BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig11079

Length=808
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP16075.1|  unnamed protein product                                324   3e-100   Coffea canephora [robusta coffee]
ref|XP_009602214.1|  PREDICTED: auxin response factor 6-like isof...    323   6e-100   Nicotiana tomentosiformis
ref|XP_009602213.1|  PREDICTED: auxin response factor 6-like isof...    323   6e-100   Nicotiana tomentosiformis
ref|XP_006357892.1|  PREDICTED: auxin response factor 6-like isof...    318   4e-98    Solanum tuberosum [potatoes]
ref|XP_006357893.1|  PREDICTED: auxin response factor 6-like isof...    318   5e-98    Solanum tuberosum [potatoes]
gb|ADH04265.1|  ARF1                                                    317   9e-98    Nicotiana benthamiana
ref|XP_009757616.1|  PREDICTED: auxin response factor 6-like isof...    316   3e-97    Nicotiana sylvestris
ref|XP_009757615.1|  PREDICTED: auxin response factor 6-like isof...    316   3e-97    Nicotiana sylvestris
gb|ACM66271.1|  ARF8                                                    307   7e-94    Solanum melongena [aubergine]
ref|XP_010106165.1|  Auxin response factor 6                            299   4e-90    
ref|XP_004304523.1|  PREDICTED: auxin response factor 6-like isof...    289   7e-87    Fragaria vesca subsp. vesca
ref|XP_011085439.1|  PREDICTED: auxin response factor 6-like            289   8e-87    Sesamum indicum [beniseed]
ref|XP_011468187.1|  PREDICTED: auxin response factor 6-like isof...    288   2e-86    Fragaria vesca subsp. vesca
ref|XP_007048898.1|  Auxin response factor 6 isoform 2                  285   2e-85    
ref|XP_010657096.1|  PREDICTED: auxin response factor 17-like           285   2e-85    
gb|AHY24213.1|  auxin response factor                                   283   7e-85    Dimocarpus longan [longan]
ref|XP_007217690.1|  hypothetical protein PRUPE_ppa001069mg             283   1e-84    Prunus persica
ref|XP_011032737.1|  PREDICTED: auxin response factor 6-like isof...    282   2e-84    Populus euphratica
ref|XP_008229616.1|  PREDICTED: auxin response factor 6-like isof...    282   2e-84    Prunus mume [ume]
ref|XP_011032738.1|  PREDICTED: auxin response factor 6-like isof...    282   2e-84    Populus euphratica
gb|ADK91822.1|  auxin response factor 6                                 281   3e-84    Solanum lycopersicum
ref|NP_001234663.1|  auxin response factor 6                            281   3e-84    Solanum lycopersicum
ref|XP_008229615.1|  PREDICTED: auxin response factor 6-like isof...    281   4e-84    
gb|KCW89820.1|  hypothetical protein EUGRSUZ_A020652                    273   5e-84    Eucalyptus grandis [rose gum]
gb|KDO63437.1|  hypothetical protein CISIN_1g002390mg                   278   2e-83    Citrus sinensis [apfelsine]
ref|XP_010275037.1|  PREDICTED: auxin response factor 6                 279   6e-83    Nelumbo nucifera [Indian lotus]
gb|KDO63434.1|  hypothetical protein CISIN_1g002390mg                   277   8e-83    Citrus sinensis [apfelsine]
gb|KDO63433.1|  hypothetical protein CISIN_1g002390mg                   277   1e-82    Citrus sinensis [apfelsine]
ref|XP_006468969.1|  PREDICTED: auxin response factor 6-like            277   1e-82    Citrus sinensis [apfelsine]
ref|XP_002307574.2|  hypothetical protein POPTR_0005s22930g             277   1e-82    Populus trichocarpa [western balsam poplar]
gb|ABK95163.1|  unknown                                                 276   2e-82    Populus trichocarpa [western balsam poplar]
ref|XP_006351989.1|  PREDICTED: auxin response factor 6-like isof...    276   2e-82    Solanum tuberosum [potatoes]
ref|XP_006351990.1|  PREDICTED: auxin response factor 6-like isof...    276   2e-82    Solanum tuberosum [potatoes]
gb|KHG01675.1|  Auxin response factor 6 -like protein                   275   2e-82    Gossypium arboreum [tree cotton]
gb|KDO63436.1|  hypothetical protein CISIN_1g002390mg                   277   2e-82    Citrus sinensis [apfelsine]
ref|XP_006446840.1|  hypothetical protein CICLE_v10014200mg             275   4e-82    Citrus clementina [clementine]
ref|XP_010054260.1|  PREDICTED: auxin response factor 6-like            274   2e-81    
ref|XP_009376828.1|  PREDICTED: auxin response factor 6-like            274   3e-81    Pyrus x bretschneideri [bai li]
gb|KJB49005.1|  hypothetical protein B456_008G097200                    271   1e-80    Gossypium raimondii
ref|XP_007141460.1|  hypothetical protein PHAVU_008G197600g             272   1e-80    Phaseolus vulgaris [French bean]
gb|KJB49004.1|  hypothetical protein B456_008G097200                    271   1e-80    Gossypium raimondii
gb|KHG06791.1|  Auxin response factor 6 -like protein                   269   3e-80    Gossypium arboreum [tree cotton]
ref|XP_010275910.1|  PREDICTED: auxin response factor 6-like isof...    270   9e-80    Nelumbo nucifera [Indian lotus]
gb|AJE26133.1|  auxin response factors                                  269   1e-79    Salix matsudana [tortured willow]
gb|KHN12007.1|  Auxin response factor 6                                 268   2e-79    Glycine soja [wild soybean]
ref|XP_006595764.1|  PREDICTED: auxin response factor 6-like            268   2e-79    
ref|XP_002279808.1|  PREDICTED: auxin response factor 6                 268   2e-79    Vitis vinifera
ref|XP_002300854.2|  hypothetical protein POPTR_0002s05590g             268   2e-79    Populus trichocarpa [western balsam poplar]
ref|XP_012072177.1|  PREDICTED: auxin response factor 6 isoform X2      268   4e-79    Jatropha curcas
ref|XP_007024965.1|  Auxin response factor 6 isoform 4                  261   9e-79    
ref|XP_011026193.1|  PREDICTED: auxin response factor 6-like isof...    265   4e-78    Populus euphratica
ref|XP_012072178.1|  PREDICTED: auxin response factor 6 isoform X3      264   4e-78    
ref|XP_011026192.1|  PREDICTED: auxin response factor 6-like isof...    265   4e-78    Populus euphratica
gb|KHG28199.1|  Auxin response factor 6                                 265   4e-78    Gossypium arboreum [tree cotton]
ref|XP_003519519.1|  PREDICTED: auxin response factor 6-like            265   4e-78    Glycine max [soybeans]
ref|XP_012072176.1|  PREDICTED: auxin response factor 6 isoform X1      263   1e-77    Jatropha curcas
gb|KJB57191.1|  hypothetical protein B456_009G152700                    262   2e-77    Gossypium raimondii
gb|KJB57190.1|  hypothetical protein B456_009G152700                    262   5e-77    Gossypium raimondii
ref|XP_007024962.1|  Auxin response factor 6 isoform 1                  261   7e-77    Theobroma cacao [chocolate]
ref|XP_007024963.1|  Auxin response factor 6 isoform 2                  261   8e-77    Theobroma cacao [chocolate]
gb|KJB33383.1|  hypothetical protein B456_006G008700                    261   8e-77    Gossypium raimondii
emb|CBI22060.3|  unnamed protein product                                260   9e-77    Vitis vinifera
ref|XP_006468258.1|  PREDICTED: auxin response factor 6-like isof...    258   1e-75    Citrus sinensis [apfelsine]
ref|XP_006468259.1|  PREDICTED: auxin response factor 6-like isof...    258   1e-75    Citrus sinensis [apfelsine]
ref|XP_006448968.1|  hypothetical protein CICLE_v10014198mg             258   2e-75    Citrus clementina [clementine]
gb|KJB57192.1|  hypothetical protein B456_009G152700                    256   5e-75    Gossypium raimondii
ref|XP_011096637.1|  PREDICTED: auxin response factor 6 isoform X3      256   5e-75    Sesamum indicum [beniseed]
ref|XP_011096635.1|  PREDICTED: auxin response factor 6 isoform X1      256   5e-75    Sesamum indicum [beniseed]
ref|XP_011096636.1|  PREDICTED: auxin response factor 6 isoform X2      256   6e-75    Sesamum indicum [beniseed]
ref|XP_010275911.1|  PREDICTED: auxin response factor 6-like isof...    256   7e-75    Nelumbo nucifera [Indian lotus]
gb|KHG10285.1|  Auxin response factor 6 -like protein                   254   2e-74    Gossypium arboreum [tree cotton]
ref|XP_010688801.1|  PREDICTED: auxin response factor 6 isoform X1      254   4e-74    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010688802.1|  PREDICTED: auxin response factor 6 isoform X2      254   4e-74    Beta vulgaris subsp. vulgaris [field beet]
emb|CDP05666.1|  unnamed protein product                                254   5e-74    Coffea canephora [robusta coffee]
ref|XP_002298839.1|  auxin response factor 6 family protein             253   8e-74    
gb|KJB69886.1|  hypothetical protein B456_011G048200                    253   9e-74    Gossypium raimondii
ref|XP_011012265.1|  PREDICTED: auxin response factor 6-like            253   1e-73    Populus euphratica
ref|XP_010090447.1|  Auxin response factor 6                            252   2e-73    Morus notabilis
ref|XP_011047524.1|  PREDICTED: auxin response factor 6-like isof...    252   2e-73    Populus euphratica
ref|XP_011047523.1|  PREDICTED: auxin response factor 6-like isof...    252   2e-73    Populus euphratica
ref|XP_007212802.1|  hypothetical protein PRUPE_ppa001179mg             252   2e-73    
emb|CDQ51986.1|  auxin response factor                                  233   2e-73    Fagus sylvatica
ref|XP_002316773.1|  auxin response factor 6 family protein             251   5e-73    
ref|XP_008776642.1|  PREDICTED: auxin response factor 17-like           250   8e-73    
ref|XP_008225531.1|  PREDICTED: auxin response factor 6                 249   3e-72    Prunus mume [ume]
ref|XP_010941528.1|  PREDICTED: auxin response factor 17-like iso...    248   3e-72    
ref|XP_010941526.1|  PREDICTED: auxin response factor 17-like iso...    248   6e-72    Elaeis guineensis
ref|XP_011085226.1|  PREDICTED: auxin response factor 6-like isof...    246   3e-71    Sesamum indicum [beniseed]
ref|XP_011085227.1|  PREDICTED: auxin response factor 6-like isof...    246   3e-71    Sesamum indicum [beniseed]
ref|XP_011007615.1|  PREDICTED: auxin response factor 6-like            245   6e-71    Populus euphratica
dbj|BAD19064.1|  auxin response factor 4                                244   9e-71    Cucumis sativus [cucumbers]
ref|XP_010908740.1|  PREDICTED: auxin response factor 17-like iso...    242   1e-70    
ref|XP_004150775.1|  PREDICTED: auxin response factor 6-like            244   2e-70    Cucumis sativus [cucumbers]
ref|XP_008444734.1|  PREDICTED: auxin response factor 6-like            243   3e-70    Cucumis melo [Oriental melon]
emb|CBI30949.3|  unnamed protein product                                224   8e-70    Vitis vinifera
ref|XP_007048897.1|  Auxin response factor 6 isoform 1                  242   1e-69    
ref|XP_010908738.1|  PREDICTED: auxin response factor 17-like iso...    241   1e-69    
ref|XP_010908734.1|  PREDICTED: auxin response factor 17-like iso...    241   1e-69    Elaeis guineensis
ref|NP_001280959.1|  auxin response factor 6-like                       241   2e-69    Malus domestica [apple tree]
ref|XP_010052021.1|  PREDICTED: auxin response factor 6                 240   3e-69    Eucalyptus grandis [rose gum]
ref|XP_009360948.1|  PREDICTED: auxin response factor 6                 239   8e-69    Pyrus x bretschneideri [bai li]
ref|XP_010923658.1|  PREDICTED: auxin response factor 17 isoform X2     239   9e-69    
ref|XP_010923656.1|  PREDICTED: auxin response factor 17 isoform X1     239   9e-69    
ref|XP_009377485.1|  PREDICTED: auxin response factor 6-like            239   1e-68    Pyrus x bretschneideri [bai li]
gb|KJB69885.1|  hypothetical protein B456_011G048200                    239   1e-68    Gossypium raimondii
ref|XP_008777704.1|  PREDICTED: auxin response factor 17-like           238   2e-68    Phoenix dactylifera
ref|XP_008371797.1|  PREDICTED: auxin response factor 6-like            238   3e-68    
gb|KDO63435.1|  hypothetical protein CISIN_1g002390mg                   236   4e-68    Citrus sinensis [apfelsine]
ref|XP_008794474.1|  PREDICTED: auxin response factor 17                237   6e-68    Phoenix dactylifera
ref|XP_008371645.1|  PREDICTED: auxin response factor 6                 236   1e-67    Malus domestica [apple tree]
ref|XP_010540604.1|  PREDICTED: auxin response factor 6-like isof...    232   2e-67    Tarenaya hassleriana [spider flower]
gb|KGN49430.1|  hypothetical protein Csa_6G524670                       235   2e-67    Cucumis sativus [cucumbers]
ref|XP_011658304.1|  PREDICTED: auxin response factor 6 isoform X2      235   2e-67    Cucumis sativus [cucumbers]
ref|XP_010540603.1|  PREDICTED: auxin response factor 6-like isof...    233   8e-67    Tarenaya hassleriana [spider flower]
ref|XP_008439586.1|  PREDICTED: LOW QUALITY PROTEIN: auxin respon...    234   8e-67    Cucumis melo [Oriental melon]
ref|XP_010540601.1|  PREDICTED: auxin response factor 6-like isof...    233   8e-67    Tarenaya hassleriana [spider flower]
gb|EYU42851.1|  hypothetical protein MIMGU_mgv1a001422mg                233   1e-66    Erythranthe guttata [common monkey flower]
ref|XP_010478419.1|  PREDICTED: auxin response factor 6 isoform X3      231   9e-66    Camelina sativa [gold-of-pleasure]
ref|XP_010499562.1|  PREDICTED: auxin response factor 6-like isof...    231   1e-65    Camelina sativa [gold-of-pleasure]
ref|XP_010478420.1|  PREDICTED: auxin response factor 6 isoform X4      231   1e-65    Camelina sativa [gold-of-pleasure]
ref|XP_010499561.1|  PREDICTED: auxin response factor 6-like isof...    231   1e-65    Camelina sativa [gold-of-pleasure]
ref|XP_010499564.1|  PREDICTED: auxin response factor 6-like isof...    230   1e-65    Camelina sativa [gold-of-pleasure]
ref|XP_010478418.1|  PREDICTED: auxin response factor 6 isoform X2      230   1e-65    Camelina sativa [gold-of-pleasure]
ref|XP_010478417.1|  PREDICTED: auxin response factor 6 isoform X1      230   1e-65    Camelina sativa [gold-of-pleasure]
ref|XP_010499563.1|  PREDICTED: auxin response factor 6-like isof...    230   1e-65    Camelina sativa [gold-of-pleasure]
ref|XP_009399037.1|  PREDICTED: auxin response factor 17                230   2e-65    Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001031115.1|  auxin response factor 6                            230   2e-65    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009384197.1|  PREDICTED: auxin response factor 17-like iso...    229   3e-65    Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_174323.1|  auxin response factor 6                               229   3e-65    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002893612.1|  hypothetical protein ARALYDRAFT_473256             229   3e-65    
ref|XP_009797608.1|  PREDICTED: auxin response factor 6-like isof...    229   3e-65    Nicotiana sylvestris
ref|XP_009797609.1|  PREDICTED: auxin response factor 6-like isof...    229   3e-65    Nicotiana sylvestris
ref|NP_001292624.1|  auxin response factor 6                            229   3e-65    Cucumis sativus [cucumbers]
ref|XP_009384193.1|  PREDICTED: auxin response factor 17-like iso...    229   3e-65    
ref|XP_010538262.1|  PREDICTED: auxin response factor 6                 228   7e-65    Tarenaya hassleriana [spider flower]
gb|ABF69979.1|  transcriptional factor B3 family protein                228   7e-65    Musa acuminata [banana]
ref|XP_006306714.1|  hypothetical protein CARUB_v10008239mg             228   1e-64    Capsella rubella
gb|KJB49006.1|  hypothetical protein B456_008G097200                    227   2e-64    Gossypium raimondii
ref|XP_007159383.1|  hypothetical protein PHAVU_002G233600g             226   4e-64    Phaseolus vulgaris [French bean]
ref|XP_009627652.1|  PREDICTED: auxin response factor 6-like isof...    226   5e-64    Nicotiana tomentosiformis
ref|XP_006597510.1|  PREDICTED: auxin response factor 6-like isof...    225   5e-64    Glycine max [soybeans]
ref|XP_006415484.1|  hypothetical protein EUTSA_v10006747mg             226   5e-64    
ref|XP_006415485.1|  hypothetical protein EUTSA_v10006747mg             226   6e-64    Eutrema salsugineum [saltwater cress]
ref|XP_009627654.1|  PREDICTED: auxin response factor 6-like isof...    225   6e-64    Nicotiana tomentosiformis
ref|XP_009627653.1|  PREDICTED: auxin response factor 6-like isof...    225   7e-64    Nicotiana tomentosiformis
ref|XP_009385053.1|  PREDICTED: auxin response factor 6-like            225   8e-64    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006597509.1|  PREDICTED: auxin response factor 6-like isof...    225   8e-64    Glycine max [soybeans]
gb|KHN06947.1|  Auxin response factor 6                                 225   1e-63    Glycine soja [wild soybean]
ref|XP_003546066.1|  PREDICTED: auxin response factor 6-like isof...    225   1e-63    Glycine max [soybeans]
gb|KFK27496.1|  hypothetical protein AALP_AA8G390400                    224   2e-63    Arabis alpina [alpine rockcress]
ref|XP_009399230.1|  PREDICTED: auxin response factor 17-like           224   2e-63    Musa acuminata subsp. malaccensis [pisang utan]
gb|EMT32630.1|  Auxin response factor 6                                 223   3e-63    
gb|EMS45463.1|  Auxin response factor 6                                 223   3e-63    Triticum urartu
ref|XP_008784820.1|  PREDICTED: LOW QUALITY PROTEIN: auxin respon...    224   4e-63    
ref|XP_010940157.1|  PREDICTED: LOW QUALITY PROTEIN: auxin respon...    223   4e-63    
ref|XP_006594518.1|  PREDICTED: auxin response factor 6-like isof...    222   7e-63    
gb|KHN47353.1|  Auxin response factor 6                                 222   1e-62    Glycine soja [wild soybean]
ref|XP_006594517.1|  PREDICTED: auxin response factor 6-like isof...    222   1e-62    Glycine max [soybeans]
ref|XP_003542951.1|  PREDICTED: auxin response factor 6-like isof...    222   1e-62    Glycine max [soybeans]
gb|AFW68990.1|  hypothetical protein ZEAMMB73_088581                    215   3e-62    
ref|XP_010233861.1|  PREDICTED: auxin response factor 6-like isof...    220   4e-62    Brachypodium distachyon [annual false brome]
ref|XP_003575362.1|  PREDICTED: auxin response factor 6-like isof...    220   5e-62    Brachypodium distachyon [annual false brome]
ref|XP_010233862.1|  PREDICTED: auxin response factor 6-like isof...    220   5e-62    
ref|XP_004293501.1|  PREDICTED: auxin response factor 6                 219   9e-62    Fragaria vesca subsp. vesca
emb|CDY09598.1|  BnaC05g23210D                                          218   3e-61    Brassica napus [oilseed rape]
emb|CDY02285.1|  BnaA09g26170D                                          218   3e-61    
ref|NP_001045993.1|  Os02g0164900                                       218   4e-61    
ref|XP_009115165.1|  PREDICTED: auxin response factor 6 isoform X2      217   6e-61    Brassica rapa
ref|XP_009393314.1|  PREDICTED: auxin response factor 17-like           217   6e-61    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009115164.1|  PREDICTED: auxin response factor 6 isoform X1      217   6e-61    Brassica rapa
ref|XP_004485979.1|  PREDICTED: auxin response factor 6-like            216   9e-61    Cicer arietinum [garbanzo]
sp|A2YG67.1|ARFQ_ORYSI  RecName: Full=Auxin response factor 17          215   3e-60    Oryza sativa Indica Group [Indian rice]
ref|XP_003563403.1|  PREDICTED: auxin response factor 17                215   3e-60    Brachypodium distachyon [annual false brome]
gb|ADG43156.1|  auxin response factor 22                                215   4e-60    Zea mays [maize]
ref|NP_001292755.1|  ADP-ribosylation factor 6                          214   5e-60    Amborella trichopoda
gb|AFW68989.1|  hypothetical protein ZEAMMB73_088581                    213   5e-60    
ref|XP_006656378.1|  PREDICTED: auxin response factor 17-like           214   7e-60    Oryza brachyantha
gb|KJB33384.1|  hypothetical protein B456_006G008700                    214   8e-60    Gossypium raimondii
ref|NP_001058360.1|  Os06g0677800                                       214   8e-60    
ref|XP_003593869.1|  Auxin response factor                              214   9e-60    Medicago truncatula
gb|KEH20527.1|  auxin response factor 2                                 213   1e-59    Medicago truncatula
ref|XP_008644237.1|  PREDICTED: uncharacterized protein LOC100502...    213   1e-59    Zea mays [maize]
gb|KEH20526.1|  auxin response factor 2                                 213   2e-59    Medicago truncatula
gb|KEH20525.1|  auxin response factor 2                                 213   2e-59    Medicago truncatula
ref|XP_002438851.1|  hypothetical protein SORBIDRAFT_10g027220          212   4e-59    Sorghum bicolor [broomcorn]
ref|XP_002451599.1|  hypothetical protein SORBIDRAFT_04g004430          212   5e-59    
gb|ADG43152.1|  auxin response factor 18                                211   6e-59    Zea mays [maize]
ref|XP_006580853.1|  PREDICTED: auxin response factor 6-like            211   6e-59    
gb|KHN12428.1|  Auxin response factor 6                                 211   6e-59    Glycine soja [wild soybean]
ref|XP_006585093.1|  PREDICTED: auxin response factor 6-like isof...    211   6e-59    Glycine max [soybeans]
ref|XP_003531170.1|  PREDICTED: auxin response factor 6-like isof...    211   6e-59    Glycine max [soybeans]
gb|KHN46047.1|  Auxin response factor 6                                 211   8e-59    Glycine soja [wild soybean]
ref|XP_007158734.1|  hypothetical protein PHAVU_002G177600g             211   1e-58    Phaseolus vulgaris [French bean]
gb|AAN16891.1|  auxin-responsive factor protein                         194   1e-58    Mirabilis jalapa
ref|XP_009402570.1|  PREDICTED: auxin response factor 6-like isof...    210   1e-58    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009402572.1|  PREDICTED: auxin response factor 6-like isof...    210   1e-58    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006646917.1|  PREDICTED: auxin response factor 6-like            210   2e-58    Oryza brachyantha
gb|EMS51666.1|  Auxin response factor 17                                209   2e-58    Triticum urartu
ref|XP_004504542.1|  PREDICTED: auxin response factor 6-like isof...    209   2e-58    Cicer arietinum [garbanzo]
ref|XP_004504543.1|  PREDICTED: auxin response factor 6-like isof...    209   2e-58    Cicer arietinum [garbanzo]
ref|XP_004966207.1|  PREDICTED: auxin response factor 17-like           209   4e-58    Setaria italica
emb|CBA11997.1|  putative auxin response factor 6                       208   7e-58    Cabomba aquatica
ref|XP_008679931.1|  PREDICTED: auxin response factor 6 isoform X3      207   1e-57    Zea mays [maize]
ref|XP_008679929.1|  PREDICTED: auxin response factor 6 isoform X2      207   1e-57    Zea mays [maize]
gb|ADG43150.1|  auxin response factor 16                                207   1e-57    Zea mays [maize]
ref|XP_008679928.1|  PREDICTED: auxin response factor 6 isoform X1      207   1e-57    
gb|KDO75361.1|  hypothetical protein CISIN_1g002624mg                   206   4e-57    Citrus sinensis [apfelsine]
ref|XP_004951871.1|  PREDICTED: auxin response factor 6-like isof...    204   2e-56    Setaria italica
ref|XP_004951872.1|  PREDICTED: auxin response factor 6-like isof...    204   2e-56    Setaria italica
emb|CDY12048.1|  BnaC03g59640D                                          204   3e-56    Brassica napus [oilseed rape]
gb|KJB57193.1|  hypothetical protein B456_009G152700                    202   4e-56    Gossypium raimondii
gb|EMT11111.1|  Auxin response factor 17                                203   4e-56    
gb|EPS59345.1|  auxin response factor 3                                 201   6e-56    Genlisea aurea
emb|CDX90245.1|  BnaA08g17390D                                          202   8e-56    
gb|EYU19157.1|  hypothetical protein MIMGU_mgv1a001449mg                201   3e-55    Erythranthe guttata [common monkey flower]
gb|ERM99180.1|  hypothetical protein AMTR_s00092p00072950               201   4e-55    Amborella trichopoda
ref|XP_009109594.1|  PREDICTED: auxin response factor 6-like            193   1e-52    Brassica rapa
gb|ACB30835.1|  ARF6                                                    174   9e-51    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010549536.1|  PREDICTED: auxin response factor 6-like            186   3e-50    Tarenaya hassleriana [spider flower]
gb|ACB30851.1|  ARF6                                                    172   5e-50    Arabidopsis thaliana [mouse-ear cress]
gb|KCW75879.1|  hypothetical protein EUGRSUZ_D00264                     184   2e-49    Eucalyptus grandis [rose gum]
emb|CBI27335.3|  unnamed protein product                                170   1e-48    Vitis vinifera
gb|KHN39511.1|  Auxin response factor 8                                 181   2e-48    Glycine soja [wild soybean]
ref|NP_001170351.1|  uncharacterized protein LOC100384328               174   2e-48    
ref|XP_006596491.1|  PREDICTED: auxin response factor 8-like            181   3e-48    Glycine max [soybeans]
ref|XP_006575467.1|  PREDICTED: auxin response factor 8-like isof...    180   4e-48    Glycine max [soybeans]
ref|XP_006575466.1|  PREDICTED: auxin response factor 8-like isof...    180   6e-48    Glycine max [soybeans]
ref|XP_010462991.1|  PREDICTED: auxin response factor 6-like            180   6e-48    
ref|XP_009627655.1|  PREDICTED: auxin response factor 6-like isof...    180   6e-48    Nicotiana tomentosiformis
emb|CBA12003.1|  putative auxin response factor 6/8                     181   6e-48    Ginkgo biloba [ginkgo]
gb|KHN41019.1|  Auxin response factor 8                                 180   6e-48    Glycine soja [wild soybean]
ref|NP_001234783.1|  auxin response factor 8                            180   8e-48    
ref|XP_006343313.1|  PREDICTED: auxin response factor 8-like isof...    178   1e-47    Solanum tuberosum [potatoes]
ref|XP_010237021.1|  PREDICTED: auxin response factor 25-like           179   1e-47    Brachypodium distachyon [annual false brome]
ref|XP_007141982.1|  hypothetical protein PHAVU_008G242400g             179   2e-47    Phaseolus vulgaris [French bean]
ref|XP_002443554.1|  hypothetical protein SORBIDRAFT_08g021460          179   2e-47    Sorghum bicolor [broomcorn]
ref|XP_006343312.1|  PREDICTED: auxin response factor 8-like isof...    178   3e-47    Solanum tuberosum [potatoes]
gb|ABN10955.2|  auxin response factor 8                                 178   3e-47    Ipomoea nil [qian niu]
gb|AFF60411.1|  auxin response factor 8                                 178   3e-47    Nicotiana tabacum [American tobacco]
ref|XP_010250613.1|  PREDICTED: auxin response factor 8 isoform X2      177   5e-47    Nelumbo nucifera [Indian lotus]
ref|XP_003553137.1|  PREDICTED: auxin response factor 8-like            177   6e-47    Glycine max [soybeans]
gb|KEH34585.1|  auxin response factor 2                                 176   6e-47    Medicago truncatula
gb|AIB05454.1|  ARF transcription factor                                177   7e-47    Zea mays [maize]
ref|XP_009789648.1|  PREDICTED: auxin response factor 8-like            177   7e-47    Nicotiana sylvestris
ref|XP_010317649.1|  PREDICTED: auxin response factor 8-1 isoform X1    176   7e-47    Solanum lycopersicum
ref|XP_008662061.1|  PREDICTED: auxin response factor 25-like           177   7e-47    
ref|NP_001169029.1|  uncharacterized protein LOC100382863               164   8e-47    
ref|XP_010250595.1|  PREDICTED: auxin response factor 8 isoform X1      177   8e-47    Nelumbo nucifera [Indian lotus]
ref|XP_008463127.1|  PREDICTED: auxin response factor 8                 176   1e-46    Cucumis melo [Oriental melon]
ref|XP_009612885.1|  PREDICTED: auxin response factor 8-like            176   1e-46    Nicotiana tomentosiformis
ref|NP_001234552.1|  auxin response factor 8-1                          176   2e-46    Solanum lycopersicum
ref|XP_007032138.1|  Auxin response factor 8-1                          176   2e-46    
ref|XP_008813049.1|  PREDICTED: auxin response factor 12-like iso...    176   2e-46    Phoenix dactylifera
ref|XP_003616115.1|  Auxin response factor                              176   3e-46    Medicago truncatula
dbj|BAJ89575.1|  predicted protein                                      172   3e-46    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003600594.1|  Auxin response factor                              176   3e-46    Medicago truncatula
ref|XP_004963222.1|  PREDICTED: auxin response factor 25-like           176   3e-46    Setaria italica
gb|KJB48161.1|  hypothetical protein B456_008G054600                    172   3e-46    Gossypium raimondii
ref|XP_008343154.1|  PREDICTED: auxin response factor 8 isoform X2      175   4e-46    Malus domestica [apple tree]
ref|XP_008662154.1|  PREDICTED: uncharacterized protein LOC100382...    174   5e-46    Zea mays [maize]
ref|XP_008343153.1|  PREDICTED: auxin response factor 8 isoform X1      175   6e-46    
ref|XP_007221468.1|  hypothetical protein PRUPE_ppa003267mg             173   6e-46    
ref|XP_008662153.1|  PREDICTED: uncharacterized protein LOC100382...    174   7e-46    
gb|ADG43164.1|  auxin response factor 30                                174   8e-46    Zea mays [maize]
ref|XP_004960119.1|  PREDICTED: auxin response factor 12-like iso...    174   8e-46    
gb|AFW59850.1|  hypothetical protein ZEAMMB73_643249                    174   1e-45    
gb|KJB48160.1|  hypothetical protein B456_008G054600                    171   1e-45    Gossypium raimondii
gb|ADG43143.1|  auxin response factor 9                                 174   1e-45    Zea mays [maize]
ref|XP_011098000.1|  PREDICTED: auxin response factor 8-like isof...    173   1e-45    
ref|XP_008672720.1|  PREDICTED: uncharacterized protein LOC100279...    174   1e-45    Zea mays [maize]
ref|NP_001146279.1|  uncharacterized protein LOC100279854               174   1e-45    Zea mays [maize]
ref|XP_010935431.1|  PREDICTED: auxin response factor 12-like iso...    172   2e-45    
gb|ADG43137.1|  auxin response factor 3                                 173   2e-45    Zea mays [maize]
tpg|DAA35415.1|  TPA: hypothetical protein ZEAMMB73_535909              173   2e-45    
ref|XP_007146950.1|  hypothetical protein PHAVU_006G084200g             173   2e-45    Phaseolus vulgaris [French bean]
ref|XP_007146949.1|  hypothetical protein PHAVU_006G084200g             173   2e-45    Phaseolus vulgaris [French bean]
ref|XP_002447305.1|  hypothetical protein SORBIDRAFT_06g032500          173   2e-45    
ref|XP_011097999.1|  PREDICTED: auxin response factor 8-like isof...    173   2e-45    
ref|XP_011097997.1|  PREDICTED: auxin response factor 8-like isof...    173   2e-45    Sesamum indicum [beniseed]
ref|XP_004231633.1|  PREDICTED: auxin response factor 8                 173   2e-45    
ref|XP_010935427.1|  PREDICTED: auxin response factor 12-like iso...    172   2e-45    
gb|KJB48159.1|  hypothetical protein B456_008G054600                    172   5e-45    
emb|CBA12001.1|  putative auxin response factor 8                       171   5e-45    
ref|XP_008648946.1|  PREDICTED: auxin response factor 17-like iso...    168   5e-45    
gb|AIE88287.1|  hypothetical protein OG_BBa0063K01.18                   171   6e-45    
ref|XP_009769536.1|  PREDICTED: auxin response factor 8-like isof...    171   6e-45    
ref|XP_006653864.1|  PREDICTED: auxin response factor 12-like           171   7e-45    
gb|AEV41129.1|  putative auxin response factor                          171   7e-45    
gb|EMS64768.1|  Auxin response factor 12                                171   7e-45    
gb|AEV41081.1|  putative auxin response factor                          171   7e-45    
gb|EYU25686.1|  hypothetical protein MIMGU_mgv1a002020mg                171   7e-45    
sp|Q258Y5.1|ARFL_ORYSI  RecName: Full=Auxin response factor 12; A...    171   7e-45    
ref|NP_001054222.1|  Os04g0671900                                       171   7e-45    
ref|XP_006350452.1|  PREDICTED: auxin response factor 8-like isof...    172   7e-45    
ref|XP_006350451.1|  PREDICTED: auxin response factor 8-like isof...    172   7e-45    
ref|XP_009769535.1|  PREDICTED: auxin response factor 8-like isof...    171   8e-45    
dbj|BAB85918.1|  auxin response factor 8                                171   8e-45    
ref|XP_004490754.1|  PREDICTED: auxin response factor 8-like            171   8e-45    
ref|XP_003580798.1|  PREDICTED: auxin response factor 12                171   8e-45    
gb|AEV40985.1|  putative auxin response factor                          171   8e-45    
gb|AEV41036.1|  putative auxin response factor                          171   8e-45    
ref|XP_009769534.1|  PREDICTED: auxin response factor 8-like isof...    171   9e-45    
gb|EEC78229.1|  hypothetical protein OsI_17874                          171   9e-45    
gb|EMT04282.1|  Auxin response factor 25                                172   9e-45    
emb|CDP01733.1|  unnamed protein product                                171   1e-44    
gb|EMT27817.1|  Auxin response factor 12                                171   1e-44    
ref|XP_012074114.1|  PREDICTED: auxin response factor 8 isoform X1      171   1e-44    
ref|XP_011655128.1|  PREDICTED: auxin response factor 8                 171   1e-44    
ref|XP_004288582.1|  PREDICTED: auxin response factor 8                 171   1e-44    
ref|XP_002266678.2|  PREDICTED: auxin response factor 8                 171   2e-44    
gb|KJB10499.1|  hypothetical protein B456_001G204500                    170   2e-44    
ref|XP_006350450.1|  PREDICTED: auxin response factor 8-like isof...    171   2e-44    
ref|XP_006350449.1|  PREDICTED: auxin response factor 8-like isof...    171   2e-44    
gb|KHG29290.1|  Auxin response factor 12                                171   2e-44    
ref|XP_009631564.1|  PREDICTED: auxin response factor 8-like isof...    170   3e-44    
ref|XP_009631563.1|  PREDICTED: auxin response factor 8-like isof...    170   3e-44    
ref|XP_009370590.1|  PREDICTED: auxin response factor 8-like isof...    169   3e-44    
ref|XP_006591281.1|  PREDICTED: auxin response factor 8-like            170   3e-44    
ref|XP_008813064.1|  PREDICTED: auxin response factor 12-like iso...    167   4e-44    
ref|XP_009370588.1|  PREDICTED: auxin response factor 8-like isof...    169   5e-44    
ref|XP_011097996.1|  PREDICTED: auxin response factor 8-like isof...    168   6e-44    
ref|XP_008813056.1|  PREDICTED: auxin response factor 12-like iso...    167   6e-44    
ref|XP_002526195.1|  Auxin response factor, putative                    169   6e-44    
gb|AFW76012.1|  hypothetical protein ZEAMMB73_306865                    167   7e-44    
gb|AFQ94050.1|  auxin response factor 1                                 168   8e-44    
ref|XP_009341866.1|  PREDICTED: auxin response factor 8-like isof...    168   1e-43    
ref|XP_009341867.1|  PREDICTED: auxin response factor 8-like isof...    168   1e-43    
ref|XP_011097995.1|  PREDICTED: auxin response factor 8-like isof...    168   1e-43    
ref|XP_009382091.1|  PREDICTED: auxin response factor 12-like           168   1e-43    
gb|EMS45696.1|  Auxin response factor 25                                169   2e-43    
ref|XP_008648945.1|  PREDICTED: auxin response factor 17-like iso...    167   2e-43    
ref|XP_006430414.1|  hypothetical protein CICLE_v10011065mg             165   3e-43    
gb|ABK95913.1|  unknown                                                 165   3e-43    
ref|XP_011038345.1|  PREDICTED: auxin response factor 8-like            167   3e-43    
gb|AFD01302.1|  auxin response factor 6                                 167   3e-43    
ref|XP_006372462.1|  hypothetical protein POPTR_0017s01870g             166   4e-43    
ref|XP_010940284.1|  PREDICTED: LOW QUALITY PROTEIN: auxin respon...    167   4e-43    
gb|KDO57332.1|  hypothetical protein CISIN_1g003544mg                   165   6e-43    
gb|KDO57328.1|  hypothetical protein CISIN_1g003544mg                   165   9e-43    
ref|XP_006481965.1|  PREDICTED: auxin response factor 8-like isof...    166   9e-43    
gb|KDO57329.1|  hypothetical protein CISIN_1g003544mg                   165   9e-43    
gb|KDO57330.1|  hypothetical protein CISIN_1g003544mg                   165   1e-42    
ref|XP_006481964.1|  PREDICTED: auxin response factor 8-like isof...    166   1e-42    
gb|KDO57331.1|  hypothetical protein CISIN_1g003544mg                   165   1e-42    
dbj|BAK00026.1|  predicted protein                                      166   1e-42    
gb|ACB30859.1|  ARF8                                                    153   1e-42    
dbj|BAB85915.1|  auxin response factor 6b                               166   1e-42    
ref|XP_002305917.2|  hypothetical protein POPTR_0004s07640g             165   1e-42    
ref|NP_001067266.1|  Os12g0613700                                       166   1e-42    
ref|XP_006430416.1|  hypothetical protein CICLE_v10011065mg             165   1e-42    
gb|EAY83881.1|  hypothetical protein OsI_39101                          166   1e-42    
ref|XP_010435545.1|  PREDICTED: auxin response factor 8-like            165   2e-42    
ref|XP_008804149.1|  PREDICTED: auxin response factor 12-like           164   3e-42    
ref|XP_006282445.1|  hypothetical protein CARUB_v10004139mg             163   3e-42    
ref|XP_008348621.1|  PREDICTED: auxin response factor 8-like            164   3e-42    
gb|EPS73545.1|  hypothetical protein M569_01212                         162   4e-42    
ref|XP_006282446.1|  hypothetical protein CARUB_v10004139mg             163   6e-42    
ref|XP_004500428.1|  PREDICTED: auxin response factor 8-like            164   6e-42    
ref|NP_198518.1|  auxin response factor 8                               162   1e-41    
ref|XP_006664743.1|  PREDICTED: auxin response factor 25-like           163   1e-41    
emb|CBA12002.1|  putative auxin response factor 6/8                     162   1e-41    
ref|XP_009397958.1|  PREDICTED: auxin response factor 12-like iso...    160   2e-41    
ref|XP_010450467.1|  PREDICTED: auxin response factor 8 isoform X1      161   2e-41    
emb|CBA11998.1|  putative auxin response factor 8                       162   2e-41    
emb|CDY53537.1|  BnaCnng25410D                                          162   2e-41    
ref|XP_010908226.1|  PREDICTED: auxin response factor 12-like           162   2e-41    
ref|XP_009397956.1|  PREDICTED: auxin response factor 12-like iso...    161   3e-41    
ref|XP_010440819.1|  PREDICTED: auxin response factor 8-like isof...    161   3e-41    
ref|XP_010450468.1|  PREDICTED: auxin response factor 8 isoform X2      161   3e-41    
emb|CBA12004.1|  putative auxin response factor 5/7                     161   4e-41    
ref|XP_002870511.1|  hypothetical protein ARALYDRAFT_493698             160   5e-41    
ref|XP_009139710.1|  PREDICTED: auxin response factor 8 isoform X3      160   8e-41    
emb|CDX74594.1|  BnaA04g07950D                                          160   8e-41    
ref|XP_009139709.1|  PREDICTED: auxin response factor 8 isoform X2      160   9e-41    
gb|EAZ38013.1|  hypothetical protein OsJ_22358                          160   9e-41    
ref|XP_010551627.1|  PREDICTED: auxin response factor 8-like isof...    160   1e-40    
ref|XP_009139708.1|  PREDICTED: auxin response factor 8 isoform X1      160   1e-40    
gb|ADG60256.1|  ARF8-like protein                                       147   2e-40    
ref|XP_011048868.1|  PREDICTED: auxin response factor 8-like            158   4e-40    
ref|XP_010528612.1|  PREDICTED: auxin response factor 8-like            158   5e-40    
ref|XP_010675199.1|  PREDICTED: auxin response factor 8 isoform X1      157   1e-39    
ref|NP_001292756.1|  auxin response factor 6                            155   4e-39    
ref|XP_010551611.1|  PREDICTED: auxin response factor 8-like isof...    155   4e-39    
ref|XP_009105160.1|  PREDICTED: auxin response factor 8-like            155   5e-39    
emb|CDY39274.1|  BnaC06g27170D                                          155   6e-39    
emb|CDY07460.1|  BnaA07g25390D                                          154   6e-39    
gb|KGN50892.1|  hypothetical protein Csa_5G315370                       152   4e-38    
ref|XP_006391521.1|  hypothetical protein EUTSA_v10018139mg             150   2e-37    
ref|XP_001773496.1|  predicted protein                                  151   2e-37    
ref|XP_006430415.1|  hypothetical protein CICLE_v10011065mg             149   4e-37    
ref|XP_001764067.1|  predicted protein                                  147   4e-36    
ref|XP_002982854.1|  hypothetical protein SELMODRAFT_179736             147   6e-36    
ref|XP_008227867.1|  PREDICTED: LOW QUALITY PROTEIN: auxin respon...    145   1e-35    
ref|XP_002990954.1|  hypothetical protein SELMODRAFT_451392             143   7e-35    
ref|XP_009778804.1|  PREDICTED: auxin response factor 5                 143   2e-34    
gb|AAO14628.1|AF467900_5  hypothetical transcription factor             142   2e-34    
ref|XP_010246954.1|  PREDICTED: auxin response factor 5-like isof...    142   3e-34    
ref|XP_010246955.1|  PREDICTED: auxin response factor 5-like isof...    142   3e-34    
ref|XP_008221297.1|  PREDICTED: auxin response factor 5 isoform X1      142   3e-34    
ref|XP_010692716.1|  PREDICTED: auxin response factor 5                 142   3e-34    
ref|XP_010061492.1|  PREDICTED: auxin response factor 5 isoform X2      142   3e-34    
ref|XP_010061491.1|  PREDICTED: auxin response factor 5 isoform X1      142   3e-34    
ref|XP_002324725.1|  auxin response factor 1 family protein             142   3e-34    
ref|XP_008221298.1|  PREDICTED: auxin response factor 5 isoform X2      142   3e-34    
gb|KCW68434.1|  hypothetical protein EUGRSUZ_F02090                     141   4e-34    
ref|XP_001771108.1|  predicted protein                                  132   5e-34    
pdb|4CHK|A  Chain A, Crystal Structure Of The Arf5 Oligomerizatio...    130   6e-34    
ref|XP_007225352.1|  hypothetical protein PRUPE_ppa000946mg             141   7e-34    
gb|AIF77047.1|  auxin response factor 8                                 129   7e-34    
ref|XP_008663703.1|  PREDICTED: auxin response factor 11 isoform X2     140   1e-33    
ref|XP_008663701.1|  PREDICTED: auxin response factor 11 isoform X1     140   1e-33    
gb|ADG43163.1|  auxin response factor 29                                140   1e-33    
gb|AFW59776.1|  hypothetical protein ZEAMMB73_806966                    140   1e-33    
ref|XP_009616118.1|  PREDICTED: auxin response factor 5                 140   1e-33    
ref|XP_002448710.1|  hypothetical protein SORBIDRAFT_06g031900          140   2e-33    
gb|EMS49956.1|  Auxin response factor 11                                140   2e-33    
ref|XP_010271412.1|  PREDICTED: auxin response factor 5-like            139   3e-33    
gb|ABR25348.1|  auxin responsive protein                                131   4e-33    
ref|XP_004960194.1|  PREDICTED: LOW QUALITY PROTEIN: auxin respon...    139   4e-33    
gb|AHC30881.1|  auxin response factor                                   139   5e-33    
ref|XP_008801434.1|  PREDICTED: auxin response factor 19-like           139   5e-33    
ref|XP_008668391.1|  PREDICTED: auxin response factor 4 isoform X2      138   6e-33    
ref|XP_004147836.1|  PREDICTED: auxin response factor 5 isoform X1      138   6e-33    
ref|XP_011652441.1|  PREDICTED: auxin response factor 5 isoform X2      138   6e-33    
ref|NP_001169359.1|  auxin response factor 4                            138   6e-33    
gb|ADG43138.1|  auxin response factor 4                                 138   6e-33    
ref|XP_008668389.1|  PREDICTED: auxin response factor 4 isoform X1      138   6e-33    
dbj|BAK01131.1|  predicted protein                                      138   6e-33    
gb|EMT31390.1|  Auxin response factor 11                                138   7e-33    
ref|XP_008242274.1|  PREDICTED: auxin response factor 7-like isof...    138   8e-33    
ref|XP_008242276.1|  PREDICTED: auxin response factor 7-like isof...    138   9e-33    
ref|XP_008242275.1|  PREDICTED: auxin response factor 7-like isof...    138   9e-33    
ref|XP_010929406.1|  PREDICTED: auxin response factor 19-like iso...    138   9e-33    
ref|XP_010095167.1|  Auxin response factor 5                            137   1e-32    
ref|XP_010929405.1|  PREDICTED: auxin response factor 19-like iso...    138   1e-32    
gb|EAY95938.1|  hypothetical protein OsI_17805                          137   1e-32    
ref|XP_007203220.1|  hypothetical protein PRUPE_ppa000708mg             137   1e-32    
emb|CAE04850.2|  OSJNBa0084K01.22                                       137   1e-32    
ref|NP_001054169.2|  Os04g0664400                                       137   1e-32    
ref|XP_011006173.1|  PREDICTED: auxin response factor 19-like iso...    137   1e-32    
ref|XP_010927184.1|  PREDICTED: auxin response factor 19-like iso...    137   1e-32    
ref|XP_011006169.1|  PREDICTED: auxin response factor 19-like iso...    137   1e-32    
ref|NP_001234545.1|  auxin response factor 5                            137   2e-32    
ref|XP_011006171.1|  PREDICTED: auxin response factor 19-like iso...    137   2e-32    
gb|KDO84793.1|  hypothetical protein CISIN_1g0025162mg                  135   2e-32    
tpg|DAA35416.1|  TPA: hypothetical protein ZEAMMB73_535909              136   2e-32    
emb|CAE03604.2|  OSJNBb0004A17.6                                        136   2e-32    
ref|XP_010927183.1|  PREDICTED: auxin response factor 19-like iso...    137   2e-32    
ref|XP_009390467.1|  PREDICTED: auxin response factor 19-like iso...    136   2e-32    
ref|XP_006342026.1|  PREDICTED: auxin response factor 5-like            136   2e-32    
ref|XP_008466503.1|  PREDICTED: auxin response factor 5 isoform X2      136   2e-32    
ref|XP_008466501.1|  PREDICTED: auxin response factor 5 isoform X1      136   2e-32    
ref|XP_012074115.1|  PREDICTED: auxin response factor 8 isoform X2      136   3e-32    
ref|XP_004291385.1|  PREDICTED: auxin response factor 5                 136   3e-32    
ref|XP_009390465.1|  PREDICTED: auxin response factor 19-like iso...    136   4e-32    
ref|XP_008798163.1|  PREDICTED: auxin response factor 19-like iso...    136   4e-32    
ref|XP_011039940.1|  PREDICTED: auxin response factor 19-like iso...    136   5e-32    
ref|XP_008798164.1|  PREDICTED: auxin response factor 19-like iso...    136   5e-32    
emb|CDP12498.1|  unnamed protein product                                136   5e-32    
ref|XP_003634382.2|  PREDICTED: auxin response factor 5                 135   5e-32    
ref|XP_010263345.1|  PREDICTED: auxin response factor 19-like iso...    135   6e-32    
gb|KHN07880.1|  Auxin response factor 19                                135   6e-32    
ref|XP_003542373.1|  PREDICTED: auxin response factor 19-like           135   6e-32    
emb|CBI19831.3|  unnamed protein product                                135   6e-32    
ref|XP_011039938.1|  PREDICTED: auxin response factor 19-like iso...    135   7e-32    
ref|XP_010263344.1|  PREDICTED: auxin response factor 19-like iso...    135   7e-32    
ref|XP_011039939.1|  PREDICTED: auxin response factor 19-like iso...    135   7e-32    
gb|AEV40929.1|  putative auxin response factor                          135   7e-32    
ref|XP_006435146.1|  hypothetical protein CICLE_v10000183mg             135   7e-32    
ref|XP_010917438.1|  PREDICTED: auxin response factor 16-like iso...    135   7e-32    
ref|XP_006381584.1|  hypothetical protein POPTR_0006s14070g             135   8e-32    
ref|XP_006381581.1|  auxin response factor 1 family protein             135   8e-32    
ref|XP_010917437.1|  PREDICTED: auxin response factor 16-like iso...    135   9e-32    
ref|XP_011045124.1|  PREDICTED: auxin response factor 5-like            135   9e-32    
ref|XP_006473629.1|  PREDICTED: auxin response factor 5-like isof...    135   9e-32    
ref|XP_006473628.1|  PREDICTED: auxin response factor 5-like isof...    135   1e-31    
ref|XP_010273878.1|  PREDICTED: auxin response factor 7-like            135   1e-31    
gb|KFK38177.1|  hypothetical protein AALP_AA3G079400                    134   1e-31    
ref|XP_006381583.1|  hypothetical protein POPTR_0006s14070g             135   1e-31    
ref|XP_003630611.1|  Auxin response factor                              135   1e-31    
emb|CDP07420.1|  unnamed protein product                                134   1e-31    
ref|XP_009413972.1|  PREDICTED: auxin response factor 19-like iso...    135   1e-31    
ref|XP_009413973.1|  PREDICTED: auxin response factor 19-like iso...    135   1e-31    
ref|XP_007017751.1|  Transcriptional factor B3 family protein / a...    134   2e-31    
ref|XP_007138629.1|  hypothetical protein PHAVU_009G224800g             134   2e-31    
gb|KHG17184.1|  Auxin response factor 19                                131   2e-31    
ref|XP_010539862.1|  PREDICTED: auxin response factor 5-like            134   2e-31    
ref|XP_008387956.1|  PREDICTED: auxin response factor 5                 134   2e-31    
emb|CAD29695.1|  early auxin-induced protein 22                         128   2e-31    
ref|XP_006452860.1|  hypothetical protein CICLE_v10007286mg             134   2e-31    
gb|KDO73830.1|  hypothetical protein CISIN_1g001728mg                   133   2e-31    
gb|AAB84358.1|  IAA21                                                   130   3e-31    
ref|XP_012073834.1|  PREDICTED: auxin response factor 5 isoform X2      133   3e-31    
ref|XP_003551063.1|  PREDICTED: auxin response factor 19-like           134   3e-31    
ref|XP_012073833.1|  PREDICTED: auxin response factor 5 isoform X1      133   3e-31    
gb|KJB14423.1|  hypothetical protein B456_002G124400                    133   3e-31    
gb|KDP36947.1|  hypothetical protein JCGZ_08238                         133   3e-31    
gb|KHN17743.1|  Auxin response factor 7                                 134   3e-31    
ref|XP_009399614.1|  PREDICTED: auxin response factor 19-like           133   4e-31    
ref|NP_001234740.1|  auxin response factor 19                           133   4e-31    



>emb|CDP16075.1| unnamed protein product [Coffea canephora]
Length=894

 Score =   324 bits (830),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 161/211 (76%), Positives = 184/211 (87%), Gaps = 5/211 (2%)
 Frame = -3

Query  806  TDSSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQ  627
            +DSS++LQNGIS+L N  GE+   ++PF+T  +TS +GTD PL+ DM TSSC+DES F+Q
Sbjct  687  SDSSLMLQNGISHLINGSGESESFSVPFATSTYTSALGTDLPLSSDMTTSSCMDESVFMQ  746

Query  626  SSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSG  447
            S+ENVDQANPP +TFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDP+RSG
Sbjct  747  SAENVDQANPPTKTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPQRSG  806

Query  446  WQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRL  267
            WQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSP EV QMGK EGIDLPN+ P    RL
Sbjct  807  WQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPLEVQQMGK-EGIDLPNSAPL--HRL  863

Query  266  PNGGSSCEVHVSQKETRN-MNGIP-LGSLDY  180
            P+ G+SC+ ++SQKETRN MNGIP +GSL Y
Sbjct  864  PSSGNSCDDYMSQKETRNSMNGIPTVGSLHY  894



>ref|XP_009602214.1| PREDICTED: auxin response factor 6-like isoform X2 [Nicotiana 
tomentosiformis]
Length=892

 Score =   323 bits (828),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 163/210 (78%), Positives = 182/210 (87%), Gaps = 4/210 (2%)
 Frame = -3

Query  806  TDSSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQ  627
            TDS  +LQNG+SN+K+S G+NG L++P++T  FT+ VG +YP+N DM TSSCVDESGFLQ
Sbjct  686  TDSLNILQNGMSNMKDSSGDNGSLSIPYATSTFTNTVGNEYPINSDMTTSSCVDESGFLQ  745

Query  626  SSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSG  447
            SSEN DQANP NRTFVKVHKSGSFGRSLDISKFSSYHELRSELA MFGLEGLLEDPERSG
Sbjct  746  SSENGDQANPTNRTFVKVHKSGSFGRSLDISKFSSYHELRSELAHMFGLEGLLEDPERSG  805

Query  446  WQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRL  267
            WQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSP EV QMGK  G+DLPN   A  QRL
Sbjct  806  WQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPLEVQQMGK-AGLDLPNAGQA--QRL  862

Query  266  PNGGSSCEVHVSQKETRN-MNGIPLGSLDY  180
            P+ G  C+ +++QK +RN MNGIPLGSLDY
Sbjct  863  PSNGVGCDDYMNQKGSRNTMNGIPLGSLDY  892



>ref|XP_009602213.1| PREDICTED: auxin response factor 6-like isoform X1 [Nicotiana 
tomentosiformis]
Length=893

 Score =   323 bits (828),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 163/210 (78%), Positives = 182/210 (87%), Gaps = 4/210 (2%)
 Frame = -3

Query  806  TDSSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQ  627
            TDS  +LQNG+SN+K+S G+NG L++P++T  FT+ VG +YP+N DM TSSCVDESGFLQ
Sbjct  687  TDSLNILQNGMSNMKDSSGDNGSLSIPYATSTFTNTVGNEYPINSDMTTSSCVDESGFLQ  746

Query  626  SSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSG  447
            SSEN DQANP NRTFVKVHKSGSFGRSLDISKFSSYHELRSELA MFGLEGLLEDPERSG
Sbjct  747  SSENGDQANPTNRTFVKVHKSGSFGRSLDISKFSSYHELRSELAHMFGLEGLLEDPERSG  806

Query  446  WQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRL  267
            WQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSP EV QMGK  G+DLPN   A  QRL
Sbjct  807  WQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPLEVQQMGK-AGLDLPNAGQA--QRL  863

Query  266  PNGGSSCEVHVSQKETRN-MNGIPLGSLDY  180
            P+ G  C+ +++QK +RN MNGIPLGSLDY
Sbjct  864  PSNGVGCDDYMNQKGSRNTMNGIPLGSLDY  893



>ref|XP_006357892.1| PREDICTED: auxin response factor 6-like isoform X1 [Solanum tuberosum]
Length=893

 Score =   318 bits (815),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 160/210 (76%), Positives = 177/210 (84%), Gaps = 2/210 (1%)
 Frame = -3

Query  806  TDSSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQ  627
            TDS  +LQ G+SN+K S G+NG L++P++T  FTS VG +YPLN DM  SSCVDESGFLQ
Sbjct  685  TDSLNILQTGMSNMKGSSGDNGSLSIPYATSTFTSTVGNEYPLNSDMTASSCVDESGFLQ  744

Query  626  SSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSG  447
            SSEN DQANP NR FVKV KSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSG
Sbjct  745  SSENGDQANPTNRIFVKVQKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSG  804

Query  446  WQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRL  267
            WQLV VDRENDVLLLGDDPWQEFVNNVWYIKILSP EV QMGK EG+DLPN + A  Q L
Sbjct  805  WQLVIVDRENDVLLLGDDPWQEFVNNVWYIKILSPHEVQQMGK-EGLDLPNGVQAQTQTL  863

Query  266  PNGGSSCEVHVSQKETRN-MNGIPLGSLDY  180
            P   + C+ +++QK +RN MNGIPLGSLDY
Sbjct  864  PGNVNGCDDYMNQKGSRNTMNGIPLGSLDY  893



>ref|XP_006357893.1| PREDICTED: auxin response factor 6-like isoform X2 [Solanum tuberosum]
Length=892

 Score =   318 bits (815),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 160/210 (76%), Positives = 177/210 (84%), Gaps = 2/210 (1%)
 Frame = -3

Query  806  TDSSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQ  627
            TDS  +LQ G+SN+K S G+NG L++P++T  FTS VG +YPLN DM  SSCVDESGFLQ
Sbjct  684  TDSLNILQTGMSNMKGSSGDNGSLSIPYATSTFTSTVGNEYPLNSDMTASSCVDESGFLQ  743

Query  626  SSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSG  447
            SSEN DQANP NR FVKV KSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSG
Sbjct  744  SSENGDQANPTNRIFVKVQKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSG  803

Query  446  WQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRL  267
            WQLV VDRENDVLLLGDDPWQEFVNNVWYIKILSP EV QMGK EG+DLPN + A  Q L
Sbjct  804  WQLVIVDRENDVLLLGDDPWQEFVNNVWYIKILSPHEVQQMGK-EGLDLPNGVQAQTQTL  862

Query  266  PNGGSSCEVHVSQKETRN-MNGIPLGSLDY  180
            P   + C+ +++QK +RN MNGIPLGSLDY
Sbjct  863  PGNVNGCDDYMNQKGSRNTMNGIPLGSLDY  892



>gb|ADH04265.1| ARF1 [Nicotiana benthamiana]
Length=889

 Score =   317 bits (813),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 159/210 (76%), Positives = 180/210 (86%), Gaps = 4/210 (2%)
 Frame = -3

Query  806  TDSSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQ  627
            TD   +LQNG+SN+K+S G+NG L++P++T  FT+ VG +YP+N DM TSSCVDESGFLQ
Sbjct  683  TDCLNILQNGMSNMKDSTGDNGSLSIPYATSTFTNTVGNEYPINSDMTTSSCVDESGFLQ  742

Query  626  SSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSG  447
            SSEN DQ NP NRTFVKVHKSGSFGRSLDISKFS+YHELRSELA MFGLEGLLEDPERSG
Sbjct  743  SSENGDQRNPTNRTFVKVHKSGSFGRSLDISKFSNYHELRSELAHMFGLEGLLEDPERSG  802

Query  446  WQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRL  267
            WQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSP EV QMGK +G+DLPN      QRL
Sbjct  803  WQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPLEVQQMGK-DGLDLPNA--GLAQRL  859

Query  266  PNGGSSCEVHVSQKETRN-MNGIPLGSLDY  180
            P+ G  C+ +++QK +RN MNGIPLGSLDY
Sbjct  860  PSNGVGCDDYMNQKGSRNTMNGIPLGSLDY  889



>ref|XP_009757616.1| PREDICTED: auxin response factor 6-like isoform X2 [Nicotiana 
sylvestris]
Length=892

 Score =   316 bits (810),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 159/210 (76%), Positives = 180/210 (86%), Gaps = 4/210 (2%)
 Frame = -3

Query  806  TDSSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQ  627
            TDS  +L NG+SN+K+S G+NG L++P++T  FT+ VG +YP+N DM TSSCVDESGFLQ
Sbjct  686  TDSLNILPNGMSNMKDSSGDNGSLSIPYATSTFTNTVGNEYPINSDMTTSSCVDESGFLQ  745

Query  626  SSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSG  447
            SSEN DQ NP NRTFVKVHKSGSFGRSLDISKFSSYHELRSELA MFGLEGLLEDPERSG
Sbjct  746  SSENGDQGNPTNRTFVKVHKSGSFGRSLDISKFSSYHELRSELAHMFGLEGLLEDPERSG  805

Query  446  WQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRL  267
            WQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSP EV QMGK +G+DLPN      QRL
Sbjct  806  WQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPLEVQQMGK-DGLDLPNA--GLVQRL  862

Query  266  PNGGSSCEVHVSQKETRN-MNGIPLGSLDY  180
            P+ G  C+ +++QK ++N MNGIPLGSLDY
Sbjct  863  PSNGVGCDDYMNQKGSQNAMNGIPLGSLDY  892



>ref|XP_009757615.1| PREDICTED: auxin response factor 6-like isoform X1 [Nicotiana 
sylvestris]
Length=893

 Score =   316 bits (810),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 159/210 (76%), Positives = 180/210 (86%), Gaps = 4/210 (2%)
 Frame = -3

Query  806  TDSSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQ  627
            TDS  +L NG+SN+K+S G+NG L++P++T  FT+ VG +YP+N DM TSSCVDESGFLQ
Sbjct  687  TDSLNILPNGMSNMKDSSGDNGSLSIPYATSTFTNTVGNEYPINSDMTTSSCVDESGFLQ  746

Query  626  SSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSG  447
            SSEN DQ NP NRTFVKVHKSGSFGRSLDISKFSSYHELRSELA MFGLEGLLEDPERSG
Sbjct  747  SSENGDQGNPTNRTFVKVHKSGSFGRSLDISKFSSYHELRSELAHMFGLEGLLEDPERSG  806

Query  446  WQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRL  267
            WQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSP EV QMGK +G+DLPN      QRL
Sbjct  807  WQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPLEVQQMGK-DGLDLPNA--GLVQRL  863

Query  266  PNGGSSCEVHVSQKETRN-MNGIPLGSLDY  180
            P+ G  C+ +++QK ++N MNGIPLGSLDY
Sbjct  864  PSNGVGCDDYMNQKGSQNAMNGIPLGSLDY  893



>gb|ACM66271.1| ARF8 [Solanum melongena]
Length=891

 Score =   307 bits (786),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 157/210 (75%), Positives = 175/210 (83%), Gaps = 4/210 (2%)
 Frame = -3

Query  806  TDSSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQ  627
            TDS  +LQ G+SN+K S G+NG L++P++   FTS VG +YPLN DM  SSCVDESGFLQ
Sbjct  685  TDSLNILQTGMSNMKGSSGDNGSLSIPYAISTFTSTVGNEYPLNSDMTASSCVDESGFLQ  744

Query  626  SSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSG  447
            SSEN DQAN  NR FVKV KSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSG
Sbjct  745  SSENGDQANQTNRIFVKVQKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSG  804

Query  446  WQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRL  267
            WQLV VDRENDVLLLGDDPWQEFVNNVWYIKILSP+EV QMGK EG+DL N +    QRL
Sbjct  805  WQLVIVDRENDVLLLGDDPWQEFVNNVWYIKILSPYEVQQMGK-EGLDLLNGV--RTQRL  861

Query  266  PNGGSSCEVHVSQKETRN-MNGIPLGSLDY  180
            P   + C+ +++QK +RN MNGIPLGSLDY
Sbjct  862  PGNVNGCDDYMNQKGSRNTMNGIPLGSLDY  891



>ref|XP_010106165.1| Auxin response factor 6 [Morus notabilis]
 gb|EXC08253.1| Auxin response factor 6 [Morus notabilis]
Length=1035

 Score =   299 bits (766),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 149/209 (71%), Positives = 175/209 (84%), Gaps = 5/209 (2%)
 Frame = -3

Query  800   SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSS  621
             SS+++QNG+S L+N G EN  L+MPF + N++S  GTD+PLN DM TSSCVDESGFLQSS
Sbjct  830   SSLMMQNGMSTLRNMGSENDSLSMPFGSSNYSSATGTDFPLNSDMTTSSCVDESGFLQSS  889

Query  620   ENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQ  441
             EN DQ NPP RTFVKVHKSGSFGRSLDISKFSSY ELRSELARMFGLEG LEDP+RSGWQ
Sbjct  890   ENGDQVNPPTRTFVKVHKSGSFGRSLDISKFSSYDELRSELARMFGLEGQLEDPQRSGWQ  949

Query  440   LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPN  261
             LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSP EV QMGK EG+   +++P+   +L N
Sbjct  950   LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPLEVQQMGK-EGLSPASSVPS--HKLSN  1006

Query  260   GGSSCEVHVSQKETRN-MNGIP-LGSLDY  180
               ++C+ ++S+++ RN  NGIP +G LDY
Sbjct  1007  SNNACDDYISRQDMRNSSNGIPSMGDLDY  1035



>ref|XP_004304523.1| PREDICTED: auxin response factor 6-like isoform X2 [Fragaria 
vesca subsp. vesca]
Length=915

 Score =   289 bits (739),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 151/209 (72%), Positives = 170/209 (81%), Gaps = 6/209 (3%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSS  621
            SS++LQNGI NL+N G     L+MPF   N+T+  G DYPLN DM TSSCVDESGFLQSS
Sbjct  711  SSLMLQNGIPNLRNIGNGTDSLSMPFGASNYTT-TGNDYPLNSDMTTSSCVDESGFLQSS  769

Query  620  ENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQ  441
            ENVDQ NPP RTFVKVHK GSFGRSLDISKFSSY ELRSEL  MFGLEG LEDP+RSGWQ
Sbjct  770  ENVDQINPPTRTFVKVHKLGSFGRSLDISKFSSYDELRSELGSMFGLEGQLEDPQRSGWQ  829

Query  440  LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPN  261
            LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSP EV QMGK EG++   ++P+  Q+  N
Sbjct  830  LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPLEVQQMGK-EGLNSVASVPS--QKQSN  886

Query  260  GGSSCEVHVSQKETRN-MNGIP-LGSLDY  180
            G S+C+ +VS+++ RN  NGI  LGSLDY
Sbjct  887  GNSTCDDYVSRQDMRNSSNGIASLGSLDY  915



>ref|XP_011085439.1| PREDICTED: auxin response factor 6-like [Sesamum indicum]
Length=929

 Score =   289 bits (739),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 150/210 (71%), Positives = 176/210 (84%), Gaps = 6/210 (3%)
 Frame = -3

Query  803  DSSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQS  624
            DSS ++ +G+S L+NSG ENG L+MPF+T  F S   TD+PLN DM TSSCVDESG+LQS
Sbjct  724  DSSAIMPSGMSTLRNSGNENGSLSMPFATPAFASAGRTDFPLNSDMTTSSCVDESGYLQS  783

Query  623  SENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGW  444
            SENVDQ NPP  TFVKVHKSGSFGRSLDISKFSSY+ELRSELA MFGLEGLLEDP+RSGW
Sbjct  784  SENVDQTNPPPGTFVKVHKSGSFGRSLDISKFSSYNELRSELAHMFGLEGLLEDPQRSGW  843

Query  443  QLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLP  264
            QLVFVDRENDVLLLGDDPWQEFVN+VWYIKILSP EV QMGK EG+D PN++   +  L 
Sbjct  844  QLVFVDRENDVLLLGDDPWQEFVNSVWYIKILSPLEVQQMGK-EGLD-PNSV--QSHYLS  899

Query  263  NGGSSCEVHVSQKETR-NMNGIP-LGSLDY  180
            + G+SC+  +S+ + R ++NGIP +G+LDY
Sbjct  900  SNGNSCDEFMSRNDPRTSLNGIPSVGTLDY  929



>ref|XP_011468187.1| PREDICTED: auxin response factor 6-like isoform X1 [Fragaria 
vesca subsp. vesca]
Length=949

 Score =   288 bits (737),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 151/209 (72%), Positives = 170/209 (81%), Gaps = 6/209 (3%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSS  621
            SS++LQNGI NL+N G     L+MPF   N+T+  G DYPLN DM TSSCVDESGFLQSS
Sbjct  745  SSLMLQNGIPNLRNIGNGTDSLSMPFGASNYTT-TGNDYPLNSDMTTSSCVDESGFLQSS  803

Query  620  ENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQ  441
            ENVDQ NPP RTFVKVHK GSFGRSLDISKFSSY ELRSEL  MFGLEG LEDP+RSGWQ
Sbjct  804  ENVDQINPPTRTFVKVHKLGSFGRSLDISKFSSYDELRSELGSMFGLEGQLEDPQRSGWQ  863

Query  440  LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPN  261
            LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSP EV QMGK EG++   ++P+  Q+  N
Sbjct  864  LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPLEVQQMGK-EGLNSVASVPS--QKQSN  920

Query  260  GGSSCEVHVSQKETRN-MNGIP-LGSLDY  180
            G S+C+ +VS+++ RN  NGI  LGSLDY
Sbjct  921  GNSTCDDYVSRQDMRNSSNGIASLGSLDY  949



>ref|XP_007048898.1| Auxin response factor 6 isoform 2 [Theobroma cacao]
 gb|EOX93055.1| Auxin response factor 6 isoform 2 [Theobroma cacao]
Length=913

 Score =   285 bits (728),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 143/209 (68%), Positives = 173/209 (83%), Gaps = 5/209 (2%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSS  621
            SS++LQ+G++NLKN G EN  L++P++  NFTS  GTD+PLN DM TSSCVDESG+LQSS
Sbjct  708  SSLMLQHGMTNLKNIGNENDSLSLPYAASNFTSASGTDFPLNSDMTTSSCVDESGYLQSS  767

Query  620  ENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQ  441
            ENVDQ NP   TF+KVHKSGSFGRSLDISKFSSY ELR ELARMFGLEG LEDP+RSGWQ
Sbjct  768  ENVDQVNPTTGTFLKVHKSGSFGRSLDISKFSSYDELRCELARMFGLEGQLEDPQRSGWQ  827

Query  440  LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPN  261
            LVFVDREND+LLLGDDPWQEFVNNVWYIKILSP EV QMGK EG+    ++P+  QRL +
Sbjct  828  LVFVDRENDILLLGDDPWQEFVNNVWYIKILSPHEVQQMGK-EGLTPATSVPS--QRLTH  884

Query  260  GGSSCEVHVSQKETRNM-NGIP-LGSLDY  180
              + C+ ++S+++ R+  NG+  +GSL+Y
Sbjct  885  SSNHCDDYMSRQDLRSSGNGLASMGSLEY  913



>ref|XP_010657096.1| PREDICTED: auxin response factor 17-like [Vitis vinifera]
Length=947

 Score =   285 bits (729),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 139/186 (75%), Positives = 159/186 (85%), Gaps = 3/186 (2%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSS  621
            SS++LQNG+SNL++ G EN  ++MPFST NF +  GTD+PLN DM TSSC+DESGFLQSS
Sbjct  763  SSLMLQNGMSNLRSIGSENDSVSMPFSTPNFANAPGTDFPLNSDMTTSSCIDESGFLQSS  822

Query  620  ENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQ  441
            EN++Q NPP RTFVKVHK GSFGRSLDI+KFSSY ELR EL RMFGLEG LEDP RSGWQ
Sbjct  823  ENLEQVNPPTRTFVKVHKLGSFGRSLDITKFSSYDELRGELGRMFGLEGRLEDPLRSGWQ  882

Query  440  LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPN  261
            LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSP EV QMGK EGI++PN +P+   R+ N
Sbjct  883  LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPLEVQQMGK-EGINVPNPIPS--HRISN  939

Query  260  GGSSCE  243
             G+SC+
Sbjct  940  SGNSCD  945



>gb|AHY24213.1| auxin response factor, partial [Dimocarpus longan]
Length=877

 Score =   283 bits (723),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 148/209 (71%), Positives = 172/209 (82%), Gaps = 7/209 (3%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSS  621
            SS++ Q+G+ NLKN G EN  L +PF+  NFTS VGTD+PLN +M TSSCVDESGFL SS
Sbjct  674  SSLMAQHGLQNLKNIGSENDSLPLPFAASNFTSAVGTDFPLNSEMTTSSCVDESGFLHSS  733

Query  620  ENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQ  441
            ENV+Q N  NRTFVKVHKSGSFGRSLDISKFSSY ELRSELARMFGLEG LED +RSGWQ
Sbjct  734  ENVEQVNTSNRTFVKVHKSGSFGRSLDISKFSSYDELRSELARMFGLEGQLEDSQRSGWQ  793

Query  440  LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPN  261
            LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSP EV QMGK EG+   +++P   QRL N
Sbjct  794  LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPLEVQQMGK-EGLSSMSSVPG--QRLSN  850

Query  260  GGSSCEVHVSQKETR-NMNGIP-LGSLDY  180
              ++C+ ++S++E R + NG+  +GSLDY
Sbjct  851  --NNCDDYLSRQELRSSSNGVASMGSLDY  877



>ref|XP_007217690.1| hypothetical protein PRUPE_ppa001069mg [Prunus persica]
 gb|EMJ18889.1| hypothetical protein PRUPE_ppa001069mg [Prunus persica]
Length=919

 Score =   283 bits (724),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 149/210 (71%), Positives = 170/210 (81%), Gaps = 7/210 (3%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSS  621
            SS++L NGI  L+N G  N  L+MPF   ++TS  G D+PLN DM TSSCVDESGFLQSS
Sbjct  714  SSLMLHNGIPTLRNIGNGNDSLSMPFGASSYTSATGNDFPLNSDMTTSSCVDESGFLQSS  773

Query  620  ENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQ  441
            ENVDQ NP  R FVKVHKSGSFGRSLDISKFSSY ELRSELARMFGLEG LEDP+RSGWQ
Sbjct  774  ENVDQVNP-TRNFVKVHKSGSFGRSLDISKFSSYDELRSELARMFGLEGQLEDPQRSGWQ  832

Query  440  LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPN  261
            LVF DRENDVLLLGDDPWQEFVNNVWYIKILSP EV QMGK EG++   ++P+   +L N
Sbjct  833  LVFGDRENDVLLLGDDPWQEFVNNVWYIKILSPLEVQQMGK-EGLNCAASVPS--NKLSN  889

Query  260  GG-SSCEVHVSQKETRN-MNGIP-LGSLDY  180
            GG ++C+ +VS+++ RN  NGI  LGSLDY
Sbjct  890  GGNTTCDDYVSRQDVRNSTNGIASLGSLDY  919



>ref|XP_011032737.1| PREDICTED: auxin response factor 6-like isoform X1 [Populus euphratica]
Length=909

 Score =   282 bits (721),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 147/209 (70%), Positives = 169/209 (81%), Gaps = 7/209 (3%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSS  621
            S+ +LQ+GI NL+N G EN  L+MPF+   FTS  G+D PLN DM  SSCVDESGFLQSS
Sbjct  706  STFMLQHGIPNLRNIGTENDPLSMPFAASTFTSATGSDIPLNSDMTASSCVDESGFLQSS  765

Query  620  ENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQ  441
            ENVDQ NP  RTFVKVHKSGS+GRSLDISKFSSY ELRSELAR+F LEGLLEDP+RSGWQ
Sbjct  766  ENVDQVNPSTRTFVKVHKSGSYGRSLDISKFSSYDELRSELARLFCLEGLLEDPQRSGWQ  825

Query  440  LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPN  261
            LVF DRENDVLLLGDDPWQEFVNNVWYIKILSP EV QMGK EG+    ++P+  Q+L N
Sbjct  826  LVFGDRENDVLLLGDDPWQEFVNNVWYIKILSPLEVQQMGK-EGLSPAASVPS--QKLSN  882

Query  260  GGSSCEVHVSQKETRN-MNGIP-LGSLDY  180
              S+C+ H++++  RN  NGI  +GSLDY
Sbjct  883  --SNCDGHMNRQGFRNSSNGIASMGSLDY  909



>ref|XP_008229616.1| PREDICTED: auxin response factor 6-like isoform X2 [Prunus mume]
Length=915

 Score =   282 bits (721),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 150/213 (70%), Positives = 168/213 (79%), Gaps = 13/213 (6%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSS  621
            SS++L NGI  L+N G  N  L+MPF   ++TS  G D+PLN DM TSSCVDESGFLQSS
Sbjct  710  SSLMLHNGIPTLRNIGNGNDSLSMPFGASSYTSATGNDFPLNSDMTTSSCVDESGFLQSS  769

Query  620  ENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQ  441
            ENVDQ NP  R FVKVHKSGSFGRSLDISKFSSY ELRSELARMFGLEG LEDP+RSGWQ
Sbjct  770  ENVDQVNP-TRNFVKVHKSGSFGRSLDISKFSSYDELRSELARMFGLEGQLEDPQRSGWQ  828

Query  440  LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKE---EGIDLPNNLPAANQR  270
            LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSP EV QMGKE       +P+N      +
Sbjct  829  LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPHEVQQMGKEGHNRAASVPSN------K  882

Query  269  LPNGG-SSCEVHVSQKETRN-MNGIP-LGSLDY  180
            L NGG ++C+ +VS+++ RN  NGI  LGSLDY
Sbjct  883  LSNGGNNTCDDYVSRQDLRNSTNGIASLGSLDY  915



>ref|XP_011032738.1| PREDICTED: auxin response factor 6-like isoform X2 [Populus euphratica]
Length=908

 Score =   282 bits (721),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 147/209 (70%), Positives = 169/209 (81%), Gaps = 7/209 (3%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSS  621
            S+ +LQ+GI NL+N G EN  L+MPF+   FTS  G+D PLN DM  SSCVDESGFLQSS
Sbjct  705  STFMLQHGIPNLRNIGTENDPLSMPFAASTFTSATGSDIPLNSDMTASSCVDESGFLQSS  764

Query  620  ENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQ  441
            ENVDQ NP  RTFVKVHKSGS+GRSLDISKFSSY ELRSELAR+F LEGLLEDP+RSGWQ
Sbjct  765  ENVDQVNPSTRTFVKVHKSGSYGRSLDISKFSSYDELRSELARLFCLEGLLEDPQRSGWQ  824

Query  440  LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPN  261
            LVF DRENDVLLLGDDPWQEFVNNVWYIKILSP EV QMGK EG+    ++P+  Q+L N
Sbjct  825  LVFGDRENDVLLLGDDPWQEFVNNVWYIKILSPLEVQQMGK-EGLSPAASVPS--QKLSN  881

Query  260  GGSSCEVHVSQKETRN-MNGIP-LGSLDY  180
              S+C+ H++++  RN  NGI  +GSLDY
Sbjct  882  --SNCDGHMNRQGFRNSSNGIASMGSLDY  908



>gb|ADK91822.1| auxin response factor 6 [Solanum lycopersicum]
Length=868

 Score =   281 bits (719),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 144/202 (71%), Positives = 166/202 (82%), Gaps = 4/202 (2%)
 Frame = -3

Query  782  NGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSSENVDQA  603
            NG+SNLK +  ENG L +P++T  FTS VG +YP+N DM TSSCVDESG LQSSENVDQA
Sbjct  670  NGMSNLKGNSPENGSLPVPYATSTFTSTVGGEYPVNSDMTTSSCVDESGVLQSSENVDQA  729

Query  602  NPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQLVFVDR  423
            N    TFVKV+KS SFGRSLDISKFSSY+ELRSELARMFGLEGLLEDPERSGWQLVFVDR
Sbjct  730  NSLTETFVKVYKSESFGRSLDISKFSSYNELRSELARMFGLEGLLEDPERSGWQLVFVDR  789

Query  422  ENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPNGGSSCE  243
            ENDVLLLGDDPW EFVN+VWYIKILSP EV QMGK +G+DLP+      QR+ + G+ C+
Sbjct  790  ENDVLLLGDDPWHEFVNSVWYIKILSPLEVQQMGK-QGLDLPSA--GKTQRITSNGNGCD  846

Query  242  VHVSQKETRN-MNGIPLGSLDY  180
              +++  + N MNGIPLGSL+Y
Sbjct  847  DSMNRNHSCNIMNGIPLGSLEY  868



>ref|NP_001234663.1| auxin response factor 6 [Solanum lycopersicum]
 gb|ACU30063.2| auxin response factor 6 [Solanum lycopersicum]
Length=881

 Score =   281 bits (719),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 144/202 (71%), Positives = 166/202 (82%), Gaps = 4/202 (2%)
 Frame = -3

Query  782  NGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSSENVDQA  603
            NG+SNLK +  ENG L +P++T  FTS VG +YP+N DM TSSCVDESG LQSSENVDQA
Sbjct  683  NGMSNLKGNSPENGSLPVPYATSTFTSTVGGEYPVNSDMTTSSCVDESGVLQSSENVDQA  742

Query  602  NPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQLVFVDR  423
            N    TFVKV+KS SFGRSLDISKFSSY+ELRSELARMFGLEGLLEDPERSGWQLVFVDR
Sbjct  743  NSLTETFVKVYKSESFGRSLDISKFSSYNELRSELARMFGLEGLLEDPERSGWQLVFVDR  802

Query  422  ENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPNGGSSCE  243
            ENDVLLLGDDPW EFVN+VWYIKILSP EV QMGK +G+DLP+      QR+ + G+ C+
Sbjct  803  ENDVLLLGDDPWHEFVNSVWYIKILSPLEVQQMGK-QGLDLPSA--GKTQRITSNGNGCD  859

Query  242  VHVSQKETRN-MNGIPLGSLDY  180
              +++  + N MNGIPLGSL+Y
Sbjct  860  DSMNRNHSCNIMNGIPLGSLEY  881



>ref|XP_008229615.1| PREDICTED: auxin response factor 6-like isoform X1 [Prunus mume]
Length=947

 Score =   281 bits (720),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 150/213 (70%), Positives = 168/213 (79%), Gaps = 13/213 (6%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSS  621
            SS++L NGI  L+N G  N  L+MPF   ++TS  G D+PLN DM TSSCVDESGFLQSS
Sbjct  742  SSLMLHNGIPTLRNIGNGNDSLSMPFGASSYTSATGNDFPLNSDMTTSSCVDESGFLQSS  801

Query  620  ENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQ  441
            ENVDQ NP  R FVKVHKSGSFGRSLDISKFSSY ELRSELARMFGLEG LEDP+RSGWQ
Sbjct  802  ENVDQVNP-TRNFVKVHKSGSFGRSLDISKFSSYDELRSELARMFGLEGQLEDPQRSGWQ  860

Query  440  LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKE---EGIDLPNNLPAANQR  270
            LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSP EV QMGKE       +P+N      +
Sbjct  861  LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPHEVQQMGKEGHNRAASVPSN------K  914

Query  269  LPNGG-SSCEVHVSQKETRN-MNGIP-LGSLDY  180
            L NGG ++C+ +VS+++ RN  NGI  LGSLDY
Sbjct  915  LSNGGNNTCDDYVSRQDLRNSTNGIASLGSLDY  947



>gb|KCW89820.1| hypothetical protein EUGRSUZ_A020652, partial [Eucalyptus grandis]
 gb|KCW89821.1| hypothetical protein EUGRSUZ_A020652, partial [Eucalyptus grandis]
 gb|KCW89822.1| hypothetical protein EUGRSUZ_A020652, partial [Eucalyptus grandis]
Length=554

 Score =   273 bits (699),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 130/172 (76%), Positives = 150/172 (87%), Gaps = 1/172 (1%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSS  621
            +S+++QNG+ +L+N G E+  L++PF T NF S  GT++P N DM TSSCVDESGFLQSS
Sbjct  380  TSLMMQNGMQHLRNIGSEHDSLSVPFGTSNFASVAGTEFPHNSDMATSSCVDESGFLQSS  439

Query  620  ENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQ  441
            ENVDQ NPP RTFVKVHKSG+FGRSLDISKFSSY ELRSELARMFGLEG LEDP+RSGWQ
Sbjct  440  ENVDQVNPPTRTFVKVHKSGTFGRSLDISKFSSYDELRSELARMFGLEGQLEDPQRSGWQ  499

Query  440  LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLP  285
            LVFVDREND+LLLGDDPWQEFVNNVWYIKILSP EV Q+GK +GI+  N++P
Sbjct  500  LVFVDRENDILLLGDDPWQEFVNNVWYIKILSPHEVKQLGK-QGINPANSVP  550



>gb|KDO63437.1| hypothetical protein CISIN_1g002390mg [Citrus sinensis]
 gb|KDO63438.1| hypothetical protein CISIN_1g002390mg [Citrus sinensis]
Length=815

 Score =   278 bits (710),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 147/210 (70%), Positives = 171/210 (81%), Gaps = 7/210 (3%)
 Frame = -3

Query  803  DSSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQS  624
            DSS++ QNG+ NLKN   EN  L++P++  NFT+ VGTD+PLN DM TSSCVDESGFLQS
Sbjct  611  DSSLMGQNGLPNLKNISSENESLSLPYAASNFTNNVGTDFPLNSDMTTSSCVDESGFLQS  670

Query  623  SENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGW  444
            SENVDQ NPP RTFVKVHKSGSFGRSLDISKFSSY ELRSELARMFGLEG LEDP+RSGW
Sbjct  671  SENVDQVNPPTRTFVKVHKSGSFGRSLDISKFSSYDELRSELARMFGLEGQLEDPQRSGW  730

Query  443  QLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLP  264
            QLVFVDRENDVLLLGDDPWQEFVNNV YIKILSP EV QMGK  G+    + P   QRL 
Sbjct  731  QLVFVDRENDVLLLGDDPWQEFVNNVGYIKILSPLEVQQMGK--GLSPVTSGPG--QRL-  785

Query  263  NGGSSCEVHVSQKETR-NMNGIP-LGSLDY  180
            +  ++ + +VS++E R + NG+  +GS++Y
Sbjct  786  SSNNNFDDYVSRQELRSSSNGVASMGSINY  815



>ref|XP_010275037.1| PREDICTED: auxin response factor 6 [Nelumbo nucifera]
Length=958

 Score =   279 bits (713),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 144/209 (69%), Positives = 170/209 (81%), Gaps = 7/209 (3%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSS  621
            SS+L+QNG+S L   G ++    MPF+  NF S  GTD+PLNP + TSSC+DESGFLQS 
Sbjct  755  SSLLMQNGMSGLGGVGSDSDSTTMPFAASNFISSTGTDFPLNPAVTTSSCLDESGFLQSP  814

Query  620  ENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQ  441
            ENV Q NPP RTFVKVHKSGSFGRSLDI++FSSYHELRSELAR+FGLEG LEDP RSGWQ
Sbjct  815  ENVGQVNPPTRTFVKVHKSGSFGRSLDITRFSSYHELRSELARLFGLEGQLEDPLRSGWQ  874

Query  440  LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPN  261
            LVFVDRENDVLLLGDDPWQEFVNNVW IKILSP EV QMGK +GI+L N++P   QRL  
Sbjct  875  LVFVDRENDVLLLGDDPWQEFVNNVWCIKILSPQEVQQMGK-QGIELLNSVPI--QRL--  929

Query  260  GGSSCEVHVSQKETRNM-NGIP-LGSLDY  180
              +SC+ +VS++++RN+ +GI  +G LDY
Sbjct  930  SSNSCDDYVSRQDSRNLSSGITSVGLLDY  958



>gb|KDO63434.1| hypothetical protein CISIN_1g002390mg [Citrus sinensis]
Length=886

 Score =   277 bits (709),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 147/210 (70%), Positives = 171/210 (81%), Gaps = 7/210 (3%)
 Frame = -3

Query  803  DSSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQS  624
            DSS++ QNG+ NLKN   EN  L++P++  NFT+ VGTD+PLN DM TSSCVDESGFLQS
Sbjct  682  DSSLMGQNGLPNLKNISSENESLSLPYAASNFTNNVGTDFPLNSDMTTSSCVDESGFLQS  741

Query  623  SENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGW  444
            SENVDQ NPP RTFVKVHKSGSFGRSLDISKFSSY ELRSELARMFGLEG LEDP+RSGW
Sbjct  742  SENVDQVNPPTRTFVKVHKSGSFGRSLDISKFSSYDELRSELARMFGLEGQLEDPQRSGW  801

Query  443  QLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLP  264
            QLVFVDRENDVLLLGDDPWQEFVNNV YIKILSP EV QMGK  G+    + P   QRL 
Sbjct  802  QLVFVDRENDVLLLGDDPWQEFVNNVGYIKILSPLEVQQMGK--GLSPVTSGPG--QRL-  856

Query  263  NGGSSCEVHVSQKETR-NMNGIP-LGSLDY  180
            +  ++ + +VS++E R + NG+  +GS++Y
Sbjct  857  SSNNNFDDYVSRQELRSSSNGVASMGSINY  886



>gb|KDO63433.1| hypothetical protein CISIN_1g002390mg [Citrus sinensis]
Length=898

 Score =   277 bits (708),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 147/210 (70%), Positives = 171/210 (81%), Gaps = 7/210 (3%)
 Frame = -3

Query  803  DSSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQS  624
            DSS++ QNG+ NLKN   EN  L++P++  NFT+ VGTD+PLN DM TSSCVDESGFLQS
Sbjct  694  DSSLMGQNGLPNLKNISSENESLSLPYAASNFTNNVGTDFPLNSDMTTSSCVDESGFLQS  753

Query  623  SENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGW  444
            SENVDQ NPP RTFVKVHKSGSFGRSLDISKFSSY ELRSELARMFGLEG LEDP+RSGW
Sbjct  754  SENVDQVNPPTRTFVKVHKSGSFGRSLDISKFSSYDELRSELARMFGLEGQLEDPQRSGW  813

Query  443  QLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLP  264
            QLVFVDRENDVLLLGDDPWQEFVNNV YIKILSP EV QMGK  G+    + P   QRL 
Sbjct  814  QLVFVDRENDVLLLGDDPWQEFVNNVGYIKILSPLEVQQMGK--GLSPVTSGPG--QRL-  868

Query  263  NGGSSCEVHVSQKETR-NMNGIP-LGSLDY  180
            +  ++ + +VS++E R + NG+  +GS++Y
Sbjct  869  SSNNNFDDYVSRQELRSSSNGVASMGSINY  898



>ref|XP_006468969.1| PREDICTED: auxin response factor 6-like [Citrus sinensis]
Length=898

 Score =   277 bits (708),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 147/210 (70%), Positives = 171/210 (81%), Gaps = 7/210 (3%)
 Frame = -3

Query  803  DSSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQS  624
            DSS++ QNG+ NLKN   EN  L++P++  NFT+ VGTD+PLN DM TSSCVDESGFLQS
Sbjct  694  DSSLMGQNGLPNLKNISSENESLSLPYAASNFTNNVGTDFPLNSDMTTSSCVDESGFLQS  753

Query  623  SENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGW  444
            SENVDQ NPP RTFVKVHKSGSFGRSLDISKFSSY ELRSELARMFGLEG LEDP+RSGW
Sbjct  754  SENVDQVNPPTRTFVKVHKSGSFGRSLDISKFSSYDELRSELARMFGLEGQLEDPQRSGW  813

Query  443  QLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLP  264
            QLVFVDRENDVLLLGDDPWQEFVNNV YIKILSP EV QMGK  G+    + P   QRL 
Sbjct  814  QLVFVDRENDVLLLGDDPWQEFVNNVGYIKILSPLEVQQMGK--GLSPVTSGPG--QRL-  868

Query  263  NGGSSCEVHVSQKETR-NMNGIP-LGSLDY  180
            +  ++ + +VS++E R + NG+  +GS++Y
Sbjct  869  SSNNNFDDYVSRQELRSSSNGVASMGSINY  898



>ref|XP_002307574.2| hypothetical protein POPTR_0005s22930g [Populus trichocarpa]
 gb|EEE94570.2| hypothetical protein POPTR_0005s22930g [Populus trichocarpa]
Length=907

 Score =   277 bits (709),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 146/209 (70%), Positives = 167/209 (80%), Gaps = 7/209 (3%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSS  621
            S+ +LQ+GI NL+N G EN  L+MPF+   FTS  G+D PLN DM  SSCVDESGFLQSS
Sbjct  704  STFMLQHGIPNLRNIGTENDPLSMPFAASTFTSATGSDIPLNSDMTASSCVDESGFLQSS  763

Query  620  ENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQ  441
            ENVDQ NP  RTFVKVHKSGS+GRSLDISKFSSY ELRSELAR+F LEGLLEDP+RSGWQ
Sbjct  764  ENVDQVNPSTRTFVKVHKSGSYGRSLDISKFSSYDELRSELARLFCLEGLLEDPQRSGWQ  823

Query  440  LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPN  261
            LVF DRENDVLLLGDDPWQEFVNNVWYIKILSP EV QMGK EG+    ++P+  Q+L N
Sbjct  824  LVFGDRENDVLLLGDDPWQEFVNNVWYIKILSPLEVQQMGK-EGLSPAASVPS--QKLSN  880

Query  260  GGSSCEVHVSQKETRN-MNGIP-LGSLDY  180
              S+ + H++ +  RN  NGI  +GSLDY
Sbjct  881  --SNSDGHMNTQGFRNSSNGIASMGSLDY  907



>gb|ABK95163.1| unknown [Populus trichocarpa]
Length=907

 Score =   276 bits (707),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 146/209 (70%), Positives = 165/209 (79%), Gaps = 7/209 (3%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSS  621
            S+ +LQ+GI NL+N G EN  L+MPF+   FTS  G+D PLN DM  SSCVDESGFLQSS
Sbjct  704  STFMLQHGIPNLRNIGTENDPLSMPFAASTFTSATGSDIPLNSDMTASSCVDESGFLQSS  763

Query  620  ENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQ  441
            ENVDQ NP  RTFVKVHKSGS+GRSLDISKFSSY ELRSELAR+F LEGLLEDP+RSGWQ
Sbjct  764  ENVDQVNPSTRTFVKVHKSGSYGRSLDISKFSSYDELRSELARLFCLEGLLEDPQRSGWQ  823

Query  440  LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPN  261
            LVF DRENDVLLLGDDPWQEFVNNVWYIKILSP EV QMGK EG+    ++P   Q+L N
Sbjct  824  LVFGDRENDVLLLGDDPWQEFVNNVWYIKILSPLEVQQMGK-EGLSPAASVPC--QKLSN  880

Query  260  GGSSCEVHVSQKETRN-MNGIP-LGSLDY  180
              S  + H++ +  RN  NGI  +GSLDY
Sbjct  881  SNS--DGHMNTQGFRNSSNGIASMGSLDY  907



>ref|XP_006351989.1| PREDICTED: auxin response factor 6-like isoform X1 [Solanum tuberosum]
Length=884

 Score =   276 bits (706),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 147/204 (72%), Positives = 166/204 (81%), Gaps = 6/204 (3%)
 Frame = -3

Query  782  NGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSSENVDQA  603
            NG+SNLK +  EN  L MP++T  FTS VG++YP+  DM TSSCVDESG LQSSENVDQA
Sbjct  684  NGMSNLKGNSPENRSLPMPYATSAFTSTVGSEYPVTSDMTTSSCVDESGVLQSSENVDQA  743

Query  602  NPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQLVFVDR  423
            N    TFVKV+KS SFGRSLDISKFSSY+ELRSELARMFGLEGLLEDPERSGWQLVFVDR
Sbjct  744  NSLTETFVKVYKSESFGRSLDISKFSSYNELRSELARMFGLEGLLEDPERSGWQLVFVDR  803

Query  422  ENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLP-NG-GSS  249
            ENDVLLLGDDPW EFVN+VWYIKILSP EV QMGK EG+DLP+      QR+  NG G+ 
Sbjct  804  ENDVLLLGDDPWHEFVNSVWYIKILSPLEVQQMGK-EGLDLPSA--GKTQRITSNGNGNG  860

Query  248  CEVHVSQKETRN-MNGIPLGSLDY  180
            C+  +++  + N MNGIPLGSLDY
Sbjct  861  CDDFMNRNHSCNIMNGIPLGSLDY  884



>ref|XP_006351990.1| PREDICTED: auxin response factor 6-like isoform X2 [Solanum tuberosum]
Length=883

 Score =   276 bits (706),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 147/204 (72%), Positives = 166/204 (81%), Gaps = 6/204 (3%)
 Frame = -3

Query  782  NGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSSENVDQA  603
            NG+SNLK +  EN  L MP++T  FTS VG++YP+  DM TSSCVDESG LQSSENVDQA
Sbjct  683  NGMSNLKGNSPENRSLPMPYATSAFTSTVGSEYPVTSDMTTSSCVDESGVLQSSENVDQA  742

Query  602  NPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQLVFVDR  423
            N    TFVKV+KS SFGRSLDISKFSSY+ELRSELARMFGLEGLLEDPERSGWQLVFVDR
Sbjct  743  NSLTETFVKVYKSESFGRSLDISKFSSYNELRSELARMFGLEGLLEDPERSGWQLVFVDR  802

Query  422  ENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLP-NG-GSS  249
            ENDVLLLGDDPW EFVN+VWYIKILSP EV QMGK EG+DLP+      QR+  NG G+ 
Sbjct  803  ENDVLLLGDDPWHEFVNSVWYIKILSPLEVQQMGK-EGLDLPSA--GKTQRITSNGNGNG  859

Query  248  CEVHVSQKETRN-MNGIPLGSLDY  180
            C+  +++  + N MNGIPLGSLDY
Sbjct  860  CDDFMNRNHSCNIMNGIPLGSLDY  883



>gb|KHG01675.1| Auxin response factor 6 -like protein [Gossypium arboreum]
Length=798

 Score =   275 bits (702),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 130/162 (80%), Positives = 143/162 (88%), Gaps = 0/162 (0%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSS  621
            SS++LQ G++NLKN+G EN  L+MP++  NFTS  GTD+PLN DM TSSCVDESG+LQSS
Sbjct  622  SSLMLQQGMTNLKNTGNENDSLSMPYAASNFTSASGTDFPLNSDMTTSSCVDESGYLQSS  681

Query  620  ENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQ  441
            E VDQ NPP  TFVKVHK GSFGRSLDISKFSSY+ELR ELARMFGLEG LEDP+RSGWQ
Sbjct  682  EYVDQVNPPTGTFVKVHKLGSFGRSLDISKFSSYNELRCELARMFGLEGQLEDPQRSGWQ  741

Query  440  LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKE  315
            LVFVDREND+LLLGDDPWQEFVNNVWYIKILSP EV QMGKE
Sbjct  742  LVFVDRENDILLLGDDPWQEFVNNVWYIKILSPLEVQQMGKE  783



>gb|KDO63436.1| hypothetical protein CISIN_1g002390mg [Citrus sinensis]
Length=928

 Score =   277 bits (708),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 147/210 (70%), Positives = 171/210 (81%), Gaps = 7/210 (3%)
 Frame = -3

Query  803  DSSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQS  624
            DSS++ QNG+ NLKN   EN  L++P++  NFT+ VGTD+PLN DM TSSCVDESGFLQS
Sbjct  724  DSSLMGQNGLPNLKNISSENESLSLPYAASNFTNNVGTDFPLNSDMTTSSCVDESGFLQS  783

Query  623  SENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGW  444
            SENVDQ NPP RTFVKVHKSGSFGRSLDISKFSSY ELRSELARMFGLEG LEDP+RSGW
Sbjct  784  SENVDQVNPPTRTFVKVHKSGSFGRSLDISKFSSYDELRSELARMFGLEGQLEDPQRSGW  843

Query  443  QLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLP  264
            QLVFVDRENDVLLLGDDPWQEFVNNV YIKILSP EV QMGK  G+    + P   QRL 
Sbjct  844  QLVFVDRENDVLLLGDDPWQEFVNNVGYIKILSPLEVQQMGK--GLSPVTSGPG--QRL-  898

Query  263  NGGSSCEVHVSQKETR-NMNGIP-LGSLDY  180
            +  ++ + +VS++E R + NG+  +GS++Y
Sbjct  899  SSNNNFDDYVSRQELRSSSNGVASMGSINY  928



>ref|XP_006446840.1| hypothetical protein CICLE_v10014200mg [Citrus clementina]
 gb|ESR60080.1| hypothetical protein CICLE_v10014200mg [Citrus clementina]
Length=898

 Score =   275 bits (704),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 146/210 (70%), Positives = 170/210 (81%), Gaps = 7/210 (3%)
 Frame = -3

Query  803  DSSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQS  624
            DSS++ QNG+ NLKN   EN  L++P++  NFT+ VGTD+PLN DM TSSCVDESGFLQS
Sbjct  694  DSSLMGQNGLPNLKNISSENESLSLPYAASNFTNNVGTDFPLNSDMTTSSCVDESGFLQS  753

Query  623  SENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGW  444
            SENVDQ NPP RTFVKVHKSGSFGRSLDISKFSSY ELR ELARMFGLEG LEDP+RSGW
Sbjct  754  SENVDQVNPPTRTFVKVHKSGSFGRSLDISKFSSYDELRGELARMFGLEGQLEDPQRSGW  813

Query  443  QLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLP  264
            QLVFVDRENDVLLLGDDPWQEFVNNV YIKILSP EV QMGK  G+    + P   QRL 
Sbjct  814  QLVFVDRENDVLLLGDDPWQEFVNNVGYIKILSPLEVQQMGK--GLSPVTSGPG--QRL-  868

Query  263  NGGSSCEVHVSQKETR-NMNGIP-LGSLDY  180
            +  ++ + +VS++E R + NG+  +GS++Y
Sbjct  869  SSNNNFDDYVSRQELRSSSNGVASMGSINY  898



>ref|XP_010054260.1| PREDICTED: auxin response factor 6-like [Eucalyptus grandis]
Length=870

 Score =   274 bits (700),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 130/172 (76%), Positives = 150/172 (87%), Gaps = 1/172 (1%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSS  621
            +S+++QNG+ +L+N G E+  L++PF T NF S  GT++P N DM TSSCVDESGFLQSS
Sbjct  696  TSLMMQNGMQHLRNIGSEHDSLSVPFGTSNFASVAGTEFPHNSDMATSSCVDESGFLQSS  755

Query  620  ENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQ  441
            ENVDQ NPP RTFVKVHKSG+FGRSLDISKFSSY ELRSELARMFGLEG LEDP+RSGWQ
Sbjct  756  ENVDQVNPPTRTFVKVHKSGTFGRSLDISKFSSYDELRSELARMFGLEGQLEDPQRSGWQ  815

Query  440  LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLP  285
            LVFVDREND+LLLGDDPWQEFVNNVWYIKILSP EV Q+GK +GI+  N++P
Sbjct  816  LVFVDRENDILLLGDDPWQEFVNNVWYIKILSPHEVKQLGK-QGINPANSVP  866



>ref|XP_009376828.1| PREDICTED: auxin response factor 6-like [Pyrus x bretschneideri]
 ref|XP_009376836.1| PREDICTED: auxin response factor 6-like [Pyrus x bretschneideri]
Length=931

 Score =   274 bits (700),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 146/209 (70%), Positives = 168/209 (80%), Gaps = 6/209 (3%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSS  621
            SS++L NGI NL+N G  N  +++PF   N+ SG G D+PLN DM TSSCVDESGFLQSS
Sbjct  727  SSLMLHNGIPNLRNIGNGNDSVSVPFGASNYASGTGNDFPLNSDMTTSSCVDESGFLQSS  786

Query  620  ENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQ  441
            ENVDQ NP   TFVKVHK GSFGRSLDISKFSSY +LRSELARMFGLEG LEDP+RSGWQ
Sbjct  787  ENVDQVNP-TGTFVKVHKLGSFGRSLDISKFSSYDDLRSELARMFGLEGQLEDPQRSGWQ  845

Query  440  LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPN  261
            LVFVDRENDVLLLGDDPWQEFVNNV+YIKILSP EV QMGK EG++   ++P  N +L N
Sbjct  846  LVFVDRENDVLLLGDDPWQEFVNNVYYIKILSPLEVQQMGK-EGLNSVASVP--NNKLSN  902

Query  260  GGSSCEVHVSQKETRN-MNGIP-LGSLDY  180
            G ++   +VS+++ RN  NGI  LGSLDY
Sbjct  903  GSNTTVDYVSRQDLRNSRNGIASLGSLDY  931



>gb|KJB49005.1| hypothetical protein B456_008G097200 [Gossypium raimondii]
Length=882

 Score =   271 bits (694),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 129/162 (80%), Positives = 143/162 (88%), Gaps = 0/162 (0%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSS  621
            SS++LQ+G++NLKN G EN  L++P++  NFTS  GTD+PLN DM TSSCVDESG+LQSS
Sbjct  706  SSLVLQHGMTNLKNIGNENDSLSLPYAASNFTSASGTDFPLNSDMTTSSCVDESGYLQSS  765

Query  620  ENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQ  441
            E VDQ NPP  TFVKVHK GSFGRSLDISKFSSY+ELR ELARMFGLEG LEDP+RSGWQ
Sbjct  766  EYVDQVNPPTGTFVKVHKLGSFGRSLDISKFSSYNELRCELARMFGLEGQLEDPQRSGWQ  825

Query  440  LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKE  315
            LVFVDREND+LLLGDDPWQEFVNNVWYIKILSP EV QMGKE
Sbjct  826  LVFVDRENDILLLGDDPWQEFVNNVWYIKILSPLEVQQMGKE  867



>ref|XP_007141460.1| hypothetical protein PHAVU_008G197600g [Phaseolus vulgaris]
 gb|ESW13454.1| hypothetical protein PHAVU_008G197600g [Phaseolus vulgaris]
Length=894

 Score =   272 bits (695),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 144/211 (68%), Positives = 166/211 (79%), Gaps = 8/211 (4%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSS  621
            SS++LQNG+SNL+N G  N  L++PFS  N     GTD+PL+ +M TSSC+DESGFLQSS
Sbjct  688  SSLMLQNGMSNLRNMGNVNDSLSLPFSASNCGGATGTDFPLSSNMTTSSCMDESGFLQSS  747

Query  620  ENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDP--ERSG  447
            ENVDQAN P  TFVKVHKSGSFGRSLDISKFSSY ELRSELARMFGLEG LEDP  +RSG
Sbjct  748  ENVDQANTPTGTFVKVHKSGSFGRSLDISKFSSYDELRSELARMFGLEGQLEDPKTQRSG  807

Query  446  WQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRL  267
            WQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSP EV QMGK  G+    + P    +L
Sbjct  808  WQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPLEVQQMGK--GVSPSTSAPG--HKL  863

Query  266  PNGGSSCEVHVSQKETR-NMNGIP-LGSLDY  180
               G+SC+ +V+Q+E R + NG+  +GS  Y
Sbjct  864  STSGNSCDNYVNQQELRSSRNGMASMGSFHY  894



>gb|KJB49004.1| hypothetical protein B456_008G097200 [Gossypium raimondii]
Length=886

 Score =   271 bits (694),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 129/162 (80%), Positives = 143/162 (88%), Gaps = 0/162 (0%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSS  621
            SS++LQ+G++NLKN G EN  L++P++  NFTS  GTD+PLN DM TSSCVDESG+LQSS
Sbjct  710  SSLVLQHGMTNLKNIGNENDSLSLPYAASNFTSASGTDFPLNSDMTTSSCVDESGYLQSS  769

Query  620  ENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQ  441
            E VDQ NPP  TFVKVHK GSFGRSLDISKFSSY+ELR ELARMFGLEG LEDP+RSGWQ
Sbjct  770  EYVDQVNPPTGTFVKVHKLGSFGRSLDISKFSSYNELRCELARMFGLEGQLEDPQRSGWQ  829

Query  440  LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKE  315
            LVFVDREND+LLLGDDPWQEFVNNVWYIKILSP EV QMGKE
Sbjct  830  LVFVDRENDILLLGDDPWQEFVNNVWYIKILSPLEVQQMGKE  871



>gb|KHG06791.1| Auxin response factor 6 -like protein [Gossypium arboreum]
Length=796

 Score =   269 bits (688),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 137/215 (64%), Positives = 168/215 (78%), Gaps = 13/215 (6%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSS  621
            SS++L +G++N K+   EN  +++P++  NFTS  GTD+PLN DM TSSCVDESG+LQSS
Sbjct  587  SSLMLHHGMTNPKSIRNENDSMSLPYAASNFTSASGTDFPLNSDMTTSSCVDESGYLQSS  646

Query  620  ENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQ  441
            ENVDQ NPP  TFVKVHKSGSFGRSLDISKF SY ELR ELAR+FGLEG LEDP+RSGWQ
Sbjct  647  ENVDQVNPPTGTFVKVHKSGSFGRSLDISKFGSYDELRCELARLFGLEGQLEDPQRSGWQ  706

Query  440  LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRL--  267
            LVFVDREND+LLLGDDPWQEFVNNVWYIKILSP EV QMGK  G +   ++P  NQRL  
Sbjct  707  LVFVDRENDILLLGDDPWQEFVNNVWYIKILSPLEVQQMGK--GQNPATSIP--NQRLTT  762

Query  266  ------PNGGSSCEVHVSQKETRNMNGIPLGSLDY  180
                   + G+ C+ ++S+++ R+ +   +GSL+Y
Sbjct  763  TTATTTSSNGNHCDDYMSRQDLRS-SVASMGSLEY  796



>ref|XP_010275910.1| PREDICTED: auxin response factor 6-like isoform X1 [Nelumbo nucifera]
Length=924

 Score =   270 bits (689),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 141/209 (67%), Positives = 171/209 (82%), Gaps = 8/209 (4%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSS  621
            SS+L+QNG+S L+  G E     MPF++ NF S  GT++PLNP + TSSC+DES FLQS 
Sbjct  722  SSLLMQNGMSGLRGVGSEGDSATMPFAS-NFVSATGTEFPLNPVVTTSSCLDESTFLQSP  780

Query  620  ENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQ  441
            ENV Q NPP RTFVKV+KSGSFGRSLDI++FSSYHELRSELARMFGLEG LEDP RSGWQ
Sbjct  781  ENVGQVNPPTRTFVKVYKSGSFGRSLDITRFSSYHELRSELARMFGLEGQLEDPLRSGWQ  840

Query  440  LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPN  261
            LVFVDRENDVLLLGDDPWQEFVN+VW IKILSP EV QMGK +G++L N++P   QRL  
Sbjct  841  LVFVDRENDVLLLGDDPWQEFVNSVWCIKILSPQEVQQMGK-QGVELLNSVPI--QRL--  895

Query  260  GGSSCEVHVSQKETRNMN-GIP-LGSLDY  180
              +SC+ +V+++++RN++ GI  +GSLDY
Sbjct  896  SSNSCDDYVNRQDSRNLSTGITSVGSLDY  924



>gb|AJE26133.1| auxin response factors [Salix matsudana]
Length=910

 Score =   269 bits (688),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 143/209 (68%), Positives = 164/209 (78%), Gaps = 7/209 (3%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSS  621
            S+ +LQ+GI NL+N G EN  L+MPF+T  FTS  G D PLN D+  SSCVDESGFLQSS
Sbjct  702  STFMLQHGIPNLRNIGTENDPLSMPFATSTFTSATGNDIPLNSDLTASSCVDESGFLQSS  761

Query  620  ENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQ  441
            ENVDQANP  RTFVKV KSGS GRSLDISKFSSY ELRSELAR+F LEG LEDP+RSGWQ
Sbjct  762  ENVDQANPSTRTFVKVQKSGSCGRSLDISKFSSYDELRSELARLFCLEGQLEDPQRSGWQ  821

Query  440  LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPN  261
            LVFVDRENDVLLLGDDPWQEFVNNVW I+ILSP EV QMGK EG+    ++P+  Q+L N
Sbjct  822  LVFVDRENDVLLLGDDPWQEFVNNVWCIRILSPLEVQQMGK-EGLSPAASVPS--QKLSN  878

Query  260  GGSSCEVHVSQKETRN-MNGIP-LGSLDY  180
              S  + H+++ + RN  NGI  +GS DY
Sbjct  879  SNS--DGHMNRHDFRNSSNGIASMGSFDY  905



>gb|KHN12007.1| Auxin response factor 6 [Glycine soja]
Length=896

 Score =   268 bits (685),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 144/211 (68%), Positives = 163/211 (77%), Gaps = 8/211 (4%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSS  621
            SS++LQNG+SNL+N G  N  L++PFS  N     GTD+PL+ +M TSSCVDESGFLQSS
Sbjct  690  SSLMLQNGMSNLRNIGNVNNSLSLPFSASNCGGASGTDFPLSSNMTTSSCVDESGFLQSS  749

Query  620  ENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDP--ERSG  447
            ENVDQAN P  TFVKVHKSGSFGRSLDISKFSSY EL SELARMFGLEG LEDP  +RSG
Sbjct  750  ENVDQANTPTGTFVKVHKSGSFGRSLDISKFSSYDELISELARMFGLEGQLEDPKTQRSG  809

Query  446  WQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRL  267
            WQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSP EV QMGK     L  +  A   +L
Sbjct  810  WQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPLEVQQMGK----GLSPSTSAPGNKL  865

Query  266  PNGGSSCEVHVSQKETR-NMNGIP-LGSLDY  180
                +SC+ +VSQ+E R + NG+  +GS  Y
Sbjct  866  STPANSCDNYVSQQELRSSRNGMASMGSFHY  896



>ref|XP_006595764.1| PREDICTED: auxin response factor 6-like [Glycine max]
Length=896

 Score =   268 bits (685),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 144/211 (68%), Positives = 163/211 (77%), Gaps = 8/211 (4%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSS  621
            SS++LQNG+SNL+N G  N  L++PFS  N     GTD+PL+ +M TSSCVDESGFLQSS
Sbjct  690  SSLMLQNGMSNLRNIGNVNNSLSLPFSASNCGGASGTDFPLSSNMTTSSCVDESGFLQSS  749

Query  620  ENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDP--ERSG  447
            ENVDQAN P  TFVKVHKSGSFGRSLDISKFSSY EL SELARMFGLEG LEDP  +RSG
Sbjct  750  ENVDQANTPTGTFVKVHKSGSFGRSLDISKFSSYDELISELARMFGLEGQLEDPKTQRSG  809

Query  446  WQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRL  267
            WQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSP EV QMGK     L  +  A   +L
Sbjct  810  WQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPLEVQQMGK----GLSPSTSAPGNKL  865

Query  266  PNGGSSCEVHVSQKETR-NMNGIP-LGSLDY  180
                +SC+ +VSQ+E R + NG+  +GS  Y
Sbjct  866  STPANSCDNYVSQQELRSSRNGMASMGSFHY  896



>ref|XP_002279808.1| PREDICTED: auxin response factor 6 [Vitis vinifera]
Length=908

 Score =   268 bits (686),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 141/209 (67%), Positives = 166/209 (79%), Gaps = 7/209 (3%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSS  621
            SS+L+QNG+S L+  G E+    +PFS+ NF S  GTD+ LNP M  SSC+DESGFLQS 
Sbjct  705  SSLLMQNGMSGLRGVGSESDSTAIPFSSSNFMSSTGTDFSLNPAMTPSSCIDESGFLQSP  764

Query  620  ENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQ  441
            ENV Q NPP RTFVKV+KSGSFGRSLDI+KFSSYHELR ELARMFGLEG LEDP RSGWQ
Sbjct  765  ENVGQVNPPTRTFVKVYKSGSFGRSLDITKFSSYHELRGELARMFGLEGQLEDPRRSGWQ  824

Query  440  LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPN  261
            LVFVDRENDVLLLGDDPW EFVN+VW IKILS  EV QMGK  G++L N++P   QRL  
Sbjct  825  LVFVDRENDVLLLGDDPWPEFVNSVWCIKILSLQEVQQMGK-RGLELLNSVPI--QRL--  879

Query  260  GGSSCEVHVSQKETRNMN-GIP-LGSLDY  180
              SSC+ + S++++RN++ GI  +GSLDY
Sbjct  880  TSSSCDDYASRQDSRNLSTGITSVGSLDY  908



>ref|XP_002300854.2| hypothetical protein POPTR_0002s05590g [Populus trichocarpa]
 gb|EEE80127.2| hypothetical protein POPTR_0002s05590g [Populus trichocarpa]
Length=936

 Score =   268 bits (686),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 144/224 (64%), Positives = 167/224 (75%), Gaps = 22/224 (10%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSS  621
            S+ +LQ+GI NL+N G EN  L+MPF+   FTS  G+D PL  DM  SSCVDESGFLQSS
Sbjct  713  STFMLQHGIPNLRNIGTENDPLSMPFTASTFTSATGSDIPLTSDMTASSCVDESGFLQSS  772

Query  620  ENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQ  441
            ENVDQ NP  RTFVKVHKSGS+GRSLDISKFSSY ELRSELAR+F LEG LED +RSGWQ
Sbjct  773  ENVDQVNPSTRTFVKVHKSGSYGRSLDISKFSSYDELRSELARLFCLEGQLEDRQRSGWQ  832

Query  440  LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPN  261
            LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSP EV QMGK EG+    ++P+  Q+L N
Sbjct  833  LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPLEVQQMGK-EGLTSAASVPS--QKLSN  889

Query  260  GGSSCEVHVSQKETRN----------------MNGIP-LGSLDY  180
              S+ + +++++E RN                 NGI  +GSLDY
Sbjct  890  --STSDGYMNRQEFRNSSNPDGYLNRQDFRNSSNGIASMGSLDY  931



>ref|XP_012072177.1| PREDICTED: auxin response factor 6 isoform X2 [Jatropha curcas]
 gb|KDP38016.1| hypothetical protein JCGZ_04659 [Jatropha curcas]
Length=899

 Score =   268 bits (684),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 140/209 (67%), Positives = 170/209 (81%), Gaps = 7/209 (3%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSS  621
            SS+LLQ+G+S L+  G ++    +PFS+ N+ S  G+D+ LNP M  SSC+DESGFLQS 
Sbjct  696  SSLLLQSGMSGLRGVGSDSDSTTIPFSSSNYMSTTGSDFSLNPAMTPSSCIDESGFLQSP  755

Query  620  ENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQ  441
            ENV Q NPP+RTFVKV+KSGSFGRSLDI+KFSSY+ELRSELARMFGLEG LEDP RSGWQ
Sbjct  756  ENVGQVNPPSRTFVKVYKSGSFGRSLDITKFSSYNELRSELARMFGLEGQLEDPLRSGWQ  815

Query  440  LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPN  261
            LVFVDRENDVLLLGDDPW EFVN+VW IKILSP EV QMGK  G++L N++P   QRL N
Sbjct  816  LVFVDRENDVLLLGDDPWPEFVNSVWCIKILSPQEVQQMGK-RGLELLNSVPI--QRLSN  872

Query  260  GGSSCEVHVSQKETRNMN-GIP-LGSLDY  180
            G  SC+ + S++++RN++ GI  +GSLDY
Sbjct  873  G--SCDDYASRQDSRNLSTGITSVGSLDY  899



>ref|XP_007024965.1| Auxin response factor 6 isoform 4 [Theobroma cacao]
 gb|EOY27587.1| Auxin response factor 6 isoform 4 [Theobroma cacao]
Length=604

 Score =   261 bits (666),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 140/209 (67%), Positives = 169/209 (81%), Gaps = 8/209 (4%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSS  621
            SS+L+ NG+S+L+  G ++    +PFS+ N+ S  GTD+ +NP M  SSC+DESGFLQS 
Sbjct  402  SSLLMPNGMSSLRGVGSDSDSTTIPFSS-NYMSTAGTDFSVNPAMTPSSCIDESGFLQSP  460

Query  620  ENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQ  441
            ENV Q NP  RTFVKV+KSGSFGRSLDISKFSSY+ELRSELARMFGLEG LEDP RSGWQ
Sbjct  461  ENVGQGNPQTRTFVKVYKSGSFGRSLDISKFSSYNELRSELARMFGLEGQLEDPLRSGWQ  520

Query  440  LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPN  261
            LVFVDRENDVLLLGDDPW EFVN+VW IKILSP EV QMGK  G++L N++P   QRL N
Sbjct  521  LVFVDRENDVLLLGDDPWPEFVNSVWCIKILSPQEVQQMGK-RGLELLNSVPV--QRLSN  577

Query  260  GGSSCEVHVSQKETRNM-NGIP-LGSLDY  180
            G  SC+ +VS++++RN+ +GI  +GSLDY
Sbjct  578  G--SCDDYVSRQDSRNLSSGIASVGSLDY  604



>ref|XP_011026193.1| PREDICTED: auxin response factor 6-like isoform X2 [Populus euphratica]
Length=930

 Score =   265 bits (678),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 143/224 (64%), Positives = 166/224 (74%), Gaps = 22/224 (10%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSS  621
            S+ +LQ+GI NL+N G EN  L+MPF+   FTS  G D PL  DM  SSC+DESGFLQSS
Sbjct  707  STFMLQHGIPNLRNIGTENDPLSMPFTASTFTSAPGGDIPLTSDMTASSCIDESGFLQSS  766

Query  620  ENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQ  441
            ENVDQ NP  RTFVKVHKSGS+GRSLDISKFSSY ELRSELAR+F LEG LEDP+RS WQ
Sbjct  767  ENVDQVNPSTRTFVKVHKSGSYGRSLDISKFSSYDELRSELARLFCLEGQLEDPQRSVWQ  826

Query  440  LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPN  261
            LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSP EV QMGK EG+    ++P+  Q+L N
Sbjct  827  LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPLEVQQMGK-EGLTSAASVPS--QKLSN  883

Query  260  GGSSCEVHVSQKETRN----------------MNGIP-LGSLDY  180
              SS + ++++++ RN                 NGI  +GSLDY
Sbjct  884  --SSSDGYMNRQDFRNSSNPDGYLNRQDFRNSSNGIASIGSLDY  925



>ref|XP_012072178.1| PREDICTED: auxin response factor 6 isoform X3 [Jatropha curcas]
Length=824

 Score =   264 bits (674),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 133/198 (67%), Positives = 162/198 (82%), Gaps = 5/198 (3%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSS  621
            SS+LLQ+G+S L+  G ++    +PFS+ N+ S  G+D+ LNP M  SSC+DESGFLQS 
Sbjct  613  SSLLLQSGMSGLRGVGSDSDSTTIPFSSSNYMSTTGSDFSLNPAMTPSSCIDESGFLQSP  672

Query  620  ENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQ  441
            ENV Q NPP+RTFVKV+KSGSFGRSLDI+KFSSY+ELRSELARMFGLEG LEDP RSGWQ
Sbjct  673  ENVGQVNPPSRTFVKVYKSGSFGRSLDITKFSSYNELRSELARMFGLEGQLEDPLRSGWQ  732

Query  440  LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPN  261
            LVFVDRENDVLLLGDDPW EFVN+VW IKILSP EV QMGK  G++L N++P   QRL N
Sbjct  733  LVFVDRENDVLLLGDDPWPEFVNSVWCIKILSPQEVQQMGK-RGLELLNSVPI--QRLSN  789

Query  260  GGSSCEVHVSQKETRNMN  207
            G  SC+ + S++++RN++
Sbjct  790  G--SCDDYASRQDSRNLS  805



>ref|XP_011026192.1| PREDICTED: auxin response factor 6-like isoform X1 [Populus euphratica]
Length=931

 Score =   265 bits (677),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 143/224 (64%), Positives = 166/224 (74%), Gaps = 22/224 (10%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSS  621
            S+ +LQ+GI NL+N G EN  L+MPF+   FTS  G D PL  DM  SSC+DESGFLQSS
Sbjct  708  STFMLQHGIPNLRNIGTENDPLSMPFTASTFTSAPGGDIPLTSDMTASSCIDESGFLQSS  767

Query  620  ENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQ  441
            ENVDQ NP  RTFVKVHKSGS+GRSLDISKFSSY ELRSELAR+F LEG LEDP+RS WQ
Sbjct  768  ENVDQVNPSTRTFVKVHKSGSYGRSLDISKFSSYDELRSELARLFCLEGQLEDPQRSVWQ  827

Query  440  LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPN  261
            LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSP EV QMGK EG+    ++P+  Q+L N
Sbjct  828  LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPLEVQQMGK-EGLTSAASVPS--QKLSN  884

Query  260  GGSSCEVHVSQKETRN----------------MNGIP-LGSLDY  180
              SS + ++++++ RN                 NGI  +GSLDY
Sbjct  885  --SSSDGYMNRQDFRNSSNPDGYLNRQDFRNSSNGIASIGSLDY  926



>gb|KHG28199.1| Auxin response factor 6 [Gossypium arboreum]
Length=892

 Score =   265 bits (676),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 142/209 (68%), Positives = 168/209 (80%), Gaps = 8/209 (4%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSS  621
            SS+LLQNG+S+L+  G E+    +PFS+ N+ S  GTD+ +NP M  SSC+DE GFLQS 
Sbjct  690  SSLLLQNGMSSLRGVGSESDSTTIPFSS-NYASTAGTDFSVNPAMTPSSCIDELGFLQSP  748

Query  620  ENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQ  441
            ENV Q NP  RTFVKV+KSGSFGRSLDISKFSSY+ELRSELARMFGLEG LEDP RSGWQ
Sbjct  749  ENVGQENPQTRTFVKVYKSGSFGRSLDISKFSSYNELRSELARMFGLEGQLEDPLRSGWQ  808

Query  440  LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPN  261
            LVFVDRENDVLLLGDDPW EFVN+VW IKILSP EV QMGK  G++L N++P   QRL N
Sbjct  809  LVFVDRENDVLLLGDDPWPEFVNSVWCIKILSPQEVQQMGK-RGLELLNSVPV--QRLSN  865

Query  260  GGSSCEVHVSQKETRNM-NGIP-LGSLDY  180
            G  SC+ + SQ+++RN+ +GI  +GSLDY
Sbjct  866  G--SCDDYASQQDSRNLSSGIASVGSLDY  892



>ref|XP_003519519.1| PREDICTED: auxin response factor 6-like [Glycine max]
 gb|KHN38362.1| Auxin response factor 17 [Glycine soja]
Length=896

 Score =   265 bits (676),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 143/211 (68%), Positives = 163/211 (77%), Gaps = 8/211 (4%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSS  621
            SS++LQ+G+SNL+N G  N  L++PFST N     GTD+PL+ +M TSSCVDESGFLQ S
Sbjct  690  SSLMLQSGMSNLRNIGKVNDSLSLPFSTSNCGGATGTDFPLSSNMTTSSCVDESGFLQCS  749

Query  620  ENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDP--ERSG  447
            ENVDQAN P  TFVKVHKSGSFGRSLDISKFSSY EL SELARMFGLEG LEDP  +RSG
Sbjct  750  ENVDQANIPTGTFVKVHKSGSFGRSLDISKFSSYDELISELARMFGLEGQLEDPKTQRSG  809

Query  446  WQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRL  267
            WQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSP EV QMGK     L  +  A   +L
Sbjct  810  WQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPLEVQQMGKV----LSPSTSAPGDKL  865

Query  266  PNGGSSCEVHVSQKETR-NMNGIP-LGSLDY  180
                +SC+ +VSQ+E R + NG+  +GS  Y
Sbjct  866  STPVNSCDNYVSQQELRSSRNGMASMGSFHY  896



>ref|XP_012072176.1| PREDICTED: auxin response factor 6 isoform X1 [Jatropha curcas]
Length=907

 Score =   263 bits (673),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 133/198 (67%), Positives = 162/198 (82%), Gaps = 5/198 (3%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSS  621
            SS+LLQ+G+S L+  G ++    +PFS+ N+ S  G+D+ LNP M  SSC+DESGFLQS 
Sbjct  696  SSLLLQSGMSGLRGVGSDSDSTTIPFSSSNYMSTTGSDFSLNPAMTPSSCIDESGFLQSP  755

Query  620  ENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQ  441
            ENV Q NPP+RTFVKV+KSGSFGRSLDI+KFSSY+ELRSELARMFGLEG LEDP RSGWQ
Sbjct  756  ENVGQVNPPSRTFVKVYKSGSFGRSLDITKFSSYNELRSELARMFGLEGQLEDPLRSGWQ  815

Query  440  LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPN  261
            LVFVDRENDVLLLGDDPW EFVN+VW IKILSP EV QMGK  G++L N++P   QRL N
Sbjct  816  LVFVDRENDVLLLGDDPWPEFVNSVWCIKILSPQEVQQMGK-RGLELLNSVPI--QRLSN  872

Query  260  GGSSCEVHVSQKETRNMN  207
            G  SC+ + S++++RN++
Sbjct  873  G--SCDDYASRQDSRNLS  888



>gb|KJB57191.1| hypothetical protein B456_009G152700 [Gossypium raimondii]
 gb|KJB57195.1| hypothetical protein B456_009G152700 [Gossypium raimondii]
Length=820

 Score =   262 bits (669),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 141/209 (67%), Positives = 168/209 (80%), Gaps = 8/209 (4%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSS  621
            SS+LLQNG+S+L+  G E+    +PFS+ N+ S  GTD+ +NP M  SSC++E GFLQS 
Sbjct  618  SSLLLQNGMSSLRGVGSESDSTTIPFSS-NYASTAGTDFSVNPAMTPSSCIEELGFLQSP  676

Query  620  ENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQ  441
            ENV Q NP  RTFVKV+KSGSFGRSLDISKFSSY+ELRSELARMFGLEG LEDP RSGWQ
Sbjct  677  ENVGQENPQTRTFVKVYKSGSFGRSLDISKFSSYNELRSELARMFGLEGQLEDPLRSGWQ  736

Query  440  LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPN  261
            LVFVDRENDVLLLGDDPW EFVN+VW IKILSP EV QMGK  G++L N++P   QRL N
Sbjct  737  LVFVDRENDVLLLGDDPWPEFVNSVWCIKILSPQEVQQMGK-RGLELLNSVPV--QRLLN  793

Query  260  GGSSCEVHVSQKETRNM-NGIP-LGSLDY  180
            G  SC+ + SQ+++RN+ +GI  +GSLDY
Sbjct  794  G--SCDDYASQQDSRNLSSGIASVGSLDY  820



>gb|KJB57190.1| hypothetical protein B456_009G152700 [Gossypium raimondii]
Length=904

 Score =   262 bits (669),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 141/209 (67%), Positives = 168/209 (80%), Gaps = 8/209 (4%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSS  621
            SS+LLQNG+S+L+  G E+    +PFS+ N+ S  GTD+ +NP M  SSC++E GFLQS 
Sbjct  702  SSLLLQNGMSSLRGVGSESDSTTIPFSS-NYASTAGTDFSVNPAMTPSSCIEELGFLQSP  760

Query  620  ENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQ  441
            ENV Q NP  RTFVKV+KSGSFGRSLDISKFSSY+ELRSELARMFGLEG LEDP RSGWQ
Sbjct  761  ENVGQENPQTRTFVKVYKSGSFGRSLDISKFSSYNELRSELARMFGLEGQLEDPLRSGWQ  820

Query  440  LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPN  261
            LVFVDRENDVLLLGDDPW EFVN+VW IKILSP EV QMGK  G++L N++P   QRL N
Sbjct  821  LVFVDRENDVLLLGDDPWPEFVNSVWCIKILSPQEVQQMGK-RGLELLNSVPV--QRLLN  877

Query  260  GGSSCEVHVSQKETRNM-NGIP-LGSLDY  180
            G  SC+ + SQ+++RN+ +GI  +GSLDY
Sbjct  878  G--SCDDYASQQDSRNLSSGIASVGSLDY  904



>ref|XP_007024962.1| Auxin response factor 6 isoform 1 [Theobroma cacao]
 gb|EOY27584.1| Auxin response factor 6 isoform 1 [Theobroma cacao]
Length=899

 Score =   261 bits (668),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 140/209 (67%), Positives = 169/209 (81%), Gaps = 8/209 (4%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSS  621
            SS+L+ NG+S+L+  G ++    +PFS+ N+ S  GTD+ +NP M  SSC+DESGFLQS 
Sbjct  697  SSLLMPNGMSSLRGVGSDSDSTTIPFSS-NYMSTAGTDFSVNPAMTPSSCIDESGFLQSP  755

Query  620  ENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQ  441
            ENV Q NP  RTFVKV+KSGSFGRSLDISKFSSY+ELRSELARMFGLEG LEDP RSGWQ
Sbjct  756  ENVGQGNPQTRTFVKVYKSGSFGRSLDISKFSSYNELRSELARMFGLEGQLEDPLRSGWQ  815

Query  440  LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPN  261
            LVFVDRENDVLLLGDDPW EFVN+VW IKILSP EV QMGK  G++L N++P   QRL N
Sbjct  816  LVFVDRENDVLLLGDDPWPEFVNSVWCIKILSPQEVQQMGK-RGLELLNSVPV--QRLSN  872

Query  260  GGSSCEVHVSQKETRNM-NGIP-LGSLDY  180
            G  SC+ +VS++++RN+ +GI  +GSLDY
Sbjct  873  G--SCDDYVSRQDSRNLSSGIASVGSLDY  899



>ref|XP_007024963.1| Auxin response factor 6 isoform 2 [Theobroma cacao]
 gb|EOY27585.1| Auxin response factor 6 isoform 2 [Theobroma cacao]
Length=902

 Score =   261 bits (667),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 140/209 (67%), Positives = 169/209 (81%), Gaps = 8/209 (4%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSS  621
            SS+L+ NG+S+L+  G ++    +PFS+ N+ S  GTD+ +NP M  SSC+DESGFLQS 
Sbjct  700  SSLLMPNGMSSLRGVGSDSDSTTIPFSS-NYMSTAGTDFSVNPAMTPSSCIDESGFLQSP  758

Query  620  ENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQ  441
            ENV Q NP  RTFVKV+KSGSFGRSLDISKFSSY+ELRSELARMFGLEG LEDP RSGWQ
Sbjct  759  ENVGQGNPQTRTFVKVYKSGSFGRSLDISKFSSYNELRSELARMFGLEGQLEDPLRSGWQ  818

Query  440  LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPN  261
            LVFVDRENDVLLLGDDPW EFVN+VW IKILSP EV QMGK  G++L N++P   QRL N
Sbjct  819  LVFVDRENDVLLLGDDPWPEFVNSVWCIKILSPQEVQQMGK-RGLELLNSVPV--QRLSN  875

Query  260  GGSSCEVHVSQKETRNM-NGIP-LGSLDY  180
            G  SC+ +VS++++RN+ +GI  +GSLDY
Sbjct  876  G--SCDDYVSRQDSRNLSSGIASVGSLDY  902



>gb|KJB33383.1| hypothetical protein B456_006G008700 [Gossypium raimondii]
Length=904

 Score =   261 bits (667),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 135/216 (63%), Positives = 165/216 (76%), Gaps = 14/216 (6%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSS  621
            SS++L +G++N K+   EN  +++P++  NFTS  GTD+PLN DM  SSCVDESG+LQSS
Sbjct  694  SSLMLHHGMTNPKSIRNENDSMSLPYAASNFTSASGTDFPLNSDMTASSCVDESGYLQSS  753

Query  620  ENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQ  441
            ENVDQ NPP  TFVKVHKSGSFGRSLDISKF SY ELR ELAR+FGLE  LEDP+RSGWQ
Sbjct  754  ENVDQVNPPTGTFVKVHKSGSFGRSLDISKFGSYDELRCELARLFGLERQLEDPQRSGWQ  813

Query  440  LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRL--  267
            LVFVDREND+LLLGDDPWQEFVNNVWYIKILSP EV QMGK  G +   ++P  NQRL  
Sbjct  814  LVFVDRENDILLLGDDPWQEFVNNVWYIKILSPLEVQQMGK--GQNPATSIP--NQRLNA  869

Query  266  -------PNGGSSCEVHVSQKETRNMNGIPLGSLDY  180
                    + G+ C  ++S+++ R+ +   +GSL+Y
Sbjct  870  TTTATTSSSNGNHCGDYMSRQDLRS-SVASMGSLEY  904



>emb|CBI22060.3| unnamed protein product [Vitis vinifera]
Length=836

 Score =   260 bits (665),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 128/167 (77%), Positives = 142/167 (85%), Gaps = 3/167 (2%)
 Frame = -3

Query  749  ENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSSENVDQANPPNRTFVKVH  570
            EN  ++MPFST NF +  GTD+PLN DM TSSC+DESGFLQSSEN++Q NPP RTFVKVH
Sbjct  627  ENDSVSMPFSTPNFANAPGTDFPLNSDMTTSSCIDESGFLQSSENLEQVNPPTRTFVKVH  686

Query  569  KSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDP  390
            K GSFGRSLDI+KFSSY ELR EL RMFGLEG LEDP RSGWQLVFVDRENDVLLLGDDP
Sbjct  687  KLGSFGRSLDITKFSSYDELRGELGRMFGLEGRLEDPLRSGWQLVFVDRENDVLLLGDDP  746

Query  389  WQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPNGGSS  249
            WQEFVNNVWYIKILSP EV QMGK EGI++PN +P+   R+ N G+S
Sbjct  747  WQEFVNNVWYIKILSPLEVQQMGK-EGINVPNPIPS--HRISNSGNS  790



>ref|XP_006468258.1| PREDICTED: auxin response factor 6-like isoform X1 [Citrus sinensis]
 gb|KDO75360.1| hypothetical protein CISIN_1g002624mg [Citrus sinensis]
Length=899

 Score =   258 bits (658),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 133/209 (64%), Positives = 164/209 (78%), Gaps = 7/209 (3%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSS  621
            SS+L+QN +S+L   G  +    +PF++ N+ S  G D+ +NP++  SSC+DESGFLQS 
Sbjct  696  SSLLMQNEMSSLGGVGSNSDSTTIPFASSNYMSTAGADFSVNPEIAPSSCIDESGFLQSP  755

Query  620  ENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQ  441
            ENV Q NPPNRTFVKV+KSGSFGRSLDI+KFSSYHELRSELARMFGLEG LEDP RSGWQ
Sbjct  756  ENVGQVNPPNRTFVKVYKSGSFGRSLDITKFSSYHELRSELARMFGLEGHLEDPLRSGWQ  815

Query  440  LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPN  261
            LVFVDRENDVLLLGD PW EFVN+VW IKILSP EV QMGK  G +L N++P   QRL N
Sbjct  816  LVFVDRENDVLLLGDGPWPEFVNSVWCIKILSPPEVQQMGK-RGNELLNSVPI--QRLSN  872

Query  260  GGSSCEVHVSQKETRNMNG--IPLGSLDY  180
              SSC+ + +++++RN++     +GSLD+
Sbjct  873  --SSCDDYATRQDSRNLSAGITSVGSLDF  899



>ref|XP_006468259.1| PREDICTED: auxin response factor 6-like isoform X2 [Citrus sinensis]
 gb|KDO75359.1| hypothetical protein CISIN_1g002624mg [Citrus sinensis]
Length=896

 Score =   258 bits (658),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 133/209 (64%), Positives = 164/209 (78%), Gaps = 7/209 (3%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSS  621
            SS+L+QN +S+L   G  +    +PF++ N+ S  G D+ +NP++  SSC+DESGFLQS 
Sbjct  693  SSLLMQNEMSSLGGVGSNSDSTTIPFASSNYMSTAGADFSVNPEIAPSSCIDESGFLQSP  752

Query  620  ENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQ  441
            ENV Q NPPNRTFVKV+KSGSFGRSLDI+KFSSYHELRSELARMFGLEG LEDP RSGWQ
Sbjct  753  ENVGQVNPPNRTFVKVYKSGSFGRSLDITKFSSYHELRSELARMFGLEGHLEDPLRSGWQ  812

Query  440  LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPN  261
            LVFVDRENDVLLLGD PW EFVN+VW IKILSP EV QMGK  G +L N++P   QRL N
Sbjct  813  LVFVDRENDVLLLGDGPWPEFVNSVWCIKILSPPEVQQMGK-RGNELLNSVPI--QRLSN  869

Query  260  GGSSCEVHVSQKETRNMNG--IPLGSLDY  180
              SSC+ + +++++RN++     +GSLD+
Sbjct  870  --SSCDDYATRQDSRNLSAGITSVGSLDF  896



>ref|XP_006448968.1| hypothetical protein CICLE_v10014198mg [Citrus clementina]
 gb|ESR62208.1| hypothetical protein CICLE_v10014198mg [Citrus clementina]
Length=899

 Score =   258 bits (658),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 133/209 (64%), Positives = 164/209 (78%), Gaps = 7/209 (3%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSS  621
            SS+L+QN +S+L   G  +    +PF++ N+ S  G D+ +NP++  SSC+DESGFLQS 
Sbjct  696  SSLLMQNEMSSLGGVGSNSDSTTIPFASSNYMSTAGADFSVNPEIAPSSCIDESGFLQSP  755

Query  620  ENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQ  441
            ENV Q NPPNRTFVKV+KSGSFGRSLDI+KFSSYHELRSELARMFGLEG LEDP RSGWQ
Sbjct  756  ENVGQVNPPNRTFVKVYKSGSFGRSLDITKFSSYHELRSELARMFGLEGHLEDPLRSGWQ  815

Query  440  LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPN  261
            LVFVDRENDVLLLGD PW EFVN+VW IKILSP EV QMGK  G +L N++P   QRL N
Sbjct  816  LVFVDRENDVLLLGDGPWPEFVNSVWCIKILSPPEVQQMGK-RGNELLNSVPI--QRLSN  872

Query  260  GGSSCEVHVSQKETRNMNG--IPLGSLDY  180
              SSC+ + +++++RN++     +GSLD+
Sbjct  873  --SSCDDYATRQDSRNLSAGITSVGSLDF  899



>gb|KJB57192.1| hypothetical protein B456_009G152700 [Gossypium raimondii]
Length=914

 Score =   256 bits (655),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 134/198 (68%), Positives = 160/198 (81%), Gaps = 6/198 (3%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSS  621
            SS+LLQNG+S+L+  G E+    +PFS+ N+ S  GTD+ +NP M  SSC++E GFLQS 
Sbjct  702  SSLLLQNGMSSLRGVGSESDSTTIPFSS-NYASTAGTDFSVNPAMTPSSCIEELGFLQSP  760

Query  620  ENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQ  441
            ENV Q NP  RTFVKV+KSGSFGRSLDISKFSSY+ELRSELARMFGLEG LEDP RSGWQ
Sbjct  761  ENVGQENPQTRTFVKVYKSGSFGRSLDISKFSSYNELRSELARMFGLEGQLEDPLRSGWQ  820

Query  440  LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPN  261
            LVFVDRENDVLLLGDDPW EFVN+VW IKILSP EV QMGK  G++L N++P   QRL N
Sbjct  821  LVFVDRENDVLLLGDDPWPEFVNSVWCIKILSPQEVQQMGK-RGLELLNSVPV--QRLLN  877

Query  260  GGSSCEVHVSQKETRNMN  207
            G  SC+ + SQ+++RN++
Sbjct  878  G--SCDDYASQQDSRNLS  893



>ref|XP_011096637.1| PREDICTED: auxin response factor 6 isoform X3 [Sesamum indicum]
Length=901

 Score =   256 bits (655),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 136/209 (65%), Positives = 165/209 (79%), Gaps = 5/209 (2%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSS  621
            S +L+QNGI NLK  G ++    + F++ +F S  G DY LNP + +SSC+DESGFL SS
Sbjct  696  SPLLMQNGIPNLKAVGSDSDNATVVFASSSFMSSSGADYSLNPTVTSSSCLDESGFLLSS  755

Query  620  ENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQ  441
            +NV   NPPNRTFVKV+KSGSFGRSLDISKFSSYHELRSELA+MFGLEG LEDP RSGWQ
Sbjct  756  DNVGHVNPPNRTFVKVYKSGSFGRSLDISKFSSYHELRSELAQMFGLEGQLEDPLRSGWQ  815

Query  440  LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPN  261
            LVFVDRENDVLLLGDDPW EFVN+VW IKILSP EV +MGK  G++L N++P     LPN
Sbjct  816  LVFVDRENDVLLLGDDPWPEFVNSVWCIKILSPQEVQEMGK-RGLELLNSVPIQKLPLPN  874

Query  260  GGSSCEVHVSQKETRNMN-GIP-LGSLDY  180
            G  +C+   +++E RNM+ GIP +G+LD+
Sbjct  875  G--TCDGFANRQEARNMSAGIPSVGTLDF  901



>ref|XP_011096635.1| PREDICTED: auxin response factor 6 isoform X1 [Sesamum indicum]
Length=903

 Score =   256 bits (655),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 136/209 (65%), Positives = 165/209 (79%), Gaps = 5/209 (2%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSS  621
            S +L+QNGI NLK  G ++    + F++ +F S  G DY LNP + +SSC+DESGFL SS
Sbjct  698  SPLLMQNGIPNLKAVGSDSDNATVVFASSSFMSSSGADYSLNPTVTSSSCLDESGFLLSS  757

Query  620  ENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQ  441
            +NV   NPPNRTFVKV+KSGSFGRSLDISKFSSYHELRSELA+MFGLEG LEDP RSGWQ
Sbjct  758  DNVGHVNPPNRTFVKVYKSGSFGRSLDISKFSSYHELRSELAQMFGLEGQLEDPLRSGWQ  817

Query  440  LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPN  261
            LVFVDRENDVLLLGDDPW EFVN+VW IKILSP EV +MGK  G++L N++P     LPN
Sbjct  818  LVFVDRENDVLLLGDDPWPEFVNSVWCIKILSPQEVQEMGK-RGLELLNSVPIQKLPLPN  876

Query  260  GGSSCEVHVSQKETRNMN-GIP-LGSLDY  180
            G  +C+   +++E RNM+ GIP +G+LD+
Sbjct  877  G--TCDGFANRQEARNMSAGIPSVGTLDF  903



>ref|XP_011096636.1| PREDICTED: auxin response factor 6 isoform X2 [Sesamum indicum]
Length=902

 Score =   256 bits (654),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 136/209 (65%), Positives = 165/209 (79%), Gaps = 5/209 (2%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSS  621
            S +L+QNGI NLK  G ++    + F++ +F S  G DY LNP + +SSC+DESGFL SS
Sbjct  697  SPLLMQNGIPNLKAVGSDSDNATVVFASSSFMSSSGADYSLNPTVTSSSCLDESGFLLSS  756

Query  620  ENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQ  441
            +NV   NPPNRTFVKV+KSGSFGRSLDISKFSSYHELRSELA+MFGLEG LEDP RSGWQ
Sbjct  757  DNVGHVNPPNRTFVKVYKSGSFGRSLDISKFSSYHELRSELAQMFGLEGQLEDPLRSGWQ  816

Query  440  LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPN  261
            LVFVDRENDVLLLGDDPW EFVN+VW IKILSP EV +MGK  G++L N++P     LPN
Sbjct  817  LVFVDRENDVLLLGDDPWPEFVNSVWCIKILSPQEVQEMGK-RGLELLNSVPIQKLPLPN  875

Query  260  GGSSCEVHVSQKETRNMN-GIP-LGSLDY  180
            G  +C+   +++E RNM+ GIP +G+LD+
Sbjct  876  G--TCDGFANRQEARNMSAGIPSVGTLDF  902



>ref|XP_010275911.1| PREDICTED: auxin response factor 6-like isoform X2 [Nelumbo nucifera]
Length=897

 Score =   256 bits (654),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 134/198 (68%), Positives = 161/198 (81%), Gaps = 8/198 (4%)
 Frame = -3

Query  767  LKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSSENVDQANPPNR  588
            L+  G E     MPF++ NF S  GT++PLNP + TSSC+DES FLQS ENV Q NPP R
Sbjct  706  LRGVGSEGDSATMPFAS-NFVSATGTEFPLNPVVTTSSCLDESTFLQSPENVGQVNPPTR  764

Query  587  TFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVL  408
            TFVKV+KSGSFGRSLDI++FSSYHELRSELARMFGLEG LEDP RSGWQLVFVDRENDVL
Sbjct  765  TFVKVYKSGSFGRSLDITRFSSYHELRSELARMFGLEGQLEDPLRSGWQLVFVDRENDVL  824

Query  407  LLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPNGGSSCEVHVSQ  228
            LLGDDPWQEFVN+VW IKILSP EV QMGK +G++L N++P   QRL    +SC+ +V++
Sbjct  825  LLGDDPWQEFVNSVWCIKILSPQEVQQMGK-QGVELLNSVPI--QRL--SSNSCDDYVNR  879

Query  227  KETRNMN-GIP-LGSLDY  180
            +++RN++ GI  +GSLDY
Sbjct  880  QDSRNLSTGITSVGSLDY  897



>gb|KHG10285.1| Auxin response factor 6 -like protein [Gossypium arboreum]
Length=843

 Score =   254 bits (649),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 136/209 (65%), Positives = 167/209 (80%), Gaps = 8/209 (4%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSS  621
            SS+L+QNG+S L+  G ++   ++PF + N+ S  G D+ +NP M  SSC+DESGFLQS 
Sbjct  641  SSVLMQNGMSGLRGVGTDSDSTSIPFFS-NYMSTAGNDFSVNPAMAPSSCIDESGFLQSQ  699

Query  620  ENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQ  441
            ENV Q+NP  RTFVKV+KSGSFGRSLDIS FS+Y+ELRSELA MFGLEG LEDP RSGWQ
Sbjct  700  ENVGQSNPQTRTFVKVYKSGSFGRSLDISAFSNYNELRSELAHMFGLEGQLEDPLRSGWQ  759

Query  440  LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPN  261
            LVFVDRENDVLLLGDDPW EFVN+VW IKILSP EV QMGK  G++L N++P   QRL N
Sbjct  760  LVFVDRENDVLLLGDDPWPEFVNSVWCIKILSPQEVQQMGK-RGLELLNSVPV--QRLSN  816

Query  260  GGSSCEVHVSQKETRNM-NGIP-LGSLDY  180
            G  SC+ +VS++++RN+ +GI  +GSLDY
Sbjct  817  G--SCDDYVSRQDSRNLSSGIASVGSLDY  843



>ref|XP_010688801.1| PREDICTED: auxin response factor 6 isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=934

 Score =   254 bits (649),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 133/204 (65%), Positives = 156/204 (76%), Gaps = 5/204 (2%)
 Frame = -3

Query  785  QNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSSENVDQ  606
            QN ++NL++   EN  L+M F+  +F S  GTD+P   D+  +SCVDESGFLQSSEN D 
Sbjct  734  QNELANLRSHNNENDSLSMQFACSSFPSAAGTDFPPASDIMATSCVDESGFLQSSENDDH  793

Query  605  ANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQLVFVD  426
             NPP+ TFVKV KSGS GRSLDISKFSSY ELRSELA MFGLEG LEDP RSGWQLVFVD
Sbjct  794  VNPPSGTFVKVQKSGSLGRSLDISKFSSYQELRSELAHMFGLEGQLEDPLRSGWQLVFVD  853

Query  425  RENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPNGGSSC  246
            RENDVLLLGDDPWQEFVNNVWYIKILSP EV QMGK EG++ PN++P    +  N  +SC
Sbjct  854  RENDVLLLGDDPWQEFVNNVWYIKILSPQEVQQMGK-EGLNFPNSIPRPKHQ--NSFNSC  910

Query  245  EVHVSQKETR-NMNGIP-LGSLDY  180
            + +  Q++ R N NG+  + SLDY
Sbjct  911  DDYTLQQDLRHNSNGMASVTSLDY  934



>ref|XP_010688802.1| PREDICTED: auxin response factor 6 isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=931

 Score =   254 bits (649),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 133/204 (65%), Positives = 156/204 (76%), Gaps = 5/204 (2%)
 Frame = -3

Query  785  QNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSSENVDQ  606
            QN ++NL++   EN  L+M F+  +F S  GTD+P   D+  +SCVDESGFLQSSEN D 
Sbjct  731  QNELANLRSHNNENDSLSMQFACSSFPSAAGTDFPPASDIMATSCVDESGFLQSSENDDH  790

Query  605  ANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQLVFVD  426
             NPP+ TFVKV KSGS GRSLDISKFSSY ELRSELA MFGLEG LEDP RSGWQLVFVD
Sbjct  791  VNPPSGTFVKVQKSGSLGRSLDISKFSSYQELRSELAHMFGLEGQLEDPLRSGWQLVFVD  850

Query  425  RENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPNGGSSC  246
            RENDVLLLGDDPWQEFVNNVWYIKILSP EV QMGK EG++ PN++P    +  N  +SC
Sbjct  851  RENDVLLLGDDPWQEFVNNVWYIKILSPQEVQQMGK-EGLNFPNSIPRPKHQ--NSFNSC  907

Query  245  EVHVSQKETR-NMNGIP-LGSLDY  180
            + +  Q++ R N NG+  + SLDY
Sbjct  908  DDYTLQQDLRHNSNGMASVTSLDY  931



>emb|CDP05666.1| unnamed protein product [Coffea canephora]
Length=906

 Score =   254 bits (648),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 132/209 (63%), Positives = 157/209 (75%), Gaps = 7/209 (3%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSS  621
            SS+L+QNG+SNL+    + G   +PF + N+    GT +  NP+M  SSC+ ESGFL+S 
Sbjct  703  SSLLIQNGMSNLRGVVSDGGCTTIPFPSSNYAGTTGTKFQQNPEMTPSSCIQESGFLRSP  762

Query  620  ENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQ  441
            +N+ Q NP  RTFVKV+KSGSFGRSLDISKFSSYHELR ELAR+FGLEGLLEDP RSGWQ
Sbjct  763  DNIGQGNPATRTFVKVYKSGSFGRSLDISKFSSYHELRIELARLFGLEGLLEDPLRSGWQ  822

Query  440  LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPN  261
            LVFVDRENDVLLLGDDPW EFVN+VW IKILSP EV  MGK  G++L N+ P  N RLPN
Sbjct  823  LVFVDRENDVLLLGDDPWPEFVNSVWCIKILSPQEVQHMGK-RGLELLNSAP--NSRLPN  879

Query  260  GGSSCEVHVSQKETRN--MNGIPLGSLDY  180
            G  SC+ + S +E RN       +GSL+Y
Sbjct  880  G--SCDDYASLQEPRNAITRMTSVGSLNY  906



>ref|XP_002298839.1| auxin response factor 6 family protein [Populus trichocarpa]
 gb|EEE83644.1| auxin response factor 6 family protein [Populus trichocarpa]
Length=884

 Score =   253 bits (646),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 133/209 (64%), Positives = 167/209 (80%), Gaps = 8/209 (4%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSS  621
            SS+LLQNG+S+L+  G ++    +PFS+ N+ S  GT++ LNP M  SSC+D+S FLQS+
Sbjct  682  SSLLLQNGMSSLRGVGSDSDSTTIPFSS-NYISTAGTNFSLNPAMTPSSCIDDSCFLQST  740

Query  620  ENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQ  441
            EN  Q NPP RTFVKV+KSGSFGRSLDI+KFSSY+ELRSEL+RMFGLEG LEDP RSGWQ
Sbjct  741  ENASQGNPPTRTFVKVYKSGSFGRSLDITKFSSYNELRSELSRMFGLEGQLEDPLRSGWQ  800

Query  440  LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPN  261
            LVF+DRENDVLLLGD PW EFVN+VWYIKILSP EV QMGK  G++L N+ P   QRL N
Sbjct  801  LVFIDRENDVLLLGDGPWPEFVNSVWYIKILSPQEVQQMGK-RGLELLNSFPI--QRLSN  857

Query  260  GGSSCEVHVSQKETRNMN-GIP-LGSLDY  180
            G  SC+ + +++++++ + GI  +GSLDY
Sbjct  858  G--SCDDYANRQDSKSSSTGITSVGSLDY  884



>gb|KJB69886.1| hypothetical protein B456_011G048200 [Gossypium raimondii]
Length=907

 Score =   253 bits (646),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 136/209 (65%), Positives = 167/209 (80%), Gaps = 8/209 (4%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSS  621
            SS+L+QNG+S L+  G ++   ++PF + N+ S  G D+ +NP M  SSC+DESGFLQS 
Sbjct  705  SSVLMQNGMSGLRGVGTDSDSTSIPFFS-NYMSTAGNDFSVNPAMTPSSCIDESGFLQSQ  763

Query  620  ENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQ  441
            ENV Q+NP  RTFVKV+KSGSFGRSLDIS FS+Y+ELRSELA MFGLEG LEDP RSGWQ
Sbjct  764  ENVGQSNPQTRTFVKVYKSGSFGRSLDISAFSNYNELRSELAHMFGLEGQLEDPLRSGWQ  823

Query  440  LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPN  261
            LVFVDRENDVLLLGDDPW EFVN+VW IKILSP EV QMGK  G++L N++P   QRL N
Sbjct  824  LVFVDRENDVLLLGDDPWPEFVNSVWCIKILSPQEVQQMGK-RGLELLNSVPV--QRLSN  880

Query  260  GGSSCEVHVSQKETRNM-NGIP-LGSLDY  180
            G  SC+ +VS++++RN+ +GI  +GSLDY
Sbjct  881  G--SCDDYVSRQDSRNLSSGIASVGSLDY  907



>ref|XP_011012265.1| PREDICTED: auxin response factor 6-like [Populus euphratica]
Length=902

 Score =   253 bits (645),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 133/209 (64%), Positives = 168/209 (80%), Gaps = 8/209 (4%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSS  621
            SS+LLQNG+S+L+  G ++    +PFS+ N+ S  GT++ LNP M  SSC+DES FLQS+
Sbjct  697  SSLLLQNGMSSLRGVGSDSDSTTIPFSS-NYMSTAGTNFSLNPAMTPSSCIDESCFLQST  755

Query  620  ENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQ  441
            ENV Q NPP RTFVKV+KSGSFGRSLDI+KFS+Y+ELRSEL+RMFGLEG LEDP RSGWQ
Sbjct  756  ENVSQGNPPTRTFVKVYKSGSFGRSLDITKFSNYNELRSELSRMFGLEGQLEDPLRSGWQ  815

Query  440  LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPN  261
            LVF+DRENDVLLLGD PW EFVN+VW IKILSP EV QMGK  G++L N+ P   QRL N
Sbjct  816  LVFIDRENDVLLLGDGPWPEFVNSVWCIKILSPQEVQQMGK-RGLELLNSFPI--QRLSN  872

Query  260  GGSSCEVHVSQKETRNMN-GIP-LGSLDY  180
            G  SC+ + +++++++++ GI  +GSLDY
Sbjct  873  G--SCDDYANRQDSKSLSTGITSVGSLDY  899



>ref|XP_010090447.1| Auxin response factor 6 [Morus notabilis]
 gb|EXB39505.1| Auxin response factor 6 [Morus notabilis]
Length=902

 Score =   252 bits (644),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 137/210 (65%), Positives = 166/210 (79%), Gaps = 8/210 (4%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPD-MGTSSCVDESGFLQS  624
            SS+L+QNGISNL+  G E+    +PF + ++ S  GT++ LNP  +  SSC+DESGFLQS
Sbjct  698  SSLLMQNGISNLRGVGSESDSTTIPFPSSSYMSTTGTNFSLNPAAIAPSSCIDESGFLQS  757

Query  623  SENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGW  444
             EN  Q N PNRTFVKVHKSGSFGRSLDI+KFSSY+ELR ELARMFGLEG LEDP RSGW
Sbjct  758  PENAGQGNNPNRTFVKVHKSGSFGRSLDITKFSSYNELRGELARMFGLEGELEDPVRSGW  817

Query  443  QLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLP  264
            QLVFVDRENDVLLLGDDPW EFVN+VW IKILSP EV QMGK  G++L N++  + QRL 
Sbjct  818  QLVFVDRENDVLLLGDDPWPEFVNSVWCIKILSPQEVQQMGK-RGLELLNSV--SIQRLA  874

Query  263  NGGSSCEVHVSQKETRNM-NGIP-LGSLDY  180
            N  +SC+ + S +++RN+ +GI  +GSLDY
Sbjct  875  N--NSCDDYPSCEDSRNLSSGITSVGSLDY  902



>ref|XP_011047524.1| PREDICTED: auxin response factor 6-like isoform X2 [Populus euphratica]
Length=902

 Score =   252 bits (644),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 133/209 (64%), Positives = 168/209 (80%), Gaps = 8/209 (4%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSS  621
            SS+LLQNG+S+L+  G ++    +PFS+ N+ S  GT++ LNP M  SSC+DES FLQS+
Sbjct  697  SSLLLQNGMSSLRGVGSDSDSTTIPFSS-NYMSTAGTNFSLNPAMTPSSCIDESCFLQST  755

Query  620  ENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQ  441
            ENV Q NPP RTFVKV+KSGSFGRSLDI+KFS+Y+ELRSEL+RMFGLEG LEDP RSGWQ
Sbjct  756  ENVSQGNPPTRTFVKVYKSGSFGRSLDITKFSNYNELRSELSRMFGLEGQLEDPLRSGWQ  815

Query  440  LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPN  261
            LVF+DRENDVLLLGD PW EFVN+VW IKILSP EV QMGK  G++L N+ P   QRL N
Sbjct  816  LVFIDRENDVLLLGDGPWPEFVNSVWCIKILSPQEVQQMGK-RGLELLNSFPI--QRLSN  872

Query  260  GGSSCEVHVSQKETRNMN-GIP-LGSLDY  180
            G  SC+ + +++++++++ GI  +GSLDY
Sbjct  873  G--SCDDYANRQDSKSLSTGITSVGSLDY  899



>ref|XP_011047523.1| PREDICTED: auxin response factor 6-like isoform X1 [Populus euphratica]
Length=904

 Score =   252 bits (644),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 133/209 (64%), Positives = 168/209 (80%), Gaps = 8/209 (4%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSS  621
            SS+LLQNG+S+L+  G ++    +PFS+ N+ S  GT++ LNP M  SSC+DES FLQS+
Sbjct  699  SSLLLQNGMSSLRGVGSDSDSTTIPFSS-NYMSTAGTNFSLNPAMTPSSCIDESCFLQST  757

Query  620  ENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQ  441
            ENV Q NPP RTFVKV+KSGSFGRSLDI+KFS+Y+ELRSEL+RMFGLEG LEDP RSGWQ
Sbjct  758  ENVSQGNPPTRTFVKVYKSGSFGRSLDITKFSNYNELRSELSRMFGLEGQLEDPLRSGWQ  817

Query  440  LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPN  261
            LVF+DRENDVLLLGD PW EFVN+VW IKILSP EV QMGK  G++L N+ P   QRL N
Sbjct  818  LVFIDRENDVLLLGDGPWPEFVNSVWCIKILSPQEVQQMGK-RGLELLNSFPI--QRLSN  874

Query  260  GGSSCEVHVSQKETRNMN-GIP-LGSLDY  180
            G  SC+ + +++++++++ GI  +GSLDY
Sbjct  875  G--SCDDYANRQDSKSLSTGITSVGSLDY  901



>ref|XP_007212802.1| hypothetical protein PRUPE_ppa001179mg [Prunus persica]
 gb|EMJ14001.1| hypothetical protein PRUPE_ppa001179mg [Prunus persica]
Length=887

 Score =   252 bits (643),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 135/208 (65%), Positives = 162/208 (78%), Gaps = 7/208 (3%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSS  621
            SS+L+QNG+SNL+  G ++    M F   N+ S  GTD+ LNP +  SSC+DESGFLQS 
Sbjct  686  SSLLMQNGMSNLRGVGSDSDSTTMHFPP-NYLSTTGTDFSLNPAVTPSSCIDESGFLQSP  744

Query  620  ENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQ  441
            ENV   NP N  FVKV+KSGSFGRSLDI+KFSSYHELR ELARMFGLEG LEDP RSGWQ
Sbjct  745  ENVGHGNPLNNNFVKVYKSGSFGRSLDITKFSSYHELRGELARMFGLEGELEDPVRSGWQ  804

Query  440  LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPN  261
            LVFVDRENDVLLLGDDPW EFVN+VW IKILSP EV QMGK  G+DL  ++P   QRL N
Sbjct  805  LVFVDRENDVLLLGDDPWPEFVNSVWCIKILSPHEVQQMGK-RGLDLLKSVP--TQRLSN  861

Query  260  GGSSCEVHVSQKETRNMNGIP-LGSLDY  180
              +SC+ + S++++RN++GI  +GSL+Y
Sbjct  862  --NSCDDYGSRQDSRNLSGITSVGSLEY  887



>emb|CDQ51986.1| auxin response factor, partial [Fagus sylvatica]
Length=169

 Score =   233 bits (595),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 121/173 (70%), Positives = 141/173 (82%), Gaps = 6/173 (3%)
 Frame = -3

Query  725  FSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRS  546
            F + NF S  GTD+ LNP M  SSC+DESGFLQS ENV Q NPP RTFVKV+KSGSFGRS
Sbjct  1    FPSSNFMSTAGTDFSLNPAMTPSSCIDESGFLQSPENVGQVNPPTRTFVKVYKSGSFGRS  60

Query  545  LDISKFSSYHELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNV  366
            LDI+KF+SYHELR ELARMFGLEG LEDP RSGWQLVFVDRENDVLLLGDDPW EFVN+V
Sbjct  61   LDITKFTSYHELRGELARMFGLEGELEDPLRSGWQLVFVDRENDVLLLGDDPW-EFVNSV  119

Query  365  WYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPNGGSSCEVHVSQKETRNMN  207
            W IKILSP EV QMGK  G++L N++P   QRL +  SSC+ +  ++++RN++
Sbjct  120  WCIKILSPQEVQQMGK-RGLELLNSVPI--QRLSS--SSCDDYGGRQDSRNLS  167



>ref|XP_002316773.1| auxin response factor 6 family protein [Populus trichocarpa]
 gb|EEE97385.1| auxin response factor 6 family protein [Populus trichocarpa]
Length=914

 Score =   251 bits (640),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 134/208 (64%), Positives = 168/208 (81%), Gaps = 8/208 (4%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSS  621
            SS+L+QNG+S+L+  G ++    +PFS+ N+ S  GT++ LNP M  SSC+DESGFLQS 
Sbjct  709  SSLLMQNGLSSLRGVGSDSDSTTVPFSS-NYMSIAGTNFSLNPAMAPSSCIDESGFLQSM  767

Query  620  ENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQ  441
            ENV Q NPP+RTFVKV+KSGSFGRSLDI+KFS+Y+ELRSELA MFGLEG LEDP RSGWQ
Sbjct  768  ENVGQGNPPSRTFVKVYKSGSFGRSLDITKFSNYNELRSELAFMFGLEGQLEDPLRSGWQ  827

Query  440  LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPN  261
            LVF+DRENDVLLLGD PW EFVN+VW IKILSP EV QMGK  G++L N++P   QRL N
Sbjct  828  LVFIDRENDVLLLGDGPWPEFVNSVWCIKILSPQEVQQMGK-RGLELLNSVPI--QRLSN  884

Query  260  GGSSCEVHVSQKETRNM-NGIP-LGSLD  183
            G  SC+ +V++++++N+ N I  +GSLD
Sbjct  885  G--SCDDYVNRQDSQNLSNAITSVGSLD  910



>ref|XP_008776642.1| PREDICTED: auxin response factor 17-like [Phoenix dactylifera]
Length=912

 Score =   250 bits (639),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 130/210 (62%), Positives = 165/210 (79%), Gaps = 8/210 (4%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSS  621
            SS+L+QNG+ +L+    E+    +P++ CNF S  GTD+PLN  + +SSC+DESGFLQS 
Sbjct  708  SSLLVQNGMPSLRTGANESDSAAVPYAACNFLSPSGTDFPLNQALTSSSCLDESGFLQSP  767

Query  620  ENVDQANPPNR-TFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGW  444
            ENVDQ N P   TFVKV+KSGSFGRSLDI++FSSYHELR EL R+FGLEG LEDP RSGW
Sbjct  768  ENVDQVNNPQSGTFVKVYKSGSFGRSLDITRFSSYHELRGELGRLFGLEGQLEDPVRSGW  827

Query  443  QLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLP  264
            QLVFVDRENDVLL+GDDPWQEFVN V+ IKILSP EV QMGK +G++L N+ P   +R P
Sbjct  828  QLVFVDRENDVLLVGDDPWQEFVNTVYCIKILSPQEVQQMGK-QGVNLLNSAPI--KRPP  884

Query  263  NGGSSCEVHVSQKETRNMNG--IPLGSLDY  180
            +  +SC+ +VS++++RN++     +GSLDY
Sbjct  885  S--NSCDGYVSRQDSRNLSSSITSVGSLDY  912



>ref|XP_008225531.1| PREDICTED: auxin response factor 6 [Prunus mume]
Length=889

 Score =   249 bits (635),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 134/208 (64%), Positives = 161/208 (77%), Gaps = 7/208 (3%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSS  621
            SS+L+QNG+SNL+  G ++    M F   N+ S  GTD+ LNP +  SSC+DESGFLQS 
Sbjct  688  SSLLMQNGMSNLRGVGSDSDSTTMHFPP-NYLSTTGTDFSLNPAVTPSSCIDESGFLQSP  746

Query  620  ENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQ  441
            ENV   N  N  FVKV+KSGSFGRSLDI+KFSSYHELR ELARMFGLEG LEDP RSGWQ
Sbjct  747  ENVGHGNTLNNNFVKVYKSGSFGRSLDITKFSSYHELRGELARMFGLEGELEDPVRSGWQ  806

Query  440  LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPN  261
            LVFVDRENDVLLLGDDPW EFVN+VW IKILSP EV QMGK  G+DL  ++P   QRL N
Sbjct  807  LVFVDRENDVLLLGDDPWPEFVNSVWCIKILSPHEVQQMGK-RGLDLLKSVP--TQRLSN  863

Query  260  GGSSCEVHVSQKETRNMNGIP-LGSLDY  180
              +SC+ + S++++RN++GI  +GSL+Y
Sbjct  864  --NSCDDYGSRQDSRNLSGITSVGSLEY  889



>ref|XP_010941528.1| PREDICTED: auxin response factor 17-like isoform X2 [Elaeis guineensis]
Length=823

 Score =   248 bits (632),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 128/210 (61%), Positives = 166/210 (79%), Gaps = 8/210 (4%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSS  621
            SS+L+QNG+ +L+    E+    MP+  CNF S  GTD+PLN  + +SSC+D S FLQS 
Sbjct  619  SSLLVQNGMPSLRTVASESDSAAMPYGACNFLSPSGTDFPLNQALTSSSCLDASRFLQSP  678

Query  620  ENVDQ-ANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGW  444
            ENVDQ ++P + TFVKV+K+GSFGRSLDI++FSSYHELRSEL R+FGLEG LEDP RSGW
Sbjct  679  ENVDQVSHPQSGTFVKVYKAGSFGRSLDITRFSSYHELRSELGRLFGLEGQLEDPVRSGW  738

Query  443  QLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLP  264
            QLVFVDRENDVLL+GDDPWQEFVN V+ IKILSP EV QMG+ +G+DL ++ P   +RLP
Sbjct  739  QLVFVDRENDVLLVGDDPWQEFVNTVYCIKILSPQEVQQMGR-QGVDLLSSAPI--KRLP  795

Query  263  NGGSSCEVHVSQKETRNMNG--IPLGSLDY  180
            +  +SC+ +VS++++RN++     +GSLDY
Sbjct  796  S--NSCDGYVSRQDSRNLSSGVTSVGSLDY  823



>ref|XP_010941526.1| PREDICTED: auxin response factor 17-like isoform X1 [Elaeis guineensis]
Length=919

 Score =   248 bits (633),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 128/210 (61%), Positives = 166/210 (79%), Gaps = 8/210 (4%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSS  621
            SS+L+QNG+ +L+    E+    MP+  CNF S  GTD+PLN  + +SSC+D S FLQS 
Sbjct  715  SSLLVQNGMPSLRTVASESDSAAMPYGACNFLSPSGTDFPLNQALTSSSCLDASRFLQSP  774

Query  620  ENVDQ-ANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGW  444
            ENVDQ ++P + TFVKV+K+GSFGRSLDI++FSSYHELRSEL R+FGLEG LEDP RSGW
Sbjct  775  ENVDQVSHPQSGTFVKVYKAGSFGRSLDITRFSSYHELRSELGRLFGLEGQLEDPVRSGW  834

Query  443  QLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLP  264
            QLVFVDRENDVLL+GDDPWQEFVN V+ IKILSP EV QMG+ +G+DL ++ P   +RLP
Sbjct  835  QLVFVDRENDVLLVGDDPWQEFVNTVYCIKILSPQEVQQMGR-QGVDLLSSAPI--KRLP  891

Query  263  NGGSSCEVHVSQKETRNMNG--IPLGSLDY  180
            +  +SC+ +VS++++RN++     +GSLDY
Sbjct  892  S--NSCDGYVSRQDSRNLSSGVTSVGSLDY  919



>ref|XP_011085226.1| PREDICTED: auxin response factor 6-like isoform X1 [Sesamum indicum]
Length=910

 Score =   246 bits (628),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 130/209 (62%), Positives = 162/209 (78%), Gaps = 5/209 (2%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSS  621
            SS+L+QNG+SNLK  G +     + F + ++ S    DY L   + +S+ +DESGFL+SS
Sbjct  705  SSLLMQNGMSNLKGVGSDCDNAAIAFGSSSYMSSPVADYSLKTTVTSSNGIDESGFLRSS  764

Query  620  ENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQ  441
            ENV   NP NRTFVKV+KSGSFGRSLDI+KFSSYHELRSELA+MFGLEG LEDP RSGWQ
Sbjct  765  ENVGHENPSNRTFVKVYKSGSFGRSLDITKFSSYHELRSELAQMFGLEGQLEDPLRSGWQ  824

Query  440  LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPN  261
            LVFVDRENDVLLLGDDPWQEFVN+VW IKILSP EV +MGK+  +++  ++P     LPN
Sbjct  825  LVFVDRENDVLLLGDDPWQEFVNSVWCIKILSPQEVQEMGKQR-LEILTSVPVQRPPLPN  883

Query  260  GGSSCEVHVSQKETRNMN-GIP-LGSLDY  180
            G S  + +VS++E RN+N GIP +G+LD+
Sbjct  884  GTS--DGYVSRQEARNINAGIPSVGTLDF  910



>ref|XP_011085227.1| PREDICTED: auxin response factor 6-like isoform X2 [Sesamum indicum]
Length=909

 Score =   246 bits (627),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 130/209 (62%), Positives = 162/209 (78%), Gaps = 5/209 (2%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSS  621
            SS+L+QNG+SNLK  G +     + F + ++ S    DY L   + +S+ +DESGFL+SS
Sbjct  704  SSLLMQNGMSNLKGVGSDCDNAAIAFGSSSYMSSPVADYSLKTTVTSSNGIDESGFLRSS  763

Query  620  ENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQ  441
            ENV   NP NRTFVKV+KSGSFGRSLDI+KFSSYHELRSELA+MFGLEG LEDP RSGWQ
Sbjct  764  ENVGHENPSNRTFVKVYKSGSFGRSLDITKFSSYHELRSELAQMFGLEGQLEDPLRSGWQ  823

Query  440  LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPN  261
            LVFVDRENDVLLLGDDPWQEFVN+VW IKILSP EV +MGK+  +++  ++P     LPN
Sbjct  824  LVFVDRENDVLLLGDDPWQEFVNSVWCIKILSPQEVQEMGKQR-LEILTSVPVQRPPLPN  882

Query  260  GGSSCEVHVSQKETRNMN-GIP-LGSLDY  180
            G S  + +VS++E RN+N GIP +G+LD+
Sbjct  883  GTS--DGYVSRQEARNINAGIPSVGTLDF  909



>ref|XP_011007615.1| PREDICTED: auxin response factor 6-like [Populus euphratica]
 ref|XP_011007617.1| PREDICTED: auxin response factor 6-like [Populus euphratica]
Length=895

 Score =   245 bits (625),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 131/208 (63%), Positives = 166/208 (80%), Gaps = 8/208 (4%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSS  621
            SS+L+QNG+S L+  G ++  + +PFS+ N+ S  GT++ LNP M  SSC+DESGFLQS+
Sbjct  693  SSLLMQNGLSGLRGVGSDSDSITVPFSS-NYMSIAGTNFSLNPAMAPSSCIDESGFLQST  751

Query  620  ENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQ  441
            E V Q NPP+RTFVKV+KSGSFGRSLDI+KFS+Y+ELRSELA MFGLEG LEDP RSGWQ
Sbjct  752  EIVGQGNPPSRTFVKVYKSGSFGRSLDITKFSNYNELRSELACMFGLEGQLEDPLRSGWQ  811

Query  440  LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPN  261
            LVF+DRENDVLLLGD PW EFVN+VW IKILSP EV +MGK  G++L N +P   QRL N
Sbjct  812  LVFIDRENDVLLLGDGPWPEFVNSVWCIKILSPQEVQKMGK-RGLELLNCVPI--QRLSN  868

Query  260  GGSSCEVHVSQKETRNM-NGIP-LGSLD  183
            G  SC+ + ++++++N+ N I  +GSLD
Sbjct  869  G--SCDDYANRQDSQNLSNAITSVGSLD  894



>dbj|BAD19064.1| auxin response factor 4 [Cucumis sativus]
Length=816

 Score =   244 bits (622),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 130/209 (62%), Positives = 164/209 (78%), Gaps = 8/209 (4%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSS  621
            SS+L+QNG+S L+    ++    +PFS+ N+ S  GT++P+NP M +S+C+DESG LQS 
Sbjct  614  SSLLMQNGMSTLRGVCNDSVSTTLPFSS-NYMSTAGTNFPVNPTMTSSNCIDESGLLQSH  672

Query  620  ENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQ  441
            ENV Q NPPN TFVKVHKSG++ RSLDI+KF+SY ELRSELARMFGLEG LEDP RSGWQ
Sbjct  673  ENVGQVNPPNGTFVKVHKSGTYSRSLDITKFNSYPELRSELARMFGLEGELEDPLRSGWQ  732

Query  440  LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPN  261
            LVFVDRENDVLLLGD PW EFVN+VW IKILSP EV  MGK  G++L N++P   QRL N
Sbjct  733  LVFVDRENDVLLLGDGPWPEFVNSVWCIKILSPEEVQDMGK-RGLELLNSVPI--QRLSN  789

Query  260  GGSSCEVHVSQKETRNM-NGIP-LGSLDY  180
              S+C+ + S++++RN+ +GI  +G LDY
Sbjct  790  --STCDDYGSRQDSRNLISGIASVGPLDY  816



>ref|XP_010908740.1| PREDICTED: auxin response factor 17-like isoform X4 [Elaeis guineensis]
Length=723

 Score =   242 bits (617),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 129/209 (62%), Positives = 162/209 (78%), Gaps = 7/209 (3%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSS  621
            SS+L+QNG+SNL+N   E     MP++ C F S  GTD+PLN  + TSSC+D+SGFL S 
Sbjct  520  SSLLVQNGMSNLRNVVNETDSAAMPYAACKFLSSSGTDFPLNQALTTSSCLDKSGFLHSV  579

Query  620  ENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQ  441
            ENVD  N  + TFVKV+KSGS+GR LDI++FSSYHELRSEL R+FGLEG LEDP RSGWQ
Sbjct  580  ENVDHMNHQSGTFVKVYKSGSYGRLLDIARFSSYHELRSELGRLFGLEGRLEDPVRSGWQ  639

Query  440  LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPN  261
            LVFVDREND LL+GDDPWQEFVNNV  IKILSP EV QMGK +G+ L N+ P   +RLP+
Sbjct  640  LVFVDRENDALLVGDDPWQEFVNNVDCIKILSPQEVQQMGK-QGVGLLNSAPI--KRLPS  696

Query  260  GGSSCEVHVSQKETRNMN-GIP-LGSLDY  180
              +SC+ + S++++ N++ GI  +GSL+Y
Sbjct  697  --NSCDGYGSRQDSSNLSTGITSVGSLNY  723



>ref|XP_004150775.1| PREDICTED: auxin response factor 6-like [Cucumis sativus]
 gb|KGN65880.1| Auxin response factor 4 [Cucumis sativus]
Length=899

 Score =   244 bits (622),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 130/209 (62%), Positives = 164/209 (78%), Gaps = 8/209 (4%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSS  621
            SS+L+QNG+S L+    ++    +PFS+ N+ S  GT++P+NP M +S+C+DESG LQS 
Sbjct  697  SSLLMQNGMSTLRGVCNDSVSTTLPFSS-NYMSTAGTNFPVNPTMTSSNCIDESGLLQSH  755

Query  620  ENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQ  441
            ENV Q NPPN TFVKVHKSG++ RSLDI+KF+SY ELRSELARMFGLEG LEDP RSGWQ
Sbjct  756  ENVGQVNPPNGTFVKVHKSGTYSRSLDITKFNSYPELRSELARMFGLEGELEDPLRSGWQ  815

Query  440  LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPN  261
            LVFVDRENDVLLLGD PW EFVN+VW IKILSP EV  MGK  G++L N++P   QRL N
Sbjct  816  LVFVDRENDVLLLGDGPWPEFVNSVWCIKILSPEEVQDMGK-RGLELLNSVPI--QRLSN  872

Query  260  GGSSCEVHVSQKETRNM-NGIP-LGSLDY  180
              S+C+ + S++++RN+ +GI  +G LDY
Sbjct  873  --STCDDYGSRQDSRNLISGIASVGPLDY  899



>ref|XP_008444734.1| PREDICTED: auxin response factor 6-like [Cucumis melo]
Length=902

 Score =   243 bits (621),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 130/209 (62%), Positives = 165/209 (79%), Gaps = 8/209 (4%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSS  621
            SS+L+QNG+SNL+  G ++    +PFS+ N+ S  G+++ +NP M +S+C+DESG LQS 
Sbjct  700  SSLLMQNGMSNLRGVGNDSVSTTLPFSS-NYMSTAGSNFSVNPTMTSSNCIDESGLLQSH  758

Query  620  ENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQ  441
            ENV Q NPPN TFVKVHKSG++ RSLDI+KF+SY ELRSELARMFGLEG LEDP RSGWQ
Sbjct  759  ENVGQVNPPNGTFVKVHKSGTYSRSLDITKFNSYPELRSELARMFGLEGELEDPLRSGWQ  818

Query  440  LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPN  261
            LVFVDRENDVLLLGD PW EFVN+VW IKILSP EV  MGK  G++L N++P   QRL N
Sbjct  819  LVFVDRENDVLLLGDGPWPEFVNSVWCIKILSPEEVQDMGK-RGLELLNSVPI--QRLSN  875

Query  260  GGSSCEVHVSQKETRNM-NGIP-LGSLDY  180
              S+C+ + S++++RN+ +GI  +G LDY
Sbjct  876  --STCDDYGSRQDSRNLISGIASVGPLDY  902



>emb|CBI30949.3| unnamed protein product [Vitis vinifera]
Length=160

 Score =   224 bits (571),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 119/165 (72%), Positives = 137/165 (83%), Gaps = 7/165 (4%)
 Frame = -3

Query  668  MGTSSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARM  489
            M  SSC+DESGFLQS ENV Q NPP RTFVKV+KSGSFGRSLDI+KFSSYHELR ELARM
Sbjct  1    MTPSSCIDESGFLQSPENVGQVNPPTRTFVKVYKSGSFGRSLDITKFSSYHELRGELARM  60

Query  488  FGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEG  309
            FGLEG LEDP RSGWQLVFVDRENDVLLLGDDPW EFVN+VW IKILS  EV QMGK  G
Sbjct  61   FGLEGQLEDPRRSGWQLVFVDRENDVLLLGDDPWPEFVNSVWCIKILSLQEVQQMGK-RG  119

Query  308  IDLPNNLPAANQRLPNGGSSCEVHVSQKETRNMN-GIP-LGSLDY  180
            ++L N++P   QRL +  SSC+ + S++++RN++ GI  +GSLDY
Sbjct  120  LELLNSVPI--QRLTS--SSCDDYASRQDSRNLSTGITSVGSLDY  160



>ref|XP_007048897.1| Auxin response factor 6 isoform 1 [Theobroma cacao]
 gb|EOX93054.1| Auxin response factor 6 isoform 1 [Theobroma cacao]
Length=1006

 Score =   242 bits (618),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 137/264 (52%), Positives = 168/264 (64%), Gaps = 60/264 (23%)
 Frame = -3

Query  800   SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSS  621
             SS++LQ+G++NLKN G EN  L++P++  NFTS  GTD+PLN DM TSSCVDESG+LQSS
Sbjct  746   SSLMLQHGMTNLKNIGNENDSLSLPYAASNFTSASGTDFPLNSDMTTSSCVDESGYLQSS  805

Query  620   ENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQ  441
             ENVDQ NP   TF+KVHKSGSFGRSLDISKFSSY ELR ELARMFGLEG LEDP+RSGWQ
Sbjct  806   ENVDQVNPTTGTFLKVHKSGSFGRSLDISKFSSYDELRCELARMFGLEGQLEDPQRSGWQ  865

Query  440   LVFVDRENDVLLLGDDPWQE----------------------------------------  381
             LVFVDREND+LLLGDDPW                                          
Sbjct  866   LVFVDRENDILLLGDDPWHADSPYILVLKICAYQATALLALRNLDFQFLYDADHIYRSSK  925

Query  380   --------FVNNVW-------YIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPNGGSSC  246
                     F  + W       YIKILSP EV QMGK EG+    ++P+  QRL +  + C
Sbjct  926   FFLFPFNYFPGSTWEFVNNVWYIKILSPHEVQQMGK-EGLTPATSVPS--QRLTHSSNHC  982

Query  245   EVHVSQKETRNM-NGIP-LGSLDY  180
             + ++S+++ R+  NG+  +GSL+Y
Sbjct  983   DDYMSRQDLRSSGNGLASMGSLEY  1006



>ref|XP_010908738.1| PREDICTED: auxin response factor 17-like isoform X2 [Elaeis guineensis]
Length=884

 Score =   241 bits (616),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 129/209 (62%), Positives = 162/209 (78%), Gaps = 7/209 (3%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSS  621
            SS+L+QNG+SNL+N   E     MP++ C F S  GTD+PLN  + TSSC+D+SGFL S 
Sbjct  681  SSLLVQNGMSNLRNVVNETDSAAMPYAACKFLSSSGTDFPLNQALTTSSCLDKSGFLHSV  740

Query  620  ENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQ  441
            ENVD  N  + TFVKV+KSGS+GR LDI++FSSYHELRSEL R+FGLEG LEDP RSGWQ
Sbjct  741  ENVDHMNHQSGTFVKVYKSGSYGRLLDIARFSSYHELRSELGRLFGLEGRLEDPVRSGWQ  800

Query  440  LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPN  261
            LVFVDREND LL+GDDPWQEFVNNV  IKILSP EV QMGK +G+ L N+ P   +RLP+
Sbjct  801  LVFVDRENDALLVGDDPWQEFVNNVDCIKILSPQEVQQMGK-QGVGLLNSAPI--KRLPS  857

Query  260  GGSSCEVHVSQKETRNMN-GIP-LGSLDY  180
              +SC+ + S++++ N++ GI  +GSL+Y
Sbjct  858  --NSCDGYGSRQDSSNLSTGITSVGSLNY  884



>ref|XP_010908734.1| PREDICTED: auxin response factor 17-like isoform X1 [Elaeis guineensis]
 ref|XP_010908736.1| PREDICTED: auxin response factor 17-like isoform X1 [Elaeis guineensis]
 ref|XP_010908737.1| PREDICTED: auxin response factor 17-like isoform X1 [Elaeis guineensis]
Length=911

 Score =   241 bits (616),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 129/209 (62%), Positives = 162/209 (78%), Gaps = 7/209 (3%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSS  621
            SS+L+QNG+SNL+N   E     MP++ C F S  GTD+PLN  + TSSC+D+SGFL S 
Sbjct  708  SSLLVQNGMSNLRNVVNETDSAAMPYAACKFLSSSGTDFPLNQALTTSSCLDKSGFLHSV  767

Query  620  ENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQ  441
            ENVD  N  + TFVKV+KSGS+GR LDI++FSSYHELRSEL R+FGLEG LEDP RSGWQ
Sbjct  768  ENVDHMNHQSGTFVKVYKSGSYGRLLDIARFSSYHELRSELGRLFGLEGRLEDPVRSGWQ  827

Query  440  LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPN  261
            LVFVDREND LL+GDDPWQEFVNNV  IKILSP EV QMGK +G+ L N+ P   +RLP+
Sbjct  828  LVFVDRENDALLVGDDPWQEFVNNVDCIKILSPQEVQQMGK-QGVGLLNSAPI--KRLPS  884

Query  260  GGSSCEVHVSQKETRNMN-GIP-LGSLDY  180
              +SC+ + S++++ N++ GI  +GSL+Y
Sbjct  885  --NSCDGYGSRQDSSNLSTGITSVGSLNY  911



>ref|NP_001280959.1| auxin response factor 6-like [Malus domestica]
 gb|ADL36576.1| ARF domain class transcription factor [Malus domestica]
Length=895

 Score =   241 bits (614),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 129/209 (62%), Positives = 164/209 (78%), Gaps = 8/209 (4%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSS  621
            S +++Q+G+SNL+  G + G   M F + N+ S  G+D+ +NP +  SSC+ ESGFLQSS
Sbjct  693  SPLIMQSGMSNLRGVGSDCGSTTMHFPS-NYMSTAGSDFSINPAVTPSSCIHESGFLQSS  751

Query  620  ENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQ  441
            EN D  +P NR FVKV+KSGSFGRSLDI+KFSSY ELR+ELARMFGLEG L+DP RSGWQ
Sbjct  752  ENADNGDPLNRNFVKVYKSGSFGRSLDITKFSSYQELRNELARMFGLEGKLDDPVRSGWQ  811

Query  440  LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPN  261
            LVFVDRENDVLLLGDDPW EFVN+VW IKILSP EV QMGK  G++L  ++P  NQRL N
Sbjct  812  LVFVDRENDVLLLGDDPWPEFVNSVWCIKILSPQEVQQMGK-RGLELLKSVP--NQRLSN  868

Query  260  GGSSCEVHVSQKETRNM-NGIP-LGSLDY  180
              +SC+ + S++++RN+ +GI  +GSL+Y
Sbjct  869  --NSCDDYGSRQDSRNLSSGITSVGSLEY  895



>ref|XP_010052021.1| PREDICTED: auxin response factor 6 [Eucalyptus grandis]
 gb|KCW75878.1| hypothetical protein EUGRSUZ_D00264 [Eucalyptus grandis]
Length=897

 Score =   240 bits (613),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 129/209 (62%), Positives = 161/209 (77%), Gaps = 8/209 (4%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSS  621
            SS+L+QNGIS+L+  G E+   +MPF + N+ S  G D+  NP +     +D+SGFLQS 
Sbjct  692  SSLLMQNGISSLRAVGSESDSTSMPFPS-NYISNSGADFAPNPSVAPPGGIDDSGFLQSP  750

Query  620  ENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQ  441
            EN++Q N P RTFVKV+KSGSFGRSLDI+KFSSY+ELRSELARMF LEG LEDP RSGWQ
Sbjct  751  ENLNQVNVPTRTFVKVYKSGSFGRSLDITKFSSYNELRSELARMFSLEGQLEDPVRSGWQ  810

Query  440  LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPN  261
            LVFVDREND LLLGD PW EFVN+VW IKILSP EV QMGK++ ++L N++P   QR  N
Sbjct  811  LVFVDRENDSLLLGDGPWPEFVNSVWCIKILSPQEVQQMGKQD-LELLNSIPV--QRHSN  867

Query  260  GGSSCEVHVSQKETRNMN-GIP-LGSLDY  180
            GG  C+   +++++R +N GIP +GSLDY
Sbjct  868  GG--CDEFTNRQDSRTINSGIPSVGSLDY  894



>ref|XP_009360948.1| PREDICTED: auxin response factor 6 [Pyrus x bretschneideri]
Length=893

 Score =   239 bits (610),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 127/209 (61%), Positives = 160/209 (77%), Gaps = 7/209 (3%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSS  621
            S +++Q+G+SNL+  G       + F + N+ S  GTD+ L   +  SSC+DESGFLQS 
Sbjct  690  SPLIMQSGMSNLRGVGSNCDTTTLHFPSSNYMSTGGTDFSLQTAVTPSSCIDESGFLQSP  749

Query  620  ENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQ  441
            EN D  +P  R FVKVHKSGSFGRSLDI+KF+SY ELR+ELARMFGLEG L+DP RSGWQ
Sbjct  750  ENADHGDPLKRNFVKVHKSGSFGRSLDITKFNSYQELRNELARMFGLEGELDDPVRSGWQ  809

Query  440  LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPN  261
            LVFVDRENDVLLLGDDPW EFVN+VW IKILSP EV QMGK  G++L  ++P  NQRLPN
Sbjct  810  LVFVDRENDVLLLGDDPWPEFVNSVWCIKILSPQEVQQMGK-RGLELLKSVP--NQRLPN  866

Query  260  GGSSCEVHVSQKETRNM-NGIP-LGSLDY  180
              +SC+ + S++++RN+ +GI  +GSL+Y
Sbjct  867  --NSCDDYGSRQDSRNLSSGITSVGSLEY  893



>ref|XP_010923658.1| PREDICTED: auxin response factor 17 isoform X2 [Elaeis guineensis]
Length=949

 Score =   239 bits (610),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 131/209 (63%), Positives = 155/209 (74%), Gaps = 12/209 (6%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSS  621
            SS+L+QNGI NL++ G E     MPF T       GTD+PLN  + +S+C +ESG LQS 
Sbjct  751  SSLLMQNGIKNLRSVGSETDSTAMPFLT-----AAGTDFPLNQALTSSNCAEESGLLQSP  805

Query  620  ENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQ  441
            EN    NP N TFVKV+KSGSFGRSLDI++F+SY ELRSEL R+FGLEG LEDP RSGWQ
Sbjct  806  ENGGHVNPQNGTFVKVYKSGSFGRSLDITRFNSYPELRSELGRLFGLEGQLEDPMRSGWQ  865

Query  440  LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPN  261
            LVFVDRENDVLLLGDDPWQEFVNNVW IKILSP EV QMGKE G  L     A ++RLP 
Sbjct  866  LVFVDRENDVLLLGDDPWQEFVNNVWCIKILSPQEVQQMGKEGGELLST---APSKRLP-  921

Query  260  GGSSCEVHVSQKETRNM-NGIP-LGSLDY  180
             GS C+ + S++++R+M NGI  +  LDY
Sbjct  922  -GSGCDGYSSRQDSRSMRNGIASVMPLDY  949



>ref|XP_010923656.1| PREDICTED: auxin response factor 17 isoform X1 [Elaeis guineensis]
 ref|XP_010923657.1| PREDICTED: auxin response factor 17 isoform X1 [Elaeis guineensis]
Length=950

 Score =   239 bits (610),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 131/209 (63%), Positives = 155/209 (74%), Gaps = 12/209 (6%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSS  621
            SS+L+QNGI NL++ G E     MPF T       GTD+PLN  + +S+C +ESG LQS 
Sbjct  752  SSLLMQNGIKNLRSVGSETDSTAMPFLT-----AAGTDFPLNQALTSSNCAEESGLLQSP  806

Query  620  ENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQ  441
            EN    NP N TFVKV+KSGSFGRSLDI++F+SY ELRSEL R+FGLEG LEDP RSGWQ
Sbjct  807  ENGGHVNPQNGTFVKVYKSGSFGRSLDITRFNSYPELRSELGRLFGLEGQLEDPMRSGWQ  866

Query  440  LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPN  261
            LVFVDRENDVLLLGDDPWQEFVNNVW IKILSP EV QMGKE G  L     A ++RLP 
Sbjct  867  LVFVDRENDVLLLGDDPWQEFVNNVWCIKILSPQEVQQMGKEGGELLST---APSKRLP-  922

Query  260  GGSSCEVHVSQKETRNM-NGIP-LGSLDY  180
             GS C+ + S++++R+M NGI  +  LDY
Sbjct  923  -GSGCDGYSSRQDSRSMRNGIASVMPLDY  950



>ref|XP_009377485.1| PREDICTED: auxin response factor 6-like [Pyrus x bretschneideri]
Length=893

 Score =   239 bits (609),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 127/209 (61%), Positives = 160/209 (77%), Gaps = 7/209 (3%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSS  621
            S +++Q+G+SNL+  G       + F + N+ S  GTD+ L   +  SSC+DESGFLQS 
Sbjct  690  SPLIMQSGMSNLRGVGSNCDTTTLHFPSSNYMSTGGTDFSLQTAVTPSSCIDESGFLQSP  749

Query  620  ENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQ  441
            EN D  +P  R FVKVHKSGSFGRSLDI+KF+SY ELR+ELARMFGLEG L+DP RSGWQ
Sbjct  750  ENADHGDPLKRNFVKVHKSGSFGRSLDITKFNSYQELRNELARMFGLEGELDDPVRSGWQ  809

Query  440  LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPN  261
            LVFVDRENDVLLLGDDPW EFVN+VW IKILSP EV QMGK  G++L  ++P  NQRLPN
Sbjct  810  LVFVDRENDVLLLGDDPWPEFVNSVWCIKILSPQEVQQMGK-RGLELLKSVP--NQRLPN  866

Query  260  GGSSCEVHVSQKETRNM-NGIP-LGSLDY  180
              +SC+ + S++++RN+ +GI  +GSL+Y
Sbjct  867  --NSCDDYGSRQDSRNLSSGITSVGSLEY  893



>gb|KJB69885.1| hypothetical protein B456_011G048200 [Gossypium raimondii]
Length=902

 Score =   239 bits (609),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 132/209 (63%), Positives = 162/209 (78%), Gaps = 13/209 (6%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSS  621
            SS+L+QNG+S L+  G ++   ++PF + N+ S  G D+ +NP M  SSC+DESGFLQS 
Sbjct  705  SSVLMQNGMSGLRGVGTDSDSTSIPFFS-NYMSTAGNDFSVNPAMTPSSCIDESGFLQSQ  763

Query  620  ENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQ  441
            ENV Q+NP  RTFVKV+KSGSFGRSLDIS FS+Y+ELRSELA MFGLEG LEDP RSGWQ
Sbjct  764  ENVGQSNPQTRTFVKVYKSGSFGRSLDISAFSNYNELRSELAHMFGLEGQLEDPLRSGWQ  823

Query  440  LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPN  261
            LVFVDRENDVLLLGDDPW      VW IKILSP EV QMGK  G++L N++P   QRL N
Sbjct  824  LVFVDRENDVLLLGDDPWP-----VWCIKILSPQEVQQMGK-RGLELLNSVPV--QRLSN  875

Query  260  GGSSCEVHVSQKETRNM-NGIP-LGSLDY  180
            G  SC+ +VS++++RN+ +GI  +GSLDY
Sbjct  876  G--SCDDYVSRQDSRNLSSGIASVGSLDY  902



>ref|XP_008777704.1| PREDICTED: auxin response factor 17-like [Phoenix dactylifera]
Length=916

 Score =   238 bits (608),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 125/210 (60%), Positives = 161/210 (77%), Gaps = 8/210 (4%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQ-S  624
            SS+L+QNG+ +L+    E+    MP++ CNF S  GTD+PLN  + +SSC+D+SGFL  S
Sbjct  712  SSLLVQNGMPSLRTVVSESDSAAMPYAACNFLSPSGTDFPLNQALTSSSCLDKSGFLHYS  771

Query  623  SENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGW  444
             EN+D  N  + TFVKV+KSGS GR LDI+KFSSYHELRSEL R+FGLEG LEDP RSGW
Sbjct  772  PENMDHVNSRSGTFVKVYKSGSLGRLLDITKFSSYHELRSELGRLFGLEGQLEDPVRSGW  831

Query  443  QLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLP  264
            QLVFVDREND LL+GDDPWQEFVN V+ IKIL+P EV QMGK +G+DL N+ P   +RLP
Sbjct  832  QLVFVDRENDALLVGDDPWQEFVNTVYCIKILAPQEVQQMGK-QGVDLLNSAPI--KRLP  888

Query  263  NGGSSCEVHVSQKETRNMNG--IPLGSLDY  180
            +  +SC+ + S++++RN++     +GSLDY
Sbjct  889  S--NSCDGYGSRQDSRNLSAGITSVGSLDY  916



>ref|XP_008371797.1| PREDICTED: auxin response factor 6-like [Malus domestica]
Length=895

 Score =   238 bits (606),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 128/209 (61%), Positives = 163/209 (78%), Gaps = 8/209 (4%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSS  621
            S +++Q+G+SNL+  G + G   M F + N+ S  G+D+ +NP +  SSC+ ESGFLQSS
Sbjct  693  SPLIMQSGMSNLRGVGSDCGSTTMHFPS-NYMSTAGSDFSINPAVTPSSCIHESGFLQSS  751

Query  620  ENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQ  441
            EN D  +P NR FVKV+KSGSFGRSLDI+KFSSY ELR+ELA MFGLEG L+DP RSGWQ
Sbjct  752  ENADNGDPLNRNFVKVYKSGSFGRSLDITKFSSYQELRNELAHMFGLEGELDDPVRSGWQ  811

Query  440  LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPN  261
            LVFVDRENDVLLLGDDPW EFVN+VW IKILSP EV QMGK  G++L  ++P  NQRL N
Sbjct  812  LVFVDRENDVLLLGDDPWPEFVNSVWCIKILSPQEVQQMGK-RGLELLKSVP--NQRLSN  868

Query  260  GGSSCEVHVSQKETRNM-NGIP-LGSLDY  180
              +SC+ + S++++RN+ +GI  +GSL+Y
Sbjct  869  --NSCDDYGSRQDSRNLSSGITSVGSLEY  895



>gb|KDO63435.1| hypothetical protein CISIN_1g002390mg [Citrus sinensis]
Length=833

 Score =   236 bits (603),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 114/140 (81%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = -3

Query  803  DSSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQS  624
            DSS++ QNG+ NLKN   EN  L++P++  NFT+ VGTD+PLN DM TSSCVDESGFLQS
Sbjct  694  DSSLMGQNGLPNLKNISSENESLSLPYAASNFTNNVGTDFPLNSDMTTSSCVDESGFLQS  753

Query  623  SENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGW  444
            SENVDQ NPP RTFVKVHKSGSFGRSLDISKFSSY ELRSELARMFGLEG LEDP+RSGW
Sbjct  754  SENVDQVNPPTRTFVKVHKSGSFGRSLDISKFSSYDELRSELARMFGLEGQLEDPQRSGW  813

Query  443  QLVFVDRENDVLLLGDDPWQ  384
            QLVFVDRENDVLLLGDDPWQ
Sbjct  814  QLVFVDRENDVLLLGDDPWQ  833



>ref|XP_008794474.1| PREDICTED: auxin response factor 17 [Phoenix dactylifera]
Length=944

 Score =   237 bits (604),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 129/209 (62%), Positives = 156/209 (75%), Gaps = 13/209 (6%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSS  621
            S +L+QNG+ NL++ G E     MPF T       GTD+PLN  + +SSC +E G LQSS
Sbjct  747  SPLLMQNGMRNLRSVGSETDSTAMPFLT-----AAGTDFPLNQVLTSSSCAEEPGLLQSS  801

Query  620  ENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQ  441
            EN    NP N TFVKV+KSGSFGRSLDI++F++Y ELRSEL R+FGLEG LEDP RSGWQ
Sbjct  802  ENGVHVNPQNGTFVKVYKSGSFGRSLDITRFNNYPELRSELGRLFGLEGQLEDPMRSGWQ  861

Query  440  LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPN  261
            LVFVDRENDVLLLGDDPWQEFVNNVW IKIL+P EV QMGK  G +LP+  P+  +RLP 
Sbjct  862  LVFVDRENDVLLLGDDPWQEFVNNVWCIKILAPQEVQQMGK--GGELPSAAPS--KRLP-  916

Query  260  GGSSCEVHVSQKETRNM-NGIP-LGSLDY  180
             GS C+ + S++++RNM NGI  +  LDY
Sbjct  917  -GSGCDGYASRQDSRNMSNGIASVMPLDY  944



>ref|XP_008371645.1| PREDICTED: auxin response factor 6 [Malus domestica]
Length=893

 Score =   236 bits (602),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 126/209 (60%), Positives = 161/209 (77%), Gaps = 7/209 (3%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSS  621
            S +++Q+G+SNL+  G       + F + N+ S  GTD+ LNP +  SSC+DES FLQS 
Sbjct  690  SPLIMQSGMSNLRGVGSNCDSTTLHFPSSNYMSTGGTDFSLNPAVTPSSCIDESRFLQSP  749

Query  620  ENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQ  441
            EN D+ +P NR FVKV+KSGSFGRSLDI+KFSSY ELR+ELAR+FGLEG L+DP RSGWQ
Sbjct  750  ENADRGDPLNRNFVKVYKSGSFGRSLDITKFSSYQELRNELARLFGLEGELDDPVRSGWQ  809

Query  440  LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPN  261
            LVFVDRENDVLLLGDDPW EFVN+VW IKILSP EV QMGK  G++L  ++P  NQR PN
Sbjct  810  LVFVDRENDVLLLGDDPWPEFVNSVWCIKILSPQEVQQMGK-RGLELLKSVP--NQRPPN  866

Query  260  GGSSCEVHVSQKETRNM-NGIP-LGSLDY  180
              + C+ + S++++RN+ +GI  +GSL+Y
Sbjct  867  --NICDDYGSRQDSRNLSSGITSVGSLEY  893



>ref|XP_010540604.1| PREDICTED: auxin response factor 6-like isoform X3 [Tarenaya 
hassleriana]
Length=653

 Score =   232 bits (592),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 130/210 (62%), Positives = 156/210 (74%), Gaps = 8/210 (4%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSS  621
            SS+L+Q+G+SNL   G EN    +PF + N  S    D+  N  +  SSC+DESGFLQSS
Sbjct  449  SSLLMQSGVSNLNAIGIENDSTALPFLSSNTVSI--NDFSSNLAVMPSSCIDESGFLQSS  506

Query  620  ENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQ  441
            +NV   NP + TFVKV+KSGSFGRSLDISKFSSYHELRSELARMFG+EG LEDP RSGWQ
Sbjct  507  DNVGSENPQSTTFVKVYKSGSFGRSLDISKFSSYHELRSELARMFGIEGRLEDPMRSGWQ  566

Query  440  LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPN  261
            LVFVDRENDVLLLGDDPW EFVN+VW IKILSP EVH+MGK  GI++ ++ P+  +++PN
Sbjct  567  LVFVDRENDVLLLGDDPWPEFVNSVWCIKILSPQEVHRMGK-RGIEILSSGPSV-RKIPN  624

Query  260  GGSSCEVHVSQKETRNMNG---IPLGSLDY  180
            GG  CE   +  + RN+ G      GS DY
Sbjct  625  GG-GCEDFGNGHDPRNLGGSIASVAGSFDY  653



>gb|KGN49430.1| hypothetical protein Csa_6G524670 [Cucumis sativus]
Length=916

 Score =   235 bits (600),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 134/212 (63%), Positives = 164/212 (77%), Gaps = 11/212 (5%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPD-MGT-SSCVDESGFLQ  627
            SS+L+QNG+ NL+    ++    +PFS+ N+ +  GT++  NP   GT S+C ++SGFLQ
Sbjct  711  SSLLMQNGMPNLRGICSDSDSTAIPFSS-NYVNTAGTNFSANPTGTGTPSNCNEDSGFLQ  769

Query  626  SSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSG  447
            S EN  Q NPP RTFVKV+KSGSFGRSLDISKFSSYH+LRSELA MFGLEG LEDP RSG
Sbjct  770  SPENTGQVNPPTRTFVKVYKSGSFGRSLDISKFSSYHQLRSELAHMFGLEGELEDPLRSG  829

Query  446  WQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRL  267
            WQLVFVDRENDVLLLGDDPW EFVN+VW IKILSP EV  MGK  G++L N++P   QRL
Sbjct  830  WQLVFVDRENDVLLLGDDPWPEFVNSVWCIKILSPQEVQDMGK-RGLELLNSVPI--QRL  886

Query  266  PNGGSSCEVHVSQKE-TRNMN-GIP-LGSLDY  180
             NG  SC+ + +++E +RNMN GI  +GSL+Y
Sbjct  887  SNG--SCDNYANRQESSRNMNSGITSVGSLEY  916



>ref|XP_011658304.1| PREDICTED: auxin response factor 6 isoform X2 [Cucumis sativus]
Length=907

 Score =   235 bits (600),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 134/212 (63%), Positives = 164/212 (77%), Gaps = 11/212 (5%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPD-MGT-SSCVDESGFLQ  627
            SS+L+QNG+ NL+    ++    +PFS+ N+ +  GT++  NP   GT S+C ++SGFLQ
Sbjct  702  SSLLMQNGMPNLRGICSDSDSTAIPFSS-NYVNTAGTNFSANPTGTGTPSNCNEDSGFLQ  760

Query  626  SSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSG  447
            S EN  Q NPP RTFVKV+KSGSFGRSLDISKFSSYH+LRSELA MFGLEG LEDP RSG
Sbjct  761  SPENTGQVNPPTRTFVKVYKSGSFGRSLDISKFSSYHQLRSELAHMFGLEGELEDPLRSG  820

Query  446  WQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRL  267
            WQLVFVDRENDVLLLGDDPW EFVN+VW IKILSP EV  MGK  G++L N++P   QRL
Sbjct  821  WQLVFVDRENDVLLLGDDPWPEFVNSVWCIKILSPQEVQDMGK-RGLELLNSVPI--QRL  877

Query  266  PNGGSSCEVHVSQKE-TRNMN-GIP-LGSLDY  180
             NG  SC+ + +++E +RNMN GI  +GSL+Y
Sbjct  878  SNG--SCDNYANRQESSRNMNSGITSVGSLEY  907



>ref|XP_010540603.1| PREDICTED: auxin response factor 6-like isoform X2 [Tarenaya 
hassleriana]
Length=808

 Score =   233 bits (593),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 130/210 (62%), Positives = 156/210 (74%), Gaps = 8/210 (4%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSS  621
            SS+L+Q+G+SNL   G EN    +PF + N  S    D+  N  +  SSC+DESGFLQSS
Sbjct  604  SSLLMQSGVSNLNAIGIENDSTALPFLSSNTVSI--NDFSSNLAVMPSSCIDESGFLQSS  661

Query  620  ENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQ  441
            +NV   NP + TFVKV+KSGSFGRSLDISKFSSYHELRSELARMFG+EG LEDP RSGWQ
Sbjct  662  DNVGSENPQSTTFVKVYKSGSFGRSLDISKFSSYHELRSELARMFGIEGRLEDPMRSGWQ  721

Query  440  LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPN  261
            LVFVDRENDVLLLGDDPW EFVN+VW IKILSP EVH+MGK  GI++ ++ P+  +++PN
Sbjct  722  LVFVDRENDVLLLGDDPWPEFVNSVWCIKILSPQEVHRMGK-RGIEILSSGPSV-RKIPN  779

Query  260  GGSSCEVHVSQKETRNMNG---IPLGSLDY  180
            GG  CE   +  + RN+ G      GS DY
Sbjct  780  GG-GCEDFGNGHDPRNLGGSIASVAGSFDY  808



>ref|XP_008439586.1| PREDICTED: LOW QUALITY PROTEIN: auxin response factor 6 [Cucumis 
melo]
Length=915

 Score =   234 bits (596),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 131/212 (62%), Positives = 164/212 (77%), Gaps = 11/212 (5%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPD-MGT-SSCVDESGFLQ  627
            SS+L+QNG+ NL+    ++    +PFS+ N+ +  G ++  NP   GT S+C+++SGFLQ
Sbjct  710  SSLLMQNGMPNLRGICSDSDSTAIPFSS-NYVNTAGANFSANPTGTGTPSNCIEDSGFLQ  768

Query  626  SSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSG  447
            S EN  Q NPP RTFVKV+KSGSFGRSLDISKFSSYH+LRSELA MFGLEG LEDP RSG
Sbjct  769  SPENTGQVNPPTRTFVKVYKSGSFGRSLDISKFSSYHQLRSELAHMFGLEGKLEDPLRSG  828

Query  446  WQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRL  267
            WQLVFVDRENDVLLLGDDPW EFVN+VW IKILSP EV  MGK  G++L N++P   QRL
Sbjct  829  WQLVFVDRENDVLLLGDDPWPEFVNSVWCIKILSPQEVEDMGK-RGLELLNSVPI--QRL  885

Query  266  PNGGSSCEVHVSQKE-TRNM-NGIP-LGSLDY  180
             NG  SC+ + +++E +RN+ +GI  +GSL+Y
Sbjct  886  SNG--SCDNYANRQESSRNLSSGITSVGSLEY  915



>ref|XP_010540601.1| PREDICTED: auxin response factor 6-like isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010540602.1| PREDICTED: auxin response factor 6-like isoform X1 [Tarenaya 
hassleriana]
Length=809

 Score =   233 bits (593),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 130/210 (62%), Positives = 156/210 (74%), Gaps = 8/210 (4%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSS  621
            SS+L+Q+G+SNL   G EN    +PF + N  S    D+  N  +  SSC+DESGFLQSS
Sbjct  605  SSLLMQSGVSNLNAIGIENDSTALPFLSSNTVSI--NDFSSNLAVMPSSCIDESGFLQSS  662

Query  620  ENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQ  441
            +NV   NP + TFVKV+KSGSFGRSLDISKFSSYHELRSELARMFG+EG LEDP RSGWQ
Sbjct  663  DNVGSENPQSTTFVKVYKSGSFGRSLDISKFSSYHELRSELARMFGIEGRLEDPMRSGWQ  722

Query  440  LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPN  261
            LVFVDRENDVLLLGDDPW EFVN+VW IKILSP EVH+MGK  GI++ ++ P+  +++PN
Sbjct  723  LVFVDRENDVLLLGDDPWPEFVNSVWCIKILSPQEVHRMGK-RGIEILSSGPSV-RKIPN  780

Query  260  GGSSCEVHVSQKETRNMNG---IPLGSLDY  180
            GG  CE   +  + RN+ G      GS DY
Sbjct  781  GG-GCEDFGNGHDPRNLGGSIASVAGSFDY  809



>gb|EYU42851.1| hypothetical protein MIMGU_mgv1a001422mg [Erythranthe guttata]
Length=822

 Score =   233 bits (593),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 112/146 (77%), Positives = 125/146 (86%), Gaps = 3/146 (2%)
 Frame = -3

Query  737  LNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSSENVDQANPPNRTFVKVHKSGS  558
            L+M ++T  F +G G D+P+N DM +SSCVDESG+LQSSENVD   P +R FVKVHKSGS
Sbjct  679  LSMAYATSAFVNGAGGDFPINSDMTSSSCVDESGYLQSSENVD---PTSRAFVKVHKSGS  735

Query  557  FGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEF  378
            FGRSLDISKFSSY ELR EL+RMFGLEG LED +RSGWQLVFVDREND+LLLGDDPWQEF
Sbjct  736  FGRSLDISKFSSYDELRGELSRMFGLEGFLEDSQRSGWQLVFVDRENDILLLGDDPWQEF  795

Query  377  VNNVWYIKILSPFEVHQMGKEEGIDL  300
            VN+VWYIKILSP EV QMGKEEG D 
Sbjct  796  VNSVWYIKILSPLEVQQMGKEEGRDF  821



>ref|XP_010478419.1| PREDICTED: auxin response factor 6 isoform X3 [Camelina sativa]
Length=922

 Score =   231 bits (588),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 130/205 (63%), Positives = 159/205 (78%), Gaps = 11/205 (5%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENG-FLNMPFSTCNFTSGVGTDYPLNPDMGT-SSCVDESGFLQ  627
            SS+L+ NG+SNL++ G E G    +PF++ NF +    D+  N  M T SSC+DESGFLQ
Sbjct  715  SSLLMPNGMSNLRSIGIEGGDSTTLPFTSSNFNN----DFSGNLAMTTPSSCIDESGFLQ  770

Query  626  SSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSG  447
            SSEN+   NP + TFVKV+KSGSFGRSLDISKFSSYHELRSELARMFGLEG LEDP RSG
Sbjct  771  SSENIGSENPQSNTFVKVYKSGSFGRSLDISKFSSYHELRSELARMFGLEGQLEDPVRSG  830

Query  446  WQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAAN--Q  273
            WQLVFVDRENDVLLLGDDPW EFV++VW IKILSP EV QMGK  G++L N+ P++N   
Sbjct  831  WQLVFVDRENDVLLLGDDPWPEFVSSVWCIKILSPQEVQQMGK-RGLELLNSAPSSNNVD  889

Query  272  RLPNGGSSCEVHVSQKETRNM-NGI  201
            +LP+ G +C+   ++ + RN+ NGI
Sbjct  890  KLPSNG-NCDDFGNRSDPRNLGNGI  913



>ref|XP_010499562.1| PREDICTED: auxin response factor 6-like isoform X2 [Camelina 
sativa]
Length=925

 Score =   231 bits (588),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 130/205 (63%), Positives = 159/205 (78%), Gaps = 11/205 (5%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENG-FLNMPFSTCNFTSGVGTDYPLNPDMGT-SSCVDESGFLQ  627
            SS+L+ NG+SNL++ G E G    +PF++ NF +    D+  N  M T SSC+DESGFLQ
Sbjct  718  SSLLMPNGMSNLRSIGIEGGDSTTLPFTSSNFNN----DFSGNLAMTTPSSCIDESGFLQ  773

Query  626  SSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSG  447
            SSEN+   NP + TFVKV+KSGSFGRSLDISKFSSYHELRSELARMFGLEG LEDP RSG
Sbjct  774  SSENIGSENPQSNTFVKVYKSGSFGRSLDISKFSSYHELRSELARMFGLEGQLEDPVRSG  833

Query  446  WQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAAN--Q  273
            WQLVFVDRENDVLLLGDDPW EFV++VW IKILSP EV QMGK  G++L N+ P++N   
Sbjct  834  WQLVFVDRENDVLLLGDDPWPEFVSSVWCIKILSPQEVQQMGK-RGLELLNSAPSSNNVD  892

Query  272  RLPNGGSSCEVHVSQKETRNM-NGI  201
            +LP+ G +C+   ++ + RN+ NGI
Sbjct  893  KLPSNG-NCDDFGNRSDPRNLGNGI  916



>ref|XP_010478420.1| PREDICTED: auxin response factor 6 isoform X4 [Camelina sativa]
Length=920

 Score =   231 bits (588),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 130/205 (63%), Positives = 159/205 (78%), Gaps = 11/205 (5%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENG-FLNMPFSTCNFTSGVGTDYPLNPDMGT-SSCVDESGFLQ  627
            SS+L+ NG+SNL++ G E G    +PF++ NF +    D+  N  M T SSC+DESGFLQ
Sbjct  713  SSLLMPNGMSNLRSIGIEGGDSTTLPFTSSNFNN----DFSGNLAMTTPSSCIDESGFLQ  768

Query  626  SSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSG  447
            SSEN+   NP + TFVKV+KSGSFGRSLDISKFSSYHELRSELARMFGLEG LEDP RSG
Sbjct  769  SSENIGSENPQSNTFVKVYKSGSFGRSLDISKFSSYHELRSELARMFGLEGQLEDPVRSG  828

Query  446  WQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAAN--Q  273
            WQLVFVDRENDVLLLGDDPW EFV++VW IKILSP EV QMGK  G++L N+ P++N   
Sbjct  829  WQLVFVDRENDVLLLGDDPWPEFVSSVWCIKILSPQEVQQMGK-RGLELLNSAPSSNNVD  887

Query  272  RLPNGGSSCEVHVSQKETRNM-NGI  201
            +LP+ G +C+   ++ + RN+ NGI
Sbjct  888  KLPSNG-NCDDFGNRSDPRNLGNGI  911



>ref|XP_010499561.1| PREDICTED: auxin response factor 6-like isoform X1 [Camelina 
sativa]
Length=927

 Score =   231 bits (588),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 130/205 (63%), Positives = 159/205 (78%), Gaps = 11/205 (5%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENG-FLNMPFSTCNFTSGVGTDYPLNPDMGT-SSCVDESGFLQ  627
            SS+L+ NG+SNL++ G E G    +PF++ NF +    D+  N  M T SSC+DESGFLQ
Sbjct  720  SSLLMPNGMSNLRSIGIEGGDSTTLPFTSSNFNN----DFSGNLAMTTPSSCIDESGFLQ  775

Query  626  SSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSG  447
            SSEN+   NP + TFVKV+KSGSFGRSLDISKFSSYHELRSELARMFGLEG LEDP RSG
Sbjct  776  SSENIGSENPQSNTFVKVYKSGSFGRSLDISKFSSYHELRSELARMFGLEGQLEDPVRSG  835

Query  446  WQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAAN--Q  273
            WQLVFVDRENDVLLLGDDPW EFV++VW IKILSP EV QMGK  G++L N+ P++N   
Sbjct  836  WQLVFVDRENDVLLLGDDPWPEFVSSVWCIKILSPQEVQQMGK-RGLELLNSAPSSNNVD  894

Query  272  RLPNGGSSCEVHVSQKETRNM-NGI  201
            +LP+ G +C+   ++ + RN+ NGI
Sbjct  895  KLPSNG-NCDDFGNRSDPRNLGNGI  918



>ref|XP_010499564.1| PREDICTED: auxin response factor 6-like isoform X4 [Camelina 
sativa]
Length=919

 Score =   230 bits (587),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 130/205 (63%), Positives = 159/205 (78%), Gaps = 11/205 (5%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENG-FLNMPFSTCNFTSGVGTDYPLNPDMGT-SSCVDESGFLQ  627
            SS+L+ NG+SNL++ G E G    +PF++ NF +    D+  N  M T SSC+DESGFLQ
Sbjct  712  SSLLMPNGMSNLRSIGIEGGDSTTLPFTSSNFNN----DFSGNLAMTTPSSCIDESGFLQ  767

Query  626  SSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSG  447
            SSEN+   NP + TFVKV+KSGSFGRSLDISKFSSYHELRSELARMFGLEG LEDP RSG
Sbjct  768  SSENIGSENPQSNTFVKVYKSGSFGRSLDISKFSSYHELRSELARMFGLEGQLEDPVRSG  827

Query  446  WQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAAN--Q  273
            WQLVFVDRENDVLLLGDDPW EFV++VW IKILSP EV QMGK  G++L N+ P++N   
Sbjct  828  WQLVFVDRENDVLLLGDDPWPEFVSSVWCIKILSPQEVQQMGK-RGLELLNSAPSSNNVD  886

Query  272  RLPNGGSSCEVHVSQKETRNM-NGI  201
            +LP+ G +C+   ++ + RN+ NGI
Sbjct  887  KLPSNG-NCDDFGNRSDPRNLGNGI  910



>ref|XP_010478418.1| PREDICTED: auxin response factor 6 isoform X2 [Camelina sativa]
Length=926

 Score =   230 bits (587),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 130/205 (63%), Positives = 159/205 (78%), Gaps = 11/205 (5%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENG-FLNMPFSTCNFTSGVGTDYPLNPDMGT-SSCVDESGFLQ  627
            SS+L+ NG+SNL++ G E G    +PF++ NF +    D+  N  M T SSC+DESGFLQ
Sbjct  719  SSLLMPNGMSNLRSIGIEGGDSTTLPFTSSNFNN----DFSGNLAMTTPSSCIDESGFLQ  774

Query  626  SSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSG  447
            SSEN+   NP + TFVKV+KSGSFGRSLDISKFSSYHELRSELARMFGLEG LEDP RSG
Sbjct  775  SSENIGSENPQSNTFVKVYKSGSFGRSLDISKFSSYHELRSELARMFGLEGQLEDPVRSG  834

Query  446  WQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAAN--Q  273
            WQLVFVDRENDVLLLGDDPW EFV++VW IKILSP EV QMGK  G++L N+ P++N   
Sbjct  835  WQLVFVDRENDVLLLGDDPWPEFVSSVWCIKILSPQEVQQMGK-RGLELLNSAPSSNNVD  893

Query  272  RLPNGGSSCEVHVSQKETRNM-NGI  201
            +LP+ G +C+   ++ + RN+ NGI
Sbjct  894  KLPSNG-NCDDFGNRSDPRNLGNGI  917



>ref|XP_010478417.1| PREDICTED: auxin response factor 6 isoform X1 [Camelina sativa]
Length=928

 Score =   230 bits (587),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 130/205 (63%), Positives = 159/205 (78%), Gaps = 11/205 (5%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENG-FLNMPFSTCNFTSGVGTDYPLNPDMGT-SSCVDESGFLQ  627
            SS+L+ NG+SNL++ G E G    +PF++ NF +    D+  N  M T SSC+DESGFLQ
Sbjct  721  SSLLMPNGMSNLRSIGIEGGDSTTLPFTSSNFNN----DFSGNLAMTTPSSCIDESGFLQ  776

Query  626  SSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSG  447
            SSEN+   NP + TFVKV+KSGSFGRSLDISKFSSYHELRSELARMFGLEG LEDP RSG
Sbjct  777  SSENIGSENPQSNTFVKVYKSGSFGRSLDISKFSSYHELRSELARMFGLEGQLEDPVRSG  836

Query  446  WQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAAN--Q  273
            WQLVFVDRENDVLLLGDDPW EFV++VW IKILSP EV QMGK  G++L N+ P++N   
Sbjct  837  WQLVFVDRENDVLLLGDDPWPEFVSSVWCIKILSPQEVQQMGK-RGLELLNSAPSSNNVD  895

Query  272  RLPNGGSSCEVHVSQKETRNM-NGI  201
            +LP+ G +C+   ++ + RN+ NGI
Sbjct  896  KLPSNG-NCDDFGNRSDPRNLGNGI  919



>ref|XP_010499563.1| PREDICTED: auxin response factor 6-like isoform X3 [Camelina 
sativa]
Length=921

 Score =   230 bits (587),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 130/205 (63%), Positives = 159/205 (78%), Gaps = 11/205 (5%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENG-FLNMPFSTCNFTSGVGTDYPLNPDMGT-SSCVDESGFLQ  627
            SS+L+ NG+SNL++ G E G    +PF++ NF +    D+  N  M T SSC+DESGFLQ
Sbjct  714  SSLLMPNGMSNLRSIGIEGGDSTTLPFTSSNFNN----DFSGNLAMTTPSSCIDESGFLQ  769

Query  626  SSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSG  447
            SSEN+   NP + TFVKV+KSGSFGRSLDISKFSSYHELRSELARMFGLEG LEDP RSG
Sbjct  770  SSENIGSENPQSNTFVKVYKSGSFGRSLDISKFSSYHELRSELARMFGLEGQLEDPVRSG  829

Query  446  WQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAAN--Q  273
            WQLVFVDRENDVLLLGDDPW EFV++VW IKILSP EV QMGK  G++L N+ P++N   
Sbjct  830  WQLVFVDRENDVLLLGDDPWPEFVSSVWCIKILSPQEVQQMGK-RGLELLNSAPSSNNVD  888

Query  272  RLPNGGSSCEVHVSQKETRNM-NGI  201
            +LP+ G +C+   ++ + RN+ NGI
Sbjct  889  KLPSNG-NCDDFGNRSDPRNLGNGI  912



>ref|XP_009399037.1| PREDICTED: auxin response factor 17 [Musa acuminata subsp. malaccensis]
 ref|XP_009399038.1| PREDICTED: auxin response factor 17 [Musa acuminata subsp. malaccensis]
Length=926

 Score =   230 bits (586),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 128/209 (61%), Positives = 159/209 (76%), Gaps = 12/209 (6%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSS  621
            SS+L+QNG+SNL+N   +     MPF      S  GTDY L+  + +S+C+++S FLQS 
Sbjct  728  SSLLVQNGMSNLRNFDNDTVSTLMPF-----VSTTGTDYALHQALTSSNCIEDSEFLQSP  782

Query  620  ENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQ  441
             +V   NP N TFVKV+KSGSFGRSLDI+KF+SY ELRSEL R+FGLEGLLEDP RSGWQ
Sbjct  783  NSVGVMNPQNGTFVKVYKSGSFGRSLDITKFNSYPELRSELGRLFGLEGLLEDPLRSGWQ  842

Query  440  LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPN  261
            LVFVDRENDVLL+GDDPW EFVNNV  IKILSP EV QMGK EG+DL N   A N+R+P+
Sbjct  843  LVFVDRENDVLLVGDDPWHEFVNNVSSIKILSPQEVQQMGK-EGVDLLNA--ATNRRIPS  899

Query  260  GGSSCEVHVSQKETRNM-NGIP-LGSLDY  180
              S  + ++S++E+RN+ NG+  +GSLDY
Sbjct  900  HTS--DEYISRQESRNLSNGMASVGSLDY  926



>ref|NP_001031115.1| auxin response factor 6 [Arabidopsis thaliana]
 sp|Q9ZTX8.2|ARFF_ARATH RecName: Full=Auxin response factor 6 [Arabidopsis thaliana]
 gb|AAT67072.1| ARF6 [Arabidopsis thaliana]
 gb|AEE31207.1| auxin response factor 6 [Arabidopsis thaliana]
Length=935

 Score =   230 bits (586),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 133/214 (62%), Positives = 163/214 (76%), Gaps = 13/214 (6%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENG-FLNMPFSTCNFTSGVGTDYPLNPDMGT-SSCVDESGFLQ  627
            SS+L+ NG+SNL++ G E G    +PF++ NF +    D+  N  M T SSC+DESGFLQ
Sbjct  728  SSLLMPNGMSNLRSIGIEGGDSTTLPFTSSNFNN----DFSGNLAMTTPSSCIDESGFLQ  783

Query  626  SSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSG  447
            SSEN+   NP + TFVKV+KSGSFGRSLDISKFSSYHELRSELARMFGLEG LEDP RSG
Sbjct  784  SSENLGSENPQSNTFVKVYKSGSFGRSLDISKFSSYHELRSELARMFGLEGQLEDPVRSG  843

Query  446  WQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQ--  273
            WQLVFVDRENDVLLLGDDPW EFV++VW IKILSP EV QMGK  G++L N+ P++N   
Sbjct  844  WQLVFVDRENDVLLLGDDPWPEFVSSVWCIKILSPQEVQQMGK-RGLELLNSAPSSNNVD  902

Query  272  RLPNGGSSCEVHVSQKETRNM-NGIPL--GSLDY  180
            +LP+ G +C+   ++ + RN+ NGI    GS +Y
Sbjct  903  KLPSNG-NCDDFGNRSDPRNLGNGIASVGGSFNY  935



>ref|XP_009384197.1| PREDICTED: auxin response factor 17-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=810

 Score =   229 bits (583),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 124/211 (59%), Positives = 152/211 (72%), Gaps = 7/211 (3%)
 Frame = -3

Query  806  TDSSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQ  627
             D SIL QNGI +L     E    N+ ++TCN  S  G D+P+N  +   + +DES FL+
Sbjct  605  VDLSILAQNGIPSLNTGVSEICSTNLSYATCNLLSSSGNDFPINRALSGCNGLDESRFLR  664

Query  626  SSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSG  447
            S ENVDQANP +  FVKV+KSGSFGR+LDI+KFSSYH+LRSEL  +FGLEG LEDP RSG
Sbjct  665  SHENVDQANPQSGLFVKVYKSGSFGRTLDITKFSSYHDLRSELGCLFGLEGQLEDPLRSG  724

Query  446  WQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRL  267
            WQLVFVD ENDVLL+GDDPWQEFVN+V YIKILSP EV QMGK +GID  N+ P   +RL
Sbjct  725  WQLVFVDWENDVLLVGDDPWQEFVNSVSYIKILSPEEVQQMGK-QGIDFVNSAPV--KRL  781

Query  266  PNGGSSCEVHVSQKETRNMNG--IPLGSLDY  180
               G  C+ HVSQ+++ N++     +GS  Y
Sbjct  782  QRNG--CDDHVSQQDSTNLSARITSVGSFKY  810



>ref|NP_174323.1| auxin response factor 6 [Arabidopsis thaliana]
 gb|AAG51093.1|AC025295_1 auxin response factor 6 (ARF6) [Arabidopsis thaliana]
 gb|AAD01513.1| ARF6 [Arabidopsis thaliana]
 gb|AEE31206.1| auxin response factor 6 [Arabidopsis thaliana]
Length=933

 Score =   229 bits (585),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 133/214 (62%), Positives = 163/214 (76%), Gaps = 13/214 (6%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENG-FLNMPFSTCNFTSGVGTDYPLNPDMGT-SSCVDESGFLQ  627
            SS+L+ NG+SNL++ G E G    +PF++ NF +    D+  N  M T SSC+DESGFLQ
Sbjct  726  SSLLMPNGMSNLRSIGIEGGDSTTLPFTSSNFNN----DFSGNLAMTTPSSCIDESGFLQ  781

Query  626  SSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSG  447
            SSEN+   NP + TFVKV+KSGSFGRSLDISKFSSYHELRSELARMFGLEG LEDP RSG
Sbjct  782  SSENLGSENPQSNTFVKVYKSGSFGRSLDISKFSSYHELRSELARMFGLEGQLEDPVRSG  841

Query  446  WQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQ--  273
            WQLVFVDRENDVLLLGDDPW EFV++VW IKILSP EV QMGK  G++L N+ P++N   
Sbjct  842  WQLVFVDRENDVLLLGDDPWPEFVSSVWCIKILSPQEVQQMGK-RGLELLNSAPSSNNVD  900

Query  272  RLPNGGSSCEVHVSQKETRNM-NGIPL--GSLDY  180
            +LP+ G +C+   ++ + RN+ NGI    GS +Y
Sbjct  901  KLPSNG-NCDDFGNRSDPRNLGNGIASVGGSFNY  933



>ref|XP_002893612.1| hypothetical protein ARALYDRAFT_473256 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69871.1| hypothetical protein ARALYDRAFT_473256 [Arabidopsis lyrata subsp. 
lyrata]
Length=891

 Score =   229 bits (584),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 133/214 (62%), Positives = 163/214 (76%), Gaps = 13/214 (6%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENG-FLNMPFSTCNFTSGVGTDYPLNPDMGT-SSCVDESGFLQ  627
            SS+L+ NG+SNL++ G E G    +PF++ NF +    D+  N  M T SSC+DESGFLQ
Sbjct  684  SSLLMPNGMSNLRSIGIEGGDSTALPFTSSNFNN----DFSGNLAMTTPSSCIDESGFLQ  739

Query  626  SSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSG  447
            SSEN+   NP + TFVKV+KSGSFGRSLDISKFSSYHELRSELARMFGLEG LEDP RSG
Sbjct  740  SSENLGTENPQSNTFVKVYKSGSFGRSLDISKFSSYHELRSELARMFGLEGQLEDPVRSG  799

Query  446  WQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAAN--Q  273
            WQLVFVDRENDVLLLGDDPW EFV++VW IKILSP EV QMGK  G++L N+ P++N   
Sbjct  800  WQLVFVDRENDVLLLGDDPWPEFVSSVWCIKILSPQEVQQMGK-RGLELLNSAPSSNNVD  858

Query  272  RLPNGGSSCEVHVSQKETRNM-NGIPL--GSLDY  180
            +LP+ G +C+   ++ + RN+ NGI    GS +Y
Sbjct  859  KLPSNG-NCDDFGNRSDPRNLGNGIASVGGSFNY  891



>ref|XP_009797608.1| PREDICTED: auxin response factor 6-like isoform X1 [Nicotiana 
sylvestris]
Length=899

 Score =   229 bits (584),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 120/210 (57%), Positives = 154/210 (73%), Gaps = 8/210 (4%)
 Frame = -3

Query  803  DSSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQS  624
            DS  L+Q+ + +L+  G +    N+PF++ N+ S  G D+  NP M  S C++  GF Q+
Sbjct  696  DSPSLMQSDMRSLRGVGSDCESANVPFASSNYLSNAGNDFAQNPVMALSGCINVPGFTQT  755

Query  623  SENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGW  444
            SEN  Q +P N TFVKV+KSGSFGRSLDI+KFSSYHELRSELARMFGLEGLLEDP RSGW
Sbjct  756  SENAGQESPHN-TFVKVYKSGSFGRSLDITKFSSYHELRSELARMFGLEGLLEDPLRSGW  814

Query  443  QLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLP  264
            QLVFVDRENDVLLLGDDPW EFVN+VW IKILSP +V QMGK +G++L N++  +     
Sbjct  815  QLVFVDRENDVLLLGDDPWPEFVNSVWCIKILSPHDVQQMGK-QGLELLNSVSMSR----  869

Query  263  NGGSSCEVHVSQKETRNMNG--IPLGSLDY  180
            +  +SC+   ++ E+RNM    + + +LDY
Sbjct  870  SSNNSCDDFANRSESRNMASGIMSVATLDY  899



>ref|XP_009797609.1| PREDICTED: auxin response factor 6-like isoform X2 [Nicotiana 
sylvestris]
Length=891

 Score =   229 bits (584),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 120/210 (57%), Positives = 154/210 (73%), Gaps = 8/210 (4%)
 Frame = -3

Query  803  DSSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQS  624
            DS  L+Q+ + +L+  G +    N+PF++ N+ S  G D+  NP M  S C++  GF Q+
Sbjct  688  DSPSLMQSDMRSLRGVGSDCESANVPFASSNYLSNAGNDFAQNPVMALSGCINVPGFTQT  747

Query  623  SENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGW  444
            SEN  Q +P N TFVKV+KSGSFGRSLDI+KFSSYHELRSELARMFGLEGLLEDP RSGW
Sbjct  748  SENAGQESPHN-TFVKVYKSGSFGRSLDITKFSSYHELRSELARMFGLEGLLEDPLRSGW  806

Query  443  QLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLP  264
            QLVFVDRENDVLLLGDDPW EFVN+VW IKILSP +V QMGK +G++L N++  +     
Sbjct  807  QLVFVDRENDVLLLGDDPWPEFVNSVWCIKILSPHDVQQMGK-QGLELLNSVSMSR----  861

Query  263  NGGSSCEVHVSQKETRNMNG--IPLGSLDY  180
            +  +SC+   ++ E+RNM    + + +LDY
Sbjct  862  SSNNSCDDFANRSESRNMASGIMSVATLDY  891



>ref|NP_001292624.1| auxin response factor 6 [Cucumis sativus]
 dbj|BAD19063.1| auxin response factor 3 [Cucumis sativus]
Length=916

 Score =   229 bits (584),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 131/212 (62%), Positives = 161/212 (76%), Gaps = 11/212 (5%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPD-MGT-SSCVDESGFLQ  627
            SS+L+QNG+ NL+    ++    +PFS+ N+ +  GT++  NP   GT S+C ++SGFL 
Sbjct  711  SSLLMQNGMPNLRGICSDSDSTAIPFSS-NYVNTAGTNFSANPTGTGTPSNCNEDSGFLH  769

Query  626  SSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSG  447
            S EN  Q NPP  TFVKV+KSGSFGRSLDISKFS YH+LRSELA MFGLEG LEDP RSG
Sbjct  770  SPENTGQVNPPTTTFVKVYKSGSFGRSLDISKFSRYHQLRSELAHMFGLEGELEDPLRSG  829

Query  446  WQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRL  267
            WQLVFVDRENDVLLLGDDPW EFVN+VW IKILSP EV  MGK  G++L N++P   QRL
Sbjct  830  WQLVFVDRENDVLLLGDDPWPEFVNSVWCIKILSPQEVQDMGK-RGLELLNSVPI--QRL  886

Query  266  PNGGSSCEVHVSQKE-TRNMN-GIP-LGSLDY  180
             NG  SC+ + +++E +RNMN GI  +GSL+Y
Sbjct  887  SNG--SCDNYANRQESSRNMNSGITSVGSLEY  916



>ref|XP_009384193.1| PREDICTED: auxin response factor 17-like isoform X1 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009384194.1| PREDICTED: auxin response factor 17-like isoform X1 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009384195.1| PREDICTED: auxin response factor 17-like isoform X1 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009384196.1| PREDICTED: auxin response factor 17-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=906

 Score =   229 bits (584),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 124/211 (59%), Positives = 152/211 (72%), Gaps = 7/211 (3%)
 Frame = -3

Query  806  TDSSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQ  627
             D SIL QNGI +L     E    N+ ++TCN  S  G D+P+N  +   + +DES FL+
Sbjct  701  VDLSILAQNGIPSLNTGVSEICSTNLSYATCNLLSSSGNDFPINRALSGCNGLDESRFLR  760

Query  626  SSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSG  447
            S ENVDQANP +  FVKV+KSGSFGR+LDI+KFSSYH+LRSEL  +FGLEG LEDP RSG
Sbjct  761  SHENVDQANPQSGLFVKVYKSGSFGRTLDITKFSSYHDLRSELGCLFGLEGQLEDPLRSG  820

Query  446  WQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRL  267
            WQLVFVD ENDVLL+GDDPWQEFVN+V YIKILSP EV QMGK +GID  N+ P   +RL
Sbjct  821  WQLVFVDWENDVLLVGDDPWQEFVNSVSYIKILSPEEVQQMGK-QGIDFVNSAPV--KRL  877

Query  266  PNGGSSCEVHVSQKETRNMNG--IPLGSLDY  180
               G  C+ HVSQ+++ N++     +GS  Y
Sbjct  878  QRNG--CDDHVSQQDSTNLSARITSVGSFKY  906



>ref|XP_010538262.1| PREDICTED: auxin response factor 6 [Tarenaya hassleriana]
Length=883

 Score =   228 bits (581),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 124/199 (62%), Positives = 151/199 (76%), Gaps = 3/199 (2%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTC-NFTSGVGT-DYPLNPDMGTSSCVDESGFLQ  627
            S +L+ +G+SNL+  G EN    +PF+T  NFT+ VG  D+  N  M  S+C+DESGFLQ
Sbjct  673  SPLLMPSGMSNLRGIGLENDNTILPFNTSSNFTNTVGINDFSSNLAMTPSNCIDESGFLQ  732

Query  626  SSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSG  447
            SSEN    NP + TFVKV+KSGSFGRSLDISKFSSYHELRSELA MFGLEG LEDP RSG
Sbjct  733  SSENPGSDNPQSTTFVKVYKSGSFGRSLDISKFSSYHELRSELAHMFGLEGQLEDPLRSG  792

Query  446  WQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRL  267
            WQLVFVDRENDVLLLGDDPW EFVN+VW IKILSP EV +MGK +G++L N+  +  +  
Sbjct  793  WQLVFVDRENDVLLLGDDPWPEFVNSVWCIKILSPQEVQEMGK-QGLELLNSGQSVQKLA  851

Query  266  PNGGSSCEVHVSQKETRNM  210
             NGG  CE   ++++ R++
Sbjct  852  ANGGGGCEDFRNRQDPRSL  870



>gb|ABF69979.1| transcriptional factor B3 family protein [Musa acuminata]
Length=898

 Score =   228 bits (581),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 119/206 (58%), Positives = 152/206 (74%), Gaps = 5/206 (2%)
 Frame = -3

Query  803  DSSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQS  624
            DSSI +QNGI +L          N+P++ CN     G D+P+N  +  S+ +DESG LQS
Sbjct  693  DSSISVQNGIRSLGTGVNGTNSTNIPYAACNLLRSAGNDFPINQAVNGSNGLDESGLLQS  752

Query  623  SENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGW  444
            +ENVD+ N  + TFVKV+KSGSFGRSLDI++FSSYHELRSEL  +FGLEG LEDP RSGW
Sbjct  753  TENVDRVNSQSGTFVKVYKSGSFGRSLDITRFSSYHELRSELGHLFGLEGQLEDPLRSGW  812

Query  443  QLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLP  264
            QLVFVDRE+DVLL+GDDPWQEFVN+V  IKILSP EV QMGK +G+D  N+ P   +RL 
Sbjct  813  QLVFVDREDDVLLVGDDPWQEFVNSVSCIKILSPEEVQQMGK-QGVDFVNSAPI--KRLQ  869

Query  263  NGGSSCEVHVSQKETRNMNGIPLGSL  186
            + G  C+ +VSQ+ +RN++   + S+
Sbjct  870  SNG--CDDYVSQQHSRNLSAARITSV  893



>ref|XP_006306714.1| hypothetical protein CARUB_v10008239mg [Capsella rubella]
 gb|EOA39612.1| hypothetical protein CARUB_v10008239mg [Capsella rubella]
Length=926

 Score =   228 bits (580),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 129/205 (63%), Positives = 158/205 (77%), Gaps = 11/205 (5%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENG-FLNMPFSTCNFTSGVGTDYPLNPDMGT-SSCVDESGFLQ  627
            SS+L+ NG+SNL++ G E G    +PF++ N    +  D+  N  M T SSC+DESGFLQ
Sbjct  719  SSLLMPNGMSNLRSIGIEGGDSTTLPFTSSN----LNNDFSGNLAMTTPSSCIDESGFLQ  774

Query  626  SSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSG  447
            SSEN+   NP + TFVKV+KSGSFGRSLDISKFSSYHELRSELARMFGLEG LEDP RSG
Sbjct  775  SSENLGSENPQSNTFVKVYKSGSFGRSLDISKFSSYHELRSELARMFGLEGQLEDPVRSG  834

Query  446  WQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAAN--Q  273
            WQLVFVDRENDVLLLGDDPW EFV++VW IKILSP EV QMGK  G++L N+ P++N   
Sbjct  835  WQLVFVDRENDVLLLGDDPWPEFVSSVWCIKILSPQEVQQMGK-RGLELLNSAPSSNNVD  893

Query  272  RLPNGGSSCEVHVSQKETRNM-NGI  201
            +LP+ G +C+   ++ + RN+ NGI
Sbjct  894  KLPSNG-NCDDFGNRSDPRNLGNGI  917



>gb|KJB49006.1| hypothetical protein B456_008G097200 [Gossypium raimondii]
Length=844

 Score =   227 bits (578),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 108/139 (78%), Positives = 122/139 (88%), Gaps = 0/139 (0%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSS  621
            SS++LQ+G++NLKN G EN  L++P++  NFTS  GTD+PLN DM TSSCVDESG+LQSS
Sbjct  706  SSLVLQHGMTNLKNIGNENDSLSLPYAASNFTSASGTDFPLNSDMTTSSCVDESGYLQSS  765

Query  620  ENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQ  441
            E VDQ NPP  TFVKVHK GSFGRSLDISKFSSY+ELR ELARMFGLEG LEDP+RSGWQ
Sbjct  766  EYVDQVNPPTGTFVKVHKLGSFGRSLDISKFSSYNELRCELARMFGLEGQLEDPQRSGWQ  825

Query  440  LVFVDRENDVLLLGDDPWQ  384
            LVFVDREND+LLLGDDPWQ
Sbjct  826  LVFVDRENDILLLGDDPWQ  844



>ref|XP_007159383.1| hypothetical protein PHAVU_002G233600g [Phaseolus vulgaris]
 gb|ESW31377.1| hypothetical protein PHAVU_002G233600g [Phaseolus vulgaris]
Length=908

 Score =   226 bits (576),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 130/210 (62%), Positives = 157/210 (75%), Gaps = 9/210 (4%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNF-TSGVGTDYPLNPDMGTSSCVDESGFLQS  624
            SS+L+ NG+SNLK     N    +P+ + N+  +  GTD  LN  + T S   ESG+LQS
Sbjct  705  SSLLMPNGMSNLKGVSSNNDSSTLPYQSSNYLNTTTGTDSSLNHGI-TPSIGGESGYLQS  763

Query  623  SENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGW  444
             EN  Q NP N+TFVKV+KSGSFGRSLDI+KFSSYHELRSELA+MFGLEG LEDP RSGW
Sbjct  764  PENAGQGNPLNKTFVKVYKSGSFGRSLDITKFSSYHELRSELAQMFGLEGELEDPVRSGW  823

Query  443  QLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLP  264
            QLVFVDRENDVLLLGD PW EFVN+VW IKILSP EV QMG   G++L N++P   QRL 
Sbjct  824  QLVFVDRENDVLLLGDGPWPEFVNSVWCIKILSPQEVQQMGN-PGLELLNSVPI--QRLS  880

Query  263  NGGSSCEVHVSQKETRNMN-GI-PLGSLDY  180
            NG   C+ +VS+++ RN++ GI  +GSLDY
Sbjct  881  NG--ICDDYVSRQDPRNISPGITAVGSLDY  908



>ref|XP_009627652.1| PREDICTED: auxin response factor 6-like isoform X1 [Nicotiana 
tomentosiformis]
Length=906

 Score =   226 bits (575),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 118/210 (56%), Positives = 153/210 (73%), Gaps = 8/210 (4%)
 Frame = -3

Query  803  DSSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQS  624
            DS  L+Q+ + +L+    +    N+PF++ N+ S  G D+  NP M  S C++  GF Q+
Sbjct  703  DSPSLMQSDMRSLRGVVSDCESTNVPFASSNYLSNAGNDFSQNPVMALSGCINVPGFTQT  762

Query  623  SENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGW  444
            SEN  Q +P N TFVKV+KSGSFGRSLDI+KFSSYHELRSELARMFGLEGLLEDP RSGW
Sbjct  763  SENAGQESPHN-TFVKVYKSGSFGRSLDITKFSSYHELRSELARMFGLEGLLEDPLRSGW  821

Query  443  QLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLP  264
            QLVFVDRENDVLLLGDDPW EFVN+VW IKILSP +V QMG+ +G++L N++  +     
Sbjct  822  QLVFVDRENDVLLLGDDPWPEFVNSVWCIKILSPHDVQQMGR-QGLELLNSVSMSR----  876

Query  263  NGGSSCEVHVSQKETRNMNG--IPLGSLDY  180
            +  +SC+   ++ E+RNM    + + +LDY
Sbjct  877  SSNNSCDDFANRSESRNMTSGIMSVATLDY  906



>ref|XP_006597510.1| PREDICTED: auxin response factor 6-like isoform X3 [Glycine max]
 ref|XP_006597511.1| PREDICTED: auxin response factor 6-like isoform X4 [Glycine max]
Length=817

 Score =   225 bits (574),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 127/210 (60%), Positives = 156/210 (74%), Gaps = 10/210 (5%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNF-TSGVGTDYPLNPDMGTSSCVDESGFLQS  624
            SS+L+ NG+S+LK   G N    +P+ + N+  +  GTD  LN   G +  + +SGFL  
Sbjct  615  SSLLMPNGMSSLKGVSGNNNSSTLPYQSSNYLNTTTGTDSSLN--HGMTPNIGDSGFLHC  672

Query  623  SENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGW  444
             E+  Q NP N+TFVKV+KSGSFGRSLDI+KFSSYHELR ELARMFGLEG LEDP RSGW
Sbjct  673  PEDAGQGNPLNKTFVKVYKSGSFGRSLDITKFSSYHELRGELARMFGLEGELEDPVRSGW  732

Query  443  QLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLP  264
            QLVFVDRENDVLLLGD PW EFVN+VW IKILSP EV QMG   G++L N++P  NQRL 
Sbjct  733  QLVFVDRENDVLLLGDGPWPEFVNSVWCIKILSPQEVQQMGN-NGLELLNSVP--NQRLS  789

Query  263  NGGSSCEVHVSQKETRNMN-GI-PLGSLDY  180
            NG   C+ +VS+++ RN++ GI  +GSLDY
Sbjct  790  NG--ICDDYVSRQDPRNLSTGITTVGSLDY  817



>ref|XP_006415484.1| hypothetical protein EUTSA_v10006747mg [Eutrema salsugineum]
 gb|ESQ33837.1| hypothetical protein EUTSA_v10006747mg [Eutrema salsugineum]
Length=895

 Score =   226 bits (575),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 129/214 (60%), Positives = 160/214 (75%), Gaps = 12/214 (6%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENG-FLNMPFSTCNFTSGVGTDYPLNPDMGT-SSCVDESGFLQ  627
            SS+L+ NG+SNL++ G E G    +PF++  F +    D+  N  M T SSC+DESGFLQ
Sbjct  687  SSLLMPNGMSNLRSIGIEGGDSTTLPFTSSTFNN----DFSGNLAMTTPSSCIDESGFLQ  742

Query  626  SSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSG  447
            SSEN+   N  + TFVKV+KSGSFGRSLDI+KFSSYHELRSELARMFGLEG LEDP RSG
Sbjct  743  SSENLGSENQQSNTFVKVYKSGSFGRSLDITKFSSYHELRSELARMFGLEGQLEDPVRSG  802

Query  446  WQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAAN--Q  273
            WQLVFVDRENDVLLLGDDPW EFV++VW IKILSP EV QMGK  G++L N+ P++N   
Sbjct  803  WQLVFVDRENDVLLLGDDPWPEFVSSVWCIKILSPQEVQQMGK-RGLELLNSAPSSNNVD  861

Query  272  RLPNGGSSCEVHVSQKETRNM-NGIPL--GSLDY  180
            +LP+   +C+   ++ + RN+ NGI    GS +Y
Sbjct  862  KLPSNNGNCDDFGNRSDPRNLGNGIASVGGSFNY  895



>ref|XP_006415485.1| hypothetical protein EUTSA_v10006747mg [Eutrema salsugineum]
 gb|ESQ33838.1| hypothetical protein EUTSA_v10006747mg [Eutrema salsugineum]
Length=901

 Score =   226 bits (575),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 129/214 (60%), Positives = 160/214 (75%), Gaps = 12/214 (6%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENG-FLNMPFSTCNFTSGVGTDYPLNPDMGT-SSCVDESGFLQ  627
            SS+L+ NG+SNL++ G E G    +PF++  F +    D+  N  M T SSC+DESGFLQ
Sbjct  693  SSLLMPNGMSNLRSIGIEGGDSTTLPFTSSTFNN----DFSGNLAMTTPSSCIDESGFLQ  748

Query  626  SSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSG  447
            SSEN+   N  + TFVKV+KSGSFGRSLDI+KFSSYHELRSELARMFGLEG LEDP RSG
Sbjct  749  SSENLGSENQQSNTFVKVYKSGSFGRSLDITKFSSYHELRSELARMFGLEGQLEDPVRSG  808

Query  446  WQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAAN--Q  273
            WQLVFVDRENDVLLLGDDPW EFV++VW IKILSP EV QMGK  G++L N+ P++N   
Sbjct  809  WQLVFVDRENDVLLLGDDPWPEFVSSVWCIKILSPQEVQQMGK-RGLELLNSAPSSNNVD  867

Query  272  RLPNGGSSCEVHVSQKETRNM-NGIPL--GSLDY  180
            +LP+   +C+   ++ + RN+ NGI    GS +Y
Sbjct  868  KLPSNNGNCDDFGNRSDPRNLGNGIASVGGSFNY  901



>ref|XP_009627654.1| PREDICTED: auxin response factor 6-like isoform X3 [Nicotiana 
tomentosiformis]
Length=891

 Score =   225 bits (574),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 118/210 (56%), Positives = 153/210 (73%), Gaps = 8/210 (4%)
 Frame = -3

Query  803  DSSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQS  624
            DS  L+Q+ + +L+    +    N+PF++ N+ S  G D+  NP M  S C++  GF Q+
Sbjct  688  DSPSLMQSDMRSLRGVVSDCESTNVPFASSNYLSNAGNDFSQNPVMALSGCINVPGFTQT  747

Query  623  SENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGW  444
            SEN  Q +P N TFVKV+KSGSFGRSLDI+KFSSYHELRSELARMFGLEGLLEDP RSGW
Sbjct  748  SENAGQESPHN-TFVKVYKSGSFGRSLDITKFSSYHELRSELARMFGLEGLLEDPLRSGW  806

Query  443  QLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLP  264
            QLVFVDRENDVLLLGDDPW EFVN+VW IKILSP +V QMG+ +G++L N++  +     
Sbjct  807  QLVFVDRENDVLLLGDDPWPEFVNSVWCIKILSPHDVQQMGR-QGLELLNSVSMSR----  861

Query  263  NGGSSCEVHVSQKETRNMNG--IPLGSLDY  180
            +  +SC+   ++ E+RNM    + + +LDY
Sbjct  862  SSNNSCDDFANRSESRNMTSGIMSVATLDY  891



>ref|XP_009627653.1| PREDICTED: auxin response factor 6-like isoform X2 [Nicotiana 
tomentosiformis]
Length=899

 Score =   225 bits (574),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 118/210 (56%), Positives = 153/210 (73%), Gaps = 8/210 (4%)
 Frame = -3

Query  803  DSSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQS  624
            DS  L+Q+ + +L+    +    N+PF++ N+ S  G D+  NP M  S C++  GF Q+
Sbjct  696  DSPSLMQSDMRSLRGVVSDCESTNVPFASSNYLSNAGNDFSQNPVMALSGCINVPGFTQT  755

Query  623  SENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGW  444
            SEN  Q +P N TFVKV+KSGSFGRSLDI+KFSSYHELRSELARMFGLEGLLEDP RSGW
Sbjct  756  SENAGQESPHN-TFVKVYKSGSFGRSLDITKFSSYHELRSELARMFGLEGLLEDPLRSGW  814

Query  443  QLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLP  264
            QLVFVDRENDVLLLGDDPW EFVN+VW IKILSP +V QMG+ +G++L N++  +     
Sbjct  815  QLVFVDRENDVLLLGDDPWPEFVNSVWCIKILSPHDVQQMGR-QGLELLNSVSMSR----  869

Query  263  NGGSSCEVHVSQKETRNMNG--IPLGSLDY  180
            +  +SC+   ++ E+RNM    + + +LDY
Sbjct  870  SSNNSCDDFANRSESRNMTSGIMSVATLDY  899



>ref|XP_009385053.1| PREDICTED: auxin response factor 6-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009385054.1| PREDICTED: auxin response factor 6-like [Musa acuminata subsp. 
malaccensis]
Length=913

 Score =   225 bits (574),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 117/209 (56%), Positives = 158/209 (76%), Gaps = 7/209 (3%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSS  621
            S +L+QNG++NL N   E   +N+ ++  NF +  G D+ LN  +  S+ ++E+GFL S 
Sbjct  710  SPLLVQNGMANLSNIRNETDSMNIRYAASNFVASSGNDFALNQTLTGSNSLEEAGFLHSP  769

Query  620  ENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQ  441
            ENVD  NP +RT VKV+KSGS GRSLDI+KFSSYHELRSEL  +FGLEG LEDP RSGWQ
Sbjct  770  ENVDSLNPKSRTSVKVYKSGSLGRSLDIAKFSSYHELRSELGHLFGLEGQLEDPLRSGWQ  829

Query  440  LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPN  261
            LVFVDREND+LL+GDDPWQEFVN+VW IKILSP EV QMGK + ++  N+     +RLPN
Sbjct  830  LVFVDRENDILLVGDDPWQEFVNSVWCIKILSPQEVQQMGK-QSVEFLNS--TCIKRLPN  886

Query  260  GGSSCEVHVSQKETRNMN-GIP-LGSLDY  180
              +SC+ +++++++R ++ GI  +G+L+Y
Sbjct  887  --NSCDDYINRQDSRTVSTGIASVGTLEY  913



>ref|XP_006597509.1| PREDICTED: auxin response factor 6-like isoform X2 [Glycine max]
Length=898

 Score =   225 bits (573),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 127/210 (60%), Positives = 156/210 (74%), Gaps = 10/210 (5%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNF-TSGVGTDYPLNPDMGTSSCVDESGFLQS  624
            SS+L+ NG+S+LK   G N    +P+ + N+  +  GTD  LN   G +  + +SGFL  
Sbjct  696  SSLLMPNGMSSLKGVSGNNNSSTLPYQSSNYLNTTTGTDSSLN--HGMTPNIGDSGFLHC  753

Query  623  SENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGW  444
             E+  Q NP N+TFVKV+KSGSFGRSLDI+KFSSYHELR ELARMFGLEG LEDP RSGW
Sbjct  754  PEDAGQGNPLNKTFVKVYKSGSFGRSLDITKFSSYHELRGELARMFGLEGELEDPVRSGW  813

Query  443  QLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLP  264
            QLVFVDRENDVLLLGD PW EFVN+VW IKILSP EV QMG   G++L N++P  NQRL 
Sbjct  814  QLVFVDRENDVLLLGDGPWPEFVNSVWCIKILSPQEVQQMGN-NGLELLNSVP--NQRLS  870

Query  263  NGGSSCEVHVSQKETRNMN-GI-PLGSLDY  180
            NG   C+ +VS+++ RN++ GI  +GSLDY
Sbjct  871  NG--ICDDYVSRQDPRNLSTGITTVGSLDY  898



>gb|KHN06947.1| Auxin response factor 6 [Glycine soja]
Length=902

 Score =   225 bits (573),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 127/210 (60%), Positives = 156/210 (74%), Gaps = 10/210 (5%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNF-TSGVGTDYPLNPDMGTSSCVDESGFLQS  624
            SS+L+ NG+S+LK   G N    +P+ + N+  +  GTD  LN   G +  + +SGFL  
Sbjct  700  SSLLMPNGMSSLKGVSGNNNSSTLPYQSSNYLNTTTGTDSSLN--HGMTPNIGDSGFLHC  757

Query  623  SENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGW  444
             E+  Q NP N+TFVKV+KSGSFGRSLDI+KFSSYHELR ELARMFGLEG LEDP RSGW
Sbjct  758  PEDAGQGNPLNKTFVKVYKSGSFGRSLDITKFSSYHELRGELARMFGLEGELEDPVRSGW  817

Query  443  QLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLP  264
            QLVFVDRENDVLLLGD PW EFVN+VW IKILSP EV QMG   G++L N++P  NQRL 
Sbjct  818  QLVFVDRENDVLLLGDGPWPEFVNSVWCIKILSPQEVQQMGN-NGLELLNSVP--NQRLS  874

Query  263  NGGSSCEVHVSQKETRNMN-GI-PLGSLDY  180
            NG   C+ +VS+++ RN++ GI  +GSLDY
Sbjct  875  NG--ICDDYVSRQDPRNLSTGITTVGSLDY  902



>ref|XP_003546066.1| PREDICTED: auxin response factor 6-like isoform X1 [Glycine max]
Length=897

 Score =   225 bits (573),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 127/210 (60%), Positives = 156/210 (74%), Gaps = 10/210 (5%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNF-TSGVGTDYPLNPDMGTSSCVDESGFLQS  624
            SS+L+ NG+S+LK   G N    +P+ + N+  +  GTD  LN   G +  + +SGFL  
Sbjct  695  SSLLMPNGMSSLKGVSGNNNSSTLPYQSSNYLNTTTGTDSSLN--HGMTPNIGDSGFLHC  752

Query  623  SENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGW  444
             E+  Q NP N+TFVKV+KSGSFGRSLDI+KFSSYHELR ELARMFGLEG LEDP RSGW
Sbjct  753  PEDAGQGNPLNKTFVKVYKSGSFGRSLDITKFSSYHELRGELARMFGLEGELEDPVRSGW  812

Query  443  QLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLP  264
            QLVFVDRENDVLLLGD PW EFVN+VW IKILSP EV QMG   G++L N++P  NQRL 
Sbjct  813  QLVFVDRENDVLLLGDGPWPEFVNSVWCIKILSPQEVQQMGN-NGLELLNSVP--NQRLS  869

Query  263  NGGSSCEVHVSQKETRNMN-GI-PLGSLDY  180
            NG   C+ +VS+++ RN++ GI  +GSLDY
Sbjct  870  NG--ICDDYVSRQDPRNLSTGITTVGSLDY  897



>gb|KFK27496.1| hypothetical protein AALP_AA8G390400 [Arabis alpina]
Length=941

 Score =   224 bits (572),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 130/214 (61%), Positives = 162/214 (76%), Gaps = 13/214 (6%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENG-FLNMPFSTCNFTSGVGTDYPLNPDMGT-SSCVDESGFLQ  627
            SS+L+ NG+SNL++ G E G    +PF++ N+ +    D+  N  M T SSC+DESGFLQ
Sbjct  734  SSLLMPNGMSNLRSIGIEGGDSTTLPFTSSNYNN----DFSGNLAMTTPSSCIDESGFLQ  789

Query  626  SSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSG  447
            SSEN+   N  + TFVKV+KSGSFGRSLDI+KFSSYHELRSELARMFGLEG LEDP RSG
Sbjct  790  SSENLGSENQQSNTFVKVYKSGSFGRSLDITKFSSYHELRSELARMFGLEGQLEDPVRSG  849

Query  446  WQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAAN--Q  273
            WQLVFVDRENDVLLLGDDPW EFV++VW IKILSP EV QMGK  G++L N+ P++N   
Sbjct  850  WQLVFVDRENDVLLLGDDPWPEFVSSVWCIKILSPQEVQQMGK-RGLELLNSAPSSNNVD  908

Query  272  RLPNGGSSCEVHVSQKETRNM-NGIPL--GSLDY  180
            +LP+ G +C+   ++ + RN+ NGI    GS +Y
Sbjct  909  KLPSNG-NCDDFGNRSDPRNLGNGIASVGGSFNY  941



>ref|XP_009399230.1| PREDICTED: auxin response factor 17-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009399231.1| PREDICTED: auxin response factor 17-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009399232.1| PREDICTED: auxin response factor 17-like [Musa acuminata subsp. 
malaccensis]
Length=909

 Score =   224 bits (570),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 118/206 (57%), Positives = 150/206 (73%), Gaps = 5/206 (2%)
 Frame = -3

Query  803  DSSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQS  624
            DSSI +QNGI +L          N+ ++ CN     G D+P+N  +  S+ + ESG LQS
Sbjct  704  DSSISVQNGIRSLGTGVNGTNSTNIVYAACNLLRSAGNDFPINQAVNGSNGLHESGLLQS  763

Query  623  SENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGW  444
            +ENVDQ N  + TFVKV+KSGSFGRSLDI++FSSYHELRSEL  +FGLEG LEDP RSGW
Sbjct  764  TENVDQVNSQSGTFVKVYKSGSFGRSLDITRFSSYHELRSELGHLFGLEGQLEDPLRSGW  823

Query  443  QLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLP  264
            QLVFVDRE+DVLL+GDDPWQEFVN+V  IKILSP EV QMGK +G+D  N+ P   +RL 
Sbjct  824  QLVFVDREDDVLLVGDDPWQEFVNSVSCIKILSPEEVQQMGK-QGVDFVNSAPI--KRLQ  880

Query  263  NGGSSCEVHVSQKETRNMNGIPLGSL  186
            + G  C+ +VSQ+ +RN++   + S+
Sbjct  881  SNG--CDDYVSQQHSRNLSAARITSV  904



>gb|EMT32630.1| Auxin response factor 6 [Aegilops tauschii]
Length=858

 Score =   223 bits (569),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 116/215 (54%), Positives = 157/215 (73%), Gaps = 15/215 (7%)
 Frame = -3

Query  797  SILLQNGISNLKNSGG-------ENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDES  639
            S+L+Q GI +L+   G       +N    +P+STCNF S    D+PLN  + +S C+DES
Sbjct  650  SLLMQGGIPSLQEDNGCIASLQDDNDSSTIPYSTCNFLSPSQNDFPLNEALASSGCLDES  709

Query  638  GFLQSSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDP  459
            G+   SEN D  N P   FVKV+KSG+FGR LDI+KFS+YHELRSE+ R+FGLEG LEDP
Sbjct  710  GYASFSENSDHVNQPTAAFVKVYKSGAFGRLLDITKFSNYHELRSEVGRLFGLEGQLEDP  769

Query  458  ERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAA  279
             RSGWQLVFVDRE+D+LL+GDDPWQEFVN+V  IKIL+P EV QMGK +GIDL ++ PA 
Sbjct  770  ARSGWQLVFVDREDDILLVGDDPWQEFVNSVSCIKILTPQEVQQMGK-QGIDLLSSAPA-  827

Query  278  NQRLPNGGSSCEVHVSQKETRNMNGI--PLGSLDY  180
             +RL   G+SC+ +  ++E+R+++ +   +GS+++
Sbjct  828  -RRL---GNSCDNYAGRQESRSLSTVIASVGSVEF  858



>gb|EMS45463.1| Auxin response factor 6 [Triticum urartu]
Length=872

 Score =   223 bits (569),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 114/206 (55%), Positives = 151/206 (73%), Gaps = 13/206 (6%)
 Frame = -3

Query  797  SILLQNGISNLKNSGG-------ENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDES  639
            S+L+Q GI +L+   G       +N    +P+STCNF S    D+PLN  + +S C+DES
Sbjct  652  SLLMQGGIPSLQEDNGCIASLQDDNDSSTIPYSTCNFLSPSQNDFPLNEALASSGCLDES  711

Query  638  GFLQSSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDP  459
            G+   SEN D  N P   FVKV+KSG+FGR LDI+KFSSYHELRSE+ R+FGL+G LEDP
Sbjct  712  GYASFSENSDHVNQPTAAFVKVYKSGAFGRLLDITKFSSYHELRSEVGRLFGLDGQLEDP  771

Query  458  ERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAA  279
             RSGWQLVFVDRE+D+LL+GDDPWQEFVN+V  IKIL+P EV QMGK +GIDL ++ PA 
Sbjct  772  ARSGWQLVFVDREDDILLVGDDPWQEFVNSVSCIKILTPQEVQQMGK-QGIDLLSSAPA-  829

Query  278  NQRLPNGGSSCEVHVSQKETRNMNGI  201
             +RL   G+SC+ +  ++E+R+++ +
Sbjct  830  -RRL---GNSCDNYAGRQESRSLSTV  851



>ref|XP_008784820.1| PREDICTED: LOW QUALITY PROTEIN: auxin response factor 6-like 
[Phoenix dactylifera]
Length=988

 Score =   224 bits (570),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 124/209 (59%), Positives = 156/209 (75%), Gaps = 13/209 (6%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSS  621
            SS+L+QNG+ NL++ G       MPF T       GTD+PLN  + +S+C++E GFLQ  
Sbjct  791  SSLLMQNGMPNLRSVGSGTDSTAMPFLT-----AAGTDFPLNQALTSSNCIEEPGFLQPP  845

Query  620  ENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQ  441
            ENV   NP N TFVKV+KSGS+GRSLDI+KF+SY ELRSEL R+FGLEG L+DP RSGWQ
Sbjct  846  ENVGHMNPQNGTFVKVYKSGSYGRSLDITKFNSYPELRSELGRLFGLEGQLDDPMRSGWQ  905

Query  440  LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPN  261
            LVF+DRENDVLLLGDDPWQEFVNNVW IKILSP E+ QMGK  G +LP   P+  +RLP+
Sbjct  906  LVFIDRENDVLLLGDDPWQEFVNNVWCIKILSPQEM-QMGKGGG-ELPGTAPS--RRLPS  961

Query  260  GGSSCEVHVSQKETRNM-NGI-PLGSLDY  180
              S  + +++++++RNM NGI  +  LDY
Sbjct  962  --SRYDDYMNRQDSRNMSNGISSMLPLDY  988



>ref|XP_010940157.1| PREDICTED: LOW QUALITY PROTEIN: auxin response factor 17-like 
[Elaeis guineensis]
Length=965

 Score =   223 bits (569),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 117/201 (58%), Positives = 151/201 (75%), Gaps = 12/201 (6%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSS  621
            SS+L+QNG+ NL++ G       MPF T       GTD+PLN  + +S+C++E GFLQS 
Sbjct  768  SSLLMQNGMPNLRSIGSGTDSTAMPFLTI-----AGTDFPLNQAITSSNCIEEPGFLQSP  822

Query  620  ENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQ  441
            ENV   NP + TFVKV+KSGS+GRSLDI+KF+SY ELR+EL R+FGLEG LEDP RSGWQ
Sbjct  823  ENVGHMNPQSGTFVKVYKSGSYGRSLDITKFNSYPELRTELGRLFGLEGQLEDPMRSGWQ  882

Query  440  LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPN  261
            LVF+DRENDVLLLGDDPWQEFVNNVW I+ILSP E+    ++EG +LP   P   +R P+
Sbjct  883  LVFIDRENDVLLLGDDPWQEFVNNVWCIRILSPQEMQ--TRKEGGELPTTAP--TKRFPS  938

Query  260  GGSSCEVHVSQKETRNM-NGI  201
            G  S + +++++++RNM NGI
Sbjct  939  G--SYDEYMNKQDSRNMSNGI  957



>ref|XP_006594518.1| PREDICTED: auxin response factor 6-like isoform X3 [Glycine max]
Length=815

 Score =   222 bits (565),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 127/210 (60%), Positives = 153/210 (73%), Gaps = 10/210 (5%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNF-TSGVGTDYPLNPDMGTSSCVDESGFLQS  624
            SS+L+ NG+S+LK   G NG   +P+ + N+  +   TD  LN   G +  + +SGFLQ 
Sbjct  613  SSLLMPNGMSSLKGVCGNNGSSTLPYQSSNYLNTTTRTDSSLN--HGMTPNIGDSGFLQC  670

Query  623  SENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGW  444
             E   Q NP N+TFVKV+KSGSFGRSLDI+KFSSYHELR ELARMFGLEG LEDP RSGW
Sbjct  671  LEEAGQGNPLNKTFVKVYKSGSFGRSLDITKFSSYHELRGELARMFGLEGELEDPVRSGW  730

Query  443  QLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLP  264
            QLVFVDRENDVLLLGD PW EFVN+VW IKILSP EV QMG   G++L N+ P   QRL 
Sbjct  731  QLVFVDRENDVLLLGDGPWPEFVNSVWCIKILSPQEVQQMGN-NGLELLNSFPI--QRLS  787

Query  263  NGGSSCEVHVSQKETRNM-NGI-PLGSLDY  180
            NG   C+ +VS+++ RN+  GI  +GSLDY
Sbjct  788  NG--ICDDYVSRQDPRNLGTGITTVGSLDY  815



>gb|KHN47353.1| Auxin response factor 6 [Glycine soja]
Length=900

 Score =   222 bits (565),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 127/210 (60%), Positives = 153/210 (73%), Gaps = 10/210 (5%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNF-TSGVGTDYPLNPDMGTSSCVDESGFLQS  624
            SS+L+ NG+S+LK   G NG   +P+ + N+  +   TD  LN   G +  + +SGFLQ 
Sbjct  698  SSLLMPNGMSSLKGVCGNNGSSTLPYQSSNYLNTTTRTDSSLN--HGMTPNIGDSGFLQC  755

Query  623  SENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGW  444
             E   Q NP N+TFVKV+KSGSFGRSLDI+KFSSYHELR ELARMFGLEG LEDP RSGW
Sbjct  756  LEEAGQGNPLNKTFVKVYKSGSFGRSLDITKFSSYHELRGELARMFGLEGELEDPVRSGW  815

Query  443  QLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLP  264
            QLVFVDRENDVLLLGD PW EFVN+VW IKILSP EV QMG   G++L N+ P   QRL 
Sbjct  816  QLVFVDRENDVLLLGDGPWPEFVNSVWCIKILSPQEVQQMGN-NGLELLNSFPI--QRLS  872

Query  263  NGGSSCEVHVSQKETRNM-NGI-PLGSLDY  180
            NG   C+ +VS+++ RN+  GI  +GSLDY
Sbjct  873  NG--ICDDYVSRQDPRNLGTGITTVGSLDY  900



>ref|XP_006594517.1| PREDICTED: auxin response factor 6-like isoform X2 [Glycine max]
Length=896

 Score =   222 bits (565),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 127/210 (60%), Positives = 153/210 (73%), Gaps = 10/210 (5%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNF-TSGVGTDYPLNPDMGTSSCVDESGFLQS  624
            SS+L+ NG+S+LK   G NG   +P+ + N+  +   TD  LN   G +  + +SGFLQ 
Sbjct  694  SSLLMPNGMSSLKGVCGNNGSSTLPYQSSNYLNTTTRTDSSLN--HGMTPNIGDSGFLQC  751

Query  623  SENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGW  444
             E   Q NP N+TFVKV+KSGSFGRSLDI+KFSSYHELR ELARMFGLEG LEDP RSGW
Sbjct  752  LEEAGQGNPLNKTFVKVYKSGSFGRSLDITKFSSYHELRGELARMFGLEGELEDPVRSGW  811

Query  443  QLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLP  264
            QLVFVDRENDVLLLGD PW EFVN+VW IKILSP EV QMG   G++L N+ P   QRL 
Sbjct  812  QLVFVDRENDVLLLGDGPWPEFVNSVWCIKILSPQEVQQMGN-NGLELLNSFPI--QRLS  868

Query  263  NGGSSCEVHVSQKETRNM-NGI-PLGSLDY  180
            NG   C+ +VS+++ RN+  GI  +GSLDY
Sbjct  869  NG--ICDDYVSRQDPRNLGTGITTVGSLDY  896



>ref|XP_003542951.1| PREDICTED: auxin response factor 6-like isoform X1 [Glycine max]
Length=895

 Score =   222 bits (565),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 127/210 (60%), Positives = 153/210 (73%), Gaps = 10/210 (5%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNF-TSGVGTDYPLNPDMGTSSCVDESGFLQS  624
            SS+L+ NG+S+LK   G NG   +P+ + N+  +   TD  LN   G +  + +SGFLQ 
Sbjct  693  SSLLMPNGMSSLKGVCGNNGSSTLPYQSSNYLNTTTRTDSSLN--HGMTPNIGDSGFLQC  750

Query  623  SENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGW  444
             E   Q NP N+TFVKV+KSGSFGRSLDI+KFSSYHELR ELARMFGLEG LEDP RSGW
Sbjct  751  LEEAGQGNPLNKTFVKVYKSGSFGRSLDITKFSSYHELRGELARMFGLEGELEDPVRSGW  810

Query  443  QLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLP  264
            QLVFVDRENDVLLLGD PW EFVN+VW IKILSP EV QMG   G++L N+ P   QRL 
Sbjct  811  QLVFVDRENDVLLLGDGPWPEFVNSVWCIKILSPQEVQQMGN-NGLELLNSFPI--QRLS  867

Query  263  NGGSSCEVHVSQKETRNM-NGI-PLGSLDY  180
            NG   C+ +VS+++ RN+  GI  +GSLDY
Sbjct  868  NG--ICDDYVSRQDPRNLGTGITTVGSLDY  895



>gb|AFW68990.1| hypothetical protein ZEAMMB73_088581 [Zea mays]
Length=510

 Score =   215 bits (548),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 113/198 (57%), Positives = 150/198 (76%), Gaps = 10/198 (5%)
 Frame = -3

Query  797  SILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQ-SS  621
            S+L+Q GI  L+N    N    +P+ST NF S    D+PL+  + +S C+D+SG++   S
Sbjct  310  SLLMQGGIPGLQNG---NDSAAIPYSTSNFLSPSQNDFPLDHTLNSSGCLDDSGYVPPCS  366

Query  620  ENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQ  441
            +N D+ N P  TFVKV+KSG++GRSLDI++FSSYHELR EL R+FGLEG LEDP RSGWQ
Sbjct  367  DNSDKVNRPPATFVKVYKSGTYGRSLDITRFSSYHELRRELGRLFGLEGQLEDPLRSGWQ  426

Query  440  LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPN  261
            LVFVDRE DVLL+GDDPWQEFV+ V  IKILSP EV QMGK +G++L ++ PA  +RL  
Sbjct  427  LVFVDREEDVLLVGDDPWQEFVSTVSCIKILSPQEVQQMGK-QGLELLSSAPA--RRL--  481

Query  260  GGSSCEVHVSQKETRNMN  207
             GSSC+ +VS++E+R+++
Sbjct  482  -GSSCDDYVSRQESRSLS  498



>ref|XP_010233861.1| PREDICTED: auxin response factor 6-like isoform X2 [Brachypodium 
distachyon]
Length=914

 Score =   220 bits (561),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 122/215 (57%), Positives = 159/215 (74%), Gaps = 15/215 (7%)
 Frame = -3

Query  797  SILLQNGISNLKNSGG-------ENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDES  639
            S+L+Q+ I  L+N          +NG   +P+STCNF S    ++PLN  + +S C+D S
Sbjct  706  SLLMQDDIPGLQNENDCIASLQDDNGSNTIPYSTCNFLSPSQNNFPLNEALTSSGCLDGS  765

Query  638  GFLQSSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDP  459
            G++  SEN DQ N P  TFVKV+KSG+ GR LDI++FSSYHELRSEL  +FGLEG LEDP
Sbjct  766  GYVPFSENPDQVNRPPATFVKVYKSGAVGRLLDITRFSSYHELRSELGHLFGLEGQLEDP  825

Query  458  ERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAA  279
             RSGWQLVFVDRENDVLL+GDDPWQEFVN+V  IKILSP EV QMGK +GI+L ++ PA 
Sbjct  826  VRSGWQLVFVDRENDVLLVGDDPWQEFVNSVSCIKILSPQEVQQMGK-QGIELLSSAPA-  883

Query  278  NQRLPNGGSSCEVHVSQKETRNMN-GI-PLGSLDY  180
             +RL NG   C+ +VS++E+RN++ GI  +GS+++
Sbjct  884  -RRLGNG---CDNYVSRQESRNLSTGIAAVGSVEF  914



>ref|XP_003575362.1| PREDICTED: auxin response factor 6-like isoform X1 [Brachypodium 
distachyon]
Length=915

 Score =   220 bits (561),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 122/215 (57%), Positives = 159/215 (74%), Gaps = 15/215 (7%)
 Frame = -3

Query  797  SILLQNGISNLKNSGG-------ENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDES  639
            S+L+Q+ I  L+N          +NG   +P+STCNF S    ++PLN  + +S C+D S
Sbjct  707  SLLMQDDIPGLQNENDCIASLQDDNGSNTIPYSTCNFLSPSQNNFPLNEALTSSGCLDGS  766

Query  638  GFLQSSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDP  459
            G++  SEN DQ N P  TFVKV+KSG+ GR LDI++FSSYHELRSEL  +FGLEG LEDP
Sbjct  767  GYVPFSENPDQVNRPPATFVKVYKSGAVGRLLDITRFSSYHELRSELGHLFGLEGQLEDP  826

Query  458  ERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAA  279
             RSGWQLVFVDRENDVLL+GDDPWQEFVN+V  IKILSP EV QMGK +GI+L ++ PA 
Sbjct  827  VRSGWQLVFVDRENDVLLVGDDPWQEFVNSVSCIKILSPQEVQQMGK-QGIELLSSAPA-  884

Query  278  NQRLPNGGSSCEVHVSQKETRNMN-GI-PLGSLDY  180
             +RL NG   C+ +VS++E+RN++ GI  +GS+++
Sbjct  885  -RRLGNG---CDNYVSRQESRNLSTGIAAVGSVEF  915



>ref|XP_010233862.1| PREDICTED: auxin response factor 6-like isoform X3 [Brachypodium 
distachyon]
Length=913

 Score =   220 bits (560),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 122/215 (57%), Positives = 159/215 (74%), Gaps = 15/215 (7%)
 Frame = -3

Query  797  SILLQNGISNLKNSGG-------ENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDES  639
            S+L+Q+ I  L+N          +NG   +P+STCNF S    ++PLN  + +S C+D S
Sbjct  705  SLLMQDDIPGLQNENDCIASLQDDNGSNTIPYSTCNFLSPSQNNFPLNEALTSSGCLDGS  764

Query  638  GFLQSSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDP  459
            G++  SEN DQ N P  TFVKV+KSG+ GR LDI++FSSYHELRSEL  +FGLEG LEDP
Sbjct  765  GYVPFSENPDQVNRPPATFVKVYKSGAVGRLLDITRFSSYHELRSELGHLFGLEGQLEDP  824

Query  458  ERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAA  279
             RSGWQLVFVDRENDVLL+GDDPWQEFVN+V  IKILSP EV QMGK +GI+L ++ PA 
Sbjct  825  VRSGWQLVFVDRENDVLLVGDDPWQEFVNSVSCIKILSPQEVQQMGK-QGIELLSSAPA-  882

Query  278  NQRLPNGGSSCEVHVSQKETRNMN-GI-PLGSLDY  180
             +RL NG   C+ +VS++E+RN++ GI  +GS+++
Sbjct  883  -RRLGNG---CDNYVSRQESRNLSTGIAAVGSVEF  913



>ref|XP_004293501.1| PREDICTED: auxin response factor 6 [Fragaria vesca subsp. vesca]
Length=880

 Score =   219 bits (558),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 127/214 (59%), Positives = 157/214 (73%), Gaps = 11/214 (5%)
 Frame = -3

Query  806  TDSSILLQNGI--SNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGF  633
            TD    L  GI  SNL+  G ++    + F + N+ S   TD+ LNP +  S+C+DESGF
Sbjct  673  TDPQTHLLFGINMSNLRAVGSDSVSTTIHFPS-NYMSTTETDFSLNPAVTPSNCIDESGF  731

Query  632  LQSSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPER  453
            LQS ENV   N PN  FVKV+KSGS+GRSLDI+KFSSYHELR ELARMFGL+G LEDP R
Sbjct  732  LQSPENVGHENQPNGNFVKVYKSGSYGRSLDITKFSSYHELRRELARMFGLDGELEDPVR  791

Query  452  SGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQ  273
            SGWQLVFVDRENDVLLLGDDPW EFVN+VW IKILSP EV QMGK  G++L  ++P   Q
Sbjct  792  SGWQLVFVDRENDVLLLGDDPWPEFVNSVWCIKILSPQEVQQMGK-RGLELLKSVPM--Q  848

Query  272  RLPNGGSSCEVH-VSQKETRNM-NGIP-LGSLDY  180
            RL    +SC+ +  S++++RN+ +GI  +GSL+Y
Sbjct  849  RL--SSNSCDDYGGSRQDSRNLSSGITSVGSLEY  880



>emb|CDY09598.1| BnaC05g23210D [Brassica napus]
Length=870

 Score =   218 bits (554),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 130/218 (60%), Positives = 157/218 (72%), Gaps = 15/218 (7%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENG-FLNMPFSTCNFTSGVGTDYPLNPDMGT-SSCVDESGFLQ  627
            SS+L+ NG+SNL++ G E G    +PF+T NF +        N  M T SSC+DE GFLQ
Sbjct  657  SSLLMPNGMSNLRSIGIEGGDSTTLPFTTSNFNNDFSGG---NLAMTTPSSCIDEPGFLQ  713

Query  626  SSENVDQANP-PNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERS  450
            SSEN+   N   N TFVKV+KSGSFGRSLDI+KFSSYHELRSELARMFGLEG LEDP RS
Sbjct  714  SSENLGSENQQSNNTFVKVYKSGSFGRSLDITKFSSYHELRSELARMFGLEGQLEDPVRS  773

Query  449  GWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAAN--  276
            GWQLVFVDRENDVLLLGDDPW EFV++VW IKILSP EV QMGK  G++L N+ P ++  
Sbjct  774  GWQLVFVDRENDVLLLGDDPWPEFVSSVWCIKILSPQEVQQMGK-RGLELLNSAPPSSNN  832

Query  275  ---QRLPNGGSSCEVHVSQKETRNM-NGIPL--GSLDY  180
               ++LP+   +C+   S+ + RN  NGI    GS +Y
Sbjct  833  NVVEKLPSNNGNCDDFGSRSDPRNRGNGIASVGGSFNY  870



>emb|CDY02285.1| BnaA09g26170D [Brassica napus]
Length=873

 Score =   218 bits (554),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 129/218 (59%), Positives = 158/218 (72%), Gaps = 15/218 (7%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENG-FLNMPFSTCNFTSGVGTDYPLNPDMGT-SSCVDESGFLQ  627
            SS+L+ NG+SNL++ G E G    +PF+T NF +        N  M T SSC+DE GFLQ
Sbjct  660  SSLLMPNGMSNLRSIGIEGGDSTTLPFTTSNFNNDFSGG---NLAMTTPSSCIDEPGFLQ  716

Query  626  SSENVDQANP-PNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERS  450
            SSEN+   N   N TFVKV+KSGSFGRSLDI+KFSSYHELRSELARMFGLEG LEDP RS
Sbjct  717  SSENLGSENQQSNNTFVKVYKSGSFGRSLDITKFSSYHELRSELARMFGLEGQLEDPVRS  776

Query  449  GWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAAN--  276
            GWQLVFVDRENDVLLLGDDPW EFV++VW IKILSP EV QMGK  G++L N+ P ++  
Sbjct  777  GWQLVFVDRENDVLLLGDDPWPEFVSSVWCIKILSPQEVQQMGK-RGLELLNSAPPSSNN  835

Query  275  ---QRLPNGGSSCEVHVSQKETRNM-NGIPL--GSLDY  180
               ++LP+   +C+   ++ + RN+ NGI    GS +Y
Sbjct  836  NVVEKLPSNNGNCDDFGNRSDPRNLGNGIASVGGSFNY  873



>ref|NP_001045993.1| Os02g0164900 [Oryza sativa Japonica Group]
 sp|Q6H6V4.1|ARFF_ORYSJ RecName: Full=Auxin response factor 6; AltName: Full=OsARF6a 
[Oryza sativa Japonica Group]
 sp|A2X1A1.1|ARFF_ORYSI RecName: Full=Auxin response factor 6; AltName: Full=OsARF6a 
[Oryza sativa Indica Group]
 dbj|BAD25169.1| putative auxin response transcription factor(ARF6) [Oryza sativa 
Japonica Group]
 dbj|BAD25545.1| putative auxin response transcription factor(ARF6) [Oryza sativa 
Japonica Group]
 dbj|BAF07907.1| Os02g0164900 [Oryza sativa Japonica Group]
 gb|EAY84611.1| hypothetical protein OsI_05979 [Oryza sativa Indica Group]
 gb|EAZ21860.1| hypothetical protein OsJ_05506 [Oryza sativa Japonica Group]
 dbj|BAG92035.1| unnamed protein product [Oryza sativa Japonica Group]
Length=908

 Score =   218 bits (554),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 117/208 (56%), Positives = 156/208 (75%), Gaps = 12/208 (6%)
 Frame = -3

Query  797  SILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSSE  618
            S+L+Q+GI +L N   EN    +P+ST NF S    DYPL+  + T  C+DESG++  S+
Sbjct  711  SLLMQDGIPSLHN---ENSSSTIPYSTSNFLSPSQDDYPLSQTLTTPGCLDESGYVPCSD  767

Query  617  NVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQL  438
            N DQ   P+ TFVKV+KSG+ GR LDI++FSSYHELRSE+ R+FGLEG LEDP RSGWQL
Sbjct  768  NADQVKRPHATFVKVYKSGTVGRLLDITRFSSYHELRSEVGRLFGLEGQLEDPLRSGWQL  827

Query  437  VFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPNG  258
            VFVDRE+DVLL+GDDPWQEFVN+V  IKILSP EV QMGK  GI+L      + +RL   
Sbjct  828  VFVDREDDVLLVGDDPWQEFVNSVSCIKILSPQEVQQMGK-PGIEL---FSTSARRL---  880

Query  257  GSSCEVHVSQKETRNMN-GIP-LGSLDY  180
            G+SC+ ++S++E+R+++ GI  +GS+++
Sbjct  881  GNSCDNYMSRQESRSLSTGIASVGSVEF  908



>ref|XP_009115165.1| PREDICTED: auxin response factor 6 isoform X2 [Brassica rapa]
Length=903

 Score =   217 bits (553),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 129/218 (59%), Positives = 158/218 (72%), Gaps = 15/218 (7%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENG-FLNMPFSTCNFTSGVGTDYPLNPDMGT-SSCVDESGFLQ  627
            SS+L+ NG+SNL++ G E G    +PF+T NF +        N  M T SSC+DE GFLQ
Sbjct  690  SSLLMPNGMSNLRSIGIEGGDSTTLPFTTSNFNNDFSGG---NLAMTTPSSCLDEPGFLQ  746

Query  626  SSENVDQANP-PNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERS  450
            SSEN+   N   N TFVKV+KSGSFGRSLDI+KFSSYHELRSELARMFGLEG LEDP RS
Sbjct  747  SSENLGSENQQSNNTFVKVYKSGSFGRSLDITKFSSYHELRSELARMFGLEGQLEDPVRS  806

Query  449  GWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAAN--  276
            GWQLVFVDRENDVLLLGDDPW EFV++VW IKILSP EV QMGK  G++L N+ P ++  
Sbjct  807  GWQLVFVDRENDVLLLGDDPWPEFVSSVWCIKILSPQEVQQMGK-RGLELLNSAPPSSNN  865

Query  275  ---QRLPNGGSSCEVHVSQKETRNM-NGIPL--GSLDY  180
               ++LP+   +C+   ++ + RN+ NGI    GS +Y
Sbjct  866  NVVEKLPSNNGNCDDFGNRSDPRNLGNGIASVGGSFNY  903



>ref|XP_009393314.1| PREDICTED: auxin response factor 17-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009393315.1| PREDICTED: auxin response factor 17-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009393316.1| PREDICTED: auxin response factor 17-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009393317.1| PREDICTED: auxin response factor 17-like [Musa acuminata subsp. 
malaccensis]
Length=909

 Score =   217 bits (552),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 116/209 (56%), Positives = 153/209 (73%), Gaps = 7/209 (3%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSS  621
            SS+L+QNG+++L N G E+    M +   NF      D+ L+  +  S  ++E+GFLQSS
Sbjct  706  SSLLMQNGMTSLCNVGRESDSTGMHYDASNFVGSSVHDFALSQALTGSGGLEETGFLQSS  765

Query  620  ENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQ  441
            +N DQ N    TFVKV KSGSFGRSLDI++FSSY+ELRSEL RMFGLEG LEDP RSGWQ
Sbjct  766  QNADQLNQKGGTFVKVSKSGSFGRSLDITRFSSYNELRSELGRMFGLEGQLEDPLRSGWQ  825

Query  440  LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPN  261
            LVFVDREND+LL+GDDPWQEFVNNVW IKILSP EV QMGK + ++  N+   + + LP 
Sbjct  826  LVFVDRENDILLVGDDPWQEFVNNVWCIKILSPQEVQQMGKHD-VNFLNS--GSIKMLPT  882

Query  260  GGSSCEVHVSQKETRNMNG--IPLGSLDY  180
             G  C+ ++S++++RN++     +GSL++
Sbjct  883  NG--CDDYISRQDSRNLSTRVASMGSLEH  909



>ref|XP_009115164.1| PREDICTED: auxin response factor 6 isoform X1 [Brassica rapa]
Length=905

 Score =   217 bits (552),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 129/218 (59%), Positives = 158/218 (72%), Gaps = 15/218 (7%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENG-FLNMPFSTCNFTSGVGTDYPLNPDMGT-SSCVDESGFLQ  627
            SS+L+ NG+SNL++ G E G    +PF+T NF +        N  M T SSC+DE GFLQ
Sbjct  692  SSLLMPNGMSNLRSIGIEGGDSTTLPFTTSNFNNDFSGG---NLAMTTPSSCLDEPGFLQ  748

Query  626  SSENVDQANP-PNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERS  450
            SSEN+   N   N TFVKV+KSGSFGRSLDI+KFSSYHELRSELARMFGLEG LEDP RS
Sbjct  749  SSENLGSENQQSNNTFVKVYKSGSFGRSLDITKFSSYHELRSELARMFGLEGQLEDPVRS  808

Query  449  GWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAAN--  276
            GWQLVFVDRENDVLLLGDDPW EFV++VW IKILSP EV QMGK  G++L N+ P ++  
Sbjct  809  GWQLVFVDRENDVLLLGDDPWPEFVSSVWCIKILSPQEVQQMGK-RGLELLNSAPPSSNN  867

Query  275  ---QRLPNGGSSCEVHVSQKETRNM-NGIPL--GSLDY  180
               ++LP+   +C+   ++ + RN+ NGI    GS +Y
Sbjct  868  NVVEKLPSNNGNCDDFGNRSDPRNLGNGIASVGGSFNY  905



>ref|XP_004485979.1| PREDICTED: auxin response factor 6-like [Cicer arietinum]
Length=908

 Score =   216 bits (551),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 124/212 (58%), Positives = 155/212 (73%), Gaps = 12/212 (6%)
 Frame = -3

Query  800  SSILLQNGISNLKN-SGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQS  624
            SS+L+ NG+SN K  SGG +    MP+ + N+ +  G D  LN   G +S + +SGFL++
Sbjct  704  SSLLMHNGMSNFKGISGGNSDSSTMPYQSSNYMNTAGNDSSLN--HGVTSSIGDSGFLRT  761

Query  623  SENVDQAN--PPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERS  450
             EN  Q N  P N TFVKV+K+GS+GRSLDI+ FSSYHELR ELARMFGLEG LEDP RS
Sbjct  762  PENAQQGNNNPLNETFVKVYKAGSYGRSLDITNFSSYHELRGELARMFGLEGELEDPVRS  821

Query  449  GWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQR  270
            GWQLVFVDRENDVLLLGD PW EFV++VW IKILSP EV QMG   G+ L N++P   QR
Sbjct  822  GWQLVFVDRENDVLLLGDGPWPEFVSSVWCIKILSPEEVQQMGN-TGLGLLNSVPI--QR  878

Query  269  LPNGGSSCEVHVSQKETRNM-NGI-PLGSLDY  180
            L NG   C+ +VS+++ R++ +GI  +GSLDY
Sbjct  879  LSNG--ICDGYVSRQDPRSLSSGITTVGSLDY  908



>sp|A2YG67.1|ARFQ_ORYSI RecName: Full=Auxin response factor 17 [Oryza sativa Indica Group]
 gb|EAZ02078.1| hypothetical protein OsI_24158 [Oryza sativa Indica Group]
Length=917

 Score =   215 bits (547),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 117/209 (56%), Positives = 159/209 (76%), Gaps = 13/209 (6%)
 Frame = -3

Query  797  SILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSSE  618
            S+L+Q GI +L+   GEN    +P+ST NF S +  D+PL+  + ++ C+DESG++  S+
Sbjct  719  SLLMQGGIPSLQ---GENDSTAIPYSTSNFLSPLQNDFPLDQTLSSADCLDESGYVPCSQ  775

Query  617  NVDQA-NPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQ  441
            N DQ  N P  TFVKV+KSG++GRSLDI++FSSYHELR EL R+FGLEG LE+P RSGWQ
Sbjct  776  NSDQVINRPPATFVKVYKSGTYGRSLDITRFSSYHELRRELGRLFGLEGQLENPLRSGWQ  835

Query  440  LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPN  261
            LVFVDRE+DVLL+GDDPWQEFVN+V  IKILSP EV QMGK    +L ++ P   +RL  
Sbjct  836  LVFVDREDDVLLVGDDPWQEFVNSVSCIKILSPQEVQQMGKP--FELLSSAPG--KRL--  889

Query  260  GGSSCEVHVSQKETRNMN-GIP-LGSLDY  180
             GSSC+ +VS++E+R+++ GI  +GS+++
Sbjct  890  -GSSCDDYVSRQESRSLSTGIASVGSVEF  917



>ref|XP_003563403.1| PREDICTED: auxin response factor 17 [Brachypodium distachyon]
Length=907

 Score =   215 bits (547),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 115/208 (55%), Positives = 157/208 (75%), Gaps = 11/208 (5%)
 Frame = -3

Query  797  SILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSSE  618
            S+L+Q GI +L +   EN    +P+ST NF S    D+ L+  + +  C+DESG++  S 
Sbjct  709  SLLMQGGIPSLHD---ENDSTTIPYSTSNFLSPSQNDFSLDQTLNSPGCLDESGYVPCSH  765

Query  617  NVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQL  438
            N +Q N P  TFVKV+KSG++GRSLDI++FSSYHELR EL R+FGLEG LEDP RSGWQL
Sbjct  766  NPNQGNQPPATFVKVYKSGTYGRSLDITRFSSYHELRRELGRLFGLEGQLEDPLRSGWQL  825

Query  437  VFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPNG  258
            VFVDRE DVLL+GDDPWQEFVN+V+ IKILSP EV QMGK +G++L ++ P+  +RL   
Sbjct  826  VFVDREEDVLLVGDDPWQEFVNSVFCIKILSPQEVQQMGK-QGLELLSSAPS--KRL---  879

Query  257  GSSCEVHVSQKETRNMN-GIP-LGSLDY  180
            GSSC+ + S++E+R+++ GI  +GS+++
Sbjct  880  GSSCDDYASRQESRSLSTGIASVGSVEF  907



>gb|ADG43156.1| auxin response factor 22 [Zea mays]
Length=925

 Score =   215 bits (547),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 117/209 (56%), Positives = 158/209 (76%), Gaps = 11/209 (5%)
 Frame = -3

Query  797  SILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQ-SS  621
            S+L++ GI  L+N    N    +P+ST NF S    D+PL+  + +S C+D+SG++   S
Sbjct  725  SLLMEGGIHGLQNG---NDSTAIPYSTSNFLSPSQNDFPLDHTLNSSGCLDDSGYVPPCS  781

Query  620  ENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQ  441
            +N DQ N P  TFVKV+KSG++GRSLDI++FSSYHELR EL R+FGLEG LEDP RSGWQ
Sbjct  782  DNSDQVNRPPATFVKVYKSGTYGRSLDITRFSSYHELRRELGRLFGLEGQLEDPLRSGWQ  841

Query  440  LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPN  261
            LVFVDRE DVLL+GDDPWQEF + V  IKILSP EV QMGK +G++L ++ PAA +RL  
Sbjct  842  LVFVDREEDVLLVGDDPWQEFASTVSCIKILSPQEVQQMGK-QGLELLSSAPAA-RRL--  897

Query  260  GGSSCEVHVSQKETRNMN-GIP-LGSLDY  180
             GSSC+ +VS++E+R+++ GI  +GS+++
Sbjct  898  -GSSCDGYVSRQESRSLSTGIASVGSVEF  925



>ref|NP_001292755.1| ADP-ribosylation factor 6 [Amborella trichopoda]
 emb|CBA11994.1| putative auxin response factor 6 [Amborella trichopoda]
Length=914

 Score =   214 bits (546),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 119/210 (57%), Positives = 154/210 (73%), Gaps = 11/210 (5%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGE-NGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQS  624
            SS+++QNG+S L+  GG+ +    + ++  NF    GTD+ LNP M  S C++ESGFL S
Sbjct  713  SSLMMQNGVSALRGLGGDIDPSAALSYAASNFLGNTGTDF-LNPGMAGSGCLNESGFLPS  771

Query  623  SENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGW  444
             ENV Q NP N  FVKV KSGSFGRSL+I++FSSY ELRSELARMFGLEG LEDP RSGW
Sbjct  772  PENVGQINPQN--FVKVCKSGSFGRSLEITRFSSYLELRSELARMFGLEGQLEDPLRSGW  829

Query  443  QLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLP  264
            QL+++DR+NDVLLLGDDPW +FV N   IKILSP E+ QMGK +GI+L   +P   Q+  
Sbjct  830  QLIYIDRDNDVLLLGDDPWPDFVKNASCIKILSPQELQQMGK-QGIELLRTVPMQRQQ--  886

Query  263  NGGSSCEVHVSQKETRNM-NGIP-LGSLDY  180
               S C+ +VS++++RN+ NGI  +G L+Y
Sbjct  887  --SSICDDYVSRQDSRNLSNGIASVGPLEY  914



>gb|AFW68989.1| hypothetical protein ZEAMMB73_088581 [Zea mays]
 gb|AIB04307.1| ARF transcription factor, partial [Zea mays]
Length=739

 Score =   213 bits (543),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 113/198 (57%), Positives = 150/198 (76%), Gaps = 10/198 (5%)
 Frame = -3

Query  797  SILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQ-SS  621
            S+L+Q GI  L+N    N    +P+ST NF S    D+PL+  + +S C+D+SG++   S
Sbjct  539  SLLMQGGIPGLQNG---NDSAAIPYSTSNFLSPSQNDFPLDHTLNSSGCLDDSGYVPPCS  595

Query  620  ENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQ  441
            +N D+ N P  TFVKV+KSG++GRSLDI++FSSYHELR EL R+FGLEG LEDP RSGWQ
Sbjct  596  DNSDKVNRPPATFVKVYKSGTYGRSLDITRFSSYHELRRELGRLFGLEGQLEDPLRSGWQ  655

Query  440  LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPN  261
            LVFVDRE DVLL+GDDPWQEFV+ V  IKILSP EV QMGK +G++L ++ PA  +RL  
Sbjct  656  LVFVDREEDVLLVGDDPWQEFVSTVSCIKILSPQEVQQMGK-QGLELLSSAPA--RRL--  710

Query  260  GGSSCEVHVSQKETRNMN  207
             GSSC+ +VS++E+R+++
Sbjct  711  -GSSCDDYVSRQESRSLS  727



>ref|XP_006656378.1| PREDICTED: auxin response factor 17-like [Oryza brachyantha]
Length=916

 Score =   214 bits (545),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 117/209 (56%), Positives = 158/209 (76%), Gaps = 13/209 (6%)
 Frame = -3

Query  797  SILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSSE  618
            S+L+Q GI +L+   GEN    +P+ST NF S    D+PL+  + ++ C+DESG++  S+
Sbjct  718  SLLMQGGIPSLQ---GENDSTAIPYSTSNFLSPSQNDFPLDQTLNSADCLDESGYVPCSQ  774

Query  617  NVDQA-NPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQ  441
            N DQ  N P  TFVKV+KSG++GRSLDI++FSSYHELR EL R+FGLEG LE+P RSGWQ
Sbjct  775  NSDQVINRPPATFVKVYKSGTYGRSLDITRFSSYHELRRELGRLFGLEGQLENPLRSGWQ  834

Query  440  LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPN  261
            LVFVDRE+DVLL+GDDPWQEFVN+V  IKILSP EV QMGK    +L ++ P   +RL  
Sbjct  835  LVFVDREDDVLLVGDDPWQEFVNSVSCIKILSPQEVQQMGKP--FELLSSAPG--KRL--  888

Query  260  GGSSCEVHVSQKETRNMN-GIP-LGSLDY  180
             GSSC+ +VS++E+R+++ GI  +GS+++
Sbjct  889  -GSSCDDYVSRQESRSLSTGIASVGSVEF  916



>gb|KJB33384.1| hypothetical protein B456_006G008700 [Gossypium raimondii]
Length=856

 Score =   214 bits (544),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 101/139 (73%), Positives = 117/139 (84%), Gaps = 0/139 (0%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSS  621
            SS++L +G++N K+   EN  +++P++  NFTS  GTD+PLN DM  SSCVDESG+LQSS
Sbjct  694  SSLMLHHGMTNPKSIRNENDSMSLPYAASNFTSASGTDFPLNSDMTASSCVDESGYLQSS  753

Query  620  ENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQ  441
            ENVDQ NPP  TFVKVHKSGSFGRSLDISKF SY ELR ELAR+FGLE  LEDP+RSGWQ
Sbjct  754  ENVDQVNPPTGTFVKVHKSGSFGRSLDISKFGSYDELRCELARLFGLERQLEDPQRSGWQ  813

Query  440  LVFVDRENDVLLLGDDPWQ  384
            LVFVDREND+LLLGDDPWQ
Sbjct  814  LVFVDRENDILLLGDDPWQ  832



>ref|NP_001058360.1| Os06g0677800 [Oryza sativa Japonica Group]
 sp|Q653U3.1|ARFQ_ORYSJ RecName: Full=Auxin response factor 17 [Oryza sativa Japonica 
Group]
 dbj|BAD45527.1| putative auxin response factor [Oryza sativa Japonica Group]
 dbj|BAD45924.1| putative auxin response factor [Oryza sativa Japonica Group]
 dbj|BAF20274.1| Os06g0677800 [Oryza sativa Japonica Group]
Length=917

 Score =   214 bits (544),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 117/209 (56%), Positives = 158/209 (76%), Gaps = 13/209 (6%)
 Frame = -3

Query  797  SILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSSE  618
            S+L+Q GI +L+   GEN    +P+ST NF S    D+PL+  + ++ C+DESG++  S+
Sbjct  719  SLLMQGGIPSLQ---GENDSTAIPYSTSNFLSPSQNDFPLDQTLSSADCLDESGYVPCSQ  775

Query  617  NVDQA-NPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQ  441
            N DQ  N P  TFVKV+KSG++GRSLDI++FSSYHELR EL R+FGLEG LE+P RSGWQ
Sbjct  776  NSDQVINRPPATFVKVYKSGTYGRSLDITRFSSYHELRRELGRLFGLEGQLENPLRSGWQ  835

Query  440  LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPN  261
            LVFVDRE+DVLL+GDDPWQEFVN+V  IKILSP EV QMGK    +L ++ P   +RL  
Sbjct  836  LVFVDREDDVLLVGDDPWQEFVNSVSCIKILSPQEVQQMGKP--FELLSSAPG--KRL--  889

Query  260  GGSSCEVHVSQKETRNMN-GIP-LGSLDY  180
             GSSC+ +VS++E+R+++ GI  +GS+++
Sbjct  890  -GSSCDDYVSRQESRSLSTGIASVGSVEF  917



>ref|XP_003593869.1| Auxin response factor [Medicago truncatula]
 gb|AES64120.1| auxin response factor 2 [Medicago truncatula]
Length=908

 Score =   214 bits (544),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 128/212 (60%), Positives = 156/212 (74%), Gaps = 12/212 (6%)
 Frame = -3

Query  800  SSILLQNGISNLKN-SGGENGFLNMPF-STCNFTSGVGTDYPLNPDMGTSSCVDESGFLQ  627
            SS+LL NG+SN K  SG  N    M +  + ++ +  G D  LN   G +  + ESGFL 
Sbjct  704  SSLLLHNGMSNFKGISGNNNDSSTMSYHQSSSYMNTAGADSSLN--HGVTPSIGESGFLH  761

Query  626  SSENVDQANPP-NRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERS  450
            + EN +Q N P N+TFVKV+KSGSFGRSLDI+KFSSY+ELRSELARMFGLEG LEDP RS
Sbjct  762  TQENGEQGNNPLNKTFVKVYKSGSFGRSLDITKFSSYNELRSELARMFGLEGELEDPVRS  821

Query  449  GWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQR  270
            GWQLVFVDRENDVLLLGD PW EFVN+VW IKILSP EV QMG   G+ L N++P   QR
Sbjct  822  GWQLVFVDRENDVLLLGDGPWPEFVNSVWCIKILSPEEVQQMGN-TGLGLLNSVPI--QR  878

Query  269  LPNGGSSCEVHVSQKETRNM-NGI-PLGSLDY  180
            L N  S C+ +VS++++RN+ +GI  +GSLDY
Sbjct  879  LSN--SICDDYVSRQDSRNLSSGITTVGSLDY  908



>gb|KEH20527.1| auxin response factor 2 [Medicago truncatula]
Length=832

 Score =   213 bits (542),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 121/209 (58%), Positives = 147/209 (70%), Gaps = 9/209 (4%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSS  621
            SS L+ N +SNLK           PF +  + +  G D  LNP  G +  V ESGF+Q+ 
Sbjct  631  SSHLVYNEMSNLKRVNSNCDSSTAPFQSSTYLNTTGADSSLNP--GLTHGVGESGFMQTP  688

Query  620  ENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQ  441
            EN  Q NP N+TFVKV+KSGSFGRSLDI+KFS+Y ELRSELARMFGLEG LEDP RSGWQ
Sbjct  689  ENGGQGNPQNKTFVKVYKSGSFGRSLDITKFSNYPELRSELARMFGLEGELEDPVRSGWQ  748

Query  440  LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPN  261
            LVFVD+ENDVLLLGD PW EFVN+VW IKILSP EV QMG   G++L N+ P   QRL N
Sbjct  749  LVFVDQENDVLLLGDGPWPEFVNSVWCIKILSPQEVQQMGT-NGLELLNSAPT--QRLSN  805

Query  260  GGSSCEVHVSQKETRNMNG--IPLGSLDY  180
            G   C+ +  ++++RN++     +GSLDY
Sbjct  806  G--ICDDYTGREDSRNLSTGLTTVGSLDY  832



>ref|XP_008644237.1| PREDICTED: uncharacterized protein LOC100502480 isoform X1 [Zea 
mays]
 ref|XP_008644238.1| PREDICTED: uncharacterized protein LOC100502480 isoform X1 [Zea 
mays]
Length=913

 Score =   213 bits (543),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 113/198 (57%), Positives = 150/198 (76%), Gaps = 10/198 (5%)
 Frame = -3

Query  797  SILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQ-SS  621
            S+L+Q GI  L+N    N    +P+ST NF S    D+PL+  + +S C+D+SG++   S
Sbjct  713  SLLMQGGIPGLQNG---NDSAAIPYSTSNFLSPSQNDFPLDHTLNSSGCLDDSGYVPPCS  769

Query  620  ENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQ  441
            +N D+ N P  TFVKV+KSG++GRSLDI++FSSYHELR EL R+FGLEG LEDP RSGWQ
Sbjct  770  DNSDKVNRPPATFVKVYKSGTYGRSLDITRFSSYHELRRELGRLFGLEGQLEDPLRSGWQ  829

Query  440  LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPN  261
            LVFVDRE DVLL+GDDPWQEFV+ V  IKILSP EV QMGK +G++L ++ PA  +RL  
Sbjct  830  LVFVDREEDVLLVGDDPWQEFVSTVSCIKILSPQEVQQMGK-QGLELLSSAPA--RRL--  884

Query  260  GGSSCEVHVSQKETRNMN  207
             GSSC+ +VS++E+R+++
Sbjct  885  -GSSCDDYVSRQESRSLS  901



>gb|KEH20526.1| auxin response factor 2 [Medicago truncatula]
Length=915

 Score =   213 bits (542),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 121/209 (58%), Positives = 147/209 (70%), Gaps = 9/209 (4%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSS  621
            SS L+ N +SNLK           PF +  + +  G D  LNP  G +  V ESGF+Q+ 
Sbjct  714  SSHLVYNEMSNLKRVNSNCDSSTAPFQSSTYLNTTGADSSLNP--GLTHGVGESGFMQTP  771

Query  620  ENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQ  441
            EN  Q NP N+TFVKV+KSGSFGRSLDI+KFS+Y ELRSELARMFGLEG LEDP RSGWQ
Sbjct  772  ENGGQGNPQNKTFVKVYKSGSFGRSLDITKFSNYPELRSELARMFGLEGELEDPVRSGWQ  831

Query  440  LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPN  261
            LVFVD+ENDVLLLGD PW EFVN+VW IKILSP EV QMG   G++L N+ P   QRL N
Sbjct  832  LVFVDQENDVLLLGDGPWPEFVNSVWCIKILSPQEVQQMGT-NGLELLNSAPT--QRLSN  888

Query  260  GGSSCEVHVSQKETRNMNG--IPLGSLDY  180
            G   C+ +  ++++RN++     +GSLDY
Sbjct  889  G--ICDDYTGREDSRNLSTGLTTVGSLDY  915



>gb|KEH20525.1| auxin response factor 2 [Medicago truncatula]
Length=914

 Score =   213 bits (542),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 121/209 (58%), Positives = 147/209 (70%), Gaps = 9/209 (4%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSS  621
            SS L+ N +SNLK           PF +  + +  G D  LNP  G +  V ESGF+Q+ 
Sbjct  713  SSHLVYNEMSNLKRVNSNCDSSTAPFQSSTYLNTTGADSSLNP--GLTHGVGESGFMQTP  770

Query  620  ENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQ  441
            EN  Q NP N+TFVKV+KSGSFGRSLDI+KFS+Y ELRSELARMFGLEG LEDP RSGWQ
Sbjct  771  ENGGQGNPQNKTFVKVYKSGSFGRSLDITKFSNYPELRSELARMFGLEGELEDPVRSGWQ  830

Query  440  LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPN  261
            LVFVD+ENDVLLLGD PW EFVN+VW IKILSP EV QMG   G++L N+ P   QRL N
Sbjct  831  LVFVDQENDVLLLGDGPWPEFVNSVWCIKILSPQEVQQMGT-NGLELLNSAPT--QRLSN  887

Query  260  GGSSCEVHVSQKETRNMNG--IPLGSLDY  180
            G   C+ +  ++++RN++     +GSLDY
Sbjct  888  G--ICDDYTGREDSRNLSTGLTTVGSLDY  914



>ref|XP_002438851.1| hypothetical protein SORBIDRAFT_10g027220 [Sorghum bicolor]
 gb|EER90218.1| hypothetical protein SORBIDRAFT_10g027220 [Sorghum bicolor]
Length=919

 Score =   212 bits (539),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 117/209 (56%), Positives = 157/209 (75%), Gaps = 12/209 (6%)
 Frame = -3

Query  797  SILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQ-SS  621
            S+L+Q GI  L+N    N    +P+ST NF S    D+PL+  + +  C+D+SG++   S
Sbjct  720  SLLMQGGIPGLQNG---NDSTAIPYSTSNFLSPSQNDFPLDHTLNSPGCLDDSGYVPPCS  776

Query  620  ENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQ  441
            +N DQ N P  TFVKV+KSG++GRSLDI++FSSYHELR EL R+FGLEG LEDP RSGWQ
Sbjct  777  DNSDQVNRPPATFVKVYKSGTYGRSLDITRFSSYHELRRELGRLFGLEGQLEDPLRSGWQ  836

Query  440  LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPN  261
            LVFVDRE DVLL+GDDPWQEFV+ V  IKILSP EV QMGK +G++L ++ PA  +RL  
Sbjct  837  LVFVDREEDVLLVGDDPWQEFVSTVSCIKILSPQEVQQMGK-QGLELLSSGPA--RRL--  891

Query  260  GGSSCEVHVSQKETRNMN-GIP-LGSLDY  180
             GSSC+ +VS++E+R+++ GI  +GS+++
Sbjct  892  -GSSCDDYVSRQESRSLSTGIASVGSVEF  919



>ref|XP_002451599.1| hypothetical protein SORBIDRAFT_04g004430 [Sorghum bicolor]
 gb|EES04575.1| hypothetical protein SORBIDRAFT_04g004430 [Sorghum bicolor]
Length=911

 Score =   212 bits (539),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 114/208 (55%), Positives = 153/208 (74%), Gaps = 11/208 (5%)
 Frame = -3

Query  797  SILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSSE  618
            S+L+Q GI +L+N   +N    +P+ST NF S    D+PLN  + ++ C+DESG+   +E
Sbjct  713  SLLMQGGIPSLQN---DNSSGTIPYSTSNFLSSSQNDFPLNQSLHSAGCLDESGYAPCAE  769

Query  617  NVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQL  438
            N +QAN    TFVKV+KSG+ GR LDI++FSSY ELRSE+ R+FGLEG LEDP RSGWQL
Sbjct  770  NSEQANQQFATFVKVYKSGNVGRLLDITRFSSYDELRSEVGRLFGLEGQLEDPLRSGWQL  829

Query  437  VFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPNG  258
            VFVDRE+DVLL+GDDPWQEFVN+V  IKILSP EV QMGK  GI L ++ P+  +RL NG
Sbjct  830  VFVDREDDVLLVGDDPWQEFVNSVSCIKILSPEEVQQMGK-PGIQLLSSAPS--RRLSNG  886

Query  257  GSSCEVHVSQKETRNMNG--IPLGSLDY  180
               C+ + S +E+R+++    P+GS+++
Sbjct  887  ---CDSYASMQESRSLSTGMAPVGSVEF  911



>gb|ADG43152.1| auxin response factor 18 [Zea mays]
Length=913

 Score =   211 bits (538),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 112/198 (57%), Positives = 150/198 (76%), Gaps = 10/198 (5%)
 Frame = -3

Query  797  SILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQ-SS  621
            S+L+Q GI  L+N    N    +P+ST NF S    D+PL+  + +S C+D+SG++   S
Sbjct  713  SLLMQGGIPGLQNG---NDSAAIPYSTSNFLSPSQNDFPLDHTLNSSGCLDDSGYVPPCS  769

Query  620  ENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQ  441
            +N D+ N P  TFVKV+KSG++GRSLDI++FSSYHELR EL R+FGLEG LEDP RSGWQ
Sbjct  770  DNSDKVNRPPATFVKVYKSGTYGRSLDITRFSSYHELRRELGRLFGLEGQLEDPLRSGWQ  829

Query  440  LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPN  261
            LVFV+RE DVLL+GDDPWQEFV+ V  IKILSP EV QMGK +G++L ++ PA  +RL  
Sbjct  830  LVFVNREEDVLLVGDDPWQEFVSTVSCIKILSPQEVQQMGK-QGLELLSSAPA--RRL--  884

Query  260  GGSSCEVHVSQKETRNMN  207
             GSSC+ +VS++E+R+++
Sbjct  885  -GSSCDDYVSRQESRSLS  901



>ref|XP_006580853.1| PREDICTED: auxin response factor 6-like [Glycine max]
Length=877

 Score =   211 bits (538),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 121/209 (58%), Positives = 152/209 (73%), Gaps = 9/209 (4%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSS  621
            SS+L+ NG+S+LK     +    +PF + N+ +    D  LNP  G +  + ESGFLQ+ 
Sbjct  676  SSLLMHNGMSSLKGVSSNSDSPTIPFQSSNYLNTTVPDSSLNP--GMTHNIGESGFLQTP  733

Query  620  ENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQ  441
            EN  Q NP N+TFVKV+KSGSFGRSLDI+KF+SY ELRSELARMFGLEG LEDP RSGWQ
Sbjct  734  ENGGQGNPTNKTFVKVYKSGSFGRSLDITKFTSYPELRSELARMFGLEGELEDPVRSGWQ  793

Query  440  LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPN  261
            LVFVD+ENDVLLLGD PW EFVN+V  IKILSP EV QMG   G++L N++P   QRL N
Sbjct  794  LVFVDQENDVLLLGDGPWPEFVNSVGCIKILSPQEVQQMGN-NGLELLNSVPI--QRLSN  850

Query  260  GGSSCEVHVSQKETRNMN-GIPL-GSLDY  180
            G   C+ +  +++ RN++ GI + GSL+Y
Sbjct  851  G--VCDDYAGREDPRNLSTGITIVGSLNY  877



>gb|KHN12428.1| Auxin response factor 6 [Glycine soja]
Length=904

 Score =   211 bits (538),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 123/209 (59%), Positives = 151/209 (72%), Gaps = 15/209 (7%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSS  621
            SS+L+ NG+S+LK     +    +PF + N+ +  G D  LNP  G +  + E+GFLQ+ 
Sbjct  709  SSLLMHNGMSSLKGVSSNSDSPTIPFQSSNYLNTTGPDSSLNP--GMTHNIGETGFLQTP  766

Query  620  ENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQ  441
            EN  Q NP N+TFVKV+KSGSFGRSLDI+KF+SY ELRSELARMFGLEG LEDP RSGWQ
Sbjct  767  ENGGQGNPSNKTFVKVYKSGSFGRSLDITKFTSYPELRSELARMFGLEGELEDPVRSGWQ  826

Query  440  LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPN  261
            LVFVD+ENDVLLLGD PW EFVN+V YIKILSP EV QMG  E ++L N++P   QRL N
Sbjct  827  LVFVDQENDVLLLGDGPWPEFVNSVGYIKILSPQEVQQMGNNE-LELLNSVPI--QRLSN  883

Query  260  GGSSCEVHVSQKETRNMN-GI-PLGSLDY  180
            G   CE      + RN++ GI  +GSL+Y
Sbjct  884  G--VCE------DPRNLSTGITTVGSLNY  904



>ref|XP_006585093.1| PREDICTED: auxin response factor 6-like isoform X2 [Glycine max]
Length=905

 Score =   211 bits (538),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 123/209 (59%), Positives = 151/209 (72%), Gaps = 15/209 (7%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSS  621
            SS+L+ NG+S+LK     +    +PF + N+ +  G D  LNP  G +  + E+GFLQ+ 
Sbjct  710  SSLLMHNGMSSLKGVSSNSDSPTIPFQSSNYLNTTGPDSSLNP--GMTHNIGETGFLQTP  767

Query  620  ENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQ  441
            EN  Q NP N+TFVKV+KSGSFGRSLDI+KF+SY ELRSELARMFGLEG LEDP RSGWQ
Sbjct  768  ENGGQGNPSNKTFVKVYKSGSFGRSLDITKFTSYPELRSELARMFGLEGELEDPVRSGWQ  827

Query  440  LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPN  261
            LVFVD+ENDVLLLGD PW EFVN+V YIKILSP EV QMG  E ++L N++P   QRL N
Sbjct  828  LVFVDQENDVLLLGDGPWPEFVNSVGYIKILSPQEVQQMGNNE-LELLNSVPI--QRLSN  884

Query  260  GGSSCEVHVSQKETRNMN-GI-PLGSLDY  180
            G   CE      + RN++ GI  +GSL+Y
Sbjct  885  G--VCE------DPRNLSTGITTVGSLNY  905



>ref|XP_003531170.1| PREDICTED: auxin response factor 6-like isoform X1 [Glycine max]
Length=904

 Score =   211 bits (538),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 123/209 (59%), Positives = 151/209 (72%), Gaps = 15/209 (7%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSS  621
            SS+L+ NG+S+LK     +    +PF + N+ +  G D  LNP  G +  + E+GFLQ+ 
Sbjct  709  SSLLMHNGMSSLKGVSSNSDSPTIPFQSSNYLNTTGPDSSLNP--GMTHNIGETGFLQTP  766

Query  620  ENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQ  441
            EN  Q NP N+TFVKV+KSGSFGRSLDI+KF+SY ELRSELARMFGLEG LEDP RSGWQ
Sbjct  767  ENGGQGNPSNKTFVKVYKSGSFGRSLDITKFTSYPELRSELARMFGLEGELEDPVRSGWQ  826

Query  440  LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPN  261
            LVFVD+ENDVLLLGD PW EFVN+V YIKILSP EV QMG  E ++L N++P   QRL N
Sbjct  827  LVFVDQENDVLLLGDGPWPEFVNSVGYIKILSPQEVQQMGNNE-LELLNSVPI--QRLSN  883

Query  260  GGSSCEVHVSQKETRNMN-GI-PLGSLDY  180
            G   CE      + RN++ GI  +GSL+Y
Sbjct  884  G--VCE------DPRNLSTGITTVGSLNY  904



>gb|KHN46047.1| Auxin response factor 6 [Glycine soja]
Length=909

 Score =   211 bits (537),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 121/209 (58%), Positives = 152/209 (73%), Gaps = 9/209 (4%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSS  621
            SS+L+ NG+S+LK     +    +PF + N+ +    D  LNP  G +  + ESGFLQ+ 
Sbjct  708  SSLLMHNGMSSLKGVSSNSDSPTIPFQSSNYLNTTVPDSSLNP--GMTHNIGESGFLQTP  765

Query  620  ENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQ  441
            EN  Q NP N+TFVKV+KSGSFGRSLDI+KF+SY ELRSELARMFGLEG LEDP RSGWQ
Sbjct  766  ENGGQGNPTNKTFVKVYKSGSFGRSLDITKFTSYPELRSELARMFGLEGELEDPVRSGWQ  825

Query  440  LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPN  261
            LVFVD+ENDVLLLGD PW EFVN+V  IKILSP EV QMG   G++L N++P   QRL N
Sbjct  826  LVFVDQENDVLLLGDGPWPEFVNSVGCIKILSPQEVQQMGN-NGLELLNSVPI--QRLSN  882

Query  260  GGSSCEVHVSQKETRNMN-GIPL-GSLDY  180
            G   C+ +  +++ RN++ GI + GSL+Y
Sbjct  883  G--VCDDYAGREDPRNLSTGITIVGSLNY  909



>ref|XP_007158734.1| hypothetical protein PHAVU_002G177600g [Phaseolus vulgaris]
 gb|ESW30728.1| hypothetical protein PHAVU_002G177600g [Phaseolus vulgaris]
Length=913

 Score =   211 bits (536),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 118/209 (56%), Positives = 153/209 (73%), Gaps = 9/209 (4%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSS  621
            SS+L+ NG+S+LK     +G   +PF + N+ +  GTD  +NP  G +  + E+GFLQ+ 
Sbjct  712  SSLLMHNGLSSLKGVSSNSGPPTIPFQSSNYLNTTGTDSSMNP--GMTHNIGEAGFLQTP  769

Query  620  ENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQ  441
            EN  Q NP  +TFVKV+KSGSFGRSLDI+KF++YHELR ELARMFGLEG LEDP RSGWQ
Sbjct  770  ENGGQGNPSIKTFVKVYKSGSFGRSLDITKFTNYHELRGELARMFGLEGELEDPVRSGWQ  829

Query  440  LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPN  261
            LVFVD+ENDVLLLGD PW EFVN+V  IKILSP EV QMG   G++L N++P   QRL +
Sbjct  830  LVFVDQENDVLLLGDGPWPEFVNSVGCIKILSPQEVQQMGN-NGLELLNSVPI--QRLSS  886

Query  260  GGSSCEVHVSQKETRNMN-GI-PLGSLDY  180
            G   C+ +   ++ R+++ GI  +GSL+Y
Sbjct  887  G--VCDDYAGHEDPRSISTGITTVGSLNY  913



>gb|AAN16891.1| auxin-responsive factor protein [Mirabilis jalapa]
Length=137

 Score =   194 bits (494),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 95/135 (70%), Positives = 108/135 (80%), Gaps = 0/135 (0%)
 Frame = -3

Query  737  LNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSSENVDQANPPNRTFVKVHKSGS  558
            L++PF    F S +G + P   +M T+SC+DESG+LQS ENVDQ N P RTFVKVHK GS
Sbjct  3    LSIPFVGSTFRSAIGNELPPGSEMSTTSCIDESGYLQSIENVDQTNQPTRTFVKVHKMGS  62

Query  557  FGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEF  378
            FGRSLDIS+FSSY ELRSELAR+FGLE  L+D  RSG QLVFVDRENDVLLLGDDPWQEF
Sbjct  63   FGRSLDISQFSSYQELRSELARLFGLENELKDSPRSGSQLVFVDRENDVLLLGDDPWQEF  122

Query  377  VNNVWYIKILSPFEV  333
            V  V +I+ILSP EV
Sbjct  123  VKTVGHIRILSPQEV  137



>ref|XP_009402570.1| PREDICTED: auxin response factor 6-like isoform X1 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009402571.1| PREDICTED: auxin response factor 6-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=902

 Score =   210 bits (535),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 112/209 (54%), Positives = 150/209 (72%), Gaps = 7/209 (3%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSS  621
            SS+L+QNG+SNL +   E   +NM ++  N     G D+ LN     S+ ++  G LQ+ 
Sbjct  699  SSLLVQNGMSNLGHLSNETDSMNMHYAASNLVGSSGNDFGLNQAFTVSNGLEPPGLLQAP  758

Query  620  ENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQ  441
             N+D  N  + TFVKV+KSGS GRSLDI+KFSSYHELRSEL R+FGLEG LEDP RSGWQ
Sbjct  759  GNMDSLNQSSGTFVKVYKSGSCGRSLDITKFSSYHELRSELGRLFGLEGQLEDPLRSGWQ  818

Query  440  LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPN  261
            LVFVDREND+LL+GDDPWQEFVNNVW IKIL   EV QMGK    D  N   A ++RLP+
Sbjct  819  LVFVDRENDILLVGDDPWQEFVNNVWCIKILMRQEVQQMGKPSA-DFLNT--AHSKRLPS  875

Query  260  GGSSCEVHVSQKETRNMNGIP--LGSLDY  180
              +SC+ +++++++R+++ +   +G+L+Y
Sbjct  876  --NSCDEYITRQDSRSLSTVTASVGTLEY  902



>ref|XP_009402572.1| PREDICTED: auxin response factor 6-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=900

 Score =   210 bits (535),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 112/209 (54%), Positives = 150/209 (72%), Gaps = 7/209 (3%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSS  621
            SS+L+QNG+SNL +   E   +NM ++  N     G D+ LN     S+ ++  G LQ+ 
Sbjct  697  SSLLVQNGMSNLGHLSNETDSMNMHYAASNLVGSSGNDFGLNQAFTVSNGLEPPGLLQAP  756

Query  620  ENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQ  441
             N+D  N  + TFVKV+KSGS GRSLDI+KFSSYHELRSEL R+FGLEG LEDP RSGWQ
Sbjct  757  GNMDSLNQSSGTFVKVYKSGSCGRSLDITKFSSYHELRSELGRLFGLEGQLEDPLRSGWQ  816

Query  440  LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPN  261
            LVFVDREND+LL+GDDPWQEFVNNVW IKIL   EV QMGK    D  N   A ++RLP+
Sbjct  817  LVFVDRENDILLVGDDPWQEFVNNVWCIKILMRQEVQQMGKPSA-DFLNT--AHSKRLPS  873

Query  260  GGSSCEVHVSQKETRNMNGIP--LGSLDY  180
              +SC+ +++++++R+++ +   +G+L+Y
Sbjct  874  --NSCDEYITRQDSRSLSTVTASVGTLEY  900



>ref|XP_006646917.1| PREDICTED: auxin response factor 6-like [Oryza brachyantha]
Length=916

 Score =   210 bits (534),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 115/208 (55%), Positives = 152/208 (73%), Gaps = 12/208 (6%)
 Frame = -3

Query  797  SILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSSE  618
            S+L+Q+GI NL N   +N    +P+ST NF S    DYPLN  + T  C+DE  +   S+
Sbjct  719  SLLMQDGIPNLHN---DNDSSTIPYSTSNFLSPSQNDYPLNQTLTTPGCLDEPEYGSCSD  775

Query  617  NVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQL  438
            N DQ   P  TFVKV+KSG+ GR LDI++FSSYHELRSE+ R+FGLEG LEDP RSGWQL
Sbjct  776  NADQVKRPPATFVKVYKSGTVGRLLDITRFSSYHELRSEVGRLFGLEGQLEDPLRSGWQL  835

Query  437  VFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPNG  258
            VFVDRE+DVLL+GDDPWQEFVN+V  IKILSP EV QMGK  GI+L      + +RL   
Sbjct  836  VFVDREDDVLLVGDDPWQEFVNSVSCIKILSPQEVQQMGK-PGIEL---FSTSARRL---  888

Query  257  GSSCEVHVSQKETRNMN-GIP-LGSLDY  180
            G+SC+ +++++E+R+++ GI  +GS+++
Sbjct  889  GNSCDNYMNRQESRSLSTGIASVGSVEF  916



>gb|EMS51666.1| Auxin response factor 17 [Triticum urartu]
Length=857

 Score =   209 bits (533),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 109/197 (55%), Positives = 143/197 (73%), Gaps = 7/197 (4%)
 Frame = -3

Query  797  SILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSSE  618
            S+L+Q G+ +      EN    +P+ST NF S    D+ L+  + +S C+DESG++  S 
Sbjct  655  SLLMQGGLHD------ENDSTAIPYSTSNFLSPSQHDFSLDQTLNSSGCLDESGYVPCSH  708

Query  617  NVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQL  438
              DQ N P  TFVKV+KSG++GRSLDI+KFS+YHELR EL R+FGLEG LEDP RSGWQL
Sbjct  709  TPDQVNQPPATFVKVYKSGTYGRSLDITKFSNYHELRRELGRLFGLEGQLEDPMRSGWQL  768

Query  437  VFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPNG  258
            VFVDRE DVLL+GDDPWQEFVN+V  IKILSP EV QMGK +G++L ++ P        G
Sbjct  769  VFVDREEDVLLVGDDPWQEFVNSVSCIKILSPQEVQQMGK-QGLELLSSAPGKRLGGGGG  827

Query  257  GSSCEVHVSQKETRNMN  207
            GSSC+ + S++E+R+++
Sbjct  828  GSSCDDYASRQESRSLS  844



>ref|XP_004504542.1| PREDICTED: auxin response factor 6-like isoform X1 [Cicer arietinum]
Length=918

 Score =   209 bits (533),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 120/209 (57%), Positives = 145/209 (69%), Gaps = 9/209 (4%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSS  621
            SS L+ N + NLK           PF +  + +  G D  LNP  G +  + ES FLQ+ 
Sbjct  717  SSHLVYNEMPNLKRVNSNCDSSTAPFQSSTYLNTAGADSSLNP--GMTHGIGESDFLQTP  774

Query  620  ENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQ  441
            EN  Q N PNRTFVKV+KSGSFGRSLDI+KFS+YHELRSELARMFGLE  LEDP RSGWQ
Sbjct  775  ENGGQGNQPNRTFVKVYKSGSFGRSLDITKFSNYHELRSELARMFGLERELEDPVRSGWQ  834

Query  440  LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPN  261
            LVFVD+ENDVLLLGD PW EFVN+VW IKILSP EV QMG   G++L N+  A NQR  N
Sbjct  835  LVFVDQENDVLLLGDGPWPEFVNSVWCIKILSPQEVQQMGN-NGLELLNS--AQNQRHSN  891

Query  260  GGSSCEVHVSQKETRNMNG--IPLGSLDY  180
            G   C+ +  ++++RN++     +GSLDY
Sbjct  892  G--ICDDYTGREDSRNLSTGLATVGSLDY  918



>ref|XP_004504543.1| PREDICTED: auxin response factor 6-like isoform X2 [Cicer arietinum]
Length=917

 Score =   209 bits (533),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 120/209 (57%), Positives = 145/209 (69%), Gaps = 9/209 (4%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSS  621
            SS L+ N + NLK           PF +  + +  G D  LNP  G +  + ES FLQ+ 
Sbjct  716  SSHLVYNEMPNLKRVNSNCDSSTAPFQSSTYLNTAGADSSLNP--GMTHGIGESDFLQTP  773

Query  620  ENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQ  441
            EN  Q N PNRTFVKV+KSGSFGRSLDI+KFS+YHELRSELARMFGLE  LEDP RSGWQ
Sbjct  774  ENGGQGNQPNRTFVKVYKSGSFGRSLDITKFSNYHELRSELARMFGLERELEDPVRSGWQ  833

Query  440  LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPN  261
            LVFVD+ENDVLLLGD PW EFVN+VW IKILSP EV QMG   G++L N+  A NQR  N
Sbjct  834  LVFVDQENDVLLLGDGPWPEFVNSVWCIKILSPQEVQQMGN-NGLELLNS--AQNQRHSN  890

Query  260  GGSSCEVHVSQKETRNMNG--IPLGSLDY  180
            G   C+ +  ++++RN++     +GSLDY
Sbjct  891  G--ICDDYTGREDSRNLSTGLATVGSLDY  917



>ref|XP_004966207.1| PREDICTED: auxin response factor 17-like [Setaria italica]
Length=913

 Score =   209 bits (532),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 114/208 (55%), Positives = 155/208 (75%), Gaps = 10/208 (5%)
 Frame = -3

Query  797  SILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSSE  618
            S+L+Q GI  L+N    N    +P+ST NF S    D+ L+  + +S C+D++G++  S+
Sbjct  714  SLLMQGGIPGLQNG---NDSTAIPYSTSNFLSPSQNDFSLDHTLNSSGCLDDAGYVPCSD  770

Query  617  NVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQL  438
            N DQ N    TFVKV+KSG++GRSLDI++FSSYHELR EL R+FGLEG LEDP RSGWQL
Sbjct  771  NSDQVNRLPATFVKVYKSGTYGRSLDITRFSSYHELRRELGRLFGLEGQLEDPMRSGWQL  830

Query  437  VFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPNG  258
            VFVDRE DVLL+GDDPWQEFV+ V  IKILSP EV QMGK +G++L ++  A  +RL   
Sbjct  831  VFVDREEDVLLVGDDPWQEFVSTVSCIKILSPQEVQQMGK-QGLELLSSA-APARRL---  885

Query  257  GSSCEVHVSQKETRNMN-GIP-LGSLDY  180
            GSSC+ +VS++E+R+++ GI  +GS+++
Sbjct  886  GSSCDDYVSRQESRSLSTGIASVGSVEF  913



>emb|CBA11997.1| putative auxin response factor 6, partial [Cabomba aquatica]
Length=856

 Score =   208 bits (529),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 120/212 (57%), Positives = 148/212 (70%), Gaps = 9/212 (4%)
 Frame = -3

Query  803  DSSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSS-C-VDESGFL  630
            DSS L+QNG + +  S  +N          N  +      PLN  MG+SS C +DE+GFL
Sbjct  650  DSSQLMQNGPTPIGASSNDNTQTAFSCGGSNHLTAPRAYLPLNSSMGSSSGCFMDENGFL  709

Query  629  QSSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERS  450
             S ++V   +PP+RTFVKVHK GS+GRSLDI+ FSSYHELRSELA MFGLEG LEDP RS
Sbjct  710  TSPDDVGLVDPPDRTFVKVHKLGSYGRSLDITNFSSYHELRSELASMFGLEGQLEDPLRS  769

Query  449  GWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQR  270
            GWQLVFVDRENDVLLLGDDPWQEFVNNVW IKILSP EV QMG+++ + L +++    Q 
Sbjct  770  GWQLVFVDRENDVLLLGDDPWQEFVNNVWCIKILSPQEVQQMGRQD-LALLHSISLQRQ-  827

Query  269  LPNGGSSCEVHVSQKETRN-MNGIP-LGSLDY  180
                 S+C+   +Q+ +RN  +GI  + SLDY
Sbjct  828  ---DSSTCDDFANQQNSRNPSSGITSVESLDY  856



>ref|XP_008679931.1| PREDICTED: auxin response factor 6 isoform X3 [Zea mays]
Length=847

 Score =   207 bits (527),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 113/208 (54%), Positives = 150/208 (72%), Gaps = 11/208 (5%)
 Frame = -3

Query  797  SILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSSE  618
            S+L+Q GI  L+N   +N    +P+ST NF S    D+PLN  + ++ C+DES +L  +E
Sbjct  649  SLLMQGGIPALQN---DNSSGTIPYSTSNFLSPSENDFPLNQPLRSAGCLDESDYLPCAE  705

Query  617  NVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQL  438
            N +QAN    TFVKV+KSG+ GR LDI++FSSY ELRSE+ R+FGLEG LEDP RSGWQL
Sbjct  706  NAEQANQQFATFVKVYKSGTVGRLLDITRFSSYDELRSEVGRLFGLEGQLEDPLRSGWQL  765

Query  437  VFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPNG  258
            VFVDRE+DVLL+GDDPWQEFVN+V  IKILSP EV +MGK  GI L ++ P+  +RL NG
Sbjct  766  VFVDREDDVLLVGDDPWQEFVNSVSCIKILSPEEVQRMGK-PGIQLLSSAPS--RRLGNG  822

Query  257  GSSCEVHVSQKETRNMNG--IPLGSLDY  180
               C+ + S +E R ++    P+GS+++
Sbjct  823  ---CDSYASMQEPRGLDAGMAPVGSVEF  847



>ref|XP_008679929.1| PREDICTED: auxin response factor 6 isoform X2 [Zea mays]
Length=913

 Score =   207 bits (528),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 113/208 (54%), Positives = 150/208 (72%), Gaps = 11/208 (5%)
 Frame = -3

Query  797  SILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSSE  618
            S+L+Q GI  L+N   +N    +P+ST NF S    D+PLN  + ++ C+DES +L  +E
Sbjct  715  SLLMQGGIPALQN---DNSSGTIPYSTSNFLSPSENDFPLNQPLRSAGCLDESDYLPCAE  771

Query  617  NVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQL  438
            N +QAN    TFVKV+KSG+ GR LDI++FSSY ELRSE+ R+FGLEG LEDP RSGWQL
Sbjct  772  NAEQANQQFATFVKVYKSGTVGRLLDITRFSSYDELRSEVGRLFGLEGQLEDPLRSGWQL  831

Query  437  VFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPNG  258
            VFVDRE+DVLL+GDDPWQEFVN+V  IKILSP EV +MGK  GI L ++ P+  +RL NG
Sbjct  832  VFVDREDDVLLVGDDPWQEFVNSVSCIKILSPEEVQRMGK-PGIQLLSSAPS--RRLGNG  888

Query  257  GSSCEVHVSQKETRNMNG--IPLGSLDY  180
               C+ + S +E R ++    P+GS+++
Sbjct  889  ---CDSYASMQEPRGLDAGMAPVGSVEF  913



>gb|ADG43150.1| auxin response factor 16 [Zea mays]
Length=905

 Score =   207 bits (528),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 113/208 (54%), Positives = 150/208 (72%), Gaps = 11/208 (5%)
 Frame = -3

Query  797  SILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSSE  618
            S+L+Q GI  L+N   +N    +P+ST NF S    D+PLN  + ++ C+DES +L  +E
Sbjct  707  SLLMQGGIPALQN---DNSSGTIPYSTSNFLSPSENDFPLNQPLRSAGCLDESDYLPCAE  763

Query  617  NVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQL  438
            N +QAN    TFVKV+KSG+ GR LDI++FSSY ELRSE+ R+FGLEG LEDP RSGWQL
Sbjct  764  NAEQANQQFATFVKVYKSGTVGRLLDITRFSSYDELRSEVGRLFGLEGQLEDPLRSGWQL  823

Query  437  VFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPNG  258
            VFVDRE+DVLL+GDDPWQEFVN+V  IKILSP EV +MGK  GI L ++ P+  +RL NG
Sbjct  824  VFVDREDDVLLVGDDPWQEFVNSVSCIKILSPEEVQRMGK-PGIQLLSSAPS--RRLGNG  880

Query  257  GSSCEVHVSQKETRNMNG--IPLGSLDY  180
               C+ + S +E R ++    P+GS+++
Sbjct  881  ---CDSYASMQEPRGLDAGMAPVGSVEF  905



>ref|XP_008679928.1| PREDICTED: auxin response factor 6 isoform X1 [Zea mays]
 gb|AFW66421.1| hypothetical protein ZEAMMB73_859793 [Zea mays]
 gb|AIB05231.1| ARF transcription factor, partial [Zea mays]
Length=914

 Score =   207 bits (528),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 113/208 (54%), Positives = 150/208 (72%), Gaps = 11/208 (5%)
 Frame = -3

Query  797  SILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSSE  618
            S+L+Q GI  L+N   +N    +P+ST NF S    D+PLN  + ++ C+DES +L  +E
Sbjct  716  SLLMQGGIPALQN---DNSSGTIPYSTSNFLSPSENDFPLNQPLRSAGCLDESDYLPCAE  772

Query  617  NVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQL  438
            N +QAN    TFVKV+KSG+ GR LDI++FSSY ELRSE+ R+FGLEG LEDP RSGWQL
Sbjct  773  NAEQANQQFATFVKVYKSGTVGRLLDITRFSSYDELRSEVGRLFGLEGQLEDPLRSGWQL  832

Query  437  VFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPNG  258
            VFVDRE+DVLL+GDDPWQEFVN+V  IKILSP EV +MGK  GI L ++ P+  +RL NG
Sbjct  833  VFVDREDDVLLVGDDPWQEFVNSVSCIKILSPEEVQRMGK-PGIQLLSSAPS--RRLGNG  889

Query  257  GSSCEVHVSQKETRNMNG--IPLGSLDY  180
               C+ + S +E R ++    P+GS+++
Sbjct  890  ---CDSYASMQEPRGLDAGMAPVGSVEF  914



>gb|KDO75361.1| hypothetical protein CISIN_1g002624mg [Citrus sinensis]
Length=834

 Score =   206 bits (524),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 98/138 (71%), Positives = 114/138 (83%), Gaps = 0/138 (0%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSS  621
            SS+L+QN +S+L   G  +    +PF++ N+ S  G D+ +NP++  SSC+DESGFLQS 
Sbjct  696  SSLLMQNEMSSLGGVGSNSDSTTIPFASSNYMSTAGADFSVNPEIAPSSCIDESGFLQSP  755

Query  620  ENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQ  441
            ENV Q NPPNRTFVKV+KSGSFGRSLDI+KFSSYHELRSELARMFGLEG LEDP RSGWQ
Sbjct  756  ENVGQVNPPNRTFVKVYKSGSFGRSLDITKFSSYHELRSELARMFGLEGHLEDPLRSGWQ  815

Query  440  LVFVDRENDVLLLGDDPW  387
            LVFVDRENDVLLLGD PW
Sbjct  816  LVFVDRENDVLLLGDGPW  833



>ref|XP_004951871.1| PREDICTED: auxin response factor 6-like isoform X1 [Setaria italica]
Length=907

 Score =   204 bits (520),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 112/208 (54%), Positives = 153/208 (74%), Gaps = 11/208 (5%)
 Frame = -3

Query  797  SILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSSE  618
            S+L+Q GI   +N   +N    +P+ST NF S    D+PL   + ++ C+DES ++ S+E
Sbjct  709  SLLMQGGIPGHQN---DNDSSTIPYSTSNFLSPSQNDFPLGQPLPSTGCLDESSYVPSAE  765

Query  617  NVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQL  438
            N +QAN    TFVKV+KSG+ GR LDI++FSSY ELRSE+ R+FGLEG LEDP RSGWQL
Sbjct  766  NSEQANQQFATFVKVYKSGTVGRLLDITRFSSYDELRSEVGRLFGLEGQLEDPLRSGWQL  825

Query  437  VFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPNG  258
            VFVD E+DVLL+GDDPWQEFVN+V  IKILS  EV QMGK +GI+L ++ PA  +RL NG
Sbjct  826  VFVDGEDDVLLVGDDPWQEFVNSVSCIKILSLEEVQQMGK-QGIELLSSAPA--RRLSNG  882

Query  257  GSSCEVHVSQKETRNMNG--IPLGSLDY  180
               C+ +VS++E++N++    P+GS+++
Sbjct  883  ---CDSYVSRQESKNLSTGMTPVGSVEF  907



>ref|XP_004951872.1| PREDICTED: auxin response factor 6-like isoform X2 [Setaria italica]
Length=872

 Score =   204 bits (519),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 112/208 (54%), Positives = 153/208 (74%), Gaps = 11/208 (5%)
 Frame = -3

Query  797  SILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSSE  618
            S+L+Q GI   +N   +N    +P+ST NF S    D+PL   + ++ C+DES ++ S+E
Sbjct  674  SLLMQGGIPGHQN---DNDSSTIPYSTSNFLSPSQNDFPLGQPLPSTGCLDESSYVPSAE  730

Query  617  NVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQL  438
            N +QAN    TFVKV+KSG+ GR LDI++FSSY ELRSE+ R+FGLEG LEDP RSGWQL
Sbjct  731  NSEQANQQFATFVKVYKSGTVGRLLDITRFSSYDELRSEVGRLFGLEGQLEDPLRSGWQL  790

Query  437  VFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPNG  258
            VFVD E+DVLL+GDDPWQEFVN+V  IKILS  EV QMGK +GI+L ++ PA  +RL NG
Sbjct  791  VFVDGEDDVLLVGDDPWQEFVNSVSCIKILSLEEVQQMGK-QGIELLSSAPA--RRLSNG  847

Query  257  GSSCEVHVSQKETRNMNG--IPLGSLDY  180
               C+ +VS++E++N++    P+GS+++
Sbjct  848  ---CDSYVSRQESKNLSTGMTPVGSVEF  872



>emb|CDY12048.1| BnaC03g59640D [Brassica napus]
Length=847

 Score =   204 bits (518),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 124/216 (57%), Positives = 155/216 (72%), Gaps = 24/216 (11%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENG-FLNMPFSTCNFT---SGVGTDYPLNPDMGTSSCVDESGF  633
            SS+L+ NG+SNL++ G E G    +PF++  F    SG  T          SSC++E GF
Sbjct  647  SSLLIPNGMSNLRSIGIEGGDSTTLPFTSSTFNNEFSGTMTT--------PSSCIEEQGF  698

Query  632  LQSSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPER  453
            LQ SEN  Q+N    TFVKVHKSGSFGRSLDI+KFSSY+ELRSELARMFGLEG LEDP R
Sbjct  699  LQPSEN-QQSN----TFVKVHKSGSFGRSLDITKFSSYNELRSELARMFGLEGQLEDPVR  753

Query  452  SGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAAN-  276
            SGWQLVFVDRENDVLLLGDDPW EFV++VW IKILSP EV QMGK  G++L N+ P++  
Sbjct  754  SGWQLVFVDRENDVLLLGDDPWPEFVSSVWCIKILSPQEVQQMGK-RGLELLNSAPSSTN  812

Query  275  -QRLPNGGSSCEVHVSQKETRNM-NGIPL--GSLDY  180
              ++P+ G +C+   ++ + R++ NGI    GS +Y
Sbjct  813  VDKVPSNG-NCDDLGNRSDPRSLGNGIASVGGSFNY  847



>gb|KJB57193.1| hypothetical protein B456_009G152700 [Gossypium raimondii]
 gb|KJB57196.1| hypothetical protein B456_009G152700 [Gossypium raimondii]
 gb|KJB57197.1| hypothetical protein B456_009G152700 [Gossypium raimondii]
Length=755

 Score =   202 bits (515),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 101/138 (73%), Positives = 115/138 (83%), Gaps = 1/138 (1%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSS  621
            SS+LLQNG+S+L+  G E+    +PFS+ N+ S  GTD+ +NP M  SSC++E GFLQS 
Sbjct  618  SSLLLQNGMSSLRGVGSESDSTTIPFSS-NYASTAGTDFSVNPAMTPSSCIEELGFLQSP  676

Query  620  ENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQ  441
            ENV Q NP  RTFVKV+KSGSFGRSLDISKFSSY+ELRSELARMFGLEG LEDP RSGWQ
Sbjct  677  ENVGQENPQTRTFVKVYKSGSFGRSLDISKFSSYNELRSELARMFGLEGQLEDPLRSGWQ  736

Query  440  LVFVDRENDVLLLGDDPW  387
            LVFVDRENDVLLLGDDPW
Sbjct  737  LVFVDRENDVLLLGDDPW  754



>gb|EMT11111.1| Auxin response factor 17 [Aegilops tauschii]
Length=858

 Score =   203 bits (517),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 111/198 (56%), Positives = 146/198 (74%), Gaps = 10/198 (5%)
 Frame = -3

Query  797  SILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSSE  618
            S+L+Q G+ +      EN    +P+ST NF S    D+ L+  + +S C+DESG++  S 
Sbjct  657  SLLMQGGLHD------ENDSTAIPYSTSNFLSPSQHDFSLDQTLNSSGCLDESGYVPCSH  710

Query  617  NVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQL  438
              DQ N P  TFVKV+KSG++GRSLDI+KFS+YHELR EL R+FGLEG LEDP RSGWQL
Sbjct  711  TPDQVNQPPATFVKVYKSGTYGRSLDITKFSNYHELRRELGRLFGLEGQLEDPMRSGWQL  770

Query  437  VFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRL-PN  261
            VFVDRE DVLL+GDDPWQEFVN+V  IKILSP EV QMGK +G++L ++ P   +RL   
Sbjct  771  VFVDREEDVLLVGDDPWQEFVNSVSCIKILSPQEVQQMGK-QGLELLSSAPG--KRLGGG  827

Query  260  GGSSCEVHVSQKETRNMN  207
            GGSSC+ + S++E+R+++
Sbjct  828  GGSSCDDYASRQESRSLS  845



>gb|EPS59345.1| auxin response factor 3, partial [Genlisea aurea]
Length=624

 Score =   201 bits (510),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 103/149 (69%), Positives = 121/149 (81%), Gaps = 5/149 (3%)
 Frame = -3

Query  758  SGGENGFLNMPFSTCNFTSGVGTDYPLN--PDMGTSSCVDESGFLQSSEN-VDQANPPNR  588
            S  E+G  +M F   ++ SG G D  LN  P + +S+C+DES F+ SSEN ++QA P + 
Sbjct  469  SNSESG--SMAFPGSSYVSGFGADCSLNFNPKVSSSTCIDESDFILSSENNLEQAAPLDS  526

Query  587  TFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVL  408
            TFVKV+KSGSFGRSLDI+KFSSYHELRS+LARMFGLEG LEDP RSGWQLVFVDRENDVL
Sbjct  527  TFVKVYKSGSFGRSLDITKFSSYHELRSQLARMFGLEGQLEDPLRSGWQLVFVDRENDVL  586

Query  407  LLGDDPWQEFVNNVWYIKILSPFEVHQMG  321
            LLGDDPW+EFVN+VW IKILSP EV +MG
Sbjct  587  LLGDDPWEEFVNSVWCIKILSPQEVQEMG  615



>emb|CDX90245.1| BnaA08g17390D [Brassica napus]
Length=852

 Score =   202 bits (514),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 123/216 (57%), Positives = 156/216 (72%), Gaps = 24/216 (11%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENG-FLNMPFSTCNFT---SGVGTDYPLNPDMGTSSCVDESGF  633
            SS+L+ NG+SNL++ G E G    +PF++  F    SG  T          SSC++E GF
Sbjct  652  SSLLIPNGMSNLRSIGIEGGDSTTLPFTSSTFNNEFSGTMTT--------PSSCIEEPGF  703

Query  632  LQSSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPER  453
            LQ SEN  Q+N    TFVKV+KSGSFGRSLDI+KFSSY+ELRSELARMFGLEG LEDP R
Sbjct  704  LQPSEN-QQSN----TFVKVYKSGSFGRSLDITKFSSYNELRSELARMFGLEGQLEDPVR  758

Query  452  SGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAAN-  276
            SGWQLVFVDRENDVLLLGDDPW EFV++VW IKILSP EV QMGK  G++L N+ P+++ 
Sbjct  759  SGWQLVFVDRENDVLLLGDDPWPEFVSSVWCIKILSPQEVQQMGK-RGLELLNSAPSSDN  817

Query  275  -QRLPNGGSSCEVHVSQKETRNM-NGIPL--GSLDY  180
              ++P+ G +C+   ++ + R++ NGI    GS +Y
Sbjct  818  VDKVPSNG-NCDDFGNRSDPRSLGNGIASVGGSFNY  852



>gb|EYU19157.1| hypothetical protein MIMGU_mgv1a001449mg [Erythranthe guttata]
Length=818

 Score =   201 bits (510),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 121/213 (57%), Positives = 159/213 (75%), Gaps = 20/213 (9%)
 Frame = -3

Query  806  TDSSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSS-CVDESGFL  630
            + SS+L+QN  + + N+       +M F++ ++   + +DY +NP + TSS C+DESGFL
Sbjct  622  SSSSLLMQNS-NEIDNA-------SMGFASSSY---MHSDYSMNPAVTTSSGCIDESGFL  670

Query  629  QSSENVDQANPPN-RTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPER  453
             SS+N      P  RTFVKV+KSGSFGRSLDI+KFSSYHELRSEL++MFGLEG LE P R
Sbjct  671  LSSDNNAGNANPPNRTFVKVYKSGSFGRSLDITKFSSYHELRSELSKMFGLEGQLEGPLR  730

Query  452  SGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQ  273
            SGWQLVFVDRENDVLLLGDDPWQEFVN+VW IKILSP E+  MGK  G++L N++   N+
Sbjct  731  SGWQLVFVDRENDVLLLGDDPWQEFVNSVWCIKILSPQEIQDMGK-RGLELLNSV--HNR  787

Query  272  RLPNGGSSCEVHVSQKETRNMN-GIP-LGSLDY  180
            +  NG  SC+ +  Q+E+RN++ GIP +G+L +
Sbjct  788  QRSNG--SCDSYGGQQESRNISAGIPSVGTLHF  818



>gb|ERM99180.1| hypothetical protein AMTR_s00092p00072950 [Amborella trichopoda]
Length=986

 Score =   201 bits (512),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 107/178 (60%), Positives = 133/178 (75%), Gaps = 5/178 (3%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGE-NGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQS  624
            SS+++QNG+S L+  GG+ +    + ++  NF    GTD+ LNP M  S C++ESGFL S
Sbjct  713  SSLMMQNGVSALRGLGGDTDPSAALSYAASNFLGNPGTDF-LNPGMAGSGCLNESGFLPS  771

Query  623  SENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGW  444
             ENV Q NP N  FVKV KSGSFGRSL+I++FSSY ELRSELARMFGLEG LEDP RSGW
Sbjct  772  PENVGQINPQN--FVKVCKSGSFGRSLEITRFSSYLELRSELARMFGLEGQLEDPLRSGW  829

Query  443  QLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQR  270
            QL+++DR+NDVLLLGDDPW +FV N   IKILSP E+ QMGK +GI+L   +P   Q+
Sbjct  830  QLIYIDRDNDVLLLGDDPWPDFVKNASCIKILSPQELQQMGK-QGIELLRTVPMQRQQ  886



>ref|XP_009109594.1| PREDICTED: auxin response factor 6-like [Brassica rapa]
Length=844

 Score =   193 bits (491),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 120/216 (56%), Positives = 153/216 (71%), Gaps = 24/216 (11%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENG-FLNMPFSTCNFT---SGVGTDYPLNPDMGTSSCVDESGF  633
            SS+L+ NG+SNL++ G E G    +PF++  F    SG  T          SSC++E GF
Sbjct  644  SSLLIPNGMSNLRSIGIEGGDSTTLPFTSSTFNNEFSGTMTT--------PSSCIEEPGF  695

Query  632  LQSSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPER  453
            LQ SEN  Q+N    TFVKV+KSGSFGRSLDI+KFSSY+ELRSELARMFGLEG LEDP R
Sbjct  696  LQPSEN-QQSN----TFVKVYKSGSFGRSLDITKFSSYNELRSELARMFGLEGQLEDPVR  750

Query  452  SGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAAN-  276
            SGWQLVFV RE  VLLLGDDPW EFV++VW IKILSP EV QMGK  G++L N+ P+++ 
Sbjct  751  SGWQLVFVGREYYVLLLGDDPWPEFVSSVWCIKILSPQEVQQMGK-RGLELLNSAPSSDN  809

Query  275  -QRLPNGGSSCEVHVSQKETRNM-NGIPL--GSLDY  180
              ++P+ G +C+   ++ + R++ NGI    GS +Y
Sbjct  810  VDKVPSNG-NCDDFGNRSDPRSLGNGIASVGGSFNY  844



>gb|ACB30835.1| ARF6, partial [Arabidopsis thaliana]
 gb|ACB30836.1| ARF6, partial [Arabidopsis thaliana]
 gb|ACB30837.1| ARF6, partial [Arabidopsis thaliana]
 gb|ACB30838.1| ARF6, partial [Arabidopsis thaliana]
 gb|ACB30839.1| ARF6, partial [Arabidopsis thaliana]
 gb|ACB30840.1| ARF6, partial [Arabidopsis thaliana]
 gb|ACB30841.1| ARF6, partial [Arabidopsis thaliana]
 gb|ACB30842.1| ARF6, partial [Arabidopsis thaliana]
 gb|ACB30843.1| ARF6, partial [Arabidopsis thaliana]
 gb|ACB30844.1| ARF6, partial [Arabidopsis thaliana]
 gb|ACB30845.1| ARF6, partial [Arabidopsis thaliana]
 gb|ACB30846.1| ARF6, partial [Arabidopsis thaliana]
 gb|ACB30847.1| ARF6, partial [Arabidopsis thaliana]
 gb|ACB30848.1| ARF6, partial [Arabidopsis thaliana]
 gb|ACB30849.1| ARF6, partial [Arabidopsis thaliana]
 gb|ACB30850.1| ARF6, partial [Arabidopsis thaliana]
 gb|ACB30852.1| ARF6, partial [Arabidopsis thaliana]
 gb|ACB30853.1| ARF6, partial [Arabidopsis thaliana]
 gb|ACB30854.1| ARF6, partial [Arabidopsis thaliana]
 gb|ACB30855.1| ARF6, partial [Arabidopsis thaliana]
 gb|ACB30856.1| ARF6, partial [Arabidopsis thaliana]
 gb|ACB30857.1| ARF6, partial [Arabidopsis thaliana]
 gb|ACB30858.1| ARF6, partial [Arabidopsis thaliana]
Length=113

 Score =   174 bits (440),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 87/108 (81%), Positives = 96/108 (89%), Gaps = 1/108 (1%)
 Frame = -3

Query  599  PPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQLVFVDRE  420
            P + TFVKV+KSGSFGRSLDISKFSSYHELRSELARMFGLEG LEDP RSGWQLVFVDRE
Sbjct  1    PQSNTFVKVYKSGSFGRSLDISKFSSYHELRSELARMFGLEGQLEDPVRSGWQLVFVDRE  60

Query  419  NDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAAN  276
            NDVLLLGDDPW EFV++VW IKILSP EV QMGK  G++L N+ P++N
Sbjct  61   NDVLLLGDDPWPEFVSSVWCIKILSPQEVQQMGK-RGLELLNSAPSSN  107



>ref|XP_010549536.1| PREDICTED: auxin response factor 6-like [Tarenaya hassleriana]
Length=805

 Score =   186 bits (473),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 106/180 (59%), Positives = 130/180 (72%), Gaps = 9/180 (5%)
 Frame = -3

Query  737  LNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSSENVDQANPPNRTFVKVHKSGS  558
            +N+  S+    SG+G +      +   S +D SGF QSSENV   NP + TFVKV+KSGS
Sbjct  624  VNIDSSSLLMQSGIGIE-----SINDFSSIDGSGFPQSSENVGFENPQSPTFVKVYKSGS  678

Query  557  FGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEF  378
            FGRSLDIS++SSY+ELRS LARMFGLEG LEDP RSGWQLVFVDRENDVLLLGDDPW EF
Sbjct  679  FGRSLDISRYSSYNELRSSLARMFGLEGQLEDPMRSGWQLVFVDRENDVLLLGDDPWLEF  738

Query  377  VNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPNGGSSCEVHVSQKETRNM-NGI  201
            +N+VW IKILSP EV +MGK  G+   ++ P+  ++L NG  +CE   +  + RN  NGI
Sbjct  739  LNSVWCIKILSPQEVQEMGK-RGLKPLSSEPSVRKKLTNG--NCEDFGNTHDPRNPGNGI  795



>gb|ACB30851.1| ARF6, partial [Arabidopsis thaliana]
Length=113

 Score =   172 bits (435),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 86/108 (80%), Positives = 96/108 (89%), Gaps = 1/108 (1%)
 Frame = -3

Query  599  PPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQLVFVDRE  420
            P + TFVKV+KSGSFGRSLDISKFSSYHELRSELARMFGLEG LE+P RSGWQLVFVDRE
Sbjct  1    PQSNTFVKVYKSGSFGRSLDISKFSSYHELRSELARMFGLEGQLENPVRSGWQLVFVDRE  60

Query  419  NDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAAN  276
            NDVLLLGDDPW EFV++VW IKILSP EV QMGK  G++L N+ P++N
Sbjct  61   NDVLLLGDDPWPEFVSSVWCIKILSPQEVQQMGK-RGLELLNSAPSSN  107



>gb|KCW75879.1| hypothetical protein EUGRSUZ_D00264 [Eucalyptus grandis]
Length=829

 Score =   184 bits (468),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 92/138 (67%), Positives = 109/138 (79%), Gaps = 1/138 (1%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSS  621
            SS+L+QNGIS+L+  G E+   +MPF + N+ S  G D+  NP +     +D+SGFLQS 
Sbjct  692  SSLLMQNGISSLRAVGSESDSTSMPFPS-NYISNSGADFAPNPSVAPPGGIDDSGFLQSP  750

Query  620  ENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQ  441
            EN++Q N P RTFVKV+KSGSFGRSLDI+KFSSY+ELRSELARMF LEG LEDP RSGWQ
Sbjct  751  ENLNQVNVPTRTFVKVYKSGSFGRSLDITKFSSYNELRSELARMFSLEGQLEDPVRSGWQ  810

Query  440  LVFVDRENDVLLLGDDPW  387
            LVFVDREND LLLGD PW
Sbjct  811  LVFVDRENDSLLLGDGPW  828



>emb|CBI27335.3| unnamed protein product [Vitis vinifera]
Length=163

 Score =   170 bits (430),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 97/160 (61%), Positives = 117/160 (73%), Gaps = 13/160 (8%)
 Frame = -3

Query  653  CV-DESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLE  477
            CV D S  LQ++  VD   P +RTFVKV+KSGS GRSLDI++FSSYHELR EL +MFG+E
Sbjct  15   CVQDPSELLQNAGQVDPPTP-SRTFVKVYKSGSVGRSLDITRFSSYHELREELGQMFGIE  73

Query  476  GLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLP  297
            G LE+P RSGWQLVFVDRENDVLLLGDDPW+ FVNNVWYIKILSP +V +MGK +GI+  
Sbjct  74   GKLENPLRSGWQLVFVDRENDVLLLGDDPWEAFVNNVWYIKILSPEDVQKMGK-QGIE-S  131

Query  296  NNLPAANQRLPNGGSSCEVHVSQKETRNMNGIP-LGSLDY  180
               P + QR+ + G+     VS        G+P  GSL+Y
Sbjct  132  GFSPNSAQRMNSSGTDDRDLVS--------GLPSAGSLEY  163



>gb|KHN39511.1| Auxin response factor 8 [Glycine soja]
Length=823

 Score =   181 bits (460),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 109/209 (52%), Positives = 131/209 (63%), Gaps = 26/209 (12%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCV-DESGFLQS  624
            S +LL   +     +  E     MP     F S      PL P      CV D S  +QS
Sbjct  639  SGLLLPTTVPRYTTASAEIDASAMPIGESGFQS------PLYP------CVQDSSELVQS  686

Query  623  SENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGW  444
            +  VD  N   RTFVKV+KSGS GRSLDIS+FSSYHELR ELA+MFG+EG LEDP RSGW
Sbjct  687  AGQVDPQNQ-TRTFVKVYKSGSVGRSLDISRFSSYHELREELAQMFGIEGKLEDPLRSGW  745

Query  443  QLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLP  264
            QLVFVDRENDVLLLGDDPW+ FVNNVWYIKILSP ++H+MG++    L    P++  RL 
Sbjct  746  QLVFVDRENDVLLLGDDPWESFVNNVWYIKILSPEDIHKMGEQAVESLG---PSSGHRLN  802

Query  263  NGGSSCEVHVSQKETRNMNGIP-LGSLDY  180
            + G+     VS        G+P +GSL+Y
Sbjct  803  STGADSHEIVS--------GLPSIGSLEY  823



>ref|NP_001170351.1| uncharacterized protein LOC100384328 [Zea mays]
 gb|ACN36719.1| unknown [Zea mays]
Length=326

 Score =   174 bits (442),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 93/164 (57%), Positives = 116/164 (71%), Gaps = 16/164 (10%)
 Frame = -3

Query  806  TDSSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDES-GFL  630
             DSS LL N + NL ++  +N     P          G+ Y  +P  G   C+D+S G L
Sbjct  169  VDSSSLLYNMVPNLTSNVADNNISAFP---------SGSTYLQSPMYG---CLDDSSGLL  216

Query  629  QSSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERS  450
            Q   N  + +P  RTFVKV+KSGS GRSLDI++FS+Y ELR EL +MFG++G L+DP+RS
Sbjct  217  Q---NTGENDPTTRTFVKVYKSGSVGRSLDITRFSNYAELREELGQMFGIKGQLDDPDRS  273

Query  449  GWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGK  318
            GWQLVFVDRENDVLLLGDDPW+ FVN+VWYIKILSP +VH+MGK
Sbjct  274  GWQLVFVDRENDVLLLGDDPWESFVNSVWYIKILSPEDVHKMGK  317



>ref|XP_006596491.1| PREDICTED: auxin response factor 8-like [Glycine max]
Length=843

 Score =   181 bits (459),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 109/209 (52%), Positives = 131/209 (63%), Gaps = 26/209 (12%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCV-DESGFLQS  624
            S +LL   +     +  E     MP     F S      PL P      CV D S  +QS
Sbjct  659  SGLLLPTTVPRYTTASAEIDASAMPIGESGFQS------PLYP------CVQDSSELVQS  706

Query  623  SENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGW  444
            +  VD  N   RTFVKV+KSGS GRSLDIS+FSSYHELR ELA+MFG+EG LEDP RSGW
Sbjct  707  AGQVDPQNQ-TRTFVKVYKSGSVGRSLDISRFSSYHELREELAQMFGIEGKLEDPLRSGW  765

Query  443  QLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLP  264
            QLVFVDRENDVLLLGDDPW+ FVNNVWYIKILSP ++H+MG++    L    P++  RL 
Sbjct  766  QLVFVDRENDVLLLGDDPWESFVNNVWYIKILSPEDIHKMGEQAVESLG---PSSGHRLN  822

Query  263  NGGSSCEVHVSQKETRNMNGIP-LGSLDY  180
            + G+     VS        G+P +GSL+Y
Sbjct  823  STGADSHEIVS--------GLPSIGSLEY  843



>ref|XP_006575467.1| PREDICTED: auxin response factor 8-like isoform X2 [Glycine max]
Length=750

 Score =   180 bits (456),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 108/209 (52%), Positives = 132/209 (63%), Gaps = 26/209 (12%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSC-VDESGFLQS  624
            S +LL   +     +  ++    MP     F S      PL P      C  D S  +QS
Sbjct  566  SGLLLPTTVPRYTTASADSDASAMPLGESGFQS------PLYP------CGQDSSELVQS  613

Query  623  SENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGW  444
            +  VD  N   RTFVKV+KSGS GRSLDIS+FSSYHELR ELA+MFG+EG LEDP RSGW
Sbjct  614  AGQVDPQNQ-TRTFVKVYKSGSVGRSLDISRFSSYHELREELAQMFGIEGKLEDPLRSGW  672

Query  443  QLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLP  264
            QLVFVDRENDVLLLGDDPW+ FVNNVWYIKILSP ++H+MG++    L +  P+  QRL 
Sbjct  673  QLVFVDRENDVLLLGDDPWESFVNNVWYIKILSPEDIHKMGEQA---LESLGPSPGQRLN  729

Query  263  NGGSSCEVHVSQKETRNMNGIP-LGSLDY  180
            + G+     VS        G+P +GSL+Y
Sbjct  730  STGADSHEIVS--------GLPSIGSLEY  750



>ref|XP_006575466.1| PREDICTED: auxin response factor 8-like isoform X1 [Glycine max]
Length=847

 Score =   180 bits (457),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 108/209 (52%), Positives = 132/209 (63%), Gaps = 26/209 (12%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSC-VDESGFLQS  624
            S +LL   +     +  ++    MP     F S      PL P      C  D S  +QS
Sbjct  663  SGLLLPTTVPRYTTASADSDASAMPLGESGFQS------PLYP------CGQDSSELVQS  710

Query  623  SENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGW  444
            +  VD  N   RTFVKV+KSGS GRSLDIS+FSSYHELR ELA+MFG+EG LEDP RSGW
Sbjct  711  AGQVDPQNQ-TRTFVKVYKSGSVGRSLDISRFSSYHELREELAQMFGIEGKLEDPLRSGW  769

Query  443  QLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLP  264
            QLVFVDRENDVLLLGDDPW+ FVNNVWYIKILSP ++H+MG++    L +  P+  QRL 
Sbjct  770  QLVFVDRENDVLLLGDDPWESFVNNVWYIKILSPEDIHKMGEQA---LESLGPSPGQRLN  826

Query  263  NGGSSCEVHVSQKETRNMNGIP-LGSLDY  180
            + G+     VS        G+P +GSL+Y
Sbjct  827  STGADSHEIVS--------GLPSIGSLEY  847



>ref|XP_010462991.1| PREDICTED: auxin response factor 6-like [Camelina sativa]
Length=795

 Score =   180 bits (456),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 100/157 (64%), Positives = 120/157 (76%), Gaps = 9/157 (6%)
 Frame = -3

Query  662  TSSCVDESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFG  483
            T+S +  SG+      VD +      FVKV+KSGSFGRSLDISKFSSYHELRSELARMFG
Sbjct  636  TNSAMTSSGWPSKRPAVDSS----FQFVKVYKSGSFGRSLDISKFSSYHELRSELARMFG  691

Query  482  LEGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGID  303
            LEG LEDP RSGWQLVFVDRENDVLLLGDDPW EFV++VW IKILSP EV QMGK  G++
Sbjct  692  LEGQLEDPVRSGWQLVFVDRENDVLLLGDDPWPEFVSSVWCIKILSPQEVQQMGK-RGLE  750

Query  302  LPNNLPAAN--QRLPNGGSSCEVHVSQKETRNM-NGI  201
            L N+ P++N   +LP+ G +C+   ++ + RN+ NGI
Sbjct  751  LLNSAPSSNNVDKLPSNG-NCDDFGNRSDPRNLGNGI  786



>ref|XP_009627655.1| PREDICTED: auxin response factor 6-like isoform X4 [Nicotiana 
tomentosiformis]
Length=842

 Score =   180 bits (457),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 90/139 (65%), Positives = 107/139 (77%), Gaps = 1/139 (1%)
 Frame = -3

Query  803  DSSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQS  624
            DS  L+Q+ + +L+    +    N+PF++ N+ S  G D+  NP M  S C++  GF Q+
Sbjct  703  DSPSLMQSDMRSLRGVVSDCESTNVPFASSNYLSNAGNDFSQNPVMALSGCINVPGFTQT  762

Query  623  SENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGW  444
            SEN  Q +P N TFVKV+KSGSFGRSLDI+KFSSYHELRSELARMFGLEGLLEDP RSGW
Sbjct  763  SENAGQESPHN-TFVKVYKSGSFGRSLDITKFSSYHELRSELARMFGLEGLLEDPLRSGW  821

Query  443  QLVFVDRENDVLLLGDDPW  387
            QLVFVDRENDVLLLGDDPW
Sbjct  822  QLVFVDRENDVLLLGDDPW  840



>emb|CBA12003.1| putative auxin response factor 6/8 [Ginkgo biloba]
Length=924

 Score =   181 bits (459),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 103/217 (47%), Positives = 141/217 (65%), Gaps = 23/217 (11%)
 Frame = -3

Query  797  SILLQNGISNLKNSG---------GENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVD  645
            S+++ + +SN +N G              LN+P  +C  TSG    +P+N  +G S  +D
Sbjct  720  SLVITDTVSNSRNIGNGAYVGSSFSVTDLLNVP--SCAPTSG----FPMNSSIGASGGLD  773

Query  644  ESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLE  465
            E+G  Q   N    NPP RTF KV+K GS GRSLD+++F+ Y ELR+EL RMFGLEG LE
Sbjct  774  ENGLSQHGANYAHINPPTRTFTKVYKLGSVGRSLDVTRFNGYQELRAELDRMFGLEGQLE  833

Query  464  DPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLP  285
            DP+RSGWQLVFVD+E DVLLLGDDPW+EFVN+V +IKILSP EV QM  +EGI L N++ 
Sbjct  834  DPQRSGWQLVFVDKEKDVLLLGDDPWEEFVNSVRFIKILSPPEVMQMS-QEGIQL-NSIR  891

Query  284  AANQRLPNGGSSCEVHVSQKETRNMNGI--PLGSLDY  180
               Q      S+ E  +++ ++ N++ +   +G L+Y
Sbjct  892  PQQQ----TSSTSEECLTRHDSHNISSVITSVGPLEY  924



>gb|KHN41019.1| Auxin response factor 8 [Glycine soja]
Length=846

 Score =   180 bits (457),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 108/209 (52%), Positives = 132/209 (63%), Gaps = 26/209 (12%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSC-VDESGFLQS  624
            S +LL   +     +  ++    MP     F S      PL P      C  D S  +QS
Sbjct  662  SGLLLPTTVPRYTTASADSDASAMPLGESGFQS------PLYP------CGQDSSELVQS  709

Query  623  SENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGW  444
            +  VD  N   RTFVKV+KSGS GRSLDIS+FSSYHELR ELA+MFG+EG LEDP RSGW
Sbjct  710  AGQVDPQNQ-TRTFVKVYKSGSVGRSLDISRFSSYHELREELAQMFGIEGKLEDPLRSGW  768

Query  443  QLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLP  264
            QLVFVDRENDVLLLGDDPW+ FVNNVWYIKILSP ++H+MG++    L +  P+  QRL 
Sbjct  769  QLVFVDRENDVLLLGDDPWESFVNNVWYIKILSPEDIHKMGEQA---LESLGPSPGQRLN  825

Query  263  NGGSSCEVHVSQKETRNMNGIP-LGSLDY  180
            + G+     VS        G+P +GSL+Y
Sbjct  826  STGADSHEIVS--------GLPSIGSLEY  846



>ref|NP_001234783.1| auxin response factor 8 [Solanum lycopersicum]
 gb|ABS83388.1| auxin response factor 8 [Solanum lycopersicum]
Length=844

 Score =   180 bits (456),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 104/209 (50%), Positives = 133/209 (64%), Gaps = 25/209 (12%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSS  621
            S +LL   +SN+  +  +    +MP  T  F           P+   S   D +  L + 
Sbjct  659  SGLLLPTTVSNVATTSIDADISSMPLGTSGF-----------PNPLYSYVQDSTDLLHNV  707

Query  620  ENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQ  441
               D    P RTFVKV+KS S GRSLDI++F+SYHELR EL +MFG+EGLLEDP+RSGWQ
Sbjct  708  GQADAQTVP-RTFVKVYKSASLGRSLDITRFNSYHELRQELGQMFGIEGLLEDPQRSGWQ  766

Query  440  LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPN  261
            LVFVDRENDVLLLGDDPW+EFVNNVWYIKILSP +V ++GKEE   L    P   +R+ +
Sbjct  767  LVFVDRENDVLLLGDDPWEEFVNNVWYIKILSPEDVQKLGKEEVGSLNRGPP---ERMSS  823

Query  260  GGSSCEVHVSQKETRN-MNGIP-LGSLDY  180
              S+        + R+ M+G+P +GSLDY
Sbjct  824  NNSA--------DGRDFMSGLPSIGSLDY  844



>ref|XP_006343313.1| PREDICTED: auxin response factor 8-like isoform X2 [Solanum tuberosum]
Length=752

 Score =   178 bits (452),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 93/172 (54%), Positives = 114/172 (66%), Gaps = 12/172 (7%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSS  621
            S +LL   +SN+  +  +    +MP  T  F++ +                D S  L + 
Sbjct  567  SGLLLPTTVSNVATTSIDADISSMPLGTSGFSNSL-----------YGYVQDSSDMLHNV  615

Query  620  ENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQ  441
              VD    P RTFVKV+KS S GRSLDI++F+SYHELR EL +MFG+EG LEDP+RSGWQ
Sbjct  616  GQVDAQTAP-RTFVKVYKSASLGRSLDITRFNSYHELRQELGQMFGIEGFLEDPQRSGWQ  674

Query  440  LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLP  285
            LVFVDRENDVLLLGDDPW+EFVNNVWYIKILSP +V ++GKEE   L   LP
Sbjct  675  LVFVDRENDVLLLGDDPWEEFVNNVWYIKILSPEDVQKLGKEEVGSLNRGLP  726



>ref|XP_010237021.1| PREDICTED: auxin response factor 25-like [Brachypodium distachyon]
Length=886

 Score =   179 bits (455),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 105/207 (51%), Positives = 137/207 (66%), Gaps = 14/207 (7%)
 Frame = -3

Query  788  LQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSSENVD  609
            L +G+S+++   G NG ++M      +    G D P    + TSSC+ ES    S +N+ 
Sbjct  690  LHDGMSSVRGGSG-NGTVSMAIPLFRYD---GEDLPPANSLATSSCLGESATFNSLDNIC  745

Query  608  QANPPNR-TFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQLVF  432
              NP    TFVKV+KSGS GRSLDI+KFSSY+ELRSEL  +FGLEG LEDP RSGWQLVF
Sbjct  746  GVNPSQGGTFVKVYKSGSPGRSLDITKFSSYYELRSELEHLFGLEGQLEDPVRSGWQLVF  805

Query  431  VDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKE-EGIDLPNNLPAANQRLPNGG  255
            VDREND+LL+GDDPWQEFVN+VW IKILSP +VHQM +  EG+     L A+  R+   G
Sbjct  806  VDRENDILLVGDDPWQEFVNSVWCIKILSPQDVHQMVRNGEGL-----LSASGARMMQ-G  859

Query  254  SSCEVHVSQKETRNMNG--IPLGSLDY  180
            + C+ + +  + +N+ G    +  LDY
Sbjct  860  NVCDDYSASHDLQNLTGNIASVPPLDY  886



>ref|XP_007141982.1| hypothetical protein PHAVU_008G242400g [Phaseolus vulgaris]
 gb|ESW13976.1| hypothetical protein PHAVU_008G242400g [Phaseolus vulgaris]
Length=844

 Score =   179 bits (453),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 106/209 (51%), Positives = 131/209 (63%), Gaps = 26/209 (12%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCV-DESGFLQS  624
            S +LL   +     +  +     MP     F + +   YP         CV D S  L+S
Sbjct  660  SGLLLPTTVPRYTTASADTDASAMPLGESGFQASL---YP---------CVQDSSELLRS  707

Query  623  SENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGW  444
            +  VD  N   RTFVKV+KSGS GRSLDIS+FSSYHELR ELA+MFG+EG LEDP RSGW
Sbjct  708  AGQVDPQNQ-TRTFVKVYKSGSVGRSLDISRFSSYHELREELAQMFGIEGKLEDPLRSGW  766

Query  443  QLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLP  264
            QLVFVDRENDVLLLGDDPW+ FVNNVWYIKILSP ++ +MG++    L    P++ QRL 
Sbjct  767  QLVFVDRENDVLLLGDDPWESFVNNVWYIKILSPEDIQKMGEQAVESLG---PSSGQRLN  823

Query  263  NGGSSCEVHVSQKETRNMNGIP-LGSLDY  180
            + G+     VS        G+P +GSL+Y
Sbjct  824  STGADSHEIVS--------GLPSIGSLEY  844



>ref|XP_002443554.1| hypothetical protein SORBIDRAFT_08g021460 [Sorghum bicolor]
 gb|EES17392.1| hypothetical protein SORBIDRAFT_08g021460 [Sorghum bicolor]
Length=895

 Score =   179 bits (454),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 107/212 (50%), Positives = 141/212 (67%), Gaps = 15/212 (7%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPD--MGTSSCVDESGFLQ  627
            SS  + +G+S +++ G  +G   +  ++  +      D  L P+  + TSSC+ ESG   
Sbjct  694  SSFAIHDGLSTVRSGGVGSGTDAITIASLRYG-----DMNLLPENSIATSSCLGESGTFN  748

Query  626  SSENVDQANPPNR-TFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERS  450
            S ++V   NP    TFVKV+KSGS GRSLDI++FSSY+ELRSEL R+FGLEG LEDP RS
Sbjct  749  SLDDVCGVNPSQGGTFVKVYKSGSLGRSLDITRFSSYYELRSELERLFGLEGQLEDPVRS  808

Query  449  GWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQR  270
            GWQLVFVDREND+LL+GDDPWQEFVN+VW IKILSP +V QM +  G DL   L A   R
Sbjct  809  GWQLVFVDRENDILLVGDDPWQEFVNSVWCIKILSPQDVQQMVRGGG-DL---LSAPGAR  864

Query  269  LPNGGSSCEVHVSQKETRNMNGI--PLGSLDY  180
            +    S C+ + +  + +N+ GI  P+  LDY
Sbjct  865  MLQ-SSVCDDYSAGHDMQNLTGIIAPVVPLDY  895



>ref|XP_006343312.1| PREDICTED: auxin response factor 8-like isoform X1 [Solanum tuberosum]
Length=848

 Score =   178 bits (452),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 93/172 (54%), Positives = 114/172 (66%), Gaps = 12/172 (7%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSS  621
            S +LL   +SN+  +  +    +MP  T  F++ +                D S  L + 
Sbjct  663  SGLLLPTTVSNVATTSIDADISSMPLGTSGFSNSL-----------YGYVQDSSDMLHNV  711

Query  620  ENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQ  441
              VD    P RTFVKV+KS S GRSLDI++F+SYHELR EL +MFG+EG LEDP+RSGWQ
Sbjct  712  GQVDAQTAP-RTFVKVYKSASLGRSLDITRFNSYHELRQELGQMFGIEGFLEDPQRSGWQ  770

Query  440  LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLP  285
            LVFVDRENDVLLLGDDPW+EFVNNVWYIKILSP +V ++GKEE   L   LP
Sbjct  771  LVFVDRENDVLLLGDDPWEEFVNNVWYIKILSPEDVQKLGKEEVGSLNRGLP  822



>gb|ABN10955.2| auxin response factor 8 [Ipomoea nil]
Length=838

 Score =   178 bits (452),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 93/157 (59%), Positives = 113/157 (72%), Gaps = 14/157 (9%)
 Frame = -3

Query  647  DESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLL  468
            D S  + S+  VD + P  RTF+KV+KSG  GRSLDI++ SSYHELR ELA+MFG+EGLL
Sbjct  695  DSSELVSSAGQVDPSTP--RTFIKVYKSGYVGRSLDITRISSYHELRQELAQMFGIEGLL  752

Query  467  EDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNL  288
            EDP+RSGWQLVFVDRENDVLLLGDDPW+ FVNNVWYIKILSP +V ++GK+E   L  N 
Sbjct  753  EDPQRSGWQLVFVDRENDVLLLGDDPWEAFVNNVWYIKILSPEDVQKLGKQEAKSLSRN-  811

Query  287  PAANQRLPNGGSSCEVHVSQKETRNMNGIP-LGSLDY  180
                +R+   G+    H+S        G P LGSL+Y
Sbjct  812  --TMERMNGSGADGRDHLS--------GFPSLGSLEY  838



>gb|AFF60411.1| auxin response factor 8 [Nicotiana tabacum]
Length=843

 Score =   178 bits (452),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 103/209 (49%), Positives = 131/209 (63%), Gaps = 26/209 (12%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSS  621
            S +LL   +SN+  +  +     MP  T  F + +                D S  L ++
Sbjct  659  SGLLLPTTVSNVSTTPIDADMSTMPLGTSGFQNSL-----------YGYVQDSSDLLHNA  707

Query  620  ENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQ  441
              VD  N   RTFVKV+KSGS GRSLDI++F+SYHELR EL +MFG+EG LEDP+RSGWQ
Sbjct  708  GQVDSLNA-TRTFVKVYKSGSVGRSLDITRFNSYHELRQELGQMFGIEGFLEDPQRSGWQ  766

Query  440  LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPN  261
            LVFVDRENDVLLLGDDPW+ FVNNVWYIKILSP +V ++GKEE   L            N
Sbjct  767  LVFVDRENDVLLLGDDPWEAFVNNVWYIKILSPEDVLKLGKEEVESL------------N  814

Query  260  GGSSCEVHVSQKETRN-MNGIP-LGSLDY  180
             GS   ++ +  + R+ M+G+P +GSLDY
Sbjct  815  RGSLERMNSNSADGRDFMSGLPSIGSLDY  843



>ref|XP_010250613.1| PREDICTED: auxin response factor 8 isoform X2 [Nelumbo nucifera]
Length=704

 Score =   177 bits (448),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 107/209 (51%), Positives = 132/209 (63%), Gaps = 28/209 (13%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSS  621
            S +LL   + NL +S  E    +MPF    F + +              C++ S  L +S
Sbjct  522  SPLLLPTSVPNLGSSSVEPDVSSMPFGGSGFQNSL------------YGCMENSSDLLNS  569

Query  620  ENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQ  441
                Q +PP RTFVKV+KSGS GRSLDIS+FSSYHELR EL +MFG+E  LEDP RSGWQ
Sbjct  570  AG--QVDPPTRTFVKVYKSGSVGRSLDISRFSSYHELREELGQMFGIEEQLEDPLRSGWQ  627

Query  440  LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPN  261
            LVFVDRENDVLLLGDDPW+ FVNNVWYIKILSP +V ++GK+E   L +N    +QR  N
Sbjct  628  LVFVDRENDVLLLGDDPWESFVNNVWYIKILSPEDVQKLGKQEVDALSSN---GDQRHSN  684

Query  260  GGSSCEVHVSQKETRNM-NGI-PLGSLDY  180
                     S  + RN  +GI  +GSL+Y
Sbjct  685  ---------SSYDVRNFTSGISSVGSLEY  704



>ref|XP_003553137.1| PREDICTED: auxin response factor 8-like [Glycine max]
 gb|KHN08745.1| Auxin response factor 8 [Glycine soja]
Length=841

 Score =   177 bits (449),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 108/211 (51%), Positives = 133/211 (63%), Gaps = 29/211 (14%)
 Frame = -3

Query  803  DSSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQS  624
            DSS LL   +     S  +     MP +   F    G+ Y          C+D S  LQS
Sbjct  657  DSSGLLPITVPGYTTSSADTNSSTMPLADSGFQ---GSLY---------GCMDSSELLQS  704

Query  623  SENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGW  444
            + +VD  N  ++TFVKV+KSGS GRSLDIS+FSSYHELR ELA+MFG+EG LEDP RSGW
Sbjct  705  AGHVDPENQ-SQTFVKVYKSGSVGRSLDISRFSSYHELREELAQMFGIEGKLEDPLRSGW  763

Query  443  QLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKE--EGIDLPNNLPAANQR  270
            QLVFVDRENDVLLLGDDPW+ FVNNVWYIKILSP ++ +MG++  E + L      + QR
Sbjct  764  QLVFVDRENDVLLLGDDPWESFVNNVWYIKILSPEDIQKMGEQAVESLAL-----GSGQR  818

Query  269  LPNGGSSCEVHVSQKETRNMNGIP-LGSLDY  180
            L   G+  +  VS        G P +GSL+Y
Sbjct  819  LNGTGAESQDIVS--------GPPSIGSLEY  841



>gb|KEH34585.1| auxin response factor 2 [Medicago truncatula]
Length=612

 Score =   176 bits (445),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 99/193 (51%), Positives = 129/193 (67%), Gaps = 19/193 (10%)
 Frame = -3

Query  737  LNMPFSTCNFTSGVGTDYPLNPDMGTS-------SCVDESGFLQSSENVDQANPPNRTFV  579
            L +P +  N+T+   TD   +  +G S       +C+ +S FLQ++E +D  N  N TFV
Sbjct  432  LLLPTTVPNYTAST-TDTGASTQLGESGFQGSLYACMQDSSFLQNAEQIDTQNQ-NPTFV  489

Query  578  KVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQLVFVDRENDVLLLG  399
            KV+KSGS GRSLDIS+FS Y ELR EL +MFG+EG LEDP RSGWQLVFVDRENDVLLLG
Sbjct  490  KVYKSGSVGRSLDISRFSCYRELREELGQMFGIEGKLEDPLRSGWQLVFVDRENDVLLLG  549

Query  398  DDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPNGGSSCEVHVSQKET  219
            DDPW+ FVNNVWYIKILSP ++ +MG ++ +++  +   + QRL   G S  +   Q  +
Sbjct  550  DDPWESFVNNVWYIKILSPEDIQKMG-DQAVEM--HGLGSGQRLNGTGESHHIVSGQPPS  606

Query  218  RNMNGIPLGSLDY  180
                   +GSLDY
Sbjct  607  -------IGSLDY  612



>gb|AIB05454.1| ARF transcription factor, partial [Zea mays]
Length=897

 Score =   177 bits (450),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 105/212 (50%), Positives = 139/212 (66%), Gaps = 14/212 (7%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPD--MGTSSCVDESGFLQ  627
            SS  + +G+S +++ G  +G   +  ++  ++     D  L P+  + TSSC+ ESG   
Sbjct  695  SSFAIHDGLSTIRSGGVGSGTDAITIASLRYS-----DANLLPENSIATSSCLGESGTFN  749

Query  626  SSENVDQANPPNR-TFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERS  450
            S ++V   NP    TFVKV+KSGS GRSLDI++F SY+ELR EL R+FGLEG LEDP RS
Sbjct  750  SLDDVCGVNPSQGGTFVKVYKSGSLGRSLDITRFGSYYELRVELERLFGLEGQLEDPARS  809

Query  449  GWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQR  270
            GWQLVFVDRENDVLLLGDDPWQEFVN+V  IKILSP ++ QM +  G DL   L A   R
Sbjct  810  GWQLVFVDRENDVLLLGDDPWQEFVNSVGCIKILSPQDLQQMARGGGGDL---LSAPGAR  866

Query  269  LPNGGSSCEVHVSQKETRNMNG--IPLGSLDY  180
            +   GS C+ + +  + +N+ G   P+  LDY
Sbjct  867  MLQ-GSVCDDYSAGHDVQNLTGSIAPVVPLDY  897



>ref|XP_009789648.1| PREDICTED: auxin response factor 8-like [Nicotiana sylvestris]
Length=845

 Score =   177 bits (449),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 102/209 (49%), Positives = 131/209 (63%), Gaps = 26/209 (12%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSS  621
            S +LL   +SN+  +  +     MP  T  F + +                D S  L ++
Sbjct  661  SGLLLPTTVSNVSTTSIDADMSAMPLGTSGFQNSL-----------YGYVQDSSDLLHNA  709

Query  620  ENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQ  441
              VD  N   RTFVKV+KSGS GRSLDI++F+SYHELR EL +MFG+EG LEDP+RSGWQ
Sbjct  710  GQVDPLNA-TRTFVKVYKSGSVGRSLDITRFNSYHELRQELGQMFGIEGFLEDPQRSGWQ  768

Query  440  LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPN  261
            LVFVDRENDVLLLGDDPW+ FVNNVWYIKILSP +V ++GKEE   L            N
Sbjct  769  LVFVDRENDVLLLGDDPWEAFVNNVWYIKILSPEDVQKLGKEEVETL------------N  816

Query  260  GGSSCEVHVSQKETRN-MNGIP-LGSLDY  180
             GS   ++ +  + R+ M+G+P +GSL+Y
Sbjct  817  RGSLERMNSNSADGRDFMSGLPSIGSLEY  845



>ref|XP_010317649.1| PREDICTED: auxin response factor 8-1 isoform X1 [Solanum lycopersicum]
Length=748

 Score =   176 bits (447),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 102/209 (49%), Positives = 132/209 (63%), Gaps = 25/209 (12%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSS  621
            S +LL   +SN+  +  +    +MP  T  F           P+   S   D +  L + 
Sbjct  563  SGLLLPTTVSNVATTSIDADISSMPLGTSGF-----------PNPLYSYVQDSTDLLHNV  611

Query  620  ENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQ  441
               D    P RTFVKV+KS S GRSLDI++F+SYHELR EL +MFG+EG LE+P+RSGWQ
Sbjct  612  GQADAQTVP-RTFVKVYKSASLGRSLDITRFNSYHELRQELGQMFGIEGFLENPQRSGWQ  670

Query  440  LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPN  261
            LVFVDRENDVLLLGDDPW+EFVNNVWYIKILSP +V ++GKEE   L    P   +R+ +
Sbjct  671  LVFVDRENDVLLLGDDPWEEFVNNVWYIKILSPEDVQKLGKEEVGSLNRGPP---ERMSS  727

Query  260  GGSSCEVHVSQKETRN-MNGIP-LGSLDY  180
              S+        + R+ M+G+P +GSLDY
Sbjct  728  NNSA--------DGRDFMSGLPSIGSLDY  748



>ref|XP_008662061.1| PREDICTED: auxin response factor 25-like [Zea mays]
 tpg|DAA47508.1| TPA: hypothetical protein ZEAMMB73_035781 [Zea mays]
Length=897

 Score =   177 bits (450),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 105/212 (50%), Positives = 139/212 (66%), Gaps = 14/212 (7%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPD--MGTSSCVDESGFLQ  627
            SS  + +G+S +++ G  +G   +  ++  ++     D  L P+  + TSSC+ ESG   
Sbjct  695  SSFAIHDGLSTIRSGGVGSGTDAITIASLRYS-----DANLLPENSIATSSCLGESGTFN  749

Query  626  SSENVDQANPPNR-TFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERS  450
            S ++V   NP    TFVKV+KSGS GRSLDI++F SY+ELR EL R+FGLEG LEDP RS
Sbjct  750  SLDDVCGVNPSQGGTFVKVYKSGSLGRSLDITRFGSYYELRVELERLFGLEGQLEDPARS  809

Query  449  GWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQR  270
            GWQLVFVDRENDVLLLGDDPWQEFVN+V  IKILSP ++ QM +  G DL   L A   R
Sbjct  810  GWQLVFVDRENDVLLLGDDPWQEFVNSVGCIKILSPQDLQQMARGGGGDL---LSAPGAR  866

Query  269  LPNGGSSCEVHVSQKETRNMNG--IPLGSLDY  180
            +   GS C+ + +  + +N+ G   P+  LDY
Sbjct  867  MLQ-GSVCDDYSAGHDVQNLTGSIAPVVPLDY  897



>ref|NP_001169029.1| uncharacterized protein LOC100382863 [Zea mays]
 gb|ACN31454.1| unknown [Zea mays]
Length=122

 Score =   164 bits (414),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 96/113 (85%), Gaps = 4/113 (4%)
 Frame = -3

Query  653  CVDES-GFLQSSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLE  477
            C+D+S G LQ   N  + +P  RTFVKV+KSGS GRSLDI++FS+Y ELR EL +MFG++
Sbjct  4    CLDDSSGLLQ---NTGENDPTTRTFVKVYKSGSVGRSLDITRFSNYAELREELGQMFGIK  60

Query  476  GLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGK  318
            G L+DP+RSGWQLVFVDRENDVLLLGDDPW+ FVN+VWYIKILSP +VH+MGK
Sbjct  61   GQLDDPDRSGWQLVFVDRENDVLLLGDDPWESFVNSVWYIKILSPEDVHKMGK  113



>ref|XP_010250595.1| PREDICTED: auxin response factor 8 isoform X1 [Nelumbo nucifera]
 ref|XP_010250602.1| PREDICTED: auxin response factor 8 isoform X1 [Nelumbo nucifera]
Length=844

 Score =   177 bits (449),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 107/209 (51%), Positives = 132/209 (63%), Gaps = 28/209 (13%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSS  621
            S +LL   + NL +S  E    +MPF    F + +              C++ S  L +S
Sbjct  662  SPLLLPTSVPNLGSSSVEPDVSSMPFGGSGFQNSL------------YGCMENSSDLLNS  709

Query  620  ENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQ  441
                Q +PP RTFVKV+KSGS GRSLDIS+FSSYHELR EL +MFG+E  LEDP RSGWQ
Sbjct  710  --AGQVDPPTRTFVKVYKSGSVGRSLDISRFSSYHELREELGQMFGIEEQLEDPLRSGWQ  767

Query  440  LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPN  261
            LVFVDRENDVLLLGDDPW+ FVNNVWYIKILSP +V ++GK+E   L +N    +QR  N
Sbjct  768  LVFVDRENDVLLLGDDPWESFVNNVWYIKILSPEDVQKLGKQEVDALSSN---GDQRHSN  824

Query  260  GGSSCEVHVSQKETRNM-NGI-PLGSLDY  180
                     S  + RN  +GI  +GSL+Y
Sbjct  825  ---------SSYDVRNFTSGISSVGSLEY  844



>ref|XP_008463127.1| PREDICTED: auxin response factor 8 [Cucumis melo]
Length=852

 Score =   176 bits (447),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 100/161 (62%), Positives = 119/161 (74%), Gaps = 15/161 (9%)
 Frame = -3

Query  656  SCV-DESGFLQSSENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGL  480
            SCV D S  L +S  VD +NP  RTFVKV+KSGS GRSLDIS+FSSY ELR ELA+MFG+
Sbjct  705  SCVQDSSELLHNSGQVDPSNP-TRTFVKVYKSGSVGRSLDISRFSSYQELREELAQMFGI  763

Query  479  EGLLEDPERSGWQLVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDL  300
            EG LEDP RSGWQLVFVDRENDVLLLGDDPW+ FVNNV YIKILSP +  ++G E+ I+ 
Sbjct  764  EGQLEDPHRSGWQLVFVDRENDVLLLGDDPWEAFVNNVGYIKILSPEDFQKLG-EQAIES  822

Query  299  PNNLPAANQRLPNGGSSCEVHVSQKETRNMNGIP-LGSLDY  180
             N  P   QRL +GG+         E  N++G+P +GSL+Y
Sbjct  823  FN--PIVGQRLTSGGN---------EAGNVSGLPSVGSLEY  852



>ref|XP_009612885.1| PREDICTED: auxin response factor 8-like [Nicotiana tomentosiformis]
Length=843

 Score =   176 bits (447),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 102/209 (49%), Positives = 131/209 (63%), Gaps = 26/209 (12%)
 Frame = -3

Query  800  SSILLQNGISNLKNSGGENGFLNMPFSTCNFTSGVGTDYPLNPDMGTSSCVDESGFLQSS  621
            S +LL   +SN+  +  +     MP  T  F + +                D S  L ++
Sbjct  659  SGLLLPTTVSNVSTTPIDADMSTMPLGTSGFQNSL-----------YGYVQDSSDLLHNA  707

Query  620  ENVDQANPPNRTFVKVHKSGSFGRSLDISKFSSYHELRSELARMFGLEGLLEDPERSGWQ  441
              VD  N   RTFVKV+KSGS GRSLDI++F+SYHELR EL +MFG+EG LEDP+RSGWQ
Sbjct  708  GQVDSLNA-TRTFVKVYKSGSVGRSLDITRFNSYHELRQELGQMFGIEGFLEDPQRSGWQ  766

Query  440  LVFVDRENDVLLLGDDPWQEFVNNVWYIKILSPFEVHQMGKEEGIDLPNNLPAANQRLPN  261
            LVFVDRENDVLLLGDDPW+ FVNNVWYIKILSP +V ++GKEE   L            N
Sbjct  767  LVFVDRENDVLLLGDDPWEAFVNNVWYIKILSPEDVLKLGKEEVESL------------N  814

Query  260  GGSSCEVHVSQKETRN-MNGIP-LGSLDY  180
             GS   ++ +  + R+ M+G+P +GSL+Y
Sbjct  815  RGSLERMNSNSADGRDFMSGLPSIGSLEY  843



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1683214431688