKTVIAKAPASPSAENTQDAIALYKTLEKRQEKLYHSFSITLMRTREKLL  382

Query  579  KMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLLGESEEAFKSLSK  400
            KM ME++ W+EAL YC+L + VYQRVY   HPL+GLQ+YT GKLEWLLG++EEA  SL K
Sbjct  383  KMLMEVESWREALSYCKLIVLVYQRVYPATHPLIGLQFYTQGKLEWLLGQTEEAVSSLIK  442

Query  399  AMDILRITHGTKSSFMKELSFKLEEARAEVSYKLSTRKEDGE  274
            A DILRI+HGT + FMK+LS KL+EARAE SYKL    EDG 
Sbjct  443  AYDILRISHGTSTPFMKDLSAKLDEARAEASYKLLAL-EDGN  483



>gb|KHN09175.1| Histone-lysine N-methyltransferase ASHR1-like protein, partial 
[Glycine soja]
Length=291

 Score =   186 bits (472),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 85/131 (65%), Positives = 105/131 (80%), Gaps = 0/131 (0%)
 Frame = -3

Query  678  RDAIVMYKSIEELELRLFHAFSINLMRTRETLLKMFMELQDWKEALEYCRLTIPVYQRVY  499
            ++AI +YK IE+L+  L+H  S+NLM+ RE +LK  MEL+ W EAL YC+LTIP YQRVY
Sbjct  161  QEAISIYKWIEKLQTELYHPLSVNLMQNREKILKSLMELEHWAEALAYCKLTIPFYQRVY  220

Query  498  QGFHPLLGLQYYTCGKLEWLLGESEEAFKSLSKAMDILRITHGTKSSFMKELSFKLEEAR  319
               HPLLGLQYYTCGKLEW LG+++EA KSL KA+DILRITHGT + FMK+L  KLEEAR
Sbjct  221  PAVHPLLGLQYYTCGKLEWYLGDTDEAVKSLIKAVDILRITHGTNTPFMKDLLMKLEEAR  280

Query  318  AEVSYKLSTRK  286
            AE SY+LS ++
Sbjct  281  AEASYRLSPKE  291



>ref|XP_010926454.1| PREDICTED: histone-lysine N-methyltransferase ASHR1 isoform X5 
[Elaeis guineensis]
Length=419

 Score =   189 bits (480),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 91/155 (59%), Positives = 123/155 (79%), Gaps = 0/155 (0%)
 Frame = -3

Query  759  KEEVMNLAGEIKsmseraslsssSGHKRDAIVMYKSIEELELRLFHAFSINLMRTRETLL  580
            ++E+  +A E+  +S++AS   SSG+  +A  +YK+I++L+L++ H  SI L+RT ETL+
Sbjct  262  QQEIEKIASEVAQLSQKASAVLSSGNYSEASAIYKTIKQLQLKVCHQCSIYLLRTHETLI  321

Query  579  KMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLLGESEEAFKSLSK  400
            K+ MEL+DW+ AL YCRLTIPVYQRVY   HP+LGLQ+Y CGKLEW L  +E+A KS +K
Sbjct  322  KILMELKDWRGALTYCRLTIPVYQRVYPAVHPMLGLQFYACGKLEWALECTEDALKSFTK  381

Query  399  AMDILRITHGTKSSFMKELSFKLEEARAEVSYKLS  295
            AMD+LRITHGT + FM++LS +LEEARAEVSYKLS
Sbjct  382  AMDVLRITHGTSTPFMRDLSRQLEEARAEVSYKLS  416



>ref|XP_010538974.1| PREDICTED: histone-lysine N-methyltransferase ASHR1 [Tarenaya 
hassleriana]
Length=484

 Score =   191 bits (484),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 99/162 (61%), Positives = 124/162 (77%), Gaps = 0/162 (0%)
 Frame = -3

Query  759  KEEVMNLAGEIKsmseraslsssSGHKRDAIVMYKSIEELELRLFHAFSINLMRTRETLL  580
            KEE+  LA E++S+SERA  S S  +K++AI +YK+IE+L+ RL H FSI L+RTRE+LL
Sbjct  323  KEEIKKLASEVQSISERAPSSLSPENKQEAIKLYKTIEKLQTRLCHPFSIALLRTRESLL  382

Query  579  KMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLLGESEEAFKSLSK  400
            KM ME+++W+EAL  CRLT+PVYQR Y   HPL GLQYY CGKLEWLLGE+EEA  SL+K
Sbjct  383  KMLMEVENWREALTCCRLTLPVYQRAYPPTHPLTGLQYYACGKLEWLLGETEEALSSLTK  442

Query  399  AMDILRITHGTKSSFMKELSFKLEEARAEVSYKLSTRKEDGE  274
            A +ILRI+HGT + FMKEL  K  EARAE SYK  +  E  +
Sbjct  443  ASEILRISHGTSTPFMKELFGKTGEARAEASYKQRSSDEGDD  484



>ref|XP_010926453.1| PREDICTED: histone-lysine N-methyltransferase ASHR1 isoform X4 
[Elaeis guineensis]
Length=423

 Score =   188 bits (478),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 91/155 (59%), Positives = 123/155 (79%), Gaps = 0/155 (0%)
 Frame = -3

Query  759  KEEVMNLAGEIKsmseraslsssSGHKRDAIVMYKSIEELELRLFHAFSINLMRTRETLL  580
            ++E+  +A E+  +S++AS   SSG+  +A  +YK+I++L+L++ H  SI L+RT ETL+
Sbjct  266  QQEIEKIASEVAQLSQKASAVLSSGNYSEASAIYKTIKQLQLKVCHQCSIYLLRTHETLI  325

Query  579  KMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLLGESEEAFKSLSK  400
            K+ MEL+DW+ AL YCRLTIPVYQRVY   HP+LGLQ+Y CGKLEW L  +E+A KS +K
Sbjct  326  KILMELKDWRGALTYCRLTIPVYQRVYPAVHPMLGLQFYACGKLEWALECTEDALKSFTK  385

Query  399  AMDILRITHGTKSSFMKELSFKLEEARAEVSYKLS  295
            AMD+LRITHGT + FM++LS +LEEARAEVSYKLS
Sbjct  386  AMDVLRITHGTSTPFMRDLSRQLEEARAEVSYKLS  420



>ref|XP_003601097.1| Histone-lysine N-methyltransferase ASHR1 [Medicago truncatula]
Length=511

 Score =   190 bits (483),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 97/152 (64%), Positives = 121/152 (80%), Gaps = 1/152 (1%)
 Frame = -3

Query  759  KEEVMNLAGEIKsmseraslsssSGHKRDAIVMYKSIEELELRLFHAFSINLMRTRETLL  580
            KEE+  +A EIK + E AS  SS     +AI ++K IE+L+ +L+H FSINLM+TRET+L
Sbjct  356  KEEIKQIATEIKFLLEEASKPSS-NDSHEAISIHKMIEKLQTKLYHPFSINLMQTRETIL  414

Query  579  KMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLLGESEEAFKSLSK  400
            K  M+L+ W+EAL YC+LTIP+YQRVY   HPLLGLQYYTCGKLEW LG++EEA KSL+K
Sbjct  415  KSLMKLEYWREALAYCKLTIPIYQRVYPAVHPLLGLQYYTCGKLEWYLGDTEEAIKSLTK  474

Query  399  AMDILRITHGTKSSFMKELSFKLEEARAEVSY  304
            A+DILRITHGTK+ F+KELS  L EARAE S+
Sbjct  475  AVDILRITHGTKTPFVKELSMMLVEARAEASF  506



>ref|XP_010666085.1| PREDICTED: histone-lysine N-methyltransferase ASHR1 isoform X2 
[Beta vulgaris subsp. vulgaris]
Length=469

 Score =   189 bits (480),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 91/159 (57%), Positives = 125/159 (79%), Gaps = 0/159 (0%)
 Frame = -3

Query  756  EEVMNLAGEIKsmseraslsssSGHKRDAIVMYKSIEELELRLFHAFSINLMRTRETLLK  577
            E++  +A ++K+ SE+A +S  SG+  +A  +Y  +E+L+L+L H  S+NLMRTR++LLK
Sbjct  311  EDIKQIASKVKTFSEKAEVSLKSGNCEEAGSLYSMVEKLQLKLCHPSSLNLMRTRDSLLK  370

Query  576  MFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLLGESEEAFKSLSKA  397
            ++M+L +W++AL YCR+T+PVY+ VY G HP+LGLQYYTCGKLEWLLGE+E   +SL KA
Sbjct  371  IYMKLSNWEDALVYCRMTVPVYEMVYPGCHPMLGLQYYTCGKLEWLLGETENCVRSLMKA  430

Query  396  MDILRITHGTKSSFMKELSFKLEEARAEVSYKLSTRKED  280
            +DILR+THGT + F KEL  KLEEARAE S+KL T  ED
Sbjct  431  VDILRVTHGTNTQFTKELLVKLEEARAEASFKLKTFDED  469



>ref|XP_010926451.1| PREDICTED: histone-lysine N-methyltransferase ASHR1 isoform X2 
[Elaeis guineensis]
Length=468

 Score =   189 bits (480),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 91/157 (58%), Positives = 123/157 (78%), Gaps = 0/157 (0%)
 Frame = -3

Query  759  KEEVMNLAGEIKsmseraslsssSGHKRDAIVMYKSIEELELRLFHAFSINLMRTRETLL  580
            ++E+  +A E+  +S++AS   SSG+  +A  +YK+I++L+L++ H  SI L+RT ETL+
Sbjct  311  QQEIEKIASEVAQLSQKASAVLSSGNYSEASAIYKTIKQLQLKVCHQCSIYLLRTHETLI  370

Query  579  KMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLLGESEEAFKSLSK  400
            K+ MEL+DW+ AL YCRLTIPVYQRVY   HP+LGLQ+Y CGKLEW L  +E+A KS +K
Sbjct  371  KILMELKDWRGALTYCRLTIPVYQRVYPAVHPMLGLQFYACGKLEWALECTEDALKSFTK  430

Query  399  AMDILRITHGTKSSFMKELSFKLEEARAEVSYKLSTR  289
            AMD+LRITHGT + FM++LS +LEEARAEVSYKLS  
Sbjct  431  AMDVLRITHGTSTPFMRDLSRQLEEARAEVSYKLSAN  467



>ref|XP_010694872.1| PREDICTED: histone-lysine N-methyltransferase ASHR1 isoform X1 
[Beta vulgaris subsp. vulgaris]
 ref|XP_010695485.1| PREDICTED: histone-lysine N-methyltransferase ASHR1 isoform X1 
[Beta vulgaris subsp. vulgaris]
 ref|XP_010696053.1| PREDICTED: histone-lysine N-methyltransferase ASHR1 isoform X1 
[Beta vulgaris subsp. vulgaris]
 ref|XP_010665503.1| PREDICTED: histone-lysine N-methyltransferase ASHR1 isoform X1 
[Beta vulgaris subsp. vulgaris]
Length=482

 Score =   189 bits (480),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 91/159 (57%), Positives = 125/159 (79%), Gaps = 0/159 (0%)
 Frame = -3

Query  756  EEVMNLAGEIKsmseraslsssSGHKRDAIVMYKSIEELELRLFHAFSINLMRTRETLLK  577
            E++  +A ++K+ SE+A +S  SG+  +A  +Y  +E+L+L+L H  S+NLMRTR++LLK
Sbjct  324  EDIKQIASKVKTFSEKAEVSLKSGNCEEAGSLYSMVEKLQLKLCHPSSLNLMRTRDSLLK  383

Query  576  MFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLLGESEEAFKSLSKA  397
            ++M+L +W++AL YCR+T+PVY+ VY G HP+LGLQYYTCGKLEWLLGE+E   +SL KA
Sbjct  384  IYMKLSNWEDALVYCRMTVPVYEMVYPGCHPMLGLQYYTCGKLEWLLGETENCVRSLMKA  443

Query  396  MDILRITHGTKSSFMKELSFKLEEARAEVSYKLSTRKED  280
            +DILR+THGT + F KEL  KLEEARAE S+KL T  ED
Sbjct  444  VDILRVTHGTNTQFTKELLVKLEEARAEASFKLKTFDED  482



>ref|XP_010926450.1| PREDICTED: histone-lysine N-methyltransferase ASHR1 isoform X1 
[Elaeis guineensis]
Length=481

 Score =   189 bits (479),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 91/155 (59%), Positives = 123/155 (79%), Gaps = 0/155 (0%)
 Frame = -3

Query  759  KEEVMNLAGEIKsmseraslsssSGHKRDAIVMYKSIEELELRLFHAFSINLMRTRETLL  580
            ++E+  +A E+  +S++AS   SSG+  +A  +YK+I++L+L++ H  SI L+RT ETL+
Sbjct  324  QQEIEKIASEVAQLSQKASAVLSSGNYSEASAIYKTIKQLQLKVCHQCSIYLLRTHETLI  383

Query  579  KMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLLGESEEAFKSLSK  400
            K+ MEL+DW+ AL YCRLTIPVYQRVY   HP+LGLQ+Y CGKLEW L  +E+A KS +K
Sbjct  384  KILMELKDWRGALTYCRLTIPVYQRVYPAVHPMLGLQFYACGKLEWALECTEDALKSFTK  443

Query  399  AMDILRITHGTKSSFMKELSFKLEEARAEVSYKLS  295
            AMD+LRITHGT + FM++LS +LEEARAEVSYKLS
Sbjct  444  AMDVLRITHGTSTPFMRDLSRQLEEARAEVSYKLS  478



>gb|EYU22920.1| hypothetical protein MIMGU_mgv1a005471mg [Erythranthe guttata]
Length=482

 Score =   188 bits (478),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 96/152 (63%), Positives = 120/152 (79%), Gaps = 0/152 (0%)
 Frame = -3

Query  759  KEEVMNLAGEIKsmseraslsssSGHKRDAIVMYKSIEELELRLFHAFSINLMRTRETLL  580
            KEE+  +A E+K +S++AS S SSG+K +A   YK IE L+L+L+H FSI LMRTRE LL
Sbjct  327  KEEISAIANEVKYISDKASKSLSSGYKIEANEAYKRIEALQLKLYHPFSIFLMRTREALL  386

Query  579  KMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLLGESEEAFKSLSK  400
            K+ M+ QDWKEAL YCRLTIP+Y+RVY   HPLLGLQYY CGKLEW LGE+  A +S++K
Sbjct  387  KISMDQQDWKEALSYCRLTIPIYERVYPKCHPLLGLQYYMCGKLEWFLGETVAAVRSMTK  446

Query  399  AMDILRITHGTKSSFMKELSFKLEEARAEVSY  304
             +D+L ITHGTK+ F+ EL+ KLEEARAE SY
Sbjct  447  GLDVLGITHGTKTPFVMELTSKLEEARAEASY  478



>ref|XP_009390922.1| PREDICTED: histone-lysine N-methyltransferase ASHR1 [Musa acuminata 
subsp. malaccensis]
Length=481

 Score =   188 bits (478),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 93/155 (60%), Positives = 119/155 (77%), Gaps = 0/155 (0%)
 Frame = -3

Query  759  KEEVMNLAGEIKsmseraslsssSGHKRDAIVMYKSIEELELRLFHAFSINLMRTRETLL  580
            ++E+  +A EI  +  +AS   SSGH  +   MYK +E+L+L+L H +S++L++TRETL+
Sbjct  324  QQEIKKIACEIAQVLGKASNCLSSGHLSEGSTMYKIVEQLQLKLCHQYSLSLLQTRETLM  383

Query  579  KMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLLGESEEAFKSLSK  400
            K+ MEL+DWK AL YCRLTIP Y+R+Y   HP+LGLQYY CGKLEWLL  +E+A KS  K
Sbjct  384  KVLMELKDWKGALTYCRLTIPTYRRIYPATHPMLGLQYYACGKLEWLLEFTEDALKSFIK  443

Query  399  AMDILRITHGTKSSFMKELSFKLEEARAEVSYKLS  295
            A DILRITHGT++ FMKEL  KLEEA AEVSYKLS
Sbjct  444  AADILRITHGTRTPFMKELLHKLEEAHAEVSYKLS  478



>gb|EEC76031.1| hypothetical protein OsI_13199 [Oryza sativa Indica Group]
Length=481

 Score =   187 bits (475),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 87/127 (69%), Positives = 105/127 (83%), Gaps = 0/127 (0%)
 Frame = -3

Query  663  MYKSIEELELRLFHAFSINLMRTRETLLKMFMELQDWKEALEYCRLTIPVYQRVYQGFHP  484
            MYK+IEELE +L+H  SI L+ TRETLLK++MELQDW+ AL YCRLTIPVY+R+Y  FHP
Sbjct  354  MYKTIEELERKLYHPLSITLLHTRETLLKIYMELQDWQTALMYCRLTIPVYERIYPPFHP  413

Query  483  LLGLQYYTCGKLEWLLGESEEAFKSLSKAMDILRITHGTKSSFMKELSFKLEEARAEVSY  304
            ++GLQ+YTCGKLEWLL  +E+A  SL++A DILRITHGTKS FMKEL  KLEE RAE S+
Sbjct  414  MIGLQFYTCGKLEWLLEYTEDALMSLTRAADILRITHGTKSEFMKELLGKLEEVRAEASF  473

Query  303  KLSTRKE  283
            +LS   E
Sbjct  474  RLSAGDE  480



>gb|ABF98444.1| MYND finger family protein, expressed [Oryza sativa Japonica 
Group]
Length=481

 Score =   187 bits (475),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 87/127 (69%), Positives = 105/127 (83%), Gaps = 0/127 (0%)
 Frame = -3

Query  663  MYKSIEELELRLFHAFSINLMRTRETLLKMFMELQDWKEALEYCRLTIPVYQRVYQGFHP  484
            MYK+IEELE +L+H  SI L+ TRETLLK++MELQDW+ AL YCRLTIPVY+R+Y  FHP
Sbjct  354  MYKTIEELERKLYHPLSITLLHTRETLLKIYMELQDWQTALMYCRLTIPVYERIYPPFHP  413

Query  483  LLGLQYYTCGKLEWLLGESEEAFKSLSKAMDILRITHGTKSSFMKELSFKLEEARAEVSY  304
            ++GLQ+YTCGKLEWLL  +E+A  SL++A DILRITHGTKS FMKEL  KLEE RAE S+
Sbjct  414  MIGLQFYTCGKLEWLLEYTEDALMSLTRAADILRITHGTKSEFMKELLGKLEEVRAEASF  473

Query  303  KLSTRKE  283
            +LS   E
Sbjct  474  RLSAGDE  480



>ref|XP_008465815.1| PREDICTED: histone-lysine N-methyltransferase ASHR1 isoform X6 
[Cucumis melo]
Length=481

 Score =   186 bits (471),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 96/156 (62%), Positives = 126/156 (81%), Gaps = 0/156 (0%)
 Frame = -3

Query  759  KEEVMNLAGEIKsmseraslsssSGHKRDAIVMYKSIEELELRLFHAFSINLMRTRETLL  580
            KE++ N+A +IKS+S+ AS S SS +  +A+ M++ +E+L+  L H +SI+LM+TRE LL
Sbjct  322  KEDIKNIASQIKSISDEASTSMSSQNYAEALFMHEKVEKLQKILCHPYSISLMQTREKLL  381

Query  579  KMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLLGESEEAFKSLSK  400
            K+ MEL++W +AL YC+LTI VYQ++Y G HPLLGLQ+YTCGKLEWLLG +E++ KS +K
Sbjct  382  KISMELENWTKALTYCKLTISVYQKLYPGIHPLLGLQFYTCGKLEWLLGHTEDSLKSYTK  441

Query  399  AMDILRITHGTKSSFMKELSFKLEEARAEVSYKLST  292
            A DILRITHGT SSFMKEL  KLEEARAE SYK S+
Sbjct  442  AFDILRITHGTNSSFMKELLQKLEEARAEASYKRSS  477



>ref|XP_008465808.1| PREDICTED: histone-lysine N-methyltransferase ASHR1 isoform X2 
[Cucumis melo]
Length=509

 Score =   186 bits (472),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 96/156 (62%), Positives = 126/156 (81%), Gaps = 0/156 (0%)
 Frame = -3

Query  759  KEEVMNLAGEIKsmseraslsssSGHKRDAIVMYKSIEELELRLFHAFSINLMRTRETLL  580
            KE++ N+A +IKS+S+ AS S SS +  +A+ M++ +E+L+  L H +SI+LM+TRE LL
Sbjct  350  KEDIKNIASQIKSISDEASTSMSSQNYAEALFMHEKVEKLQKILCHPYSISLMQTREKLL  409

Query  579  KMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLLGESEEAFKSLSK  400
            K+ MEL++W +AL YC+LTI VYQ++Y G HPLLGLQ+YTCGKLEWLLG +E++ KS +K
Sbjct  410  KISMELENWTKALTYCKLTISVYQKLYPGIHPLLGLQFYTCGKLEWLLGHTEDSLKSYTK  469

Query  399  AMDILRITHGTKSSFMKELSFKLEEARAEVSYKLST  292
            A DILRITHGT SSFMKEL  KLEEARAE SYK S+
Sbjct  470  AFDILRITHGTNSSFMKELLQKLEEARAEASYKRSS  505



>ref|XP_006650467.1| PREDICTED: histone-lysine N-methyltransferase ASHR1-like [Oryza 
brachyantha]
Length=477

 Score =   184 bits (466),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 85/123 (69%), Positives = 103/123 (84%), Gaps = 0/123 (0%)
 Frame = -3

Query  663  MYKSIEELELRLFHAFSINLMRTRETLLKMFMELQDWKEALEYCRLTIPVYQRVYQGFHP  484
            +YK+IEEL  +L+H  S  L+ TRETLLK++MELQDW+ AL YCRLTIPVY+RVY  FHP
Sbjct  353  LYKTIEELVQKLYHPLSTTLLHTRETLLKIYMELQDWQTALMYCRLTIPVYERVYPPFHP  412

Query  483  LLGLQYYTCGKLEWLLGESEEAFKSLSKAMDILRITHGTKSSFMKELSFKLEEARAEVSY  304
            ++GLQ+YTCGKLEWLL  +E+A KSL++A DILRITHGTKS FMKEL  KLEE RAE S+
Sbjct  413  MIGLQFYTCGKLEWLLEYTEDALKSLTRAADILRITHGTKSEFMKELLGKLEEVRAEASF  472

Query  303  KLS  295
            +LS
Sbjct  473  RLS  475



>ref|XP_007137368.1| hypothetical protein PHAVU_009G121500g [Phaseolus vulgaris]
 gb|ESW09362.1| hypothetical protein PHAVU_009G121500g [Phaseolus vulgaris]
Length=485

 Score =   182 bits (462),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 84/129 (65%), Positives = 103/129 (80%), Gaps = 0/129 (0%)
 Frame = -3

Query  678  RDAIVMYKSIEELELRLFHAFSINLMRTRETLLKMFMELQDWKEALEYCRLTIPVYQRVY  499
            ++ I +YK IE+L+  L+H FS++LM+TRE +LK  MEL+ W EAL YC+LTIP Y++VY
Sbjct  354  QEVISIYKKIEKLQTELYHPFSVSLMQTREKILKSLMELEHWTEALAYCKLTIPFYEKVY  413

Query  498  QGFHPLLGLQYYTCGKLEWLLGESEEAFKSLSKAMDILRITHGTKSSFMKELSFKLEEAR  319
               HPLLGLQYYTCGKLEW LGE EE  KSL+KA+DILRITHGT + FMK+L  KLEEAR
Sbjct  414  PSIHPLLGLQYYTCGKLEWYLGEIEEGVKSLTKAVDILRITHGTNTPFMKDLLMKLEEAR  473

Query  318  AEVSYKLST  292
            AE SYK S+
Sbjct  474  AEASYKFSS  482



>ref|XP_008465812.1| PREDICTED: histone-lysine N-methyltransferase ASHR1 isoform X5 
[Cucumis melo]
 ref|XP_008465813.1| PREDICTED: histone-lysine N-methyltransferase ASHR1 isoform X5 
[Cucumis melo]
 ref|XP_008465814.1| PREDICTED: histone-lysine N-methyltransferase ASHR1 isoform X5 
[Cucumis melo]
Length=417

 Score =   176 bits (445),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 96/171 (56%), Positives = 126/171 (74%), Gaps = 15/171 (9%)
 Frame = -3

Query  759  KEEVMNLAGEIKsmseraslsssSGHKRDAIVMYKSIEELELRLFHAFSINLMRTRETLL  580
            KE++ N+A +IKS+S+ AS S SS +  +A+ M++ +E+L+  L H +SI+LM+TRE LL
Sbjct  243  KEDIKNIASQIKSISDEASTSMSSQNYAEALFMHEKVEKLQKILCHPYSISLMQTREKLL  302

Query  579  KMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEW--------------  442
            K+ MEL++W +AL YC+LTI VYQ++Y G HPLLGLQ+YTCGKLEW              
Sbjct  303  KISMELENWTKALTYCKLTISVYQKLYPGIHPLLGLQFYTCGKLEWLVVHQDVSFTSPSL  362

Query  441  -LLGESEEAFKSLSKAMDILRITHGTKSSFMKELSFKLEEARAEVSYKLST  292
             LLG +E++ KS +KA DILRITHGT SSFMKEL  KLEEARAE SYK S+
Sbjct  363  LLLGHTEDSLKSYTKAFDILRITHGTNSSFMKELLQKLEEARAEASYKRSS  413



>gb|AGZ15368.1| histone-lysine N-methyltransferase ASHR1-like protein [Phaseolus 
vulgaris]
Length=488

 Score =   176 bits (445),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 82/129 (64%), Positives = 101/129 (78%), Gaps = 0/129 (0%)
 Frame = -3

Query  678  RDAIVMYKSIEELELRLFHAFSINLMRTRETLLKMFMELQDWKEALEYCRLTIPVYQRVY  499
            ++ I +YK IE+L+  L+H FS++LM+TRE +LK  MEL+ W EAL YC+LTIP Y++VY
Sbjct  355  QEVISIYKKIEKLQTELYHPFSVSLMQTREKILKSLMELEHWTEALAYCKLTIPFYEKVY  414

Query  498  QGFHPLLGLQYYTCGKLEWLLGESEEAFKSLSKAMDILRITHGTKSSFMKELSFKLEEAR  319
               HPLLGLQYYTCGKLEW LGE EE  KSL+KA+DILRITHGT + FMK+   KLEEAR
Sbjct  415  PFIHPLLGLQYYTCGKLEWYLGEIEEGVKSLTKAVDILRITHGTNTPFMKDFLMKLEEAR  474

Query  318  AEVSYKLST  292
            AE  YK S+
Sbjct  475  AEAFYKFSS  483



>ref|XP_008465811.1| PREDICTED: histone-lysine N-methyltransferase ASHR1 isoform X4 
[Cucumis melo]
Length=490

 Score =   176 bits (445),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 96/171 (56%), Positives = 126/171 (74%), Gaps = 15/171 (9%)
 Frame = -3

Query  759  KEEVMNLAGEIKsmseraslsssSGHKRDAIVMYKSIEELELRLFHAFSINLMRTRETLL  580
            KE++ N+A +IKS+S+ AS S SS +  +A+ M++ +E+L+  L H +SI+LM+TRE LL
Sbjct  316  KEDIKNIASQIKSISDEASTSMSSQNYAEALFMHEKVEKLQKILCHPYSISLMQTREKLL  375

Query  579  KMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEW--------------  442
            K+ MEL++W +AL YC+LTI VYQ++Y G HPLLGLQ+YTCGKLEW              
Sbjct  376  KISMELENWTKALTYCKLTISVYQKLYPGIHPLLGLQFYTCGKLEWLVVHQDVSFTSPSL  435

Query  441  -LLGESEEAFKSLSKAMDILRITHGTKSSFMKELSFKLEEARAEVSYKLST  292
             LLG +E++ KS +KA DILRITHGT SSFMKEL  KLEEARAE SYK S+
Sbjct  436  LLLGHTEDSLKSYTKAFDILRITHGTNSSFMKELLQKLEEARAEASYKRSS  486



>ref|XP_008465809.1| PREDICTED: histone-lysine N-methyltransferase ASHR1 isoform X3 
[Cucumis melo]
Length=496

 Score =   176 bits (445),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 96/171 (56%), Positives = 126/171 (74%), Gaps = 15/171 (9%)
 Frame = -3

Query  759  KEEVMNLAGEIKsmseraslsssSGHKRDAIVMYKSIEELELRLFHAFSINLMRTRETLL  580
            KE++ N+A +IKS+S+ AS S SS +  +A+ M++ +E+L+  L H +SI+LM+TRE LL
Sbjct  322  KEDIKNIASQIKSISDEASTSMSSQNYAEALFMHEKVEKLQKILCHPYSISLMQTREKLL  381

Query  579  KMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEW--------------  442
            K+ MEL++W +AL YC+LTI VYQ++Y G HPLLGLQ+YTCGKLEW              
Sbjct  382  KISMELENWTKALTYCKLTISVYQKLYPGIHPLLGLQFYTCGKLEWLVVHQDVSFTSPSL  441

Query  441  -LLGESEEAFKSLSKAMDILRITHGTKSSFMKELSFKLEEARAEVSYKLST  292
             LLG +E++ KS +KA DILRITHGT SSFMKEL  KLEEARAE SYK S+
Sbjct  442  LLLGHTEDSLKSYTKAFDILRITHGTNSSFMKELLQKLEEARAEASYKRSS  492



>ref|XP_008465807.1| PREDICTED: histone-lysine N-methyltransferase ASHR1 isoform X1 
[Cucumis melo]
Length=524

 Score =   176 bits (446),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 96/171 (56%), Positives = 126/171 (74%), Gaps = 15/171 (9%)
 Frame = -3

Query  759  KEEVMNLAGEIKsmseraslsssSGHKRDAIVMYKSIEELELRLFHAFSINLMRTRETLL  580
            KE++ N+A +IKS+S+ AS S SS +  +A+ M++ +E+L+  L H +SI+LM+TRE LL
Sbjct  350  KEDIKNIASQIKSISDEASTSMSSQNYAEALFMHEKVEKLQKILCHPYSISLMQTREKLL  409

Query  579  KMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEW--------------  442
            K+ MEL++W +AL YC+LTI VYQ++Y G HPLLGLQ+YTCGKLEW              
Sbjct  410  KISMELENWTKALTYCKLTISVYQKLYPGIHPLLGLQFYTCGKLEWLVVHQDVSFTSPSL  469

Query  441  -LLGESEEAFKSLSKAMDILRITHGTKSSFMKELSFKLEEARAEVSYKLST  292
             LLG +E++ KS +KA DILRITHGT SSFMKEL  KLEEARAE SYK S+
Sbjct  470  LLLGHTEDSLKSYTKAFDILRITHGTNSSFMKELLQKLEEARAEASYKRSS  520



>gb|EPS73138.1| hypothetical protein M569_01616, partial [Genlisea aurea]
Length=475

 Score =   173 bits (439),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 77/114 (68%), Positives = 97/114 (85%), Gaps = 0/114 (0%)
 Frame = -3

Query  657  KSIEELELRLFHAFSINLMRTRETLLKMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLL  478
            K +E+L+++L+H FS++LMRTRETLLK+FME+QDW++AL YCRL +PVY+ +Y  FHPLL
Sbjct  355  KLVEDLQMKLYHPFSVSLMRTRETLLKIFMEVQDWEQALSYCRLILPVYEVIYSRFHPLL  414

Query  477  GLQYYTCGKLEWLLGESEEAFKSLSKAMDILRITHGTKSSFMKELSFKLEEARA  316
            GLQYY CGK+EWLLGE+E A +SL+KA DILRITHGTK+ F  EL   LEEARA
Sbjct  415  GLQYYCCGKIEWLLGETEAAIRSLTKAWDILRITHGTKTGFTAELVGMLEEARA  468



>gb|EMT19769.1| Histone-lysine N-methyltransferase ASHR1 [Aegilops tauschii]
Length=463

 Score =   168 bits (425),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 82/145 (57%), Positives = 111/145 (77%), Gaps = 8/145 (6%)
 Frame = -3

Query  675  DAIVMYKSIEELELRLFHAFSINLMRTRETLLKMFMELQDWKEALEYCRLTIPVYQRVYQ  496
            +A  +YK+IE+LE + +H+FS  L+ TRETLLK++MELQDW+ AL YCRLTIPVY+RVY 
Sbjct  280  EAGSVYKTIEQLEQKHYHSFSTTLLHTRETLLKIYMELQDWQTALMYCRLTIPVYERVYP  339

Query  495  GFHPLLGLQYYTCGKLEWLLGESEEAFKSLSKAMDILRITHGTKSSFMKEL-SFKLEEAR  319
             FHP++GLQ+YTCGKLEWLL  +E+A KSL++A D+LRITHGT+S FMKEL  ++LE ++
Sbjct  340  PFHPMVGLQFYTCGKLEWLLEYTEDALKSLTRAADVLRITHGTQSQFMKELFGYRLETSK  399

Query  318  AEVSYKLST------RKED-GEGFQ  265
                 +L+       R +D G G+Q
Sbjct  400  FHEKTQLTVMTNRDRRSQDSGIGYQ  424



>ref|XP_004290832.1| PREDICTED: histone-lysine N-methyltransferase ASHR1-like [Fragaria 
vesca subsp. vesca]
Length=482

 Score =   167 bits (423),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 77/122 (63%), Positives = 97/122 (80%), Gaps = 0/122 (0%)
 Frame = -3

Query  675  DAIVMYKSIEELELRLFHAFSINLMRTRETLLKMFMELQDWKEALEYCRLTIPVYQRVYQ  496
            + I + K++E L+  L H F + L+ T E L+K  M++++W EAL YCRLTIPVYQRVY 
Sbjct  355  EVIAILKAMETLQRYLCHNFCVYLLPTWEELIKNLMKVEEWSEALAYCRLTIPVYQRVYP  414

Query  495  GFHPLLGLQYYTCGKLEWLLGESEEAFKSLSKAMDILRITHGTKSSFMKELSFKLEEARA  316
            GFHP LGLQYYTCGKLEWLLGE+++A KSL+KA+DILRITHGT + FMK+L  +LEEARA
Sbjct  415  GFHPSLGLQYYTCGKLEWLLGETDDALKSLTKAVDILRITHGTSTPFMKDLFRRLEEARA  474

Query  315  EV  310
            E 
Sbjct  475  EA  476



>ref|XP_008782265.1| PREDICTED: histone-lysine N-methyltransferase ASHR1 isoform X2 
[Phoenix dactylifera]
Length=467

 Score =   157 bits (398),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 82/155 (53%), Positives = 111/155 (72%), Gaps = 14/155 (9%)
 Frame = -3

Query  759  KEEVMNLAGEIKsmseraslsssSGHKRDAIVMYKSIEELELRLFHAFSINLMRTRETLL  580
            ++E+  +A E+  +SE+AS   SSG+  +A  +YK+IE+L+++L H FSINL+RTRE L+
Sbjct  324  QQEIKKIASEVAELSEKASTILSSGNYSEASAIYKTIEQLQVKLCHQFSINLLRTREILI  383

Query  579  KMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLLGESEEAFKSLSK  400
            K+ MEL+DW+               VY   HPLLGLQ+  CGKLEW LG +E+A KS +K
Sbjct  384  KILMELKDWRG--------------VYPAVHPLLGLQFCACGKLEWALGCTEDALKSFAK  429

Query  399  AMDILRITHGTKSSFMKELSFKLEEARAEVSYKLS  295
            AMD+LRITHGT + FM++LS +LEEARAE SYKLS
Sbjct  430  AMDVLRITHGTGTPFMRDLSRQLEEARAEASYKLS  464



>gb|ERM95321.1| hypothetical protein AMTR_s00008p00145610 [Amborella trichopoda]
Length=517

 Score =   154 bits (389),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 71/127 (56%), Positives = 94/127 (74%), Gaps = 0/127 (0%)
 Frame = -3

Query  687  GHKRDAIVMYKSIEELELRLFHAFSINLMRTRETLLKMFMELQDWKEALEYCRLTIPVYQ  508
            G   +A  +Y+ I++ ++ L+H  SI LMRTRETL+ + MEL+D +EAL YC+LTIPVYQ
Sbjct  348  GKYSEACNLYRIIDQQQMELYHPLSIGLMRTRETLVMILMELKDCEEALRYCQLTIPVYQ  407

Query  507  RVYQGFHPLLGLQYYTCGKLEWLLGESEEAFKSLSKAMDILRITHGTKSSFMKELSFKLE  328
            R Y  FHPLLGLQYYTCGKLEW L ++  A KSL+KA DIL++THG  +  +++L   LE
Sbjct  408  RAYPEFHPLLGLQYYTCGKLEWFLEKTLNAVKSLTKAADILKVTHGATTPLVRDLMGLLE  467

Query  327  EARAEVS  307
            EAR E +
Sbjct  468  EARTETA  474



>gb|EYU22918.1| hypothetical protein MIMGU_mgv1a007180mg [Erythranthe guttata]
Length=416

 Score =   152 bits (384),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 82/151 (54%), Positives = 109/151 (72%), Gaps = 0/151 (0%)
 Frame = -3

Query  759  KEEVMNLAGEIKsmseraslsssSGHKRDAIVMYKSIEELELRLFHAFSINLMRTRETLL  580
             +E+  +  E+K +S++AS+S SSG K +A V YK IE+L+L+L+H FSI++MRTRETLL
Sbjct  258  NKELSTITNELKCISDKASVSLSSGRKSEASVAYKRIEKLQLKLYHPFSISIMRTRETLL  317

Query  579  KMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLLGESEEAFKSLSK  400
            K+ MEL D+K A  YC   I +Y+RVY   HPLLGL YY CG++E L+GE +   +SL K
Sbjct  318  KISMELMDFKGAHSYCISVIQIYERVYPKCHPLLGLHYYLCGQIEMLMGEKKTTVESLKK  377

Query  399  AMDILRITHGTKSSFMKELSFKLEEARAEVS  307
            A +I RITHGTK+ F  EL  KL+EARA  S
Sbjct  378  AYNIFRITHGTKTPFTMELKTKLDEARAMAS  408



>ref|XP_011626691.1| PREDICTED: histone-lysine N-methyltransferase ASHR1 [Amborella 
trichopoda]
Length=631

 Score =   154 bits (389),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 71/127 (56%), Positives = 94/127 (74%), Gaps = 0/127 (0%)
 Frame = -3

Query  687  GHKRDAIVMYKSIEELELRLFHAFSINLMRTRETLLKMFMELQDWKEALEYCRLTIPVYQ  508
            G   +A  +Y+ I++ ++ L+H  SI LMRTRETL+ + MEL+D +EAL YC+LTIPVYQ
Sbjct  348  GKYSEACNLYRIIDQQQMELYHPLSIGLMRTRETLVMILMELKDCEEALRYCQLTIPVYQ  407

Query  507  RVYQGFHPLLGLQYYTCGKLEWLLGESEEAFKSLSKAMDILRITHGTKSSFMKELSFKLE  328
            R Y  FHPLLGLQYYTCGKLEW L ++  A KSL+KA DIL++THG  +  +++L   LE
Sbjct  408  RAYPEFHPLLGLQYYTCGKLEWFLEKTLNAVKSLTKAADILKVTHGATTPLVRDLMGLLE  467

Query  327  EARAEVS  307
            EAR E +
Sbjct  468  EARTETA  474



>ref|XP_010926452.1| PREDICTED: histone-lysine N-methyltransferase ASHR1 isoform X3 
[Elaeis guineensis]
Length=467

 Score =   151 bits (381),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 78/157 (50%), Positives = 110/157 (70%), Gaps = 14/157 (9%)
 Frame = -3

Query  759  KEEVMNLAGEIKsmseraslsssSGHKRDAIVMYKSIEELELRLFHAFSINLMRTRETLL  580
            ++E+  +A E+  +S++AS   SSG+  +A  +YK+I++L+L++ H  SI L+RT ETL+
Sbjct  324  QQEIEKIASEVAQLSQKASAVLSSGNYSEASAIYKTIKQLQLKVCHQCSIYLLRTHETLI  383

Query  579  KMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLLGESEEAFKSLSK  400
            K+ MEL+DW+               VY   HP+LGLQ+Y CGKLEW L  +E+A KS +K
Sbjct  384  KILMELKDWRG--------------VYPAVHPMLGLQFYACGKLEWALECTEDALKSFTK  429

Query  399  AMDILRITHGTKSSFMKELSFKLEEARAEVSYKLSTR  289
            AMD+LRITHGT + FM++LS +LEEARAEVSYKLS  
Sbjct  430  AMDVLRITHGTSTPFMRDLSRQLEEARAEVSYKLSAN  466



>ref|XP_010322913.1| PREDICTED: histone-lysine N-methyltransferase ASHR1 isoform X3 
[Solanum lycopersicum]
Length=426

 Score =   145 bits (365),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 74/105 (70%), Positives = 87/105 (83%), Gaps = 0/105 (0%)
 Frame = -3

Query  759  KEEVMNLAGEIKsmseraslsssSGHKRDAIVMYKSIEELELRLFHAFSINLMRTRETLL  580
            KEE+ N   EI+S+SE+AS+S   GH +DA VMYK IE+L+L L+HA SINLMRTRE +L
Sbjct  322  KEEIKNTVHEIQSLSEKASISLPCGHNKDASVMYKMIEKLQLELYHASSINLMRTRENIL  381

Query  579  KMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLE  445
            K+ MELQDWKEAL+YCRLTIP Y+RVY   HPLLGLQYYTCGKLE
Sbjct  382  KILMELQDWKEALKYCRLTIPAYRRVYPECHPLLGLQYYTCGKLE  426



>gb|ABR16570.1| unknown [Picea sitchensis]
Length=441

 Score =   144 bits (362),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 67/138 (49%), Positives = 96/138 (70%), Gaps = 1/138 (1%)
 Frame = -3

Query  687  GHKRDAIVMYKSIEELELRLFHAFSINLMRTRETLLKMFMELQDWKEALEYCRLTIPVYQ  508
            G+  +A  +Y+ I++L+ +L+H +S+ L+RT +TLLK+ MEL DWK+AL+YCRLTIP Y+
Sbjct  304  GNYSEARSLYEQIQQLQTQLWHPYSVILLRTGDTLLKICMELYDWKQALKYCRLTIPAYE  363

Query  507  RVYQGFHPLLGLQYYTCGKLEWLLGESEEAFKSLSKAMDILRITHGTKSSFMKELSFKLE  328
            R Y   HP++GLQYY CGKLEW L  + EA     KA  IL +THG  S F+ +L  +++
Sbjct  364  RAYPTCHPMMGLQYYACGKLEWFLENTLEALNFFEKAAKILTVTHGRNSEFLTQLFDRIQ  423

Query  327  EARAEVSYKLSTRKEDGE  274
            EA AE ++ L  R +D E
Sbjct  424  EAHAEAAH-LRPRYDDNE  440



>ref|XP_001778213.1| predicted protein [Physcomitrella patens]
 gb|EDQ56995.1| predicted protein [Physcomitrella patens]
Length=490

 Score =   140 bits (352),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 60/123 (49%), Positives = 91/123 (74%), Gaps = 0/123 (0%)
 Frame = -3

Query  663  MYKSIEELELRLFHAFSINLMRTRETLLKMFMELQDWKEALEYCRLTIPVYQRVYQGFHP  484
            +Y  +E  + +L+H +S+ L+RT + LLK+ M+++DW  ALE+C+ TIP Y+R Y  F P
Sbjct  362  LYSEVEAKQRKLWHPYSVPLLRTHDALLKICMDMEDWASALEFCQSTIPAYERAYPPFSP  421

Query  483  LLGLQYYTCGKLEWLLGESEEAFKSLSKAMDILRITHGTKSSFMKELSFKLEEARAEVSY  304
            LLGLQY+T GKL+WLLG+S +A  +L KA  ++++THG+KS  +  L+  L+EA+AEV+Y
Sbjct  422  LLGLQYFTLGKLQWLLGDSAKAVNTLRKAYTVIQVTHGSKSELLHGLTSTLQEAQAEVAY  481

Query  303  KLS  295
            K S
Sbjct  482  KRS  484



>gb|ADP02224.1| zf-MYND domain-containing protein [Triticum aestivum]
Length=520

 Score =   136 bits (343),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 66/115 (57%), Positives = 88/115 (77%), Gaps = 8/115 (7%)
 Frame = -3

Query  585  LLKMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLLGESEEAFKSL  406
            LL+++MELQDW+ AL YCRLTIPVY+RVY  FHP++GLQ+YTCGKLEWLL  +E+A KSL
Sbjct  367  LLQIYMELQDWQTALMYCRLTIPVYERVYPPFHPMVGLQFYTCGKLEWLLEYTEDALKSL  426

Query  405  SKAMDILRITHGTKSSFMKEL-SFKLEEARAEVSYKLST------RKED-GEGFQ  265
            ++A D+LRITHGT+S FMKEL  ++LE ++     +L+       R +D G G+Q
Sbjct  427  TRAADVLRITHGTQSQFMKELFGYRLETSKFHEKTQLTVMTNRDRRSQDSGIGYQ  481



>ref|XP_012078168.1| PREDICTED: histone-lysine N-methyltransferase ASHR1 isoform X2 
[Jatropha curcas]
Length=451

 Score =   134 bits (337),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 89/110 (81%), Gaps = 2/110 (2%)
 Frame = -3

Query  759  KEEVMNLAGEIKsmseraslsssSGHKRDAIVMYKSIEELELRLFHAFSINLMRTRETLL  580
            KEEV  +A EI++ S++AS S SSG+ ++AI MYK++E+L+ +L H FSI+LM+TRE LL
Sbjct  323  KEEVKKIAAEIQATSDKASKSVSSGNLQEAISMYKTVEKLQRKLCHPFSISLMQTREKLL  382

Query  579  KMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLE--WLL  436
            KM MEL+DW+EAL YC+LTIPVYQ VY  FHPLLGLQYYT GKLE  W L
Sbjct  383  KMLMELEDWREALSYCKLTIPVYQSVYPQFHPLLGLQYYTSGKLECCWFL  432



>gb|AAL75997.1|AF466646_5 putative SET-domain transcriptional regulator [Zea mays]
 gb|AFW67884.1| putative SET-domain transcriptional regulator [Zea mays]
Length=410

 Score =   131 bits (330),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 75/136 (55%), Positives = 96/136 (71%), Gaps = 9/136 (7%)
 Frame = -3

Query  681  KRDAIVMYKSIEELELRLFHAFSINLMRTRETLLKMFMELQDWKEALEYCRLTIPVYQ--  508
            K +A  +YK IE+LE  L+HAFS  L+ T ETLLK+++ELQDW  AL YCRLTIPVY+  
Sbjct  274  KAEAGSIYKIIEQLERNLYHAFSTTLLHTCETLLKIYLELQDWWTALTYCRLTIPVYESK  333

Query  507  --RVYQGF-HPLLGLQYYTCGKLEWLLGESEEAFKSLSKAMDILRITHGTKSSFMKELSF  337
              R+   F  P    + Y  G LE+    +E+A KSL++A DIL++THG KS FMKEL  
Sbjct  334  AWRLKIPFPRPRTVREAYGTGLLEF----TEDALKSLTRAADILKVTHGVKSQFMKELFG  389

Query  336  KLEEARAEVSYKLSTR  289
            KLEEARAEVS++LS+R
Sbjct  390  KLEEARAEVSFRLSSR  405



>gb|AFW67882.1| hypothetical protein ZEAMMB73_219813 [Zea mays]
Length=443

 Score =   127 bits (320),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 64/105 (61%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  756  EEVMNLAGEIKsmseraslsssSGHKRDAIVMYKSIEELELRLFHAFSINLMRTRETLLK  577
            EE+ N+  EI  +S++AS   SSG+K +A  +YK IE+LE  L+HAFS  L+ T ETLLK
Sbjct  322  EEIKNMRSEILQLSDKASSFLSSGNKAEAGSIYKIIEQLERNLYHAFSTTLLHTCETLLK  381

Query  576  MFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEW  442
            +++ELQDW  AL YCRLTIPVY+RVY  FHP++GLQ+YTCGKLEW
Sbjct  382  IYLELQDWWTALTYCRLTIPVYERVYPPFHPMIGLQFYTCGKLEW  426



>ref|XP_010091345.1| Histone-lysine N-methyltransferase [Morus notabilis]
 gb|EXB44335.1| Histone-lysine N-methyltransferase [Morus notabilis]
Length=463

 Score =   127 bits (319),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 72/165 (44%), Positives = 96/165 (58%), Gaps = 31/165 (19%)
 Frame = -3

Query  759  KEEVMNLAGEIKsmseraslsssSGHKRDAIVMYKSIEELELRLFHAF-----SINLMRT  595
            KEE+  +A EIKS +             D  +   S + + L   H       S  +++T
Sbjct  325  KEEIKAIASEIKSWT-------------DKALTSSSSQSILLHFVHGVAGLEGSTGILQT  371

Query  594  RETLLKMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLLGESEEAF  415
              + ++  +E               P    VY GFHPLLGLQYYTCGKLEWLLG++E A 
Sbjct  372  DHSSIRKLIEFD-------------PCTAGVYPGFHPLLGLQYYTCGKLEWLLGDTENAV  418

Query  414  KSLSKAMDILRITHGTKSSFMKELSFKLEEARAEVSYKLSTRKED  280
            KSL+KA+DILRITHGT + FMKEL  KL+EARAE SYKLS+++++
Sbjct  419  KSLTKAVDILRITHGTTTPFMKELFMKLDEARAEASYKLSSKEDE  463



>gb|AAM97151.1| unknown protein,3'-partial [Oryza sativa Japonica Group]
Length=425

 Score =   126 bits (316),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 60/104 (58%), Positives = 81/104 (78%), Gaps = 0/104 (0%)
 Frame = -3

Query  756  EEVMNLAGEIKsmseraslsssSGHKRDAIVMYKSIEELELRLFHAFSINLMRTRETLLK  577
            EE+  +A ++  +S++ S   SSG+  +   MYK+IEELE +L+H  SI L+ TRETLLK
Sbjct  322  EELQKMASDVLLLSDKVSSLVSSGNNSEVGSMYKTIEELERKLYHPLSITLLHTRETLLK  381

Query  576  MFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLE  445
            ++MELQDW+ AL YCRLTIPVY+R+Y  FHP++GLQ+YTCGKLE
Sbjct  382  IYMELQDWQTALMYCRLTIPVYERIYPPFHPMIGLQFYTCGKLE  425



>gb|ACN35999.1| unknown [Zea mays]
 gb|AFW88217.1| hypothetical protein ZEAMMB73_999877 [Zea mays]
Length=129

 Score =   119 bits (299),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 53/82 (65%), Positives = 67/82 (82%), Gaps = 0/82 (0%)
 Frame = -3

Query  687  GHKRDAIVMYKSIEELELRLFHAFSINLMRTRETLLKMFMELQDWKEALEYCRLTIPVYQ  508
            G+K +A  +YK I++LE  L+HAFS  L+ T ETLLK+++ELQDW  AL YCRLTIPVY+
Sbjct  19   GNKAEAGSIYKIIKQLERNLYHAFSTTLLHTCETLLKIYLELQDWWTALTYCRLTIPVYE  78

Query  507  RVYQGFHPLLGLQYYTCGKLEW  442
            RVY  FHP++GLQ+YTCGKLEW
Sbjct  79   RVYPPFHPMIGLQFYTCGKLEW  100



>ref|XP_008660114.1| PREDICTED: histone-lysine N-methyltransferase ASHR1-like isoform 
X2 [Zea mays]
Length=451

 Score =   124 bits (312),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 62/105 (59%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  756  EEVMNLAGEIKsmseraslsssSGHKRDAIVMYKSIEELELRLFHAFSINLMRTRETLLK  577
            EE+ N+  +I  +S++AS   SSG+K +A  +YK I++LE  L+HAFS  L+ T ETLLK
Sbjct  318  EEIKNMRSKILQLSDKASSFLSSGNKAEAGSIYKIIKQLERNLYHAFSTTLLHTCETLLK  377

Query  576  MFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEW  442
            +++ELQDW  AL YCRLTIPVY+RVY  FHP++GLQ+YTCGKLEW
Sbjct  378  IYLELQDWWTALTYCRLTIPVYERVYPPFHPMIGLQFYTCGKLEW  422



>ref|XP_008660108.1| PREDICTED: SET and MYND domain-containing protein 4-like isoform 
X1 [Zea mays]
 ref|XP_008660109.1| PREDICTED: SET and MYND domain-containing protein 4-like isoform 
X1 [Zea mays]
 ref|XP_008660110.1| PREDICTED: SET and MYND domain-containing protein 4-like isoform 
X1 [Zea mays]
 ref|XP_008660111.1| PREDICTED: SET and MYND domain-containing protein 4-like isoform 
X1 [Zea mays]
 ref|XP_008660112.1| PREDICTED: SET and MYND domain-containing protein 4-like isoform 
X1 [Zea mays]
 ref|XP_008660113.1| PREDICTED: SET and MYND domain-containing protein 4-like isoform 
X1 [Zea mays]
Length=463

 Score =   124 bits (312),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 62/105 (59%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  756  EEVMNLAGEIKsmseraslsssSGHKRDAIVMYKSIEELELRLFHAFSINLMRTRETLLK  577
            EE+ N+  +I  +S++AS   SSG+K +A  +YK I++LE  L+HAFS  L+ T ETLLK
Sbjct  330  EEIKNMRSKILQLSDKASSFLSSGNKAEAGSIYKIIKQLERNLYHAFSTTLLHTCETLLK  389

Query  576  MFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEW  442
            +++ELQDW  AL YCRLTIPVY+RVY  FHP++GLQ+YTCGKLEW
Sbjct  390  IYLELQDWWTALTYCRLTIPVYERVYPPFHPMIGLQFYTCGKLEW  434



>ref|XP_008660115.1| PREDICTED: uncharacterized protein LOC103639092 isoform X3 [Zea 
mays]
 ref|XP_008660116.1| PREDICTED: uncharacterized protein LOC103639092 isoform X3 [Zea 
mays]
 ref|XP_008660117.1| PREDICTED: uncharacterized protein LOC103639092 isoform X3 [Zea 
mays]
Length=437

 Score =   121 bits (304),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 82/106 (77%), Gaps = 0/106 (0%)
 Frame = -3

Query  756  EEVMNLAGEIKsmseraslsssSGHKRDAIVMYKSIEELELRLFHAFSINLMRTRETLLK  577
            EE+ N+  +I  +S++AS   SSG+K +A  +YK I++LE  L+HAFS  L+ T ETLLK
Sbjct  330  EEIKNMRSKILQLSDKASSFLSSGNKAEAGSIYKIIKQLERNLYHAFSTTLLHTCETLLK  389

Query  576  MFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWL  439
            +++ELQDW  AL YCRLTIPVY+RVY  FHP++GLQ+YTCGKLE L
Sbjct  390  IYLELQDWWTALTYCRLTIPVYERVYPPFHPMIGLQFYTCGKLECL  435



>gb|EYU22919.1| hypothetical protein MIMGU_mgv1a006005mg [Erythranthe guttata]
Length=461

 Score =   119 bits (299),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 60/121 (50%), Positives = 84/121 (69%), Gaps = 0/121 (0%)
 Frame = -3

Query  675  DAIVMYKSIEELELRLFHAFSINLMRTRETLLKMFMELQDWKEALEYCRLTIPVYQRVYQ  496
            +A V YK +EELEL+L+H FSI++MRTR  LLK+ M+L D + AL   R  I +Y+RVY 
Sbjct  331  EASVAYKRVEELELKLYHPFSISIMRTRAKLLKISMDLDDMEGALLNIRSIIQIYERVYP  390

Query  495  GFHPLLGLQYYTCGKLEWLLGESEEAFKSLSKAMDILRITHGTKSSFMKELSFKLEEARA  316
             +HPL+G + Y CG++E  LG    A +SL+KA ++ RITHGT S    +++ KL EARA
Sbjct  391  KWHPLIGARCYLCGQIEMELGYMVGAIESLTKAYNVFRITHGTNSPLTMKITSKLAEARA  450

Query  315  E  313
            +
Sbjct  451  K  451



>ref|XP_010666643.1| PREDICTED: histone-lysine N-methyltransferase ASHR1 isoform X3 
[Beta vulgaris subsp. vulgaris]
Length=427

 Score =   117 bits (293),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 55/104 (53%), Positives = 83/104 (80%), Gaps = 0/104 (0%)
 Frame = -3

Query  756  EEVMNLAGEIKsmseraslsssSGHKRDAIVMYKSIEELELRLFHAFSINLMRTRETLLK  577
            E++  +A ++K+ SE+A +S  SG+  +A  +Y  +E+L+L+L H  S+NLMRTR++LLK
Sbjct  324  EDIKQIASKVKTFSEKAEVSLKSGNCEEAGSLYSMVEKLQLKLCHPSSLNLMRTRDSLLK  383

Query  576  MFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLE  445
            ++M+L +W++AL YCR+T+PVY+ VY G HP+LGLQYYTCGKLE
Sbjct  384  IYMKLSNWEDALVYCRMTVPVYEMVYPGCHPMLGLQYYTCGKLE  427



>ref|XP_002981276.1| hypothetical protein SELMODRAFT_114558, partial [Selaginella 
moellendorffii]
 gb|EFJ17464.1| hypothetical protein SELMODRAFT_114558, partial [Selaginella 
moellendorffii]
Length=453

 Score =   117 bits (293),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 62/148 (42%), Positives = 97/148 (66%), Gaps = 1/148 (1%)
 Frame = -3

Query  759  KEEVMNLAGEIKsmseraslsssSGHKRDAIVMYKSIEELELRLFHAFSINLMRTRETLL  580
              EV  L+ E + M E+A+   ++G    A + ++  E+L+  L++  S+ LMRTR+ LL
Sbjct  291  PNEVNKLSTEAEGMIEKANRLQAAGDLHGARMAFQQAEKLQTELWNPRSVKLMRTRDLLL  350

Query  579  KMFMELQDWKEALEYCRLTIPVYQRVYQGF-HPLLGLQYYTCGKLEWLLGESEEAFKSLS  403
            ++++ L+DW  AL  CRLT+P Y+  Y G  HPLLGLQYYT GKLE   G   EA ++ +
Sbjct  351  RVYLSLEDWDLALHVCRLTLPAYETAYPGSKHPLLGLQYYTLGKLEMHAGSVTEAVRAYA  410

Query  402  KAMDILRITHGTKSSFMKELSFKLEEAR  319
            KA DIL +THG++  F+++L  +L++A+
Sbjct  411  KAFDILSVTHGSRGEFVRKLRNELDQAK  438



>ref|XP_002969663.1| hypothetical protein SELMODRAFT_231366 [Selaginella moellendorffii]
 gb|EFJ28787.1| hypothetical protein SELMODRAFT_231366 [Selaginella moellendorffii]
Length=484

 Score =   117 bits (294),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 62/147 (42%), Positives = 97/147 (66%), Gaps = 1/147 (1%)
 Frame = -3

Query  756  EEVMNLAGEIKsmseraslsssSGHKRDAIVMYKSIEELELRLFHAFSINLMRTRETLLK  577
             EV  L+ E + M E+A+   ++G    A + ++  E+L+  L++  S+ LMRTR+ LL+
Sbjct  323  NEVNKLSTEAEGMIEKANRLQAAGDLHGARMAFQQAEKLQTELWNPRSVKLMRTRDLLLR  382

Query  576  MFMELQDWKEALEYCRLTIPVYQRVYQGF-HPLLGLQYYTCGKLEWLLGESEEAFKSLSK  400
            +++ L+DW  AL  CRLT+P Y+  Y G  HPLLGLQYYT GKLE   G   EA ++ +K
Sbjct  383  VYLSLEDWDLALHVCRLTLPAYETAYPGSKHPLLGLQYYTLGKLEMHAGSVTEAVRAYAK  442

Query  399  AMDILRITHGTKSSFMKELSFKLEEAR  319
            A DIL +THG++  F+++L  +L++A+
Sbjct  443  AFDILSVTHGSRGEFVRKLRNELDQAK  469



>gb|EEE59772.1| hypothetical protein OsJ_12271 [Oryza sativa Japonica Group]
Length=384

 Score =   116 bits (291),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 53/79 (67%), Positives = 64/79 (81%), Gaps = 0/79 (0%)
 Frame = -3

Query  519  PVYQRVYQGFHPLLGLQYYTCGKLEWLLGESEEAFKSLSKAMDILRITHGTKSSFMKELS  340
            PVY+R+Y  FHP++GLQ+YTCGKLEWLL  +E+A  SL++A DILRITHGTKS FMKEL 
Sbjct  305  PVYERIYPPFHPMIGLQFYTCGKLEWLLEYTEDALMSLTRAADILRITHGTKSEFMKELL  364

Query  339  FKLEEARAEVSYKLSTRKE  283
             KLEE RAE S++LS   E
Sbjct  365  GKLEEVRAEASFRLSAGDE  383



>ref|XP_007018976.1| Histone-lysine N-methyltransferase ASHR1 [Theobroma cacao]
 gb|EOY16201.1| Histone-lysine N-methyltransferase ASHR1 [Theobroma cacao]
Length=485

 Score =   114 bits (286),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 58/119 (49%), Positives = 75/119 (63%), Gaps = 0/119 (0%)
 Frame = -3

Query  687  GHKRDAIVMYKSIEELELRLFHAFSINLMRTRETLLKMFMELQDWKEALEYCRLTIPVYQ  508
            G+ R+A+  YK +EE  L LFH  S ++M  R  L K++M+  D + ALE CRLT PV+Q
Sbjct  356  GYFREALSTYKRVEEATLDLFHPSSFSVMIVRNLLTKLYMKTGDIQAALECCRLTTPVHQ  415

Query  507  RVYQGFHPLLGLQYYTCGKLEWLLGESEEAFKSLSKAMDILRITHGTKSSFMKELSFKL  331
            R+ QG  P+LG  YYT G LEW+ G  E+A   L +A DIL ITHGT    +KEL   L
Sbjct  416  RLLQGHDPVLGRHYYTRGMLEWVKGNKEDALNYLIRAGDILEITHGTNFPLVKELLINL  474



>ref|XP_009618110.1| PREDICTED: histone-lysine N-methyltransferase ASHR1 isoform X2 
[Nicotiana tomentosiformis]
Length=416

 Score =   105 bits (263),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = -3

Query  759  KEEVMNLAGEIKsmseraslsssSGHKRDAIVMYKSIEELELRLFHAFSINLMRTRETLL  580
            KEE+  +  EI+++SE+AS S S+GHK+DA VMYK IE+L+ +L H FS+NLMRTRE LL
Sbjct  321  KEEIKIIVNEIETISEKASFSLSNGHKKDASVMYKMIEKLQQKLCHQFSVNLMRTRENLL  380

Query  579  KMFMELQDWKEALEYCRLTIPVYQ  508
            K+ MELQDWKEAL+YCRLTIPVY+
Sbjct  381  KILMELQDWKEALKYCRLTIPVYK  404



>gb|KDP32757.1| hypothetical protein JCGZ_12049 [Jatropha curcas]
Length=332

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 58/131 (44%), Positives = 86/131 (66%), Gaps = 9/131 (7%)
 Frame = -3

Query  681  KRDAIVMYKSIEELELRLFHAFSINLMRTRETLLKMFMELQDWKEALEYCRLTIPVYQRV  502
            K +  +  K+ + L  ++F + S  L++TR  L+K  ++  +W++ALEYCR+TI V+++V
Sbjct  208  KCNGFLRLKAEKILRKKMFVSTSAYLLQTRIALIKGLVKEGEWQKALEYCRMTISVFEKV  267

Query  501  YQGFHPLLGLQYYTCGKLEWLLGESEEAFKSLSKAMDILRITHGTKSSFMKELSFKLEEA  322
            Y        +QY TCGKLEW  G  + A   LSKA+DIL+ITHGT+S F K+L  KLE+A
Sbjct  268  Y--------IQY-TCGKLEWHHGNPQVAIDLLSKALDILQITHGTESPFTKDLLLKLEQA  318

Query  321  RAEVSYKLSTR  289
            RA  S+KL+  
Sbjct  319  RAGESFKLTPN  329



>ref|XP_009764594.1| PREDICTED: histone-lysine N-methyltransferase ASHR1 isoform X3 
[Nicotiana sylvestris]
Length=427

 Score =   103 bits (256),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = -3

Query  759  KEEVMNLAGEIKsmseraslsssSGHKRDAIVMYKSIEELELRLFHAFSINLMRTRETLL  580
            +EE+  +  E++SMSE+AS S S+GH +DA VMYK IE+L+ +L+H FS+NLMRTRE LL
Sbjct  332  REEIKIVVNEMESMSEKASFSLSNGHNKDASVMYKMIEKLQQKLYHQFSVNLMRTRENLL  391

Query  579  KMFMELQDWKEALEYCRLTIPVYQ  508
            K+ MELQDWKEAL+YCRLTIPVY+
Sbjct  392  KILMELQDWKEALKYCRLTIPVYK  415



>ref|XP_007018979.1| Histone-lysine N-methyltransferase ASHR1 isoform 3 [Theobroma 
cacao]
 gb|EOY16204.1| Histone-lysine N-methyltransferase ASHR1 isoform 3 [Theobroma 
cacao]
Length=337

 Score = 96.7 bits (239),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 49/126 (39%), Positives = 73/126 (58%), Gaps = 0/126 (0%)
 Frame = -3

Query  678  RDAIVMYKSIEELELRLFHAFSINLMRTRETLLKMFMELQDWKEALEYCRLTIPVYQRVY  499
            ++A+  +K  EE  L LFH  S ++M  R  L K++  + D + ALE CRL  PV++R+ 
Sbjct  204  QEAVSTFKRAEEAALDLFHPSSFSVMMVRNLLTKLYTTIGDTRAALESCRLMTPVHERLL  263

Query  498  QGFHPLLGLQYYTCGKLEWLLGESEEAFKSLSKAMDILRITHGTKSSFMKELSFKLEEAR  319
            Q  +P+ G+ Y T G LEW+ G   +    L +A DIL +THGT    +KEL   L +  
Sbjct  264  QTLNPVRGMHYLTRGMLEWVEGNRGDGRNYLVRAGDILLLTHGTNFPLVKELLINLAKDH  323

Query  318  AEVSYK  301
            AE++ K
Sbjct  324  AELAKK  329



>ref|XP_007018978.1| Histone-lysine N-methyltransferase ASHR1 isoform 2 [Theobroma 
cacao]
 gb|EOY16203.1| Histone-lysine N-methyltransferase ASHR1 isoform 2 [Theobroma 
cacao]
Length=347

 Score = 96.3 bits (238),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 49/126 (39%), Positives = 73/126 (58%), Gaps = 0/126 (0%)
 Frame = -3

Query  678  RDAIVMYKSIEELELRLFHAFSINLMRTRETLLKMFMELQDWKEALEYCRLTIPVYQRVY  499
            ++A+  +K  EE  L LFH  S ++M  R  L K++  + D + ALE CRL  PV++R+ 
Sbjct  214  QEAVSTFKRAEEAALDLFHPSSFSVMMVRNLLTKLYTTIGDTRAALESCRLMTPVHERLL  273

Query  498  QGFHPLLGLQYYTCGKLEWLLGESEEAFKSLSKAMDILRITHGTKSSFMKELSFKLEEAR  319
            Q  +P+ G+ Y T G LEW+ G   +    L +A DIL +THGT    +KEL   L +  
Sbjct  274  QTLNPVRGMHYLTRGMLEWVEGNRGDGRNYLVRAGDILLLTHGTNFPLVKELLINLAKDH  333

Query  318  AEVSYK  301
            AE++ K
Sbjct  334  AELAKK  339



>ref|XP_007018977.1| Histone-lysine N-methyltransferase ASHR1 isoform 1 [Theobroma 
cacao]
 gb|EOY16202.1| Histone-lysine N-methyltransferase ASHR1 isoform 1 [Theobroma 
cacao]
Length=489

 Score = 95.5 bits (236),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 49/126 (39%), Positives = 73/126 (58%), Gaps = 0/126 (0%)
 Frame = -3

Query  678  RDAIVMYKSIEELELRLFHAFSINLMRTRETLLKMFMELQDWKEALEYCRLTIPVYQRVY  499
            ++A+  +K  EE  L LFH  S ++M  R  L K++  + D + ALE CRL  PV++R+ 
Sbjct  356  QEAVSTFKRAEEAALDLFHPSSFSVMMVRNLLTKLYTTIGDTRAALESCRLMTPVHERLL  415

Query  498  QGFHPLLGLQYYTCGKLEWLLGESEEAFKSLSKAMDILRITHGTKSSFMKELSFKLEEAR  319
            Q  +P+ G+ Y T G LEW+ G   +    L +A DIL +THGT    +KEL   L +  
Sbjct  416  QTLNPVRGMHYLTRGMLEWVEGNRGDGRNYLVRAGDILLLTHGTNFPLVKELLINLAKDH  475

Query  318  AEVSYK  301
            AE++ K
Sbjct  476  AELAKK  481



>ref|XP_007018973.1| Histone-lysine N-methyltransferase ASHR1 [Theobroma cacao]
 gb|EOY16198.1| Histone-lysine N-methyltransferase ASHR1 [Theobroma cacao]
Length=330

 Score = 92.8 bits (229),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 50/110 (45%), Positives = 65/110 (59%), Gaps = 0/110 (0%)
 Frame = -3

Query  672  AIVMYKSIEELELRLFHAFSINLMRTRETLLKMFMELQDWKEALEYCRLTIPVYQRVYQG  493
            A+  YK IE   L LFH  S+++M  R+ L K+ ME  D + ALE CRL  PV +R+ Q 
Sbjct  203  ALSTYKKIEAATLDLFHPSSLSVMLVRKLLTKLHMETGDIQAALECCRLITPVRERLLQR  262

Query  492  FHPLLGLQYYTCGKLEWLLGESEEAFKSLSKAMDILRITHGTKSSFMKEL  343
              P+LG  YY  GKLE + G+ E+    L +A DIL ITHGT    + EL
Sbjct  263  NDPVLGRHYYLRGKLEGVKGDKEDGRDYLIRARDILEITHGTNFPLVTEL  312



>gb|KJB29251.1| hypothetical protein B456_005G091200 [Gossypium raimondii]
Length=415

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 47/84 (56%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = -3

Query  759  KEEVMNLAGEIKsmseraslsssSGHKRDAIVMYKSIEELELRLFHAFSINLMRTRETLL  580
            KEE+  +A +IK++S++A   SSSG+ ++AIV+YK+IE+L+  + H FSI LMRTRE LL
Sbjct  323  KEEIRKIASDIKALSDKALKCSSSGNLQEAIVLYKNIEKLQKEVCHPFSIILMRTREKLL  382

Query  579  KMFMELQDWKEALEYCRLTIPVYQ  508
            ++ M+L++WKEAL  CRLTIPVY+
Sbjct  383  EILMQLEEWKEALAICRLTIPVYE  406



>ref|XP_011012503.1| PREDICTED: histone-lysine N-methyltransferase ASHR1-like isoform 
X4 [Populus euphratica]
Length=413

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 45/86 (52%), Positives = 64/86 (74%), Gaps = 0/86 (0%)
 Frame = -3

Query  759  KEEVMNLAGEIKsmseraslsssSGHKRDAIVMYKSIEELELRLFHAFSINLMRTRETLL  580
            KEEV  +  EI ++S++   S+S G+ ++ I +YK IE+L++ L H FSI+LMRT+E LL
Sbjct  323  KEEVKRIVCEITAISDKKLKSTSPGNHKEVISIYKMIEKLQMELCHPFSISLMRTQEELL  382

Query  579  KMFMELQDWKEALEYCRLTIPVYQRV  502
            K+ MEL DW+EAL YCRLTI  YQ++
Sbjct  383  KILMELGDWREALAYCRLTITGYQKL  408



>gb|AFW88215.1| hypothetical protein ZEAMMB73_999877 [Zea mays]
Length=484

 Score = 77.8 bits (190),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 48/61 (79%), Gaps = 0/61 (0%)
 Frame = -3

Query  681  KRDAIVMYKSIEELELRLFHAFSINLMRTRETLLKMFMELQDWKEALEYCRLTIPVYQRV  502
            K +A  +YK I++LE  L+HAFS  L+ T ETLLK+++ELQDW  AL YCRLTIPVY+++
Sbjct  293  KAEAGSIYKIIKQLERNLYHAFSTTLLHTCETLLKIYLELQDWWTALTYCRLTIPVYEKI  352

Query  501  Y  499
            +
Sbjct  353  F  353



>gb|AFW88214.1| hypothetical protein ZEAMMB73_999877 [Zea mays]
Length=529

 Score = 77.8 bits (190),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 48/61 (79%), Gaps = 0/61 (0%)
 Frame = -3

Query  681  KRDAIVMYKSIEELELRLFHAFSINLMRTRETLLKMFMELQDWKEALEYCRLTIPVYQRV  502
            K +A  +YK I++LE  L+HAFS  L+ T ETLLK+++ELQDW  AL YCRLTIPVY+++
Sbjct  293  KAEAGSIYKIIKQLERNLYHAFSTTLLHTCETLLKIYLELQDWWTALTYCRLTIPVYEKI  352

Query  501  Y  499
            +
Sbjct  353  F  353



>gb|EFN69720.1| Histone-lysine N-methyltransferase ASHR1 [Camponotus floridanus]
Length=132

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/96 (41%), Positives = 54/96 (56%), Gaps = 0/96 (0%)
 Frame = -3

Query  633  RLFHAFSINLMRTRETLLKMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCG  454
             + H F+I  +RT E      M L+ W++A  Y +  IP Y   Y   HPL+GL Y   G
Sbjct  16   NILHRFNIQHIRTLEAAHIAAMNLKYWEDAELYGKELIPGYLLYYGEIHPLIGLLYLMTG  75

Query  453  KLEWLLGESEEAFKSLSKAMDILRITHGTKSSFMKE  346
            K++  L + +EA K L KA ++L ITHG K S M+E
Sbjct  76   KIQLHLNKPKEALKVLEKASEVLMITHGDKHSLMRE  111



>ref|XP_003969594.1| PREDICTED: histone-lysine N-methyltransferase SMYD3 [Takifugu 
rubripes]
Length=434

 Score = 74.7 bits (182),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 38/98 (39%), Positives = 56/98 (57%), Gaps = 0/98 (0%)
 Frame = -3

Query  603  MRTRETLLKMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLLGESE  424
            +R  +  L   ++L  W EA+EY + T+PVY   Y   HP+ G+Q    GKL+  L   E
Sbjct  331  LRVTDMALDASIQLGLWTEAVEYGQKTLPVYHLYYPDPHPVHGVQLVRVGKLQHYLAHIE  390

Query  423  EAFKSLSKAMDILRITHGTKSSFMKELSFKLEEARAEV  310
            EA  +  +A  IL++THG  +S   +L  K+EE RAE+
Sbjct  391  EALDTFKQAYRILKVTHGNDNSITTDLLMKMEECRAEM  428



>ref|XP_011174680.1| PREDICTED: histone-lysine N-methyltransferase SMYD3-like, partial 
[Solenopsis invicta]
Length=218

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 39/95 (41%), Positives = 55/95 (58%), Gaps = 0/95 (0%)
 Frame = -3

Query  630  LFHAFSINLMRTRETLLKMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGK  451
            + H F+I  + T E      M L+ W++A  Y +  IP Y   Y   HPL GL Y T GK
Sbjct  104  IMHKFNIQHVHTLEMATIAAMNLECWEDAEIYGKELIPGYLLYYGEVHPLTGLLYLTTGK  163

Query  450  LEWLLGESEEAFKSLSKAMDILRITHGTKSSFMKE  346
            ++  LG+ +EA ++L+KA  IL ITHG K S ++E
Sbjct  164  IQLHLGKPKEALRALNKASTILMITHGDKHSLVRE  198



>ref|XP_004367850.1| SET and MYND domain containing 3, putative [Acanthamoeba castellanii 
str. Neff]
 gb|ELR25095.1| SET and MYND domain containing 3, putative [Acanthamoeba castellanii 
str. Neff]
Length=365

 Score = 70.9 bits (172),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 53/85 (62%), Gaps = 0/85 (0%)
 Frame = -3

Query  555  WKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLLGESEEAFKSLSKAMDILRIT  376
            W+EAL YC  ++ V++R+Y    PL+GLQY   GKL + L  +E A +S+ +A+ IL IT
Sbjct  269  WREALLYCSASLAVFERIYPPRWPLVGLQYLIHGKLSFYLKYTEAALESMQRALPILTIT  328

Query  375  HGTKSSFMKELSFKLEEARAEVSYK  301
            H +    ++ L   L EA AE +Y+
Sbjct  329  HSSGHPLVRTLHTMLAEATAEWNYE  353



>ref|XP_011345715.1| PREDICTED: histone-lysine N-methyltransferase SMYD3 isoform X3 
[Cerapachys biroi]
Length=413

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 42/111 (38%), Positives = 62/111 (56%), Gaps = 4/111 (4%)
 Frame = -3

Query  666  VMYKSIEELELR----LFHAFSINLMRTRETLLKMFMELQDWKEALEYCRLTIPVYQRVY  499
            V Y  + ++ L+    + H F++  +RT E      M L  W++A  Y +   P YQ  Y
Sbjct  282  VAYLDVSKICLKKQKGVLHRFNVQHVRTLEMAHIAAMNLGRWEDAELYGKELAPGYQLYY  341

Query  498  QGFHPLLGLQYYTCGKLEWLLGESEEAFKSLSKAMDILRITHGTKSSFMKE  346
               HPL GL Y T GK++  LG+S++AF+ L KA  +L ITHG K S ++E
Sbjct  342  GEVHPLTGLLYLTTGKIQLHLGKSKQAFEVLKKANMVLMITHGDKHSLVRE  392



>ref|XP_011345713.1| PREDICTED: histone-lysine N-methyltransferase SMYD3 isoform X1 
[Cerapachys biroi]
Length=449

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 42/111 (38%), Positives = 62/111 (56%), Gaps = 4/111 (4%)
 Frame = -3

Query  666  VMYKSIEELELR----LFHAFSINLMRTRETLLKMFMELQDWKEALEYCRLTIPVYQRVY  499
            V Y  + ++ L+    + H F++  +RT E      M L  W++A  Y +   P YQ  Y
Sbjct  318  VAYLDVSKICLKKQKGVLHRFNVQHVRTLEMAHIAAMNLGRWEDAELYGKELAPGYQLYY  377

Query  498  QGFHPLLGLQYYTCGKLEWLLGESEEAFKSLSKAMDILRITHGTKSSFMKE  346
               HPL GL Y T GK++  LG+S++AF+ L KA  +L ITHG K S ++E
Sbjct  378  GEVHPLTGLLYLTTGKIQLHLGKSKQAFEVLKKANMVLMITHGDKHSLVRE  428



>ref|XP_011345714.1| PREDICTED: histone-lysine N-methyltransferase SMYD3 isoform X2 
[Cerapachys biroi]
 gb|EZA50042.1| SET and MYND domain-containing protein [Cerapachys biroi]
Length=443

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 42/111 (38%), Positives = 62/111 (56%), Gaps = 4/111 (4%)
 Frame = -3

Query  666  VMYKSIEELELR----LFHAFSINLMRTRETLLKMFMELQDWKEALEYCRLTIPVYQRVY  499
            V Y  + ++ L+    + H F++  +RT E      M L  W++A  Y +   P YQ  Y
Sbjct  312  VAYLDVSKICLKKQKGVLHRFNVQHVRTLEMAHIAAMNLGRWEDAELYGKELAPGYQLYY  371

Query  498  QGFHPLLGLQYYTCGKLEWLLGESEEAFKSLSKAMDILRITHGTKSSFMKE  346
               HPL GL Y T GK++  LG+S++AF+ L KA  +L ITHG K S ++E
Sbjct  372  GEVHPLTGLLYLTTGKIQLHLGKSKQAFEVLKKANMVLMITHGDKHSLVRE  422



>ref|XP_011254247.1| PREDICTED: histone-lysine N-methyltransferase SMYD3 [Camponotus 
floridanus]
Length=450

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/96 (41%), Positives = 54/96 (56%), Gaps = 0/96 (0%)
 Frame = -3

Query  633  RLFHAFSINLMRTRETLLKMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCG  454
             + H F+I  +RT E      M L+ W++A  Y +  IP Y   Y   HPL+GL Y   G
Sbjct  334  NILHRFNIQHIRTLEAAHIAAMNLKYWEDAELYGKELIPGYLLYYGEIHPLIGLLYLMTG  393

Query  453  KLEWLLGESEEAFKSLSKAMDILRITHGTKSSFMKE  346
            K++  L + +EA K L KA ++L ITHG K S M+E
Sbjct  394  KIQLHLNKPKEALKVLEKASEVLMITHGDKHSLMRE  429



>ref|XP_007540471.1| PREDICTED: histone-lysine N-methyltransferase SMYD3 [Poecilia 
formosa]
Length=443

 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 40/109 (37%), Positives = 58/109 (53%), Gaps = 2/109 (2%)
 Frame = -3

Query  609  NLMRTRET--LLKMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLL  436
            NL R R T   L   ++L  W+EAL Y + T+P Y+  Y   HP+ G+Q    GKL+  L
Sbjct  334  NLYRLRVTDMALDAAVQLGQWEEALTYGKQTLPAYRLFYPDPHPVHGVQLMRVGKLQHHL  393

Query  435  GESEEAFKSLSKAMDILRITHGTKSSFMKELSFKLEEARAEVSYKLSTR  289
               E+A  +  +A  I+R+THG       +L  K+EE R E+  + S R
Sbjct  394  EHLEDALDTFKEAFIIMRMTHGDDHPLTSDLRMKMEECRLEMDAQQSGR  442



>ref|XP_011875678.1| PREDICTED: histone-lysine N-methyltransferase SMYD3 [Vollenhovia 
emeryi]
Length=439

 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 37/95 (39%), Positives = 54/95 (57%), Gaps = 0/95 (0%)
 Frame = -3

Query  630  LFHAFSINLMRTRETLLKMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGK  451
            + H F+I  +RT E      M L+ W++A  Y    +P Y   Y   HPL GL Y T GK
Sbjct  325  VMHKFNIQHVRTLEMAHIAAMNLECWEDAEFYGNELVPGYLMYYGEIHPLTGLLYLTTGK  384

Query  450  LEWLLGESEEAFKSLSKAMDILRITHGTKSSFMKE  346
            ++  LG+ +E  ++L+KA  +L ITHG K S ++E
Sbjct  385  IQLHLGKPKEGLRALNKASAVLTITHGNKHSLVQE  419



>ref|XP_006779990.1| PREDICTED: histone-lysine N-methyltransferase SMYD3-like isoform 
X2 [Neolamprologus brichardi]
Length=391

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/105 (32%), Positives = 57/105 (54%), Gaps = 0/105 (0%)
 Frame = -3

Query  603  MRTRETLLKMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLLGESE  424
            +R  +  L   + L  W+EA+ Y   T+P Y++ Y   HP+ G+Q    GKL+  L   E
Sbjct  286  LRITDMALDATVHLGRWEEAMSYGVTTLPAYRQYYPDPHPVHGIQLMRVGKLQHYLENIE  345

Query  423  EAFKSLSKAMDILRITHGTKSSFMKELSFKLEEARAEVSYKLSTR  289
            +A  +  +A  I++ THG     M EL+ K++E  +E+ +  S+R
Sbjct  346  DALDTFKQAYGIVKFTHGEDHPLMTELTMKMKECHSEMDHHSSSR  390



>ref|XP_011506257.1| PREDICTED: histone-lysine N-methyltransferase SMYD3 [Ceratosolen 
solmsi marchali]
Length=433

 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 37/95 (39%), Positives = 55/95 (58%), Gaps = 0/95 (0%)
 Frame = -3

Query  630  LFHAFSINLMRTRETLLKMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGK  451
            +FH  +I  +RT E+ L + +E   W+EA  +    +P Y   Y  FHPL GL Y+  GK
Sbjct  321  IFHPLNILHIRTMESTLDVAIESGHWQEASLFGIKLLPGYLYYYGEFHPLTGLLYFKIGK  380

Query  450  LEWLLGESEEAFKSLSKAMDILRITHGTKSSFMKE  346
            ++  LG+ E A K L +A  IL++THG + S + E
Sbjct  381  IQLYLGQEEAALKMLMEAYKILKVTHGDEHSLINE  415



>gb|EGI64301.1| SET and MYND domain-containing protein 3 [Acromyrmex echinatior]
Length=441

 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 56/95 (59%), Gaps = 0/95 (0%)
 Frame = -3

Query  630  LFHAFSINLMRTRETLLKMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGK  451
            + H F+I  +RT E      M L+ W++A  Y +  +P Y   Y   HPL GL Y T GK
Sbjct  331  IMHKFNIQHVRTLEMAHIAAMNLKCWEDAEFYGKELVPGYLLYYGEIHPLTGLLYLTVGK  390

Query  450  LEWLLGESEEAFKSLSKAMDILRITHGTKSSFMKE  346
            ++  L + +EAF++L+KA  +L ITHG K S ++E
Sbjct  391  IQLHLEKPKEAFQALTKANTVLTITHGDKHSIVEE  425



>ref|XP_011056400.1| PREDICTED: histone-lysine N-methyltransferase SMYD3 isoform X1 
[Acromyrmex echinatior]
Length=444

 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 56/95 (59%), Gaps = 0/95 (0%)
 Frame = -3

Query  630  LFHAFSINLMRTRETLLKMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGK  451
            + H F+I  +RT E      M L+ W++A  Y +  +P Y   Y   HPL GL Y T GK
Sbjct  334  IMHKFNIQHVRTLEMAHIAAMNLKCWEDAEFYGKELVPGYLLYYGEIHPLTGLLYLTVGK  393

Query  450  LEWLLGESEEAFKSLSKAMDILRITHGTKSSFMKE  346
            ++  L + +EAF++L+KA  +L ITHG K S ++E
Sbjct  394  IQLHLEKPKEAFQALTKANTVLTITHGDKHSIVEE  428



>ref|XP_011056401.1| PREDICTED: histone-lysine N-methyltransferase SMYD3 isoform X2 
[Acromyrmex echinatior]
Length=437

 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 56/95 (59%), Gaps = 0/95 (0%)
 Frame = -3

Query  630  LFHAFSINLMRTRETLLKMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGK  451
            + H F+I  +RT E      M L+ W++A  Y +  +P Y   Y   HPL GL Y T GK
Sbjct  327  IMHKFNIQHVRTLEMAHIAAMNLKCWEDAEFYGKELVPGYLLYYGEIHPLTGLLYLTVGK  386

Query  450  LEWLLGESEEAFKSLSKAMDILRITHGTKSSFMKE  346
            ++  L + +EAF++L+KA  +L ITHG K S ++E
Sbjct  387  IQLHLEKPKEAFQALTKANTVLTITHGDKHSIVEE  421



>ref|XP_008293366.1| PREDICTED: histone-lysine N-methyltransferase SMYD3 [Stegastes 
partitus]
Length=436

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 60/109 (55%), Gaps = 0/109 (0%)
 Frame = -3

Query  615  SINLMRTRETLLKMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLL  436
            +++ +R  +  L   + LQ W+EA+ Y   T+  Y+  Y   HP+ G+Q    GKL+  L
Sbjct  327  NLHKLRITDMALDASIHLQHWEEAMRYGAKTLSTYKLYYPDPHPVHGIQLMRVGKLQHYL  386

Query  435  GESEEAFKSLSKAMDILRITHGTKSSFMKELSFKLEEARAEVSYKLSTR  289
               E+A  +  +A +IL++THG       +L  ++EE R E+ +K S+R
Sbjct  387  EHIEDALDTFKQAYEILKLTHGDDHPMTADLRTRMEECRCEMDHKSSSR  435



>ref|XP_006779989.1| PREDICTED: histone-lysine N-methyltransferase SMYD3-like isoform 
X1 [Neolamprologus brichardi]
Length=439

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 34/105 (32%), Positives = 57/105 (54%), Gaps = 0/105 (0%)
 Frame = -3

Query  603  MRTRETLLKMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLLGESE  424
            +R  +  L   + L  W+EA+ Y   T+P Y++ Y   HP+ G+Q    GKL+  L   E
Sbjct  334  LRITDMALDATVHLGRWEEAMSYGVTTLPAYRQYYPDPHPVHGIQLMRVGKLQHYLENIE  393

Query  423  EAFKSLSKAMDILRITHGTKSSFMKELSFKLEEARAEVSYKLSTR  289
            +A  +  +A  I++ THG     M EL+ K++E  +E+ +  S+R
Sbjct  394  DALDTFKQAYGIVKFTHGEDHPLMTELTMKMKECHSEMDHHSSSR  438



>ref|XP_011704687.1| PREDICTED: histone-lysine N-methyltransferase SMYD3 isoform X2 
[Wasmannia auropunctata]
Length=441

 Score = 68.2 bits (165),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 56/95 (59%), Gaps = 0/95 (0%)
 Frame = -3

Query  630  LFHAFSINLMRTRETLLKMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGK  451
            + + F+I  +RT E      M L+ W++A  Y +  +P Y   Y   HPL GL Y T GK
Sbjct  327  VMYKFNIQHVRTLEMAHIAAMNLKCWEDAEFYGKELMPGYLLYYGEIHPLTGLLYLTTGK  386

Query  450  LEWLLGESEEAFKSLSKAMDILRITHGTKSSFMKE  346
            ++  LG+ +EA ++L+KA  +L ITHG K S +KE
Sbjct  387  IQLHLGKPKEALRALNKANTVLMITHGDKHSLVKE  421



>ref|XP_012056540.1| PREDICTED: histone-lysine N-methyltransferase SMYD3 [Atta cephalotes]
Length=444

 Score = 68.2 bits (165),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 55/95 (58%), Gaps = 0/95 (0%)
 Frame = -3

Query  630  LFHAFSINLMRTRETLLKMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGK  451
            + H F+I  +RT E      M L+ W++A  Y +  +P Y   Y   HPL GL Y T GK
Sbjct  334  IMHKFNIQHVRTLEMAHIAAMNLKCWEDAEFYGKELVPGYLLYYGEIHPLTGLLYLTIGK  393

Query  450  LEWLLGESEEAFKSLSKAMDILRITHGTKSSFMKE  346
            ++  L + +EA ++L+KA  +L ITHG K S M+E
Sbjct  394  IQLHLEKPKEALQALTKANTVLTITHGDKHSIMEE  428



>ref|XP_011704686.1| PREDICTED: histone-lysine N-methyltransferase SMYD3 isoform X1 
[Wasmannia auropunctata]
Length=448

 Score = 68.2 bits (165),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 56/95 (59%), Gaps = 0/95 (0%)
 Frame = -3

Query  630  LFHAFSINLMRTRETLLKMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGK  451
            + + F+I  +RT E      M L+ W++A  Y +  +P Y   Y   HPL GL Y T GK
Sbjct  334  VMYKFNIQHVRTLEMAHIAAMNLKCWEDAEFYGKELMPGYLLYYGEIHPLTGLLYLTTGK  393

Query  450  LEWLLGESEEAFKSLSKAMDILRITHGTKSSFMKE  346
            ++  LG+ +EA ++L+KA  +L ITHG K S +KE
Sbjct  394  IQLHLGKPKEALRALNKANTVLMITHGDKHSLVKE  428



>ref|XP_010781250.1| PREDICTED: histone-lysine N-methyltransferase SMYD3, partial 
[Notothenia coriiceps]
Length=388

 Score = 67.8 bits (164),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 34/93 (37%), Positives = 53/93 (57%), Gaps = 0/93 (0%)
 Frame = -3

Query  570  MELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLLGESEEAFKSLSKAMD  391
            + L  W+EAL Y   T+PVY++ Y   HP+ G+Q    GKL+  L   E+A  +  +A  
Sbjct  289  IHLGHWEEALGYGEKTLPVYRQYYPDPHPVHGVQLMRVGKLQHYLEHIEDALDTFKQAFK  348

Query  390  ILRITHGTKSSFMKELSFKLEEARAEVSYKLST  292
            I+++THG       +L  K+EE R+E+  K S+
Sbjct  349  IIKLTHGVDHPMTTDLLMKMEECRSELDQKSSS  381



>ref|XP_005915117.1| PREDICTED: histone-lysine N-methyltransferase SMYD3-like [Haplochromis 
burtoni]
Length=439

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 58/106 (55%), Gaps = 0/106 (0%)
 Frame = -3

Query  603  MRTRETLLKMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLLGESE  424
            +R  +  L   + L  W+EA+ Y   T+P Y++ Y+  HP+ G+Q    GKL+  L   E
Sbjct  334  LRITDMALDASVHLGRWEEAMSYGVTTLPAYRQYYRDPHPVHGIQLMRVGKLQHYLENIE  393

Query  423  EAFKSLSKAMDILRITHGTKSSFMKELSFKLEEARAEVSYKLSTRK  286
            +A  +  +A  I++ THG       EL+ K++E  +E+ +  S+R+
Sbjct  394  DALDTFKQAYGIVKFTHGEDHPLTTELTMKMKECHSEMDHHSSSRR  439



>ref|XP_005459017.1| PREDICTED: histone-lysine N-methyltransferase SMYD3-like isoform 
X2 [Oreochromis niloticus]
Length=373

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 57/105 (54%), Gaps = 0/105 (0%)
 Frame = -3

Query  603  MRTRETLLKMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLLGESE  424
            +R  +  L   + L  W+EA+ Y   T+P Y++ Y   HP+ G+Q    GKL+  L   E
Sbjct  268  LRITDMALDASVHLGRWEEAMSYGVTTLPAYRQYYPDPHPVHGIQLMRVGKLQHYLENIE  327

Query  423  EAFKSLSKAMDILRITHGTKSSFMKELSFKLEEARAEVSYKLSTR  289
            +A  +  +A +I++ THG       EL+ K++E  +E+ +  S+R
Sbjct  328  DALDTFRQAYEIVKFTHGEDHPLTTELTMKMKECHSEMDHHSSSR  372



>ref|XP_004539562.1| PREDICTED: histone-lysine N-methyltransferase SMYD3-like [Maylandia 
zebra]
Length=439

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 57/106 (54%), Gaps = 0/106 (0%)
 Frame = -3

Query  603  MRTRETLLKMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLLGESE  424
            +R  +  L   + L  W+EA+ Y   T+P Y++ Y   HP+ G+Q    GKL+  L   E
Sbjct  334  LRITDMALDASVHLGRWEEAMSYGVTTLPAYRQYYPDPHPVHGIQLMRVGKLQHYLENIE  393

Query  423  EAFKSLSKAMDILRITHGTKSSFMKELSFKLEEARAEVSYKLSTRK  286
            +A  +  +A  I++ THG       EL+ K++E  +E+ +  S+R+
Sbjct  394  DALDTFKQAYGIVKFTHGEDHPLTTELTMKMKECHSEMDHHSSSRR  439



>ref|XP_005733360.1| PREDICTED: histone-lysine N-methyltransferase SMYD3-like [Pundamilia 
nyererei]
Length=439

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 57/106 (54%), Gaps = 0/106 (0%)
 Frame = -3

Query  603  MRTRETLLKMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLLGESE  424
            +R  +  L   + L  W+EA+ Y   T+P Y++ Y   HP+ G+Q    GKL+  L   E
Sbjct  334  LRITDMALDASVHLGRWEEAMSYGVTTLPAYRQYYPDPHPVHGIQLMRVGKLQHYLENIE  393

Query  423  EAFKSLSKAMDILRITHGTKSSFMKELSFKLEEARAEVSYKLSTRK  286
            +A  +  +A  I++ THG       EL+ K++E  +E+ +  S+R+
Sbjct  394  DALDTFKQAYGIVKFTHGEDHPLTTELTMKMKECHSEMDHHSSSRR  439



>ref|XP_004530439.1| PREDICTED: histone-lysine N-methyltransferase SMYD3-like isoform 
X1 [Ceratitis capitata]
 ref|XP_004530440.1| PREDICTED: histone-lysine N-methyltransferase SMYD3-like isoform 
X2 [Ceratitis capitata]
 ref|XP_004530441.1| PREDICTED: histone-lysine N-methyltransferase SMYD3-like isoform 
X3 [Ceratitis capitata]
Length=494

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 37/107 (35%), Positives = 62/107 (58%), Gaps = 1/107 (1%)
 Frame = -3

Query  630  LFHAFSINLMRTRETLLKMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGK  451
            + H F++  ++T +   +  +++  W EALEY    +P +++ Y  +HPLLG+ Y   GK
Sbjct  385  VLHPFNVWHLKTLDAAFEAAIDVSKWAEALEYGIELVPGFRKYYGDWHPLLGMLYLKIGK  444

Query  450  LEWLLGESEEAFKSLSKAMDILRITHGTKSSFMKE-LSFKLEEARAE  313
            ++    E +EA  +L +A  IL+ITHG   S ++E L   L +A AE
Sbjct  445  IQLYKSELKEAINNLREAQKILQITHGRDHSLLREQLQPMLAQALAE  491



>ref|XP_003454545.1| PREDICTED: histone-lysine N-methyltransferase SMYD3-like isoform 
X1 [Oreochromis niloticus]
Length=439

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 57/105 (54%), Gaps = 0/105 (0%)
 Frame = -3

Query  603  MRTRETLLKMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLLGESE  424
            +R  +  L   + L  W+EA+ Y   T+P Y++ Y   HP+ G+Q    GKL+  L   E
Sbjct  334  LRITDMALDASVHLGRWEEAMSYGVTTLPAYRQYYPDPHPVHGIQLMRVGKLQHYLENIE  393

Query  423  EAFKSLSKAMDILRITHGTKSSFMKELSFKLEEARAEVSYKLSTR  289
            +A  +  +A +I++ THG       EL+ K++E  +E+ +  S+R
Sbjct  394  DALDTFRQAYEIVKFTHGEDHPLTTELTMKMKECHSEMDHHSSSR  438



>ref|XP_005043339.1| PREDICTED: histone-lysine N-methyltransferase SMYD3 [Ficedula 
albicollis]
Length=428

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 53/92 (58%), Gaps = 0/92 (0%)
 Frame = -3

Query  591  ETLLKMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLLGESEEAFK  412
            +  +   + L+ W+EAL Y   T+  Y+R Y GFHPL  +Q    GKL++  G   +A +
Sbjct  332  DCAMDACINLESWEEALHYGSRTLEPYRRYYPGFHPLRAVQLMRVGKLQYSQGMFPQALE  391

Query  411  SLSKAMDILRITHGTKSSFMKELSFKLEEARA  316
            +L +A +I+++THGT  S MK L    EE  A
Sbjct  392  TLKQAYNIMKVTHGTDHSQMKVLMEIKEECEA  423



>ref|XP_008403993.1| PREDICTED: histone-lysine N-methyltransferase SMYD3 [Poecilia 
reticulata]
 ref|XP_008403994.1| PREDICTED: histone-lysine N-methyltransferase SMYD3 [Poecilia 
reticulata]
Length=443

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 36/105 (34%), Positives = 55/105 (52%), Gaps = 0/105 (0%)
 Frame = -3

Query  603  MRTRETLLKMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLLGESE  424
            +R  +  L   ++L  W+EAL Y   T+P Y+  Y   HP+ G+Q    GKL+  L   E
Sbjct  338  LRVTDMALDAAVQLGQWEEALTYGMKTLPAYRLFYPDPHPVHGVQLMRVGKLQHHLEHLE  397

Query  423  EAFKSLSKAMDILRITHGTKSSFMKELSFKLEEARAEVSYKLSTR  289
            +A  +  +A  I+R+THG       +L  K+EE R E+  + S R
Sbjct  398  DALDTFKEAFIIMRMTHGDDHPLTSDLRMKMEECRLEMDMQQSGR  442



>ref|XP_002188283.2| PREDICTED: SET and MYND domain-containing protein 3 [Taeniopygia 
guttata]
Length=289

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 56/100 (56%), Gaps = 0/100 (0%)
 Frame = -3

Query  615  SINLMRTRETLLKMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLL  436
            +I  ++  +  +   + L+ W+EAL Y   T+  Y+  Y GFHPL  +Q    GKL++  
Sbjct  185  NIYQLKMLDCAMDACINLESWEEALYYGSRTLEPYRLYYPGFHPLRAVQLMRVGKLQYSQ  244

Query  435  GESEEAFKSLSKAMDILRITHGTKSSFMKELSFKLEEARA  316
            G   +A ++L +A +I+++THGT  S MK L    EE  A
Sbjct  245  GMVPQALETLKQAYNIMKVTHGTDHSLMKVLMEMKEECEA  284



>ref|XP_010755099.1| PREDICTED: histone-lysine N-methyltransferase SMYD3, partial 
[Larimichthys crocea]
Length=382

 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 55/103 (53%), Gaps = 0/103 (0%)
 Frame = -3

Query  603  MRTRETLLKMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLLGESE  424
            +R  +  +   + L  W+EA+ Y   T+PVY++ Y   HP+ G+Q    GKL+  L   E
Sbjct  279  LRMTDMAVDASIHLGHWREAVGYGEKTLPVYRQYYPDPHPVHGVQLMRVGKLQHYLEHIE  338

Query  423  EAFKSLSKAMDILRITHGTKSSFMKELSFKLEEARAEVSYKLS  295
            +A  +  +A  I+++THG       +L  K+EE R E+  + S
Sbjct  339  DALDTFKQAYQIIKLTHGDDHPMTTDLLMKMEECRTEMDQQSS  381



>ref|XP_009090154.1| PREDICTED: histone-lysine N-methyltransferase SMYD3 [Serinus 
canaria]
Length=289

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 56/100 (56%), Gaps = 0/100 (0%)
 Frame = -3

Query  615  SINLMRTRETLLKMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLL  436
            +I  ++  +  +   + L+ W+EAL Y   T+  Y+  Y GFHPL  +Q    GKL++  
Sbjct  185  NIYQLKMLDCAMDACINLESWEEALYYGSRTLEPYRLYYPGFHPLRAVQLMRVGKLQYSQ  244

Query  435  GESEEAFKSLSKAMDILRITHGTKSSFMKELSFKLEEARA  316
            G   +A ++L +A +I+++THGT  S MK L    EE  A
Sbjct  245  GMVPQALETLKQAYNIMKVTHGTDHSLMKVLMEIKEECEA  284



>gb|KFO53608.1| Histone-lysine N-methyltransferase SMYD3, partial [Corvus brachyrhynchos]
Length=257

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 56/100 (56%), Gaps = 0/100 (0%)
 Frame = -3

Query  615  SINLMRTRETLLKMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLL  436
            +I  ++  +  +   + L+ W+EAL Y   T+  Y+  Y GFHPL  +Q    GKL++  
Sbjct  153  NIYQLKMLDCAMDACINLESWEEALYYGSRTLEPYRLYYPGFHPLRAVQLMRVGKLQYSQ  212

Query  435  GESEEAFKSLSKAMDILRITHGTKSSFMKELSFKLEEARA  316
            G   +A ++L +A +I+++THGT  S MK L    EE  A
Sbjct  213  GMFPQALETLKQAYNIMKVTHGTDHSLMKVLMEIKEECEA  252



>gb|EFN77865.1| SET and MYND domain-containing protein 3 [Harpegnathos saltator]
Length=354

 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 35/95 (37%), Positives = 55/95 (58%), Gaps = 0/95 (0%)
 Frame = -3

Query  630  LFHAFSINLMRTRETLLKMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGK  451
            + H+F+I  +RT +T     + L+ W++A  Y +  +P Y   Y   HPL+GL Y T GK
Sbjct  237  ILHSFNIQHIRTLDTAFLAAVNLEYWEDAELYSKQLLPGYLLYYGEVHPLIGLLYLTMGK  296

Query  450  LEWLLGESEEAFKSLSKAMDILRITHGTKSSFMKE  346
            ++  L + ++A + L KA  +L ITHG K   M+E
Sbjct  297  IQLHLRKLKQALEILKKASAVLTITHGDKHPIMRE  331



>ref|XP_005489779.1| PREDICTED: histone-lysine N-methyltransferase SMYD3 isoform X2 
[Zonotrichia albicollis]
Length=391

 Score = 65.5 bits (158),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 56/100 (56%), Gaps = 0/100 (0%)
 Frame = -3

Query  615  SINLMRTRETLLKMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLL  436
            +I  ++  +  +   + L+ W+EAL Y   T+  Y+  Y GFHPL  +Q    GKL++  
Sbjct  287  NIYQLKMLDCAMDACINLESWEEALYYGSRTLEPYRLYYPGFHPLRAVQLMRVGKLQYSQ  346

Query  435  GESEEAFKSLSKAMDILRITHGTKSSFMKELSFKLEEARA  316
            G   +A ++L +A +I+++THGT  S MK L    EE  A
Sbjct  347  GMVPQALETLKQAYNIMKVTHGTDHSLMKALMEIKEECEA  386



>ref|XP_005489778.1| PREDICTED: histone-lysine N-methyltransferase SMYD3 isoform X1 
[Zonotrichia albicollis]
Length=428

 Score = 65.5 bits (158),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 56/100 (56%), Gaps = 0/100 (0%)
 Frame = -3

Query  615  SINLMRTRETLLKMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLL  436
            +I  ++  +  +   + L+ W+EAL Y   T+  Y+  Y GFHPL  +Q    GKL++  
Sbjct  324  NIYQLKMLDCAMDACINLESWEEALYYGSRTLEPYRLYYPGFHPLRAVQLMRVGKLQYSQ  383

Query  435  GESEEAFKSLSKAMDILRITHGTKSSFMKELSFKLEEARA  316
            G   +A ++L +A +I+++THGT  S MK L    EE  A
Sbjct  384  GMVPQALETLKQAYNIMKVTHGTDHSLMKALMEIKEECEA  423



>ref|XP_004700019.1| PREDICTED: histone-lysine N-methyltransferase SMYD3 [Echinops 
telfairi]
Length=428

 Score = 65.5 bits (158),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 38/103 (37%), Positives = 58/103 (56%), Gaps = 0/103 (0%)
 Frame = -3

Query  618  FSINLMRTRETLLKMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWL  439
             +I  ++  +  L   + L  W+EAL Y   T+  Y+  + G HP+ G+Q    GKL+  
Sbjct  323  INIYQLKVLDCALDACIHLGLWEEALCYGIRTMEPYKIFFPGSHPIRGVQVMKVGKLQLH  382

Query  438  LGESEEAFKSLSKAMDILRITHGTKSSFMKELSFKLEEARAEV  310
            LG   EA K+L  A DILR+THG + S +++L+  LEE  A +
Sbjct  383  LGMFPEARKNLRLAFDILRVTHGREHSLIEDLTLLLEECEANM  425



>ref|XP_011149470.1| PREDICTED: histone-lysine N-methyltransferase SMYD3, partial 
[Harpegnathos saltator]
Length=443

 Score = 65.1 bits (157),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 35/95 (37%), Positives = 55/95 (58%), Gaps = 0/95 (0%)
 Frame = -3

Query  630  LFHAFSINLMRTRETLLKMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGK  451
            + H+F+I  +RT +T     + L+ W++A  Y +  +P Y   Y   HPL+GL Y T GK
Sbjct  281  ILHSFNIQHIRTLDTAFLAAVNLEYWEDAELYSKQLLPGYLLYYGEVHPLIGLLYLTMGK  340

Query  450  LEWLLGESEEAFKSLSKAMDILRITHGTKSSFMKE  346
            ++  L + ++A + L KA  +L ITHG K   M+E
Sbjct  341  IQLHLRKLKQALEILKKASAVLTITHGDKHPIMRE  375



>gb|ESA08452.1| hypothetical protein GLOINDRAFT_210128 [Rhizophagus irregularis 
DAOM 181602]
 gb|EXX52496.1| Set6p [Rhizophagus irregularis DAOM 197198w]
Length=502

 Score = 65.5 bits (158),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 38/133 (29%), Positives = 70/133 (53%), Gaps = 7/133 (5%)
 Frame = -3

Query  678  RDAIVMYKSIEELELRLFHAFSINLMRTRETLLKMFMELQDWKEALEYCRLTIPVYQRVY  499
            R A+  ++   +++  L +  + N++RTR+TL++++  L+DWK+AL++    I  Y+ +Y
Sbjct  367  RQAVTFFEQTFKIQQELLYEANYNMIRTRKTLVEIYCNLKDWKKALDHSLKLIESYRILY  426

Query  498  QGFHPLLGLQYYTCGKLEWLLGESEEAFKSLSKAMDILR-------ITHGTKSSFMKELS  340
               HPLL LQ Y+  ++      ++   K L K  ++LR       ITHG +    K + 
Sbjct  427  SKSHPLLSLQIYSTARIYLSFDYNDIKVKDLEKIDELLREALKGLEITHGYQHPITKMVE  486

Query  339  FKLEEARAEVSYK  301
              L +   E+  K
Sbjct  487  MNLWDVEGELGLK  499



>gb|EXX52497.1| Set6p [Rhizophagus irregularis DAOM 197198w]
Length=441

 Score = 65.1 bits (157),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 38/133 (29%), Positives = 70/133 (53%), Gaps = 7/133 (5%)
 Frame = -3

Query  678  RDAIVMYKSIEELELRLFHAFSINLMRTRETLLKMFMELQDWKEALEYCRLTIPVYQRVY  499
            R A+  ++   +++  L +  + N++RTR+TL++++  L+DWK+AL++    I  Y+ +Y
Sbjct  306  RQAVTFFEQTFKIQQELLYEANYNMIRTRKTLVEIYCNLKDWKKALDHSLKLIESYRILY  365

Query  498  QGFHPLLGLQYYTCGKLEWLLGESEEAFKSLSKAMDILR-------ITHGTKSSFMKELS  340
               HPLL LQ Y+  ++      ++   K L K  ++LR       ITHG +    K + 
Sbjct  366  SKSHPLLSLQIYSTARIYLSFDYNDIKVKDLEKIDELLREALKGLEITHGYQHPITKMVE  425

Query  339  FKLEEARAEVSYK  301
              L +   E+  K
Sbjct  426  MNLWDVEGELGLK  438



>ref|XP_009985112.1| PREDICTED: histone-lysine N-methyltransferase SMYD3-like [Tauraco 
erythrolophus]
Length=112

 Score = 61.2 bits (147),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/100 (33%), Positives = 55/100 (55%), Gaps = 0/100 (0%)
 Frame = -3

Query  615  SINLMRTRETLLKMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLL  436
            +I  ++  +  +   + L+ W+EAL Y   T+  Y+  Y GFHPL  +Q    GKL++  
Sbjct  8    NIYQLKMLDCAMDACINLESWEEALYYGSRTLGPYRLYYPGFHPLRAVQLMRVGKLQYSQ  67

Query  435  GESEEAFKSLSKAMDILRITHGTKSSFMKELSFKLEEARA  316
                +A ++L +A +I+++THGT  S M+ L    EE  A
Sbjct  68   DMFPQALETLKQAYNIMKVTHGTDHSLMQALMEIKEECEA  107



>ref|XP_008308612.1| PREDICTED: histone-lysine N-methyltransferase SMYD3 isoform X1 
[Cynoglossus semilaevis]
Length=453

 Score = 65.1 bits (157),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 50/86 (58%), Gaps = 0/86 (0%)
 Frame = -3

Query  570  MELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLLGESEEAFKSLSKAMD  391
            + LQ W+EAL + R T+ VY+R +   HP+ G+Q    GKL+  LG  +EA  +  +A  
Sbjct  357  VHLQLWEEALSFGRKTLSVYKRYFPDPHPVHGVQLMRVGKLQHYLGHIQEALDTFRQAFQ  416

Query  390  ILRITHGTKSSFMKELSFKLEEARAE  313
            IL +THG       E+  K+EE ++E
Sbjct  417  ILELTHGRTHPLTTEVLTKMEECQSE  442



>ref|XP_011491788.1| PREDICTED: histone-lysine N-methyltransferase SMYD3 [Oryzias 
latipes]
Length=417

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/101 (34%), Positives = 56/101 (55%), Gaps = 0/101 (0%)
 Frame = -3

Query  603  MRTRETLLKMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLLGESE  424
            ++  +  L   + L  W+EAL +   T+P Y+  Y   HP+ G+Q    GKL+  LG  E
Sbjct  313  LKITDMALDASVHLGRWEEALSFGLKTLPSYRLYYADPHPVHGVQLMRVGKLQHHLGCIE  372

Query  423  EAFKSLSKAMDILRITHGTKSSFMKELSFKLEEARAEVSYK  301
            +A +S  +A  IL++THG     + +L  K+EE R+E+  +
Sbjct  373  DALESFKEAFKILKLTHGEDHPLIVDLMMKMEECRSEIDLQ  413



>ref|XP_319707.4| AGAP008954-PA [Anopheles gambiae str. PEST]
 gb|EAA14812.4| AGAP008954-PA [Anopheles gambiae str. PEST]
Length=453

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/125 (29%), Positives = 63/125 (50%), Gaps = 9/125 (7%)
 Frame = -3

Query  678  RDAIVMYKSIEELEL---------RLFHAFSINLMRTRETLLKMFMELQDWKEALEYCRL  526
            RD +   KS+  L++          + H ++++ ++T +  ++  + L+ W EA  Y   
Sbjct  311  RDHLAQMKSVAYLDVSRLCLEKQANVLHRYNVHHIKTLDNAMESALNLEKWTEATGYGLR  370

Query  525  TIPVYQRVYQGFHPLLGLQYYTCGKLEWLLGESEEAFKSLSKAMDILRITHGTKSSFMKE  346
             +  +++ Y  +HPLLGL Y   GKL+    +  EA K L +A  ILR+THG +    K 
Sbjct  371  LLDGFRQYYSTYHPLLGLTYLKVGKLQLYQCQFAEALKQLQQAAKILRVTHGEQDDLYKR  430

Query  345  LSFKL  331
            +   L
Sbjct  431  VLVPL  435



>ref|XP_009811023.1| PREDICTED: histone-lysine N-methyltransferase SMYD3-like [Gavia 
stellata]
Length=112

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/91 (33%), Positives = 52/91 (57%), Gaps = 0/91 (0%)
 Frame = -3

Query  615  SINLMRTRETLLKMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLL  436
            +I  ++  +  +   + L+ W+EAL Y   T+  Y+  Y GFHPL  +Q    GKL++  
Sbjct  8    NIYQLKMLDCAMDACINLESWEEALYYGSRTLGPYRLYYPGFHPLRAVQLMQVGKLQYSQ  67

Query  435  GESEEAFKSLSKAMDILRITHGTKSSFMKEL  343
                +A ++L +A +I+++THGT  S M+ L
Sbjct  68   DMFPQALETLKQAYNIMKVTHGTDHSLMQAL  98



>gb|KFP00980.1| Histone-lysine N-methyltransferase SMYD3, partial [Calypte anna]
Length=257

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 42/121 (35%), Positives = 62/121 (51%), Gaps = 10/121 (8%)
 Frame = -3

Query  648  EELELRLFHAFSINLMRTRET---LLKMF-------MELQDWKEALEYCRLTIPVYQRVY  499
            E++  R  +  S N+ R  +T    LKM        + L  W+EAL Y   T+  Y+  Y
Sbjct  132  EQVLARCQNLLSSNVDRIPDTNIYQLKMLDCAMDACVNLGSWEEALYYGSRTLGAYRLYY  191

Query  498  QGFHPLLGLQYYTCGKLEWLLGESEEAFKSLSKAMDILRITHGTKSSFMKELSFKLEEAR  319
             GFHPL  +Q    GKL++      +A ++L +A DI+++THGT  S M+ L    EE  
Sbjct  192  PGFHPLRAVQLMRVGKLQYNQAMFPQALETLKQAYDIMKVTHGTDHSLMQALMDIKEECE  251

Query  318  A  316
            A
Sbjct  252  A  252



>gb|KGM00140.1| Histone-lysine N-methyltransferase SMYD3, partial [Charadrius 
vociferus]
Length=255

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 47/128 (37%), Positives = 68/128 (53%), Gaps = 16/128 (13%)
 Frame = -3

Query  678  RDAI--VMY-KSIEELE---LRLFHAFSINLMRTRETL---LKMF-------MELQDWKE  547
            +DA+  V Y KS EE E    R  +  S N+ R  +T    LKM        + L+ W+E
Sbjct  116  KDAVNEVRYPKSKEEWEQVLARCQNLLSCNMGRLPDTNIYHLKMLDCAMDACINLESWEE  175

Query  546  ALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLLGESEEAFKSLSKAMDILRITHGT  367
            AL Y   T+  Y+  Y GFHPL  +Q    GKL++      +A ++L +A DI+++THGT
Sbjct  176  ALYYGSRTLGPYRLYYPGFHPLRAVQLMRVGKLQYSQDMFPQALETLKQAYDIMKVTHGT  235

Query  366  KSSFMKEL  343
              S M+ L
Sbjct  236  DHSLMQAL  243



>ref|XP_008638455.1| PREDICTED: LOW QUALITY PROTEIN: histone-lysine N-methyltransferase 
SMYD3 [Corvus brachyrhynchos]
Length=486

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 56/100 (56%), Gaps = 0/100 (0%)
 Frame = -3

Query  615  SINLMRTRETLLKMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLL  436
            +I  ++  +  +   + L+ W+EAL Y   T+  Y+  Y GFHPL  +Q    GKL++  
Sbjct  382  NIYQLKMLDCAMDACINLESWEEALYYGSRTLEPYRLYYPGFHPLRAVQLMRVGKLQYSQ  441

Query  435  GESEEAFKSLSKAMDILRITHGTKSSFMKELSFKLEEARA  316
            G   +A ++L +A +I+++THGT  S MK L    EE  A
Sbjct  442  GMFPQALETLKQAYNIMKVTHGTDHSLMKVLMEIKEECEA  481



>ref|XP_005796279.1| PREDICTED: histone-lysine N-methyltransferase SMYD3-like [Xiphophorus 
maculatus]
Length=435

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/99 (34%), Positives = 52/99 (53%), Gaps = 0/99 (0%)
 Frame = -3

Query  603  MRTRETLLKMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLLGESE  424
            +R  +  L   ++L  W+EAL Y   T+P Y+  Y   HP+ G+Q    GKL+  L   E
Sbjct  334  LRVTDMALDAAVQLGQWEEALRYGMKTLPAYRLFYPDPHPVHGVQLMRVGKLQHYLEHLE  393

Query  423  EAFKSLSKAMDILRITHGTKSSFMKELSFKLEEARAEVS  307
            +A  +  +A  I+R+THG       +L  K+EE   E+S
Sbjct  394  DALDTFKEAFTIMRMTHGDGHPLTSDLRMKMEECCLEMS  432



>ref|XP_010664254.1| PREDICTED: histone-lysine N-methyltransferase ASHR1 isoform X3 
[Vitis vinifera]
Length=433

 Score = 55.8 bits (133),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 50/65 (77%), Gaps = 1/65 (2%)
 Frame = -3

Query  759  KEEVMNLAGEIKsmseraslsssSGHKRDAIVMYKSIEELELRLFHAFSINLMRTRETLL  580
            KEE+  LA E+K +S++A++SSS  H  +A  +YK IE+L+ +LFH FSINLMRTRE +L
Sbjct  323  KEEIKRLASELKPLSDKATMSSS-SHYVEATSIYKMIEKLQTKLFHPFSINLMRTREAIL  381

Query  579  KMFME  565
            K F++
Sbjct  382  KEFIQ  386


 Score = 30.0 bits (66),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 30/50 (60%), Gaps = 0/50 (0%)
 Frame = -1

Query  515  FIREYIKDFIRCLDSSIILVENLNGCLEsrrkhssh*arRWIY*ELLMEQ  366
             ++E+I+D   CL  +II   NLNG L  +R  S+   R+ IY +LLM Q
Sbjct  380  ILKEFIQDSTLCLGCNIIRAGNLNGYLGKQRMLSNRSLRQQIYCKLLMVQ  429



>gb|KFV18406.1| Histone-lysine N-methyltransferase SMYD3, partial [Tauraco erythrolophus]
Length=158

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 33/100 (33%), Positives = 55/100 (55%), Gaps = 0/100 (0%)
 Frame = -3

Query  615  SINLMRTRETLLKMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLL  436
            +I  ++  +  +   + L+ W+EAL Y   T+  Y+  Y GFHPL  +Q    GKL++  
Sbjct  54   NIYQLKMLDCAMDACINLESWEEALYYGSRTLGPYRLYYPGFHPLRAVQLMRVGKLQYSQ  113

Query  435  GESEEAFKSLSKAMDILRITHGTKSSFMKELSFKLEEARA  316
                +A ++L +A +I+++THGT  S M+ L    EE  A
Sbjct  114  DMFPQALETLKQAYNIMKVTHGTDHSLMQALMEIKEECEA  153



>ref|XP_005416292.1| PREDICTED: histone-lysine N-methyltransferase SMYD3, partial 
[Geospiza fortis]
Length=374

 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 55/100 (55%), Gaps = 0/100 (0%)
 Frame = -3

Query  615  SINLMRTRETLLKMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLL  436
            +I  ++  +  +   + L+ W+EAL Y   T+  Y+  Y GFHPL  +Q    GKL++  
Sbjct  270  NIYQLKMLDCAMDACINLESWEEALYYGSRTLEPYRLYYPGFHPLRAVQLMRVGKLQYSQ  329

Query  435  GESEEAFKSLSKAMDILRITHGTKSSFMKELSFKLEEARA  316
            G   +A ++L +A +I+++THG   S MK L    EE  A
Sbjct  330  GMVPQALETLKQAYNIMKVTHGADHSLMKALMEIKEECEA  369



>ref|XP_005526931.1| PREDICTED: histone-lysine N-methyltransferase SMYD3 [Pseudopodoces 
humilis]
Length=428

 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 55/100 (55%), Gaps = 0/100 (0%)
 Frame = -3

Query  615  SINLMRTRETLLKMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLL  436
            +I  ++  +  +   + L+ W+EAL Y   T+  Y   Y GFHPL  +Q    GKL++  
Sbjct  324  NIYQLKMLDCAMDACINLESWEEALYYGSRTLEPYSLYYPGFHPLRAVQLMRVGKLQYSQ  383

Query  435  GESEEAFKSLSKAMDILRITHGTKSSFMKELSFKLEEARA  316
            G   +A ++L +A +I+++THGT  S MK L    EE  A
Sbjct  384  GMFPQALETLKQAYNIMKVTHGTDHSLMKVLMEIKEECDA  423



>ref|XP_010390163.1| PREDICTED: histone-lysine N-methyltransferase SMYD3 [Corvus cornix 
cornix]
Length=536

 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 56/100 (56%), Gaps = 0/100 (0%)
 Frame = -3

Query  615  SINLMRTRETLLKMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLL  436
            +I  ++  +  +   + L+ W+EAL Y   T+  Y+  Y GFHPL  +Q    GKL++  
Sbjct  432  NIYQLKMLDCAMDACINLESWEEALYYGSRTLEPYRLYYPGFHPLRAVQLMRVGKLQYSQ  491

Query  435  GESEEAFKSLSKAMDILRITHGTKSSFMKELSFKLEEARA  316
            G   +A ++L +A +I+++THGT  S MK L    EE  A
Sbjct  492  GMFPQALETLKQAYNIMKVTHGTDHSLMKVLMEIKEECEA  531



>gb|KFU94882.1| SET and MYND domain-containing protein 3, partial [Chaetura pelagica]
Length=257

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 52/91 (57%), Gaps = 0/91 (0%)
 Frame = -3

Query  615  SINLMRTRETLLKMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLL  436
            +I  ++  +  +   + L+ W+EAL Y   T+  Y+  Y GFHPL  LQ    GKL++  
Sbjct  153  NIYQLKMLDCAMDACINLEFWEEALHYGSRTLEPYRLYYPGFHPLRALQLMRVGKLQYSR  212

Query  435  GESEEAFKSLSKAMDILRITHGTKSSFMKEL  343
                +A ++L +A DI+++THGT  S M+ L
Sbjct  213  DMFPQALETLKQAYDIMKVTHGTDHSLMQAL  243



>ref|XP_011163573.1| PREDICTED: histone-lysine N-methyltransferase ASHR1-like [Solenopsis 
invicta]
Length=142

 Score = 60.5 bits (145),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 58/109 (53%), Gaps = 0/109 (0%)
 Frame = -3

Query  678  RDAIVMYKSIEELELRLFHAFSINLMRTRETLLKMFMELQDWKEALEYCRLTIPVYQRVY  499
             D + + K   E +  + H F+I  +RT E      M    W++A  Y +  +P Y+  +
Sbjct  18   NDKLSLSKKCLEKQKNVMHKFNIQHVRTLERAFITAMNELCWQDAEFYGKKLVPGYELYF  77

Query  498  QGFHPLLGLQYYTCGKLEWLLGESEEAFKSLSKAMDILRITHGTKSSFM  352
               HP  G+ Y   G  +  LG+S EA ++L+KA  +L+I++G K+SF+
Sbjct  78   GEVHPDTGMLYMHIGTAQRHLGKSNEALETLNKAKTVLKISYGEKNSFV  126



>ref|XP_009891966.1| PREDICTED: histone-lysine N-methyltransferase SMYD3 [Charadrius 
vociferus]
Length=442

 Score = 63.2 bits (152),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 47/128 (37%), Positives = 68/128 (53%), Gaps = 16/128 (13%)
 Frame = -3

Query  678  RDAI--VMY-KSIEELE---LRLFHAFSINLMRTRETL---LKMF-------MELQDWKE  547
            +DA+  V Y KS EE E    R  +  S N+ R  +T    LKM        + L+ W+E
Sbjct  301  KDAVNEVRYPKSKEEWEQVLARCQNLLSCNMGRLPDTNIYHLKMLDCAMDACINLESWEE  360

Query  546  ALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLLGESEEAFKSLSKAMDILRITHGT  367
            AL Y   T+  Y+  Y GFHPL  +Q    GKL++      +A ++L +A DI+++THGT
Sbjct  361  ALYYGSRTLGPYRLYYPGFHPLRAVQLMRVGKLQYSQDMFPQALETLKQAYDIMKVTHGT  420

Query  366  KSSFMKEL  343
              S M+ L
Sbjct  421  DHSLMQAL  428



>ref|XP_002109888.1| hypothetical protein TRIADDRAFT_53251 [Trichoplax adhaerens]
 gb|EDV28054.1| hypothetical protein TRIADDRAFT_53251 [Trichoplax adhaerens]
Length=448

 Score = 63.2 bits (152),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 34/88 (39%), Positives = 53/88 (60%), Gaps = 0/88 (0%)
 Frame = -3

Query  603  MRTRETLLKMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLLGESE  424
            +R  E L+  ++E Q ++EALEY R     Y R+Y  ++P+ G+     GKLE  LG+  
Sbjct  356  IRIIENLMDAYIESQRYEEALEYARRLEEPYCRLYPRYYPVTGVHLMKQGKLECYLGKFG  415

Query  423  EAFKSLSKAMDILRITHGTKSSFMKELS  340
            EA KSL KA +IL ++HG +   + E++
Sbjct  416  EAVKSLGKAKEILLVSHGKECGLIHEMN  443



>gb|KFW86090.1| Histone-lysine N-methyltransferase SMYD3, partial [Manacus vitellinus]
Length=257

 Score = 62.0 bits (149),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 56/102 (55%), Gaps = 0/102 (0%)
 Frame = -3

Query  615  SINLMRTRETLLKMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLL  436
            +I  ++  +  +   + L+ W+EAL Y   T+  Y+  Y GFHPL  +Q    GKL++  
Sbjct  153  NIYQLKMLDCAMDACINLESWEEALCYGLRTLEPYRLYYPGFHPLRAVQLLRVGKLQYSQ  212

Query  435  GESEEAFKSLSKAMDILRITHGTKSSFMKELSFKLEEARAEV  310
                +A ++L +A +I+++THGT  S MK L    EE  A V
Sbjct  213  DMFPQALETLKQAYNIMKVTHGTDHSLMKTLMEIKEECEAMV  254



>ref|XP_008492237.1| PREDICTED: histone-lysine N-methyltransferase SMYD3 [Calypte 
anna]
Length=446

 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 46/127 (36%), Positives = 64/127 (50%), Gaps = 13/127 (10%)
 Frame = -3

Query  657  KSIEELE---LRLFHAFSINLMRTRET---LLKMF-------MELQDWKEALEYCRLTIP  517
            KS EE E    R  +  S N+ R  +T    LKM        + L  W+EAL Y   T+ 
Sbjct  315  KSKEEWEQVLARCQNLLSSNVDRIPDTNIYQLKMLDCAMDACVNLGSWEEALYYGSRTLG  374

Query  516  VYQRVYQGFHPLLGLQYYTCGKLEWLLGESEEAFKSLSKAMDILRITHGTKSSFMKELSF  337
             Y+  Y GFHPL  +Q    GKL++      +A ++L +A DI+++THGT  S M+ L  
Sbjct  375  AYRLYYPGFHPLRAVQLMRVGKLQYNQAMFPQALETLKQAYDIMKVTHGTDHSLMQALMD  434

Query  336  KLEEARA  316
              EE  A
Sbjct  435  IKEECEA  441



>ref|XP_009840545.1| hypothetical protein H257_14434 [Aphanomyces astaci]
 gb|ETV70102.1| hypothetical protein H257_14434 [Aphanomyces astaci]
Length=439

 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 35/122 (29%), Positives = 65/122 (53%), Gaps = 1/122 (1%)
 Frame = -3

Query  672  AIVMYK-SIEELELRLFHAFSINLMRTRETLLKMFMELQDWKEALEYCRLTIPVYQRVYQ  496
            AI +Y+  ++  E  L + +++ ++     +L + +E+ +  +A++  R     Y+R+Y 
Sbjct  311  AIELYRRGLDAREKGLSNPWNVLILEVHSQMLTLHIEMGNGHDAVQTARAIYAFYKRLYH  370

Query  495  GFHPLLGLQYYTCGKLEWLLGESEEAFKSLSKAMDILRITHGTKSSFMKELSFKLEEARA  316
              HPL GL  YT G LE    +   A + L++A+ IL ITHG   + ++ L  ++ E R 
Sbjct  371  PNHPLTGLHLYTLGDLESQCHDDGGAVQHLNEALRILTITHGANHAMVQTLKARMNEFRP  430

Query  315  EV  310
             V
Sbjct  431  SV  432



>ref|XP_010002917.1| PREDICTED: histone-lysine N-methyltransferase SMYD3, partial 
[Chaetura pelagica]
Length=376

 Score = 62.4 bits (150),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 52/91 (57%), Gaps = 0/91 (0%)
 Frame = -3

Query  615  SINLMRTRETLLKMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLL  436
            +I  ++  +  +   + L+ W+EAL Y   T+  Y+  Y GFHPL  LQ    GKL++  
Sbjct  272  NIYQLKMLDCAMDACINLEFWEEALHYGSRTLEPYRLYYPGFHPLRALQLMRVGKLQYSR  331

Query  435  GESEEAFKSLSKAMDILRITHGTKSSFMKEL  343
                +A ++L +A DI+++THGT  S M+ L
Sbjct  332  DMFPQALETLKQAYDIMKVTHGTDHSLMQAL  362



>ref|XP_008928311.1| PREDICTED: histone-lysine N-methyltransferase SMYD3 [Manacus 
vitellinus]
Length=297

 Score = 62.0 bits (149),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 56/102 (55%), Gaps = 0/102 (0%)
 Frame = -3

Query  615  SINLMRTRETLLKMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLL  436
            +I  ++  +  +   + L+ W+EAL Y   T+  Y+  Y GFHPL  +Q    GKL++  
Sbjct  193  NIYQLKMLDCAMDACINLESWEEALCYGLRTLEPYRLYYPGFHPLRAVQLLRVGKLQYSQ  252

Query  435  GESEEAFKSLSKAMDILRITHGTKSSFMKELSFKLEEARAEV  310
                +A ++L +A +I+++THGT  S MK L    EE  A V
Sbjct  253  DMFPQALETLKQAYNIMKVTHGTDHSLMKTLMEIKEECEAMV  294



>ref|XP_006626128.1| PREDICTED: histone-lysine N-methyltransferase SMYD3-like [Lepisosteus 
oculatus]
Length=428

 Score = 62.4 bits (150),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 57/103 (55%), Gaps = 0/103 (0%)
 Frame = -3

Query  615  SINLMRTRETLLKMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLL  436
            +I L++  +  +   + L+ W +AL +   T+  Y+  YQGFHP LG+Q    GKL++ +
Sbjct  323  NIYLLKMLDYTMDACINLRKWDKALFFGTRTLQPYRMYYQGFHPALGVQLMRLGKLQYYM  382

Query  435  GESEEAFKSLSKAMDILRITHGTKSSFMKELSFKLEEARAEVS  307
                EA  +L +A +++++THG       +L   L E +AE+ 
Sbjct  383  ERFCEALDTLKQAYEVMKVTHGVDHPLTTDLQQMLGECQAEMD  425



>ref|XP_011212036.1| PREDICTED: histone-lysine N-methyltransferase SMYD3 [Bactrocera 
dorsalis]
 ref|XP_011212037.1| PREDICTED: histone-lysine N-methyltransferase SMYD3 [Bactrocera 
dorsalis]
Length=490

 Score = 62.4 bits (150),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 61/105 (58%), Gaps = 1/105 (1%)
 Frame = -3

Query  624  HAFSINLMRTRETLLKMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLE  445
            H  ++  ++T +   +  +++  W+EALE+ +  +P +++ Y  +HPLLG+ +   GK++
Sbjct  384  HPLNVWHLKTLDAAFEAAIDVSKWEEALEFGKELVPGFRKYYGDWHPLLGMLHLKIGKIQ  443

Query  444  WLLGESEEAFKSLSKAMDILRITHGTKSSFMKE-LSFKLEEARAE  313
                +  EA  +L +A  IL+ITHG   S ++E L   L +A AE
Sbjct  444  LYKCQLTEAINNLKEAQKILQITHGHDHSLLREQLKLMLAQALAE  488



>ref|XP_003490836.1| PREDICTED: SET and MYND domain-containing protein 3-like [Bombus 
impatiens]
Length=439

 Score = 62.0 bits (149),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 34/95 (36%), Positives = 51/95 (54%), Gaps = 0/95 (0%)
 Frame = -3

Query  630  LFHAFSINLMRTRETLLKMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGK  451
            + H  ++  ++T +T     + LQ W+EA  Y +  I  Y   Y   HP  G+ Y + GK
Sbjct  328  ILHPLNVQYVQTLQTAFDSSINLQHWEEAESYAKKLINGYLTYYGEIHPSTGILYLSIGK  387

Query  450  LEWLLGESEEAFKSLSKAMDILRITHGTKSSFMKE  346
            LE  L + ++A K+L KA  IL ITHG + S + E
Sbjct  388  LEVYLKKLKQAIKTLRKASSILTITHGAQHSVIVE  422



>ref|XP_009506851.1| PREDICTED: histone-lysine N-methyltransferase SMYD3 [Phalacrocorax 
carbo]
Length=269

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 49/137 (36%), Positives = 71/137 (52%), Gaps = 16/137 (12%)
 Frame = -3

Query  678  RDAI--VMY-KSIEELE---LRLFHAFSINLMRTRET---LLKMF-------MELQDWKE  547
            RDA+  V Y KS EE E    R  +  S N+ R  +T    LKM        + L+ W+E
Sbjct  128  RDAVNKVRYPKSKEEWEQVLARCQNLLSSNMGRLPDTNIYQLKMLDCAMDACINLESWEE  187

Query  546  ALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLLGESEEAFKSLSKAMDILRITHGT  367
            AL Y   T+  Y+  Y GFHPL  +Q    GKL++      +A ++L +A +I+++THGT
Sbjct  188  ALYYGSRTLGPYRLYYPGFHPLRAVQLMRVGKLQYSQDMFPQALETLKQAYNIMKVTHGT  247

Query  366  KSSFMKELSFKLEEARA  316
              S ++ L    EE  A
Sbjct  248  DHSLVQALMEIKEECEA  264



>gb|KFV67688.1| Histone-lysine N-methyltransferase SMYD3, partial [Picoides pubescens]
Length=256

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 46/128 (36%), Positives = 69/128 (54%), Gaps = 16/128 (13%)
 Frame = -3

Query  678  RDAI--VMY-KSIEELE---LRLFHAFSINLMRTRET---LLKMF-------MELQDWKE  547
            +DA+  V Y KS EE E    R  +  S N+ R  +T    LKM        + L+ W+E
Sbjct  115  KDAVNEVRYPKSKEEWEQVLTRCQNLLSSNMGRLPDTNIYQLKMLDYAMDACINLESWEE  174

Query  546  ALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLLGESEEAFKSLSKAMDILRITHGT  367
            AL Y   T+  Y+  Y GFHPL  +Q    GKL++      +A ++L +A +I+++THGT
Sbjct  175  ALYYGSKTLEPYRLYYPGFHPLRAVQLMRVGKLQYSQDMFPQALETLKQAYNIMKVTHGT  234

Query  366  KSSFMKEL  343
            + S M+ L
Sbjct  235  EHSLMQAL  242



>gb|KFQ82155.1| Histone-lysine N-methyltransferase SMYD3, partial [Phaethon lepturus]
Length=257

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 38/112 (34%), Positives = 60/112 (54%), Gaps = 10/112 (9%)
 Frame = -3

Query  648  EELELRLFHAFSINLMRTRET---LLKMF-------MELQDWKEALEYCRLTIPVYQRVY  499
            E++  R  +  S N+ R  +T    LKM        + L+ W+EAL Y   T+  Y+  Y
Sbjct  132  EQVLARCQNLLSNNMHRLPDTNIYQLKMLDCAMDACINLESWEEALYYGSRTLGPYRLYY  191

Query  498  QGFHPLLGLQYYTCGKLEWLLGESEEAFKSLSKAMDILRITHGTKSSFMKEL  343
             GFHPL  +Q    GKL++      +A ++L +A +I+++THGT  S M+ L
Sbjct  192  PGFHPLRAVQLMRVGKLQYSQDMFPQALETLKQAYNIMKVTHGTDHSLMQAL  243



>ref|XP_010705249.1| PREDICTED: histone-lysine N-methyltransferase SMYD3-like [Meleagris 
gallopavo]
Length=242

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/91 (33%), Positives = 52/91 (57%), Gaps = 0/91 (0%)
 Frame = -3

Query  615  SINLMRTRETLLKMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLL  436
            +I  ++  +  +   + L+ W++AL Y   T+  Y+  Y  FHPL  +Q    GKL++  
Sbjct  138  NIYQLKLLDCAMDACINLEAWEQALCYGSRTLGPYRLYYPNFHPLRAVQLMRVGKLQYSQ  197

Query  435  GESEEAFKSLSKAMDILRITHGTKSSFMKEL  343
            G   +A ++L +A DI+++THGT  S M+ L
Sbjct  198  GMLPQALETLKQAYDIMKVTHGTDHSLMQAL  228



>ref|XP_010292649.1| PREDICTED: histone-lysine N-methyltransferase SMYD3 [Phaethon 
lepturus]
Length=269

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 38/112 (34%), Positives = 60/112 (54%), Gaps = 10/112 (9%)
 Frame = -3

Query  648  EELELRLFHAFSINLMRTRET---LLKMF-------MELQDWKEALEYCRLTIPVYQRVY  499
            E++  R  +  S N+ R  +T    LKM        + L+ W+EAL Y   T+  Y+  Y
Sbjct  144  EQVLARCQNLLSNNMHRLPDTNIYQLKMLDCAMDACINLESWEEALYYGSRTLGPYRLYY  203

Query  498  QGFHPLLGLQYYTCGKLEWLLGESEEAFKSLSKAMDILRITHGTKSSFMKEL  343
             GFHPL  +Q    GKL++      +A ++L +A +I+++THGT  S M+ L
Sbjct  204  PGFHPLRAVQLMRVGKLQYSQDMFPQALETLKQAYNIMKVTHGTDHSLMQAL  255



>ref|XP_009899229.1| PREDICTED: LOW QUALITY PROTEIN: histone-lysine N-methyltransferase 
SMYD3 [Picoides pubescens]
Length=425

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 46/128 (36%), Positives = 69/128 (54%), Gaps = 16/128 (13%)
 Frame = -3

Query  678  RDAI--VMY-KSIEELE---LRLFHAFSINLMRTRET---LLKMF-------MELQDWKE  547
            +DA+  V Y KS EE E    R  +  S N+ R  +T    LKM        + L+ W+E
Sbjct  284  KDAVNEVRYPKSKEEWEQVLTRCQNLLSSNMGRLPDTNIYQLKMLDYAMDACINLESWEE  343

Query  546  ALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLLGESEEAFKSLSKAMDILRITHGT  367
            AL Y   T+  Y+  Y GFHPL  +Q    GKL++      +A ++L +A +I+++THGT
Sbjct  344  ALYYGSKTLEPYRLYYPGFHPLRAVQLMRVGKLQYSQDMFPQALETLKQAYNIMKVTHGT  403

Query  366  KSSFMKEL  343
            + S M+ L
Sbjct  404  EHSLMQAL  411



>ref|XP_011419033.1| PREDICTED: histone-lysine N-methyltransferase SMYD3-like [Crassostrea 
gigas]
Length=455

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/113 (33%), Positives = 59/113 (52%), Gaps = 4/113 (4%)
 Frame = -3

Query  630  LFHAFSINLMRTRETLLKMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGK  451
            + H  +++ ++  + LL   ++LQ W +AL Y   T+P Y++ Y    P LG+Q    GK
Sbjct  341  ILHPLNLSCVQILDCLLDASVDLQLWDKALMYGSETLPAYRKYYPPNSPNLGIQLLKLGK  400

Query  450  LEWLLGESEEAFKSLSKAMDILRITHGTK----SSFMKELSFKLEEARAEVSY  304
            +   L   +EA K L +A DIL +THG      S  ++ L    EE R E+ +
Sbjct  401  IHLYLHNLKEALKLLQQARDILLVTHGRDHVLYSQLLELLYQTQEEMRTELEF  453



>ref|XP_007422322.1| PREDICTED: histone-lysine N-methyltransferase SMYD3 [Python bivittatus]
Length=423

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/84 (37%), Positives = 50/84 (60%), Gaps = 0/84 (0%)
 Frame = -3

Query  552  KEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLLGESEEAFKSLSKAMDILRITH  373
            +EAL Y   T+  Y+  Y GFHPL  +Q    GKL++      +A ++L +A DI+++TH
Sbjct  340  EEALHYGNRTLEPYRFYYSGFHPLRAIQMMRVGKLQYSQDMFSQALETLKQAHDIMKVTH  399

Query  372  GTKSSFMKELSFKLEEARAEVSYK  301
            GT+ S M++L    E+  A + +K
Sbjct  400  GTEHSLMQDLMMLKEDCEAGMPFK  423



>ref|XP_005146080.1| PREDICTED: histone-lysine N-methyltransferase SMYD3 [Melopsittacus 
undulatus]
Length=428

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/91 (33%), Positives = 51/91 (56%), Gaps = 0/91 (0%)
 Frame = -3

Query  615  SINLMRTRETLLKMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLL  436
            +I  ++  +  +   + L+ W+EAL Y   T+  Y   Y GFHPL  +Q    GKL++  
Sbjct  324  NIYQLKMLDCAMDACINLESWEEALSYGSRTLGPYSLYYPGFHPLRAVQLMRVGKLQYSQ  383

Query  435  GESEEAFKSLSKAMDILRITHGTKSSFMKEL  343
                +A ++L +A +I+++THGT  S M+ L
Sbjct  384  DMFPQALETLKQAYNIMKVTHGTDHSLMQAL  414



>gb|KFR16655.1| Histone-lysine N-methyltransferase SMYD3, partial [Opisthocomus 
hoazin]
Length=257

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 55/100 (55%), Gaps = 0/100 (0%)
 Frame = -3

Query  615  SINLMRTRETLLKMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLL  436
            +I  ++  +  +   + L+ W+EAL Y   T+  Y+  Y GFHPL  +Q    GKL++  
Sbjct  153  NIYQLKMLDCAMDACINLESWEEALYYGSRTLGPYRLYYPGFHPLRAVQLMRVGKLQYSQ  212

Query  435  GESEEAFKSLSKAMDILRITHGTKSSFMKELSFKLEEARA  316
                +A ++L +A +I+++THGT  S M+ L    E+  A
Sbjct  213  DMFPQALETLKQAYNIMKVTHGTDHSLMQALMEMKEQCEA  252



>ref|XP_008184392.1| PREDICTED: histone-lysine N-methyltransferase SMYD3 [Acyrthosiphon 
pisum]
 ref|XP_008184393.1| PREDICTED: histone-lysine N-methyltransferase SMYD3 [Acyrthosiphon 
pisum]
 ref|XP_008184395.1| PREDICTED: histone-lysine N-methyltransferase SMYD3 [Acyrthosiphon 
pisum]
 ref|XP_008184396.1| PREDICTED: histone-lysine N-methyltransferase SMYD3 [Acyrthosiphon 
pisum]
 ref|XP_008184397.1| PREDICTED: histone-lysine N-methyltransferase SMYD3 [Acyrthosiphon 
pisum]
Length=455

 Score = 60.8 bits (146),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/87 (37%), Positives = 51/87 (59%), Gaps = 0/87 (0%)
 Frame = -3

Query  630  LFHAFSINLMRTRETLLKMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGK  451
            +FH  +IN ++  +   +  ++++ WKE+L+Y  L I  Y+  Y  +HP LG+ Y    K
Sbjct  348  IFHPNNINRVKILDLAFESAIKMEQWKESLKYGILLIDGYRVYYNEWHPSLGVLYMKLFK  407

Query  450  LEWLLGESEEAFKSLSKAMDILRITHG  370
            L  ++  SE A K L K M IL++THG
Sbjct  408  LCSIVENSESAVKYLKKGMSILKVTHG  434



>ref|XP_009319544.1| PREDICTED: histone-lysine N-methyltransferase SMYD3 [Pygoscelis 
adeliae]
Length=439

 Score = 60.8 bits (146),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 46/128 (36%), Positives = 68/128 (53%), Gaps = 16/128 (13%)
 Frame = -3

Query  678  RDAI--VMY-KSIEELE---LRLFHAFSINLMRTRET---LLKMF-------MELQDWKE  547
            +DA+  V Y KS EE E    R  +  S N+ R  +T    LKM        + L+ W+E
Sbjct  298  KDAVNEVRYPKSKEEWEQVLARCQNLLSGNMGRLPDTNIYQLKMLDCAMDACINLESWEE  357

Query  546  ALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLLGESEEAFKSLSKAMDILRITHGT  367
            AL Y   T+  Y+  Y GFHPL  +Q    GKL++      +A ++L +A +I+++THGT
Sbjct  358  ALYYGSRTLGPYRMYYPGFHPLRAVQLMRVGKLQYSQDMFPQALETLKQAYNIMKVTHGT  417

Query  366  KSSFMKEL  343
              S M+ L
Sbjct  418  DHSLMQAL  425



>ref|XP_003394366.1| PREDICTED: SET and MYND domain-containing protein 3-like [Bombus 
terrestris]
Length=439

 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 34/95 (36%), Positives = 51/95 (54%), Gaps = 0/95 (0%)
 Frame = -3

Query  630  LFHAFSINLMRTRETLLKMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGK  451
            + H  ++  ++T +T     + LQ W+EA  Y +  I  Y   Y   HP  G+ Y + GK
Sbjct  328  ILHPLNVQYVQTLQTAFDSSINLQHWEEAESYAKKLINGYLAYYGEIHPSTGILYLSIGK  387

Query  450  LEWLLGESEEAFKSLSKAMDILRITHGTKSSFMKE  346
            LE  L + ++A K+L KA  IL ITHG + S + E
Sbjct  388  LEVYLKKLKQAIKTLRKASLILTITHGAQHSVIVE  422



>ref|XP_005508782.1| PREDICTED: histone-lysine N-methyltransferase SMYD3 [Columba 
livia]
Length=475

 Score = 60.5 bits (145),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 29/83 (35%), Positives = 48/83 (58%), Gaps = 0/83 (0%)
 Frame = -3

Query  591  ETLLKMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLLGESEEAFK  412
            +  +   + L+ W+EAL Y   T+  Y+  Y GFHPL  +Q    GKL++      +A +
Sbjct  379  DCAMDACINLESWEEALYYGNRTLEPYRLYYPGFHPLRAVQLMRVGKLQYSQDMFPQALE  438

Query  411  SLSKAMDILRITHGTKSSFMKEL  343
            +L +A +I+++THGT  S M+ L
Sbjct  439  TLKQAYNIMKVTHGTDHSLMQAL  461



>ref|XP_009940480.1| PREDICTED: histone-lysine N-methyltransferase SMYD3 [Opisthocomus 
hoazin]
Length=346

 Score = 59.7 bits (143),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 30/91 (33%), Positives = 52/91 (57%), Gaps = 0/91 (0%)
 Frame = -3

Query  615  SINLMRTRETLLKMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLL  436
            +I  ++  +  +   + L+ W+EAL Y   T+  Y+  Y GFHPL  +Q    GKL++  
Sbjct  242  NIYQLKMLDCAMDACINLESWEEALYYGSRTLGPYRLYYPGFHPLRAVQLMRVGKLQYSQ  301

Query  435  GESEEAFKSLSKAMDILRITHGTKSSFMKEL  343
                +A ++L +A +I+++THGT  S M+ L
Sbjct  302  DMFPQALETLKQAYNIMKVTHGTDHSLMQAL  332



>ref|XP_009461995.1| PREDICTED: histone-lysine N-methyltransferase SMYD3 [Nipponia 
nippon]
Length=428

 Score = 60.1 bits (144),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 30/91 (33%), Positives = 52/91 (57%), Gaps = 0/91 (0%)
 Frame = -3

Query  615  SINLMRTRETLLKMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLL  436
            +I  ++  +  +   + L+ W+EAL Y   T+  Y+  Y GFHPL  +Q    GKL++  
Sbjct  324  NIYQLKMLDCAMDACINLESWEEALYYGSRTLGPYRLYYPGFHPLRAVQLMRVGKLQYSQ  383

Query  435  GESEEAFKSLSKAMDILRITHGTKSSFMKEL  343
                +A ++L +A +I+++THGT  S M+ L
Sbjct  384  DMFPQALETLKQAYNIMKVTHGTDHSLMQAL  414



>ref|XP_008908858.1| hypothetical protein, variant 1 [Phytophthora parasitica INRA-310]
 gb|ETI42352.1| hypothetical protein, variant 1 [Phytophthora parasitica P1569]
 gb|ETL88992.1| hypothetical protein, variant 1 [Phytophthora parasitica]
 gb|ETM42231.1| hypothetical protein, variant 1 [Phytophthora parasitica]
 gb|ETN05794.1| hypothetical protein, variant 1 [Phytophthora parasitica INRA-310]
 gb|ETP12078.1| hypothetical protein, variant 1 [Phytophthora parasitica CJ01A1]
 gb|ETP40196.1| hypothetical protein, variant 1 [Phytophthora parasitica P10297]
Length=478

 Score = 60.1 bits (144),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 44/131 (34%), Positives = 64/131 (49%), Gaps = 8/131 (6%)
 Frame = -3

Query  684  HKRDAIVMYKSIEELELRLFHAFSINLMRTRETLLKMFMELQDWKEALEYCRLTIPVYQR  505
             ++  I   + + E +  + H  SI  ++T  TL    ME    +EA+ Y    +  Y+R
Sbjct  348  QQQQCIDALQKLAEQQSIILHHDSIARLQTLATLFSAEMERGSVEEAIGYGERMLEFYRR  407

Query  504  VYQGFHPLLGLQYYTCGKL-----EWLLGESEEAFKS---LSKAMDILRITHGTKSSFMK  349
            VY   HP+ GL  +T G L     +   G  E   KS   L++A  ILRITHG    F+K
Sbjct  408  VYNSNHPMTGLHLFTLGDLYGQQAQAGTGAEESKQKSLEYLTEAQRILRITHGKDHRFVK  467

Query  348  ELSFKLEEARA  316
             LS +LE+  A
Sbjct  468  MLSDRLEKVSA  478



>ref|XP_009910221.1| PREDICTED: histone-lysine N-methyltransferase SMYD3 [Haliaeetus 
albicilla]
Length=269

 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 62/119 (52%), Gaps = 2/119 (2%)
 Frame = -3

Query  666  VMYKSIEELELRLFHAFSINLMRTR--ETLLKMFMELQDWKEALEYCRLTIPVYQRVYQG  493
            V+ +  + L   + H    N+ + +  +  +   + L+ W+EAL Y   T+  Y+  Y G
Sbjct  146  VLARCQDLLSSNMGHLPDTNIYQLKMLDCAMDACINLECWEEALYYGSRTLGPYRLYYPG  205

Query  492  FHPLLGLQYYTCGKLEWLLGESEEAFKSLSKAMDILRITHGTKSSFMKELSFKLEEARA  316
            FHPL  +Q    GKL++      +A ++L +A +I+++THGT  S M+ L    E+  A
Sbjct  206  FHPLRAVQLMRVGKLQYSQDMFPQALETLKQAYNIMKVTHGTDHSLMQALVEIKEQCEA  264



>gb|KFP98686.1| Histone-lysine N-methyltransferase SMYD3, partial [Haliaeetus 
albicilla]
Length=257

 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 62/119 (52%), Gaps = 2/119 (2%)
 Frame = -3

Query  666  VMYKSIEELELRLFHAFSINL--MRTRETLLKMFMELQDWKEALEYCRLTIPVYQRVYQG  493
            V+ +  + L   + H    N+  ++  +  +   + L+ W+EAL Y   T+  Y+  Y G
Sbjct  134  VLARCQDLLSSNMGHLPDTNIYQLKMLDCAMDACINLECWEEALYYGSRTLGPYRLYYPG  193

Query  492  FHPLLGLQYYTCGKLEWLLGESEEAFKSLSKAMDILRITHGTKSSFMKELSFKLEEARA  316
            FHPL  +Q    GKL++      +A ++L +A +I+++THGT  S M+ L    E+  A
Sbjct  194  FHPLRAVQLMRVGKLQYSQDMFPQALETLKQAYNIMKVTHGTDHSLMQALVEIKEQCEA  252



>ref|XP_011573182.1| PREDICTED: histone-lysine N-methyltransferase SMYD3 [Aquila chrysaetos 
canadensis]
Length=428

 Score = 59.7 bits (143),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 46/128 (36%), Positives = 67/128 (52%), Gaps = 16/128 (13%)
 Frame = -3

Query  678  RDAI--VMY-KSIEELE---LRLFHAFSINLMRTRET---LLKMF-------MELQDWKE  547
            +DA+  V Y KS EE E    R  +  S N+ R  +T    LKM        + L+ W+E
Sbjct  287  KDAVNEVRYPKSKEEWEQVLARCQNLLSSNMGRLPDTNIYQLKMLDCAMDACINLESWEE  346

Query  546  ALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLLGESEEAFKSLSKAMDILRITHGT  367
            AL Y   T+  Y   Y GFHPL  +Q    GKL++      +A ++L +A +I+++THGT
Sbjct  347  ALYYGSRTLGPYGLYYPGFHPLRAVQLMRVGKLQYSQDMFPQALETLKQAYNIMKVTHGT  406

Query  366  KSSFMKEL  343
              S M+ L
Sbjct  407  DHSLMQAL  414



>ref|XP_008908860.1| hypothetical protein, variant 3 [Phytophthora parasitica INRA-310]
 gb|ETI42354.1| hypothetical protein, variant 3 [Phytophthora parasitica P1569]
 gb|ETL88994.1| hypothetical protein, variant 3 [Phytophthora parasitica]
 gb|ETM42233.1| hypothetical protein, variant 3 [Phytophthora parasitica]
 gb|ETN05796.1| hypothetical protein, variant 3 [Phytophthora parasitica INRA-310]
 gb|ETP12080.1| hypothetical protein, variant 3 [Phytophthora parasitica CJ01A1]
 gb|ETP40198.1| hypothetical protein, variant 3 [Phytophthora parasitica P10297]
Length=454

 Score = 59.7 bits (143),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 44/131 (34%), Positives = 64/131 (49%), Gaps = 8/131 (6%)
 Frame = -3

Query  684  HKRDAIVMYKSIEELELRLFHAFSINLMRTRETLLKMFMELQDWKEALEYCRLTIPVYQR  505
             ++  I   + + E +  + H  SI  ++T  TL    ME    +EA+ Y    +  Y+R
Sbjct  324  QQQQCIDALQKLAEQQSIILHHDSIARLQTLATLFSAEMERGSVEEAIGYGERMLEFYRR  383

Query  504  VYQGFHPLLGLQYYTCGKL-----EWLLGESEEAFKS---LSKAMDILRITHGTKSSFMK  349
            VY   HP+ GL  +T G L     +   G  E   KS   L++A  ILRITHG    F+K
Sbjct  384  VYNSNHPMTGLHLFTLGDLYGQQAQAGTGAEESKQKSLEYLTEAQRILRITHGKDHRFVK  443

Query  348  ELSFKLEEARA  316
             LS +LE+  A
Sbjct  444  MLSDRLEKVSA  454



>gb|KFW93105.1| Histone-lysine N-methyltransferase SMYD3, partial [Phalacrocorax 
carbo]
Length=260

 Score = 58.9 bits (141),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 50/140 (36%), Positives = 71/140 (51%), Gaps = 19/140 (14%)
 Frame = -3

Query  678  RDAI--VMY-KSIEELE---LRLFHAFSINLMRTRET---LLKMF-------MELQDWKE  547
            RDA+  V Y KS EE E    R  +  S N+ R  +T    LKM        + L+ W+E
Sbjct  116  RDAVNKVRYPKSKEEWEQVLARCQNLLSSNMGRLPDTNIYQLKMLDCAMDACINLESWEE  175

Query  546  ALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEW---LLGESEEAFKSLSKAMDILRIT  376
            AL Y   T+  Y+  Y GFHPL  +Q    GKL++   +  ++ E  K  S A +I+++T
Sbjct  176  ALYYGSRTLGPYRLYYPGFHPLRAVQLMRVGKLQYSQDMFPQALETLKQASIAYNIMKVT  235

Query  375  HGTKSSFMKELSFKLEEARA  316
            HGT  S ++ L    EE  A
Sbjct  236  HGTDHSLVQALMEIKEECEA  255



>ref|XP_008908857.1| hypothetical protein PPTG_13178 [Phytophthora parasitica INRA-310]
 gb|ETI42351.1| hypothetical protein F443_12521 [Phytophthora parasitica P1569]
 gb|ETL88991.1| hypothetical protein L917_12000 [Phytophthora parasitica]
 gb|ETM42230.1| hypothetical protein L914_12087 [Phytophthora parasitica]
 gb|ETN05793.1| hypothetical protein PPTG_13178 [Phytophthora parasitica INRA-310]
 gb|ETP12077.1| hypothetical protein F441_12488 [Phytophthora parasitica CJ01A1]
 gb|ETP40195.1| hypothetical protein F442_12433 [Phytophthora parasitica P10297]
Length=501

 Score = 59.7 bits (143),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 44/131 (34%), Positives = 64/131 (49%), Gaps = 8/131 (6%)
 Frame = -3

Query  684  HKRDAIVMYKSIEELELRLFHAFSINLMRTRETLLKMFMELQDWKEALEYCRLTIPVYQR  505
             ++  I   + + E +  + H  SI  ++T  TL    ME    +EA+ Y    +  Y+R
Sbjct  371  QQQQCIDALQKLAEQQSIILHHDSIARLQTLATLFSAEMERGSVEEAIGYGERMLEFYRR  430

Query  504  VYQGFHPLLGLQYYTCGKL-----EWLLGESEEAFKS---LSKAMDILRITHGTKSSFMK  349
            VY   HP+ GL  +T G L     +   G  E   KS   L++A  ILRITHG    F+K
Sbjct  431  VYNSNHPMTGLHLFTLGDLYGQQAQAGTGAEESKQKSLEYLTEAQRILRITHGKDHRFVK  490

Query  348  ELSFKLEEARA  316
             LS +LE+  A
Sbjct  491  MLSDRLEKVSA  501



>ref|XP_008908859.1| hypothetical protein, variant 2 [Phytophthora parasitica INRA-310]
 gb|ETI42353.1| hypothetical protein, variant 2 [Phytophthora parasitica P1569]
 gb|ETL88993.1| hypothetical protein, variant 2 [Phytophthora parasitica]
 gb|ETM42232.1| hypothetical protein, variant 2 [Phytophthora parasitica]
 gb|ETN05795.1| hypothetical protein, variant 2 [Phytophthora parasitica INRA-310]
 gb|ETP12079.1| hypothetical protein, variant 2 [Phytophthora parasitica CJ01A1]
 gb|ETP40197.1| hypothetical protein, variant 2 [Phytophthora parasitica P10297]
Length=477

 Score = 59.7 bits (143),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 44/131 (34%), Positives = 64/131 (49%), Gaps = 8/131 (6%)
 Frame = -3

Query  684  HKRDAIVMYKSIEELELRLFHAFSINLMRTRETLLKMFMELQDWKEALEYCRLTIPVYQR  505
             ++  I   + + E +  + H  SI  ++T  TL    ME    +EA+ Y    +  Y+R
Sbjct  347  QQQQCIDALQKLAEQQSIILHHDSIARLQTLATLFSAEMERGSVEEAIGYGERMLEFYRR  406

Query  504  VYQGFHPLLGLQYYTCGKL-----EWLLGESEEAFKS---LSKAMDILRITHGTKSSFMK  349
            VY   HP+ GL  +T G L     +   G  E   KS   L++A  ILRITHG    F+K
Sbjct  407  VYNSNHPMTGLHLFTLGDLYGQQAQAGTGAEESKQKSLEYLTEAQRILRITHGKDHRFVK  466

Query  348  ELSFKLEEARA  316
             LS +LE+  A
Sbjct  467  MLSDRLEKVSA  477



>ref|XP_009643004.1| PREDICTED: histone-lysine N-methyltransferase SMYD3 [Egretta 
garzetta]
Length=490

 Score = 59.7 bits (143),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 38/112 (34%), Positives = 59/112 (53%), Gaps = 10/112 (9%)
 Frame = -3

Query  648  EELELRLFHAFSINLMRTRET---LLKMF-------MELQDWKEALEYCRLTIPVYQRVY  499
            E++  R  +  S N+ R  +T    LKM        + L+ W+EAL Y   T+  Y   Y
Sbjct  365  EQVLARCQNLLSSNMGRLPDTNIYQLKMLDCAMDACINLESWEEALYYGSKTLGPYSLYY  424

Query  498  QGFHPLLGLQYYTCGKLEWLLGESEEAFKSLSKAMDILRITHGTKSSFMKEL  343
             GFHPL  +Q    GKL++      +A ++L +A +I+++THGT  S M+ L
Sbjct  425  PGFHPLRAVQLMRVGKLQYSQDMFPQALETLKQAYNIMKVTHGTDHSLMQAL  476



>gb|KDR23505.1| SET and MYND domain-containing protein 3 [Zootermopsis nevadensis]
Length=448

 Score = 59.7 bits (143),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 54/95 (57%), Gaps = 0/95 (0%)
 Frame = -3

Query  630  LFHAFSINLMRTRETLLKMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGK  451
            LFH+  I  ++  +   +  +++  W++A+E+ +  I  Y++ Y  +HPLLG+ Y   GK
Sbjct  338  LFHSLDILHVKVLDLAFESSIQIGQWEQAVEFGQELIAGYEKYYGEYHPLLGIHYLKLGK  397

Query  450  LEWLLGESEEAFKSLSKAMDILRITHGTKSSFMKE  346
            +   L +  EA  +L  A  ++R+THG + +  ++
Sbjct  398  INLYLKKFNEALNTLKNAEIVIRVTHGDRHALYRD  432



>gb|KFP20822.1| Histone-lysine N-methyltransferase SMYD3, partial [Egretta garzetta]
Length=260

 Score = 58.9 bits (141),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 39/115 (34%), Positives = 59/115 (51%), Gaps = 13/115 (11%)
 Frame = -3

Query  648  EELELRLFHAFSINLMRTRET---LLKMF-------MELQDWKEALEYCRLTIPVYQRVY  499
            E++  R  +  S N+ R  +T    LKM        + L+ W+EAL Y   T+  Y   Y
Sbjct  132  EQVLARCQNLLSSNMGRLPDTNIYQLKMLDCAMDACINLESWEEALYYGSKTLGPYSLYY  191

Query  498  QGFHPLLGLQYYTCGKLEW---LLGESEEAFKSLSKAMDILRITHGTKSSFMKEL  343
             GFHPL  +Q    GKL++   +  ++ E  K  S A +I+++THGT  S M+ L
Sbjct  192  PGFHPLRAVQLMRVGKLQYSQDMFPQALETLKQASTAYNIMKVTHGTDHSLMQAL  246



>gb|ETK82361.1| hypothetical protein, variant 1 [Phytophthora parasitica]
 gb|ETL35753.1| hypothetical protein, variant 1 [Phytophthora parasitica]
Length=478

 Score = 59.7 bits (143),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 44/131 (34%), Positives = 64/131 (49%), Gaps = 8/131 (6%)
 Frame = -3

Query  684  HKRDAIVMYKSIEELELRLFHAFSINLMRTRETLLKMFMELQDWKEALEYCRLTIPVYQR  505
             ++  I   + + E +  + H  SI  ++T  TL    ME    +EA+ Y    +  Y+R
Sbjct  348  QQQQCIDALQKLAEQQSIILHHDSIARLQTLATLFSAEMERGSVEEAIGYGERMLEFYRR  407

Query  504  VYQGFHPLLGLQYYTCGKL-----EWLLGESEEAFKS---LSKAMDILRITHGTKSSFMK  349
            VY   HP+ GL  +T G L     +   G  E   KS   L++A  ILRITHG    F+K
Sbjct  408  VYNSNHPMTGLHLFTLGDLYGQQAQAGTGAEESKQKSLEYLTEAQRILRITHGKGHRFVK  467

Query  348  ELSFKLEEARA  316
             LS +LE+  A
Sbjct  468  MLSDRLEKVSA  478



>ref|XP_002100247.1| GE16937 [Drosophila yakuba]
 gb|EDX01355.1| GE16937 [Drosophila yakuba]
Length=469

 Score = 59.7 bits (143),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 62/110 (56%), Gaps = 1/110 (1%)
 Frame = -3

Query  630  LFHAFSINLMRTRETLLKMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGK  451
            +FH  ++  ++T +   +  +E+  W +AL+Y +  +P +++ +  ++PLLGL +   GK
Sbjct  360  VFHPLNVWYVKTLDAAFEAAIEVGKWTDALDYGQRLLPGFRKYHGPWNPLLGLLHMKLGK  419

Query  450  LEWLLGESEEAFKSLSKAMDILRITHGTKSSFMKE-LSFKLEEARAEVSY  304
            ++   G S+EA   L +A  IL +THG     + E L   + +AR E ++
Sbjct  420  IQLYEGRSKEALHHLEEAQRILTVTHGRDHRLLTEQLYVLILQARQEAAH  469



>gb|ETK82363.1| hypothetical protein, variant 3 [Phytophthora parasitica]
 gb|ETL35755.1| hypothetical protein, variant 3 [Phytophthora parasitica]
Length=454

 Score = 59.7 bits (143),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 44/131 (34%), Positives = 64/131 (49%), Gaps = 8/131 (6%)
 Frame = -3

Query  684  HKRDAIVMYKSIEELELRLFHAFSINLMRTRETLLKMFMELQDWKEALEYCRLTIPVYQR  505
             ++  I   + + E +  + H  SI  ++T  TL    ME    +EA+ Y    +  Y+R
Sbjct  324  QQQQCIDALQKLAEQQSIILHHDSIARLQTLATLFSAEMERGSVEEAIGYGERMLEFYRR  383

Query  504  VYQGFHPLLGLQYYTCGKL-----EWLLGESEEAFKS---LSKAMDILRITHGTKSSFMK  349
            VY   HP+ GL  +T G L     +   G  E   KS   L++A  ILRITHG    F+K
Sbjct  384  VYNSNHPMTGLHLFTLGDLYGQQAQAGTGAEESKQKSLEYLTEAQRILRITHGKGHRFVK  443

Query  348  ELSFKLEEARA  316
             LS +LE+  A
Sbjct  444  MLSDRLEKVSA  454



>gb|AAM51103.1| SD20045p [Drosophila melanogaster]
Length=382

 Score = 59.3 bits (142),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 32/108 (30%), Positives = 60/108 (56%), Gaps = 1/108 (1%)
 Frame = -3

Query  630  LFHAFSINLMRTRETLLKMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGK  451
            +FH  ++  ++T +   +  +E+  W +AL+Y +  +P +++ +  ++PLLGL +   GK
Sbjct  274  VFHPLNVWYVKTLDAAFEAAIEVGKWSDALDYGQRLLPGFRKYHGPWNPLLGLLHMKLGK  333

Query  450  LEWLLGESEEAFKSLSKAMDILRITHGTKSSFMKELSFKLE-EARAEV  310
            ++   G S+EA   L +A  IL +THG     + E  + L  +AR E 
Sbjct  334  IQLYEGHSKEALHHLEEAQRILTVTHGRDHRLLTEQLYVLVLQARQEA  381



>ref|XP_005827049.1| hypothetical protein GUITHDRAFT_164767 [Guillardia theta CCMP2712]
 gb|EKX40069.1| hypothetical protein GUITHDRAFT_164767 [Guillardia theta CCMP2712]
Length=500

 Score = 59.7 bits (143),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 36/118 (31%), Positives = 59/118 (50%), Gaps = 0/118 (0%)
 Frame = -3

Query  672  AIVMYKSIEELELRLFHAFSINLMRTRETLLKMFMELQDWKEALEYCRLTIPVYQRVYQG  493
            A+   K ++E  L       ++ +  +  +L+  +EL     A+  C+  +  Y+ +Y  
Sbjct  379  ALSRLKDLDENVLADRGNVDLDRLSVKSKMLQASIELGMMDSAIRACKQVVEGYRGIYPP  438

Query  492  FHPLLGLQYYTCGKLEWLLGESEEAFKSLSKAMDILRITHGTKSSFMKELSFKLEEAR  319
             HPLLGLQ YT G L +  G  EEA   L +   IL  TH  +S+ ++ ++  L EAR
Sbjct  439  LHPLLGLQLYTLGNLLFDDGRGEEAADVLQEGQKILLATHDRRSTMVQGITELLAEAR  496



>ref|XP_008877093.1| hypothetical protein H310_11978 [Aphanomyces invadans]
 gb|ETV94331.1| hypothetical protein H310_11978 [Aphanomyces invadans]
Length=452

 Score = 59.3 bits (142),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 40/124 (32%), Positives = 69/124 (56%), Gaps = 6/124 (5%)
 Frame = -3

Query  687  GHKRDAIVMYKSIEELELR---LFHAFSINLMRTRETLLKMFMELQDWKEALEYCRLTIP  517
             ++  AI ++K    L++R   L + +S+ L+     LL +++E+ +  +A++  R    
Sbjct  305  SNRETAIDLFK--RTLDVRASVLANEWSVLLLEVHAQLLTLYIEMGNGHDAIQTARKMYA  362

Query  516  VYQRVYQGFHPLLGLQYYTCGKLEWLLGESEEAFKSLSKAMDILRITHGTKSSFMKELSF  337
             YQ +Y   HPL GL  YT G LE  L + E A + L++A  IL ITHG K + ++ L  
Sbjct  363  FYQHLYDPNHPLTGLHLYTLGDLESQL-QVEGAQQHLTEAWRILTITHGAKHAMVQTLKG  421

Query  336  KLEE  325
            +++E
Sbjct  422  RVDE  425



>ref|XP_419536.1| PREDICTED: histone-lysine N-methyltransferase SMYD3 isoform X4 
[Gallus gallus]
Length=428

 Score = 59.3 bits (142),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 30/91 (33%), Positives = 51/91 (56%), Gaps = 0/91 (0%)
 Frame = -3

Query  615  SINLMRTRETLLKMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLL  436
            +I  ++  +  +   + L+ W++AL Y   T+  Y+  Y  FHPL  +Q    GKL++  
Sbjct  324  NIYQLKLLDCAMDACINLEAWEQALCYGSRTLGPYRLYYPDFHPLRAVQLMRVGKLQYSQ  383

Query  435  GESEEAFKSLSKAMDILRITHGTKSSFMKEL  343
            G   +A  +L +A DI+++THGT  S M+ L
Sbjct  384  GMLPQALGTLKQAYDIMKVTHGTDHSLMQAL  414



>gb|ETK82360.1| hypothetical protein L915_12245 [Phytophthora parasitica]
 gb|ETL35752.1| hypothetical protein L916_12164 [Phytophthora parasitica]
Length=501

 Score = 59.3 bits (142),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 44/131 (34%), Positives = 64/131 (49%), Gaps = 8/131 (6%)
 Frame = -3

Query  684  HKRDAIVMYKSIEELELRLFHAFSINLMRTRETLLKMFMELQDWKEALEYCRLTIPVYQR  505
             ++  I   + + E +  + H  SI  ++T  TL    ME    +EA+ Y    +  Y+R
Sbjct  371  QQQQCIDALQKLAEQQSIILHHDSIARLQTLATLFSAEMERGSVEEAIGYGERMLEFYRR  430

Query  504  VYQGFHPLLGLQYYTCGKL-----EWLLGESEEAFKS---LSKAMDILRITHGTKSSFMK  349
            VY   HP+ GL  +T G L     +   G  E   KS   L++A  ILRITHG    F+K
Sbjct  431  VYNSNHPMTGLHLFTLGDLYGQQAQAGTGAEESKQKSLEYLTEAQRILRITHGKGHRFVK  490

Query  348  ELSFKLEEARA  316
             LS +LE+  A
Sbjct  491  MLSDRLEKVSA  501



>ref|XP_004935489.1| PREDICTED: histone-lysine N-methyltransferase SMYD3 isoform X5 
[Gallus gallus]
Length=481

 Score = 59.3 bits (142),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 30/91 (33%), Positives = 51/91 (56%), Gaps = 0/91 (0%)
 Frame = -3

Query  615  SINLMRTRETLLKMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLL  436
            +I  ++  +  +   + L+ W++AL Y   T+  Y+  Y  FHPL  +Q    GKL++  
Sbjct  377  NIYQLKLLDCAMDACINLEAWEQALCYGSRTLGPYRLYYPDFHPLRAVQLMRVGKLQYSQ  436

Query  435  GESEEAFKSLSKAMDILRITHGTKSSFMKEL  343
            G   +A  +L +A DI+++THGT  S M+ L
Sbjct  437  GMLPQALGTLKQAYDIMKVTHGTDHSLMQAL  467



>ref|XP_004935490.1| PREDICTED: histone-lysine N-methyltransferase SMYD3 isoform X6 
[Gallus gallus]
Length=447

 Score = 59.3 bits (142),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 30/91 (33%), Positives = 51/91 (56%), Gaps = 0/91 (0%)
 Frame = -3

Query  615  SINLMRTRETLLKMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLL  436
            +I  ++  +  +   + L+ W++AL Y   T+  Y+  Y  FHPL  +Q    GKL++  
Sbjct  343  NIYQLKLLDCAMDACINLEAWEQALCYGSRTLGPYRLYYPDFHPLRAVQLMRVGKLQYSQ  402

Query  435  GESEEAFKSLSKAMDILRITHGTKSSFMKEL  343
            G   +A  +L +A DI+++THGT  S M+ L
Sbjct  403  GMLPQALGTLKQAYDIMKVTHGTDHSLMQAL  433



>gb|ETK82362.1| hypothetical protein, variant 2 [Phytophthora parasitica]
 gb|ETL35754.1| hypothetical protein, variant 2 [Phytophthora parasitica]
Length=477

 Score = 59.3 bits (142),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 44/131 (34%), Positives = 64/131 (49%), Gaps = 8/131 (6%)
 Frame = -3

Query  684  HKRDAIVMYKSIEELELRLFHAFSINLMRTRETLLKMFMELQDWKEALEYCRLTIPVYQR  505
             ++  I   + + E +  + H  SI  ++T  TL    ME    +EA+ Y    +  Y+R
Sbjct  347  QQQQCIDALQKLAEQQSIILHHDSIARLQTLATLFSAEMERGSVEEAIGYGERMLEFYRR  406

Query  504  VYQGFHPLLGLQYYTCGKL-----EWLLGESEEAFKS---LSKAMDILRITHGTKSSFMK  349
            VY   HP+ GL  +T G L     +   G  E   KS   L++A  ILRITHG    F+K
Sbjct  407  VYNSNHPMTGLHLFTLGDLYGQQAQAGTGAEESKQKSLEYLTEAQRILRITHGKGHRFVK  466

Query  348  ELSFKLEEARA  316
             LS +LE+  A
Sbjct  467  MLSDRLEKVSA  477



>gb|ELU10312.1| hypothetical protein CAPTEDRAFT_158133 [Capitella teleta]
Length=441

 Score = 59.3 bits (142),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 30/97 (31%), Positives = 53/97 (55%), Gaps = 1/97 (1%)
 Frame = -3

Query  630  LFHAFSINLMRTRETLLKMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGK  451
            + H ++++ ++  +  L   +E   W +ALE  RLT+  Y+  Y   HP +G+  +  GK
Sbjct  338  ILHPYNVHFIKLCDLSLDACIETSQWDDALELGRLTVVAYRFYYGELHPSVGILLFKIGK  397

Query  450  LEWLLGESEEAFKSLSKAMDILRITHGTKSSFMKELS  340
            +   L +  EA + L +A  +LR+THG   S  K+L+
Sbjct  398  ILSYLAD-REALQFLKQAATVLRVTHGDDHSLYKDLA  433



>ref|XP_010561240.1| PREDICTED: histone-lysine N-methyltransferase SMYD3 [Haliaeetus 
leucocephalus]
Length=375

 Score = 59.3 bits (142),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 33/110 (30%), Positives = 59/110 (54%), Gaps = 2/110 (2%)
 Frame = -3

Query  666  VMYKSIEELELRLFHAFSINLMRTR--ETLLKMFMELQDWKEALEYCRLTIPVYQRVYQG  493
            V+ +  + L   + H    N+ + +  +  +   + L+ W+EAL Y   T+  Y+  Y G
Sbjct  252  VLARCQDLLSSNMGHLPDTNIYQLKMLDCAMDACINLECWEEALYYGSRTLGPYRLYYPG  311

Query  492  FHPLLGLQYYTCGKLEWLLGESEEAFKSLSKAMDILRITHGTKSSFMKEL  343
            FHPL  +Q    GKL++      +A ++L +A +I+++THGT  S M+ L
Sbjct  312  FHPLRAVQLMRVGKLQYSQDMFPQALETLKQAYNIMKVTHGTDHSLMQAL  361



>ref|XP_007534948.1| PREDICTED: histone-lysine N-methyltransferase SMYD3 [Erinaceus 
europaeus]
Length=428

 Score = 59.3 bits (142),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 55/103 (53%), Gaps = 0/103 (0%)
 Frame = -3

Query  615  SINLMRTRETLLKMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLL  436
            +I+ ++  +  +   + L   +EAL Y   T+  Y+  Y G HP+ G+Q    GKL+   
Sbjct  324  NIHQLKVLDGAMDACIHLGQLEEALSYAIRTLEPYRIFYPGNHPVRGVQLMKVGKLQLHQ  383

Query  435  GESEEAFKSLSKAMDILRITHGTKSSFMKELSFKLEEARAEVS  307
            G   +A K+L  A DI+++THG + S  ++L   LEE  A  S
Sbjct  384  GMFPQAMKNLRLAFDIVKVTHGREHSLTEDLILLLEECEASAS  426



>ref|XP_005435180.1| PREDICTED: histone-lysine N-methyltransferase SMYD3 [Falco cherrug]
Length=271

 Score = 58.5 bits (140),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 66/128 (52%), Gaps = 16/128 (13%)
 Frame = -3

Query  678  RDAI--VMY-KSIEELE---LRLFHAFSINLMRTRET---LLKMF-------MELQDWKE  547
            RDA+  V Y KS E+ E    R  +  S N+ R  +T    LKM        + L+ W+E
Sbjct  128  RDAVNEVKYPKSKEDWEQVLARCQNLLSGNVGRLPDTNIYQLKMLDCAMDACINLESWEE  187

Query  546  ALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLLGESEEAFKSLSKAMDILRITHGT  367
            AL Y   T+  Y   Y GFHPL  +Q    GKL++      +A ++L +A +I+++THG 
Sbjct  188  ALYYGHRTLEPYSLYYPGFHPLRAVQLMRVGKLQYSQDMFPQALETLKQAYNIMKVTHGP  247

Query  366  KSSFMKEL  343
              S M+ L
Sbjct  248  DHSLMQAL  255



>ref|XP_005232529.1| PREDICTED: histone-lysine N-methyltransferase SMYD3 [Falco peregrinus]
Length=271

 Score = 58.5 bits (140),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 66/128 (52%), Gaps = 16/128 (13%)
 Frame = -3

Query  678  RDAI--VMY-KSIEELE---LRLFHAFSINLMRTRET---LLKMF-------MELQDWKE  547
            RDA+  V Y KS E+ E    R  +  S N+ R  +T    LKM        + L+ W+E
Sbjct  128  RDAVNEVKYPKSKEDWEQVLARCQNLLSGNVGRLPDTNIYQLKMLDCAMDACINLESWEE  187

Query  546  ALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLLGESEEAFKSLSKAMDILRITHGT  367
            AL Y   T+  Y   Y GFHPL  +Q    GKL++      +A ++L +A +I+++THG 
Sbjct  188  ALYYGHRTLEPYSLYYPGFHPLRAVQLMRVGKLQYSQDMFPQALETLKQAYNIMKVTHGP  247

Query  366  KSSFMKEL  343
              S M+ L
Sbjct  248  DHSLMQAL  255



>gb|KFW65195.1| Histone-lysine N-methyltransferase SMYD3, partial [Pygoscelis 
adeliae]
Length=260

 Score = 58.5 bits (140),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 47/131 (36%), Positives = 68/131 (52%), Gaps = 19/131 (15%)
 Frame = -3

Query  678  RDAI--VMY-KSIEELE---LRLFHAFSINLMRTRET---LLKMF-------MELQDWKE  547
            +DA+  V Y KS EE E    R  +  S N+ R  +T    LKM        + L+ W+E
Sbjct  116  KDAVNEVRYPKSKEEWEQVLARCQNLLSGNMGRLPDTNIYQLKMLDCAMDACINLESWEE  175

Query  546  ALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEW---LLGESEEAFKSLSKAMDILRIT  376
            AL Y   T+  Y+  Y GFHPL  +Q    GKL++   +  ++ E  K  S A +I+++T
Sbjct  176  ALYYGSRTLGPYRMYYPGFHPLRAVQLMRVGKLQYSQDMFPQALETLKQASIAYNIMKVT  235

Query  375  HGTKSSFMKEL  343
            HGT  S M+ L
Sbjct  236  HGTDHSLMQAL  246



>ref|XP_006871333.1| PREDICTED: histone-lysine N-methyltransferase SMYD3-like [Chrysochloris 
asiatica]
Length=428

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 46/80 (58%), Gaps = 0/80 (0%)
 Frame = -3

Query  549  EALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLLGESEEAFKSLSKAMDILRITHG  370
            EAL Y   T+  Y+  + G HP+ G+Q    GKL+   G   +A K+L  A DILR+THG
Sbjct  346  EALFYGTRTMEPYRIFFPGNHPVRGVQVMKVGKLQLHQGMFTQAMKNLRLAFDILRVTHG  405

Query  369  TKSSFMKELSFKLEEARAEV  310
             + S M++L   LEE  A +
Sbjct  406  REHSLMEDLVLLLEECNANI  425



>ref|XP_006817722.1| PREDICTED: histone-lysine N-methyltransferase SMYD3-like [Saccoglossus 
kowalevskii]
Length=126

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 47/90 (52%), Gaps = 0/90 (0%)
 Frame = -3

Query  582  LKMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLLGESEEAFKSLS  403
            + + +ELQ W+ AL Y   T   Y+  Y  +HP  G+Q+    KL+  L   +EA + L 
Sbjct  9    MDVCIELQQWESALNYGLKTTEPYRLHYPSYHPNTGVQFARIAKLQMYLSYLQEAHRYLQ  68

Query  402  KAMDILRITHGTKSSFMKELSFKLEEARAE  313
            +A++IL +THG       +L   L E + E
Sbjct  69   EALNILEVTHGKGHPLTTDLQRLLHECQEE  98



>gb|KFV87334.1| Histone-lysine N-methyltransferase SMYD3, partial [Struthio camelus 
australis]
Length=257

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/91 (32%), Positives = 50/91 (55%), Gaps = 0/91 (0%)
 Frame = -3

Query  615  SINLMRTRETLLKMFMELQDWKEALEYCRLTIPVYQRVYQGFHPLLGLQYYTCGKLEWLL  436
            +I  ++  +  +   + L  W+EAL Y   T+  Y+  Y GFHPL  +Q    GKL++  
Sbjct  153  NIYQLKMLDCAMDACINLGSWEEALNYGSRTLGPYRLYYPGFHPLRAVQLMRVGKLQYSQ  212

Query  435  GESEEAFKSLSKAMDILRITHGTKSSFMKEL  343
                +A ++L +A +I+++THG   S M+ L
Sbjct  213  DMFPQALETLKQAYNIMKVTHGADHSLMQAL  243



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1483248998725