BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig11072

Length=802
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009615365.1|  PREDICTED: aldose 1-epimerase                      312   2e-101   Nicotiana tomentosiformis
ref|XP_004236201.1|  PREDICTED: aldose 1-epimerase                      309   2e-100   Solanum lycopersicum
ref|XP_006344389.1|  PREDICTED: aldose 1-epimerase-like                 307   1e-99    Solanum tuberosum [potatoes]
ref|XP_009803676.1|  PREDICTED: aldose 1-epimerase                      307   1e-99    Nicotiana sylvestris
ref|XP_011071623.1|  PREDICTED: aldose 1-epimerase                      299   2e-96    
ref|XP_008239819.1|  PREDICTED: aldose 1-epimerase                      297   2e-95    Prunus mume [ume]
ref|XP_007210522.1|  hypothetical protein PRUPE_ppa007822mg             294   2e-94    
ref|XP_004299386.1|  PREDICTED: aldose 1-epimerase                      293   1e-93    Fragaria vesca subsp. vesca
ref|XP_007037270.1|  Galactose mutarotase-like superfamily protein      292   3e-93    
ref|XP_007037277.1|  Galactose mutarotase-like superfamily protein      294   4e-93    
ref|XP_006439628.1|  hypothetical protein CICLE_v10024457mg             290   8e-93    Citrus clementina [clementine]
emb|CDP12362.1|  unnamed protein product                                290   1e-92    Coffea canephora [robusta coffee]
ref|XP_006477524.1|  PREDICTED: aldose 1-epimerase-like                 290   1e-92    
gb|KDO76084.1|  hypothetical protein CISIN_1g043310mg                   288   6e-92    Citrus sinensis [apfelsine]
ref|XP_009149871.1|  PREDICTED: aldose 1-epimerase                      284   2e-90    Brassica rapa
gb|EYU35859.1|  hypothetical protein MIMGU_mgv1a008920mg                284   2e-90    Erythranthe guttata [common monkey flower]
emb|CDY24155.1|  BnaC03g57220D                                          283   4e-90    Brassica napus [oilseed rape]
gb|KFK34079.1|  hypothetical protein AALP_AA5G099600                    282   7e-90    Arabis alpina [alpine rockcress]
ref|XP_006291372.1|  hypothetical protein CARUB_v10017512mg             282   8e-90    Capsella rubella
ref|XP_002511545.1|  aldose-1-epimerase, putative                       282   9e-90    Ricinus communis
emb|CDY36929.1|  BnaA06g17140D                                          282   1e-89    Brassica napus [oilseed rape]
ref|XP_012080544.1|  PREDICTED: aldose 1-epimerase                      280   4e-89    Jatropha curcas
gb|KDP31227.1|  hypothetical protein JCGZ_11603                         280   4e-89    Jatropha curcas
ref|XP_010547806.1|  PREDICTED: aldose 1-epimerase-like                 280   5e-89    Tarenaya hassleriana [spider flower]
ref|XP_006404338.1|  hypothetical protein EUTSA_v10010502mg             280   6e-89    
ref|XP_010029392.1|  PREDICTED: aldose 1-epimerase-like                 280   8e-89    Eucalyptus grandis [rose gum]
ref|XP_006404339.1|  hypothetical protein EUTSA_v10010502mg             279   9e-89    Eutrema salsugineum [saltwater cress]
ref|XP_002875866.1|  hypothetical protein ARALYDRAFT_906011             279   1e-88    Arabidopsis lyrata subsp. lyrata
gb|AFK48015.1|  unknown                                                 271   1e-87    Lotus japonicus
ref|XP_011029977.1|  PREDICTED: aldose 1-epimerase-like                 276   2e-87    Populus euphratica
gb|AAM61410.1|  aldose 1-epimerase-like protein                         275   3e-87    Arabidopsis thaliana [mouse-ear cress]
ref|NP_190364.1|  putative aldose 1-epimerase                           275   4e-87    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002268039.1|  PREDICTED: aldose 1-epimerase                      275   6e-87    Vitis vinifera
ref|XP_008453190.1|  PREDICTED: aldose 1-epimerase-like                 275   7e-87    Cucumis melo [Oriental melon]
ref|XP_010032358.1|  PREDICTED: aldose 1-epimerase-like                 274   2e-86    Eucalyptus grandis [rose gum]
ref|XP_004508758.1|  PREDICTED: aldose 1-epimerase-like isoform X2      271   3e-86    
ref|XP_004138299.1|  PREDICTED: aldose 1-epimerase                      273   3e-86    Cucumis sativus [cucumbers]
ref|XP_010503389.1|  PREDICTED: aldose 1-epimerase-like                 273   4e-86    Camelina sativa [gold-of-pleasure]
gb|KJB39892.1|  hypothetical protein B456_007G036000                    272   7e-86    Gossypium raimondii
ref|XP_004508757.1|  PREDICTED: aldose 1-epimerase-like isoform X1      272   8e-86    Cicer arietinum [garbanzo]
ref|XP_006377092.1|  hypothetical protein POPTR_0012s14420g             272   9e-86    Populus trichocarpa [western balsam poplar]
ref|XP_010426233.1|  PREDICTED: aldose 1-epimerase-like                 272   1e-85    Camelina sativa [gold-of-pleasure]
ref|XP_010550628.1|  PREDICTED: aldose 1-epimerase-like                 270   7e-85    Tarenaya hassleriana [spider flower]
ref|XP_008453675.1|  PREDICTED: aldose 1-epimerase                      268   2e-84    
emb|CAN61059.1|  hypothetical protein VITISV_011619                     267   3e-84    Vitis vinifera
gb|AFK38126.1|  unknown                                                 268   4e-84    Lotus japonicus
ref|XP_002321845.2|  aldose 1-epimerase family protein                  263   7e-84    
ref|XP_002282868.1|  PREDICTED: aldose 1-epimerase                      266   1e-83    Vitis vinifera
ref|XP_006373311.1|  hypothetical protein POPTR_0017s11660g             266   1e-83    Populus trichocarpa [western balsam poplar]
ref|XP_011008939.1|  PREDICTED: aldose 1-epimerase-like                 267   2e-83    Populus euphratica
ref|XP_002282831.1|  PREDICTED: aldose 1-epimerase                      264   1e-82    Vitis vinifera
ref|XP_010256040.1|  PREDICTED: aldose 1-epimerase-like                 263   2e-82    Nelumbo nucifera [Indian lotus]
gb|KDO72518.1|  hypothetical protein CISIN_1g017992mg                   262   8e-82    Citrus sinensis [apfelsine]
ref|XP_006482556.1|  PREDICTED: aldose 1-epimerase-like                 261   1e-81    Citrus sinensis [apfelsine]
ref|XP_008784468.1|  PREDICTED: aldose 1-epimerase-like                 261   1e-81    Phoenix dactylifera
gb|KDO72517.1|  hypothetical protein CISIN_1g0479221mg                  255   2e-81    Citrus sinensis [apfelsine]
ref|XP_010693333.1|  PREDICTED: aldose 1-epimerase                      260   5e-81    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004147466.2|  PREDICTED: aldose 1-epimerase-like                 260   7e-81    Cucumis sativus [cucumbers]
ref|XP_010242446.1|  PREDICTED: aldose 1-epimerase-like                 259   1e-80    Nelumbo nucifera [Indian lotus]
ref|XP_009347058.1|  PREDICTED: aldose 1-epimerase                      258   2e-80    Pyrus x bretschneideri [bai li]
ref|XP_008230742.1|  PREDICTED: aldose 1-epimerase-like                 258   3e-80    Prunus mume [ume]
ref|XP_008341553.1|  PREDICTED: aldose 1-epimerase                      258   4e-80    Malus domestica [apple tree]
ref|XP_010256788.1|  PREDICTED: aldose 1-epimerase-like                 257   5e-80    Nelumbo nucifera [Indian lotus]
gb|EPS71547.1|  hypothetical protein M569_03212                         256   6e-80    Genlisea aurea
ref|XP_008443423.1|  PREDICTED: aldose 1-epimerase                      257   8e-80    
ref|XP_010937062.1|  PREDICTED: aldose 1-epimerase-like                 256   1e-79    Elaeis guineensis
ref|XP_006384345.1|  hypothetical protein POPTR_0004s13470g             256   1e-79    
ref|XP_002305327.1|  hypothetical protein POPTR_0004s13470g             256   1e-79    Populus trichocarpa [western balsam poplar]
ref|XP_007155325.1|  hypothetical protein PHAVU_003G191500g             256   1e-79    Phaseolus vulgaris [French bean]
ref|XP_002517487.1|  aldose-1-epimerase, putative                       256   2e-79    Ricinus communis
ref|XP_006431103.1|  hypothetical protein CICLE_v10011989mg             256   2e-79    Citrus clementina [clementine]
ref|XP_007216505.1|  hypothetical protein PRUPE_ppa024124mg             255   3e-79    
ref|XP_011046256.1|  PREDICTED: aldose 1-epimerase-like                 255   3e-79    Populus euphratica
ref|XP_006482555.1|  PREDICTED: aldose 1-epimerase-like                 255   5e-79    Citrus sinensis [apfelsine]
ref|XP_003550776.1|  PREDICTED: aldose 1-epimerase-like                 254   5e-79    Glycine max [soybeans]
gb|KHN30819.1|  Aldose 1-epimerase                                      252   6e-79    Glycine soja [wild soybean]
emb|CBI22179.3|  unnamed protein product                                271   7e-79    Vitis vinifera
ref|XP_003528185.2|  PREDICTED: aldose 1-epimerase-like                 253   1e-78    Glycine max [soybeans]
ref|XP_002323843.2|  hypothetical protein POPTR_0017s11650g             253   3e-78    Populus trichocarpa [western balsam poplar]
ref|XP_009779455.1|  PREDICTED: aldose 1-epimerase-like isoform X4      252   8e-78    Nicotiana sylvestris
ref|XP_010102873.1|  Aldose 1-epimerase                                 251   1e-77    Morus notabilis
ref|XP_009624450.1|  PREDICTED: aldose 1-epimerase-like isoform X2      251   2e-77    Nicotiana tomentosiformis
ref|XP_009624449.1|  PREDICTED: aldose 1-epimerase-like isoform X1      251   2e-77    Nicotiana tomentosiformis
ref|XP_002318873.1|  aldose 1-epimerase family protein                  249   3e-77    
gb|KHN48675.1|  Aldose 1-epimerase                                      249   5e-77    Glycine soja [wild soybean]
gb|KJB75755.1|  hypothetical protein B456_012G055600                    245   6e-77    Gossypium raimondii
ref|XP_009401394.1|  PREDICTED: aldose 1-epimerase-like                 249   6e-77    Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN13632.1|  Aldose 1-epimerase                                      249   1e-76    Glycine soja [wild soybean]
ref|XP_006338469.1|  PREDICTED: aldose 1-epimerase-like isoform X1      248   2e-76    Solanum tuberosum [potatoes]
ref|XP_006578581.1|  PREDICTED: aldose 1-epimerase-like                 248   2e-76    Glycine max [soybeans]
ref|XP_004302346.1|  PREDICTED: aldose 1-epimerase-like                 248   3e-76    Fragaria vesca subsp. vesca
ref|XP_003534458.1|  PREDICTED: aldose 1-epimerase-like                 248   4e-76    Glycine max [soybeans]
ref|XP_006338470.1|  PREDICTED: aldose 1-epimerase-like isoform X2      247   4e-76    Solanum tuberosum [potatoes]
ref|XP_009779461.1|  PREDICTED: aldose 1-epimerase-like                 247   4e-76    Nicotiana sylvestris
ref|XP_009624451.1|  PREDICTED: aldose 1-epimerase-like                 246   6e-76    Nicotiana tomentosiformis
gb|KJB75754.1|  hypothetical protein B456_012G055600                    246   8e-76    Gossypium raimondii
ref|XP_004232231.2|  PREDICTED: aldose 1-epimerase-like                 249   8e-76    
ref|XP_002323842.1|  aldose 1-epimerase family protein                  246   1e-75    Populus trichocarpa [western balsam poplar]
ref|NP_001241992.1|  uncharacterized protein LOC100781853 precursor     246   1e-75    
ref|XP_012083064.1|  PREDICTED: aldose 1-epimerase-like                 245   3e-75    Jatropha curcas
ref|XP_007099714.1|  Galactose mutarotase-like superfamily protei...    247   3e-75    
tpg|DAA37475.1|  TPA: hypothetical protein ZEAMMB73_785674              238   9e-75    
gb|KHG05985.1|  Aldose 1-epimerase                                      243   1e-74    Gossypium arboreum [tree cotton]
ref|XP_007139591.1|  hypothetical protein PHAVU_008G042600g             243   1e-74    Phaseolus vulgaris [French bean]
ref|XP_009593213.1|  PREDICTED: aldose 1-epimerase-like                 243   1e-74    Nicotiana tomentosiformis
gb|AES91241.2|  aldose 1-epimerase family protein                       243   1e-74    Medicago truncatula
ref|XP_008811569.1|  PREDICTED: aldose 1-epimerase-like                 243   2e-74    
ref|XP_007032473.1|  Galactose mutarotase-like superfamily protein      243   2e-74    Theobroma cacao [chocolate]
ref|XP_011008940.1|  PREDICTED: aldose 1-epimerase-like                 241   5e-74    Populus euphratica
ref|XP_008784475.1|  PREDICTED: aldose 1-epimerase-like                 241   7e-74    Phoenix dactylifera
ref|XP_006338467.1|  PREDICTED: aldose 1-epimerase-like                 241   7e-74    Solanum tuberosum [potatoes]
ref|XP_003621163.1|  Aldose 1-epimerase                                 235   1e-73    
ref|XP_003621162.1|  Aldose 1-epimerase                                 241   1e-73    Medicago truncatula
ref|XP_011098592.1|  PREDICTED: aldose 1-epimerase-like                 241   1e-73    Sesamum indicum [beniseed]
ref|XP_010916998.1|  PREDICTED: aldose 1-epimerase-like                 240   1e-73    Elaeis guineensis
emb|CDP02212.1|  unnamed protein product                                241   2e-73    Coffea canephora [robusta coffee]
ref|XP_009779459.1|  PREDICTED: aldose 1-epimerase-like isoform X8      240   2e-73    Nicotiana sylvestris
ref|XP_009779457.1|  PREDICTED: aldose 1-epimerase-like isoform X6      240   2e-73    Nicotiana sylvestris
ref|XP_009369413.1|  PREDICTED: LOW QUALITY PROTEIN: aldose 1-epi...    234   3e-73    Pyrus x bretschneideri [bai li]
gb|AAL09398.1|AF307095_1  non-cell-autonomous protein pathway2          239   6e-73    Nicotiana tabacum [American tobacco]
ref|XP_009779450.1|  PREDICTED: aldose 1-epimerase-like                 238   1e-72    Nicotiana sylvestris
ref|XP_003609044.1|  Aldose 1-epimerase-like protein                    237   2e-72    
ref|NP_001137118.1|  aldose 1-epimerase precursor                       238   2e-72    Zea mays [maize]
ref|XP_009779453.1|  PREDICTED: aldose 1-epimerase-like isoform X3      239   4e-72    Nicotiana sylvestris
ref|XP_009779451.1|  PREDICTED: aldose 1-epimerase-like isoform X1      240   5e-72    Nicotiana sylvestris
ref|XP_009779452.1|  PREDICTED: aldose 1-epimerase-like isoform X2      239   5e-72    Nicotiana sylvestris
emb|CDX78613.1|  BnaA03g05250D                                          234   6e-72    
gb|ACG28451.1|  aldose 1-epimerase precursor                            236   7e-72    Zea mays [maize]
gb|KGN46963.1|  hypothetical protein Csa_6G153465                       236   1e-71    Cucumis sativus [cucumbers]
ref|XP_009624447.1|  PREDICTED: aldose 1-epimerase-like                 235   1e-71    Nicotiana tomentosiformis
emb|CDX70595.1|  BnaC03g06790D                                          234   1e-71    
emb|CBA10127.1|  non-cell-autonomous protein pathway                    235   1e-71    Nicotiana benthamiana
gb|AAL09397.1|AF307094_1  non-cell-autonomous protein pathway1          235   2e-71    Nicotiana tabacum [American tobacco]
gb|ABK22097.1|  unknown                                                 234   3e-71    Picea sitchensis
ref|XP_009779460.1|  PREDICTED: aldose 1-epimerase-like isoform X9      234   3e-71    Nicotiana sylvestris
ref|XP_008346833.1|  PREDICTED: LOW QUALITY PROTEIN: aldose 1-epi...    228   6e-71    
ref|XP_004489156.1|  PREDICTED: aldose 1-epimerase-like                 234   7e-71    Cicer arietinum [garbanzo]
gb|KJB33630.1|  hypothetical protein B456_006G023000                    234   1e-70    Gossypium raimondii
gb|AAB94619.1|  aldose-1-epimerase-like protein                         233   1e-70    Nicotiana tabacum [American tobacco]
gb|AFK41318.1|  unknown                                                 233   1e-70    Lotus japonicus
ref|XP_009779456.1|  PREDICTED: aldose 1-epimerase-like isoform X5      233   1e-70    Nicotiana sylvestris
ref|XP_009779458.1|  PREDICTED: aldose 1-epimerase-like isoform X7      233   2e-70    Nicotiana sylvestris
gb|ABG65914.1|  Aldose 1-epimerase family protein, expressed            230   2e-70    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006287626.1|  hypothetical protein CARUB_v10000838mg             236   3e-70    Capsella rubella
ref|XP_002964269.1|  hypothetical protein SELMODRAFT_142651             229   4e-70    
ref|XP_009131443.1|  PREDICTED: aldose 1-epimerase-like                 236   5e-70    Brassica rapa
ref|XP_002871651.1|  hypothetical protein ARALYDRAFT_488355             235   5e-70    Arabidopsis lyrata subsp. lyrata
ref|XP_002446606.1|  hypothetical protein SORBIDRAFT_06g018800          231   7e-70    Sorghum bicolor [broomcorn]
gb|AAL75737.1|AC091724_10  Putative aldose 1-epimerase - like pro...    230   8e-70    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001064192.1|  Os10g0155500                                       231   9e-70    
dbj|BAC43284.1|  putative aldose 1-epimerase                            229   1e-69    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009121605.1|  PREDICTED: aldose 1-epimerase isoform X1           234   1e-69    Brassica rapa
ref|XP_009121606.1|  PREDICTED: aldose 1-epimerase isoform X2           234   1e-69    Brassica rapa
ref|XP_006338471.1|  PREDICTED: aldose 1-epimerase-like isoform X3      230   1e-69    Solanum tuberosum [potatoes]
gb|EMT10467.1|  Aldose 1-epimerase                                      224   2e-69    
ref|XP_007151211.1|  hypothetical protein PHAVU_004G027000g             230   2e-69    Phaseolus vulgaris [French bean]
dbj|BAK00680.1|  predicted protein                                      230   3e-69    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT01730.1|  Aldose 1-epimerase                                      229   3e-69    
ref|XP_004982549.1|  PREDICTED: aldose 1-epimerase-like                 232   3e-69    Setaria italica
gb|EAY77740.1|  hypothetical protein OsI_32784                          228   3e-69    Oryza sativa Indica Group [Indian rice]
ref|NP_001062565.1|  Os09g0108600                                       227   4e-69    
ref|XP_004983378.1|  PREDICTED: aldose 1-epimerase-like                 228   5e-69    Setaria italica
gb|KHN13234.1|  Aldose 1-epimerase                                      229   5e-69    Glycine soja [wild soybean]
ref|XP_003543750.1|  PREDICTED: aldose 1-epimerase-like                 229   5e-69    Glycine max [soybeans]
ref|XP_009624445.1|  PREDICTED: aldose 1-epimerase-like                 228   6e-69    Nicotiana tomentosiformis
ref|XP_002467340.1|  hypothetical protein SORBIDRAFT_01g025920          228   6e-69    Sorghum bicolor [broomcorn]
ref|XP_010453642.1|  PREDICTED: aldose 1-epimerase-like                 231   1e-68    Camelina sativa [gold-of-pleasure]
gb|KFK25751.1|  hypothetical protein AALP_AA8G154800                    233   1e-68    Arabis alpina [alpine rockcress]
ref|XP_002466911.1|  hypothetical protein SORBIDRAFT_01g016500          230   1e-68    Sorghum bicolor [broomcorn]
ref|XP_003579892.1|  PREDICTED: aldose 1-epimerase-like                 228   1e-68    Brachypodium distachyon [annual false brome]
ref|XP_006338472.1|  PREDICTED: aldose 1-epimerase-like                 228   1e-68    Solanum tuberosum [potatoes]
ref|XP_010492338.1|  PREDICTED: aldose 1-epimerase-like                 231   3e-68    Camelina sativa [gold-of-pleasure]
ref|XP_010420168.1|  PREDICTED: aldose 1-epimerase-like                 231   3e-68    Camelina sativa [gold-of-pleasure]
ref|XP_006651555.1|  PREDICTED: uncharacterized protein LOC102719852    234   3e-68    
ref|XP_009417229.1|  PREDICTED: aldose 1-epimerase-like                 226   3e-68    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010918323.1|  PREDICTED: aldose 1-epimerase-like                 226   3e-68    Elaeis guineensis
ref|XP_010317286.1|  PREDICTED: aldose 1-epimerase-like                 228   3e-68    
ref|XP_009624446.1|  PREDICTED: aldose 1-epimerase-like                 226   4e-68    Nicotiana tomentosiformis
emb|CDX85053.1|  BnaC05g20020D                                          230   5e-68    
ref|XP_002989540.1|  hypothetical protein SELMODRAFT_129964             227   5e-68    
ref|NP_197018.1|  aldose 1-epimerase-like protein                       230   5e-68    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009405677.1|  PREDICTED: aldose 1-epimerase-like                 225   5e-68    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010524327.1|  PREDICTED: aldose 1-epimerase isoform X1           229   6e-68    Tarenaya hassleriana [spider flower]
gb|KEH24989.1|  aldose 1-epimerase family protein                       226   7e-68    Medicago truncatula
gb|ACE97529.1|  aldose 1-epimerase                                      219   7e-68    Populus tremula [European aspen]
gb|EAY97171.1|  hypothetical protein OsI_19092                          225   7e-68    Oryza sativa Indica Group [Indian rice]
ref|NP_001169820.1|  hypothetical protein precursor                     225   2e-67    Zea mays [maize]
gb|ACE97530.1|  aldose 1-epimerase                                      218   2e-67    Populus tremula [European aspen]
ref|XP_006827141.1|  PREDICTED: aldose 1-epimerase                      224   3e-67    Amborella trichopoda
gb|KHN45485.1|  Aldose 1-epimerase                                      224   4e-67    Glycine soja [wild soybean]
ref|XP_008644102.1|  PREDICTED: hypothetical protein isoform X1         225   4e-67    
gb|ACE97533.1|  aldose 1-epimerase                                      217   5e-67    Populus tremula [European aspen]
dbj|BAJ88499.1|  predicted protein                                      226   7e-67    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010930440.1|  PREDICTED: aldose 1-epimerase-like isoform X2      221   7e-67    
gb|ACE97531.1|  aldose 1-epimerase                                      216   7e-67    Populus tremula [European aspen]
gb|ACE97554.1|  aldose 1-epimerase                                      216   7e-67    Populus tremula [European aspen]
ref|XP_002988820.1|  hypothetical protein SELMODRAFT_159754             223   1e-66    Selaginella moellendorffii
ref|XP_002964577.1|  hypothetical protein SELMODRAFT_230384             223   1e-66    Selaginella moellendorffii
ref|XP_006400031.1|  hypothetical protein EUTSA_v10013324mg             226   1e-66    Eutrema salsugineum [saltwater cress]
ref|XP_011001586.1|  PREDICTED: aldose 1-epimerase-like isoform X2      222   2e-66    Populus euphratica
ref|XP_011001585.1|  PREDICTED: aldose 1-epimerase-like isoform X1      222   2e-66    Populus euphratica
dbj|BAJ86209.1|  predicted protein                                      223   2e-66    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004975839.1|  PREDICTED: aldose 1-epimerase-like                 222   2e-66    Setaria italica
gb|ACE97548.1|  aldose 1-epimerase                                      215   2e-66    Populus tremula [European aspen]
gb|ACE97538.1|  aldose 1-epimerase                                      215   2e-66    Populus tremula [European aspen]
ref|XP_007036807.1|  Galactose mutarotase-like superfamily protei...    218   3e-66    
ref|XP_009414392.1|  PREDICTED: aldose 1-epimerase-like                 222   3e-66    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003579891.1|  PREDICTED: aldose 1-epimerase-like                 222   3e-66    Brachypodium distachyon [annual false brome]
ref|XP_006338468.1|  PREDICTED: aldose 1-epimerase-like                 221   4e-66    Solanum tuberosum [potatoes]
dbj|BAK04813.1|  predicted protein                                      221   4e-66    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KCW84112.1|  hypothetical protein EUGRSUZ_B00995                     219   5e-66    Eucalyptus grandis [rose gum]
gb|EMS48168.1|  Aldose 1-epimerase                                      219   5e-66    Triticum urartu
gb|KCW84111.1|  hypothetical protein EUGRSUZ_B00995                     219   6e-66    Eucalyptus grandis [rose gum]
ref|XP_010930434.1|  PREDICTED: aldose 1-epimerase-like isoform X1      220   6e-66    Elaeis guineensis
ref|XP_011039151.1|  PREDICTED: aldose 1-epimerase-like                 220   6e-66    Populus euphratica
ref|XP_004235803.1|  PREDICTED: aldose 1-epimerase                      220   7e-66    Solanum lycopersicum
ref|NP_001241954.1|  uncharacterized protein LOC100803092 precursor     221   9e-66    Glycine max [soybeans]
ref|XP_009766422.1|  PREDICTED: aldose 1-epimerase                      219   9e-66    Nicotiana sylvestris
gb|EYU34099.1|  hypothetical protein MIMGU_mgv1a008692mg                221   9e-66    Erythranthe guttata [common monkey flower]
ref|XP_006341518.1|  PREDICTED: aldose 1-epimerase-like                 219   1e-65    Solanum tuberosum [potatoes]
ref|XP_004975838.1|  PREDICTED: aldose 1-epimerase-like                 220   1e-65    Setaria italica
gb|KCW84110.1|  hypothetical protein EUGRSUZ_B00995                     219   1e-65    Eucalyptus grandis [rose gum]
gb|KCW84113.1|  hypothetical protein EUGRSUZ_B00995                     218   1e-65    Eucalyptus grandis [rose gum]
ref|XP_010265811.1|  PREDICTED: aldose 1-epimerase-like                 219   2e-65    Nelumbo nucifera [Indian lotus]
ref|XP_010034276.1|  PREDICTED: aldose 1-epimerase-like                 219   2e-65    Eucalyptus grandis [rose gum]
ref|XP_002317867.1|  aldose 1-epimerase family protein                  219   2e-65    Populus trichocarpa [western balsam poplar]
ref|XP_008803764.1|  PREDICTED: aldose 1-epimerase                      218   3e-65    
ref|XP_007036806.1|  Galactose mutarotase-like superfamily protei...    218   3e-65    
ref|XP_009620755.1|  PREDICTED: aldose 1-epimerase                      218   3e-65    Nicotiana tomentosiformis
ref|XP_006372579.1|  hypothetical protein POPTR_0017s02950g             219   4e-65    Populus trichocarpa [western balsam poplar]
ref|XP_008453487.1|  PREDICTED: aldose 1-epimerase                      218   4e-65    Cucumis melo [Oriental melon]
ref|XP_006372578.1|  hypothetical protein POPTR_0017s02950g             219   4e-65    Populus trichocarpa [western balsam poplar]
gb|KHG22159.1|  Aldose 1-epimerase                                      218   5e-65    Gossypium arboreum [tree cotton]
gb|KEH24988.1|  aldose 1-epimerase family protein                       219   5e-65    Medicago truncatula
ref|XP_012086275.1|  PREDICTED: aldose 1-epimerase-like                 218   5e-65    Jatropha curcas
ref|XP_004232229.1|  PREDICTED: aldose 1-epimerase-like                 218   6e-65    Solanum lycopersicum
ref|NP_001169952.1|  uncharacterized protein LOC100383851               212   7e-65    
ref|XP_002530475.1|  aldose-1-epimerase, putative                       218   7e-65    Ricinus communis
gb|EMT09272.1|  Aldose 1-epimerase                                      216   8e-65    
gb|EMT28343.1|  Aldose 1-epimerase                                      217   9e-65    
ref|XP_008374865.1|  PREDICTED: aldose 1-epimerase                      217   1e-64    Malus domestica [apple tree]
ref|XP_004137351.1|  PREDICTED: aldose 1-epimerase                      217   1e-64    Cucumis sativus [cucumbers]
ref|XP_009356028.1|  PREDICTED: aldose 1-epimerase-like                 217   1e-64    Pyrus x bretschneideri [bai li]
ref|XP_009360073.1|  PREDICTED: aldose 1-epimerase-like                 217   1e-64    Pyrus x bretschneideri [bai li]
ref|XP_010274745.1|  PREDICTED: aldose 1-epimerase-like                 216   2e-64    Nelumbo nucifera [Indian lotus]
ref|XP_006826839.1|  PREDICTED: aldose 1-epimerase                      217   2e-64    Amborella trichopoda
ref|XP_003573719.1|  PREDICTED: aldose 1-epimerase                      216   2e-64    Brachypodium distachyon [annual false brome]
gb|EEE61117.1|  hypothetical protein OsJ_15041                          217   2e-64    Oryza sativa Japonica Group [Japonica rice]
gb|EMS45763.1|  Aldose 1-epimerase                                      216   2e-64    Triticum urartu
ref|XP_006661643.1|  PREDICTED: aldose 1-epimerase-like                 216   3e-64    Oryza brachyantha
gb|KJB30179.1|  hypothetical protein B456_005G132500                    214   3e-64    Gossypium raimondii
emb|CDJ26298.1|  unnamed protein product                                217   3e-64    Triticum aestivum [Canadian hard winter wheat]
gb|EYU33340.1|  hypothetical protein MIMGU_mgv1a009621mg                216   3e-64    Erythranthe guttata [common monkey flower]
ref|XP_006490787.1|  PREDICTED: aldose 1-epimerase-like                 216   4e-64    Citrus sinensis [apfelsine]
ref|XP_008240141.1|  PREDICTED: aldose 1-epimerase                      216   4e-64    Prunus mume [ume]
ref|XP_004299522.1|  PREDICTED: aldose 1-epimerase                      215   5e-64    Fragaria vesca subsp. vesca
emb|CBW45774.1|  ORW1943Ba0077G13.2                                     217   5e-64    Oryza rufipogon [common wild rice]
gb|ACR37686.1|  unknown                                                 210   6e-64    Zea mays [maize]
ref|XP_007209327.1|  hypothetical protein PRUPE_ppa008258mg             215   6e-64    Prunus persica
ref|XP_004984206.1|  PREDICTED: aldose 1-epimerase-like                 216   7e-64    Setaria italica
emb|CAH67072.1|  OSIGBa0097P08.2                                        216   8e-64    Oryza sativa [red rice]
tpg|DAA45585.1|  TPA: aldose 1-epimerase                                215   9e-64    
gb|KJB30177.1|  hypothetical protein B456_005G132500                    214   1e-63    Gossypium raimondii
gb|KJB30178.1|  hypothetical protein B456_005G132500                    214   1e-63    Gossypium raimondii
ref|XP_010549060.1|  PREDICTED: aldose 1-epimerase                      214   1e-63    Tarenaya hassleriana [spider flower]
ref|XP_003619838.1|  Aldose 1-epimerase family protein expressed        214   1e-63    Medicago truncatula
ref|XP_008393430.1|  PREDICTED: aldose 1-epimerase-like                 214   1e-63    
ref|XP_002446604.1|  hypothetical protein SORBIDRAFT_06g018780          213   2e-63    
ref|XP_003575218.1|  PREDICTED: aldose 1-epimerase-like                 214   3e-63    Brachypodium distachyon [annual false brome]
gb|EMS48569.1|  Aldose 1-epimerase                                      212   3e-63    Triticum urartu
gb|KHN44634.1|  Aldose 1-epimerase                                      213   4e-63    Glycine soja [wild soybean]
ref|NP_001242054.1|  uncharacterized protein LOC100776238               213   4e-63    Glycine max [soybeans]
ref|XP_008666819.1|  PREDICTED: aldose 1-epimerase isoform X2           211   6e-63    Zea mays [maize]
ref|NP_001052977.1|  Os04g0458300                                       213   7e-63    
ref|XP_008666812.1|  PREDICTED: aldose 1-epimerase isoform X1           211   7e-63    Zea mays [maize]
ref|XP_002531177.1|  aldose-1-epimerase, putative                       212   8e-63    Ricinus communis
gb|KDO50781.1|  hypothetical protein CISIN_1g021840mg                   211   8e-63    Citrus sinensis [apfelsine]
ref|XP_010679093.1|  PREDICTED: aldose 1-epimerase                      212   8e-63    Beta vulgaris subsp. vulgaris [field beet]
gb|KHN43629.1|  Aldose 1-epimerase                                      211   9e-63    Glycine soja [wild soybean]
emb|CAD40900.2|  OSJNBa0036B21.18                                       213   1e-62    
ref|XP_006582882.1|  PREDICTED: uncharacterized protein LOC100776...    212   1e-62    
ref|XP_006430571.1|  hypothetical protein CICLE_v10012137mg             211   2e-62    
emb|CDO98338.1|  unnamed protein product                                211   2e-62    
ref|XP_006482094.1|  PREDICTED: aldose 1-epimerase-like                 211   2e-62    
gb|EAY94387.1|  hypothetical protein OsI_16154                          212   2e-62    
ref|NP_001140553.1|  aldose 1-epimerase                                 211   2e-62    
ref|XP_003534140.1|  PREDICTED: aldose 1-epimerase                      211   3e-62    
ref|XP_008644114.1|  PREDICTED: uncharacterized protein LOC100383...    214   3e-62    
ref|XP_004512748.1|  PREDICTED: aldose 1-epimerase-like                 211   3e-62    
emb|CBI15585.3|  unnamed protein product                                210   3e-62    
ref|XP_012077819.1|  PREDICTED: aldose 1-epimerase-like                 210   4e-62    
gb|AAK64036.1|  putative aldose 1-epimerase                             210   4e-62    
ref|XP_002282634.1|  PREDICTED: aldose 1-epimerase                      210   5e-62    
ref|NP_566594.2|  putative aldose 1-epimerase                           210   6e-62    
ref|XP_011073000.1|  PREDICTED: aldose 1-epimerase                      209   8e-62    
ref|NP_001149545.1|  aldose 1-epimerase precursor                       210   1e-61    
ref|XP_004975836.1|  PREDICTED: aldose 1-epimerase-like                 210   1e-61    
emb|CDP18771.1|  unnamed protein product                                210   1e-61    
dbj|BAK01606.1|  predicted protein                                      209   1e-61    
ref|XP_009113609.1|  PREDICTED: aldose 1-epimerase-like                 209   1e-61    
ref|XP_006652377.1|  PREDICTED: aldose 1-epimerase-like                 209   2e-61    
emb|CDP15260.1|  unnamed protein product                                209   2e-61    
dbj|BAK02841.1|  predicted protein                                      209   2e-61    
gb|EAZ30964.1|  hypothetical protein OsJ_15042                          209   2e-61    
ref|XP_010465867.1|  PREDICTED: aldose 1-epimerase-like                 208   2e-61    
gb|EMT01731.1|  Aldose 1-epimerase                                      203   2e-61    
ref|XP_010099722.1|  Aldose 1-epimerase                                 208   3e-61    
ref|XP_002452332.1|  hypothetical protein SORBIDRAFT_04g023830          209   4e-61    
ref|XP_001771667.1|  predicted protein                                  208   4e-61    
ref|XP_002455882.1|  hypothetical protein SORBIDRAFT_03g026790          207   1e-60    
gb|AFK38051.1|  unknown                                                 206   1e-60    
ref|XP_010487703.1|  PREDICTED: aldose 1-epimerase-like                 206   1e-60    
ref|XP_002453662.1|  hypothetical protein SORBIDRAFT_04g010040          206   2e-60    
ref|XP_010506176.1|  PREDICTED: aldose 1-epimerase-like                 206   2e-60    
ref|NP_001052979.1|  Os04g0458600                                       206   2e-60    
emb|CDX92179.1|  BnaA05g22280D                                          206   2e-60    
emb|CAD40901.2|  OSJNBa0036B21.19                                       206   3e-60    
ref|XP_002453661.1|  hypothetical protein SORBIDRAFT_04g010030          206   4e-60    
gb|EMT25696.1|  Aldose 1-epimerase                                      206   4e-60    
gb|EAZ08102.1|  hypothetical protein OsI_30367                          210   5e-60    
ref|XP_002465201.1|  hypothetical protein SORBIDRAFT_01g033970          205   8e-60    
ref|XP_003579893.1|  PREDICTED: aldose 1-epimerase-like                 205   8e-60    
gb|EMS49868.1|  Aldose 1-epimerase                                      205   9e-60    
ref|NP_001047214.1|  Os02g0575800                                       205   9e-60    
ref|XP_002885235.1|  aldose 1-epimerase family protein                  204   9e-60    
ref|XP_007152681.1|  hypothetical protein PHAVU_004G150200g             204   9e-60    
gb|EAY86398.1|  hypothetical protein OsI_07776                          205   9e-60    
gb|ABK26409.1|  unknown                                                 205   1e-59    
ref|XP_008669323.1|  PREDICTED: aldose 1-epimerase-like                 204   1e-59    
ref|XP_006406670.1|  hypothetical protein EUTSA_v10021070mg             204   1e-59    
gb|ABK21947.1|  unknown                                                 205   2e-59    
gb|KFK39119.1|  hypothetical protein AALP_AA3G203500                    203   2e-59    
ref|XP_010233225.1|  PREDICTED: aldose 1-epimerase-like isoform X2      201   2e-59    
gb|AFK40570.1|  unknown                                                 203   3e-59    
emb|CDX95801.1|  BnaC05g35520D                                          202   4e-59    
ref|XP_002517486.1|  aldose-1-epimerase, putative                       202   6e-59    
ref|XP_004952870.1|  PREDICTED: aldose 1-epimerase-like                 203   7e-59    
gb|EYU24186.1|  hypothetical protein MIMGU_mgv1a009569mg                202   7e-59    
ref|XP_006298977.1|  hypothetical protein CARUB_v10015102mg             202   8e-59    
ref|XP_009145951.1|  PREDICTED: aldose 1-epimerase                      202   9e-59    
ref|XP_004975843.1|  PREDICTED: aldose 1-epimerase-like                 201   3e-58    
ref|XP_003559722.1|  PREDICTED: aldose 1-epimerase-like isoform X1      202   4e-58    
ref|XP_006431105.1|  hypothetical protein CICLE_v100120043mg            196   5e-58    
ref|XP_006431106.1|  hypothetical protein CICLE_v100120043mg            195   2e-57    
gb|EAY90251.1|  hypothetical protein OsI_11823                          197   1e-56    
ref|NP_001050238.1|  Os03g0381000                                       197   1e-56    
gb|EPS66431.1|  aldose 1-epimerase family protein                       194   4e-56    
gb|KDO47395.1|  hypothetical protein CISIN_1g019518mg                   194   4e-56    
gb|EMT00805.1|  Aldose 1-epimerase                                      195   6e-56    
gb|KDP45488.1|  hypothetical protein JCGZ_09737                         193   3e-55    
ref|XP_012083800.1|  PREDICTED: aldose 1-epimerase-like                 192   5e-55    
ref|XP_004975840.1|  PREDICTED: aldose 1-epimerase-like                 192   6e-55    
ref|XP_011395547.1|  Aldose 1-epimerase                                 191   1e-54    
gb|EGJ32436.1|  galactose mutarotase family enzyme                      198   1e-54    
emb|CDX91954.1|  BnaC03g32560D                                          192   5e-54    
emb|CDX74292.1|  BnaA03g27550D                                          189   5e-53    
gb|ADE77915.1|  unknown                                                 188   6e-53    
ref|XP_009134623.1|  PREDICTED: aldose 1-epimerase                      189   8e-53    
tpg|DAA37473.1|  TPA: hypothetical protein ZEAMMB73_929316              181   8e-53    
ref|XP_006648778.1|  PREDICTED: aldose 1-epimerase-like                 185   2e-52    
ref|NP_001169236.1|  hypothetical protein precursor                     185   3e-52    
ref|NP_001130052.1|  hypothetical protein precursor                     185   3e-52    
ref|XP_002446607.1|  hypothetical protein SORBIDRAFT_06g018810          182   3e-51    
ref|XP_002446609.1|  hypothetical protein SORBIDRAFT_06g018830          182   6e-51    
ref|XP_002115030.1|  hypothetical protein TRIADDRAFT_28936              179   1e-50    
ref|XP_004975841.1|  PREDICTED: aldose 1-epimerase-like isoform X1      181   2e-50    
ref|XP_002446608.1|  hypothetical protein SORBIDRAFT_06g018820          181   3e-50    
gb|AEQ94127.1|  putative aldose 1-epimerase                             177   6e-50    
ref|WP_014217007.1|  aldose 1-epimerase                                 179   1e-49    
ref|WP_040303125.1|  aldose epimerase                                   177   2e-49    
ref|WP_041623122.1|  aldose epimerase                                   177   2e-49    
ref|XP_002945807.1|  hypothetical protein VOLCADRAFT_108842             178   2e-49    
ref|XP_001696312.1|  aldose-1-epimerase                                 178   4e-49    
gb|EAZ81982.1|  aldose 1-epimerase                                      177   4e-49    
gb|ADN01229.1|  aldose 1-epimerase                                      177   5e-49    
gb|KDO72516.1|  hypothetical protein CISIN_1g0479222mg                  174   6e-49    
ref|WP_035567082.1|  aldose epimerase                                   176   8e-49    
gb|AIZ65075.1|  aldose epimerase                                        176   9e-49    
ref|WP_033411286.1|  aldose epimerase                                   176   1e-48    
ref|WP_044512808.1|  aldose epimerase                                   176   1e-48    
ref|XP_006651441.1|  PREDICTED: aldose 1-epimerase-like                 174   2e-48    
ref|WP_022823286.1|  aldose 1-epimerase                                 176   2e-48    
ref|WP_020036661.1|  hypothetical protein                               169   4e-48    
ref|WP_020148381.1|  hypothetical protein                               175   5e-48    
ref|WP_026474564.1|  aldose epimerase                                   174   5e-48    
ref|WP_010042455.1|  aldose 1-epimerase                                 174   6e-48    
ref|WP_014623924.1|  aldose epimerase                                   173   7e-48    
gb|ADI21612.1|  galactose mutarotase and related enzymes                174   1e-47    
ref|WP_044107725.1|  aldose epimerase                                   173   1e-47    
ref|WP_020474134.1|  hypothetical protein                               173   1e-47    
ref|WP_007412994.1|  aldose 1-epimerase                                 173   1e-47    
ref|XP_002732394.1|  PREDICTED: aldose 1-epimerase-like                 172   2e-47    
gb|AII50869.1|  hypothetical protein N008_02595                         172   2e-47    
ref|WP_014454566.1|  galactose mutarotase                               172   2e-47    
ref|WP_044018224.1|  aldose epimerase                                   172   2e-47    
ref|WP_010423646.1|  aldose 1-epimerase                                 172   2e-47    
ref|WP_034257000.1|  aldose epimerase                                   172   3e-47    
ref|WP_026967330.1|  aldose epimerase                                   172   4e-47    
ref|XP_790746.3|  PREDICTED: aldose 1-epimerase-like                    171   5e-47    
dbj|GAO42453.1|  aldose 1-epimerase                                     171   7e-47    
ref|WP_010527222.1|  aldose 1-epimerase                                 171   9e-47    
ref|WP_031497495.1|  aldose epimerase                                   170   9e-47    
ref|WP_041974916.1|  aldose epimerase                                   171   9e-47    
emb|CDM64824.1|  aldose 1-epimerase                                     171   1e-46    
ref|XP_006083544.1|  PREDICTED: aldose 1-epimerase                      169   1e-46    
gb|EAZ23543.1|  hypothetical protein OsJ_07241                          171   1e-46    
ref|WP_041869949.1|  aldose epimerase                                   171   1e-46    
ref|WP_035471832.1|  aldose epimerase                                   170   2e-46    
ref|WP_028788649.1|  aldose epimerase                                   170   2e-46    
ref|WP_041400237.1|  aldose epimerase                                   169   2e-46    
ref|WP_022211643.1|  aldose 1-epimerase (Mutarotase)                    169   3e-46    
ref|WP_036775978.1|  aldose epimerase                                   170   3e-46    
ref|XP_006755980.1|  PREDICTED: aldose 1-epimerase                      169   3e-46    
ref|WP_040547305.1|  aldose epimerase                                   170   3e-46    
gb|EEF62009.1|  Aldose 1-epimerase                                      170   4e-46    
ref|WP_044517622.1|  aldose epimerase                                   170   4e-46    
gb|ADY61345.1|  aldose 1-epimerase                                      169   4e-46    
ref|XP_002035526.1|  GM13871                                            169   4e-46    
gb|ACS92849.1|  MIP04215p                                               169   4e-46    
ref|NP_648026.1|  CG10467                                               169   4e-46    
ref|WP_008193754.1|  MULTISPECIES: aldose 1-epimerase                   169   5e-46    
ref|XP_004909179.1|  PREDICTED: aldose 1-epimerase isoform X2           168   5e-46    
ref|WP_026137299.1|  aldose epimerase                                   169   6e-46    
ref|WP_013968960.1|  aldose 1-epimerase                                 168   6e-46    
dbj|BAL54282.1|  aldose 1-epimerase                                     167   6e-46    
ref|WP_009490423.1|  galactose mutarotase-like enzyme                   168   7e-46    
gb|AAM48443.1|  RE67917p                                                169   7e-46    
ref|XP_005649176.1|  aldose 1-epimerase                                 168   7e-46    
ref|WP_041227978.1|  aldose epimerase                                   168   8e-46    
ref|XP_003473083.1|  PREDICTED: aldose 1-epimerase                      167   1e-45    
ref|XP_002083817.1|  GD13155                                            168   1e-45    
ref|WP_045687938.1|  aldose epimerase                                   168   1e-45    
ref|WP_030138506.1|  aldose epimerase                                   168   1e-45    
ref|WP_042394740.1|  aldose epimerase                                   167   1e-45    
ref|XP_005864787.1|  PREDICTED: aldose 1-epimerase                      167   1e-45    
ref|XP_005390943.1|  PREDICTED: aldose 1-epimerase                      167   1e-45    
gb|ACO47894.1|  putative aldose 1-epimerase                             168   1e-45    
ref|WP_019948597.1|  hypothetical protein                               167   1e-45    
ref|WP_015918897.1|  aldose 1-epimerase                                 167   2e-45    
ref|WP_025864460.1|  hypothetical protein                               167   2e-45    
ref|WP_020733607.1|  aldose 1-epimerase                                 167   2e-45    
ref|WP_029955704.1|  aldose epimerase                                   166   3e-45    
ref|XP_010965969.1|  PREDICTED: aldose 1-epimerase                      166   3e-45    
ref|XP_006181118.1|  PREDICTED: aldose 1-epimerase                      166   3e-45    
ref|XP_010995558.1|  PREDICTED: aldose 1-epimerase                      166   3e-45    
ref|WP_016643775.1|  putative Aldose 1-epimerase                        167   3e-45    
ref|XP_004765562.1|  PREDICTED: aldose 1-epimerase                      166   4e-45    
ref|WP_020702526.1|  hypothetical protein                               166   4e-45    
ref|XP_006151419.1|  PREDICTED: aldose 1-epimerase                      166   4e-45    
ref|XP_002596830.1|  hypothetical protein BRAFLDRAFT_284587             166   4e-45    
gb|EMI46288.1|  aldose 1-epimerase                                      166   5e-45    
ref|XP_003456731.1|  PREDICTED: aldose 1-epimerase-like isoform X1      166   6e-45    
ref|XP_004627683.1|  PREDICTED: aldose 1-epimerase                      166   6e-45    
ref|WP_038982375.1|  aldose epimerase                                   166   6e-45    
ref|WP_036360957.1|  galactose mutarotase                               166   6e-45    
ref|WP_037326103.1|  aldose epimerase                                   166   6e-45    
ref|WP_030621969.1|  aldose epimerase                                   166   7e-45    
ref|WP_044251468.1|  aldose epimerase                                   166   7e-45    
ref|WP_008071143.1|  aldose 1-epimerase                                 166   7e-45    
ref|XP_008547584.1|  PREDICTED: aldose 1-epimerase isoform X1           166   8e-45    
gb|EDY21773.1|  Aldose 1-epimerase                                      165   8e-45    
ref|WP_026333455.1|  aldose epimerase                                   166   9e-45    
ref|WP_039589204.1|  MULTISPECIES: aldose epimerase                     166   9e-45    
gb|ERM83570.1|  hypothetical protein P872_00405                         166   1e-44    
ref|WP_008011376.1|  aldose 1-epimerase                                 166   1e-44    
ref|WP_011521128.1|  aldose 1-epimerase                                 166   1e-44    
ref|WP_012910340.1|  aldose 1-epimerase                                 166   1e-44    
ref|WP_013557686.1|  aldose 1-epimerase                                 166   1e-44    
ref|WP_006926540.1|  aldose 1-epimerase                                 166   1e-44    
ref|WP_007901713.1|  aldose 1-epimerase                                 166   1e-44    
ref|XP_001500653.1|  PREDICTED: aldose 1-epimerase                      165   1e-44    
ref|WP_010663064.1|  aldose 1-epimerase                                 166   1e-44    
ref|XP_005360823.1|  PREDICTED: aldose 1-epimerase                      165   1e-44    
ref|WP_008084922.1|  aldose 1-epimerase                                 166   1e-44    
ref|WP_022599892.1|  aldose 1-epimerase                                 165   1e-44    
ref|XP_008979086.1|  PREDICTED: aldose 1-epimerase                      164   1e-44    
ref|WP_023923045.1|  hypothetical protein                               165   2e-44    
ref|XP_002093883.1|  GE20511                                            165   2e-44    
ref|WP_005609810.1|  aldose 1-epimerase                                 164   2e-44    
ref|WP_009318184.1|  MULTISPECIES: aldose 1-epimerase                   165   2e-44    
ref|WP_007226529.1|  aldose 1-epimerase                                 164   2e-44    
ref|XP_004418183.1|  PREDICTED: aldose 1-epimerase                      164   2e-44    
ref|XP_005630417.1|  PREDICTED: aldose 1-epimerase isoform X2           163   2e-44    
ref|WP_042724385.1|  aldose epimerase                                   165   2e-44    
ref|WP_046062093.1|  aldose epimerase                                   165   2e-44    
ref|XP_005630416.1|  PREDICTED: aldose 1-epimerase isoform X1           163   2e-44    
ref|XP_006215616.1|  PREDICTED: aldose 1-epimerase                      164   2e-44    
ref|WP_021597659.1|  hypothetical protein                               165   2e-44    
ref|XP_006745353.1|  PREDICTED: aldose 1-epimerase                      164   2e-44    
ref|XP_006587469.1|  PREDICTED: aldose 1-epimerase-like isoform X2      160   3e-44    
ref|WP_003200080.1|  MULTISPECIES: aldose 1-epimerase                   165   3e-44    
ref|WP_041074064.1|  aldose epimerase                                   165   3e-44    
ref|WP_039652883.1|  aldose epimerase                                   164   3e-44    
ref|WP_011335064.1|  aldose 1-epimerase                                 165   3e-44    
ref|WP_004082991.1|  aldose 1-epimerase                                 164   3e-44    
ref|WP_035655159.1|  hypothetical protein                               164   3e-44    
ref|XP_004410051.1|  PREDICTED: aldose 1-epimerase                      164   3e-44    
ref|WP_043189420.1|  aldose epimerase                                   165   3e-44    
ref|NP_001277522.1|  galactose mutarotase (aldose 1-epimerase)          164   3e-44    
ref|WP_009254455.1|  MULTISPECIES: hypothetical protein                 164   3e-44    



>ref|XP_009615365.1| PREDICTED: aldose 1-epimerase [Nicotiana tomentosiformis]
Length=353

 Score =   312 bits (799),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 145/187 (78%), Positives = 167/187 (89%), Gaps = 0/187 (0%)
 Frame = -1

Query  772  NQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTGA  593
            N+L I+M+AK LNKATPVNLASHTYWNLGGH SG+I SHTIQLF SKITPV++KLIPTG 
Sbjct  166  NKLAIKMQAKPLNKATPVNLASHTYWNLGGHTSGNIFSHTIQLFGSKITPVNDKLIPTGQ  225

Query  592  ISPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGLKHLGKAAVVVDSKSGRKMELW  413
            I+PV+GTA+DFL+ R IGS+ +++PGGYDINYVLD+   KHL + A+V +SKSGRKMELW
Sbjct  226  ITPVEGTAYDFLKPRTIGSKFSDIPGGYDINYVLDNTEGKHLQRVAIVQESKSGRKMELW  285

Query  412  TNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETYDH  233
            TNKPGVQFYTSNML + KGKGG+VY K+AALCLETQGFPDSVN PNFPSQIVNPGETY H
Sbjct  286  TNKPGVQFYTSNMLENAKGKGGFVYSKYAALCLETQGFPDSVNHPNFPSQIVNPGETYKH  345

Query  232  VMVYRFT  212
            +MVYRFT
Sbjct  346  IMVYRFT  352



>ref|XP_004236201.1| PREDICTED: aldose 1-epimerase [Solanum lycopersicum]
Length=355

 Score =   309 bits (792),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 145/187 (78%), Positives = 165/187 (88%), Gaps = 0/187 (0%)
 Frame = -1

Query  772  NQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTGA  593
            N+L + M+AK  NKATPVNLASH+YWNLGGH+SGDILS TIQ+F SKITPV++KLIP G 
Sbjct  167  NKLALIMQAKPHNKATPVNLASHSYWNLGGHNSGDILSQTIQIFGSKITPVNDKLIPNGE  226

Query  592  ISPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGLKHLGKAAVVVDSKSGRKMELW  413
            I+PVKGT FDFLQ R IGS+L+E+PGGYDINYVLD+   KHL + A+V +SKSGRKMELW
Sbjct  227  ITPVKGTGFDFLQPRTIGSKLSEIPGGYDINYVLDNTEGKHLRRVAIVEESKSGRKMELW  286

Query  412  TNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETYDH  233
            TNKPGVQFYTSNML + KGKGG+VY K+AALCLETQGFPDSVN PNFPSQIVNPGETY H
Sbjct  287  TNKPGVQFYTSNMLDNVKGKGGFVYSKYAALCLETQGFPDSVNHPNFPSQIVNPGETYKH  346

Query  232  VMVYRFT  212
            +MVYRFT
Sbjct  347  IMVYRFT  353



>ref|XP_006344389.1| PREDICTED: aldose 1-epimerase-like [Solanum tuberosum]
Length=355

 Score =   307 bits (787),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 144/187 (77%), Positives = 165/187 (88%), Gaps = 0/187 (0%)
 Frame = -1

Query  772  NQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTGA  593
            N+L + M+AK  NKATPVNLASH+YWNLGGH+SGDILS TIQ+F SKITPV++KLIP G 
Sbjct  167  NKLALIMQAKPHNKATPVNLASHSYWNLGGHNSGDILSQTIQIFGSKITPVNDKLIPNGE  226

Query  592  ISPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGLKHLGKAAVVVDSKSGRKMELW  413
            I+PVKGT FDFLQ R IGS+L+E+PGGYDINYVLD+   KHL + A+V +SKSGRKMELW
Sbjct  227  ITPVKGTGFDFLQPRTIGSKLSEIPGGYDINYVLDNTEGKHLRRVAIVQESKSGRKMELW  286

Query  412  TNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETYDH  233
            TNKPGVQFYTSNML + KGKGG+VY K+AALCLETQGFPDSVN PNFPSQIVNPG+TY H
Sbjct  287  TNKPGVQFYTSNMLDNVKGKGGFVYSKYAALCLETQGFPDSVNHPNFPSQIVNPGKTYKH  346

Query  232  VMVYRFT  212
            +MVYRFT
Sbjct  347  IMVYRFT  353



>ref|XP_009803676.1| PREDICTED: aldose 1-epimerase [Nicotiana sylvestris]
Length=353

 Score =   307 bits (787),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 144/187 (77%), Positives = 164/187 (88%), Gaps = 0/187 (0%)
 Frame = -1

Query  772  NQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTGA  593
            N+L I M+A  LN ATPVNLASHTYWNLGGH SG+I SHTIQLF SK+TPVD+KLIPTG 
Sbjct  166  NKLAINMQATPLNIATPVNLASHTYWNLGGHTSGNIFSHTIQLFGSKMTPVDDKLIPTGQ  225

Query  592  ISPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGLKHLGKAAVVVDSKSGRKMELW  413
            I+PV+GTA+DFL+ R IGS+ +++PGGYDINYVLD+   KHL K A+V +SKSGRKMELW
Sbjct  226  ITPVEGTAYDFLKPRTIGSKFSDIPGGYDINYVLDNTEGKHLQKVAIVQESKSGRKMELW  285

Query  412  TNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETYDH  233
            TNKPGVQFYTSNML + KGKGG+VY K+AALCLETQGFPDSVN PNFPSQIVNPGETY H
Sbjct  286  TNKPGVQFYTSNMLENAKGKGGFVYSKYAALCLETQGFPDSVNHPNFPSQIVNPGETYKH  345

Query  232  VMVYRFT  212
            +MVYRFT
Sbjct  346  IMVYRFT  352



>ref|XP_011071623.1| PREDICTED: aldose 1-epimerase [Sesamum indicum]
Length=353

 Score =   299 bits (765),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 145/188 (77%), Positives = 159/188 (85%), Gaps = 1/188 (1%)
 Frame = -1

Query  772  NQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTGA  593
            N+LGI+M+AK+LNK TPVNLASHTYWNLGGH SGDILSHTI+L  S+ITPVD+KLIPTG 
Sbjct  164  NKLGIKMQAKSLNKPTPVNLASHTYWNLGGHTSGDILSHTIRLQASRITPVDDKLIPTGE  223

Query  592  ISPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGL-KHLGKAAVVVDSKSGRKMEL  416
            ISPVKGT +DFL+ R IGS+  ELP GYDINYVLD  G  KH  K A V + KSGRKMEL
Sbjct  224  ISPVKGTPYDFLERRKIGSKFTELPDGYDINYVLDRTGDGKHFMKVATVHEEKSGRKMEL  283

Query  415  WTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETYD  236
            WTN+PGVQFYTSNML DT GKGG+VYKKHAA CLETQGFPDSVN PNFPSQI+ PG  Y 
Sbjct  284  WTNQPGVQFYTSNMLPDTVGKGGFVYKKHAAFCLETQGFPDSVNHPNFPSQILLPGVEYR  343

Query  235  HVMVYRFT  212
            HVMVYRFT
Sbjct  344  HVMVYRFT  351



>ref|XP_008239819.1| PREDICTED: aldose 1-epimerase [Prunus mume]
Length=366

 Score =   297 bits (760),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 139/187 (74%), Positives = 161/187 (86%), Gaps = 0/187 (0%)
 Frame = -1

Query  772  NQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTGA  593
            N+L I+M+AKALNKATPVNLA HTYWNL GH+SGDILSH +QLF S ITPV+++LIPTG 
Sbjct  178  NKLAIKMEAKALNKATPVNLAHHTYWNLRGHNSGDILSHHLQLFGSNITPVNDQLIPTGE  237

Query  592  ISPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGLKHLGKAAVVVDSKSGRKMELW  413
            I+PVKGT +DFL+A+ IGS++NELP GYDINYVLD    KHL KA V+ DS SGRK+ELW
Sbjct  238  IAPVKGTPYDFLEAQEIGSKINELPDGYDINYVLDPSSYKHLRKAVVLRDSVSGRKLELW  297

Query  412  TNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETYDH  233
            TN PG+QFYTSN L + KGK G+VYKKHAA+CLETQGFPD+VN PNFPSQ+V PGETY H
Sbjct  298  TNMPGLQFYTSNKLDNVKGKDGFVYKKHAAVCLETQGFPDAVNHPNFPSQVVKPGETYLH  357

Query  232  VMVYRFT  212
            VMVYRFT
Sbjct  358  VMVYRFT  364



>ref|XP_007210522.1| hypothetical protein PRUPE_ppa007822mg [Prunus persica]
 gb|EMJ11721.1| hypothetical protein PRUPE_ppa007822mg [Prunus persica]
Length=354

 Score =   294 bits (752),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 138/187 (74%), Positives = 160/187 (86%), Gaps = 0/187 (0%)
 Frame = -1

Query  772  NQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTGA  593
            N+L I+M+AKALNKATPVNLA HTYWNL GH+SGDILSH +QLF S ITPV+++LIPTG 
Sbjct  166  NKLAIKMEAKALNKATPVNLAHHTYWNLRGHNSGDILSHHLQLFGSNITPVNDQLIPTGE  225

Query  592  ISPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGLKHLGKAAVVVDSKSGRKMELW  413
            I+PVKGT +DFL+ + IGS++NELP GYDINYVLD    KHL KA V+ DS SGRK+ELW
Sbjct  226  IAPVKGTPYDFLEPQEIGSKINELPDGYDINYVLDPSSYKHLRKAVVLRDSVSGRKLELW  285

Query  412  TNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETYDH  233
            TN PG+QFYTSN L + KGK G+VY+KHAA+CLETQGFPD+VN PNFPSQIV PGETY H
Sbjct  286  TNMPGLQFYTSNKLDNVKGKDGFVYEKHAAVCLETQGFPDAVNHPNFPSQIVKPGETYLH  345

Query  232  VMVYRFT  212
            VMVYRFT
Sbjct  346  VMVYRFT  352



>ref|XP_004299386.1| PREDICTED: aldose 1-epimerase [Fragaria vesca subsp. vesca]
Length=380

 Score =   293 bits (750),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 137/187 (73%), Positives = 159/187 (85%), Gaps = 0/187 (0%)
 Frame = -1

Query  766  LGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTGAIS  587
            L I+M+AKAL K TPVNLA HTYWNL GH+SGDILSH I +F S ITPV+++LIPTG I+
Sbjct  194  LAIKMEAKALTKVTPVNLAHHTYWNLRGHNSGDILSHKIHIFGSNITPVNDELIPTGDIA  253

Query  586  PVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGLKHLGKAAVVVDSKSGRKMELWTN  407
            PVKGTA+DFL+ R IGS +NELP GYDINY++D     HL KAAV+ DS SGRKMELWTN
Sbjct  254  PVKGTAYDFLEPREIGSRINELPDGYDINYIMDPSSPDHLRKAAVLHDSVSGRKMELWTN  313

Query  406  KPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETYDHVM  227
            +PG+QFYTSNML D KGKGG+VYKK+AA+CLETQGFPDSVN PNFPSQI+NPG+TY H M
Sbjct  314  QPGLQFYTSNMLNDVKGKGGFVYKKYAAVCLETQGFPDSVNHPNFPSQILNPGDTYMHSM  373

Query  226  VYRFTTH  206
            VYRFT +
Sbjct  374  VYRFTAN  380



>ref|XP_007037270.1| Galactose mutarotase-like superfamily protein [Theobroma cacao]
 gb|EOY21771.1| Galactose mutarotase-like superfamily protein [Theobroma cacao]
Length=398

 Score =   292 bits (748),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 139/189 (74%), Positives = 157/189 (83%), Gaps = 0/189 (0%)
 Frame = -1

Query  772  NQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTGA  593
            N+LG++M+AK LNKATPVNLA HTYWNLGGH SGDILSHT+QLF S ITPVD++LIPTG 
Sbjct  210  NKLGVKMEAKPLNKATPVNLALHTYWNLGGHSSGDILSHTLQLFGSSITPVDDELIPTGK  269

Query  592  ISPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGLKHLGKAAVVVDSKSGRKMELW  413
            I PV+GT +DFLQ   IGS L++LP GYD+NYVLD    +HL K AVV +SKSGRKMELW
Sbjct  270  IDPVQGTPYDFLQPHEIGSMLDQLPHGYDVNYVLDKSSPQHLRKVAVVHESKSGRKMELW  329

Query  412  TNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETYDH  233
            TNKPGVQ YTSNML   KGK G+VY  +A LCLETQGFPDSVN PNFPSQIVNPGET  H
Sbjct  330  TNKPGVQVYTSNMLKSEKGKDGFVYSTYAGLCLETQGFPDSVNHPNFPSQIVNPGETCKH  389

Query  232  VMVYRFTTH  206
             MV+RFTT+
Sbjct  390  FMVFRFTTN  398



>ref|XP_007037277.1| Galactose mutarotase-like superfamily protein [Theobroma cacao]
 gb|EOY21778.1| Galactose mutarotase-like superfamily protein [Theobroma cacao]
Length=455

 Score =   294 bits (752),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 139/189 (74%), Positives = 157/189 (83%), Gaps = 0/189 (0%)
 Frame = -1

Query  772  NQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTGA  593
            N+LG++M+AK LNKATPVNLA HTYWNLGGH SGDILSHT+QLF S ITPVD++LIPTG 
Sbjct  267  NKLGVKMEAKPLNKATPVNLALHTYWNLGGHSSGDILSHTLQLFGSSITPVDDELIPTGK  326

Query  592  ISPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGLKHLGKAAVVVDSKSGRKMELW  413
            I PV+GT +DFLQ   IGS L++LP GYD+NYVLD    +HL K AVV +SKSGRKMELW
Sbjct  327  IDPVQGTPYDFLQPHEIGSMLDQLPHGYDVNYVLDKSSPQHLRKVAVVHESKSGRKMELW  386

Query  412  TNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETYDH  233
            TNKPGVQ YTSNML   KGK G+VY  +A LCLETQGFPDSVN PNFPSQIVNPGETY H
Sbjct  387  TNKPGVQVYTSNMLKSEKGKDGFVYSTYAGLCLETQGFPDSVNHPNFPSQIVNPGETYKH  446

Query  232  VMVYRFTTH  206
             MV+RFT +
Sbjct  447  FMVFRFTAN  455



>ref|XP_006439628.1| hypothetical protein CICLE_v10024457mg [Citrus clementina]
 gb|ESR52868.1| hypothetical protein CICLE_v10024457mg [Citrus clementina]
Length=359

 Score =   290 bits (742),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 136/188 (72%), Positives = 154/188 (82%), Gaps = 0/188 (0%)
 Frame = -1

Query  775  QNQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTG  596
            +N L ++MKAK L KATPVNLA HTYWNLGGH SGDI SH +QLF S +TPV+++LIPTG
Sbjct  170  ENNLVVKMKAKPLEKATPVNLALHTYWNLGGHSSGDIFSHKLQLFGSHVTPVNDRLIPTG  229

Query  595  AISPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGLKHLGKAAVVVDSKSGRKMEL  416
             I+PV GT +DFLQ R IGS+  ELP GYDINYVLD+   +HL K AVV +S SGRKMEL
Sbjct  230  KITPVTGTPYDFLQPREIGSKFKELPDGYDINYVLDNPNPEHLKKVAVVSESVSGRKMEL  289

Query  415  WTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETYD  236
            WTNKPGVQFYTSNML   KGK G+VY  +A  CLETQGFPDSVN PNFPSQ+VNPGETY+
Sbjct  290  WTNKPGVQFYTSNMLGKVKGKDGFVYSNYAGFCLETQGFPDSVNNPNFPSQVVNPGETYN  349

Query  235  HVMVYRFT  212
            HVMVYRFT
Sbjct  350  HVMVYRFT  357



>emb|CDP12362.1| unnamed protein product [Coffea canephora]
Length=362

 Score =   290 bits (741),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 136/189 (72%), Positives = 156/189 (83%), Gaps = 0/189 (0%)
 Frame = -1

Query  772  NQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTGA  593
            N+LG++M+A  L+KATP+NLASH+YWNL GH SGDI SH IQLF SKITPVD+KLIPTG 
Sbjct  173  NRLGLKMEATPLDKATPINLASHSYWNLAGHGSGDIFSHDIQLFASKITPVDDKLIPTGQ  232

Query  592  ISPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGLKHLGKAAVVVDSKSGRKMELW  413
            I PV+GT +DFLQ+R+IGS+ NELP GYDINYV+D     H+ K AVV + KSGRKMELW
Sbjct  233  IVPVQGTPYDFLQSRSIGSKFNELPSGYDINYVVDYVPNGHVHKVAVVQEPKSGRKMELW  292

Query  412  TNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETYDH  233
            +NKPGVQFYTSNML DT GK G  Y+++  L LETQGFPDSVN PNFPSQIVNPGE Y H
Sbjct  293  SNKPGVQFYTSNMLNDTLGKDGATYRRYGGLALETQGFPDSVNHPNFPSQIVNPGENYLH  352

Query  232  VMVYRFTTH  206
            VMVYRFT H
Sbjct  353  VMVYRFTAH  361



>ref|XP_006477524.1| PREDICTED: aldose 1-epimerase-like [Citrus sinensis]
Length=359

 Score =   290 bits (741),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 136/188 (72%), Positives = 153/188 (81%), Gaps = 0/188 (0%)
 Frame = -1

Query  775  QNQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTG  596
            +N L ++MKAK L KATPVNLA HTYWNLGGH SGDI SH +QLF S +TPVD++LIPTG
Sbjct  170  ENNLVVKMKAKPLEKATPVNLALHTYWNLGGHSSGDIFSHKLQLFGSHVTPVDDRLIPTG  229

Query  595  AISPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGLKHLGKAAVVVDSKSGRKMEL  416
             I+PV GT +DFLQ R IGS+  ELP GYDINYVLD+   +HL K AVV +S SGRKMEL
Sbjct  230  KITPVTGTPYDFLQPREIGSKFKELPDGYDINYVLDNPNPEHLKKVAVVSESVSGRKMEL  289

Query  415  WTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETYD  236
            WTNKPGVQFYTSNML    GK G+VY  +A  CLETQGFPDSVN PNFPSQ+VNPGETY+
Sbjct  290  WTNKPGVQFYTSNMLGKVMGKDGFVYSNYAGFCLETQGFPDSVNNPNFPSQVVNPGETYN  349

Query  235  HVMVYRFT  212
            HVMVYRFT
Sbjct  350  HVMVYRFT  357



>gb|KDO76084.1| hypothetical protein CISIN_1g043310mg [Citrus sinensis]
Length=359

 Score =   288 bits (736),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 135/188 (72%), Positives = 153/188 (81%), Gaps = 0/188 (0%)
 Frame = -1

Query  775  QNQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTG  596
            +N L ++MKAK L KATPVNLA HTYWNLGGH SGDI SH +QLF S +TPV+++LIPTG
Sbjct  170  ENNLVVKMKAKPLEKATPVNLALHTYWNLGGHSSGDIFSHKLQLFGSHVTPVNDRLIPTG  229

Query  595  AISPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGLKHLGKAAVVVDSKSGRKMEL  416
             I+PV GT +DFLQ R IGS+  ELP GYDINYVLD+   +HL K AVV +S SGRKMEL
Sbjct  230  KITPVTGTPYDFLQPREIGSKFKELPDGYDINYVLDNPNPEHLKKVAVVSESVSGRKMEL  289

Query  415  WTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETYD  236
            WTNKPGVQFYTSNML    GK G+VY  +A  CLETQGFPDSVN PNFPSQ+VNPGETY+
Sbjct  290  WTNKPGVQFYTSNMLGKVMGKDGFVYSNYAGFCLETQGFPDSVNNPNFPSQVVNPGETYN  349

Query  235  HVMVYRFT  212
            HVMVYRFT
Sbjct  350  HVMVYRFT  357



>ref|XP_009149871.1| PREDICTED: aldose 1-epimerase [Brassica rapa]
Length=357

 Score =   284 bits (727),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 133/190 (70%), Positives = 155/190 (82%), Gaps = 0/190 (0%)
 Frame = -1

Query  775  QNQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTG  596
            +N+L ++M+AK LNK TP+NLA HTYWNL GH+SGDILSH IQL   KITPVDE+LIPTG
Sbjct  168  ENKLALKMEAKPLNKPTPINLALHTYWNLHGHNSGDILSHKIQLLAKKITPVDEELIPTG  227

Query  595  AISPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGLKHLGKAAVVVDSKSGRKMEL  416
             I+ +KGT +DFL+ R IGS + ELPGGYDINYV+D    KHL K AVV +  +GRKMEL
Sbjct  228  EITSIKGTPYDFLEPREIGSRIQELPGGYDINYVIDGIVGKHLRKTAVVSEKVTGRKMEL  287

Query  415  WTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETYD  236
            WTN+PGVQFYTSN+LT   GKG  VYKK+A LCLETQGFPDSVN  NFPSQIVNPGE+Y 
Sbjct  288  WTNQPGVQFYTSNLLTSVVGKGNAVYKKYAGLCLETQGFPDSVNHKNFPSQIVNPGESYL  347

Query  235  HVMVYRFTTH  206
            HVM++RFT H
Sbjct  348  HVMLFRFTAH  357



>gb|EYU35859.1| hypothetical protein MIMGU_mgv1a008920mg [Erythranthe guttata]
Length=358

 Score =   284 bits (726),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 138/190 (73%), Positives = 156/190 (82%), Gaps = 2/190 (1%)
 Frame = -1

Query  775  QNQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTG  596
            +++L I+M+A  L K TPVNLASHTYWNLGGH+SGDI SHTIQL  SKITPV++KLIPTG
Sbjct  167  KHKLAIKMEATPLTKPTPVNLASHTYWNLGGHNSGDIFSHTIQLLASKITPVNDKLIPTG  226

Query  595  AISPVKGTAFDFLQARAIGSELNELPGGYDINYVLD--SHGLKHLGKAAVVVDSKSGRKM  422
             +SPV+GT +DFL  R IGS+ NELP GYDINYVLD  S  + H  KAAVV   KSGRKM
Sbjct  227  KLSPVEGTPYDFLHPRTIGSKFNELPDGYDINYVLDRPSGPIHHFTKAAVVQHEKSGRKM  286

Query  421  ELWTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGET  242
            ELWTN+ GVQFYTSNML DT GKGG+VYKKHAA+ LETQGFPDSVN PNFPSQIV+ G+ 
Sbjct  287  ELWTNQIGVQFYTSNMLNDTVGKGGFVYKKHAAIALETQGFPDSVNHPNFPSQIVDVGDK  346

Query  241  YDHVMVYRFT  212
            Y H MVYRFT
Sbjct  347  YVHAMVYRFT  356



>emb|CDY24155.1| BnaC03g57220D [Brassica napus]
Length=359

 Score =   283 bits (724),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 132/190 (69%), Positives = 156/190 (82%), Gaps = 0/190 (0%)
 Frame = -1

Query  775  QNQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTG  596
            +N+L ++M+ K LNK TP+NLA HTYWNL GH+SGDILSH IQL   KITPVDE+LIPTG
Sbjct  170  ENKLALKMEGKPLNKPTPINLALHTYWNLHGHNSGDILSHKIQLLAKKITPVDEELIPTG  229

Query  595  AISPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGLKHLGKAAVVVDSKSGRKMEL  416
             I+ ++GT +DFL+ R IGS ++ELPGGYDINYV+D    KHL KAAVV +  +GRKMEL
Sbjct  230  EITSIEGTPYDFLEPREIGSRIHELPGGYDINYVIDGIVGKHLRKAAVVSEKVTGRKMEL  289

Query  415  WTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETYD  236
            WTN+PGVQFYTSN+LT   GKG  VYKK+A LCLETQGFPDSVN  NFPSQIVNPGE+Y 
Sbjct  290  WTNQPGVQFYTSNLLTSVVGKGNAVYKKYAGLCLETQGFPDSVNHKNFPSQIVNPGESYL  349

Query  235  HVMVYRFTTH  206
            HVM++RFT H
Sbjct  350  HVMLFRFTAH  359



>gb|KFK34079.1| hypothetical protein AALP_AA5G099600 [Arabis alpina]
Length=359

 Score =   282 bits (722),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 131/190 (69%), Positives = 154/190 (81%), Gaps = 0/190 (0%)
 Frame = -1

Query  775  QNQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTG  596
            QN+L ++M+AK LNK TP+NLA HTYWNL  H+SGD+LSH IQL   KITPVDEKLIPTG
Sbjct  170  QNKLALKMEAKPLNKPTPINLALHTYWNLHSHNSGDVLSHKIQLHAGKITPVDEKLIPTG  229

Query  595  AISPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGLKHLGKAAVVVDSKSGRKMEL  416
             I+P+ GT +DFL+ R+IGS + ELPGGYDINYV+D    KHL K AVV +  +GRKMEL
Sbjct  230  EITPIHGTPYDFLEPRSIGSRIKELPGGYDINYVIDGTAGKHLRKTAVVSEEVTGRKMEL  289

Query  415  WTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETYD  236
            WTN+PGVQFYTSNM+T   GKG  VY+K+  LCLETQGFPDSVN  NFPSQIVNPGE+Y 
Sbjct  290  WTNQPGVQFYTSNMMTRVVGKGKAVYEKYGGLCLETQGFPDSVNHKNFPSQIVNPGESYL  349

Query  235  HVMVYRFTTH  206
            HVM++RFT H
Sbjct  350  HVMLFRFTAH  359



>ref|XP_006291372.1| hypothetical protein CARUB_v10017512mg [Capsella rubella]
 gb|EOA24270.1| hypothetical protein CARUB_v10017512mg [Capsella rubella]
Length=358

 Score =   282 bits (722),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 130/190 (68%), Positives = 155/190 (82%), Gaps = 0/190 (0%)
 Frame = -1

Query  775  QNQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTG  596
            +N+LG++M+AK LNK TP+NLA HTYWNL GH+SGDILSH IQLF  KITPVD+KLIPTG
Sbjct  169  ENKLGVKMEAKPLNKPTPINLALHTYWNLRGHNSGDILSHKIQLFAGKITPVDDKLIPTG  228

Query  595  AISPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGLKHLGKAAVVVDSKSGRKMEL  416
             I+ + GT +DFL+ R IG+ ++ELPGGYDINYV+D    KHL KAAVV +  +GRKMEL
Sbjct  229  EITSISGTPYDFLEPRRIGARIHELPGGYDINYVIDGQIGKHLRKAAVVTEDVTGRKMEL  288

Query  415  WTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETYD  236
            WTN+PGVQFYTSNM+    GKG  VY K+  LCLETQGFPDSVN  NFP+QIVNPGE+Y 
Sbjct  289  WTNQPGVQFYTSNMMKRVVGKGNAVYGKYGGLCLETQGFPDSVNHKNFPTQIVNPGESYL  348

Query  235  HVMVYRFTTH  206
            HVM++RFT H
Sbjct  349  HVMLFRFTAH  358



>ref|XP_002511545.1| aldose-1-epimerase, putative [Ricinus communis]
 gb|EEF52147.1| aldose-1-epimerase, putative [Ricinus communis]
Length=364

 Score =   282 bits (722),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 133/189 (70%), Positives = 153/189 (81%), Gaps = 0/189 (0%)
 Frame = -1

Query  772  NQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTGA  593
            N+LG++M AK  +K TPVN+A HTYWNLGGH+SGDI SHTIQ+F SKITPVD+ LIPTG 
Sbjct  176  NRLGVKMIAKPKDKPTPVNIALHTYWNLGGHNSGDIFSHTIQIFGSKITPVDKDLIPTGE  235

Query  592  ISPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGLKHLGKAAVVVDSKSGRKMELW  413
            I  ++GT +DFLQ R IGS   ELP GYD+NYVL      HL KAAVV DS SGR MELW
Sbjct  236  IKSMEGTPYDFLQPRTIGSRFKELPDGYDMNYVLQDLNPGHLKKAAVVKDSVSGRTMELW  295

Query  412  TNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETYDH  233
            TNKPG+QFYTSNML + +GK G VYK++A + LETQGFPDSVN PNFPSQIVNPGETY+H
Sbjct  296  TNKPGLQFYTSNMLDNVEGKDGAVYKRYAGIALETQGFPDSVNHPNFPSQIVNPGETYEH  355

Query  232  VMVYRFTTH  206
            +MVYRFT H
Sbjct  356  IMVYRFTAH  364



>emb|CDY36929.1| BnaA06g17140D [Brassica napus]
Length=357

 Score =   282 bits (721),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 132/190 (69%), Positives = 155/190 (82%), Gaps = 0/190 (0%)
 Frame = -1

Query  775  QNQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTG  596
            +N+L ++M+AK LNK TP+NLA HTYWNL GH+SGDILSH IQL   KITPVDE+LIPTG
Sbjct  168  ENKLALKMEAKPLNKPTPINLALHTYWNLHGHNSGDILSHKIQLLAKKITPVDEELIPTG  227

Query  595  AISPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGLKHLGKAAVVVDSKSGRKMEL  416
             I+ +KGT +DFL+ R IGS ++ELPGGYDINYV+D    KHL K AVV +  +GRKMEL
Sbjct  228  EITSIKGTPYDFLEPREIGSRIHELPGGYDINYVIDGIVGKHLRKTAVVSEKVTGRKMEL  287

Query  415  WTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETYD  236
            WTN+PGVQFYTSN+L    GKG  VYKK+A LCLETQGFPDSVN  NFPSQIVNPGE+Y 
Sbjct  288  WTNQPGVQFYTSNLLKSVVGKGNAVYKKYAGLCLETQGFPDSVNHKNFPSQIVNPGESYL  347

Query  235  HVMVYRFTTH  206
            HVM++RFT H
Sbjct  348  HVMLFRFTAH  357



>ref|XP_012080544.1| PREDICTED: aldose 1-epimerase [Jatropha curcas]
Length=359

 Score =   280 bits (717),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 132/187 (71%), Positives = 154/187 (82%), Gaps = 1/187 (1%)
 Frame = -1

Query  772  NQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTGA  593
            N++ ++M AK LNKATPVNLA HTY+NL GH+SGDILSH IQLF  +ITPVD +LIPTG 
Sbjct  172  NKIAVKMVAKPLNKATPVNLALHTYFNLAGHNSGDILSHKIQLFAPEITPVDSELIPTGK  231

Query  592  ISPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGLKHLGKAAVVVDSKSGRKMELW  413
            I+PVKGT FDFL+ R IGS + E+PG YDINYVL+     HL +AA+V +  SGRK+ELW
Sbjct  232  ITPVKGTPFDFLEPREIGSRIKEVPG-YDINYVLEDLKSGHLKRAAIVKEDVSGRKLELW  290

Query  412  TNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETYDH  233
            TN+PGVQFYTSNML D KGK G++Y+K A  CLETQGFPDSVN PNFPSQIVNPGETY H
Sbjct  291  TNQPGVQFYTSNMLHDVKGKDGFIYQKFAGFCLETQGFPDSVNHPNFPSQIVNPGETYMH  350

Query  232  VMVYRFT  212
            +MVYRFT
Sbjct  351  IMVYRFT  357



>gb|KDP31227.1| hypothetical protein JCGZ_11603 [Jatropha curcas]
Length=352

 Score =   280 bits (716),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 132/187 (71%), Positives = 154/187 (82%), Gaps = 1/187 (1%)
 Frame = -1

Query  772  NQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTGA  593
            N++ ++M AK LNKATPVNLA HTY+NL GH+SGDILSH IQLF  +ITPVD +LIPTG 
Sbjct  165  NKIAVKMVAKPLNKATPVNLALHTYFNLAGHNSGDILSHKIQLFAPEITPVDSELIPTGK  224

Query  592  ISPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGLKHLGKAAVVVDSKSGRKMELW  413
            I+PVKGT FDFL+ R IGS + E+PG YDINYVL+     HL +AA+V +  SGRK+ELW
Sbjct  225  ITPVKGTPFDFLEPREIGSRIKEVPG-YDINYVLEDLKSGHLKRAAIVKEDVSGRKLELW  283

Query  412  TNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETYDH  233
            TN+PGVQFYTSNML D KGK G++Y+K A  CLETQGFPDSVN PNFPSQIVNPGETY H
Sbjct  284  TNQPGVQFYTSNMLHDVKGKDGFIYQKFAGFCLETQGFPDSVNHPNFPSQIVNPGETYMH  343

Query  232  VMVYRFT  212
            +MVYRFT
Sbjct  344  IMVYRFT  350



>ref|XP_010547806.1| PREDICTED: aldose 1-epimerase-like [Tarenaya hassleriana]
Length=357

 Score =   280 bits (717),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 132/189 (70%), Positives = 154/189 (81%), Gaps = 1/189 (1%)
 Frame = -1

Query  772  NQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTGA  593
            N+LG++M+AK L+K TP+NLA HTYWNL G  SGDILSH IQLF S ITPVD++LIPTG 
Sbjct  170  NKLGVKMEAKPLSKPTPINLALHTYWNLKGQSSGDILSHDIQLFASHITPVDDQLIPTGK  229

Query  592  ISPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGLKHLGKAAVVVDSKSGRKMELW  413
            IS V GT +DFL +R IGS ++ELPGGYDINYV+D     HL + AVV +S SGR+MELW
Sbjct  230  ISAVAGTPYDFLGSRPIGSRIDELPGGYDINYVIDGES-GHLRRTAVVTESVSGRRMELW  288

Query  412  TNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETYDH  233
            +N+ GVQFYTSNMLT  +GKGGYVY K+  LCLETQGFPDSVN  NFPSQIVNPG+TY H
Sbjct  289  SNQVGVQFYTSNMLTSVRGKGGYVYSKYGGLCLETQGFPDSVNHENFPSQIVNPGDTYLH  348

Query  232  VMVYRFTTH  206
            VMV+RFT H
Sbjct  349  VMVFRFTAH  357



>ref|XP_006404338.1| hypothetical protein EUTSA_v10010502mg [Eutrema salsugineum]
 gb|ESQ45791.1| hypothetical protein EUTSA_v10010502mg [Eutrema salsugineum]
Length=343

 Score =   280 bits (715),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 128/190 (67%), Positives = 154/190 (81%), Gaps = 0/190 (0%)
 Frame = -1

Query  775  QNQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTG  596
            +N+L ++M+AK +NK TP+NLA HTYWNL  H+SGDILSH IQL   KITPVD+KLIPTG
Sbjct  154  ENKLAVKMEAKPINKPTPINLALHTYWNLHSHNSGDILSHKIQLLAGKITPVDKKLIPTG  213

Query  595  AISPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGLKHLGKAAVVVDSKSGRKMEL  416
             I+ ++GT +DFL+ R IGS ++ELPGGYDINYV+D    KHL K A+V +  +GRKMEL
Sbjct  214  EITAIEGTPYDFLEPREIGSRIDELPGGYDINYVIDGIAGKHLRKTAIVSEESTGRKMEL  273

Query  415  WTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETYD  236
            W+N+PGVQFYTSN+LT   GK   VYKKHA LCLETQGFPDSVN  NFPSQIVNPGE+Y 
Sbjct  274  WSNQPGVQFYTSNLLTRVAGKERAVYKKHAGLCLETQGFPDSVNHNNFPSQIVNPGESYL  333

Query  235  HVMVYRFTTH  206
            HVM++RFT H
Sbjct  334  HVMLFRFTAH  343



>ref|XP_010029392.1| PREDICTED: aldose 1-epimerase-like [Eucalyptus grandis]
 gb|KCW83563.1| hypothetical protein EUGRSUZ_B00459 [Eucalyptus grandis]
Length=356

 Score =   280 bits (715),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 126/189 (67%), Positives = 158/189 (84%), Gaps = 0/189 (0%)
 Frame = -1

Query  772  NQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTGA  593
            ++LG++++AKAL+K+TPVNLA HTYWNL G +SG+ILSH IQLF SKITPVD  LIPTG 
Sbjct  168  DKLGVKLEAKALDKSTPVNLALHTYWNLAGQNSGNILSHEIQLFASKITPVDSALIPTGE  227

Query  592  ISPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGLKHLGKAAVVVDSKSGRKMELW  413
            I  ++ + +DFL+   IGS++NE+PGGYDINYVLD  G KHL K A+V D+ SGRK+ELW
Sbjct  228  IRDIRRSPYDFLEPHTIGSQINEVPGGYDINYVLDDTGSKHLKKVAIVQDNHSGRKLELW  287

Query  412  TNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETYDH  233
            +N+PGVQFYTSNM+    GKGG+VY K+A LCLETQGFPD+VN PNFPSQIVNPG+ Y++
Sbjct  288  SNQPGVQFYTSNMIDHVVGKGGFVYTKYAGLCLETQGFPDAVNHPNFPSQIVNPGQHYEN  347

Query  232  VMVYRFTTH  206
            VMV+RF+ H
Sbjct  348  VMVFRFSAH  356



>ref|XP_006404339.1| hypothetical protein EUTSA_v10010502mg [Eutrema salsugineum]
 gb|ESQ45792.1| hypothetical protein EUTSA_v10010502mg [Eutrema salsugineum]
Length=350

 Score =   279 bits (714),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 128/190 (67%), Positives = 154/190 (81%), Gaps = 0/190 (0%)
 Frame = -1

Query  775  QNQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTG  596
            +N+L ++M+AK +NK TP+NLA HTYWNL  H+SGDILSH IQL   KITPVD+KLIPTG
Sbjct  161  ENKLAVKMEAKPINKPTPINLALHTYWNLHSHNSGDILSHKIQLLAGKITPVDKKLIPTG  220

Query  595  AISPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGLKHLGKAAVVVDSKSGRKMEL  416
             I+ ++GT +DFL+ R IGS ++ELPGGYDINYV+D    KHL K A+V +  +GRKMEL
Sbjct  221  EITAIEGTPYDFLEPREIGSRIDELPGGYDINYVIDGIAGKHLRKTAIVSEESTGRKMEL  280

Query  415  WTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETYD  236
            W+N+PGVQFYTSN+LT   GK   VYKKHA LCLETQGFPDSVN  NFPSQIVNPGE+Y 
Sbjct  281  WSNQPGVQFYTSNLLTRVAGKERAVYKKHAGLCLETQGFPDSVNHNNFPSQIVNPGESYL  340

Query  235  HVMVYRFTTH  206
            HVM++RFT H
Sbjct  341  HVMLFRFTAH  350



>ref|XP_002875866.1| hypothetical protein ARALYDRAFT_906011 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52125.1| hypothetical protein ARALYDRAFT_906011 [Arabidopsis lyrata subsp. 
lyrata]
Length=358

 Score =   279 bits (714),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 130/190 (68%), Positives = 154/190 (81%), Gaps = 0/190 (0%)
 Frame = -1

Query  775  QNQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTG  596
            +N+LG++M+AK LNK TP+NLA HTYWNL  H+SGDILSH IQL   KITPVD+KLIPTG
Sbjct  169  ENKLGVKMEAKPLNKPTPINLALHTYWNLHSHNSGDILSHKIQLLAGKITPVDDKLIPTG  228

Query  595  AISPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGLKHLGKAAVVVDSKSGRKMEL  416
             I+ + GT +DFL+ R IGS ++ELPGGYDINYV+D    KHL K AVV +  +GRKMEL
Sbjct  229  EITSITGTPYDFLEPREIGSRIHELPGGYDINYVIDGPIGKHLRKTAVVTEEVTGRKMEL  288

Query  415  WTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETYD  236
            WTN+PGVQFYTSNM+T   GKG  VY+K+  LCLETQGFPDSVN  NFPSQIVNPGE+Y 
Sbjct  289  WTNQPGVQFYTSNMMTRVVGKGKAVYEKYGGLCLETQGFPDSVNHKNFPSQIVNPGESYL  348

Query  235  HVMVYRFTTH  206
            HVM++RFT H
Sbjct  349  HVMLFRFTAH  358



>gb|AFK48015.1| unknown [Lotus japonicus]
Length=194

 Score =   271 bits (692),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 123/187 (66%), Positives = 152/187 (81%), Gaps = 0/187 (0%)
 Frame = -1

Query  772  NQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTGA  593
            N+LG+RM A  ++K TPVNLA HTYWNL GHDSGDILSHT+Q+F SKITPVD++LIPTG 
Sbjct  6    NKLGVRMIATPVDKPTPVNLAQHTYWNLRGHDSGDILSHTVQIFGSKITPVDDELIPTGE  65

Query  592  ISPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGLKHLGKAAVVVDSKSGRKMELW  413
               VKGT +DFL+ + +GS++++LPG YD+NYVLD    +HL K A+V D+ SGRK+ELW
Sbjct  66   FQEVKGTPYDFLEPKEVGSQIHDLPGLYDVNYVLDPSSPQHLRKVAIVKDNVSGRKLELW  125

Query  412  TNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETYDH  233
            +N+PGVQ+YTS ML DTKGKGG  Y +++ + LETQGFPDSVN PNFPS IV PG+TY H
Sbjct  126  SNQPGVQYYTSGMLKDTKGKGGATYHQYSGIALETQGFPDSVNHPNFPSMIVRPGQTYKH  185

Query  232  VMVYRFT  212
             MVYRFT
Sbjct  186  YMVYRFT  192



>ref|XP_011029977.1| PREDICTED: aldose 1-epimerase-like [Populus euphratica]
Length=354

 Score =   276 bits (706),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 128/189 (68%), Positives = 151/189 (80%), Gaps = 0/189 (0%)
 Frame = -1

Query  772  NQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTGA  593
            N+L ++M+A  LNK TPVNLA H YWNLGGH SGDILSHTIQL  S+ITPVDE+LIPTG 
Sbjct  166  NKLAVKMRAMPLNKRTPVNLALHAYWNLGGHSSGDILSHTIQLLASEITPVDEELIPTGE  225

Query  592  ISPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGLKHLGKAAVVVDSKSGRKMELW  413
            I  VK T +DF + R IGS   +LP GYDINYVLD+    HL K AVV +  SGRK+ELW
Sbjct  226  IVAVKDTPYDFHKPREIGSMFTQLPDGYDINYVLDNVNSGHLKKVAVVQEGVSGRKLELW  285

Query  412  TNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETYDH  233
            TN+PGVQFYTSNML + KGKGG+VY K+A +CLETQGFPD+VN P FPSQIVNPG+ Y++
Sbjct  286  TNQPGVQFYTSNMLDNVKGKGGFVYAKYAGICLETQGFPDAVNHPRFPSQIVNPGDIYEN  345

Query  232  VMVYRFTTH  206
            +M+YRFT H
Sbjct  346  IMIYRFTAH  354



>gb|AAM61410.1| aldose 1-epimerase-like protein [Arabidopsis thaliana]
Length=358

 Score =   275 bits (704),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 128/190 (67%), Positives = 153/190 (81%), Gaps = 0/190 (0%)
 Frame = -1

Query  775  QNQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTG  596
            +N+LG++M+AK LNK TP+NLA HTYWNL  H+SG+ILSH IQL   KITPVD+KLIPTG
Sbjct  169  ENKLGVKMEAKPLNKPTPINLALHTYWNLHSHNSGNILSHKIQLLAGKITPVDDKLIPTG  228

Query  595  AISPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGLKHLGKAAVVVDSKSGRKMEL  416
             I+ + GT +DFL+ R IGS ++ELPGGYDINYV+D    KHL K AVV +  +GRKMEL
Sbjct  229  EITSIAGTPYDFLEPREIGSRIHELPGGYDINYVIDGPIGKHLRKTAVVTEEVTGRKMEL  288

Query  415  WTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETYD  236
            WTN+PGVQFYTSNM+    GKG  VY+K+  LCLETQGFPDSVN  NFPSQIVNPGE+Y 
Sbjct  289  WTNQPGVQFYTSNMMKRVVGKGKAVYEKYGGLCLETQGFPDSVNHKNFPSQIVNPGESYL  348

Query  235  HVMVYRFTTH  206
            HVM++RFT H
Sbjct  349  HVMLFRFTAH  358



>ref|NP_190364.1| putative aldose 1-epimerase [Arabidopsis thaliana]
 emb|CAB41863.1| aldose 1-epimerase-like protein [Arabidopsis thaliana]
 gb|AAL36040.1| AT3g47800/T23J7_130 [Arabidopsis thaliana]
 gb|AAO42757.1| At3g47800/T23J7_130 [Arabidopsis thaliana]
 dbj|BAE99082.1| aldose 1-epimerase - like protein [Arabidopsis thaliana]
 gb|AEE78330.1| putative aldose 1-epimerase [Arabidopsis thaliana]
Length=358

 Score =   275 bits (704),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 128/190 (67%), Positives = 153/190 (81%), Gaps = 0/190 (0%)
 Frame = -1

Query  775  QNQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTG  596
            +N+LG++M+AK LNK TP+NLA HTYWNL  H+SG+ILSH IQL   KITPVD+KLIPTG
Sbjct  169  ENKLGVKMEAKPLNKPTPINLALHTYWNLHSHNSGNILSHKIQLLAGKITPVDDKLIPTG  228

Query  595  AISPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGLKHLGKAAVVVDSKSGRKMEL  416
             I+ + GT +DFL+ R IGS ++ELPGGYDINYV+D    KHL K AVV +  +GRKMEL
Sbjct  229  EITSITGTPYDFLEPREIGSRIHELPGGYDINYVIDGPIGKHLRKTAVVTEQVTGRKMEL  288

Query  415  WTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETYD  236
            WTN+PGVQFYTSNM+    GKG  VY+K+  LCLETQGFPDSVN  NFPSQIVNPGE+Y 
Sbjct  289  WTNQPGVQFYTSNMMKRVVGKGKAVYEKYGGLCLETQGFPDSVNHKNFPSQIVNPGESYL  348

Query  235  HVMVYRFTTH  206
            HVM++RFT H
Sbjct  349  HVMLFRFTAH  358



>ref|XP_002268039.1| PREDICTED: aldose 1-epimerase [Vitis vinifera]
 emb|CBI15252.3| unnamed protein product [Vitis vinifera]
Length=354

 Score =   275 bits (703),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 127/187 (68%), Positives = 149/187 (80%), Gaps = 0/187 (0%)
 Frame = -1

Query  772  NQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTGA  593
            N+L I+M  + LNKATPVNLASH+YWNLGGH SGD+ SH +QLF  KITPVD++LIPTG 
Sbjct  166  NKLVIKMTGRPLNKATPVNLASHSYWNLGGHSSGDVFSHQVQLFADKITPVDDELIPTGK  225

Query  592  ISPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGLKHLGKAAVVVDSKSGRKMELW  413
            I PV+GT +DFL    I +  +ELP GYDINYVL+  G +H  KAAVV +SKSGRKMELW
Sbjct  226  ILPVEGTPYDFLNIHEIKTRFHELPSGYDINYVLNYVGNEHFHKAAVVYESKSGRKMELW  285

Query  412  TNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETYDH  233
            TN+PG+QFYTSNML   KGKGG  Y  +  +CLETQGFPD+VN P+FPSQIVNPGE Y+H
Sbjct  286  TNQPGLQFYTSNMLGTVKGKGGVTYNNYDGICLETQGFPDAVNHPDFPSQIVNPGEIYEH  345

Query  232  VMVYRFT  212
             MVYRFT
Sbjct  346  FMVYRFT  352



>ref|XP_008453190.1| PREDICTED: aldose 1-epimerase-like [Cucumis melo]
Length=353

 Score =   275 bits (702),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 130/188 (69%), Positives = 150/188 (80%), Gaps = 1/188 (1%)
 Frame = -1

Query  772  NQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTGA  593
            N+LG++M+AK+LNKATPVN+A H+YWNL GH SGDILSH I+LF S ITPVD +LIPTG 
Sbjct  163  NKLGVKMQAKSLNKATPVNIAQHSYWNLDGHSSGDILSHKIKLFASSITPVDSELIPTGK  222

Query  592  ISPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGLKHLGKAAVVVDSKSGRKMELW  413
            I PV  T FDF   R IGS++    GGYDINYV+D  G +HL K A V   KSGRKMELW
Sbjct  223  IIPVAKTPFDFTTPREIGSQIKS-AGGYDINYVVDDTGSEHLKKVAEVTGKKSGRKMELW  281

Query  412  TNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETYDH  233
            +N+PGVQFYT N L + KGK G VYK++A LCLETQGFPDSVN PNFPSQIVNPGE+Y+H
Sbjct  282  SNQPGVQFYTGNQLKEVKGKDGAVYKQYAGLCLETQGFPDSVNHPNFPSQIVNPGESYEH  341

Query  232  VMVYRFTT  209
            VMVYRFT 
Sbjct  342  VMVYRFTV  349



>ref|XP_010032358.1| PREDICTED: aldose 1-epimerase-like [Eucalyptus grandis]
 gb|KCW51761.1| hypothetical protein EUGRSUZ_J01219 [Eucalyptus grandis]
Length=382

 Score =   274 bits (701),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 127/187 (68%), Positives = 154/187 (82%), Gaps = 0/187 (0%)
 Frame = -1

Query  772  NQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTGA  593
            N L I MKAKALNKATPVNLA HTYWNLGG + G+ILS  +Q+F S+ITP D +LIPTG 
Sbjct  193  NHLSISMKAKALNKATPVNLAQHTYWNLGGQNRGNILSEEVQIFASQITPCDSQLIPTGK  252

Query  592  ISPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGLKHLGKAAVVVDSKSGRKMELW  413
            I PVKGT +DFL+ R +GS +N+LP GYDINYVLDS     L +AA+V D KSGR +EL 
Sbjct  253  IIPVKGTPYDFLEPRTVGSRINKLPNGYDINYVLDSAQSTKLHRAAIVRDKKSGRVLELV  312

Query  412  TNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETYDH  233
            TN+PGVQFYTSNM+ + KGKGG+VYKKHAALCLETQ +PDSV+ PNFPS+IV PG++Y+H
Sbjct  313  TNQPGVQFYTSNMIKEIKGKGGFVYKKHAALCLETQKYPDSVHHPNFPSEIVYPGKSYEH  372

Query  232  VMVYRFT  212
            VM+++FT
Sbjct  373  VMLFKFT  379



>ref|XP_004508758.1| PREDICTED: aldose 1-epimerase-like isoform X2 [Cicer arietinum]
Length=318

 Score =   271 bits (694),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 126/188 (67%), Positives = 151/188 (80%), Gaps = 0/188 (0%)
 Frame = -1

Query  775  QNQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTG  596
            +N LG++M AK ++KATPVNLA HTYWNL GH+SGDILSH +Q+F S ITPVD  LIPTG
Sbjct  129  RNLLGVKMIAKPIDKATPVNLAQHTYWNLRGHNSGDILSHIVQIFGSNITPVDNNLIPTG  188

Query  595  AISPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGLKHLGKAAVVVDSKSGRKMEL  416
             +  V+ T +DFL+ + +GS++NELPG YDINYVLD +   HL K A+V D  SGRKMEL
Sbjct  189  KVQSVQNTPYDFLKPKKVGSQINELPGLYDINYVLDKNSQNHLSKVAMVRDPVSGRKMEL  248

Query  415  WTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETYD  236
            W+N+ GVQ+YTS ML DTKGKGG +Y KHA + LETQG+PDSVN PNFPSQIV+PGETY 
Sbjct  249  WSNQLGVQYYTSGMLGDTKGKGGVIYHKHAGIALETQGYPDSVNHPNFPSQIVHPGETYK  308

Query  235  HVMVYRFT  212
            H MVYRFT
Sbjct  309  HYMVYRFT  316



>ref|XP_004138299.1| PREDICTED: aldose 1-epimerase [Cucumis sativus]
 gb|KGN63659.1| hypothetical protein Csa_1G009630 [Cucumis sativus]
Length=354

 Score =   273 bits (697),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 129/189 (68%), Positives = 150/189 (79%), Gaps = 1/189 (1%)
 Frame = -1

Query  772  NQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTGA  593
            N+LG++M+A++LNK TPVNLA H+YWNL GH SG+ILSH I+LF S ITPVD +LIPTG 
Sbjct  164  NKLGVKMQAESLNKPTPVNLAQHSYWNLDGHSSGNILSHKIKLFASSITPVDSELIPTGK  223

Query  592  ISPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGLKHLGKAAVVVDSKSGRKMELW  413
            I+PV  T FDF   R IGS++    GGYDINYV+D  G  HL K A V   KSGRKMELW
Sbjct  224  ITPVARTPFDFTTPREIGSQIKS-AGGYDINYVVDDTGSGHLKKVAEVTGKKSGRKMELW  282

Query  412  TNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETYDH  233
            +N+PGVQFYT N L + KGK G VYK++A LCLETQGFPDSVN PNFPSQIVNPGE+Y+H
Sbjct  283  SNQPGVQFYTGNQLKEVKGKDGAVYKQYAGLCLETQGFPDSVNHPNFPSQIVNPGESYEH  342

Query  232  VMVYRFTTH  206
            VMVYRFT H
Sbjct  343  VMVYRFTAH  351



>ref|XP_010503389.1| PREDICTED: aldose 1-epimerase-like [Camelina sativa]
Length=360

 Score =   273 bits (698),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 128/190 (67%), Positives = 150/190 (79%), Gaps = 0/190 (0%)
 Frame = -1

Query  775  QNQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTG  596
            +N LG++M+AK LNK TP+NLA HTYWNL  H+SGDILSH IQL   KITPVD+ LIPTG
Sbjct  171  KNILGVKMEAKPLNKPTPINLALHTYWNLRSHNSGDILSHKIQLLADKITPVDDTLIPTG  230

Query  595  AISPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGLKHLGKAAVVVDSKSGRKMEL  416
             I+ + GT +DFL+ R IGS ++ELPGGYDINY++D    KHL K AVV +  +GRKMEL
Sbjct  231  EITSIAGTPYDFLEPREIGSRIHELPGGYDINYIIDGPIGKHLRKTAVVTEDVTGRKMEL  290

Query  415  WTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETYD  236
            WTN+PGVQFYTSNML    GKG  VY K+  LCLETQGFPDSVN  NFP+QIVNPGETY 
Sbjct  291  WTNQPGVQFYTSNMLKRVVGKGKAVYGKYGGLCLETQGFPDSVNHKNFPTQIVNPGETYL  350

Query  235  HVMVYRFTTH  206
            HVM++RFT H
Sbjct  351  HVMLFRFTAH  360



>gb|KJB39892.1| hypothetical protein B456_007G036000 [Gossypium raimondii]
Length=352

 Score =   272 bits (695),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 130/191 (68%), Positives = 151/191 (79%), Gaps = 1/191 (1%)
 Frame = -1

Query  775  QNQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTG  596
            +++L ++M AK LNK TPVNLA HTYWNLGGH+SGDI+SHT++LF SKITPVD +LIPTG
Sbjct  162  KSKLAVKMMAKPLNKPTPVNLALHTYWNLGGHNSGDIMSHTLKLFGSKITPVDSELIPTG  221

Query  595  AISPVKGTAFDFLQARAIGSELNELPGGYDINYVL-DSHGLKHLGKAAVVVDSKSGRKME  419
             I PV+ T +DF + R IGS+ ++LP GYDINYVL  S   +HL K AVVV+SK GRKME
Sbjct  222  EIVPVRKTPYDFRRPREIGSKFDQLPHGYDINYVLHKSRRSRHLRKVAVVVESKCGRKME  281

Query  418  LWTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETY  239
            LWTN PGVQFYTSNML + KGK G VY K+A  CLETQGFPD+VN PNFPSQIV P   Y
Sbjct  282  LWTNMPGVQFYTSNMLKNEKGKNGTVYGKYAGFCLETQGFPDAVNHPNFPSQIVKPRGIY  341

Query  238  DHVMVYRFTTH  206
             H MVYRFT H
Sbjct  342  KHFMVYRFTAH  352



>ref|XP_004508757.1| PREDICTED: aldose 1-epimerase-like isoform X1 [Cicer arietinum]
Length=353

 Score =   272 bits (695),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 126/188 (67%), Positives = 151/188 (80%), Gaps = 0/188 (0%)
 Frame = -1

Query  775  QNQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTG  596
            +N LG++M AK ++KATPVNLA HTYWNL GH+SGDILSH +Q+F S ITPVD  LIPTG
Sbjct  164  RNLLGVKMIAKPIDKATPVNLAQHTYWNLRGHNSGDILSHIVQIFGSNITPVDNNLIPTG  223

Query  595  AISPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGLKHLGKAAVVVDSKSGRKMEL  416
             +  V+ T +DFL+ + +GS++NELPG YDINYVLD +   HL K A+V D  SGRKMEL
Sbjct  224  KVQSVQNTPYDFLKPKKVGSQINELPGLYDINYVLDKNSQNHLSKVAMVRDPVSGRKMEL  283

Query  415  WTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETYD  236
            W+N+ GVQ+YTS ML DTKGKGG +Y KHA + LETQG+PDSVN PNFPSQIV+PGETY 
Sbjct  284  WSNQLGVQYYTSGMLGDTKGKGGVIYHKHAGIALETQGYPDSVNHPNFPSQIVHPGETYK  343

Query  235  HVMVYRFT  212
            H MVYRFT
Sbjct  344  HYMVYRFT  351



>ref|XP_006377092.1| hypothetical protein POPTR_0012s14420g [Populus trichocarpa]
 gb|ERP54889.1| hypothetical protein POPTR_0012s14420g [Populus trichocarpa]
Length=355

 Score =   272 bits (695),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 126/189 (67%), Positives = 151/189 (80%), Gaps = 0/189 (0%)
 Frame = -1

Query  772  NQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTGA  593
            N+L ++M+A  LNK TPVNLA H YWNLGGH SGDILSHTIQL  S+ITPVDE+LIPTG 
Sbjct  167  NKLVVKMRAMPLNKRTPVNLALHAYWNLGGHSSGDILSHTIQLLASEITPVDEELIPTGE  226

Query  592  ISPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGLKHLGKAAVVVDSKSGRKMELW  413
            I  V+ T +DF + R IGS   +LP GYDINYVLD+    HL K AVV +  SGRK+ELW
Sbjct  227  IVAVEDTPYDFHKPREIGSMFTQLPDGYDINYVLDNVNPGHLKKVAVVQEGVSGRKLELW  286

Query  412  TNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETYDH  233
            TN+PGVQFYTSNML + KGKGG+VY ++A +CLETQGFPD+VN P FPSQIVNPG+ Y++
Sbjct  287  TNQPGVQFYTSNMLDNVKGKGGFVYTQYAGICLETQGFPDAVNHPRFPSQIVNPGDIYEN  346

Query  232  VMVYRFTTH  206
            +M+YRFT H
Sbjct  347  IMIYRFTAH  355



>ref|XP_010426233.1| PREDICTED: aldose 1-epimerase-like [Camelina sativa]
Length=360

 Score =   272 bits (695),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 128/190 (67%), Positives = 151/190 (79%), Gaps = 0/190 (0%)
 Frame = -1

Query  775  QNQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTG  596
            +N LG++M+AK LNK TP+NLA HTYWNL GH+SGDILSH IQL   KITPVD+ LIPTG
Sbjct  171  KNILGVKMEAKPLNKPTPINLALHTYWNLHGHNSGDILSHKIQLLADKITPVDDTLIPTG  230

Query  595  AISPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGLKHLGKAAVVVDSKSGRKMEL  416
             I+ + GT +DFL+ R IGS ++ELPGGYDINY++D    KHL K AVV +  +GRKMEL
Sbjct  231  EITSINGTPYDFLEPREIGSRIHELPGGYDINYIIDGPIGKHLRKTAVVTEDITGRKMEL  290

Query  415  WTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETYD  236
            WTN+PGVQFYTSNML    GKG  VY K+  LCLETQGFPDSVN  NFP+QIV+PGETY 
Sbjct  291  WTNQPGVQFYTSNMLKRVVGKGKAVYGKYGGLCLETQGFPDSVNHKNFPTQIVSPGETYL  350

Query  235  HVMVYRFTTH  206
            HVM++RFT H
Sbjct  351  HVMLFRFTAH  360



>ref|XP_010550628.1| PREDICTED: aldose 1-epimerase-like [Tarenaya hassleriana]
Length=356

 Score =   270 bits (689),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 129/191 (68%), Positives = 151/191 (79%), Gaps = 2/191 (1%)
 Frame = -1

Query  772  NQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTGA  593
            N+LG++M+AK LNKATP++LA HTYWNL G +SGDILSH +QLF S ITPVD  LIPTG 
Sbjct  166  NELGVKMEAKPLNKATPIDLALHTYWNLKGQNSGDILSHDVQLFASHITPVDVHLIPTGH  225

Query  592  ISPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGLKH--LGKAAVVVDSKSGRKME  419
            ISPV GT +DFL    IG  +++LPGGYDINYV+ S G     L + AVV +S SGR+ME
Sbjct  226  ISPVAGTPYDFLSPIPIGRRIHQLPGGYDINYVISSGGSGEHLLRRTAVVSESVSGRRME  285

Query  418  LWTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETY  239
            LWTN+ GVQFYTSNMLT  +GKGG+VY+K+  LCLETQGFPDSVN  NFPSQIV PGE Y
Sbjct  286  LWTNQVGVQFYTSNMLTSVRGKGGFVYRKYGGLCLETQGFPDSVNHENFPSQIVKPGEIY  345

Query  238  DHVMVYRFTTH  206
             HVMV+RFT H
Sbjct  346  LHVMVFRFTAH  356



>ref|XP_008453675.1| PREDICTED: aldose 1-epimerase [Cucumis melo]
Length=337

 Score =   268 bits (684),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 127/189 (67%), Positives = 148/189 (78%), Gaps = 1/189 (1%)
 Frame = -1

Query  772  NQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTGA  593
            N+LGI+M+AK++NK TPVNLA H YWNL GH SG+ILSH I+LF S ITPVD +LIPTG 
Sbjct  149  NKLGIKMEAKSINKPTPVNLAQHAYWNLDGHSSGNILSHKIKLFASSITPVDNELIPTGE  208

Query  592  ISPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGLKHLGKAAVVVDSKSGRKMELW  413
            I+PV GT +DF   R I S++    GGYDINYV+D  G +HL K A V   KSGRKMELW
Sbjct  209  ITPVAGTPYDFTTPREIRSQIKS-AGGYDINYVVDDTGSEHLKKVAEVTGKKSGRKMELW  267

Query  412  TNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETYDH  233
            +N+PGVQFYT+N L   KGK G VY+ HA LCLETQGFPD++N PNFPSQIVNPGE+Y H
Sbjct  268  SNQPGVQFYTANKLNGVKGKDGAVYENHAGLCLETQGFPDALNHPNFPSQIVNPGESYVH  327

Query  232  VMVYRFTTH  206
            VMVYRFT H
Sbjct  328  VMVYRFTVH  336



>emb|CAN61059.1| hypothetical protein VITISV_011619 [Vitis vinifera]
Length=329

 Score =   267 bits (682),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 123/180 (68%), Positives = 144/180 (80%), Gaps = 0/180 (0%)
 Frame = -1

Query  751  KAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTGAISPVKGT  572
            + + LNKATPVNLASH+YWNLGGH SGD+ SH +QLF  KITPVD++LIPTG I PV+GT
Sbjct  148  EGRPLNKATPVNLASHSYWNLGGHSSGDVFSHQVQLFADKITPVDDELIPTGKILPVEGT  207

Query  571  AFDFLQARAIGSELNELPGGYDINYVLDSHGLKHLGKAAVVVDSKSGRKMELWTNKPGVQ  392
             +DFL    I +  +ELP GYDINYVL+  G +H  KAAVV +SKSGRKMELWTN+PG+Q
Sbjct  208  PYDFLNIHEIKTRFHELPSGYDINYVLNYVGNEHFHKAAVVYESKSGRKMELWTNQPGLQ  267

Query  391  FYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETYDHVMVYRFT  212
            FYTSNML   KGKGG  Y  +  +CLETQGFPD+VN P+FPSQIVNPGE Y+H MVYRFT
Sbjct  268  FYTSNMLGTVKGKGGVTYNNYDGICLETQGFPDAVNHPDFPSQIVNPGEIYEHFMVYRFT  327



>gb|AFK38126.1| unknown [Lotus japonicus]
Length=354

 Score =   268 bits (684),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 122/187 (65%), Positives = 151/187 (81%), Gaps = 0/187 (0%)
 Frame = -1

Query  772  NQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTGA  593
            N+LG+RM A  ++K TPVNLA HTYWNL GHDSGDILSHT+Q+F SKITPVD++LIPTG 
Sbjct  166  NKLGVRMIATPVDKPTPVNLAQHTYWNLRGHDSGDILSHTVQIFGSKITPVDDELIPTGE  225

Query  592  ISPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGLKHLGKAAVVVDSKSGRKMELW  413
               VKGT +DFL+ + +GS++++LPG YD+NYVLD    +HL K A+V D+  GRK+ELW
Sbjct  226  FQEVKGTPYDFLEPKEVGSQIHDLPGLYDVNYVLDPSSPQHLRKVAIVKDNVFGRKLELW  285

Query  412  TNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETYDH  233
            +N+PGVQ+YTS ML DTKGKGG  Y +++ + LETQGFPDSVN PNFPS IV PG+TY H
Sbjct  286  SNQPGVQYYTSGMLKDTKGKGGATYHQYSGIALETQGFPDSVNHPNFPSMIVRPGQTYKH  345

Query  232  VMVYRFT  212
             MVYRFT
Sbjct  346  YMVYRFT  352



>ref|XP_002321845.2| aldose 1-epimerase family protein, partial [Populus trichocarpa]
 gb|EEF05972.2| aldose 1-epimerase family protein, partial [Populus trichocarpa]
Length=233

 Score =   263 bits (671),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 126/184 (68%), Positives = 146/184 (79%), Gaps = 0/184 (0%)
 Frame = -1

Query  772  NQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTGA  593
            N++ +RM AK LNK TPVNLA H YWNLG H+SGDILSHTIQLF S++TPVDE+LIPTG 
Sbjct  50   NKIAVRMWAKPLNKPTPVNLALHAYWNLGRHNSGDILSHTIQLFGSEVTPVDEELIPTGE  109

Query  592  ISPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGLKHLGKAAVVVDSKSGRKMELW  413
            I  VK T +D LQAR IGS  N+LP GYDINYVLD     H  K AVV +S SGRK+ELW
Sbjct  110  IVNVKDTPYDSLQAREIGSMFNQLPDGYDINYVLDDLNPGHFMKVAVVQESVSGRKLELW  169

Query  412  TNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETYDH  233
            TN+PGVQFYTSNML + KGKGG VY KHA +CLETQ FPD+VN P FPSQIV+PG+ Y +
Sbjct  170  TNQPGVQFYTSNMLDNVKGKGGCVYAKHAGICLETQVFPDAVNHPYFPSQIVDPGKIYQN  229

Query  232  VMVY  221
            +M+Y
Sbjct  230  IMIY  233



>ref|XP_002282868.1| PREDICTED: aldose 1-epimerase [Vitis vinifera]
Length=359

 Score =   266 bits (681),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 127/186 (68%), Positives = 151/186 (81%), Gaps = 0/186 (0%)
 Frame = -1

Query  769  QLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTGAI  590
            QL + MKAKALNKATPVNLA H YWNLGGH SGDILS+ IQ+F S ITPVD++LIPTG I
Sbjct  171  QLIVTMKAKALNKATPVNLAQHAYWNLGGHTSGDILSNEIQIFGSHITPVDKELIPTGKI  230

Query  589  SPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGLKHLGKAAVVVDSKSGRKMELWT  410
             PVKGT +DFL+   IGS++N+LP G+DINYVLD      +G AA+V   KSGR +EL+T
Sbjct  231  VPVKGTPYDFLKPCTIGSKINKLPSGFDINYVLDDTAPNKVGLAAMVHHKKSGRMLELYT  290

Query  409  NKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETYDHV  230
            N PG+QFYTSN L D KGKGG+VY+ HAALCLETQGFPDSVN PNFPSQIV PG++Y H 
Sbjct  291  NAPGLQFYTSNSLKDVKGKGGFVYQAHAALCLETQGFPDSVNHPNFPSQIVTPGKSYHHS  350

Query  229  MVYRFT  212
            M+++F+
Sbjct  351  MLFKFS  356



>ref|XP_006373311.1| hypothetical protein POPTR_0017s11660g [Populus trichocarpa]
 gb|ERP51108.1| hypothetical protein POPTR_0017s11660g [Populus trichocarpa]
Length=358

 Score =   266 bits (681),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 128/188 (68%), Positives = 150/188 (80%), Gaps = 1/188 (1%)
 Frame = -1

Query  772  NQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTGA  593
            NQL I M+AKA NKATPVNL +H +WNLGGH+SGDILS  IQ+F S+ TPVD KLIPTG 
Sbjct  171  NQLCITMEAKARNKATPVNLVNHAFWNLGGHNSGDILSEKIQIFASRYTPVDSKLIPTGK  230

Query  592  ISPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGLKHLGKAAVVVDSKSGRKMELW  413
            I  VK T +DFL+   IGS++NELP GYDINY LD  G K L KAA+V D KSGR ME+ 
Sbjct  231  IVTVKETPYDFLKPNTIGSKINELPKGYDINYALDGSGNKKLRKAAIVHDEKSGRAMEIL  290

Query  412  TNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETYDH  233
            TN+PGVQF+TSN L + KGKGG++YK H ALCLETQGFPDSVN PNFPSQIVNPG+ Y H
Sbjct  291  TNQPGVQFFTSNTL-NVKGKGGFMYKPHGALCLETQGFPDSVNHPNFPSQIVNPGKPYQH  349

Query  232  VMVYRFTT  209
             M+++F+T
Sbjct  350  YMLFKFST  357



>ref|XP_011008939.1| PREDICTED: aldose 1-epimerase-like [Populus euphratica]
Length=404

 Score =   267 bits (683),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 128/188 (68%), Positives = 150/188 (80%), Gaps = 1/188 (1%)
 Frame = -1

Query  772  NQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTGA  593
            NQL I M+AKA NKATPVNL +H +WNLGGH+SGDILS  IQ+F S+ TPVD KLIPTG 
Sbjct  217  NQLCITMEAKARNKATPVNLVNHAFWNLGGHNSGDILSEKIQIFASRYTPVDSKLIPTGK  276

Query  592  ISPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGLKHLGKAAVVVDSKSGRKMELW  413
            I  VK T +DFL+   IGS +NELP GYDINY LD  G K L KAA+V D KSGR ME+ 
Sbjct  277  IVTVKETPYDFLKPNTIGSRINELPKGYDINYALDGSGNKKLRKAAIVHDEKSGRAMEIL  336

Query  412  TNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETYDH  233
            TN+PGVQF+TSN L + KGKGG++YK+H ALCLETQGFPDSVN PNFPSQIVNPG+ Y H
Sbjct  337  TNQPGVQFFTSNSL-NVKGKGGFMYKRHGALCLETQGFPDSVNHPNFPSQIVNPGKPYKH  395

Query  232  VMVYRFTT  209
             M+++F+T
Sbjct  396  YMLFKFST  403



>ref|XP_002282831.1| PREDICTED: aldose 1-epimerase [Vitis vinifera]
 emb|CBI22174.3| unnamed protein product [Vitis vinifera]
Length=359

 Score =   264 bits (674),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 125/186 (67%), Positives = 151/186 (81%), Gaps = 0/186 (0%)
 Frame = -1

Query  769  QLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTGAI  590
            QL + MKAKALNKATPVNLA H YWNLGGH SGDILS+ IQ+F S ITPVD++LIPTG I
Sbjct  171  QLIVTMKAKALNKATPVNLAQHAYWNLGGHTSGDILSNEIQIFGSHITPVDKELIPTGKI  230

Query  589  SPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGLKHLGKAAVVVDSKSGRKMELWT  410
             PVKGT +DFL+   IGS++N+LP G++INYVLD      +G AA+V   KSGR +EL+T
Sbjct  231  VPVKGTPYDFLKPCTIGSKINKLPSGFNINYVLDDTAPNKVGLAAMVHHKKSGRMLELYT  290

Query  409  NKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETYDHV  230
            N PG+QFYTSN L D KGKGG+VY+ HAALCLET+GFPDSVN PNFPSQIV PG++Y H 
Sbjct  291  NAPGLQFYTSNFLKDEKGKGGFVYQAHAALCLETEGFPDSVNHPNFPSQIVTPGKSYHHS  350

Query  229  MVYRFT  212
            M+++F+
Sbjct  351  MLFKFS  356



>ref|XP_010256040.1| PREDICTED: aldose 1-epimerase-like [Nelumbo nucifera]
Length=358

 Score =   263 bits (672),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 121/188 (64%), Positives = 147/188 (78%), Gaps = 0/188 (0%)
 Frame = -1

Query  772  NQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTGA  593
            N+L + MKA+ALNKATPVNLA HTYWNL GH+SGD+L   +Q+F S ITPVD++LIPTG 
Sbjct  170  NKLAVFMKARALNKATPVNLAQHTYWNLAGHNSGDVLGQHVQIFGSHITPVDKELIPTGK  229

Query  592  ISPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGLKHLGKAAVVVDSKSGRKMELW  413
            I+PVKGT +DF +   +G  +++LP GYDINYVLD      L KAA+V D KSGR +ELW
Sbjct  230  IAPVKGTPYDFREKHTVGCRIDQLPNGYDINYVLDGKPHHFLKKAAMVHDPKSGRMLELW  289

Query  412  TNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETYDH  233
            TN PG+QFYT NML D KGK G +YK H+ +CLETQGFPDSVN PNFPSQIV PG+ Y H
Sbjct  290  TNAPGLQFYTGNMLKDVKGKDGAIYKVHSGICLETQGFPDSVNHPNFPSQIVTPGKLYKH  349

Query  232  VMVYRFTT  209
             M+++FTT
Sbjct  350  YMLFKFTT  357



>gb|KDO72518.1| hypothetical protein CISIN_1g017992mg [Citrus sinensis]
Length=362

 Score =   262 bits (669),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 126/187 (67%), Positives = 147/187 (79%), Gaps = 0/187 (0%)
 Frame = -1

Query  769  QLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTGAI  590
            QL + MKAKALNKATPVNLA HTYWNLGGH+SGDILS  IQ+F S  TPVD +LIPTG I
Sbjct  171  QLRVTMKAKALNKATPVNLAQHTYWNLGGHNSGDILSEEIQIFASYFTPVDSQLIPTGHI  230

Query  589  SPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGLKHLGKAAVVVDSKSGRKMELWT  410
              VKGT +DFL+   +G  +++LP GYDINYVL++     + K AVV D KSG  M+L T
Sbjct  231  VSVKGTPYDFLKPHTVGGRIDKLPHGYDINYVLEAGSGNKMKKVAVVHDKKSGIVMKLTT  290

Query  409  NKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETYDHV  230
            N+PGVQFYT+N L D KGKGG+VY+ HAALCLETQ FPDSVN PNFPS IVNPGETY H 
Sbjct  291  NQPGVQFYTANSLKDVKGKGGFVYQPHAALCLETQAFPDSVNHPNFPSTIVNPGETYKHH  350

Query  229  MVYRFTT  209
            MV++F+T
Sbjct  351  MVFKFST  357



>ref|XP_006482556.1| PREDICTED: aldose 1-epimerase-like [Citrus sinensis]
Length=362

 Score =   261 bits (668),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 126/187 (67%), Positives = 148/187 (79%), Gaps = 0/187 (0%)
 Frame = -1

Query  769  QLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTGAI  590
            QL + MKAKALNKATPVNLA HTYWNLGGH+SGDILS  IQ+F S  TPVD +LIPTG I
Sbjct  171  QLRVTMKAKALNKATPVNLAQHTYWNLGGHNSGDILSEEIQIFASYFTPVDSQLIPTGHI  230

Query  589  SPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGLKHLGKAAVVVDSKSGRKMELWT  410
              VKGT +DFL+   +GS +++LP GYDINYVL++     + K AVV D KSG  M+L T
Sbjct  231  VSVKGTPYDFLKPHIVGSRIDKLPHGYDINYVLEAGSGNKMKKVAVVHDKKSGIVMKLTT  290

Query  409  NKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETYDHV  230
            N+PGVQFYT+N L + KGKGG+VY+ HAALCLETQ FPDSVN PNFPS IVNPGETY H 
Sbjct  291  NQPGVQFYTANSLKNVKGKGGFVYQPHAALCLETQAFPDSVNHPNFPSTIVNPGETYKHH  350

Query  229  MVYRFTT  209
            MV++F+T
Sbjct  351  MVFKFST  357



>ref|XP_008784468.1| PREDICTED: aldose 1-epimerase-like [Phoenix dactylifera]
Length=358

 Score =   261 bits (667),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 124/190 (65%), Positives = 148/190 (78%), Gaps = 7/190 (4%)
 Frame = -1

Query  769  QLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTGAI  590
            +L + M AK++NKATPVNL  HTYWNLGGH+SG ILS+T+Q+F S +TP D  LIPTG I
Sbjct  171  ELSVTMDAKSVNKATPVNLLQHTYWNLGGHNSGTILSNTVQIFASHVTPSDSHLIPTGEI  230

Query  589  SPVKGTAFDFLQARAIGSELNELPGGYDINYVLD----SHGLKHLGKAAVVVDSKSGRKM  422
              V GT +DFL+   +GS +NEL GGYDINYVLD    SHG++   K AVV D  SGR  
Sbjct  231  VSVSGTPYDFLKPMIVGSRINELTGGYDINYVLDLPMDSHGMR---KVAVVKDGGSGRAF  287

Query  421  ELWTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGET  242
            ELW+N+PGVQFYTSN L D KGKGG+VY +HAALCLETQGFPD+VN PNFPSQIVNPGE 
Sbjct  288  ELWSNQPGVQFYTSNSLKDVKGKGGFVYGQHAALCLETQGFPDAVNHPNFPSQIVNPGEV  347

Query  241  YDHVMVYRFT  212
            Y H M+++F+
Sbjct  348  YKHYMLFKFS  357



>gb|KDO72517.1| hypothetical protein CISIN_1g0479221mg, partial [Citrus sinensis]
Length=190

 Score =   255 bits (651),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 119/188 (63%), Positives = 146/188 (78%), Gaps = 1/188 (1%)
 Frame = -1

Query  769  QLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTGAI  590
            +L ++MKAKA NKATPVNLA H+YWNLGGH+SGDILS  +Q+F S  TPVD++LIPTG I
Sbjct  1    ELSVKMKAKARNKATPVNLAQHSYWNLGGHNSGDILSQEVQIFASSYTPVDDQLIPTGKI  60

Query  589  SPVKGTAFDFLQARAIGSELNELPGGYDINYVLD-SHGLKHLGKAAVVVDSKSGRKMELW  413
              V+GT +DFLQ  AIGS +++LP GYDINYVLD     K + K A+V D KSGR MEL 
Sbjct  61   ETVEGTPYDFLQPHAIGSSIDKLPVGYDINYVLDKDDSSKKMRKVAIVHDKKSGRVMELL  120

Query  412  TNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETYDH  233
             ++PGVQ+YT   + + +GKGG+VYKKHA LCLETQ FPDSVN PNFP+ IV PGE Y H
Sbjct  121  ADQPGVQYYTGGQIKEVRGKGGFVYKKHAGLCLETQAFPDSVNHPNFPNTIVYPGEKYKH  180

Query  232  VMVYRFTT  209
             M+Y+F+T
Sbjct  181  HMLYKFST  188



>ref|XP_010693333.1| PREDICTED: aldose 1-epimerase [Beta vulgaris subsp. vulgaris]
Length=380

 Score =   260 bits (665),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 123/190 (65%), Positives = 150/190 (79%), Gaps = 3/190 (2%)
 Frame = -1

Query  772  NQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTGA  593
            N L + M+AK LNK TPVNLA HTYWNLGGH SG+IL+H +Q+F S+ITPVD+ LIPTG 
Sbjct  190  NHLLVTMRAKPLNKPTPVNLAQHTYWNLGGHTSGNILAHEVQIFASQITPVDKNLIPTGK  249

Query  592  ISPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGLKH--LGKAAVVVDSKSGRKME  419
               VKGT FDFL+   +GS +N+LP GYDINYV+D +  +H  +   AVV + KSGR ME
Sbjct  250  FEQVKGTPFDFLKPHTVGSTINKLPKGYDINYVVDGYKTRHAAVTPVAVVKEKKSGRVME  309

Query  418  LWTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETY  239
            LW NKPGVQFYTSN L +T GKGG+VY  HAALCLETQGFPD+VN PNFPS +V+PGETY
Sbjct  310  LWANKPGVQFYTSNTL-NTTGKGGHVYGPHAALCLETQGFPDAVNHPNFPSVMVSPGETY  368

Query  238  DHVMVYRFTT  209
            +H M+++F+T
Sbjct  369  EHYMLFKFST  378



>ref|XP_004147466.2| PREDICTED: aldose 1-epimerase-like [Cucumis sativus]
 gb|KGN59582.1| hypothetical protein Csa_3G827250 [Cucumis sativus]
Length=383

 Score =   260 bits (664),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 126/194 (65%), Positives = 151/194 (78%), Gaps = 1/194 (1%)
 Frame = -1

Query  787  TCSLQNQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKL  608
            T   +NQL + M AKALNK TPVNLA HTYWNLGGH+SGDILS+ +Q+F S+IT VD  L
Sbjct  189  TLIAKNQLKLTMNAKALNKPTPVNLAQHTYWNLGGHNSGDILSNHLQIFGSRITVVDHNL  248

Query  607  IPTGAISPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGLKH-LGKAAVVVDSKSG  431
            IPTG + PVKGT FDFL+ R +GS +N+LP GYDINY LD    +H L KAAVV D KSG
Sbjct  249  IPTGKLEPVKGTPFDFLKPRTVGSRINKLPKGYDINYALDDGTGEHKLKKAAVVHDKKSG  308

Query  430  RKMELWTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNP  251
            R +EL TN PGVQFYT N + D KGKGG+VY+ HAALCLETQGFPD+VN  NFPS IV P
Sbjct  309  RMLELSTNVPGVQFYTGNYIKDVKGKGGFVYQAHAALCLETQGFPDAVNHHNFPSTIVTP  368

Query  250  GETYDHVMVYRFTT  209
             + Y+H+M+++F+T
Sbjct  369  KKPYNHIMLFKFST  382



>ref|XP_010242446.1| PREDICTED: aldose 1-epimerase-like [Nelumbo nucifera]
Length=364

 Score =   259 bits (661),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 120/192 (63%), Positives = 154/192 (80%), Gaps = 1/192 (1%)
 Frame = -1

Query  781  SLQNQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIP  602
            +++NQL + MKAKALNKATPVNLA HTYWNLGGH+SGDILS T+Q+F S+ TPVD +LIP
Sbjct  167  TVENQLSVTMKAKALNKATPVNLAQHTYWNLGGHNSGDILSETLQIFASQYTPVDSELIP  226

Query  601  TGAISPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSH-GLKHLGKAAVVVDSKSGRK  425
            TG I+PVKGT +DF + + +GS +++LP GYDINYV+D+  G + + KAA++ DSKSGR 
Sbjct  227  TGEIAPVKGTPYDFGEPQTVGSRIDQLPNGYDINYVVDAEGGPRTMKKAAILSDSKSGRV  286

Query  424  MELWTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGE  245
            MEL T+ PG+Q YT++ L D KGK G VYK HA LCLETQGFPDS++ P+FPSQI+ P +
Sbjct  287  MELRTSAPGLQLYTADKLKDIKGKNGAVYKPHAGLCLETQGFPDSLHHPDFPSQIITPKK  346

Query  244  TYDHVMVYRFTT  209
            TY H ++Y F T
Sbjct  347  TYKHFILYTFKT  358



>ref|XP_009347058.1| PREDICTED: aldose 1-epimerase [Pyrus x bretschneideri]
Length=369

 Score =   258 bits (660),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 125/193 (65%), Positives = 147/193 (76%), Gaps = 1/193 (1%)
 Frame = -1

Query  787  TCSLQNQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKL  608
            T +  NQL I+MKAKALNK TPV+LA HTYWNLGGH+SGDILS  + +F S  TPVD  L
Sbjct  174  TLTGDNQLSIKMKAKALNKPTPVSLAQHTYWNLGGHNSGDILSQDVTIFASHYTPVDSHL  233

Query  607  IPTGAISPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGL-KHLGKAAVVVDSKSG  431
            IPTG I+ VKGT +DFL+   +GS +N+LP GYDINY LDS G+   L  A VV D KSG
Sbjct  234  IPTGKIASVKGTPYDFLKPNDVGSRINKLPSGYDINYCLDSSGVGNKLRPATVVHDKKSG  293

Query  430  RKMELWTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNP  251
            R +EL TN PG+QFYTSN L D KGKGG+VY+ HAALCLETQGFPDSVN PNFPS IV P
Sbjct  294  RVLELSTNAPGLQFYTSNFLKDVKGKGGFVYEPHAALCLETQGFPDSVNHPNFPSTIVTP  353

Query  250  GETYDHVMVYRFT  212
             + Y H M+++F+
Sbjct  354  KKPYKHFMLFKFS  366



>ref|XP_008230742.1| PREDICTED: aldose 1-epimerase-like [Prunus mume]
Length=366

 Score =   258 bits (659),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 122/187 (65%), Positives = 147/187 (79%), Gaps = 0/187 (0%)
 Frame = -1

Query  769  QLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTGAI  590
            QL ++MKAKALNK TPVNLA HTYWNLGGH+SGD+LS  I++F S+IT VD  LIPTG  
Sbjct  174  QLSVKMKAKALNKPTPVNLAQHTYWNLGGHNSGDVLSQYIKIFASQITLVDSHLIPTGKF  233

Query  589  SPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGLKHLGKAAVVVDSKSGRKMELWT  410
            + VKGT +DFL+++A+GS +N+L  GYDINYVLD      L  AAVV D KSGR +EL T
Sbjct  234  ASVKGTPYDFLKSKAVGSRINKLASGYDINYVLDGGAGNKLKPAAVVYDKKSGRVLELST  293

Query  409  NKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETYDHV  230
            N PG+QFYTSN L D KGKGG+VY+ HAALCLETQGFPD+VN PNFPS IV P + Y H 
Sbjct  294  NAPGLQFYTSNSLKDVKGKGGFVYEPHAALCLETQGFPDAVNHPNFPSTIVTPKKPYKHN  353

Query  229  MVYRFTT  209
            M+++F+T
Sbjct  354  MLFKFST  360



>ref|XP_008341553.1| PREDICTED: aldose 1-epimerase [Malus domestica]
Length=367

 Score =   258 bits (658),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 125/193 (65%), Positives = 148/193 (77%), Gaps = 1/193 (1%)
 Frame = -1

Query  787  TCSLQNQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKL  608
            T +  NQL I+MKAKALNK TPV+LA HTYWNLGGH+SGD+LS  + +F S  TPVD  L
Sbjct  172  TLTGDNQLSIKMKAKALNKPTPVSLAQHTYWNLGGHNSGDVLSQDVTIFASHYTPVDSHL  231

Query  607  IPTGAISPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGL-KHLGKAAVVVDSKSG  431
            IPTG I+ VKGT +DFL+  A+GS +N+L  GYDINY LDS G+   L  AAVV D KSG
Sbjct  232  IPTGKIASVKGTPYDFLKPDAVGSRINKLTSGYDINYCLDSSGVGNKLRPAAVVHDKKSG  291

Query  430  RKMELWTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNP  251
            R +EL TN PG+QFYTSN L D KGKGG+VY+ HAALCLETQGFPDSVN PNFPS IV P
Sbjct  292  RVLELSTNAPGLQFYTSNSLKDVKGKGGFVYEPHAALCLETQGFPDSVNHPNFPSTIVTP  351

Query  250  GETYDHVMVYRFT  212
             + Y H M+++F+
Sbjct  352  KKPYKHFMLFKFS  364



>ref|XP_010256788.1| PREDICTED: aldose 1-epimerase-like [Nelumbo nucifera]
Length=359

 Score =   257 bits (657),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 126/195 (65%), Positives = 147/195 (75%), Gaps = 2/195 (1%)
 Frame = -1

Query  787  TCSLQNQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKL  608
            T   +  L + M AKA++KATPVNLA HTYWNLGGH SGDILS T+Q+F S+IT +D +L
Sbjct  163  TIDGEETLSVTMTAKAMDKATPVNLAQHTYWNLGGHKSGDILSETVQIFGSQITLLDSQL  222

Query  607  IPTGAISPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSH--GLKHLGKAAVVVDSKS  434
            IPTG I+PVKGT +DF+Q R +GS + +L  GYDINYVLD    G   L KAA V DS+S
Sbjct  223  IPTGKIAPVKGTPYDFMQPRTVGSRIKQLSNGYDINYVLDVDEVGDDQLKKAATVYDSRS  282

Query  433  GRKMELWTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVN  254
            GR MEL T+ PGVQFYT+N L DTKGK G VYK HA LCLET GFPDSVN PNFPS IV 
Sbjct  283  GRMMELRTSAPGVQFYTANNLKDTKGKDGAVYKAHAGLCLETGGFPDSVNHPNFPSTIVV  342

Query  253  PGETYDHVMVYRFTT  209
            PG+ Y H+M+Y FTT
Sbjct  343  PGKLYQHLMLYTFTT  357



>gb|EPS71547.1| hypothetical protein M569_03212, partial [Genlisea aurea]
Length=329

 Score =   256 bits (654),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 117/189 (62%), Positives = 144/189 (76%), Gaps = 2/189 (1%)
 Frame = -1

Query  772  NQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTGA  593
            ++L I+M+AK LN ATP+NLASH YWNLGGH SGDI SHT+QLF S+ITP D+ LIPTG 
Sbjct  140  DRLAIKMQAKPLNMATPINLASHIYWNLGGHSSGDIFSHTLQLFASEITPTDDDLIPTGE  199

Query  592  ISPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSH--GLKHLGKAAVVVDSKSGRKME  419
            +  V  T FDF Q R IGS  +++PGGYD+NY +D      +HL K A   + ++GRK+E
Sbjct  200  LRRVDRTPFDFRQPRTIGSHFSQVPGGYDVNYAVDESEPKFQHLSKVAAAREPETGRKLE  259

Query  418  LWTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETY  239
            LW+N+PGVQFY+ NM+  TKGK G VY K+A  CLETQGFPDSVN P FPSQ+V+PGE Y
Sbjct  260  LWSNQPGVQFYSGNMIPATKGKDGAVYDKYAGFCLETQGFPDSVNHPRFPSQVVSPGEDY  319

Query  238  DHVMVYRFT  212
             HVMV+RFT
Sbjct  320  LHVMVFRFT  328



>ref|XP_008443423.1| PREDICTED: aldose 1-epimerase [Cucumis melo]
Length=383

 Score =   257 bits (657),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 125/194 (64%), Positives = 148/194 (76%), Gaps = 1/194 (1%)
 Frame = -1

Query  787  TCSLQNQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKL  608
            T    NQL + M AKALNK TPVNLA HTYWNLGGH+SGDILS+ +Q+F S+IT VD  L
Sbjct  189  TLIANNQLKLTMHAKALNKPTPVNLAQHTYWNLGGHNSGDILSNHLQIFGSRITVVDHNL  248

Query  607  IPTGAISPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGLKH-LGKAAVVVDSKSG  431
            IPTG + PVKGT FDFL+ R +GS +N+LP GYDINY LD    +H L KAAVV D KSG
Sbjct  249  IPTGKLEPVKGTPFDFLKPRMVGSRINKLPKGYDINYALDDGTREHKLKKAAVVHDKKSG  308

Query  430  RKMELWTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNP  251
            R +EL TN PGVQ YT N + D KGKGG+VY+ HAALCLETQGFPD+VN  NFPS IV P
Sbjct  309  RMLELSTNVPGVQLYTGNYIKDVKGKGGFVYQAHAALCLETQGFPDAVNHHNFPSTIVTP  368

Query  250  GETYDHVMVYRFTT  209
             + Y H+M+++F+T
Sbjct  369  KKPYKHIMLFKFST  382



>ref|XP_010937062.1| PREDICTED: aldose 1-epimerase-like [Elaeis guineensis]
Length=358

 Score =   256 bits (654),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 123/190 (65%), Positives = 145/190 (76%), Gaps = 7/190 (4%)
 Frame = -1

Query  769  QLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTGAI  590
            +L + M AK  NKATPVNL  HTYWNLGGH+SG ILS+T+Q+F S +TP D  LIPTG I
Sbjct  171  ELSVAMDAKPGNKATPVNLLQHTYWNLGGHNSGTILSNTVQIFASHVTPTDSHLIPTGEI  230

Query  589  SPVKGTAFDFLQARAIGSELNELPGGYDINYVLDS----HGLKHLGKAAVVVDSKSGRKM  422
              V GT +DFL+   +GS +NEL GGYDINYVLDS    HG++   K AVV D  SGR  
Sbjct  231  RSVSGTPYDFLKPMIVGSRINELTGGYDINYVLDSPMDGHGMR---KVAVVKDGGSGRAF  287

Query  421  ELWTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGET  242
            ELW+N+PGVQFYTSN L D KGKGG+VY +HAALCLETQGFPD+VN PNFPS IVNPGE 
Sbjct  288  ELWSNQPGVQFYTSNFLKDVKGKGGFVYGQHAALCLETQGFPDAVNHPNFPSIIVNPGEV  347

Query  241  YDHVMVYRFT  212
            Y H M+++F+
Sbjct  348  YKHYMLFKFS  357



>ref|XP_006384345.1| hypothetical protein POPTR_0004s13470g [Populus trichocarpa]
 gb|ERP62142.1| hypothetical protein POPTR_0004s13470g [Populus trichocarpa]
Length=367

 Score =   256 bits (655),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 126/187 (67%), Positives = 145/187 (78%), Gaps = 1/187 (1%)
 Frame = -1

Query  772  NQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTGA  593
            N+L I MKAKALNKATPVNL +H YWNLGGH+SGDILS  IQ+F S  TPVD +LIPTG 
Sbjct  180  NKLRITMKAKALNKATPVNLVNHAYWNLGGHNSGDILSEEIQIFASHYTPVDSQLIPTGE  239

Query  592  ISPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGLKHLGKAAVVVDSKSGRKMELW  413
            I  VKGT +DFL+   IGS++N+L  GYDINY LD  G   L K A+V D KSGR ME+ 
Sbjct  240  IVTVKGTPYDFLKPNTIGSKINKLTNGYDINYALDGSGNDKLKKVAIVRDKKSGRMMEIL  299

Query  412  TNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETYDH  233
            TN+PGVQFYTSN L   KGKGG+VY+ +AALCLETQGFPDSVN PNFPSQIVNPG  Y H
Sbjct  300  TNQPGVQFYTSNTLYQ-KGKGGFVYEPYAALCLETQGFPDSVNHPNFPSQIVNPGTYYKH  358

Query  232  VMVYRFT  212
             M+ +F+
Sbjct  359  QMLIKFS  365



>ref|XP_002305327.1| hypothetical protein POPTR_0004s13470g [Populus trichocarpa]
 gb|EEE85838.1| hypothetical protein POPTR_0004s13470g [Populus trichocarpa]
Length=358

 Score =   256 bits (654),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 126/187 (67%), Positives = 145/187 (78%), Gaps = 1/187 (1%)
 Frame = -1

Query  772  NQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTGA  593
            N+L I MKAKALNKATPVNL +H YWNLGGH+SGDILS  IQ+F S  TPVD +LIPTG 
Sbjct  171  NKLRITMKAKALNKATPVNLVNHAYWNLGGHNSGDILSEEIQIFASHYTPVDSQLIPTGE  230

Query  592  ISPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGLKHLGKAAVVVDSKSGRKMELW  413
            I  VKGT +DFL+   IGS++N+L  GYDINY LD  G   L K A+V D KSGR ME+ 
Sbjct  231  IVTVKGTPYDFLKPNTIGSKINKLTNGYDINYALDGSGNDKLKKVAIVRDKKSGRMMEIL  290

Query  412  TNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETYDH  233
            TN+PGVQFYTSN L   KGKGG+VY+ +AALCLETQGFPDSVN PNFPSQIVNPG  Y H
Sbjct  291  TNQPGVQFYTSNTLYQ-KGKGGFVYEPYAALCLETQGFPDSVNHPNFPSQIVNPGTYYKH  349

Query  232  VMVYRFT  212
             M+ +F+
Sbjct  350  QMLIKFS  356



>ref|XP_007155325.1| hypothetical protein PHAVU_003G191500g [Phaseolus vulgaris]
 gb|ESW27319.1| hypothetical protein PHAVU_003G191500g [Phaseolus vulgaris]
Length=354

 Score =   256 bits (653),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 121/189 (64%), Positives = 146/189 (77%), Gaps = 0/189 (0%)
 Frame = -1

Query  772  NQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTGA  593
            ++L ++M AK ++KATPVNLA HTYWNLGGH+SGDILSH +Q+F S IT VD+ LIPTG 
Sbjct  166  HELAVKMIAKPVDKATPVNLAQHTYWNLGGHNSGDILSHIVQIFGSHITAVDKLLIPTGE  225

Query  592  ISPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGLKHLGKAAVVVDSKSGRKMELW  413
            I  VKGT +DFL+ + + + ++ELP  YD+NYVLD     HL K AVV D  SGRKMELW
Sbjct  226  IISVKGTPYDFLEPKKVATYIHELPDLYDMNYVLDKSFQNHLSKVAVVRDPVSGRKMELW  285

Query  412  TNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETYDH  233
            +N+ GVQFYTS  L  TKGK G +Y K AA+ LETQGFPDSVN P FP+QIV PGETY+H
Sbjct  286  SNQLGVQFYTSGQLNATKGKDGAIYHKFAAIALETQGFPDSVNHPYFPTQIVKPGETYEH  345

Query  232  VMVYRFTTH  206
            +MVYRFT H
Sbjct  346  IMVYRFTAH  354



>ref|XP_002517487.1| aldose-1-epimerase, putative [Ricinus communis]
 gb|EEF45029.1| aldose-1-epimerase, putative [Ricinus communis]
Length=357

 Score =   256 bits (653),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 120/188 (64%), Positives = 147/188 (78%), Gaps = 1/188 (1%)
 Frame = -1

Query  772  NQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTGA  593
            NQL I MKAKA  K+TPVNLA+H YWNLGG  SGDILS  IQ+F S+ TP+D +LIPTG 
Sbjct  170  NQLSITMKAKAQKKSTPVNLANHAYWNLGGQSSGDILSQEIQIFASRYTPLDSQLIPTGQ  229

Query  592  ISPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGLKHLGKAAVVVDSKSGRKMELW  413
            I  VK T +DFL    IGS++N+LP GYDINY LD+     + K A+V D K+GR MEL+
Sbjct  230  IVSVKATPYDFLNPATIGSKINQLPKGYDINYALDASAHNKMKKTAIVHDKKTGRVMELF  289

Query  412  TNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETYDH  233
            TN+PG+QFYTSN L + KGKGG+VYK HAALCLETQG+PD+VN PNFPS IVNPG++Y H
Sbjct  290  TNQPGLQFYTSNTL-EKKGKGGFVYKPHAALCLETQGYPDAVNHPNFPSVIVNPGKSYKH  348

Query  232  VMVYRFTT  209
             M+++F+T
Sbjct  349  YMLFKFST  356



>ref|XP_006431103.1| hypothetical protein CICLE_v10011989mg [Citrus clementina]
 gb|ESR44343.1| hypothetical protein CICLE_v10011989mg [Citrus clementina]
Length=373

 Score =   256 bits (653),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 120/190 (63%), Positives = 146/190 (77%), Gaps = 1/190 (1%)
 Frame = -1

Query  775  QNQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTG  596
            + +L ++MKAKA NKATPVNLA H+YWNLGGH SGDILS  +Q+F S  TPVD++LIPTG
Sbjct  182  EKELSVKMKAKARNKATPVNLAQHSYWNLGGHSSGDILSQEVQIFASSYTPVDDQLIPTG  241

Query  595  AISPVKGTAFDFLQARAIGSELNELPGGYDINYVLD-SHGLKHLGKAAVVVDSKSGRKME  419
             I  V+GT +DFLQ  AIGS +++LPGGYDINYVLD     K + K A+V D KSGR ME
Sbjct  242  KIETVEGTPYDFLQPHAIGSSIDKLPGGYDINYVLDKDDSSKTMRKVAIVHDKKSGRVME  301

Query  418  LWTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETY  239
            L  ++PGVQ+YT   + +  GKGG+VYKKHA LCLETQ FPDSVN PNFP+ IV PGE Y
Sbjct  302  LLADQPGVQYYTGGQIKEVTGKGGFVYKKHAGLCLETQAFPDSVNHPNFPNTIVYPGEKY  361

Query  238  DHVMVYRFTT  209
             H M+Y+F+T
Sbjct  362  KHHMLYKFST  371



>ref|XP_007216505.1| hypothetical protein PRUPE_ppa024124mg [Prunus persica]
 gb|EMJ17704.1| hypothetical protein PRUPE_ppa024124mg [Prunus persica]
Length=366

 Score =   255 bits (652),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 121/187 (65%), Positives = 145/187 (78%), Gaps = 0/187 (0%)
 Frame = -1

Query  769  QLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTGAI  590
            QL ++MKAKALNK TPVNLA HTYWNLGGH+ GD+LS  I++F S+IT VD  LIPTG  
Sbjct  174  QLSVKMKAKALNKPTPVNLAQHTYWNLGGHNCGDVLSQYIKIFASQITLVDSHLIPTGKF  233

Query  589  SPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGLKHLGKAAVVVDSKSGRKMELWT  410
            + VKGT +DFL+ +A+GS +N+L  GYDINYVLD      L  AAVV D KSGR +EL T
Sbjct  234  ASVKGTPYDFLKPKAVGSRINKLASGYDINYVLDGGAGNKLKPAAVVYDKKSGRVLELST  293

Query  409  NKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETYDHV  230
            N PG+QFYTSN L D KGKGG+VY+ HAALCLETQGFPD+VN PNFPS IV P + Y H 
Sbjct  294  NAPGLQFYTSNFLKDVKGKGGFVYEPHAALCLETQGFPDAVNHPNFPSTIVTPKKPYKHN  353

Query  229  MVYRFTT  209
            M+++F+T
Sbjct  354  MLFKFST  360



>ref|XP_011046256.1| PREDICTED: aldose 1-epimerase-like [Populus euphratica]
 ref|XP_011046257.1| PREDICTED: aldose 1-epimerase-like [Populus euphratica]
Length=358

 Score =   255 bits (651),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 126/187 (67%), Positives = 144/187 (77%), Gaps = 1/187 (1%)
 Frame = -1

Query  772  NQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTGA  593
            N+L I MKAKAL KATPVNL +H YWNLGGH+SGDILS  IQ+F S  TPVD +LIPTG 
Sbjct  171  NKLRITMKAKALKKATPVNLVNHAYWNLGGHNSGDILSEEIQIFASHYTPVDSELIPTGE  230

Query  592  ISPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGLKHLGKAAVVVDSKSGRKMELW  413
            I  VKGT +DFL+   IGS++N+L  GYDINY LD  G   L KAA+V D KSGR ME+ 
Sbjct  231  IVTVKGTPYDFLKPNTIGSKINKLTNGYDINYALDGSGNDKLKKAAIVHDKKSGRMMEIL  290

Query  412  TNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETYDH  233
            TN+PGVQFYTSN L   KGKGG+VY+ H ALCLETQGFPDSVN PNFPSQIVNPG  Y H
Sbjct  291  TNQPGVQFYTSNTLYQ-KGKGGFVYEPHGALCLETQGFPDSVNQPNFPSQIVNPGTYYKH  349

Query  232  VMVYRFT  212
             M+ +F+
Sbjct  350  QMLIKFS  356



>ref|XP_006482555.1| PREDICTED: aldose 1-epimerase-like [Citrus sinensis]
Length=373

 Score =   255 bits (651),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 119/190 (63%), Positives = 147/190 (77%), Gaps = 1/190 (1%)
 Frame = -1

Query  775  QNQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTG  596
            + +L ++MKAKA NKATPVNLA H+YWNLGGH+SGDILS  +Q+F S  TPVD++LIPTG
Sbjct  182  EKELSVKMKAKARNKATPVNLAQHSYWNLGGHNSGDILSQEVQIFASSYTPVDDQLIPTG  241

Query  595  AISPVKGTAFDFLQARAIGSELNELPGGYDINYVLD-SHGLKHLGKAAVVVDSKSGRKME  419
             I  V+GT +DFLQ  AIGS +++LP GYDINYVLD     K + K A+V D KSGR ME
Sbjct  242  KIETVEGTPYDFLQPHAIGSSIDKLPVGYDINYVLDKDDSSKKMRKVAIVHDKKSGRVME  301

Query  418  LWTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETY  239
            L  ++PGVQ+YT   + + +GKGG+VYKKHA LCLETQ FPDSVN PNFP+ IV PGE Y
Sbjct  302  LLADQPGVQYYTGGQIKEVRGKGGFVYKKHAGLCLETQAFPDSVNHPNFPNTIVYPGEKY  361

Query  238  DHVMVYRFTT  209
             H M+Y+F+T
Sbjct  362  KHHMLYKFST  371



>ref|XP_003550776.1| PREDICTED: aldose 1-epimerase-like [Glycine max]
 gb|KHN18538.1| Aldose 1-epimerase [Glycine soja]
Length=351

 Score =   254 bits (649),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 121/189 (64%), Positives = 146/189 (77%), Gaps = 2/189 (1%)
 Frame = -1

Query  775  QNQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTG  596
            +++L ++M AK ++KATPVNLA HTYWNL GH+SGDILSHT+Q+F S ITPVD  LIPTG
Sbjct  164  RHKLAVKMIAKPVDKATPVNLAQHTYWNLRGHNSGDILSHTVQIFGSHITPVDRLLIPTG  223

Query  595  AISPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGLKHLGKAAVVVDSKSGRKMEL  416
             I  VKGT +DFL+ + +GS++ E  G YD+NYVLD    KHL K  VV D  SGRK+EL
Sbjct  224  EIISVKGTPYDFLEPKKVGSQIQE--GLYDMNYVLDKSFKKHLSKVVVVTDPVSGRKLEL  281

Query  415  WTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETYD  236
            W+N+ G+QFYTS  L  TKGK G VY+KHA + LETQGFPDSVN+P FPSQIV PGE Y 
Sbjct  282  WSNQLGLQFYTSGQLNATKGKDGAVYRKHAGIALETQGFPDSVNYPYFPSQIVRPGEIYK  341

Query  235  HVMVYRFTT  209
            H M+YRFTT
Sbjct  342  HTMLYRFTT  350



>gb|KHN30819.1| Aldose 1-epimerase [Glycine soja]
Length=294

 Score =   252 bits (644),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 117/187 (63%), Positives = 142/187 (76%), Gaps = 0/187 (0%)
 Frame = -1

Query  772  NQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTGA  593
            N+  ++M AK ++KATPVNLA HTYWNL GH+ GDILSH +Q+F SKITPVD+KLIPTG 
Sbjct  106  NKYCVKMIAKPIDKATPVNLAHHTYWNLKGHNGGDILSHEVQIFGSKITPVDKKLIPTGK  165

Query  592  ISPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGLKHLGKAAVVVDSKSGRKMELW  413
               VKGT +DFL+ R +GS +N+LPG YD+NYVLD+    H  K  +V +  SGRK+ELW
Sbjct  166  FESVKGTPYDFLEPREVGSRINDLPGLYDMNYVLDASSPNHFRKVLIVREKVSGRKLELW  225

Query  412  TNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETYDH  233
            +N+ G+QFYT  ML  TKGK G +Y KH  + LETQGFPD+VN  NFPSQIV PGETY H
Sbjct  226  SNQIGLQFYTGGMLNATKGKDGAIYHKHGGMALETQGFPDAVNHSNFPSQIVRPGETYKH  285

Query  232  VMVYRFT  212
             MVYRFT
Sbjct  286  YMVYRFT  292



>emb|CBI22179.3| unnamed protein product [Vitis vinifera]
Length=1699

 Score =   271 bits (694),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 129/191 (68%), Positives = 153/191 (80%), Gaps = 0/191 (0%)
 Frame = -1

Query  769  QLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTGAI  590
            QL + MKAKALNKATPVNLA H YWNLGGH SGDILS+ IQ+F S ITPVD++LIPTG I
Sbjct  171  QLIVTMKAKALNKATPVNLAQHAYWNLGGHTSGDILSNEIQIFGSHITPVDKELIPTGKI  230

Query  589  SPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGLKHLGKAAVVVDSKSGRKMELWT  410
             PVKGT +DFL+   IGS++N+LP G+DINYVLD      +G AA+V   KSGR +EL+T
Sbjct  231  VPVKGTPYDFLKPCTIGSKINKLPSGFDINYVLDDTAPNKVGLAAMVHHKKSGRMLELYT  290

Query  409  NKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETYDHV  230
            N PG+QFYTSN L D KGKGG+VY+ HAALCLETQGFPDSVN PNFPSQIV PG++Y H 
Sbjct  291  NAPGLQFYTSNSLKDVKGKGGFVYQAHAALCLETQGFPDSVNHPNFPSQIVTPGKSYHHS  350

Query  229  MVYRFTTHDAS  197
            M+++F+   AS
Sbjct  351  MLFKFSIRMAS  361



>ref|XP_003528185.2| PREDICTED: aldose 1-epimerase-like [Glycine max]
Length=353

 Score =   253 bits (647),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 117/187 (63%), Positives = 142/187 (76%), Gaps = 0/187 (0%)
 Frame = -1

Query  772  NQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTGA  593
            N+  ++M AK ++KATPVNLA HTYWNL GH+ GDILSH +Q+F SKITPVD+KLIPTG 
Sbjct  165  NKYSVKMIAKPIDKATPVNLAHHTYWNLKGHNGGDILSHEVQIFGSKITPVDKKLIPTGK  224

Query  592  ISPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGLKHLGKAAVVVDSKSGRKMELW  413
               VKGT +DFL+ R +GS +N+LPG YD+NYVLD+    H  K  +V +  SGRK+ELW
Sbjct  225  FESVKGTPYDFLEPREVGSRINDLPGLYDMNYVLDASSPNHFRKVLIVREKVSGRKLELW  284

Query  412  TNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETYDH  233
            +N+ G+QFYT  ML  TKGK G +Y KH  + LETQGFPD+VN  NFPSQIV PGETY H
Sbjct  285  SNQIGLQFYTGGMLNATKGKDGAIYHKHGGMALETQGFPDAVNHSNFPSQIVRPGETYKH  344

Query  232  VMVYRFT  212
             MVYRFT
Sbjct  345  YMVYRFT  351



>ref|XP_002323843.2| hypothetical protein POPTR_0017s11650g [Populus trichocarpa]
 gb|EEF03976.2| hypothetical protein POPTR_0017s11650g [Populus trichocarpa]
Length=358

 Score =   253 bits (645),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 123/188 (65%), Positives = 144/188 (77%), Gaps = 1/188 (1%)
 Frame = -1

Query  772  NQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTGA  593
            NQL I M+AKALNKATPV L +H +WNLGGH+SGDILS  IQ+F S+  PVD  LIPTG 
Sbjct  171  NQLCITMEAKALNKATPVCLVNHAFWNLGGHNSGDILSEKIQIFASRYLPVDSTLIPTGE  230

Query  592  ISPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGLKHLGKAAVVVDSKSGRKMELW  413
            I  VK T +DFL+   IGS +NELP GYD NY LD  G K L KAA+V D KSGR ME+ 
Sbjct  231  IVTVKETPYDFLKPNTIGSRINELPKGYDTNYALDGSGNKKLRKAAIVHDEKSGRAMEIL  290

Query  412  TNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETYDH  233
            TN+PGVQ +TSN L + KGKGG++YK H AL LETQGFPDSVN PNFPSQIVNPG+ Y H
Sbjct  291  TNQPGVQLFTSNTL-NVKGKGGFMYKPHGALSLETQGFPDSVNRPNFPSQIVNPGKPYKH  349

Query  232  VMVYRFTT  209
             M+++F+T
Sbjct  350  YMLFKFST  357



>ref|XP_009779455.1| PREDICTED: aldose 1-epimerase-like isoform X4 [Nicotiana sylvestris]
Length=377

 Score =   252 bits (643),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 123/195 (63%), Positives = 150/195 (77%), Gaps = 5/195 (3%)
 Frame = -1

Query  790  LTCSLQN--QLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVD  617
            +T +L++  +L + MKAKALN ATPVNLA HTYWN+GGH+SGDILS+ +Q+F S ITPVD
Sbjct  178  VTYALEDPYKLSVVMKAKALNMATPVNLAQHTYWNIGGHNSGDILSNVVQIFASHITPVD  237

Query  616  EKLIPTGAISPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGLKHLGKAAVVVDSK  437
            E LIPTG ISPVK T +DFL+ R +GS++NEL  GYDINY LDS     +   A+V D K
Sbjct  238  EHLIPTGEISPVKNTPYDFLKPREVGSQINELQSGYDINYALDSSA--EMKPVAIVHDKK  295

Query  436  SGRKMELWTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIV  257
            SGR M+L  + PGVQFYT+N L   KGKGGYVY+ HAALC ETQGFPD+VN PNFPS IV
Sbjct  296  SGRVMDLQASAPGVQFYTANSLIQ-KGKGGYVYQPHAALCFETQGFPDAVNHPNFPSTIV  354

Query  256  NPGETYDHVMVYRFT  212
            +PG+ Y H M+Y F+
Sbjct  355  SPGKAYTHKMLYTFS  369



>ref|XP_010102873.1| Aldose 1-epimerase [Morus notabilis]
 gb|EXB94289.1| Aldose 1-epimerase [Morus notabilis]
Length=364

 Score =   251 bits (642),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 119/188 (63%), Positives = 148/188 (79%), Gaps = 1/188 (1%)
 Frame = -1

Query  769  QLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTGAI  590
            +L ++M+AKALNK TPVNLA HTYWNLGGH+SGDILS+ I++F S IT VD +LIPTG  
Sbjct  174  RLKVKMEAKALNKPTPVNLAQHTYWNLGGHNSGDILSNKIKIFASHITVVDSQLIPTGKF  233

Query  589  SPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGL-KHLGKAAVVVDSKSGRKMELW  413
            +PVKGT +DFL+   +GS + +LP GYDINYVLD     K L + AVV DSKSGR + L 
Sbjct  234  APVKGTPYDFLKPHLVGSRIKKLPKGYDINYVLDGPASDKKLKRVAVVYDSKSGRSLALS  293

Query  412  TNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETYDH  233
            T+ PGVQFY+ N L D KGKGG VY+ HA LCLETQGFPD+VN P+FPS IV+PG+ Y+H
Sbjct  294  TSAPGVQFYSGNFLKDVKGKGGAVYEAHAGLCLETQGFPDAVNHPDFPSTIVSPGKPYNH  353

Query  232  VMVYRFTT  209
            VM+++F+T
Sbjct  354  VMLFKFST  361



>ref|XP_009624450.1| PREDICTED: aldose 1-epimerase-like isoform X2 [Nicotiana tomentosiformis]
Length=360

 Score =   251 bits (640),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 122/195 (63%), Positives = 151/195 (77%), Gaps = 5/195 (3%)
 Frame = -1

Query  790  LTCSLQN--QLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVD  617
            +T +L++  +L + MKAKALNKATPVNLA HTYWN+GGH+SGDILS+ +Q+F S ITPVD
Sbjct  161  VTYALEDPYKLSVVMKAKALNKATPVNLAQHTYWNIGGHNSGDILSNVVQIFASHITPVD  220

Query  616  EKLIPTGAISPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGLKHLGKAAVVVDSK  437
            E LIPTG ISPVK T +DFL+ R +G+++++LP GYDINY LDS     +   A+V D K
Sbjct  221  EHLIPTGEISPVKNTPYDFLKPREVGNQISKLPSGYDINYALDS--TVEMKPVAIVYDKK  278

Query  436  SGRKMELWTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIV  257
            SGR M+L  + PGVQFYT+N L   KGKGGYVY+ HAALC ETQGFPD+VN PNFPS IV
Sbjct  279  SGRVMDLQASAPGVQFYTANSLIQ-KGKGGYVYQPHAALCFETQGFPDAVNHPNFPSTIV  337

Query  256  NPGETYDHVMVYRFT  212
             PG+ Y H M+Y F+
Sbjct  338  TPGKAYVHKMLYTFS  352



>ref|XP_009624449.1| PREDICTED: aldose 1-epimerase-like isoform X1 [Nicotiana tomentosiformis]
Length=371

 Score =   251 bits (640),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 122/195 (63%), Positives = 151/195 (77%), Gaps = 5/195 (3%)
 Frame = -1

Query  790  LTCSLQN--QLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVD  617
            +T +L++  +L + MKAKALNKATPVNLA HTYWN+GGH+SGDILS+ +Q+F S ITPVD
Sbjct  172  VTYALEDPYKLSVVMKAKALNKATPVNLAQHTYWNIGGHNSGDILSNVVQIFASHITPVD  231

Query  616  EKLIPTGAISPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGLKHLGKAAVVVDSK  437
            E LIPTG ISPVK T +DFL+ R +G+++++LP GYDINY LDS     +   A+V D K
Sbjct  232  EHLIPTGEISPVKNTPYDFLKPREVGNQISKLPSGYDINYALDS--TVEMKPVAIVYDKK  289

Query  436  SGRKMELWTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIV  257
            SGR M+L  + PGVQFYT+N L   KGKGGYVY+ HAALC ETQGFPD+VN PNFPS IV
Sbjct  290  SGRVMDLQASAPGVQFYTANSLIQ-KGKGGYVYQPHAALCFETQGFPDAVNHPNFPSTIV  348

Query  256  NPGETYDHVMVYRFT  212
             PG+ Y H M+Y F+
Sbjct  349  TPGKAYVHKMLYTFS  363



>ref|XP_002318873.1| aldose 1-epimerase family protein [Populus trichocarpa]
 gb|EEE97093.1| aldose 1-epimerase family protein [Populus trichocarpa]
Length=345

 Score =   249 bits (637),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 119/189 (63%), Positives = 143/189 (76%), Gaps = 10/189 (5%)
 Frame = -1

Query  772  NQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTGA  593
            N+L ++M+A  LNK TPVNLA H YWNLGGH SGDILSHTIQL  S+ITPVDE+LIPTG 
Sbjct  167  NKLVVKMRAMPLNKRTPVNLALHAYWNLGGHSSGDILSHTIQLLASEITPVDEELIPTGE  226

Query  592  ISPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGLKHLGKAAVVVDSKSGRKMELW  413
            I  V+ T +DF + R IGS   +LP GYDINYVLD+    HL K AVV +  SGRK+ELW
Sbjct  227  IVAVEDTPYDFHKPREIGSMFTQLPDGYDINYVLDNVNPGHLKKVAVVQEGVSGRKLELW  286

Query  412  TNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETYDH  233
            TN+PGVQFYTS          G+VY ++A +CLETQGFPD+VN P FPSQIVNPG+ Y++
Sbjct  287  TNQPGVQFYTS----------GFVYTQYAGICLETQGFPDAVNHPRFPSQIVNPGDIYEN  336

Query  232  VMVYRFTTH  206
            +M+YRFT H
Sbjct  337  IMIYRFTAH  345



>gb|KHN48675.1| Aldose 1-epimerase, partial [Glycine soja]
Length=343

 Score =   249 bits (635),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 118/187 (63%), Positives = 147/187 (79%), Gaps = 2/187 (1%)
 Frame = -1

Query  772  NQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTGA  593
            ++ G++M AK ++KATPVNLA HTYWNL GH+SGDILSHT+Q+F S ITPVD+ LIPTG 
Sbjct  157  HEFGVKMIAKQVDKATPVNLAQHTYWNLRGHNSGDILSHTVQIFGSHITPVDKLLIPTGE  216

Query  592  ISPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGLKHLGKAAVVVDSKSGRKMELW  413
            I  VKGT +DFL+ + +GS++ E  G YD+NYVLD    KHL KAAVV+D  SGRK+ELW
Sbjct  217  IISVKGTPYDFLEPKKVGSQIQE--GLYDMNYVLDKSFQKHLSKAAVVIDPVSGRKLELW  274

Query  412  TNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETYDH  233
            +N+ G+QFYTS  L  TKGK   +Y KHA + LET+GFPDSVN+P FPSQIV PGE Y+H
Sbjct  275  SNQLGLQFYTSGQLNATKGKDEALYGKHAGIALETKGFPDSVNYPYFPSQIVKPGEIYEH  334

Query  232  VMVYRFT  212
             M+Y+FT
Sbjct  335  TMLYKFT  341



>gb|KJB75755.1| hypothetical protein B456_012G055600 [Gossypium raimondii]
Length=245

 Score =   245 bits (626),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 125/187 (67%), Positives = 147/187 (79%), Gaps = 1/187 (1%)
 Frame = -1

Query  772  NQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTGA  593
            N+L +RMKAKALNKATPVNLA HTYWNLG H+SGDILS  +Q+F S  TPVD +LIPTG 
Sbjct  57   NRLTVRMKAKALNKATPVNLAQHTYWNLGNHNSGDILSEQVQIFASHYTPVDSQLIPTGK  116

Query  592  ISPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGLKHLGKAAVVVDSKSGRKMELW  413
             + VKGT +DFL+   +GS +N+L  GYDINYV+D    K L KAAVV D KSGR MEL+
Sbjct  117  FATVKGTPYDFLKPHTVGSRINKLENGYDINYVIDGVDGK-LKKAAVVKDKKSGRVMELF  175

Query  412  TNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETYDH  233
            TN+ GVQFYT+N L D +GKGGYVY+ H ALCLETQ FPDSVN PNFPS IV PG+ Y H
Sbjct  176  TNQAGVQFYTANFLKDVRGKGGYVYESHGALCLETQAFPDSVNHPNFPSVIVYPGKEYKH  235

Query  232  VMVYRFT  212
            VMV++F+
Sbjct  236  VMVFKFS  242



>ref|XP_009401394.1| PREDICTED: aldose 1-epimerase-like [Musa acuminata subsp. malaccensis]
Length=360

 Score =   249 bits (636),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 121/188 (64%), Positives = 142/188 (76%), Gaps = 2/188 (1%)
 Frame = -1

Query  769  QLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTGAI  590
            +L I M AK+LNKATPVNLA H+YWNLGGH SG ILS+ +Q+F SKITPVD  LIP G I
Sbjct  172  ELSIAMCAKSLNKATPVNLAQHSYWNLGGHGSGTILSNMVQIFSSKITPVDANLIPIGTI  231

Query  589  SPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSH-GLKHLGKAAVVVDSK-SGRKMEL  416
             PV GT +DFL+   +GS +++L GGYDINYVLD   G   + K AVV D   SGR  EL
Sbjct  232  VPVSGTPYDFLKPTTVGSRIDKLSGGYDINYVLDQPIGSNGMRKVAVVKDGDGSGRAFEL  291

Query  415  WTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETYD  236
            W N+PGVQFYT N L + KGKGG +Y KHA LCLETQGFPDSVN PNFPSQIVNPG+ Y 
Sbjct  292  WANQPGVQFYTGNFLNNVKGKGGQIYGKHAGLCLETQGFPDSVNHPNFPSQIVNPGKDYK  351

Query  235  HVMVYRFT  212
            H M+++F+
Sbjct  352  HNMLFKFS  359



>gb|KHN13632.1| Aldose 1-epimerase [Glycine soja]
Length=371

 Score =   249 bits (635),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 118/193 (61%), Positives = 147/193 (76%), Gaps = 2/193 (1%)
 Frame = -1

Query  775  QNQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTG  596
            +NQL I MK KALNK TPVNLA+H YWNLGGH+SG+IL+  +Q+F SKITPVD KLIPTG
Sbjct  173  KNQLVILMKGKALNKPTPVNLANHAYWNLGGHNSGNILNEVVQIFGSKITPVDNKLIPTG  232

Query  595  AISPVKGTAFDFLQARAIGSELNELPG--GYDINYVLDSHGLKHLGKAAVVVDSKSGRKM  422
              + VKGTA+DFL+ + +GS +N+L G  GYDINYV+D    + +  AA+V D KSGR +
Sbjct  233  KFASVKGTAYDFLKPQTVGSRINQLAGTKGYDINYVIDGEKGQKIKLAAIVQDKKSGRVL  292

Query  421  ELWTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGET  242
            EL+TN PG+QFYT N + D KGKGGYVY  HA LCLE+Q FPDSVN PNFPS IV   + 
Sbjct  293  ELFTNAPGLQFYTGNYIKDLKGKGGYVYNAHAGLCLESQAFPDSVNHPNFPSTIVTQEKP  352

Query  241  YDHVMVYRFTTHD  203
            Y H M+++F+T +
Sbjct  353  YKHYMLFKFSTKN  365



>ref|XP_006338469.1| PREDICTED: aldose 1-epimerase-like isoform X1 [Solanum tuberosum]
Length=360

 Score =   248 bits (632),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 121/199 (61%), Positives = 154/199 (77%), Gaps = 5/199 (3%)
 Frame = -1

Query  802  LLL*LTCSLQN--QLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKI  629
            LL+ +T +L+N  +L + MKAKALNKATPVNLA H+YWNLGGH+SG+ILS+ +Q+F S I
Sbjct  157  LLVSVTYALKNPYKLSVVMKAKALNKATPVNLAQHSYWNLGGHNSGNILSNVVQIFASHI  216

Query  628  TPVDEKLIPTGAISPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGLKHLGKAAVV  449
            TPVD+ LIPTG ISPVK T ++FL+ R +GS++ EL  GYDINYV+DS   + +   A+V
Sbjct  217  TPVDQSLIPTGEISPVKNTPYNFLKPREVGSQIKELQSGYDINYVVDS--TEKMKPVAIV  274

Query  448  VDSKSGRKMELWTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFP  269
             D KSGR M++  + PGVQFYT+N L + KGKGGYVY+ HAALC ETQGFPD+VN PNFP
Sbjct  275  YDEKSGRVMDVQASAPGVQFYTANSL-NQKGKGGYVYQPHAALCFETQGFPDAVNHPNFP  333

Query  268  SQIVNPGETYDHVMVYRFT  212
              IV PG+ Y H M+Y F+
Sbjct  334  PTIVTPGKAYVHKMLYTFS  352



>ref|XP_006578581.1| PREDICTED: aldose 1-epimerase-like [Glycine max]
Length=355

 Score =   248 bits (632),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 116/188 (62%), Positives = 143/188 (76%), Gaps = 1/188 (1%)
 Frame = -1

Query  772  NQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGD-ILSHTIQLFCSKITPVDEKLIPTG  596
            N+  ++M A+ ++KATPVNLA HTYWNL G +SGD ILSH +Q+F SKITPVD++LIPTG
Sbjct  166  NKYSLKMIARPIDKATPVNLAHHTYWNLKGQNSGDNILSHEVQIFGSKITPVDKELIPTG  225

Query  595  AISPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGLKHLGKAAVVVDSKSGRKMEL  416
                VKGT +DFL+ R +GS +N+LPG YD+NYVLD+    H  K  +V +  SGRK+EL
Sbjct  226  KFESVKGTPYDFLEPREVGSRINDLPGLYDMNYVLDASSPYHFRKVIIVREKVSGRKLEL  285

Query  415  WTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETYD  236
            W+N+ G+QFYT  ML  TKGK G +Y KH  + LETQGFPD+VN PNFPSQIV PGETY 
Sbjct  286  WSNQLGLQFYTGGMLNATKGKDGAIYHKHGGMALETQGFPDAVNRPNFPSQIVRPGETYK  345

Query  235  HVMVYRFT  212
            H MVYRFT
Sbjct  346  HYMVYRFT  353



>ref|XP_004302346.1| PREDICTED: aldose 1-epimerase-like [Fragaria vesca subsp. vesca]
Length=365

 Score =   248 bits (632),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 121/189 (64%), Positives = 147/189 (78%), Gaps = 2/189 (1%)
 Frame = -1

Query  769  QLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTGAI  590
            QL I+MKAKALNK TPVNLA HTYWNLGGH+SG+ILS  +Q+F SKIT VD+ LIPTG  
Sbjct  175  QLSIKMKAKALNKPTPVNLAQHTYWNLGGHNSGNILSQHVQIFGSKITLVDKGLIPTGKF  234

Query  589  SPVKGTAFDFLQARAIGSELNELPG--GYDINYVLDSHGLKHLGKAAVVVDSKSGRKMEL  416
            + VKGT +DFL+ + +GS +++L    GYD+NYVLD      L +AAVV DSKSGR +EL
Sbjct  235  ASVKGTPYDFLKPQVVGSRIDKLKATKGYDVNYVLDGPAGNKLKRAAVVHDSKSGRMLEL  294

Query  415  WTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETYD  236
             TN PG+QFYTSN L D KGKGG VY+  AALCLETQGFPD+VN PNFPS IV P ++Y 
Sbjct  295  STNAPGMQFYTSNYLQDVKGKGGCVYQPRAALCLETQGFPDAVNHPNFPSTIVTPTKSYK  354

Query  235  HVMVYRFTT  209
            H M+++F+T
Sbjct  355  HYMLFKFST  363



>ref|XP_003534458.1| PREDICTED: aldose 1-epimerase-like [Glycine max]
 gb|KHN11594.1| Aldose 1-epimerase [Glycine soja]
Length=371

 Score =   248 bits (632),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 117/193 (61%), Positives = 147/193 (76%), Gaps = 2/193 (1%)
 Frame = -1

Query  775  QNQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTG  596
            +NQL I MK K LNK TPVNLA+H YWNLGGH+SG+IL+  +Q+F SKITPVD KLIPTG
Sbjct  173  KNQLVILMKGKTLNKPTPVNLANHAYWNLGGHNSGNILNEVVQIFGSKITPVDSKLIPTG  232

Query  595  AISPVKGTAFDFLQARAIGSELNELP--GGYDINYVLDSHGLKHLGKAAVVVDSKSGRKM  422
              + VKGTA+DFL+ + +GS +N+L    GYDINYVLD    + +  AA+V D KSGR +
Sbjct  233  KFASVKGTAYDFLKPQTVGSRINQLAETKGYDINYVLDGEKGQKIKLAAIVQDKKSGRVL  292

Query  421  ELWTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGET  242
            EL+TN PG+QFYT N + D KGKGGYVY+ H+ LCLE+Q FPDSVN PNFPS IV P + 
Sbjct  293  ELFTNAPGLQFYTGNYVKDLKGKGGYVYQSHSGLCLESQAFPDSVNQPNFPSTIVTPEKP  352

Query  241  YDHVMVYRFTTHD  203
            Y H M+++F+T +
Sbjct  353  YKHYMLFKFSTKN  365



>ref|XP_006338470.1| PREDICTED: aldose 1-epimerase-like isoform X2 [Solanum tuberosum]
Length=357

 Score =   247 bits (630),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 121/199 (61%), Positives = 154/199 (77%), Gaps = 5/199 (3%)
 Frame = -1

Query  802  LLL*LTCSLQN--QLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKI  629
            LL+ +T +L+N  +L + MKAKALNKATPVNLA H+YWNLGGH+SG+ILS+ +Q+F S I
Sbjct  154  LLVSVTYALKNPYKLSVVMKAKALNKATPVNLAQHSYWNLGGHNSGNILSNVVQIFASHI  213

Query  628  TPVDEKLIPTGAISPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGLKHLGKAAVV  449
            TPVD+ LIPTG ISPVK T ++FL+ R +GS++ EL  GYDINYV+DS   + +   A+V
Sbjct  214  TPVDQSLIPTGEISPVKNTPYNFLKPREVGSQIKELQSGYDINYVVDS--TEKMKPVAIV  271

Query  448  VDSKSGRKMELWTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFP  269
             D KSGR M++  + PGVQFYT+N L + KGKGGYVY+ HAALC ETQGFPD+VN PNFP
Sbjct  272  YDEKSGRVMDVQASAPGVQFYTANSL-NQKGKGGYVYQPHAALCFETQGFPDAVNHPNFP  330

Query  268  SQIVNPGETYDHVMVYRFT  212
              IV PG+ Y H M+Y F+
Sbjct  331  PTIVTPGKAYVHKMLYTFS  349



>ref|XP_009779461.1| PREDICTED: aldose 1-epimerase-like [Nicotiana sylvestris]
Length=355

 Score =   247 bits (630),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 122/199 (61%), Positives = 156/199 (78%), Gaps = 5/199 (3%)
 Frame = -1

Query  802  LLL*LTCSLQN--QLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKI  629
            LL+ +T +L++  +L + MK KALNKATPVNLA HTYWN+GGH SG+ILS+ IQ+F S+I
Sbjct  157  LLVSVTYALKDPYKLSVVMKGKALNKATPVNLAQHTYWNIGGHTSGNILSNVIQIFASQI  216

Query  628  TPVDEKLIPTGAISPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGLKHLGKAAVV  449
            T VD+ LIPTGA++PVK T +DFL+ R +GS++N+L  GYDINY LDS   +++   A+V
Sbjct  217  TLVDQHLIPTGALAPVKNTPYDFLKPRKVGSQINKLQNGYDINYALDSS--ENMKPVAIV  274

Query  448  VDSKSGRKMELWTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFP  269
             D KSGR M+L  + PGVQFYT+N L   KGKGGYVY+ HAALCLETQGFPD+VN PNFP
Sbjct  275  YDKKSGRVMDLQASAPGVQFYTANSLIK-KGKGGYVYQPHAALCLETQGFPDAVNHPNFP  333

Query  268  SQIVNPGETYDHVMVYRFT  212
            S IV PG++Y H M+Y F+
Sbjct  334  STIVTPGKSYIHKMLYTFS  352



>ref|XP_009624451.1| PREDICTED: aldose 1-epimerase-like [Nicotiana tomentosiformis]
Length=356

 Score =   246 bits (629),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 123/199 (62%), Positives = 151/199 (76%), Gaps = 5/199 (3%)
 Frame = -1

Query  802  LLL*LTCSLQN--QLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKI  629
            LL+ +T  L++  +L + MKAKALNKATPVNLA HTYWN+GGH SGDILS+ IQ+F S I
Sbjct  157  LLVSVTYGLKDPYKLSVVMKAKALNKATPVNLAQHTYWNIGGHTSGDILSNDIQIFASHI  216

Query  628  TPVDEKLIPTGAISPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGLKHLGKAAVV  449
            TPVD+ LIPTG  +PVK T +DFL+ R +GS++N+L  GYDINY LD    + +   A+V
Sbjct  217  TPVDQHLIPTGEFAPVKNTPYDFLKPRKVGSQINKLQNGYDINYALDIS--EKMKPVAIV  274

Query  448  VDSKSGRKMELWTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFP  269
             D KSGR M+L  + PGVQFYT+N L   KGKGGYVY+ HAALCLETQGFPD+VN PNFP
Sbjct  275  YDKKSGRVMDLQASAPGVQFYTANSLI-KKGKGGYVYQPHAALCLETQGFPDAVNHPNFP  333

Query  268  SQIVNPGETYDHVMVYRFT  212
            S IV PG+ Y H M+Y F+
Sbjct  334  STIVTPGKNYVHKMLYTFS  352



>gb|KJB75754.1| hypothetical protein B456_012G055600 [Gossypium raimondii]
Length=359

 Score =   246 bits (629),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 125/187 (67%), Positives = 147/187 (79%), Gaps = 1/187 (1%)
 Frame = -1

Query  772  NQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTGA  593
            N+L +RMKAKALNKATPVNLA HTYWNLG H+SGDILS  +Q+F S  TPVD +LIPTG 
Sbjct  171  NRLTVRMKAKALNKATPVNLAQHTYWNLGNHNSGDILSEQVQIFASHYTPVDSQLIPTGK  230

Query  592  ISPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGLKHLGKAAVVVDSKSGRKMELW  413
             + VKGT +DFL+   +GS +N+L  GYDINYV+D    K L KAAVV D KSGR MEL+
Sbjct  231  FATVKGTPYDFLKPHTVGSRINKLENGYDINYVIDGVDGK-LKKAAVVKDKKSGRVMELF  289

Query  412  TNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETYDH  233
            TN+ GVQFYT+N L D +GKGGYVY+ H ALCLETQ FPDSVN PNFPS IV PG+ Y H
Sbjct  290  TNQAGVQFYTANFLKDVRGKGGYVYESHGALCLETQAFPDSVNHPNFPSVIVYPGKEYKH  349

Query  232  VMVYRFT  212
            VMV++F+
Sbjct  350  VMVFKFS  356



>ref|XP_004232231.2| PREDICTED: aldose 1-epimerase-like [Solanum lycopersicum]
Length=464

 Score =   249 bits (637),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 121/199 (61%), Positives = 155/199 (78%), Gaps = 5/199 (3%)
 Frame = -1

Query  802  LLL*LTCSLQN--QLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKI  629
            LL+ +T +L++  +L + MKA+ALNKATPVNLA H+YWNLGGH+SGDILS+ +Q+F S I
Sbjct  261  LLVSVTYALKDPYKLSVVMKAEALNKATPVNLAQHSYWNLGGHNSGDILSNVVQIFASHI  320

Query  628  TPVDEKLIPTGAISPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGLKHLGKAAVV  449
            TPVD+ LIPTG ISP+K T +DFL+ R +GS++ EL  GYDINYVLDS   + +   A+V
Sbjct  321  TPVDQSLIPTGKISPIKNTPYDFLKPREVGSQIKELQSGYDINYVLDS--TEKMKPVAIV  378

Query  448  VDSKSGRKMELWTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFP  269
             D KSGR M++  + PGVQFYT+N L + KGKGGYVY+ HAALC ETQGFPD++N PNFP
Sbjct  379  YDEKSGRVMDVQASAPGVQFYTANSL-NQKGKGGYVYQPHAALCFETQGFPDAMNHPNFP  437

Query  268  SQIVNPGETYDHVMVYRFT  212
            S IV PG+ Y H M+Y F+
Sbjct  438  STIVTPGKAYIHKMLYTFS  456



>ref|XP_002323842.1| aldose 1-epimerase family protein [Populus trichocarpa]
 gb|EEF03975.1| aldose 1-epimerase family protein [Populus trichocarpa]
Length=359

 Score =   246 bits (628),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 123/196 (63%), Positives = 145/196 (74%), Gaps = 3/196 (2%)
 Frame = -1

Query  787  TCSLQNQLGIRMKAKAL-NKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEK  611
            T    NQ+ + MKAK + NKATPVN+A+H YWNLGGH+SGDILS  IQ+F S  TPVD  
Sbjct  165  TLLADNQVTVVMKAKNIGNKATPVNIANHAYWNLGGHNSGDILSEKIQIFASNYTPVDND  224

Query  610  LIPTGAISPVKGTAFDFLQARAIGSELNELPGGYDINYVLDS-HGLKHLGKAAVVVDSKS  434
            LIPTG I  VKGT FDFL+  AIGS   +LP GYDINY LD  HG K + KAAV+ D KS
Sbjct  225  LIPTGKIEAVKGTPFDFLKPEAIGSRTRQLPKGYDINYALDGVHGGK-IRKAAVLQDEKS  283

Query  433  GRKMELWTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVN  254
            G +MEL TN PG+QFYT NM+ D KGK G+VYK HAALCLETQ +PD VN P+FP  IV 
Sbjct  284  GIEMELSTNAPGLQFYTGNMIKDVKGKAGFVYKAHAALCLETQWYPDYVNQPDFPQSIVE  343

Query  253  PGETYDHVMVYRFTTH  206
            P + Y HVM+Y+F++H
Sbjct  344  PRKNYKHVMLYKFSSH  359



>ref|NP_001241992.1| uncharacterized protein LOC100781853 precursor [Glycine max]
 gb|ACU17623.1| unknown [Glycine max]
Length=371

 Score =   246 bits (628),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 117/193 (61%), Positives = 146/193 (76%), Gaps = 2/193 (1%)
 Frame = -1

Query  775  QNQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTG  596
            +NQL I MK KALNK TPVNLA+H YWNLGGH+SG+IL+  +Q+  SKITPVD KLIPTG
Sbjct  173  KNQLVILMKGKALNKPTPVNLANHAYWNLGGHNSGNILNEVVQILGSKITPVDNKLIPTG  232

Query  595  AISPVKGTAFDFLQARAIGSELNELPG--GYDINYVLDSHGLKHLGKAAVVVDSKSGRKM  422
              + VKGTA+DFL+ + +GS +N+L G  GYDINYV+D    + +  AA+V D KSGR +
Sbjct  233  KFASVKGTAYDFLKPQTVGSRINQLAGTKGYDINYVIDGEKGQKIKLAAIVQDKKSGRVL  292

Query  421  ELWTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGET  242
            EL+TN PG+QFYT N + D KGKGGYVY  HA LCLE+Q FPDSVN PNFPS IV   + 
Sbjct  293  ELFTNAPGLQFYTGNYIKDLKGKGGYVYNAHAGLCLESQAFPDSVNHPNFPSTIVTQEKP  352

Query  241  YDHVMVYRFTTHD  203
            Y H M+++F+T +
Sbjct  353  YKHYMLFKFSTKN  365



>ref|XP_012083064.1| PREDICTED: aldose 1-epimerase-like [Jatropha curcas]
 gb|KDP45491.1| hypothetical protein JCGZ_09740 [Jatropha curcas]
Length=364

 Score =   245 bits (626),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 122/193 (63%), Positives = 147/193 (76%), Gaps = 6/193 (3%)
 Frame = -1

Query  775  QNQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTG  596
            +NQL I MKAKALNK TPVNL +H YWNLGGH+SGDILS  IQ+F SK TP++ +LIPTG
Sbjct  170  ENQLSITMKAKALNKPTPVNLVNHAYWNLGGHNSGDILSEEIQIFGSKYTPLNSELIPTG  229

Query  595  AISPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSH-----GLKHLGKAAVVVDSKSG  431
             I+ VKGT +DFL+   IGS++ +LP GYDINY LD         K L KAA+V D K+G
Sbjct  230  EIASVKGTPYDFLKPYIIGSKIRKLPNGYDINYALDDKKTGRGSSKVLKKAAIVYDKKTG  289

Query  430  RKMELWTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNP  251
            R + L+TN+PGVQFYTSN LT  KGKGGYVYK  AALCLETQG+PD+V+ PNFPS IV P
Sbjct  290  RALHLFTNQPGVQFYTSNTLTQ-KGKGGYVYKPFAALCLETQGYPDAVHHPNFPSTIVYP  348

Query  250  GETYDHVMVYRFT  212
            G+ Y H M+ +F+
Sbjct  349  GKAYKHYMLIKFS  361



>ref|XP_007099714.1| Galactose mutarotase-like superfamily protein, putative [Theobroma 
cacao]
 gb|EOY20329.1| Galactose mutarotase-like superfamily protein, putative [Theobroma 
cacao]
Length=438

 Score =   247 bits (631),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 122/187 (65%), Positives = 147/187 (79%), Gaps = 1/187 (1%)
 Frame = -1

Query  772  NQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTGA  593
            N+L + MKA ALNKATPVNLA HTYWNLG H+SGDILS  +Q+F S+ TPVD +LIPTG 
Sbjct  250  NKLTVTMKANALNKATPVNLAQHTYWNLGNHNSGDILSEEVQIFASQYTPVDSQLIPTGE  309

Query  592  ISPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGLKHLGKAAVVVDSKSGRKMELW  413
             + VKGT +DFL++  +GS +N+LP GYDINYVLD      + K AVV D KSGR MEL 
Sbjct  310  FASVKGTPYDFLKSHTVGSRINKLPSGYDINYVLDG-APGKIKKVAVVKDKKSGRVMELL  368

Query  412  TNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETYDH  233
            TN+PGVQFYT+N L D KGKGGYVY+ H ALCLETQGFPDSVN PNFPS I+ PG+ Y H
Sbjct  369  TNQPGVQFYTANFLKDVKGKGGYVYQPHGALCLETQGFPDSVNHPNFPSTIIYPGKEYKH  428

Query  232  VMVYRFT  212
            +M+++F+
Sbjct  429  IMLFKFS  435



>tpg|DAA37475.1| TPA: hypothetical protein ZEAMMB73_785674 [Zea mays]
Length=187

 Score =   238 bits (606),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 113/187 (60%), Positives = 136/187 (73%), Gaps = 7/187 (4%)
 Frame = -1

Query  754  MKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTGAISPVKG  575
            M A A+NKATPVNLA HTYWNLGG  SGD+L +T+QLF S+ TPV   LIPTGA++PV G
Sbjct  1    MNATAVNKATPVNLAQHTYWNLGGQGSGDVLRNTVQLFASRYTPVGGGLIPTGAVAPVAG  60

Query  574  TAFDFLQARAIGSELNELPGG------YDINYVLDSHGLKHLGKAAVVVDSKSGRKMELW  413
            T +DFL   A+GS + ++ GG      YD NY +D      L K AVV D  SGR +ELW
Sbjct  61   TPYDFLAPAAVGSRIRQVSGGKAGVYGYDTNYAVDGE-PGALRKVAVVRDGASGRALELW  119

Query  412  TNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETYDH  233
             N+PGVQFYT N L D KGKGG VY+++ ALCLETQGFPD+VN PNFPSQIV PG+ Y H
Sbjct  120  ANQPGVQFYTGNFLQDVKGKGGKVYQQYGALCLETQGFPDAVNHPNFPSQIVRPGQVYKH  179

Query  232  VMVYRFT  212
             MV++F+
Sbjct  180  DMVFKFS  186



>gb|KHG05985.1| Aldose 1-epimerase [Gossypium arboreum]
Length=359

 Score =   243 bits (621),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 125/187 (67%), Positives = 146/187 (78%), Gaps = 1/187 (1%)
 Frame = -1

Query  772  NQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTGA  593
            N+L +RMKAKALNKATPVNLA HTYWNLG H+SGDILS  +Q+F S  TPVD +LIPTG 
Sbjct  171  NRLTVRMKAKALNKATPVNLAQHTYWNLGNHNSGDILSEQVQIFASHYTPVDSQLIPTGK  230

Query  592  ISPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGLKHLGKAAVVVDSKSGRKMELW  413
             + VKGT +DFL+   +GS +N+L  GYDINYV+D    K L KAAVV D KSGR MEL+
Sbjct  231  FAAVKGTPYDFLKPHTVGSRINKLENGYDINYVIDGVDGK-LKKAAVVKDKKSGRVMELF  289

Query  412  TNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETYDH  233
            TN+ GVQFYT+N L D KGK GYVY+ H ALCLETQ FPDSVN PNFPS IV PG+ Y H
Sbjct  290  TNQAGVQFYTANSLKDVKGKDGYVYEPHGALCLETQAFPDSVNHPNFPSTIVYPGKEYKH  349

Query  232  VMVYRFT  212
            VMV++F+
Sbjct  350  VMVFKFS  356



>ref|XP_007139591.1| hypothetical protein PHAVU_008G042600g [Phaseolus vulgaris]
 gb|ESW11585.1| hypothetical protein PHAVU_008G042600g [Phaseolus vulgaris]
Length=364

 Score =   243 bits (621),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 121/191 (63%), Positives = 140/191 (73%), Gaps = 2/191 (1%)
 Frame = -1

Query  775  QNQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTG  596
            +NQL I MK KALNK TPVNLA+H YWNLGG +SG+IL+  +Q+F SKIT VD KLIPTG
Sbjct  170  KNQLVILMKGKALNKPTPVNLANHAYWNLGGQNSGNILNEVVQIFGSKITVVDSKLIPTG  229

Query  595  AISPVKGTAFDFLQARAIGSELNELP--GGYDINYVLDSHGLKHLGKAAVVVDSKSGRKM  422
                VKGTA+DFL+   IGS +N+L    GYDINYVLD    K    AA+V D KSGR M
Sbjct  230  KFGYVKGTAYDFLKPHTIGSRINQLAETKGYDINYVLDVEKGKKRKLAAIVQDKKSGRVM  289

Query  421  ELWTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGET  242
            EL+TN PG+QFYT N +   KGKGGYVY  HA LCLETQ FPDSVN PNFPS IV P + 
Sbjct  290  ELYTNAPGLQFYTGNYVKHVKGKGGYVYNAHAGLCLETQAFPDSVNRPNFPSTIVTPEKP  349

Query  241  YDHVMVYRFTT  209
            Y H M+Y+F+T
Sbjct  350  YKHYMLYKFST  360



>ref|XP_009593213.1| PREDICTED: aldose 1-epimerase-like [Nicotiana tomentosiformis]
Length=359

 Score =   243 bits (621),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 118/187 (63%), Positives = 145/187 (78%), Gaps = 3/187 (2%)
 Frame = -1

Query  769  QLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTGAI  590
            +L + MKAKALNKATPVNLA H+YWN+GGH+SGDILS+ IQ+F S ITPVDE LIPTG I
Sbjct  171  KLSVVMKAKALNKATPVNLAQHSYWNIGGHNSGDILSNVIQIFASHITPVDEHLIPTGEI  230

Query  589  SPVKGTAFDFLQARAIGSEL-NELPGGYDINYVLDSHGLKHLGKAAVVVDSKSGRKMELW  413
             PVK T +DFL+ R +GS++ N+   GYDINYVLDS   + +   A+V D KSGR M + 
Sbjct  231  IPVKNTPYDFLKPRKVGSQMINKHQNGYDINYVLDSS--EKMKPVAIVYDKKSGRVMVVQ  288

Query  412  TNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETYDH  233
             + PGVQFYT+N + + KGK GYVY+ H+ALCLETQGFPD+VN PNFPS IV PG+TY H
Sbjct  289  ASAPGVQFYTANFVINKKGKDGYVYQPHSALCLETQGFPDAVNHPNFPSTIVTPGKTYVH  348

Query  232  VMVYRFT  212
             M+Y F+
Sbjct  349  KMLYMFS  355



>gb|AES91241.2| aldose 1-epimerase family protein [Medicago truncatula]
Length=340

 Score =   243 bits (619),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 113/187 (60%), Positives = 139/187 (74%), Gaps = 18/187 (10%)
 Frame = -1

Query  775  QNQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTG  596
            +N LG++M AK +NK TPVNLA H YWNLGGH+SGDIL+H++Q+F S ITPVD+KLIPTG
Sbjct  169  KNILGVKMTAKPVNKPTPVNLAQHAYWNLGGHNSGDILNHSVQIFGSSITPVDDKLIPTG  228

Query  595  AISPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGLKHLGKAAVVVDSKSGRKMEL  416
             +  VK T +DFL+ + +GS++N+LPG YDINY +D                   RKMEL
Sbjct  229  KLESVKNTPYDFLKPKQVGSQINDLPGLYDINYAIDE------------------RKMEL  270

Query  415  WTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETYD  236
            W+N+ G+Q+YTS MLTDTKGK G  Y K+  + LETQGFPDSVN PNFPSQIV PGETY 
Sbjct  271  WSNQVGLQYYTSGMLTDTKGKDGATYHKYGGIALETQGFPDSVNKPNFPSQIVKPGETYK  330

Query  235  HVMVYRF  215
            H+MVYRF
Sbjct  331  HIMVYRF  337



>ref|XP_008811569.1| PREDICTED: aldose 1-epimerase-like [Phoenix dactylifera]
Length=358

 Score =   243 bits (619),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 110/187 (59%), Positives = 139/187 (74%), Gaps = 1/187 (1%)
 Frame = -1

Query  766  LGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTGAIS  587
            L + M+A   NK TPVNLA H+YWNLGGHDSG IL H++Q+F S ITPVD+ LIPTG I 
Sbjct  171  LSVSMRAVPRNKPTPVNLAQHSYWNLGGHDSGTILKHSVQIFASHITPVDKNLIPTGEIE  230

Query  586  PVKGTAFDFLQARAIGSELNELPGGYDINYVLDS-HGLKHLGKAAVVVDSKSGRKMELWT  410
            PV GT +DF +   + S ++ +PGGYDINYVLD+   ++ + K A+V D +SGR +ELWT
Sbjct  231  PVAGTPYDFREPMTVASRIDHVPGGYDINYVLDAPTDVQGVRKVAIVEDCESGRVLELWT  290

Query  409  NKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETYDHV  230
            N+PGVQFYT N L D KGKGG+ YK+H  LCLETQ FPD+VN P FP +I +PGE Y H 
Sbjct  291  NQPGVQFYTGNFLKDEKGKGGHYYKQHDGLCLETQNFPDAVNHPQFPREIYSPGEVYKHY  350

Query  229  MVYRFTT  209
            M+Y+F+ 
Sbjct  351  MLYKFSV  357



>ref|XP_007032473.1| Galactose mutarotase-like superfamily protein [Theobroma cacao]
 gb|EOY03399.1| Galactose mutarotase-like superfamily protein [Theobroma cacao]
Length=364

 Score =   243 bits (620),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 122/192 (64%), Positives = 146/192 (76%), Gaps = 1/192 (1%)
 Frame = -1

Query  787  TCSLQNQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKL  608
            T   +N+L + MKAK + K TPVNLA HTYWNLG HDSGDILS  IQ+F S  TPVD +L
Sbjct  171  TLLAKNKLSVTMKAKVVKKYTPVNLAQHTYWNLGNHDSGDILSEEIQIFASLYTPVDSQL  230

Query  607  IPTGAISPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGLKHLGKAAVVVDSKSGR  428
            IPTG + PVKGT +DFL+ + IGS + ELP GYDINY LD      + K AVV D KSGR
Sbjct  231  IPTGKLEPVKGTPYDFLKLQTIGSRIKELPKGYDINYALDGTP-GKMKKVAVVKDKKSGR  289

Query  427  KMELWTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPG  248
             M+L+ N+PGVQFYT NM+ + KGKGG+VYK HAALCLETQGFPDSVN PNFPSQIV P 
Sbjct  290  VMKLFANQPGVQFYTGNMIRNVKGKGGFVYKAHAALCLETQGFPDSVNHPNFPSQIVTPK  349

Query  247  ETYDHVMVYRFT  212
            + Y+H M+++F+
Sbjct  350  KLYEHNMLFKFS  361



>ref|XP_011008940.1| PREDICTED: aldose 1-epimerase-like [Populus euphratica]
Length=359

 Score =   241 bits (616),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 121/196 (62%), Positives = 145/196 (74%), Gaps = 3/196 (2%)
 Frame = -1

Query  787  TCSLQNQLGIRMKAKAL-NKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEK  611
            T   +NQ+ + MKAK + NKATPVN+A+H YWNLGGH+ G ILS  IQ+F S  TPVD  
Sbjct  165  TLLAENQVTVVMKAKNIGNKATPVNIANHAYWNLGGHNRGGILSEKIQIFASNYTPVDSD  224

Query  610  LIPTGAISPVKGTAFDFLQARAIGSELNELPGGYDINYVLDS-HGLKHLGKAAVVVDSKS  434
            LIPTG I  VKGT FDFL+ +AIGS   +LP GYDINY LD  HG K + KAAV+ D KS
Sbjct  225  LIPTGKIEAVKGTPFDFLKPKAIGSRTKQLPKGYDINYALDGVHGGK-IRKAAVLHDEKS  283

Query  433  GRKMELWTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVN  254
            G +MEL TN PG+QFYT NM+ D KGK G+VYK HAALCLETQ +PD +N P+FP  IV 
Sbjct  284  GIEMELSTNAPGLQFYTGNMIKDVKGKDGFVYKAHAALCLETQWYPDYLNQPDFPQSIVE  343

Query  253  PGETYDHVMVYRFTTH  206
            P + Y HVM+Y+F+TH
Sbjct  344  PRKNYKHVMLYKFSTH  359



>ref|XP_008784475.1| PREDICTED: aldose 1-epimerase-like [Phoenix dactylifera]
Length=364

 Score =   241 bits (616),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 115/196 (59%), Positives = 143/196 (73%), Gaps = 13/196 (7%)
 Frame = -1

Query  769  QLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTGAI  590
            +L + M AK++NKATPVNL  HTYWNLGGH+SG ILS+T+Q+F S +TP D   IPTG I
Sbjct  171  ELSVTMDAKSVNKATPVNLLQHTYWNLGGHNSGTILSNTVQIFASHVTPSDSHFIPTGEI  230

Query  589  SPVKGTAFDFLQARAIGSELNELPGGYDINYVLD----------SHGLKHLGKAAVVVDS  440
              V GT +DFL+   +GS +NE+ GGY+INY +           +HG++   K AVV D 
Sbjct  231  VSVSGTPYDFLKPMIVGSRINEITGGYNINYDVKGKGGFVYGQHAHGMR---KVAVVKDG  287

Query  439  KSGRKMELWTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQI  260
             SGR  ELW+N+PGVQFYTSN L D KGKGG+VY +HAALCLETQGF D+VN PNFPSQI
Sbjct  288  GSGRAFELWSNQPGVQFYTSNSLKDVKGKGGFVYGQHAALCLETQGFADAVNHPNFPSQI  347

Query  259  VNPGETYDHVMVYRFT  212
            VN GE Y H M+++F+
Sbjct  348  VNAGEVYKHYMLFKFS  363



>ref|XP_006338467.1| PREDICTED: aldose 1-epimerase-like [Solanum tuberosum]
Length=358

 Score =   241 bits (616),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 114/196 (58%), Positives = 151/196 (77%), Gaps = 6/196 (3%)
 Frame = -1

Query  790  LTCSLQNQ--LGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVD  617
            +T +L++   L +  KAKALNKATP+NL+ H YWN+GGH+SGD+LS  +Q+F S ITP+D
Sbjct  162  VTYALKDHYNLSVVFKAKALNKATPINLSHHPYWNIGGHNSGDVLSQVVQIFASHITPLD  221

Query  616  EKLIPTGAISPVKGTAFDFLQARAIGSELNELPGGYDINYVLDS-HGLKHLGKAAVVVDS  440
             + IPTG ISPVK T +DFL+ R +GS ++++  GYDINY LDS   +KH+   A+V D 
Sbjct  222  TQHIPTGIISPVKNTPYDFLKPRKVGSRIDKIQNGYDINYALDSTEKMKHV---AIVYDK  278

Query  439  KSGRKMELWTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQI  260
            KSGR+M++    PGVQFYT+N + +TKGKGGYVY+ H+ALCLETQGFPD+VN PNFPS I
Sbjct  279  KSGREMDIKATAPGVQFYTANWVINTKGKGGYVYQPHSALCLETQGFPDAVNHPNFPSTI  338

Query  259  VNPGETYDHVMVYRFT  212
            V PG++Y H ++Y FT
Sbjct  339  VTPGKSYVHSVLYTFT  354



>ref|XP_003621163.1| Aldose 1-epimerase [Medicago truncatula]
Length=187

 Score =   235 bits (599),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 114/184 (62%), Positives = 139/184 (76%), Gaps = 2/184 (1%)
 Frame = -1

Query  754  MKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTGAISPVKG  575
            MKAKALNK TPVNLA+H YWN+GG +SG+IL+  IQ+F SK T VD+KLIPTG  + VKG
Sbjct  1    MKAKALNKPTPVNLANHAYWNIGGQNSGNILNEVIQIFGSKTTIVDDKLIPTGKFASVKG  60

Query  574  TAFDFLQARAIGSELNELP--GGYDINYVLDSHGLKHLGKAAVVVDSKSGRKMELWTNKP  401
            TA+DFL+ + IGS +++L    GYDINYVLD    K +  AA V D KSGR +EL+TN P
Sbjct  61   TAYDFLKPQIIGSRISQLAQHKGYDINYVLDGEKGKKIKLAAKVHDKKSGRILELYTNAP  120

Query  400  GVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETYDHVMVY  221
            G+QFYT N + D KGK GYVYK HA LCLE+Q FPDSVN PNFPS IV P + Y H M++
Sbjct  121  GLQFYTGNYIKDVKGKSGYVYKAHAGLCLESQAFPDSVNHPNFPSTIVTPEKPYKHYMLF  180

Query  220  RFTT  209
            +F+T
Sbjct  181  KFST  184



>ref|XP_003621162.1| Aldose 1-epimerase [Medicago truncatula]
 gb|AES77380.1| aldose 1-epimerase family protein [Medicago truncatula]
Length=362

 Score =   241 bits (615),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 118/191 (62%), Positives = 144/191 (75%), Gaps = 2/191 (1%)
 Frame = -1

Query  775  QNQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTG  596
            +NQL I MKAKALNK TPVNLA+H YWN+GG +SG+IL+  IQ+F SK T VD+KLIPTG
Sbjct  169  KNQLVIIMKAKALNKPTPVNLANHAYWNIGGQNSGNILNEVIQIFGSKTTIVDDKLIPTG  228

Query  595  AISPVKGTAFDFLQARAIGSELNELP--GGYDINYVLDSHGLKHLGKAAVVVDSKSGRKM  422
              + VKGTA+DFL+ + IGS +++L    GYDINYVLD    K +  AA V D KSGR +
Sbjct  229  KFASVKGTAYDFLKPQIIGSRISQLAQHKGYDINYVLDGEKGKKIKLAAKVHDKKSGRIL  288

Query  421  ELWTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGET  242
            EL+TN PG+QFYT N + D KGK GYVYK HA LCLE+Q FPDSVN PNFPS IV P + 
Sbjct  289  ELYTNAPGLQFYTGNYIKDVKGKSGYVYKAHAGLCLESQAFPDSVNHPNFPSTIVTPEKP  348

Query  241  YDHVMVYRFTT  209
            Y H M+++F+T
Sbjct  349  YKHYMLFKFST  359



>ref|XP_011098592.1| PREDICTED: aldose 1-epimerase-like [Sesamum indicum]
Length=360

 Score =   241 bits (614),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 116/190 (61%), Positives = 142/190 (75%), Gaps = 3/190 (2%)
 Frame = -1

Query  769  QLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTGAI  590
            +L + MKAKAL+KATPV+LA H+YWNLGGH+SG+ LS  +QLF S IT VD+KLIPTG I
Sbjct  169  KLSVTMKAKALDKATPVSLAQHSYWNLGGHNSGNTLSDELQLFASHITLVDDKLIPTGKI  228

Query  589  SPVKGTAFDFLQARAIGSELNELPGG---YDINYVLDSHGLKHLGKAAVVVDSKSGRKME  419
             PVK T +DFL+   I   +  LP G   YDINYV+D    + +   A+V + KSGR M+
Sbjct  229  VPVKSTPYDFLEPHVIKGPIKRLPKGSKGYDINYVVDGPKGQKMKPVAIVYNKKSGRIMK  288

Query  418  LWTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETY  239
            L  N PGVQ YT N + D KGKGGYVY+ HAALCLETQGFPDSVN PNFPS+IVNPG+TY
Sbjct  289  LSANAPGVQLYTGNYINDVKGKGGYVYQSHAALCLETQGFPDSVNHPNFPSEIVNPGKTY  348

Query  238  DHVMVYRFTT  209
            +H M++ F+T
Sbjct  349  EHCMLFTFST  358



>ref|XP_010916998.1| PREDICTED: aldose 1-epimerase-like [Elaeis guineensis]
 ref|XP_010916999.1| PREDICTED: aldose 1-epimerase-like [Elaeis guineensis]
 ref|XP_010917000.1| PREDICTED: aldose 1-epimerase-like [Elaeis guineensis]
Length=358

 Score =   240 bits (613),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 110/185 (59%), Positives = 138/185 (75%), Gaps = 1/185 (1%)
 Frame = -1

Query  766  LGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTGAIS  587
              + M+A   NK TPVNLA HTYWNLGGHDSG IL H++Q+F S  TPVD+ LIPTG I+
Sbjct  171  FSVSMRAVPRNKPTPVNLAQHTYWNLGGHDSGTILKHSVQIFASHFTPVDKNLIPTGKIA  230

Query  586  PVKGTAFDFLQARAIGSELNELPGGYDINYVLDS-HGLKHLGKAAVVVDSKSGRKMELWT  410
            PV+GT +DF +     S +++LPGGYDINYVLDS   ++ + K A+V D +SGR +ELW 
Sbjct  231  PVEGTPYDFRKPMTSASRIDQLPGGYDINYVLDSPTDVQGVRKVAIVEDCESGRVLELWA  290

Query  409  NKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETYDHV  230
            N+PGVQFYT N L D KGKGG+ YK+H  LCLETQ FPD+VN PNFP ++ +PGE Y H 
Sbjct  291  NQPGVQFYTGNFLKDEKGKGGHHYKQHDGLCLETQDFPDAVNHPNFPREVYSPGEVYKHY  350

Query  229  MVYRF  215
            M+Y+F
Sbjct  351  MLYKF  355



>emb|CDP02212.1| unnamed protein product [Coffea canephora]
Length=362

 Score =   241 bits (614),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 115/189 (61%), Positives = 145/189 (77%), Gaps = 2/189 (1%)
 Frame = -1

Query  769  QLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTGAI  590
            +L + M+A+ALNKATPVNLA H+YWNLGGH+SGD+LS  +Q+F S  TPV+ +LIPTG I
Sbjct  171  KLRVIMEAEALNKATPVNLAQHSYWNLGGHNSGDVLSDEVQIFASHFTPVNNQLIPTGKI  230

Query  589  SPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGLK-HLGKAAVVVDS-KSGRKMEL  416
            SPVKGT +DFL+   IGS++N+LP G+DINY LD  G + +  K AV+  S K+G  M++
Sbjct  231  SPVKGTPYDFLKPHTIGSQINQLPSGFDINYALDGGGDEDNDMKVAVIAHSKKTGIGMKI  290

Query  415  WTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETYD  236
             T+ PG+QFYT+N L D  GK GYVY+ HAA C ETQGFPDSVN PNFPSQIVNPG+ Y 
Sbjct  291  STSAPGLQFYTANHLKDVTGKSGYVYQAHAAYCFETQGFPDSVNHPNFPSQIVNPGDVYT  350

Query  235  HVMVYRFTT  209
            H ++Y F T
Sbjct  351  HYILYEFKT  359



>ref|XP_009779459.1| PREDICTED: aldose 1-epimerase-like isoform X8 [Nicotiana sylvestris]
Length=356

 Score =   240 bits (612),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 111/199 (56%), Positives = 153/199 (77%), Gaps = 4/199 (2%)
 Frame = -1

Query  802  LLL*LTCSLQN--QLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKI  629
            +L+ +T +L++  +L +  KA+ALNKATP+NL+ H YWN+GGH+SGD+LS  +Q++ S I
Sbjct  157  VLVSVTYALKDPYKLSVVFKARALNKATPINLSHHPYWNIGGHNSGDVLSQVLQIYASHI  216

Query  628  TPVDEKLIPTGAISPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGLKHLGKAAVV  449
            TP+D++ IPTG ISPVK T +DFL+ R +GS ++++  GYDINY LDS   + +   A+V
Sbjct  217  TPLDKQHIPTGEISPVKNTPYDFLKPRKVGSRIDKIQNGYDINYALDSS--RKMKPVAIV  274

Query  448  VDSKSGRKMELWTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFP  269
             D KSGR M++    PGVQFYT+N + +TKGKGGYVY+ H+ALCLETQGFPD+VN PNFP
Sbjct  275  FDKKSGRVMDIKATAPGVQFYTANFVINTKGKGGYVYQPHSALCLETQGFPDAVNHPNFP  334

Query  268  SQIVNPGETYDHVMVYRFT  212
            S IV PG+TY H ++Y F+
Sbjct  335  STIVTPGKTYLHSVLYTFS  353



>ref|XP_009779457.1| PREDICTED: aldose 1-epimerase-like isoform X6 [Nicotiana sylvestris]
Length=357

 Score =   240 bits (612),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 111/199 (56%), Positives = 153/199 (77%), Gaps = 4/199 (2%)
 Frame = -1

Query  802  LLL*LTCSLQN--QLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKI  629
            +L+ +T +L++  +L +  KA+ALNKATP+NL+ H YWN+GGH+SGD+LS  +Q++ S I
Sbjct  158  VLVSVTYALKDPYKLSVVFKARALNKATPINLSHHPYWNIGGHNSGDVLSQVLQIYASHI  217

Query  628  TPVDEKLIPTGAISPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGLKHLGKAAVV  449
            TP+D++ IPTG ISPVK T +DFL+ R +GS ++++  GYDINY LDS   + +   A+V
Sbjct  218  TPLDKQHIPTGEISPVKNTPYDFLKPRKVGSRIDKIQNGYDINYALDSS--RKMKPVAIV  275

Query  448  VDSKSGRKMELWTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFP  269
             D KSGR M++    PGVQFYT+N + +TKGKGGYVY+ H+ALCLETQGFPD+VN PNFP
Sbjct  276  FDKKSGRVMDIKATAPGVQFYTANFVINTKGKGGYVYQPHSALCLETQGFPDAVNHPNFP  335

Query  268  SQIVNPGETYDHVMVYRFT  212
            S IV PG+TY H ++Y F+
Sbjct  336  STIVTPGKTYLHSVLYTFS  354



>ref|XP_009369413.1| PREDICTED: LOW QUALITY PROTEIN: aldose 1-epimerase [Pyrus x bretschneideri]
Length=185

 Score =   234 bits (596),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 111/183 (61%), Positives = 141/183 (77%), Gaps = 2/183 (1%)
 Frame = -1

Query  754  MKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTGAISPVKG  575
            M+AKA NK TP NLA HT+WN+ G  SG ILSH IQ+F S++TPV+++LIPTG    +KG
Sbjct  1    MEAKAHNKVTPANLAHHTHWNIRGQSSGGILSHRIQIFGSRVTPVNDQLIPTGETVLMKG  60

Query  574  TAFDFLQARAIGSELNELPGGYDINYVLD--SHGLKHLGKAAVVVDSKSGRKMELWTNKP  401
            T ++FL+ + I S++N LP GYDIN VLD      KHL KAA + DS  GR++ELWT+ P
Sbjct  61   TPYEFLEPQEIVSKINGLPDGYDINCVLDPSRRSHKHLRKAAALHDSVXGRQLELWTDIP  120

Query  400  GVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETYDHVMVY  221
            G+QFYTSNML + KGKGG   +KHAA+CLETQGFPD+VN PNFPS+++ PGETY H+M+ 
Sbjct  121  GLQFYTSNMLDNVKGKGGSXVQKHAAVCLETQGFPDTVNHPNFPSRVIXPGETYLHLMLX  180

Query  220  RFT  212
            RFT
Sbjct  181  RFT  183



>gb|AAL09398.1|AF307095_1 non-cell-autonomous protein pathway2 [Nicotiana tabacum]
Length=357

 Score =   239 bits (609),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 111/199 (56%), Positives = 153/199 (77%), Gaps = 4/199 (2%)
 Frame = -1

Query  802  LLL*LTCSLQN--QLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKI  629
            +L+ +T +L++  +L +  KA+ALNKATP+NL+ H YWN+GGH+SGD+LS  +Q++ S I
Sbjct  158  VLVSVTYALKDPYKLSVVFKARALNKATPINLSHHPYWNIGGHNSGDVLSQVLQIYASHI  217

Query  628  TPVDEKLIPTGAISPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGLKHLGKAAVV  449
            TP+D++ IPTG ISPVK T +DFL+ R +GS ++++  GYDINY LDS   + +   A+V
Sbjct  218  TPLDKQHIPTGEISPVKNTPYDFLKPRKVGSRIDKIQNGYDINYALDSS--RKMKPVAIV  275

Query  448  VDSKSGRKMELWTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFP  269
             D KSGR M++    PGVQFYT+N + +TKGKGGYVY+ H+ALCLETQGFPD+VN PNFP
Sbjct  276  FDKKSGRVMDIKATAPGVQFYTANFVINTKGKGGYVYQPHSALCLETQGFPDAVNHPNFP  335

Query  268  SQIVNPGETYDHVMVYRFT  212
            S IV PG+TY H ++Y F+
Sbjct  336  STIVIPGKTYLHSVLYTFS  354



>ref|XP_009779450.1| PREDICTED: aldose 1-epimerase-like [Nicotiana sylvestris]
Length=355

 Score =   238 bits (607),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 118/188 (63%), Positives = 141/188 (75%), Gaps = 3/188 (2%)
 Frame = -1

Query  769  QLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTGAI  590
            +L + MKAK  NKATPVNLA HTYWN+GGH+SGDILS+ IQ+F S ITPVDE LIPTG I
Sbjct  171  KLSVVMKAKDRNKATPVNLAQHTYWNIGGHNSGDILSNVIQIFASHITPVDEHLIPTGEI  230

Query  589  SPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGLKHLGKAAVVVDSKSGRKMELWT  410
            + VK T +DFL+ R +GS +N+   GYDINYVLDS   K +   A+V D KSGR M +  
Sbjct  231  TSVKNTPYDFLKPRKVGSRINKHQNGYDINYVLDSS--KKMKPVAIVYDKKSGRVMLVQA  288

Query  409  NKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETYDHV  230
            + PGVQF+T+N L   KGKGGYVY+ HAALCLETQGFPD+VN PNFPS IV P +TY H 
Sbjct  289  SAPGVQFFTANSLIK-KGKGGYVYQPHAALCLETQGFPDAVNHPNFPSTIVTPRKTYVHK  347

Query  229  MVYRFTTH  206
            M+Y F  +
Sbjct  348  MLYTFVKY  355



>ref|XP_003609044.1| Aldose 1-epimerase-like protein [Medicago truncatula]
Length=337

 Score =   237 bits (605),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 112/187 (60%), Positives = 137/187 (73%), Gaps = 21/187 (11%)
 Frame = -1

Query  775  QNQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTG  596
            +N LG++M AK +NK TPVNLA H YWNLGGH+SGDIL+H++Q+F S ITPVD+KLIPTG
Sbjct  169  KNILGVKMTAKPVNKPTPVNLAQHAYWNLGGHNSGDILNHSVQIFGSSITPVDDKLIPTG  228

Query  595  AISPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGLKHLGKAAVVVDSKSGRKMEL  416
             +  VK T +DFL+ + +GS++N+LPG YDINY                      RKMEL
Sbjct  229  KLESVKNTPYDFLKPKQVGSQINDLPGLYDINYE---------------------RKMEL  267

Query  415  WTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETYD  236
            W+N+ G+Q+YTS MLTDTKGK G  Y K+  + LETQGFPDSVN PNFPSQIV PGETY 
Sbjct  268  WSNQVGLQYYTSGMLTDTKGKDGATYHKYGGIALETQGFPDSVNKPNFPSQIVKPGETYK  327

Query  235  HVMVYRF  215
            H+MVYRF
Sbjct  328  HIMVYRF  334



>ref|NP_001137118.1| aldose 1-epimerase precursor [Zea mays]
 gb|ACF83300.1| unknown [Zea mays]
 tpg|DAA37476.1| TPA: aldose 1-epimerase [Zea mays]
Length=363

 Score =   238 bits (607),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 114/191 (60%), Positives = 138/191 (72%), Gaps = 7/191 (4%)
 Frame = -1

Query  766  LGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTGAIS  587
            L + M A A+NKATPVNLA HTYWNLGG  SGD+L +T+QLF S+ TPV   LIPTGA++
Sbjct  173  LRVHMNATAVNKATPVNLAQHTYWNLGGQGSGDVLRNTVQLFASRYTPVGGGLIPTGAVA  232

Query  586  PVKGTAFDFLQARAIGSELNELPGG------YDINYVLDSHGLKHLGKAAVVVDSKSGRK  425
            PV GT +DFL   A+GS + ++ GG      YD NY +D      L K AVV D  SGR 
Sbjct  233  PVAGTPYDFLAPAAVGSRIRQVSGGKAGVYGYDTNYAVDGE-PGALRKVAVVRDGASGRA  291

Query  424  MELWTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGE  245
            +ELW N+PGVQFYT N L D KGKGG VY+++ ALCLETQGFPD+VN PNFPSQIV PG+
Sbjct  292  LELWANQPGVQFYTGNFLQDVKGKGGKVYQQYGALCLETQGFPDAVNHPNFPSQIVRPGQ  351

Query  244  TYDHVMVYRFT  212
             Y H MV++F+
Sbjct  352  VYKHDMVFKFS  362



>ref|XP_009779453.1| PREDICTED: aldose 1-epimerase-like isoform X3 [Nicotiana sylvestris]
Length=450

 Score =   239 bits (611),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 111/199 (56%), Positives = 153/199 (77%), Gaps = 4/199 (2%)
 Frame = -1

Query  802  LLL*LTCSLQN--QLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKI  629
            +L+ +T +L++  +L +  KA+ALNKATP+NL+ H YWN+GGH+SGD+LS  +Q++ S I
Sbjct  251  VLVSVTYALKDPYKLSVVFKARALNKATPINLSHHPYWNIGGHNSGDVLSQVLQIYASHI  310

Query  628  TPVDEKLIPTGAISPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGLKHLGKAAVV  449
            TP+D++ IPTG ISPVK T +DFL+ R +GS ++++  GYDINY LDS   + +   A+V
Sbjct  311  TPLDKQHIPTGEISPVKNTPYDFLKPRKVGSRIDKIQNGYDINYALDSS--RKMKPVAIV  368

Query  448  VDSKSGRKMELWTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFP  269
             D KSGR M++    PGVQFYT+N + +TKGKGGYVY+ H+ALCLETQGFPD+VN PNFP
Sbjct  369  FDKKSGRVMDIKATAPGVQFYTANFVINTKGKGGYVYQPHSALCLETQGFPDAVNHPNFP  428

Query  268  SQIVNPGETYDHVMVYRFT  212
            S IV PG+TY H ++Y F+
Sbjct  429  STIVTPGKTYLHSVLYTFS  447



>ref|XP_009779451.1| PREDICTED: aldose 1-epimerase-like isoform X1 [Nicotiana sylvestris]
Length=467

 Score =   240 bits (612),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 111/199 (56%), Positives = 153/199 (77%), Gaps = 4/199 (2%)
 Frame = -1

Query  802  LLL*LTCSLQN--QLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKI  629
            +L+ +T +L++  +L +  KA+ALNKATP+NL+ H YWN+GGH+SGD+LS  +Q++ S I
Sbjct  268  VLVSVTYALKDPYKLSVVFKARALNKATPINLSHHPYWNIGGHNSGDVLSQVLQIYASHI  327

Query  628  TPVDEKLIPTGAISPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGLKHLGKAAVV  449
            TP+D++ IPTG ISPVK T +DFL+ R +GS ++++  GYDINY LDS   + +   A+V
Sbjct  328  TPLDKQHIPTGEISPVKNTPYDFLKPRKVGSRIDKIQNGYDINYALDSS--RKMKPVAIV  385

Query  448  VDSKSGRKMELWTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFP  269
             D KSGR M++    PGVQFYT+N + +TKGKGGYVY+ H+ALCLETQGFPD+VN PNFP
Sbjct  386  FDKKSGRVMDIKATAPGVQFYTANFVINTKGKGGYVYQPHSALCLETQGFPDAVNHPNFP  445

Query  268  SQIVNPGETYDHVMVYRFT  212
            S IV PG+TY H ++Y F+
Sbjct  446  STIVTPGKTYLHSVLYTFS  464



>ref|XP_009779452.1| PREDICTED: aldose 1-epimerase-like isoform X2 [Nicotiana sylvestris]
Length=450

 Score =   239 bits (610),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 111/199 (56%), Positives = 153/199 (77%), Gaps = 4/199 (2%)
 Frame = -1

Query  802  LLL*LTCSLQN--QLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKI  629
            +L+ +T +L++  +L +  KA+ALNKATP+NL+ H YWN+GGH+SGD+LS  +Q++ S I
Sbjct  251  VLVSVTYALKDPYKLSVVFKARALNKATPINLSHHPYWNIGGHNSGDVLSQVLQIYASHI  310

Query  628  TPVDEKLIPTGAISPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGLKHLGKAAVV  449
            TP+D++ IPTG ISPVK T +DFL+ R +GS ++++  GYDINY LDS   + +   A+V
Sbjct  311  TPLDKQHIPTGEISPVKNTPYDFLKPRKVGSRIDKIQNGYDINYALDSS--RKMKPVAIV  368

Query  448  VDSKSGRKMELWTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFP  269
             D KSGR M++    PGVQFYT+N + +TKGKGGYVY+ H+ALCLETQGFPD+VN PNFP
Sbjct  369  FDKKSGRVMDIKATAPGVQFYTANFVINTKGKGGYVYQPHSALCLETQGFPDAVNHPNFP  428

Query  268  SQIVNPGETYDHVMVYRFT  212
            S IV PG+TY H ++Y F+
Sbjct  429  STIVTPGKTYLHSVLYTFS  447



>emb|CDX78613.1| BnaA03g05250D [Brassica napus]
Length=309

 Score =   234 bits (598),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 111/188 (59%), Positives = 139/188 (74%), Gaps = 1/188 (1%)
 Frame = -1

Query  775  QNQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTG  596
            +N+L + M+AK  +KATP+NLA H+YWNLGGH++GDILS  IQ+  S  TPVD +LIPTG
Sbjct  120  ENELSVVMEAKPKDKATPINLAHHSYWNLGGHNAGDILSEEIQILGSSYTPVDGELIPTG  179

Query  595  AISPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGLKHLGKAAVVVDSKSGRKMEL  416
             ISPVKGT++DFLQ R I   + +L  GYDINY LD    K + K   ++D KSGRKMEL
Sbjct  180  EISPVKGTSYDFLQLRPIKDNMKDLKAGYDINYCLDGKADK-MRKIVELIDKKSGRKMEL  238

Query  415  WTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETYD  236
              N+PG+QFYT  ML D KGK G  Y+  A LCLETQG+P+SVN P FPSQIV PG+TY 
Sbjct  239  SGNQPGLQFYTGGMLKDIKGKNGTTYQAFAGLCLETQGYPNSVNNPKFPSQIVEPGKTYK  298

Query  235  HVMVYRFT  212
            H M+++F+
Sbjct  299  HTMLFKFS  306



>gb|ACG28451.1| aldose 1-epimerase precursor [Zea mays]
Length=364

 Score =   236 bits (602),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 113/191 (59%), Positives = 138/191 (72%), Gaps = 7/191 (4%)
 Frame = -1

Query  766  LGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTGAIS  587
            L + M A A+NKATPVNLA HTYWNLGG  SGD+L +T+QLF S+ TPV   LIPTGA++
Sbjct  174  LRVHMNATAVNKATPVNLAQHTYWNLGGQGSGDVLRNTVQLFASRYTPVGGGLIPTGAVA  233

Query  586  PVKGTAFDFLQARAIGSELNELPGG------YDINYVLDSHGLKHLGKAAVVVDSKSGRK  425
            PV GT +DFL   A+GS + ++ GG      YD NY +D      L K AVV D  SGR 
Sbjct  234  PVAGTPYDFLAPAAVGSRIRQVSGGKAGVYGYDTNYAVDGE-PGALRKVAVVRDGASGRA  292

Query  424  MELWTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGE  245
            +ELW N+PGVQFYT N L D KGKGG VY+++ ALCLETQGFPD+VN P+FPSQIV PG+
Sbjct  293  LELWANQPGVQFYTGNFLQDVKGKGGKVYQQYGALCLETQGFPDAVNHPDFPSQIVRPGQ  352

Query  244  TYDHVMVYRFT  212
             Y H MV++F+
Sbjct  353  VYKHDMVFKFS  363



>gb|KGN46963.1| hypothetical protein Csa_6G153465 [Cucumis sativus]
Length=358

 Score =   236 bits (601),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 109/190 (57%), Positives = 138/190 (73%), Gaps = 0/190 (0%)
 Frame = -1

Query  775  QNQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTG  596
            + QL + MKA AL++ TPVNLA H YWNLGGH+S DILSH IQ+F S+ITPVD  +IPTG
Sbjct  169  ETQLAVEMKAIALDQPTPVNLAQHAYWNLGGHNSEDILSHQIQIFGSRITPVDTHMIPTG  228

Query  595  AISPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGLKHLGKAAVVVDSKSGRKMEL  416
             I PV+GT +DFL  + IG  + +LP G+DI YVLD    +   KAA + + KSGR +EL
Sbjct  229  EIMPVQGTPYDFLTPKIIGDNMKKLPNGFDIYYVLDGLKGRENRKAATLRERKSGRVLEL  288

Query  415  WTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETYD  236
            WTN  G+QFYT N L +  GKGG+VY+ HA LC+ETQGFPD+VN PNFPS IV     Y+
Sbjct  289  WTNADGLQFYTGNWLRNLTGKGGFVYEAHAGLCMETQGFPDAVNHPNFPSHIVTKESPYE  348

Query  235  HVMVYRFTTH  206
            H M+++F+T 
Sbjct  349  HSMLFKFSTE  358



>ref|XP_009624447.1| PREDICTED: aldose 1-epimerase-like [Nicotiana tomentosiformis]
 ref|XP_009624448.1| PREDICTED: aldose 1-epimerase-like [Nicotiana tomentosiformis]
Length=357

 Score =   235 bits (600),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 110/199 (55%), Positives = 151/199 (76%), Gaps = 4/199 (2%)
 Frame = -1

Query  802  LLL*LTCSLQN--QLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKI  629
            +L+ +T +L++  +L +  KA+ALNKATP+NL+ H YWN+GGH++GD+LS  +Q++ S I
Sbjct  157  VLVSVTYALKDPYKLSVVFKARALNKATPINLSHHPYWNIGGHNTGDVLSQVLQIYASHI  216

Query  628  TPVDEKLIPTGAISPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGLKHLGKAAVV  449
            TP+D++ IPTG ISPVK T +DFL+   +GS +N++  GYDINY LDS   K +   A+V
Sbjct  217  TPLDKQHIPTGEISPVKNTPYDFLKPHKVGSRINKIQNGYDINYALDSS--KKMKPVAIV  274

Query  448  VDSKSGRKMELWTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFP  269
             D KSGR M++    PGVQFYT+N + +TKGKGGYVY+ H+ALCLETQGFPD+VN PNFP
Sbjct  275  YDKKSGRVMDIKATAPGVQFYTANFVINTKGKGGYVYQPHSALCLETQGFPDAVNHPNFP  334

Query  268  SQIVNPGETYDHVMVYRFT  212
            S IV PG+T  H ++Y F+
Sbjct  335  STIVTPGKTNVHSVLYTFS  353



>emb|CDX70595.1| BnaC03g06790D [Brassica napus]
Length=309

 Score =   234 bits (596),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 111/188 (59%), Positives = 139/188 (74%), Gaps = 1/188 (1%)
 Frame = -1

Query  775  QNQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTG  596
            +N+L + M+AK  +KATP+NLA H+YWNLGGH++GDILS  IQ+  S  TPVD +LIPTG
Sbjct  120  ENELSVVMEAKPKDKATPINLAHHSYWNLGGHNAGDILSEEIQILGSSYTPVDSELIPTG  179

Query  595  AISPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGLKHLGKAAVVVDSKSGRKMEL  416
             ISPVKGT++DFLQ R I   + +L  GYDINY LD    K + K   +VD KSGRKMEL
Sbjct  180  EISPVKGTSYDFLQLRPIKDNMKDLKTGYDINYCLDGKADK-MRKIVELVDKKSGRKMEL  238

Query  415  WTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETYD  236
              N+PG+QFYT  +L D KGK G  Y+  A LCLETQG+P+SVN P FPSQIV PG+TY 
Sbjct  239  SGNQPGLQFYTGGLLKDIKGKNGTTYQAFAGLCLETQGYPNSVNNPKFPSQIVEPGKTYK  298

Query  235  HVMVYRFT  212
            H M+++F+
Sbjct  299  HTMLFKFS  306



>emb|CBA10127.1| non-cell-autonomous protein pathway [Nicotiana benthamiana]
Length=357

 Score =   235 bits (600),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 107/186 (58%), Positives = 142/186 (76%), Gaps = 2/186 (1%)
 Frame = -1

Query  769  QLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTGAI  590
            +L +  KA++LNKATP+NL+ H YWN+GGH+SGD+LS  +Q++ S ITP+D++ IPTG I
Sbjct  171  KLSVVFKARSLNKATPINLSHHPYWNIGGHNSGDVLSQVLQIYASHITPLDKQHIPTGEI  230

Query  589  SPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGLKHLGKAAVVVDSKSGRKMELWT  410
            SPVK T +DFL+   +GS ++++  GYDINY LDS   K +   A+V D KSGR M +  
Sbjct  231  SPVKNTPYDFLKPHKVGSRIDKIQNGYDINYALDSS--KKMKPVAIVYDKKSGRVMNIQA  288

Query  409  NKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETYDHV  230
              PGVQFYT+N + +TKGKGGYVY+ H+ALCLETQGFPD+VN PNFPS IV PG+TY H 
Sbjct  289  TAPGVQFYTANFVINTKGKGGYVYQPHSALCLETQGFPDAVNHPNFPSTIVTPGKTYLHS  348

Query  229  MVYRFT  212
            ++Y F+
Sbjct  349  VLYTFS  354



>gb|AAL09397.1|AF307094_1 non-cell-autonomous protein pathway1 [Nicotiana tabacum]
Length=357

 Score =   235 bits (599),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 110/199 (55%), Positives = 150/199 (75%), Gaps = 4/199 (2%)
 Frame = -1

Query  802  LLL*LTCSLQN--QLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKI  629
            +L+ +T +L++  +L +  KA+ALNKATP+NL+ H YWN+GGH++GD+LS  +Q++ S I
Sbjct  157  VLVSVTYALKDPYKLSVVFKARALNKATPINLSHHPYWNIGGHNTGDVLSQVLQIYASHI  216

Query  628  TPVDEKLIPTGAISPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGLKHLGKAAVV  449
            TP+D + IPTG ISPVK T +DFL+   +GS +N++  GYDINY LDS   K +   A+V
Sbjct  217  TPLDNQHIPTGEISPVKNTPYDFLKPHKVGSRINKIQNGYDINYALDSS--KKMKPVAIV  274

Query  448  VDSKSGRKMELWTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFP  269
             D KSGR M++    PGVQFYT+N + +TKGKGGYVY+ H+ALCLETQGFPD+VN PNFP
Sbjct  275  YDKKSGRVMDIKATAPGVQFYTANFVINTKGKGGYVYQPHSALCLETQGFPDAVNHPNFP  334

Query  268  SQIVNPGETYDHVMVYRFT  212
            S IV PG+T  H ++Y F+
Sbjct  335  STIVTPGKTNVHSVLYTFS  353



>gb|ABK22097.1| unknown [Picea sitchensis]
Length=345

 Score =   234 bits (597),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 115/199 (58%), Positives = 141/199 (71%), Gaps = 7/199 (4%)
 Frame = -1

Query  787  TCSLQNQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKL  608
            T S   +L + M+A   NK TPV+LA HTYWNL GH+SGDIL H++Q++ S +TPVDE L
Sbjct  150  TLSGNLELRLDMEAVPRNKPTPVSLAQHTYWNLAGHNSGDILDHSVQIWGSHVTPVDENL  209

Query  607  IPTGAISPVKGTAFDFLQARAIGSELNELPGGYDINYVLDS----HGLKHLGKAAVVVDS  440
            IPTG + P+KGT FDF   + +GS +NE+PGGYD N+VLD      GLKH   A  V D 
Sbjct  210  IPTGELLPIKGTPFDFTNEKIVGSTINEVPGGYDHNFVLDCGESMDGLKH---AIKVEDP  266

Query  439  KSGRKMELWTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQI  260
             S R ++LWTN PG+QFYT N L    GKGG VY KHA LCLETQGFP++VN  NFPS I
Sbjct  267  SSSRVLDLWTNAPGMQFYTGNFLDGVVGKGGAVYGKHAGLCLETQGFPNAVNQANFPSII  326

Query  259  VNPGETYDHVMVYRFTTHD  203
            V+PGE Y H MVY+F+ H+
Sbjct  327  VSPGEVYRHTMVYKFSVHN  345



>ref|XP_009779460.1| PREDICTED: aldose 1-epimerase-like isoform X9 [Nicotiana sylvestris]
Length=356

 Score =   234 bits (598),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 107/186 (58%), Positives = 143/186 (77%), Gaps = 2/186 (1%)
 Frame = -1

Query  769  QLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTGAI  590
            +L +  +AKALNKATP+NL+ H YWN+GGH+SGD+LS  +Q+F S ITPVDE+LIPTG I
Sbjct  170  KLSVVFRAKALNKATPINLSHHPYWNIGGHNSGDVLSQVVQIFASNITPVDEQLIPTGEI  229

Query  589  SPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGLKHLGKAAVVVDSKSGRKMELWT  410
            +PVK T +DFL+ R +GS ++++  GYD NYVLDS+  + +   A+V D KSGR M++  
Sbjct  230  APVKNTPYDFLKPRKVGSRIDKIDRGYDRNYVLDSN--EKMKPVAIVYDKKSGRVMDIKA  287

Query  409  NKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETYDHV  230
              P V FYT+N + D KGKGGYVY+ H++L LETQG+PD+VN PNFPS IVNPG+TY H 
Sbjct  288  TAPCVHFYTANWVIDVKGKGGYVYQPHSSLSLETQGYPDAVNHPNFPSTIVNPGKTYTHS  347

Query  229  MVYRFT  212
            ++Y F+
Sbjct  348  VLYTFS  353



>ref|XP_008346833.1| PREDICTED: LOW QUALITY PROTEIN: aldose 1-epimerase-like [Malus 
domestica]
Length=185

 Score =   228 bits (581),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 110/183 (60%), Positives = 138/183 (75%), Gaps = 2/183 (1%)
 Frame = -1

Query  754  MKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTGAISPVKG  575
            M+A+A NK TPVNLA HT WN+ G  SG ILSH IQ+F S++TPV+++LIPTG    VKG
Sbjct  1    MEAEAHNKVTPVNLAHHTXWNIRGQSSGGILSHKIQIFGSRVTPVNDQLIPTGETVIVKG  60

Query  574  TAFDFLQARAIGSELNELPGGYDINYVL--DSHGLKHLGKAAVVVDSKSGRKMELWTNKP  401
            T ++FL+ + I S++N LP GYDIN VL  ++   KHL KAA + DS  GR++ELWT+ P
Sbjct  61   TPYEFLEPQEIVSKINGLPDGYDINCVLHPETSSHKHLRKAAALHDSVXGRQLELWTDMP  120

Query  400  GVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETYDHVMVY  221
            GVQFY SNML + KGKGG   K HAA CLETQGFPD+VN PNFPS+++  GETY H+M+ 
Sbjct  121  GVQFYRSNMLDNVKGKGGSCTKXHAAACLETQGFPDAVNRPNFPSRVIKRGETYLHIMLC  180

Query  220  RFT  212
            RFT
Sbjct  181  RFT  183



>ref|XP_004489156.1| PREDICTED: aldose 1-epimerase-like [Cicer arietinum]
Length=364

 Score =   234 bits (596),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 113/190 (59%), Positives = 142/190 (75%), Gaps = 2/190 (1%)
 Frame = -1

Query  775  QNQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTG  596
            +NQL I MKAKALNK TPVNLA+H YWN+G  +SG+IL+  IQ+F SKIT VD KLIPTG
Sbjct  171  KNQLVIIMKAKALNKPTPVNLANHAYWNIGNQNSGNILNEVIQIFGSKITIVDNKLIPTG  230

Query  595  AISPVKGTAFDFLQARAIGSELNELPG--GYDINYVLDSHGLKHLGKAAVVVDSKSGRKM  422
              + VKGT +DFL+ + IG+ +N+L    GYDINYVLD    K++  AA V D KSGR +
Sbjct  231  TFASVKGTPYDFLKPQIIGTRINQLAKTKGYDINYVLDGEKGKNIKLAAKVFDKKSGRTL  290

Query  421  ELWTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGET  242
            EL+TN PG+QFYT N + D KGK G+VY+ HA LCLE+Q FPDSVN P+FPS IV P + 
Sbjct  291  ELYTNAPGLQFYTGNYIMDVKGKNGHVYQAHAGLCLESQAFPDSVNHPDFPSTIVTPEKP  350

Query  241  YDHVMVYRFT  212
            Y H M+++F+
Sbjct  351  YKHYMLFKFS  360



>gb|KJB33630.1| hypothetical protein B456_006G023000 [Gossypium raimondii]
Length=388

 Score =   234 bits (597),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 110/188 (59%), Positives = 145/188 (77%), Gaps = 1/188 (1%)
 Frame = -1

Query  772  NQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTGA  593
            N+L +++KAK L+K TPVNLA+H YWNLG HDSGDILSH ++++  + TPV+E+LIPTGA
Sbjct  190  NRLRVQLKAKTLDKPTPVNLATHIYWNLGNHDSGDILSHKLRIYGPQYTPVNEELIPTGA  249

Query  592  ISPVKGTAFDFLQARAIGSELNELPGGYDINYVLDS-HGLKHLGKAAVVVDSKSGRKMEL  416
            + PV+GTA+DFL+ R IGS + EL  GY+INYV+D  +    + K AVV D KSGR M+L
Sbjct  250  LQPVQGTAYDFLELRPIGSGIKELQKGYNINYVIDGPNDHIKMKKTAVVKDEKSGRVMKL  309

Query  415  WTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETYD  236
             TN+PGVQF + + + + KGKGG +YK HA LCL+TQGFPD+VN PNFPSQI+ P + Y 
Sbjct  310  HTNQPGVQFNSGSQINNVKGKGGVIYKPHAGLCLQTQGFPDAVNHPNFPSQIITPEKPYK  369

Query  235  HVMVYRFT  212
            H + Y+FT
Sbjct  370  HKIHYKFT  377



>gb|AAB94619.1| aldose-1-epimerase-like protein [Nicotiana tabacum]
Length=356

 Score =   233 bits (594),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 108/186 (58%), Positives = 142/186 (76%), Gaps = 2/186 (1%)
 Frame = -1

Query  769  QLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTGAI  590
            +L +  +AKALNKATP+NL+ H YWN+GGHDSGD+LS  +Q+F S IT VD++LIPTG I
Sbjct  170  KLSVVFRAKALNKATPINLSHHPYWNIGGHDSGDVLSQVLQIFGSHITLVDKQLIPTGEI  229

Query  589  SPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGLKHLGKAAVVVDSKSGRKMELWT  410
            +P+K T +DFL+ R +GS +N+L  GYDINYVLDS   + +    +V D KSGR M++  
Sbjct  230  APIKNTPYDFLKPRKVGSRINKLKNGYDINYVLDS--TEKMKPVGIVYDKKSGRVMDVQA  287

Query  409  NKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETYDHV  230
            + PGVQFYT+N + +TKGKGG+VY+ H+AL LET  FPD+VN PNFPS IVNPGE Y H 
Sbjct  288  SSPGVQFYTANFVNNTKGKGGFVYQPHSALSLETLVFPDAVNHPNFPSTIVNPGEKYVHS  347

Query  229  MVYRFT  212
            ++Y F+
Sbjct  348  VLYTFS  353



>gb|AFK41318.1| unknown [Lotus japonicus]
Length=372

 Score =   233 bits (594),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 114/192 (59%), Positives = 145/192 (76%), Gaps = 3/192 (2%)
 Frame = -1

Query  775  QNQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTG  596
            +N L I MKAKALNK TPVNL +H YWNLG H+SG+IL   +Q+F S+IT +D  LIPTG
Sbjct  172  KNSLSIIMKAKALNKPTPVNLINHAYWNLGNHNSGNILGEVVQIFGSRITVLDSHLIPTG  231

Query  595  AISPVKGTAFDFLQARAIGSELNELP--GGYDINYVLDSHGLKHLGK-AAVVVDSKSGRK  425
             I+ VKGT +DFL+ + +G+ +N+LP   GYDINYVLD    K L K AA+V+D KSGR 
Sbjct  232  EIASVKGTPYDFLKPQVVGARINQLPKTNGYDINYVLDGGKSKGLIKLAAIVMDKKSGRV  291

Query  424  MELWTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGE  245
            M+L+TN PG+QFYT+N + + KGKGG+VY+  A LCLE+Q FPDSVN PNFPS IV P +
Sbjct  292  MKLFTNAPGLQFYTANKVKNEKGKGGFVYQPRAGLCLESQVFPDSVNHPNFPSSIVTPEK  351

Query  244  TYDHVMVYRFTT  209
             Y HVM+ +F+T
Sbjct  352  PYKHVMLLKFST  363



>ref|XP_009779456.1| PREDICTED: aldose 1-epimerase-like isoform X5 [Nicotiana sylvestris]
Length=373

 Score =   233 bits (594),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 110/195 (56%), Positives = 148/195 (76%), Gaps = 4/195 (2%)
 Frame = -1

Query  790  LTCSLQN--QLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVD  617
            +T +L++  +L +  +AKALNKATP+NL+ H YWN+GGHDSGD+LS  +Q+F S IT VD
Sbjct  178  VTYTLKDSYKLSVVFRAKALNKATPINLSHHPYWNIGGHDSGDVLSQVLQIFGSHITLVD  237

Query  616  EKLIPTGAISPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGLKHLGKAAVVVDSK  437
            ++LIPTG I+PVK T +DFL+ R +GS +N+L  GYDINYVLDS   + +    +V D K
Sbjct  238  KQLIPTGEIAPVKNTPYDFLKPRKVGSRINKLKNGYDINYVLDS--TEKMKPVGIVYDKK  295

Query  436  SGRKMELWTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIV  257
            SGR M++  + PGVQFYT+N + +TKGKGG+VY+ H+AL LET  FPD+VN PNFPS +V
Sbjct  296  SGRVMDVQASAPGVQFYTANFVNNTKGKGGFVYQPHSALSLETLVFPDAVNHPNFPSTVV  355

Query  256  NPGETYDHVMVYRFT  212
            NPGE Y H ++Y F+
Sbjct  356  NPGEKYVHSVLYTFS  370



>ref|XP_009779458.1| PREDICTED: aldose 1-epimerase-like isoform X7 [Nicotiana sylvestris]
Length=356

 Score =   233 bits (593),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 110/195 (56%), Positives = 148/195 (76%), Gaps = 4/195 (2%)
 Frame = -1

Query  790  LTCSLQN--QLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVD  617
            +T +L++  +L +  +AKALNKATP+NL+ H YWN+GGHDSGD+LS  +Q+F S IT VD
Sbjct  161  VTYTLKDSYKLSVVFRAKALNKATPINLSHHPYWNIGGHDSGDVLSQVLQIFGSHITLVD  220

Query  616  EKLIPTGAISPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGLKHLGKAAVVVDSK  437
            ++LIPTG I+PVK T +DFL+ R +GS +N+L  GYDINYVLDS   + +    +V D K
Sbjct  221  KQLIPTGEIAPVKNTPYDFLKPRKVGSRINKLKNGYDINYVLDS--TEKMKPVGIVYDKK  278

Query  436  SGRKMELWTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIV  257
            SGR M++  + PGVQFYT+N + +TKGKGG+VY+ H+AL LET  FPD+VN PNFPS +V
Sbjct  279  SGRVMDVQASAPGVQFYTANFVNNTKGKGGFVYQPHSALSLETLVFPDAVNHPNFPSTVV  338

Query  256  NPGETYDHVMVYRFT  212
            NPGE Y H ++Y F+
Sbjct  339  NPGEKYVHSVLYTFS  353



>gb|ABG65914.1| Aldose 1-epimerase family protein, expressed [Oryza sativa Japonica 
Group]
Length=286

 Score =   230 bits (587),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 112/198 (57%), Positives = 142/198 (72%), Gaps = 9/198 (5%)
 Frame = -1

Query  787  TCSLQNQLGIR--MKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDE  614
            T SL +   +R  M+A A NKATP+NLA HTYWNL GH+SGD L H+IQ++   ITPVDE
Sbjct  91   TYSLPDSTTLRLDMEAVAENKATPINLAQHTYWNLAGHNSGDTLDHSIQIWGKHITPVDE  150

Query  613  KLIPTGAISPVKGTAFDFLQARAIGSELNELPGGYDINYVLDS----HGLKHLGKAAVVV  446
              IPTG I PVKGT FDF     IG+ +N++PGGYD NYVLDS    +GLKH   AA + 
Sbjct  151  NTIPTGEIMPVKGTPFDFTTEHKIGARINDVPGGYDHNYVLDSGEEKNGLKH---AAKLK  207

Query  445  DSKSGRKMELWTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPS  266
            DS + R ++LWT+ PG+QFYT+N +    GKGG VY KH+ +CLETQGFP+++N PNFPS
Sbjct  208  DSSNSRTLDLWTDAPGMQFYTANYVDGVTGKGGAVYGKHSGVCLETQGFPNAINQPNFPS  267

Query  265  QIVNPGETYDHVMVYRFT  212
             +V PGE Y H M++ F+
Sbjct  268  VVVQPGEKYKHTMLFEFS  285



>ref|XP_006287626.1| hypothetical protein CARUB_v10000838mg [Capsella rubella]
 gb|EOA20524.1| hypothetical protein CARUB_v10000838mg [Capsella rubella]
Length=484

 Score =   236 bits (601),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 112/192 (58%), Positives = 138/192 (72%), Gaps = 1/192 (1%)
 Frame = -1

Query  787  TCSLQNQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKL  608
            T    N+L + M+AK  +KATPVNLA HTYWNLGGH++GDILS  IQ+  S  TPVD +L
Sbjct  291  TLDKDNELSVVMEAKTKDKATPVNLAHHTYWNLGGHNAGDILSEEIQILGSSYTPVDGEL  350

Query  607  IPTGAISPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGLKHLGKAAVVVDSKSGR  428
            IPTG ISPVKGT +DFLQ R I   + +L  GYDINY LD    K + K   +VD KSGR
Sbjct  351  IPTGQISPVKGTPYDFLQLRPIKDNIKDLKTGYDINYCLDGKADK-MRKIVDLVDKKSGR  409

Query  427  KMELWTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPG  248
            KMEL  N+PG+QFYT  ML D KGK G VY+ +  LCLETQ +PD++N+P FPSQIV PG
Sbjct  410  KMELTGNQPGLQFYTGEMLKDIKGKNGAVYQAYGGLCLETQSYPDALNYPKFPSQIVEPG  469

Query  247  ETYDHVMVYRFT  212
            + Y H M+++F+
Sbjct  470  KKYKHTMLFKFS  481



>ref|XP_002964269.1| hypothetical protein SELMODRAFT_142651 [Selaginella moellendorffii]
 gb|EFJ34602.1| hypothetical protein SELMODRAFT_142651 [Selaginella moellendorffii]
Length=288

 Score =   229 bits (584),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 109/198 (55%), Positives = 140/198 (71%), Gaps = 8/198 (4%)
 Frame = -1

Query  787  TCSLQNQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKL  608
            T S +N+L + + A   NK TPVNLA H+YWNL GH+SG IL+HT+++  S  TPVD  L
Sbjct  92   TLSGENELRVELIASTRNKMTPVNLAHHSYWNLAGHNSGSILNHTVKILASHYTPVDALL  151

Query  607  IPTGAISPVKGTAFDFLQARAIGSELNELPGGYDINYVL-----DSHGLKHLGKAAVVVD  443
            IPTG I+PV  T FDFL+  +IGS +  +PGGYD N+ L     D  GL H   A  + D
Sbjct  152  IPTGEIAPVAETPFDFLEPMSIGSRIESVPGGYDHNFALDKTVRDDEGLYH---AVTLED  208

Query  442  SKSGRKMELWTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQ  263
              S RKME+WTN+PGVQFY+ N +   +GKGG VY KHA LCLETQGFP++VN PNFPS 
Sbjct  209  PVSTRKMEIWTNQPGVQFYSGNQIVRIEGKGGAVYSKHAGLCLETQGFPNAVNQPNFPSV  268

Query  262  IVNPGETYDHVMVYRFTT  209
            I+N G+ Y+HVMV++F++
Sbjct  269  ILNSGDVYNHVMVHKFSS  286



>ref|XP_009131443.1| PREDICTED: aldose 1-epimerase-like [Brassica rapa]
Length=535

 Score =   236 bits (603),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 111/188 (59%), Positives = 139/188 (74%), Gaps = 1/188 (1%)
 Frame = -1

Query  775  QNQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTG  596
            +N+L + M+AK  +KATP+NLA H+YWNLGGH++GDILS  IQ+  S  TPVD +LIPTG
Sbjct  346  ENELSVVMEAKPKDKATPINLAHHSYWNLGGHNAGDILSEEIQILGSSYTPVDGELIPTG  405

Query  595  AISPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGLKHLGKAAVVVDSKSGRKMEL  416
             ISPVKGT++DFLQ R I   + +L  GYDINY LD    K + K   ++D KSGRKMEL
Sbjct  406  EISPVKGTSYDFLQLRPIKDNMKDLKAGYDINYCLDGKADK-MRKIVELIDKKSGRKMEL  464

Query  415  WTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETYD  236
              N+PG+QFYT  ML D KGK G  Y+  A LCLETQG+P+SVN P FPSQIV PG+TY 
Sbjct  465  SGNQPGLQFYTGGMLKDIKGKNGTTYQAFAGLCLETQGYPNSVNNPKFPSQIVEPGKTYK  524

Query  235  HVMVYRFT  212
            H M+++F+
Sbjct  525  HTMLFKFS  532



>ref|XP_002871651.1| hypothetical protein ARALYDRAFT_488355 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47910.1| hypothetical protein ARALYDRAFT_488355 [Arabidopsis lyrata subsp. 
lyrata]
Length=484

 Score =   235 bits (599),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 111/187 (59%), Positives = 137/187 (73%), Gaps = 1/187 (1%)
 Frame = -1

Query  772  NQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTGA  593
            N+L + M+AK ++KATPVNLA H+YWNLGGH+SGDILS  IQ+  S  TPVD +LIPTG 
Sbjct  296  NELSVVMEAKPIDKATPVNLAHHSYWNLGGHNSGDILSEEIQILGSSYTPVDGELIPTGK  355

Query  592  ISPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGLKHLGKAAVVVDSKSGRKMELW  413
            I+PVKGTA+DFLQ R I   + +L  GYDINY LD    K + K   +VD KSGRKMEL 
Sbjct  356  ITPVKGTAYDFLQLRPIKDNMKDLKTGYDINYCLDGKA-KKMRKIVELVDKKSGRKMELS  414

Query  412  TNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETYDH  233
             N+PG+QFYT  ML D KGK G VY+    LCLETQ +PD++N P FPSQIV PG+ Y H
Sbjct  415  GNQPGLQFYTGGMLKDIKGKNGAVYQAFGGLCLETQSYPDALNHPKFPSQIVEPGKKYKH  474

Query  232  VMVYRFT  212
             M+++F+
Sbjct  475  TMLFKFS  481



>ref|XP_002446606.1| hypothetical protein SORBIDRAFT_06g018800 [Sorghum bicolor]
 gb|EES10934.1| hypothetical protein SORBIDRAFT_06g018800 [Sorghum bicolor]
Length=373

 Score =   231 bits (590),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 112/195 (57%), Positives = 138/195 (71%), Gaps = 9/195 (5%)
 Frame = -1

Query  769  QLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTGAI  590
            +L + M A A NKATPVNLA HTYWNLGG  SGD+L +T+QLF S+ TPVD  LIPTG +
Sbjct  178  ELRVHMNATAANKATPVNLAQHTYWNLGGEGSGDVLHNTVQLFASRYTPVDSALIPTGVV  237

Query  589  SPVKGTAFDFLQARAIGSELNELPGG------YDINYVLDSHGLKH---LGKAAVVVDSK  437
            +PV GT +DFL    +G+ + ++ GG      YD NY +D         L K AVV D K
Sbjct  238  APVAGTPYDFLAPTPVGARIRQVSGGKAGIYGYDTNYAVDGDDAGAGAALRKVAVVRDGK  297

Query  436  SGRKMELWTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIV  257
            SGR MELW N+PGVQFYT N L D +GKGG VY ++ ALCLETQGFPD+VN P+FPSQIV
Sbjct  298  SGRAMELWANQPGVQFYTGNFLQDVEGKGGKVYGQYGALCLETQGFPDAVNHPSFPSQIV  357

Query  256  NPGETYDHVMVYRFT  212
            +PG+ Y H MV++F+
Sbjct  358  SPGQVYKHDMVFKFS  372



>gb|AAL75737.1|AC091724_10 Putative aldose 1-epimerase - like protein [Oryza sativa Japonica 
Group]
 gb|AAM46059.1|AC122145_13 Putative aldose 1-epimerase - like protein [Oryza sativa Japonica 
Group]
 gb|EAZ15347.1| hypothetical protein OsJ_30764 [Oryza sativa Japonica Group]
Length=343

 Score =   230 bits (587),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 112/198 (57%), Positives = 142/198 (72%), Gaps = 9/198 (5%)
 Frame = -1

Query  787  TCSLQNQLGIR--MKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDE  614
            T SL +   +R  M+A A NKATP+NLA HTYWNL GH+SGD L H+IQ++   ITPVDE
Sbjct  148  TYSLPDSTTLRLDMEAVAENKATPINLAQHTYWNLAGHNSGDTLDHSIQIWGKHITPVDE  207

Query  613  KLIPTGAISPVKGTAFDFLQARAIGSELNELPGGYDINYVLDS----HGLKHLGKAAVVV  446
              IPTG I PVKGT FDF     IG+ +N++PGGYD NYVLDS    +GLKH   AA + 
Sbjct  208  NTIPTGEIMPVKGTPFDFTTEHKIGARINDVPGGYDHNYVLDSGEEKNGLKH---AAKLK  264

Query  445  DSKSGRKMELWTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPS  266
            DS + R ++LWT+ PG+QFYT+N +    GKGG VY KH+ +CLETQGFP+++N PNFPS
Sbjct  265  DSSNSRTLDLWTDAPGMQFYTANYVDGVTGKGGAVYGKHSGVCLETQGFPNAINQPNFPS  324

Query  265  QIVNPGETYDHVMVYRFT  212
             +V PGE Y H M++ F+
Sbjct  325  VVVQPGEKYKHTMLFEFS  342



>ref|NP_001064192.1| Os10g0155500 [Oryza sativa Japonica Group]
 gb|ABB46780.1| Aldose 1-epimerase family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF26106.1| Os10g0155500 [Oryza sativa Japonica Group]
Length=362

 Score =   231 bits (588),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 109/189 (58%), Positives = 138/189 (73%), Gaps = 7/189 (4%)
 Frame = -1

Query  766  LGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTGAIS  587
            L + M+A A NKATP+NLA HTYWNL GH+SGD L H+IQ++   ITPVDE  IPTG I 
Sbjct  176  LRLDMEAVAENKATPINLAQHTYWNLAGHNSGDTLDHSIQIWGKHITPVDENTIPTGEIM  235

Query  586  PVKGTAFDFLQARAIGSELNELPGGYDINYVLDS----HGLKHLGKAAVVVDSKSGRKME  419
            PVKGT FDF     IG+ +N++PGGYD NYVLDS    +GLKH   AA + DS + R ++
Sbjct  236  PVKGTPFDFTTEHKIGARINDVPGGYDHNYVLDSGEEKNGLKH---AAKLKDSSNSRTLD  292

Query  418  LWTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETY  239
            LWT+ PG+QFYT+N +    GKGG VY KH+ +CLETQGFP+++N PNFPS +V PGE Y
Sbjct  293  LWTDAPGMQFYTANYVDGVTGKGGAVYGKHSGVCLETQGFPNAINQPNFPSVVVQPGEKY  352

Query  238  DHVMVYRFT  212
             H M++ F+
Sbjct  353  KHTMLFEFS  361



>dbj|BAC43284.1| putative aldose 1-epimerase [Arabidopsis thaliana]
Length=298

 Score =   229 bits (583),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 110/187 (59%), Positives = 135/187 (72%), Gaps = 1/187 (1%)
 Frame = -1

Query  772  NQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTGA  593
            N+L + M+AK  +KATPVNLA H+YWNLGGH+SGDILS  IQ+  S  TPVD +LIPTG 
Sbjct  110  NELSVVMEAKPKDKATPVNLAHHSYWNLGGHNSGDILSEEIQILGSGYTPVDGELIPTGK  169

Query  592  ISPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGLKHLGKAAVVVDSKSGRKMELW  413
            I+PVKGTA+DFLQ R I   + +L  GYDINY LD    K + K   +VD KSGRKMEL 
Sbjct  170  INPVKGTAYDFLQLRPIKDNMKDLKTGYDINYCLDGKA-KKMRKIVELVDKKSGRKMELS  228

Query  412  TNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETYDH  233
             N+ G+QFYT  ML D KGK G VY+    LCLETQ +PD++N P FPSQIV PG+ Y H
Sbjct  229  GNQAGLQFYTGGMLKDVKGKNGAVYQAFGGLCLETQSYPDALNHPKFPSQIVEPGKKYKH  288

Query  232  VMVYRFT  212
             M+++F+
Sbjct  289  TMLFKFS  295



>ref|XP_009121605.1| PREDICTED: aldose 1-epimerase isoform X1 [Brassica rapa]
Length=500

 Score =   234 bits (598),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 115/187 (61%), Positives = 136/187 (73%), Gaps = 1/187 (1%)
 Frame = -1

Query  772  NQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTGA  593
            N+L + M+AKA +KATPVNLA HTYWNLGGH+SGDILS  IQ+  S  TPVD +LIPTG 
Sbjct  312  NKLSVVMEAKAKDKATPVNLAHHTYWNLGGHNSGDILSEEIQILGSSYTPVDGELIPTGK  371

Query  592  ISPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGLKHLGKAAVVVDSKSGRKMELW  413
            ISPVK T +DFLQ R I   + +L  GYDINY LD    K + K   +VD KSGRKMEL 
Sbjct  372  ISPVKRTPYDFLQPRPIKDNMKDLKTGYDINYCLDGKADK-MRKIVELVDKKSGRKMELS  430

Query  412  TNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETYDH  233
             N+PG+QFYT  ML D KGK G VY+  A LCLETQ +PDSVN P FPSQIV PG+ Y H
Sbjct  431  ANQPGLQFYTGGMLKDIKGKNGTVYQAFAGLCLETQSYPDSVNNPKFPSQIVEPGKNYKH  490

Query  232  VMVYRFT  212
             M+++F+
Sbjct  491  NMLFKFS  497



>ref|XP_009121606.1| PREDICTED: aldose 1-epimerase isoform X2 [Brassica rapa]
Length=497

 Score =   234 bits (597),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 115/187 (61%), Positives = 136/187 (73%), Gaps = 1/187 (1%)
 Frame = -1

Query  772  NQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTGA  593
            N+L + M+AKA +KATPVNLA HTYWNLGGH+SGDILS  IQ+  S  TPVD +LIPTG 
Sbjct  309  NKLSVVMEAKAKDKATPVNLAHHTYWNLGGHNSGDILSEEIQILGSSYTPVDGELIPTGK  368

Query  592  ISPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGLKHLGKAAVVVDSKSGRKMELW  413
            ISPVK T +DFLQ R I   + +L  GYDINY LD    K + K   +VD KSGRKMEL 
Sbjct  369  ISPVKRTPYDFLQPRPIKDNMKDLKTGYDINYCLDGKADK-MRKIVELVDKKSGRKMELS  427

Query  412  TNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETYDH  233
             N+PG+QFYT  ML D KGK G VY+  A LCLETQ +PDSVN P FPSQIV PG+ Y H
Sbjct  428  ANQPGLQFYTGGMLKDIKGKNGTVYQAFAGLCLETQSYPDSVNNPKFPSQIVEPGKNYKH  487

Query  232  VMVYRFT  212
             M+++F+
Sbjct  488  NMLFKFS  494



>ref|XP_006338471.1| PREDICTED: aldose 1-epimerase-like isoform X3 [Solanum tuberosum]
Length=353

 Score =   230 bits (586),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 116/199 (58%), Positives = 145/199 (73%), Gaps = 5/199 (3%)
 Frame = -1

Query  802  LLL*LTCSLQN--QLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKI  629
            LL  +T +L++  +L + MKAKALNKATPVNLA H YWNLGGH+SGDILS+ IQ+F S I
Sbjct  154  LLASVTYALEDPYKLSVVMKAKALNKATPVNLAQHAYWNLGGHNSGDILSNDIQIFASHI  213

Query  628  TPVDEKLIPTGAISPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGLKHLGKAAVV  449
            TP+D+  IPTG I+PVK T +DFL+ R +GS+  +L  GYDINY LDS   + L   A+V
Sbjct  214  TPLDQHFIPTGKIAPVKNTPYDFLKPRKVGSQFKKLQNGYDINYPLDS--TEKLKPTAIV  271

Query  448  VDSKSGRKMELWTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFP  269
             D KSGR M L T  P VQ YT+N L   KGKGG+VY+ ++A+CLETQGFPD+VN PNFP
Sbjct  272  RDKKSGRVMSLQTTAPAVQLYTANTLVK-KGKGGFVYQPYSAICLETQGFPDAVNHPNFP  330

Query  268  SQIVNPGETYDHVMVYRFT  212
            S IV P   Y H M++ F+
Sbjct  331  STIVTPENPYFHKMLFTFS  349



>gb|EMT10467.1| Aldose 1-epimerase [Aegilops tauschii]
Length=191

 Score =   224 bits (571),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 109/192 (57%), Positives = 134/192 (70%), Gaps = 8/192 (4%)
 Frame = -1

Query  769  QLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTGAI  590
            +L + M+A  LNKATP++LA HTYWNL GHDSGD+L+H+IQ+  S+ITPVD+  IPTG  
Sbjct  2    ELKLEMEAAPLNKATPISLAQHTYWNLAGHDSGDVLAHSIQIRGSQITPVDQISIPTGEF  61

Query  589  SPVKGTAFDFLQARAIGSELNELPGGYDINYVLDS-----HGLKHLGKAAVVVDSKSGRK  425
              V GT FDFL    IG  + ++PGGYD NYVLD       GL+H+ K   V D  S R 
Sbjct  62   MQVSGTPFDFLTEGEIGDRIGQVPGGYDHNYVLDDSREVKSGLRHVAK---VTDPSSFRV  118

Query  424  MELWTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGE  245
            + +W + PGVQFYT N L    GKGG VY KHA LCLETQGFP++VN PNFPS IV+PGE
Sbjct  119  LNIWGDAPGVQFYTGNFLAGIVGKGGAVYGKHAGLCLETQGFPNAVNQPNFPSVIVHPGE  178

Query  244  TYDHVMVYRFTT  209
             Y H M++ F+T
Sbjct  179  KYMHTMLFEFST  190



>ref|XP_007151211.1| hypothetical protein PHAVU_004G027000g [Phaseolus vulgaris]
 gb|ESW23205.1| hypothetical protein PHAVU_004G027000g [Phaseolus vulgaris]
Length=368

 Score =   230 bits (586),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 108/191 (57%), Positives = 141/191 (74%), Gaps = 2/191 (1%)
 Frame = -1

Query  775  QNQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTG  596
            +N L I MKAKALNK TPVNL +H YWNLG H+SG+IL   +Q+F S++T +D+ LIPTG
Sbjct  169  KNSLRIVMKAKALNKPTPVNLLNHAYWNLGNHNSGNILDEVVQIFGSQVTLLDDHLIPTG  228

Query  595  AISPVKGTAFDFLQARAIGSELNELP--GGYDINYVLDSHGLKHLGKAAVVVDSKSGRKM  422
              + VKGT +DFL+   +G  +N+LP   GYDINYVLD    K +   A+VVD KSGR M
Sbjct  229  KFASVKGTPYDFLEPHIVGERINQLPKTNGYDINYVLDGAKGKEIKLGAIVVDKKSGRVM  288

Query  421  ELWTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGET  242
            +++TN PG+QFYT+N + + KGKGG+VY+  +ALCLE+Q FPDSVN PNFPS IV P   
Sbjct  289  KVFTNAPGLQFYTANFVKNEKGKGGFVYQPRSALCLESQAFPDSVNHPNFPSTIVTPQNP  348

Query  241  YDHVMVYRFTT  209
            Y HV++ +F+T
Sbjct  349  YKHVLLLKFST  359



>dbj|BAK00680.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=372

 Score =   230 bits (586),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 112/195 (57%), Positives = 136/195 (70%), Gaps = 11/195 (6%)
 Frame = -1

Query  766  LGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTGAIS  587
            L +RM A AL+KATPVNLA HTYWNLGGH SGD+L +T+QL  S+ TPVD  LIPTG ++
Sbjct  178  LSVRMNATALDKATPVNLAQHTYWNLGGHGSGDVLGNTVQLLASRYTPVDATLIPTGQLA  237

Query  586  PVKGTAFDFLQARAIGSELNELPG---------GYDINYVLDSHGLKHLGKAAVVVDSKS  434
            PV GT +D     A+G  L ++ G         GYD+NYV+D    + L K A V D  S
Sbjct  238  PVAGTPYDLRAPTAVGEHLRQVVGGSSGGSTVYGYDMNYVVDGDA-RALRKVAAVRDGAS  296

Query  433  GRKMELWTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVN  254
            GR +ELW ++PGVQFYT N L D KGKGG  Y ++AALCLETQGFPD+VN P FPSQIV 
Sbjct  297  GRALELWADQPGVQFYTGNFLKDVKGKGGETYGQYAALCLETQGFPDAVNHPEFPSQIVR  356

Query  253  PGE-TYDHVMVYRFT  212
            PGE  Y H MV++F+
Sbjct  357  PGEAAYKHDMVFKFS  371



>gb|EMT01730.1| Aldose 1-epimerase [Aegilops tauschii]
Length=331

 Score =   229 bits (583),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 109/191 (57%), Positives = 137/191 (72%), Gaps = 7/191 (4%)
 Frame = -1

Query  772  NQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTGA  593
            ++L +RM A A  KATPVNLA H YWNLGGH SG +L   ++LF S+ TPVD  LIPTG 
Sbjct  143  HELSVRMNATARGKATPVNLAHHAYWNLGGHGSGSVLGEEVRLFASRYTPVDAALIPTGH  202

Query  592  ISPVKGTAFDFLQARAIGSELNEL----PGGYDINYVLDSHGLKHLGKAAVVVDSKSGRK  425
            ++PV GT +DF    A+GS +  L      GYDINYV+D  GL+ +   AVV D  SGR 
Sbjct  203  LAPVAGTPYDFRTPAAVGSRIGGLLSRGVNGYDINYVVDGGGLRPV---AVVRDGASGRA  259

Query  424  MELWTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGE  245
            MELW ++PGVQFYT+N L+  +GKGG VY ++ ALCLETQGFPD+VN P+FPSQIV PG+
Sbjct  260  MELWADQPGVQFYTANGLSGVRGKGGKVYGRYGALCLETQGFPDAVNRPSFPSQIVRPGK  319

Query  244  TYDHVMVYRFT  212
             Y H MV++F+
Sbjct  320  VYMHHMVFKFS  330



>ref|XP_004982549.1| PREDICTED: aldose 1-epimerase-like [Setaria italica]
Length=441

 Score =   232 bits (591),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 109/191 (57%), Positives = 137/191 (72%), Gaps = 7/191 (4%)
 Frame = -1

Query  766  LGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTGAIS  587
            L + M+A  LNKATP++LA HTYWNL GH+SGD+L H++Q++ SKITPVD+  IPTG   
Sbjct  254  LKLEMEATPLNKATPISLAQHTYWNLAGHNSGDVLPHSVQIWGSKITPVDQTSIPTGEFM  313

Query  586  PVKGTAFDFLQARAIGSELNELPGGYDINYVLDSH----GLKHLGKAAVVVDSKSGRKME  419
            PV GT FDFL    IGS ++++PGGYD NYVLDS     GL+H+ K   VVD  S R ++
Sbjct  314  PVSGTPFDFLTGNRIGSRIDQVPGGYDHNYVLDSGELRLGLRHVAK---VVDPSSLRVLD  370

Query  418  LWTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETY  239
            +W + PGVQFYT N L    GKGG VY KHA  CLETQGFP++VN PNFPS ++ PGE Y
Sbjct  371  IWADAPGVQFYTGNFLHGIVGKGGVVYGKHAGFCLETQGFPNAVNQPNFPSIVIRPGEKY  430

Query  238  DHVMVYRFTTH  206
             H M++ F+T 
Sbjct  431  QHTMLFEFSTE  441



>gb|EAY77740.1| hypothetical protein OsI_32784 [Oryza sativa Indica Group]
Length=334

 Score =   228 bits (582),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 111/198 (56%), Positives = 142/198 (72%), Gaps = 9/198 (5%)
 Frame = -1

Query  787  TCSLQNQLGIR--MKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDE  614
            T SL +   +R  M+A A NKATP+NLA HTYWNL GH+SGD L H+IQ++   ITPVDE
Sbjct  139  TYSLPDSTTLRLDMEAVAENKATPINLAQHTYWNLAGHNSGDTLDHSIQIWGKHITPVDE  198

Query  613  KLIPTGAISPVKGTAFDFLQARAIGSELNELPGGYDINYVLDS----HGLKHLGKAAVVV  446
              IPTG I PVK T FDF     IG+ +N++PGGYD NYVLDS    +GLKH   AA + 
Sbjct  199  NTIPTGEIMPVKDTPFDFTTEHKIGARINDVPGGYDHNYVLDSGEEKNGLKH---AAKLK  255

Query  445  DSKSGRKMELWTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPS  266
            DS + R ++LWT+ PG+QFYT+N +    GKGG VY+KH+ +CLETQGFP+++N PNFPS
Sbjct  256  DSSNSRTLDLWTDAPGMQFYTANYVDGITGKGGAVYEKHSGVCLETQGFPNAINQPNFPS  315

Query  265  QIVNPGETYDHVMVYRFT  212
             +V PGE Y H M++ F+
Sbjct  316  VVVQPGEKYKHTMLFEFS  333



>ref|NP_001062565.1| Os09g0108600 [Oryza sativa Japonica Group]
 dbj|BAF24479.1| Os09g0108600, partial [Oryza sativa Japonica Group]
Length=288

 Score =   227 bits (578),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 105/187 (56%), Positives = 135/187 (72%), Gaps = 1/187 (1%)
 Frame = -1

Query  766  LGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTGAIS  587
            L + M+A  LNKATP++LA HTYWNL GH+SGD+L+HT+Q+  S+ITPVDE  IPTG + 
Sbjct  101  LKLEMEAIPLNKATPISLAQHTYWNLAGHNSGDVLAHTVQILGSQITPVDETSIPTGEMM  160

Query  586  PVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGLKH-LGKAAVVVDSKSGRKMELWT  410
            PV G+ F+FL    IGS ++++PGGYD N+V+D   +K  L   A V D  S R +++W 
Sbjct  161  PVSGSPFNFLTETTIGSRIDQVPGGYDHNFVIDCGEVKSGLCHVAKVTDPSSSRVLDIWA  220

Query  409  NKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETYDHV  230
            + PGVQFYT N L    GKGG VY KHA LCLETQGFP++VN PNFPS +V PGE Y H 
Sbjct  221  DAPGVQFYTGNFLNGIVGKGGAVYGKHAGLCLETQGFPNAVNQPNFPSVVVQPGEKYSHT  280

Query  229  MVYRFTT  209
            M++ F+T
Sbjct  281  MLFEFST  287



>ref|XP_004983378.1| PREDICTED: aldose 1-epimerase-like [Setaria italica]
Length=335

 Score =   228 bits (581),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 110/198 (56%), Positives = 141/198 (71%), Gaps = 9/198 (5%)
 Frame = -1

Query  787  TCSLQNQLGIRMKAKAL--NKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDE  614
            T SL     +R+  +A+  +KATP+NLA HTYWNL GH+SGDIL+HTIQ++   ITPVDE
Sbjct  140  TYSLPEATTLRLDMEAIPHDKATPINLAQHTYWNLAGHNSGDILNHTIQIWGKHITPVDE  199

Query  613  KLIPTGAISPVKGTAFDFLQARAIGSELNELPGGYDINYVLD----SHGLKHLGKAAVVV  446
              IPTG I PV+GT FDF     IG  +N++PGGYD NYVLD     +G+KH   AA + 
Sbjct  200  NTIPTGEIMPVEGTPFDFTTEHKIGERINDVPGGYDHNYVLDCGDEKNGVKH---AAKLR  256

Query  445  DSKSGRKMELWTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPS  266
            D  S R + LWT+ PG+QFYT+N +T   GKGG VY+KHA +CLETQGFP+++N PNFPS
Sbjct  257  DPSSSRTLNLWTDAPGMQFYTANYVTGITGKGGAVYEKHAGVCLETQGFPNAINQPNFPS  316

Query  265  QIVNPGETYDHVMVYRFT  212
             +V PGE Y H M++ F+
Sbjct  317  VVVQPGEKYKHTMLFEFS  334



>gb|KHN13234.1| Aldose 1-epimerase [Glycine soja]
Length=367

 Score =   229 bits (584),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 108/191 (57%), Positives = 141/191 (74%), Gaps = 2/191 (1%)
 Frame = -1

Query  775  QNQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTG  596
            +N L I MKAKALNK TPVN+ +H YWNLG H+SG+IL   +Q+F S++T  D+ LIPTG
Sbjct  168  KNSLRIIMKAKALNKPTPVNMVNHAYWNLGNHNSGNILDEVVQIFGSQVTLFDDHLIPTG  227

Query  595  AISPVKGTAFDFLQARAIGSELNELP--GGYDINYVLDSHGLKHLGKAAVVVDSKSGRKM  422
              + VKGT +DFL+   +G  +N+LP   GYDINYVLD    K +  AA+VVD KSGR M
Sbjct  228  QYASVKGTPYDFLEPHIVGERINQLPKTNGYDINYVLDGEKGKEIKLAAIVVDKKSGRVM  287

Query  421  ELWTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGET  242
            +L+TN PG+QFYT+N + + KGKGG+VY+  +ALCLE+Q FPDSVN PNFPS IV   + 
Sbjct  288  KLFTNAPGLQFYTANFVKNEKGKGGFVYQPRSALCLESQAFPDSVNHPNFPSTIVTTEKP  347

Query  241  YDHVMVYRFTT  209
            Y HV++ +F+T
Sbjct  348  YKHVLLLKFST  358



>ref|XP_003543750.1| PREDICTED: aldose 1-epimerase-like [Glycine max]
Length=367

 Score =   229 bits (584),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 108/191 (57%), Positives = 141/191 (74%), Gaps = 2/191 (1%)
 Frame = -1

Query  775  QNQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTG  596
            +N L I MKAKALNK TPVN+ +H YWNLG H+SG+IL   +Q+F S++T  D+ LIPTG
Sbjct  168  KNSLRIIMKAKALNKPTPVNMVNHAYWNLGNHNSGNILDEVVQIFGSQVTLFDDHLIPTG  227

Query  595  AISPVKGTAFDFLQARAIGSELNELP--GGYDINYVLDSHGLKHLGKAAVVVDSKSGRKM  422
              + VKGT +DFL+   +G  +N+LP   GYDINYVLD    K +  AA+VVD KSGR M
Sbjct  228  QYASVKGTPYDFLEPHIVGERINQLPKTNGYDINYVLDGEKGKEIKLAAIVVDKKSGRVM  287

Query  421  ELWTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGET  242
            +L+TN PG+QFYT+N + + KGKGG+VY+  +ALCLE+Q FPDSVN PNFPS IV   + 
Sbjct  288  KLFTNAPGLQFYTANFVKNEKGKGGFVYQPRSALCLESQAFPDSVNHPNFPSTIVTTEKP  347

Query  241  YDHVMVYRFTT  209
            Y HV++ +F+T
Sbjct  348  YKHVLLLKFST  358



>ref|XP_009624445.1| PREDICTED: aldose 1-epimerase-like [Nicotiana tomentosiformis]
Length=356

 Score =   228 bits (582),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 106/186 (57%), Positives = 141/186 (76%), Gaps = 2/186 (1%)
 Frame = -1

Query  769  QLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTGAI  590
            +L +  KAKALNKATP+NL+ H YWN+GGH+SGD+LS  +Q+F S ITPVDE+LIPTG I
Sbjct  170  KLSVVFKAKALNKATPINLSHHPYWNIGGHNSGDVLSQVVQIFSSHITPVDEQLIPTGEI  229

Query  589  SPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGLKHLGKAAVVVDSKSGRKMELWT  410
            + VK T +DFL+ R +GS ++++  GYD NYVLDS+  + +   A+V D KSGR M++  
Sbjct  230  ARVKNTPYDFLKPRKVGSRIDKIDRGYDRNYVLDSN--EKMKPVAIVYDKKSGRVMDIQA  287

Query  409  NKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETYDHV  230
              P V FYT+N + D KGKGGYVY+ H++L LETQG+PD+VN PNFPS IVN G+TY H 
Sbjct  288  TAPCVHFYTANWVIDVKGKGGYVYQPHSSLSLETQGYPDAVNHPNFPSTIVNSGKTYAHS  347

Query  229  MVYRFT  212
            ++Y F+
Sbjct  348  VLYTFS  353



>ref|XP_002467340.1| hypothetical protein SORBIDRAFT_01g025920 [Sorghum bicolor]
 gb|EER94338.1| hypothetical protein SORBIDRAFT_01g025920 [Sorghum bicolor]
Length=337

 Score =   228 bits (581),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 108/189 (57%), Positives = 137/189 (72%), Gaps = 7/189 (4%)
 Frame = -1

Query  766  LGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTGAIS  587
            L + M+A   NKATP++LA HTYWNL GH SGDIL+H+IQ++   ITPVDE  IPTG I 
Sbjct  151  LRLDMEATPENKATPISLAQHTYWNLAGHASGDILNHSIQIWGKHITPVDENTIPTGEIM  210

Query  586  PVKGTAFDFLQARAIGSELNELPGGYDINYVLDS----HGLKHLGKAAVVVDSKSGRKME  419
            PV GT+FDF     IG  +N++PGGYD NY+LD     +GLKH   AA + D  S R +E
Sbjct  211  PVNGTSFDFTTEHKIGERINDVPGGYDHNYMLDCGDEKNGLKH---AAKLRDPSSLRTLE  267

Query  418  LWTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETY  239
            LWT+ PG+QFYT+N + D  GKGG VY+KHA +CLETQGFP+++N PNFPS +V PGE Y
Sbjct  268  LWTDAPGMQFYTANYVNDISGKGGAVYEKHAGVCLETQGFPNAINQPNFPSVVVRPGEKY  327

Query  238  DHVMVYRFT  212
             H M++ F+
Sbjct  328  KHTMLFEFS  336



>ref|XP_010453642.1| PREDICTED: aldose 1-epimerase-like [Camelina sativa]
Length=489

 Score =   231 bits (590),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 110/187 (59%), Positives = 136/187 (73%), Gaps = 1/187 (1%)
 Frame = -1

Query  772  NQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTGA  593
            N+L + M+AK  +KATPVNLA HTYWNLGGH++GDILS  IQ+  S  TPVD +LIPTG 
Sbjct  301  NELSVVMEAKPKDKATPVNLAHHTYWNLGGHNAGDILSEEIQILGSSYTPVDGELIPTGQ  360

Query  592  ISPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGLKHLGKAAVVVDSKSGRKMELW  413
            ISPVKGT +DFLQ R I   + +L  GYDINY LD    K + K   +VD KSGRKMEL 
Sbjct  361  ISPVKGTPYDFLQLRPIKDNMKDLKTGYDINYCLDGQANK-MRKIVELVDRKSGRKMELS  419

Query  412  TNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETYDH  233
             N+PG+QFYT  ML D KGK G V + +  LCLETQ +PD++N+P FPSQIV PG+ Y H
Sbjct  420  GNQPGLQFYTGGMLKDIKGKNGAVNQAYGGLCLETQSYPDALNYPKFPSQIVEPGKNYKH  479

Query  232  VMVYRFT  212
             M+++F+
Sbjct  480  TMLFKFS  486



>gb|KFK25751.1| hypothetical protein AALP_AA8G154800 [Arabis alpina]
Length=539

 Score =   233 bits (594),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 111/187 (59%), Positives = 136/187 (73%), Gaps = 1/187 (1%)
 Frame = -1

Query  772  NQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTGA  593
            N+L + M+AK  +KATPVNLA H+YWNLGGH++GDILS  IQ+  S  TPVD +LIPTG 
Sbjct  351  NELSVVMEAKPKDKATPVNLAHHSYWNLGGHNAGDILSEEIQILGSSYTPVDGELIPTGQ  410

Query  592  ISPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGLKHLGKAAVVVDSKSGRKMELW  413
            ISPVKGT +DFLQ R I   + +L  GYDINY LD    K + K   +VD KSGRKMEL 
Sbjct  411  ISPVKGTPYDFLQLRPIKDNMKDLKTGYDINYCLDGKAEK-MRKIVELVDKKSGRKMELS  469

Query  412  TNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETYDH  233
             ++PG+QFYT  ML D KGK G VYK  A LCLETQ +PD++N P FPSQIV PG+ Y H
Sbjct  470  GDQPGLQFYTGGMLKDIKGKNGTVYKAFAGLCLETQSYPDALNHPKFPSQIVEPGKKYKH  529

Query  232  VMVYRFT  212
             M+++F+
Sbjct  530  TMLFKFS  536



>ref|XP_002466911.1| hypothetical protein SORBIDRAFT_01g016500 [Sorghum bicolor]
 gb|EER93909.1| hypothetical protein SORBIDRAFT_01g016500 [Sorghum bicolor]
Length=450

 Score =   230 bits (587),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 109/190 (57%), Positives = 138/190 (73%), Gaps = 7/190 (4%)
 Frame = -1

Query  766  LGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTGAIS  587
            L + M+A  LNKATP++LA HTYWNL GHDSGD+LSH+IQ++ S+ITPVD+  IPTG   
Sbjct  263  LKLEMEAIPLNKATPISLAQHTYWNLAGHDSGDVLSHSIQIWGSQITPVDQTSIPTGEFM  322

Query  586  PVKGTAFDFLQARAIGSELNELPGGYDINYVLDS----HGLKHLGKAAVVVDSKSGRKME  419
            PV GT FDFL    IGS ++++PGGYD NY+LDS     GL+H+ K   V D  S R ++
Sbjct  323  PVSGTPFDFLTGNRIGSRIDQVPGGYDHNYMLDSSEVRSGLRHVAK---VSDPSSLRALD  379

Query  418  LWTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETY  239
            +W + PGVQFYT N L    GKGG VY KH+ LCLETQGFP++VN PNFPS + +PGE Y
Sbjct  380  IWADAPGVQFYTGNFLHGIVGKGGAVYGKHSGLCLETQGFPNAVNQPNFPSVVFHPGEKY  439

Query  238  DHVMVYRFTT  209
             H M++ F+T
Sbjct  440  RHTMLFEFST  449



>ref|XP_003579892.1| PREDICTED: aldose 1-epimerase-like [Brachypodium distachyon]
Length=367

 Score =   228 bits (581),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 111/196 (57%), Positives = 136/196 (69%), Gaps = 11/196 (6%)
 Frame = -1

Query  766  LGIRMKAKALNKATPVNLASHTYWNLGGHDSG-DILSHTIQLFCSKITPVDEKLIPTGAI  590
            L +RM A AL+KATPVNLA HTYWNLGG  SG D+L HT+QLF +  TPVD  LIPTG +
Sbjct  171  LRVRMNATALDKATPVNLAQHTYWNLGGQGSGRDVLGHTVQLFAAHYTPVDGTLIPTGQL  230

Query  589  SPVKGTAFDFLQARAIGSELNELPGG---------YDINYVLDSHGLKHLGKAAVVVDSK  437
            +PV GT +D     A+G+ + ++ GG         +DINY +D    + L K AVV D  
Sbjct  231  APVAGTPYDLRTPTAVGARVRQVSGGSSNGSAVYGFDINYAVDGEDARALRKVAVVRDGA  290

Query  436  SGRKMELWTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIV  257
            SGR MELW ++PGVQFYT N L D KGKGG VY ++ ALCLETQGFPD+VN P FPSQIV
Sbjct  291  SGRAMELWADQPGVQFYTGNFLKDVKGKGGAVYGQYGALCLETQGFPDAVNQPGFPSQIV  350

Query  256  NPGE-TYDHVMVYRFT  212
             PG+  Y H MV++F+
Sbjct  351  RPGQAAYKHDMVFKFS  366



>ref|XP_006338472.1| PREDICTED: aldose 1-epimerase-like [Solanum tuberosum]
Length=357

 Score =   228 bits (580),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 106/186 (57%), Positives = 141/186 (76%), Gaps = 2/186 (1%)
 Frame = -1

Query  769  QLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTGAI  590
            +L +  KAK+LNKATP+NL+ H YWNL GH SGD+LS  +Q++ S IT VDE+LIPTG I
Sbjct  171  KLSVEFKAKSLNKATPINLSHHPYWNLRGHKSGDVLSQVVQIYASHITLVDEQLIPTGEI  230

Query  589  SPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGLKHLGKAAVVVDSKSGRKMELWT  410
            SPVK T +DFL+ R +GS ++++  GYD NYVLDS+  + +   A+V D KSGR M++  
Sbjct  231  SPVKNTPYDFLKPRKVGSRIDKVQIGYDRNYVLDSN--EKMKAVAIVYDKKSGRVMDIQA  288

Query  409  NKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETYDHV  230
            + P V FYTSN + + KGKGG+VY+ H+AL LETQG+PD+VN PNFPS IVNPG+TY H 
Sbjct  289  SAPCVHFYTSNWIINVKGKGGFVYQPHSALSLETQGYPDAVNHPNFPSTIVNPGKTYAHS  348

Query  229  MVYRFT  212
            ++Y F+
Sbjct  349  VLYTFS  354



>ref|XP_010492338.1| PREDICTED: aldose 1-epimerase-like [Camelina sativa]
Length=508

 Score =   231 bits (589),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 110/187 (59%), Positives = 136/187 (73%), Gaps = 1/187 (1%)
 Frame = -1

Query  772  NQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTGA  593
            N+L + M+AK  +KATPVNLA H+YWNLGGH++GDILS  IQ+  S  TPVD +LIPTG 
Sbjct  320  NELSVVMEAKPKDKATPVNLAHHSYWNLGGHNAGDILSEEIQILGSSYTPVDGELIPTGK  379

Query  592  ISPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGLKHLGKAAVVVDSKSGRKMELW  413
            ISPVKGT +DFLQ R I   + +L  GYDINY LD    K + K   +VD KSGRKMEL 
Sbjct  380  ISPVKGTPYDFLQLRPIKDNIKDLKTGYDINYCLDGEANK-MRKIVELVDKKSGRKMELS  438

Query  412  TNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETYDH  233
             ++PG+QFYT  ML D KGK G VY+ +  LCLETQ +PDS+N P FPSQIV PG+ Y H
Sbjct  439  GDQPGLQFYTGGMLKDIKGKNGTVYQAYGGLCLETQSYPDSLNHPKFPSQIVEPGKKYKH  498

Query  232  VMVYRFT  212
             M+++F+
Sbjct  499  TMLFKFS  505



>ref|XP_010420168.1| PREDICTED: aldose 1-epimerase-like [Camelina sativa]
Length=489

 Score =   231 bits (588),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 109/187 (58%), Positives = 135/187 (72%), Gaps = 1/187 (1%)
 Frame = -1

Query  772  NQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTGA  593
            N+L + M+AK  +KATPVNLA HTYWNLGGH++GDILS  IQ+  S  TPVD +LIPTG 
Sbjct  301  NELSVVMEAKPNDKATPVNLAHHTYWNLGGHNAGDILSEEIQILGSSYTPVDGELIPTGQ  360

Query  592  ISPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGLKHLGKAAVVVDSKSGRKMELW  413
            ISPVKGT +DFLQ R I   + +L  GYDINY LD      + K   +VD KSGRKMEL 
Sbjct  361  ISPVKGTPYDFLQLRPIKDNMKDLKTGYDINYCLDGQA-NQMRKIVELVDKKSGRKMELS  419

Query  412  TNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETYDH  233
             N+PG+QFYT  ML D KGK G V + +  LCLETQ +PD++N+P FPSQIV PG+ Y H
Sbjct  420  GNQPGLQFYTGGMLKDIKGKNGAVNQAYGGLCLETQSYPDALNYPKFPSQIVEPGKNYKH  479

Query  232  VMVYRFT  212
             M+++F+
Sbjct  480  TMLFKFS  486



>ref|XP_006651555.1| PREDICTED: uncharacterized protein LOC102719852 [Oryza brachyantha]
Length=673

 Score =   234 bits (598),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 111/190 (58%), Positives = 139/190 (73%), Gaps = 7/190 (4%)
 Frame = -1

Query  766  LGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTGAIS  587
            L + M+A  LNKATP++LA HTYWNL GH SGD+L+HT+Q++ S+ITPVDE  IPTG + 
Sbjct  486  LKLEMEAIPLNKATPISLAQHTYWNLAGHSSGDVLAHTVQIWGSQITPVDETSIPTGEMM  545

Query  586  PVKGTAFDFLQARAIGSELNELPGGYDINYVLDS----HGLKHLGKAAVVVDSKSGRKME  419
            PV GT FDFL+   IGS ++++PGGYD N+VLDS     GL+H   AA V D  S R ++
Sbjct  546  PVSGTPFDFLREATIGSRIDQVPGGYDHNFVLDSGEVKSGLRH---AAKVTDPSSSRVLD  602

Query  418  LWTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETY  239
            +W + PGVQFYT N L    GKGG VY KHA LCLETQGFP++VN PNFPS  V+PGE Y
Sbjct  603  IWADAPGVQFYTGNFLNGIVGKGGAVYGKHAGLCLETQGFPNAVNQPNFPSMTVHPGEKY  662

Query  238  DHVMVYRFTT  209
             H M++ F+T
Sbjct  663  SHTMLFEFST  672



>ref|XP_009417229.1| PREDICTED: aldose 1-epimerase-like [Musa acuminata subsp. malaccensis]
Length=334

 Score =   226 bits (576),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 111/193 (58%), Positives = 135/193 (70%), Gaps = 7/193 (4%)
 Frame = -1

Query  775  QNQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTG  596
            +  L + M+A  LNKATPVNLA HTYWNL GH+SG+IL H+IQ+  S +TPVD+ LIPTG
Sbjct  144  RTSLKLEMEAVPLNKATPVNLAQHTYWNLAGHNSGNILDHSIQILASHLTPVDKNLIPTG  203

Query  595  AISPVKGTAFDFLQARAIGSELNELPGGYDINYVLDS----HGLKHLGKAAVVVDSKSGR  428
             I PV GT FDF   + IGS ++EL  GYD NYVLD      GLKH   AA V D    R
Sbjct  204  EIMPVSGTCFDFTTEKKIGSRIHELQVGYDHNYVLDCGEERSGLKH---AAKVKDPSGSR  260

Query  427  KMELWTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPG  248
             ++LWT+ PG+QFYT N +    GKGG VY KHAALCLETQGFP+++N PNFPS +V PG
Sbjct  261  VLDLWTDAPGMQFYTGNYVDGVVGKGGAVYGKHAALCLETQGFPNAINQPNFPSVVVQPG  320

Query  247  ETYDHVMVYRFTT  209
            E   H M++ F+T
Sbjct  321  EKSKHTMLFEFST  333



>ref|XP_010918323.1| PREDICTED: aldose 1-epimerase-like [Elaeis guineensis]
Length=341

 Score =   226 bits (576),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 108/190 (57%), Positives = 136/190 (72%), Gaps = 7/190 (4%)
 Frame = -1

Query  766  LGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTGAIS  587
            L + M+A   NKATP++LA HTYWNL GH+SG+IL H+IQ+  S+ITPVD   +PTG I 
Sbjct  154  LKLEMEAVPQNKATPISLAQHTYWNLAGHNSGNILEHSIQIPASQITPVDANTVPTGEIM  213

Query  586  PVKGTAFDFLQARAIGSELNELPGGYDINYVLDS----HGLKHLGKAAVVVDSKSGRKME  419
            PVKGT FDFL+   IGS ++E+PGGYD NYVLD      GL+H   AA + D  S R + 
Sbjct  214  PVKGTPFDFLKENKIGSRIHEVPGGYDHNYVLDCGEERSGLRH---AARLKDPSSSRVLN  270

Query  418  LWTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETY  239
            +WT+ PG+QFYT N +    GKGG VY KHA LCLETQGFP+++N PNFPS +V PGE Y
Sbjct  271  IWTDAPGMQFYTGNYVNGIVGKGGAVYGKHAGLCLETQGFPNAINQPNFPSVVVQPGEKY  330

Query  238  DHVMVYRFTT  209
             HVM++ F+ 
Sbjct  331  RHVMLFEFSV  340



>ref|XP_010317286.1| PREDICTED: aldose 1-epimerase-like [Solanum lycopersicum]
Length=390

 Score =   228 bits (580),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 109/196 (56%), Positives = 147/196 (75%), Gaps = 4/196 (2%)
 Frame = -1

Query  802  LLL*LTCSLQN--QLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKI  629
            +L+ +T +L++  +L +  KAK+LNKATP+NL+ H YWNL GH+SGD+LS  +Q++ S I
Sbjct  158  VLVSVTYALKDPYKLSVEFKAKSLNKATPINLSHHPYWNLRGHNSGDVLSQVVQIYASHI  217

Query  628  TPVDEKLIPTGAISPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGLKHLGKAAVV  449
            TPVDE+LIPTG ISPVK T ++FL+ R +GS ++E+  GYD NYVLDS+  K +   A+V
Sbjct  218  TPVDEQLIPTGEISPVKNTPYNFLKPRKVGSRIDEVQIGYDRNYVLDSN--KKMKPVAIV  275

Query  448  VDSKSGRKMELWTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFP  269
             D KSGR M +    P V FYT+N + + KGKGG+VY+  +AL LETQG+PD+VN PNFP
Sbjct  276  YDKKSGRVMNIQATAPCVHFYTANWIINVKGKGGFVYQPRSALSLETQGYPDAVNHPNFP  335

Query  268  SQIVNPGETYDHVMVY  221
            S IVNPG+TY H +VY
Sbjct  336  STIVNPGKTYAHSVVY  351



>ref|XP_009624446.1| PREDICTED: aldose 1-epimerase-like [Nicotiana tomentosiformis]
Length=356

 Score =   226 bits (576),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 106/186 (57%), Positives = 141/186 (76%), Gaps = 2/186 (1%)
 Frame = -1

Query  769  QLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTGAI  590
            +L +  +AKALNKATP+NL+ H YWN+GGH+SGD+LS  +Q+F S IT VD++LIPTG I
Sbjct  170  KLSVVFRAKALNKATPINLSHHPYWNIGGHNSGDVLSQVLQIFGSHITLVDKQLIPTGEI  229

Query  589  SPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGLKHLGKAAVVVDSKSGRKMELWT  410
            +PVK T +DFL+ R + S +N+L  GYDINYVLDS+  + +    +V D KSGR M++  
Sbjct  230  APVKNTPYDFLKPRKVRSRINKLKNGYDINYVLDSN--EKMKPVGIVYDKKSGRVMDVQA  287

Query  409  NKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETYDHV  230
            + PGVQFYT+N + + KGKGG+VY+ H+AL LET  FPD+VN PNFPS IVNPGE Y H 
Sbjct  288  SAPGVQFYTANGVNNIKGKGGFVYQPHSALSLETLVFPDAVNHPNFPSTIVNPGEKYVHS  347

Query  229  MVYRFT  212
            ++Y F+
Sbjct  348  VLYTFS  353



>emb|CDX85053.1| BnaC05g20020D [Brassica napus]
Length=501

 Score =   230 bits (587),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 112/187 (60%), Positives = 135/187 (72%), Gaps = 1/187 (1%)
 Frame = -1

Query  772  NQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTGA  593
            N+L + M+A+A ++ATPVNLA HTYWNLGG +SGDILS  IQ+  S  TPVD +LIPTG 
Sbjct  313  NELSVVMEAEAKDQATPVNLAHHTYWNLGGQNSGDILSEEIQILGSSYTPVDGELIPTGK  372

Query  592  ISPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGLKHLGKAAVVVDSKSGRKMELW  413
            ISPVK T +DFLQ R I   + +L  GYDINY LD    K + K   +VD KSGRKMEL 
Sbjct  373  ISPVKRTPYDFLQPRPIKDNMKDLKTGYDINYCLDGKADK-MRKIVELVDKKSGRKMELS  431

Query  412  TNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETYDH  233
             N+PG+QFYT  ML D KGK G VY+  A LCLETQ +PDSVN P FPSQIV PG+ Y H
Sbjct  432  ANQPGLQFYTGGMLKDIKGKNGTVYQAFAGLCLETQSYPDSVNNPKFPSQIVEPGKNYKH  491

Query  232  VMVYRFT  212
             M+++F+
Sbjct  492  NMLFKFS  498


 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/83 (39%), Positives = 39/83 (47%), Gaps = 27/83 (33%)
 Frame = -1

Query  469  LGKAAVVVDSKSGRKMELWTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDS  290
            + K   +VD KSGRKMEL  N+PG+QFYT  ML D KGK G                   
Sbjct  212  MRKIVELVDKKSGRKMELSANQPGLQFYTGGMLKDIKGKNG-------------------  252

Query  289  VNFPNFPSQIVNPGETYDHVMVY  221
                     IV PG+ Y H M++
Sbjct  253  --------TIVEPGKNYKHNMLF  267



>ref|XP_002989540.1| hypothetical protein SELMODRAFT_129964 [Selaginella moellendorffii]
 gb|EFJ09416.1| hypothetical protein SELMODRAFT_129964 [Selaginella moellendorffii]
Length=379

 Score =   227 bits (578),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 108/198 (55%), Positives = 140/198 (71%), Gaps = 8/198 (4%)
 Frame = -1

Query  787  TCSLQNQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKL  608
            T S +N+L + + A   NK TPVNLA H+YWNL GH+SG IL+HT+++  S  TPVD  L
Sbjct  183  TLSGENELRVELIASTRNKMTPVNLAHHSYWNLAGHNSGSILNHTVKILASHYTPVDALL  242

Query  607  IPTGAISPVKGTAFDFLQARAIGSELNELPGGYDINYVL-----DSHGLKHLGKAAVVVD  443
            IPTG I+PV  T FDFL+  +IGS +  +PGGYD N+ L     D  GL H   A  + D
Sbjct  243  IPTGEIAPVAKTPFDFLEPMSIGSRIESVPGGYDHNFALDKTVRDDEGLYH---AVTLED  299

Query  442  SKSGRKMELWTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQ  263
              S RKME+WTN+PGVQFY+ N +   +GKGG VY K+A LCLETQGFP++VN PNFPS 
Sbjct  300  PVSTRKMEIWTNQPGVQFYSGNQIVRIEGKGGAVYSKYAGLCLETQGFPNAVNQPNFPSV  359

Query  262  IVNPGETYDHVMVYRFTT  209
            I+N G+ Y+HVMV++F++
Sbjct  360  ILNSGDVYNHVMVHKFSS  377



>ref|NP_197018.1| aldose 1-epimerase-like protein [Arabidopsis thaliana]
 emb|CAB89324.1| putative aldose 1-epimerase-like protein [Arabidopsis thaliana]
 gb|ABE66157.1| aldose 1-epimerase family protein [Arabidopsis thaliana]
 gb|AED92121.1| aldose 1-epimerase [Arabidopsis thaliana]
Length=490

 Score =   230 bits (586),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 110/187 (59%), Positives = 135/187 (72%), Gaps = 1/187 (1%)
 Frame = -1

Query  772  NQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTGA  593
            N+L + M+AK  +KATPVNLA H+YWNLGGH+SGDILS  IQ+  S  TPVD +LIPTG 
Sbjct  302  NELSVVMEAKPKDKATPVNLAHHSYWNLGGHNSGDILSEEIQILGSGYTPVDGELIPTGK  361

Query  592  ISPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGLKHLGKAAVVVDSKSGRKMELW  413
            I+PVKGTA+DFLQ R I   + +L  GYDINY LD    K + K   +VD KSGRKMEL 
Sbjct  362  INPVKGTAYDFLQLRPIKDNMKDLKTGYDINYCLDGKA-KKMRKIVELVDKKSGRKMELS  420

Query  412  TNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETYDH  233
             N+ G+QFYT  ML D KGK G VY+    LCLETQ +PD++N P FPSQIV PG+ Y H
Sbjct  421  GNQAGLQFYTGGMLKDVKGKNGAVYQAFGGLCLETQSYPDALNHPKFPSQIVEPGKKYKH  480

Query  232  VMVYRFT  212
             M+++F+
Sbjct  481  TMLFKFS  487



>ref|XP_009405677.1| PREDICTED: aldose 1-epimerase-like [Musa acuminata subsp. malaccensis]
Length=334

 Score =   225 bits (574),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 111/191 (58%), Positives = 134/191 (70%), Gaps = 7/191 (4%)
 Frame = -1

Query  769  QLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTGAI  590
             L + M+A   NKATPV+LA HTYWNL GH+SG IL H+IQ++ S +TPVDE LIPTG I
Sbjct  146  SLKLEMEAVPTNKATPVSLAQHTYWNLAGHNSGHILDHSIQIWASHVTPVDENLIPTGEI  205

Query  589  SPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSH----GLKHLGKAAVVVDSKSGRKM  422
             PV GT FDF   R I S ++E+P GYD NYVLD      GLKH   AA V D  S R +
Sbjct  206  MPVTGTPFDFTSERKIDSRIHEVPVGYDHNYVLDCGEKRCGLKH---AAKVKDPSSSRVL  262

Query  421  ELWTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGET  242
             LWT+ PG+QFYT N +T   GKGG VY+KHA LCLETQGFP+++N PNFPS +V PGE 
Sbjct  263  NLWTDAPGLQFYTGNFVTGVVGKGGAVYEKHAGLCLETQGFPNAINQPNFPSIVVQPGEK  322

Query  241  YDHVMVYRFTT  209
              H M++ F+T
Sbjct  323  SKHTMLFEFST  333



>ref|XP_010524327.1| PREDICTED: aldose 1-epimerase isoform X1 [Tarenaya hassleriana]
 ref|XP_010524328.1| PREDICTED: aldose 1-epimerase isoform X2 [Tarenaya hassleriana]
Length=451

 Score =   229 bits (583),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 110/187 (59%), Positives = 136/187 (73%), Gaps = 1/187 (1%)
 Frame = -1

Query  772  NQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTGA  593
            N+L + M+AK  +KATPVNLA HTYWNLGGHDSGDILS  I++  S+ TPVD +LIPTG 
Sbjct  263  NELRVEMEAKPKDKATPVNLAHHTYWNLGGHDSGDILSEQIRILGSRYTPVDGQLIPTGK  322

Query  592  ISPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGLKHLGKAAVVVDSKSGRKMELW  413
              PV+GT FDFL    I  ++ +L  GYDIN  L+    K + K   +VD +SGRKMEL 
Sbjct  323  TLPVQGTPFDFLHLHPIKDKIKKLNKGYDINICLEGKA-KRIRKVVELVDKRSGRKMELS  381

Query  412  TNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETYDH  233
             N+PG+QFYT   L + KGK G VYK +A LCLETQG+PDSVN+ NFPSQIV PG+TY H
Sbjct  382  ANQPGLQFYTGGQLKNVKGKNGAVYKAYAGLCLETQGYPDSVNYKNFPSQIVQPGKTYKH  441

Query  232  VMVYRFT  212
            VM ++F+
Sbjct  442  VMHFKFS  448



>gb|KEH24989.1| aldose 1-epimerase family protein [Medicago truncatula]
Length=375

 Score =   226 bits (577),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 109/195 (56%), Positives = 144/195 (74%), Gaps = 5/195 (3%)
 Frame = -1

Query  775  QNQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTG  596
            +N L I M+AKALNK TPVNL +H YWNLG H+SG+IL   +Q+F SK TP+D+ LIPTG
Sbjct  173  KNSLTIIMQAKALNKPTPVNLVNHAYWNLGNHNSGNILDEVVQIFGSKFTPIDKNLIPTG  232

Query  595  AISPVKGTAFDFLQARAIGSELNELP--GGYDINYVLDSHGLKH---LGKAAVVVDSKSG  431
              S VKGT +DFL+ + +G+ +N+LP   GYDINYVL+   L+    L  AA+V+D KSG
Sbjct  233  KFSSVKGTPYDFLKPQIVGTRINQLPKTNGYDINYVLNKGKLEKKEGLKVAAIVMDKKSG  292

Query  430  RKMELWTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNP  251
            R M+L TN PG+QFY++N + + KGKGG+VY+  +ALCLE+Q FPDSVN P FPS IV  
Sbjct  293  RVMKLSTNAPGLQFYSANFVKNDKGKGGFVYQPRSALCLESQAFPDSVNHPKFPSTIVTK  352

Query  250  GETYDHVMVYRFTTH  206
             + Y HVM+ +F+T+
Sbjct  353  EKPYKHVMLLKFSTN  367



>gb|ACE97529.1| aldose 1-epimerase, partial [Populus tremula]
 gb|ACE97534.1| aldose 1-epimerase, partial [Populus tremula]
 gb|ACE97536.1| aldose 1-epimerase, partial [Populus tremula]
 gb|ACE97537.1| aldose 1-epimerase, partial [Populus tremula]
 gb|ACE97539.1| aldose 1-epimerase, partial [Populus tremula]
 gb|ACE97541.1| aldose 1-epimerase, partial [Populus tremula]
 gb|ACE97542.1| aldose 1-epimerase, partial [Populus tremula]
 gb|ACE97543.1| aldose 1-epimerase, partial [Populus tremula]
 gb|ACE97544.1| aldose 1-epimerase, partial [Populus tremula]
 gb|ACE97549.1| aldose 1-epimerase, partial [Populus tremula]
 gb|ACE97550.1| aldose 1-epimerase, partial [Populus tremula]
 gb|ACE97553.1| aldose 1-epimerase, partial [Populus tremula]
 gb|ACE97555.1| aldose 1-epimerase, partial [Populus tremula]
Length=158

 Score =   219 bits (558),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 106/159 (67%), Positives = 124/159 (78%), Gaps = 1/159 (1%)
 Frame = -1

Query  754  MKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTGAISPVKG  575
            M+AKALNKATPV L +H +WNLGGH+SGDILS  IQ+F S+  P+D +LIPTG I  VKG
Sbjct  1    MEAKALNKATPVCLVNHAFWNLGGHNSGDILSEKIQIFASRYIPLDNQLIPTGEIVTVKG  60

Query  574  TAFDFLQARAIGSELNELPGGYDINYVLDSHGLKHLGKAAVVVDSKSGRKMELWTNKPGV  395
            T +DFL+   IGS +NELP GYDINY LD  G K L KAA+V D KSGR ME+ TN+PGV
Sbjct  61   TPYDFLKPNTIGSRINELPKGYDINYALDGSGNKKLRKAAIVHDEKSGRAMEILTNQPGV  120

Query  394  QFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFP  278
            Q +TSN L + KGKGG++YK H ALCLETQGFPDSVN P
Sbjct  121  QLFTSNTL-NVKGKGGFMYKPHGALCLETQGFPDSVNHP  158



>gb|EAY97171.1| hypothetical protein OsI_19092 [Oryza sativa Indica Group]
Length=344

 Score =   225 bits (574),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 107/190 (56%), Positives = 137/190 (72%), Gaps = 7/190 (4%)
 Frame = -1

Query  766  LGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTGAIS  587
            L + M+A A NKATP+NLA HTYWNL GH+SGD L H+IQ++   ITPVDE  IPTG I 
Sbjct  158  LRLDMEAVAENKATPINLAQHTYWNLAGHNSGDTLDHSIQIWGKHITPVDENTIPTGEIM  217

Query  586  PVKGTAFDFLQARAIGSELNELPGGYDINYVLDS----HGLKHLGKAAVVVDSKSGRKME  419
            PVK T FDF     IG+ +N++PGGYD NYVLDS    +GLKH   AA + DS + R ++
Sbjct  218  PVKDTPFDFTTEHNIGARINDVPGGYDHNYVLDSGEEKNGLKH---AAKLKDSSNSRTLD  274

Query  418  LWTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETY  239
            LWT+ PG+QFYT+N +    GKGG VY KH+ +CLETQG P+++N PNFPS +V PGE Y
Sbjct  275  LWTDAPGMQFYTANYVDGITGKGGAVYGKHSGVCLETQGLPNAINQPNFPSVVVQPGEKY  334

Query  238  DHVMVYRFTT  209
             H M++ F++
Sbjct  335  KHTMLFEFSS  344



>ref|NP_001169820.1| hypothetical protein precursor [Zea mays]
 gb|ACN34992.1| unknown [Zea mays]
 gb|AFW71980.1| hypothetical protein ZEAMMB73_754437 [Zea mays]
Length=381

 Score =   225 bits (574),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 105/193 (54%), Positives = 133/193 (69%), Gaps = 8/193 (4%)
 Frame = -1

Query  766  LGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTGAIS  587
            L +RM A A ++ATPVNLA H YWNLGGH SG +L  T+QLF S+ TPVD  L+PTGA++
Sbjct  187  LSVRMNATARSRATPVNLAHHAYWNLGGHGSGPVLGETVQLFASRYTPVDAALVPTGALA  246

Query  586  PVKGTAFDFLQARAIGSELNELP--------GGYDINYVLDSHGLKHLGKAAVVVDSKSG  431
            PV GT +DF     +G+ L +L          GYD NY +D      L   A V D  +G
Sbjct  247  PVAGTPYDFRAPAPVGARLADLRPRRGTGGVAGYDTNYAVDGAASPSLRPVARVWDGATG  306

Query  430  RKMELWTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNP  251
            R MELW ++PGVQFYTSN L   +GKGG VY+++AALCLETQGFPD+VN P+FPSQIV P
Sbjct  307  RAMELWADQPGVQFYTSNGLAGVRGKGGSVYRRYAALCLETQGFPDAVNHPSFPSQIVRP  366

Query  250  GETYDHVMVYRFT  212
            G+ Y H M+++F+
Sbjct  367  GKVYSHDMLFKFS  379



>gb|ACE97530.1| aldose 1-epimerase, partial [Populus tremula]
 gb|ACE97532.1| aldose 1-epimerase, partial [Populus tremula]
 gb|ACE97535.1| aldose 1-epimerase, partial [Populus tremula]
 gb|ACE97545.1| aldose 1-epimerase, partial [Populus tremula]
 gb|ACE97546.1| aldose 1-epimerase, partial [Populus tremula]
 gb|ACE97547.1| aldose 1-epimerase, partial [Populus tremula]
 gb|ACE97551.1| aldose 1-epimerase, partial [Populus tremula]
 gb|ACE97552.1| aldose 1-epimerase, partial [Populus tremula]
Length=158

 Score =   218 bits (555),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 105/159 (66%), Positives = 124/159 (78%), Gaps = 1/159 (1%)
 Frame = -1

Query  754  MKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTGAISPVKG  575
            M+AKALNKATPV L +H +WNLGGH+SGDILS  IQ+F S+  P+D +LIPTG I  VKG
Sbjct  1    MEAKALNKATPVCLVNHAFWNLGGHNSGDILSEKIQIFASRYIPLDNQLIPTGEIVTVKG  60

Query  574  TAFDFLQARAIGSELNELPGGYDINYVLDSHGLKHLGKAAVVVDSKSGRKMELWTNKPGV  395
            T +DFL+   IGS +NELP GYDINY LD  G + L KAA+V D KSGR ME+ TN+PGV
Sbjct  61   TPYDFLKPNTIGSRINELPKGYDINYALDGSGNEKLRKAAIVHDEKSGRAMEILTNQPGV  120

Query  394  QFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFP  278
            Q +TSN L + KGKGG++YK H ALCLETQGFPDSVN P
Sbjct  121  QLFTSNTL-NVKGKGGFMYKPHGALCLETQGFPDSVNHP  158



>ref|XP_006827141.1| PREDICTED: aldose 1-epimerase [Amborella trichopoda]
 gb|ERM94378.1| hypothetical protein AMTR_s00010p00250550 [Amborella trichopoda]
Length=368

 Score =   224 bits (572),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 114/191 (60%), Positives = 139/191 (73%), Gaps = 8/191 (4%)
 Frame = -1

Query  769  QLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTGAI  590
            Q+ + M+A   NK TPVNLA HTYWNL G +SG IL +T+QL+ S+ TPVD+ LIPTG I
Sbjct  179  QISVSMEAIPRNKPTPVNLAQHTYWNLAGQNSGPILGNTVQLWASQYTPVDKTLIPTGEI  238

Query  589  SPVKGTAFDFLQARAIGSELNELPGGYDINYVL----DSHGLKHLGKAAVVVDSKSGRKM  422
              V  T +DFLQ   +GS ++E+  GYDINYVL    +S+GL+   KAA V D K+GR +
Sbjct  239  LSVGNTPYDFLQPYTVGSRISEVASGYDINYVLSSSKESNGLR---KAAKVTDHKTGRVL  295

Query  421  ELWTNKPGVQFYTSNMLTD-TKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGE  245
            ELWT+  G+QFYT NML D T GKGG VY  H AL LETQGFPDSVN PNFPSQIVNPG+
Sbjct  296  ELWTDNVGLQFYTGNMLNDVTGGKGGCVYGIHDALALETQGFPDSVNHPNFPSQIVNPGQ  355

Query  244  TYDHVMVYRFT  212
             Y H M+Y+F+
Sbjct  356  VYRHNMLYKFS  366



>gb|KHN45485.1| Aldose 1-epimerase [Glycine soja]
Length=368

 Score =   224 bits (571),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 107/192 (56%), Positives = 140/192 (73%), Gaps = 3/192 (2%)
 Frame = -1

Query  775  QNQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTG  596
            +N L I MKAKALNK TPVN+ +H YWNLG H+SG+IL   +Q+F S++T  D+ LIPTG
Sbjct  168  KNSLSIIMKAKALNKPTPVNMVNHAYWNLGNHNSGNILDEVVQIFGSQVTLFDDNLIPTG  227

Query  595  AISPVKGTAFDFLQARAIGSELNELP--GGYDINYVLDSH-GLKHLGKAAVVVDSKSGRK  425
              + V+GT  DFL+   +G  +N+LP   GY+INYVLD   G   +  AA+ VD KSGR 
Sbjct  228  QYASVRGTPNDFLEPHIVGERINQLPKTNGYNINYVLDGEKGNAEIKLAAIAVDKKSGRV  287

Query  424  MELWTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGE  245
            M+L+TN PG+QFYT+N + + KGKGG+VY+  +ALCLE+Q FPDSVN PNFPS IV P +
Sbjct  288  MKLFTNAPGLQFYTANFVKNDKGKGGFVYQPRSALCLESQAFPDSVNHPNFPSTIVTPDK  347

Query  244  TYDHVMVYRFTT  209
             Y HVM+ +F+T
Sbjct  348  PYKHVMLLKFST  359



>ref|XP_008644102.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
Length=409

 Score =   225 bits (574),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 105/193 (54%), Positives = 133/193 (69%), Gaps = 8/193 (4%)
 Frame = -1

Query  766  LGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTGAIS  587
            L +RM A A ++ATPVNLA H YWNLGGH SG +L  T+QLF S+ TPVD  L+PTGA++
Sbjct  215  LSVRMNATARSRATPVNLAHHAYWNLGGHGSGPVLGETVQLFASRYTPVDAALVPTGALA  274

Query  586  PVKGTAFDFLQARAIGSELNELP--------GGYDINYVLDSHGLKHLGKAAVVVDSKSG  431
            PV GT +DF     +G+ L +L          GYD NY +D      L   A V D  +G
Sbjct  275  PVAGTPYDFRAPAPVGARLADLRPRRGTGGVAGYDTNYAVDGAASPSLRPVARVWDGATG  334

Query  430  RKMELWTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNP  251
            R MELW ++PGVQFYTSN L   +GKGG VY+++AALCLETQGFPD+VN P+FPSQIV P
Sbjct  335  RAMELWADQPGVQFYTSNGLAGVRGKGGSVYRRYAALCLETQGFPDAVNHPSFPSQIVRP  394

Query  250  GETYDHVMVYRFT  212
            G+ Y H M+++F+
Sbjct  395  GKVYSHDMLFKFS  407



>gb|ACE97533.1| aldose 1-epimerase, partial [Populus tremula]
 gb|ACE97540.1| aldose 1-epimerase, partial [Populus tremula]
Length=158

 Score =   217 bits (552),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 105/159 (66%), Positives = 123/159 (77%), Gaps = 1/159 (1%)
 Frame = -1

Query  754  MKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTGAISPVKG  575
            M+AKALNKATPV L +H +WNLGGH+SGDILS  IQ+F S+  P+D +LIP G I  VKG
Sbjct  1    MEAKALNKATPVCLVNHAFWNLGGHNSGDILSEKIQIFASRYIPLDNQLIPIGEIVTVKG  60

Query  574  TAFDFLQARAIGSELNELPGGYDINYVLDSHGLKHLGKAAVVVDSKSGRKMELWTNKPGV  395
            T +DFL+   IGS +NELP GYDINY LD  G K L KAA+V D KSGR ME+ TN+PGV
Sbjct  61   TPYDFLKPNTIGSRINELPKGYDINYALDGSGNKKLRKAAIVHDEKSGRAMEILTNQPGV  120

Query  394  QFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFP  278
            Q +TSN L + KGKGG++YK H ALCLETQGFPDSVN P
Sbjct  121  QLFTSNTL-NVKGKGGFMYKPHGALCLETQGFPDSVNHP  158



>dbj|BAJ88499.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=438

 Score =   226 bits (575),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 109/192 (57%), Positives = 135/192 (70%), Gaps = 8/192 (4%)
 Frame = -1

Query  769  QLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTGAI  590
            +L + M+A  LNKATP++LA HTYWNL GHDSGD+L+H+IQ+  S+ITPVD+  IPTG  
Sbjct  249  ELKLEMEAAPLNKATPISLAQHTYWNLAGHDSGDVLAHSIQIRGSQITPVDQISIPTGEF  308

Query  589  SPVKGTAFDFLQARAIGSELNELPGGYDINYVLDS-----HGLKHLGKAAVVVDSKSGRK  425
              V GT FDFL    IG  + ++PGGYD NYVLDS       L+H+ K   V D  S R 
Sbjct  309  MQVSGTPFDFLTEAEIGERIGQVPGGYDHNYVLDSSREAKSSLRHVAK---VTDPSSFRV  365

Query  424  MELWTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGE  245
            + +W++ PGVQFYT N L    GKGG VY KHA LCLETQGFP++VN PNFPS IV+PGE
Sbjct  366  LNIWSDAPGVQFYTGNFLGGIVGKGGAVYGKHAGLCLETQGFPNAVNQPNFPSVIVHPGE  425

Query  244  TYDHVMVYRFTT  209
             Y H M++ F+T
Sbjct  426  KYTHTMLFEFST  437



>ref|XP_010930440.1| PREDICTED: aldose 1-epimerase-like isoform X2 [Elaeis guineensis]
Length=280

 Score =   221 bits (562),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 107/190 (56%), Positives = 132/190 (69%), Gaps = 7/190 (4%)
 Frame = -1

Query  766  LGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTGAIS  587
            L + M+A  LNK TP+NLA HTYWNL GH+SG++L H+IQ++ S +TPVDE  IPTG I 
Sbjct  93   LKLEMEAVPLNKPTPINLAQHTYWNLAGHNSGNVLGHSIQIWASHVTPVDENSIPTGEIM  152

Query  586  PVKGTAFDFLQARAIGSELNELPGGYDINYVLD----SHGLKHLGKAAVVVDSKSGRKME  419
            PV GT FDF     IGS ++ELP GYD NYVLD      GLKH+ K   V    S R + 
Sbjct  153  PVSGTPFDFTTENKIGSRIHELPVGYDHNYVLDCGEEKSGLKHVAK---VKHPLSSRVLN  209

Query  418  LWTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETY  239
            LW + PGVQFYT+N ++   GK G VY+KHA LCLETQGFP+++N PNFPS  V PGE Y
Sbjct  210  LWADAPGVQFYTANYVSGVVGKAGAVYEKHAGLCLETQGFPNAINQPNFPSIAVQPGEKY  269

Query  238  DHVMVYRFTT  209
             H M++ F+T
Sbjct  270  RHNMLFEFST  279



>gb|ACE97531.1| aldose 1-epimerase, partial [Populus tremula]
 gb|ACE97556.1| aldose 1-epimerase, partial [Populus tremula]
Length=158

 Score =   216 bits (551),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 105/159 (66%), Positives = 123/159 (77%), Gaps = 1/159 (1%)
 Frame = -1

Query  754  MKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTGAISPVKG  575
            M+AKALNKATPV L +H +WNL GH+SGDILS  IQ+F S+  P+D +LIPTG I  VKG
Sbjct  1    MEAKALNKATPVCLVNHAFWNLRGHNSGDILSEKIQIFASRYIPLDNQLIPTGEIVTVKG  60

Query  574  TAFDFLQARAIGSELNELPGGYDINYVLDSHGLKHLGKAAVVVDSKSGRKMELWTNKPGV  395
            T +DFL+   IGS +NELP GYDINY LD  G K L KAA+V D KSGR ME+ TN+PGV
Sbjct  61   TPYDFLKPNTIGSRINELPKGYDINYALDGSGNKKLRKAAIVHDEKSGRAMEILTNQPGV  120

Query  394  QFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFP  278
            Q +TSN L + KGKGG++YK H ALCLETQGFPDSVN P
Sbjct  121  QLFTSNTL-NVKGKGGFMYKPHGALCLETQGFPDSVNHP  158



>gb|ACE97554.1| aldose 1-epimerase, partial [Populus tremula]
Length=158

 Score =   216 bits (551),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 105/159 (66%), Positives = 123/159 (77%), Gaps = 1/159 (1%)
 Frame = -1

Query  754  MKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTGAISPVKG  575
            M+AKALNKATPV L +H +WNLGGH+SGDILS  IQ+F S+  P+D +LIPTG I  VK 
Sbjct  1    MEAKALNKATPVCLVNHAFWNLGGHNSGDILSEKIQIFASRYIPLDNQLIPTGEIVTVKE  60

Query  574  TAFDFLQARAIGSELNELPGGYDINYVLDSHGLKHLGKAAVVVDSKSGRKMELWTNKPGV  395
            T +DFL+   IGS +NELP GYDINY LD  G K L KAA+V D KSGR ME+ TN+PGV
Sbjct  61   TPYDFLKPNTIGSRINELPKGYDINYALDGSGNKKLRKAAIVHDEKSGRAMEILTNQPGV  120

Query  394  QFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFP  278
            Q +TSN L + KGKGG++YK H ALCLETQGFPDSVN P
Sbjct  121  QLFTSNTL-NVKGKGGFMYKPHGALCLETQGFPDSVNHP  158



>ref|XP_002988820.1| hypothetical protein SELMODRAFT_159754 [Selaginella moellendorffii]
 gb|EFJ10082.1| hypothetical protein SELMODRAFT_159754 [Selaginella moellendorffii]
Length=359

 Score =   223 bits (568),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 109/195 (56%), Positives = 133/195 (68%), Gaps = 0/195 (0%)
 Frame = -1

Query  775  QNQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTG  596
            +N+L + M+A   +K TPV+LA HTYWNL GH SG IL HTI +  S+ TPVD+  IPTG
Sbjct  160  ENELRVEMRAVPASKQTPVSLAQHTYWNLAGHKSGSILDHTICISASRYTPVDDFQIPTG  219

Query  595  AISPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGLKHLGKAAVVVDSKSGRKMEL  416
             ++PV GTAFDFLQ   IGS ++++ GGYD NYVLD      L  AA V D  SGR MEL
Sbjct  220  ELAPVAGTAFDFLQEARIGSRIDQVEGGYDHNYVLDQKQGPGLCFAARVRDPSSGRTMEL  279

Query  415  WTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETYD  236
             T+ PG+QFYT N L    GK G VY+KHA LCLETQGFP++VN   FPS +V+PGE Y 
Sbjct  280  LTDAPGLQFYTGNFLVAEAGKDGEVYRKHAGLCLETQGFPNAVNDARFPSVMVSPGEVYR  339

Query  235  HVMVYRFTTHDASHT  191
            H MV+RF+      T
Sbjct  340  HQMVFRFSVTQKEKT  354



>ref|XP_002964577.1| hypothetical protein SELMODRAFT_230384 [Selaginella moellendorffii]
 gb|EFJ34910.1| hypothetical protein SELMODRAFT_230384 [Selaginella moellendorffii]
Length=359

 Score =   223 bits (567),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 108/188 (57%), Positives = 132/188 (70%), Gaps = 0/188 (0%)
 Frame = -1

Query  775  QNQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTG  596
            +N+L + M+A   +K TPV+LA HTYWNL GH SG IL HTI +  S+ TPVD+  IPTG
Sbjct  160  ENELRVEMRAVPASKQTPVSLAQHTYWNLAGHKSGSILDHTICISASRYTPVDDFQIPTG  219

Query  595  AISPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGLKHLGKAAVVVDSKSGRKMEL  416
             ++PV GTAFDFLQ   IGS ++++ GGYD NYVLD      L  AA V D  SGR MEL
Sbjct  220  ELAPVAGTAFDFLQEARIGSRIDQVEGGYDHNYVLDQKQGPGLCFAARVRDPSSGRTMEL  279

Query  415  WTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETYD  236
             T+ PG+QFYT N L    GK G VY+KHA LCLETQGFP++VN   FPS +V+PGE Y 
Sbjct  280  LTDAPGLQFYTGNFLVAEAGKDGQVYRKHAGLCLETQGFPNAVNDARFPSVMVSPGEVYR  339

Query  235  HVMVYRFT  212
            H MV+RF+
Sbjct  340  HQMVFRFS  347



>ref|XP_006400031.1| hypothetical protein EUTSA_v10013324mg [Eutrema salsugineum]
 gb|ESQ41484.1| hypothetical protein EUTSA_v10013324mg [Eutrema salsugineum]
Length=502

 Score =   226 bits (577),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 108/187 (58%), Positives = 136/187 (73%), Gaps = 1/187 (1%)
 Frame = -1

Query  772  NQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTGA  593
            N+L + M+A   +KATPVNLA H+YWNLGGH++GDILS  IQ+  S  TPVD +LIPTG 
Sbjct  314  NELSVVMEAMPKDKATPVNLAHHSYWNLGGHNAGDILSEEIQILGSSYTPVDGELIPTGN  373

Query  592  ISPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGLKHLGKAAVVVDSKSGRKMELW  413
            ISPVKGT +DFLQ R I   + +L  GYDINY LD    K + K   ++D KSGRKMEL 
Sbjct  374  ISPVKGTPYDFLQLRPIKDNMKDLKTGYDINYCLDGKADK-MRKIVELIDKKSGRKMELS  432

Query  412  TNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETYDH  233
             N+PG+QFYT  ML + KGK G VY+ +A LCLETQ +P++VN P FPSQIV PG+ Y H
Sbjct  433  GNQPGLQFYTGGMLKNIKGKNGTVYQAYAGLCLETQSYPNAVNNPKFPSQIVEPGKKYKH  492

Query  232  VMVYRFT  212
             M+++F+
Sbjct  493  TMLFKFS  499



>ref|XP_011001586.1| PREDICTED: aldose 1-epimerase-like isoform X2 [Populus euphratica]
Length=357

 Score =   222 bits (566),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 107/197 (54%), Positives = 139/197 (71%), Gaps = 8/197 (4%)
 Frame = -1

Query  787  TCSLQNQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKL  608
            T +    L + M+A   NK TP+NLA HTYWNL GH+SG++L H +Q+  S+ITPVD+  
Sbjct  162  TLTSSKTLRLDMEAVPKNKITPINLAQHTYWNLAGHNSGNVLEHLVQISGSQITPVDKNS  221

Query  607  IPTGAISPVKGTAFDFLQARAIGSELNELPG-GYDINYVLDS----HGLKHLGKAAVVVD  443
            IPTG + PVKGTAFDF   + +GS + E+PG GYD NYVLDS     GLKH+ K   V D
Sbjct  222  IPTGELLPVKGTAFDFTSEKKVGSSIREVPGLGYDHNYVLDSGEKKEGLKHVAK---VKD  278

Query  442  SKSGRKMELWTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQ  263
              S R + LWT+ PGVQFYT+N +   +GKGG VY+KH+ LCLETQGFP+++N PNFPS 
Sbjct  279  PSSSRVLNLWTDAPGVQFYTANYVNGVRGKGGAVYEKHSGLCLETQGFPNAINQPNFPSI  338

Query  262  IVNPGETYDHVMVYRFT  212
            +V PG+ Y H M++ F+
Sbjct  339  VVVPGDKYKHSMLFEFS  355



>ref|XP_011001585.1| PREDICTED: aldose 1-epimerase-like isoform X1 [Populus euphratica]
Length=358

 Score =   222 bits (566),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 107/197 (54%), Positives = 139/197 (71%), Gaps = 8/197 (4%)
 Frame = -1

Query  787  TCSLQNQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKL  608
            T +    L + M+A   NK TP+NLA HTYWNL GH+SG++L H +Q+  S+ITPVD+  
Sbjct  163  TLTSSKTLRLDMEAVPKNKITPINLAQHTYWNLAGHNSGNVLEHLVQISGSQITPVDKNS  222

Query  607  IPTGAISPVKGTAFDFLQARAIGSELNELPG-GYDINYVLDS----HGLKHLGKAAVVVD  443
            IPTG + PVKGTAFDF   + +GS + E+PG GYD NYVLDS     GLKH+ K   V D
Sbjct  223  IPTGELLPVKGTAFDFTSEKKVGSSIREVPGLGYDHNYVLDSGEKKEGLKHVAK---VKD  279

Query  442  SKSGRKMELWTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQ  263
              S R + LWT+ PGVQFYT+N +   +GKGG VY+KH+ LCLETQGFP+++N PNFPS 
Sbjct  280  PSSSRVLNLWTDAPGVQFYTANYVNGVRGKGGAVYEKHSGLCLETQGFPNAINQPNFPSI  339

Query  262  IVNPGETYDHVMVYRFT  212
            +V PG+ Y H M++ F+
Sbjct  340  VVVPGDKYKHSMLFEFS  356



>dbj|BAJ86209.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ92102.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK04986.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=369

 Score =   223 bits (567),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 108/201 (54%), Positives = 137/201 (68%), Gaps = 7/201 (3%)
 Frame = -1

Query  784  CSLQNQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLI  605
             S Q  L IRM   A NKATPVNLA+H YWNL GH SGDIL H +Q+F S  TPVD  +I
Sbjct  170  LSRQYDLSIRMNVTARNKATPVNLANHAYWNLAGHGSGDILKHELQMFASHYTPVDGSMI  229

Query  604  PTGAISPVKGTAFDFLQARAIGSELNELPGG---YDINYVLDSHGLKHLGKAAVVVDSKS  434
            PTG ++PV GT +DF +   +G+ +  +PGG   YD+NY +D      +   A V + KS
Sbjct  230  PTGEVAPVAGTMYDFGRRIPVGTNMKIVPGGGGGYDMNYAVDGQ-QNAMRPVARVREPKS  288

Query  433  GRKMELWTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVN  254
            GR +ELW N+PGVQFYT++ L + KGK G VY ++ ALCLETQ +PD+VN PNFPS IV 
Sbjct  289  GRALELWANQPGVQFYTASWLINEKGKAGKVYGQYGALCLETQAYPDAVNHPNFPSSIVR  348

Query  253  PGETYDHVMVYRFT---THDA  200
            PG+ Y H MV+RF+   T+DA
Sbjct  349  PGQVYKHDMVFRFSYQATYDA  369



>ref|XP_004975839.1| PREDICTED: aldose 1-epimerase-like [Setaria italica]
Length=368

 Score =   222 bits (566),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 111/194 (57%), Positives = 132/194 (68%), Gaps = 8/194 (4%)
 Frame = -1

Query  769  QLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTGAI  590
            +L + M A AL+KATPVNLA+H YWNL G   GDIL HT+QLF S+ TPVD  LIPTGA+
Sbjct  174  ELSLHMNATALDKATPVNLANHAYWNLAGQGRGDILGHTVQLFASRYTPVDGALIPTGAV  233

Query  589  SPVKGTAFDFLQARAIGSELNELPGG------YDINYVLDSHGLKH-LGKAAVVVDSK-S  434
             PV GT +D      +G+ +  + GG      YD NY +D       L K AVV D   S
Sbjct  234  VPVAGTPYDLRAPTPVGAHVRAIYGGKAGIYGYDTNYAVDGGAGAAALRKVAVVRDGGGS  293

Query  433  GRKMELWTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVN  254
            GR MELW N+PGVQFYT N L D KGKGG VY ++ ALCLETQGFPD+VN PNFPSQIV 
Sbjct  294  GRAMELWANQPGVQFYTGNFLKDVKGKGGKVYGQYGALCLETQGFPDAVNHPNFPSQIVR  353

Query  253  PGETYDHVMVYRFT  212
            PG+ Y H MV++F+
Sbjct  354  PGQVYRHDMVFKFS  367



>gb|ACE97548.1| aldose 1-epimerase, partial [Populus tremula]
Length=158

 Score =   215 bits (548),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 104/159 (65%), Positives = 123/159 (77%), Gaps = 1/159 (1%)
 Frame = -1

Query  754  MKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTGAISPVKG  575
            M+AKALNKATPV L +H +WNL GH+SGDILS  IQ+F S+  P+D +LIPTG I  VKG
Sbjct  1    MEAKALNKATPVCLVNHAFWNLRGHNSGDILSEKIQIFASRYIPLDNQLIPTGEIVTVKG  60

Query  574  TAFDFLQARAIGSELNELPGGYDINYVLDSHGLKHLGKAAVVVDSKSGRKMELWTNKPGV  395
            T +DFL+   IGS +NELP GYDINY LD  G + L KAA+V D KSGR ME+ TN+PGV
Sbjct  61   TPYDFLKPNTIGSRINELPKGYDINYALDGSGNEKLRKAAIVHDEKSGRAMEILTNQPGV  120

Query  394  QFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFP  278
            Q +TSN L + KGKGG++YK H ALCLETQGFPDSVN P
Sbjct  121  QLFTSNTL-NVKGKGGFMYKPHGALCLETQGFPDSVNHP  158



>gb|ACE97538.1| aldose 1-epimerase, partial [Populus tremula]
Length=158

 Score =   215 bits (548),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 104/159 (65%), Positives = 123/159 (77%), Gaps = 1/159 (1%)
 Frame = -1

Query  754  MKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTGAISPVKG  575
            M+AKALNKATPV L +H +WNLGGH+SGDILS  IQ+F S+  P+D +LIPTG I  VK 
Sbjct  1    MEAKALNKATPVCLVNHAFWNLGGHNSGDILSEKIQIFASRYIPLDNQLIPTGEIVTVKE  60

Query  574  TAFDFLQARAIGSELNELPGGYDINYVLDSHGLKHLGKAAVVVDSKSGRKMELWTNKPGV  395
            T +DFL+   IGS +NELP GYDINY LD  G + L KAA+V D KSGR ME+ TN+PGV
Sbjct  61   TPYDFLKPNTIGSRINELPKGYDINYALDGSGNEKLRKAAIVHDEKSGRAMEILTNQPGV  120

Query  394  QFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFP  278
            Q +TSN L + KGKGG++YK H ALCLETQGFPDSVN P
Sbjct  121  QLFTSNTL-NVKGKGGFMYKPHGALCLETQGFPDSVNHP  158



>ref|XP_007036807.1| Galactose mutarotase-like superfamily protein isoform 2, partial 
[Theobroma cacao]
 gb|EOY21308.1| Galactose mutarotase-like superfamily protein isoform 2, partial 
[Theobroma cacao]
Length=255

 Score =   218 bits (556),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 105/196 (54%), Positives = 135/196 (69%), Gaps = 7/196 (4%)
 Frame = -1

Query  787  TCSLQNQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKL  608
            T +    + + M+A   NKATP+NLA HTYWNL GH+SG+IL H+IQ++ S ITPVD+  
Sbjct  61   TLTSSTTMKLEMEAVPENKATPINLAQHTYWNLAGHNSGNILDHSIQIWASHITPVDQNT  120

Query  607  IPTGAISPVKGTAFDFLQARAIGSELNELPGGYDINYVL----DSHGLKHLGKAAVVVDS  440
            IPTG I PVKGT FDF   + +G+ ++E+  GYD NYVL    +  GLKH   AA V D 
Sbjct  121  IPTGEIMPVKGTPFDFTAEKKVGTSIHEVGLGYDHNYVLGGGEEKLGLKH---AAKVKDP  177

Query  439  KSGRKMELWTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQI  260
             S R + LWT+ PGVQFYT+N +    GKGG VY KH+ LCLETQGFP+++N PNFPS +
Sbjct  178  SSARVLNLWTSAPGVQFYTANYVNRVVGKGGAVYNKHSGLCLETQGFPNAINQPNFPSVV  237

Query  259  VNPGETYDHVMVYRFT  212
            V PG  Y H M++ F+
Sbjct  238  VQPGNKYQHTMLFEFS  253



>ref|XP_009414392.1| PREDICTED: aldose 1-epimerase-like [Musa acuminata subsp. malaccensis]
Length=361

 Score =   222 bits (565),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 107/187 (57%), Positives = 133/187 (71%), Gaps = 2/187 (1%)
 Frame = -1

Query  766  LGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTGAIS  587
            L + M A  L K TP+NLA HTYWNLGGH+SG IL   I++F S ITPV+++LIPTG I 
Sbjct  173  LSVIMHAVPLTKPTPINLAQHTYWNLGGHESGSILEDRIKIFASHITPVNDQLIPTGEIR  232

Query  586  PVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHG-LKHLGKAAVVVDSK-SGRKMELW  413
             V GT FDF +   IGS++  +PGGYDINYVL S   ++ + K AVV D + SGR +ELW
Sbjct  233  SVSGTPFDFREPAKIGSKIGRVPGGYDINYVLSSPADVQGVRKVAVVEDGRGSGRVLELW  292

Query  412  TNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETYDH  233
             N+PGVQFYT N L   +GK G+ YK H  LCLETQGFPDSVN P FP+QI +PG+ Y H
Sbjct  293  ANQPGVQFYTGNFLKHERGKNGHYYKIHDGLCLETQGFPDSVNHPKFPNQIYSPGQVYKH  352

Query  232  VMVYRFT  212
             M ++F+
Sbjct  353  FMQFKFS  359



>ref|XP_003579891.1| PREDICTED: aldose 1-epimerase-like [Brachypodium distachyon]
Length=363

 Score =   222 bits (565),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 103/190 (54%), Positives = 131/190 (69%), Gaps = 3/190 (2%)
 Frame = -1

Query  766  LGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTGAIS  587
            L IRM A AL+KATPVNLA+H YWNLGGH SGD+L H +QL  S+ TP+D+  IPTG I+
Sbjct  174  LSIRMHATALSKATPVNLANHAYWNLGGHGSGDVLKHELQLLASRYTPLDKSKIPTGQIA  233

Query  586  PVKGTAFDFLQARAIGSELNELPGG---YDINYVLDSHGLKHLGKAAVVVDSKSGRKMEL  416
             V GT +DFL  + +G  +  +PGG   YDINY +D      + + A V D  SGR ME+
Sbjct  234  AVSGTMYDFLAPKPVGKHMEIVPGGGGGYDINYAVDGEDQYAMRRVARVRDPASGRAMEV  293

Query  415  WTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETYD  236
            W N+PGVQ YTSN + + KGK G VY+++ ALCLETQ +PD+VN P FPS IV PG+ Y 
Sbjct  294  WANQPGVQLYTSNWVINEKGKAGKVYQQYGALCLETQAYPDAVNHPEFPSSIVRPGQAYK  353

Query  235  HVMVYRFTTH  206
            H M  +F+ H
Sbjct  354  HDMEIKFSAH  363



>ref|XP_006338468.1| PREDICTED: aldose 1-epimerase-like [Solanum tuberosum]
Length=355

 Score =   221 bits (564),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 111/195 (57%), Positives = 140/195 (72%), Gaps = 4/195 (2%)
 Frame = -1

Query  790  LTCSLQN--QLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVD  617
            +T +L++  +L +  KAKALNKATP+NL+ H YWN+GGH SGDILS+ IQ+F S IT VD
Sbjct  160  VTFALKDPYKLSVVFKAKALNKATPINLSHHPYWNIGGHTSGDILSNVIQIFGSHITLVD  219

Query  616  EKLIPTGAISPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGLKHLGKAAVVVDSK  437
            ++LIPTG I+PVK T +DFL+   +GS +N+L  GYDINY LDS     +    VV D K
Sbjct  220  KELIPTGEIAPVKNTPYDFLKPHTVGSRINKLQNGYDINYALDSTA--KMKPVGVVYDKK  277

Query  436  SGRKMELWTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIV  257
            SGR M +  + PGVQFYTSN     KGKGG++Y  HAAL LET  FPD+VN PNFPS IV
Sbjct  278  SGRMMNVKASAPGVQFYTSNWDKSKKGKGGFMYPPHAALALETLVFPDAVNHPNFPSSIV  337

Query  256  NPGETYDHVMVYRFT  212
            NPG+ Y H ++Y F+
Sbjct  338  NPGDRYVHSVLYTFS  352



>dbj|BAK04813.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=363

 Score =   221 bits (564),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 105/192 (55%), Positives = 135/192 (70%), Gaps = 6/192 (3%)
 Frame = -1

Query  775  QNQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTG  596
            ++ L +RM A A  KATPVNLA H YWNLGG  SG +L   ++LF S+ TPV   LIPTG
Sbjct  173  RHALSVRMNATARGKATPVNLAHHAYWNLGGDGSGSVLGQKVRLFASRYTPVGAALIPTG  232

Query  595  AISPVKGTAFDFLQARAIGSELNEL----PGGYDINYVLDSHGLKHLGKAAVVVDSKSGR  428
             ++PV GT +DF +  A+G+ +  L      GYDINYV+D  G + L + A V D  SGR
Sbjct  233  RLAPVAGTPYDFRRPAAVGARIGGLLSRGVAGYDINYVVD--GGRGLRRVAAVRDGASGR  290

Query  427  KMELWTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPG  248
             MELW ++PGVQFYT+N L+  +GKGG VY ++ ALCLETQGFP++VN P+FPSQIV PG
Sbjct  291  AMELWADQPGVQFYTANGLSGVRGKGGKVYGRYGALCLETQGFPNAVNEPSFPSQIVRPG  350

Query  247  ETYDHVMVYRFT  212
            E Y H M++RF+
Sbjct  351  EVYRHHMLFRFS  362



>gb|KCW84112.1| hypothetical protein EUGRSUZ_B00995 [Eucalyptus grandis]
Length=302

 Score =   219 bits (558),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 107/197 (54%), Positives = 138/197 (70%), Gaps = 8/197 (4%)
 Frame = -1

Query  787  TCSLQNQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKL  608
            T +    + + M+A   NKATP++LA HTYWNL GHDSG+IL+H+IQ++ + ITPVD+  
Sbjct  107  TLTSSTTMRLDMEAVPENKATPISLAQHTYWNLAGHDSGNILNHSIQIWANHITPVDQNT  166

Query  607  IPTGAISPVKGTAFDFLQARAIGSELNELPG-GYDINYVLD----SHGLKHLGKAAVVVD  443
            IPTG I PVKGTAFDF   + IG+ ++E+PG GYD NYVLD      GLKH   AA + D
Sbjct  167  IPTGEIMPVKGTAFDFTTEKKIGTSIHEVPGLGYDHNYVLDCGEEKSGLKH---AAKLKD  223

Query  442  SKSGRKMELWTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQ  263
              S R ++LWTN PG+QFYT N +    GKG   Y KH+ +CLETQGFP+++N PNFPS 
Sbjct  224  PSSSRVLDLWTNAPGMQFYTGNYVNGVVGKGDAAYGKHSGVCLETQGFPNAINQPNFPSV  283

Query  262  IVNPGETYDHVMVYRFT  212
            IV PGE Y H M++ F+
Sbjct  284  IVRPGEKYKHSMLFEFS  300



>gb|EMS48168.1| Aldose 1-epimerase [Triticum urartu]
Length=313

 Score =   219 bits (559),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 106/197 (54%), Positives = 138/197 (70%), Gaps = 8/197 (4%)
 Frame = -1

Query  766  LGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTGAIS  587
            L IRM   A NKATPVNLA+H YWNL GH SGD+L H +Q+F S  TPVD  +IPTG ++
Sbjct  117  LSIRMNVTARNKATPVNLANHAYWNLAGHGSGDVLKHELQMFASHYTPVDASMIPTGQVA  176

Query  586  PVKGTAFDFLQARAIGSELNELPGG---YDINYVLD-SHGLKH-LGKAAVVVDSKSGRKM  422
             V GT +DF +   +G+ +  +PGG   YD+NY +D  HG ++ +   A V++ KSGR  
Sbjct  177  SVAGTMYDFGRRIPVGTNMKIVPGGGGGYDMNYAVDGQHGQQNAMRPVARVLEPKSGRAF  236

Query  421  ELWTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGET  242
            ELW N+PGVQFYT++ L + KGK G VY ++ ALCLETQ +PD+VN PNFPS IV PG+ 
Sbjct  237  ELWANQPGVQFYTASWLINEKGKAGKVYGQYGALCLETQAYPDAVNHPNFPSSIVRPGQV  296

Query  241  YDHVMVYRFT---THDA  200
            Y H MV+RF+   T+DA
Sbjct  297  YKHDMVFRFSYQATYDA  313



>gb|KCW84111.1| hypothetical protein EUGRSUZ_B00995 [Eucalyptus grandis]
Length=305

 Score =   219 bits (558),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 107/197 (54%), Positives = 138/197 (70%), Gaps = 8/197 (4%)
 Frame = -1

Query  787  TCSLQNQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKL  608
            T +    + + M+A   NKATP++LA HTYWNL GHDSG+IL+H+IQ++ + ITPVD+  
Sbjct  110  TLTSSTTMRLDMEAVPENKATPISLAQHTYWNLAGHDSGNILNHSIQIWANHITPVDQNT  169

Query  607  IPTGAISPVKGTAFDFLQARAIGSELNELPG-GYDINYVLD----SHGLKHLGKAAVVVD  443
            IPTG I PVKGTAFDF   + IG+ ++E+PG GYD NYVLD      GLKH   AA + D
Sbjct  170  IPTGEIMPVKGTAFDFTTEKKIGTSIHEVPGLGYDHNYVLDCGEEKSGLKH---AAKLKD  226

Query  442  SKSGRKMELWTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQ  263
              S R ++LWTN PG+QFYT N +    GKG   Y KH+ +CLETQGFP+++N PNFPS 
Sbjct  227  PSSSRVLDLWTNAPGMQFYTGNYVNGVVGKGDAAYGKHSGVCLETQGFPNAINQPNFPSV  286

Query  262  IVNPGETYDHVMVYRFT  212
            IV PGE Y H M++ F+
Sbjct  287  IVRPGEKYKHSMLFEFS  303



>ref|XP_010930434.1| PREDICTED: aldose 1-epimerase-like isoform X1 [Elaeis guineensis]
Length=338

 Score =   220 bits (561),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 107/190 (56%), Positives = 132/190 (69%), Gaps = 7/190 (4%)
 Frame = -1

Query  766  LGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTGAIS  587
            L + M+A  LNK TP+NLA HTYWNL GH+SG++L H+IQ++ S +TPVDE  IPTG I 
Sbjct  151  LKLEMEAVPLNKPTPINLAQHTYWNLAGHNSGNVLGHSIQIWASHVTPVDENSIPTGEIM  210

Query  586  PVKGTAFDFLQARAIGSELNELPGGYDINYVLDS----HGLKHLGKAAVVVDSKSGRKME  419
            PV GT FDF     IGS ++ELP GYD NYVLD      GLKH+ K   V    S R + 
Sbjct  211  PVSGTPFDFTTENKIGSRIHELPVGYDHNYVLDCGEEKSGLKHVAK---VKHPLSSRVLN  267

Query  418  LWTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETY  239
            LW + PGVQFYT+N ++   GK G VY+KHA LCLETQGFP+++N PNFPS  V PGE Y
Sbjct  268  LWADAPGVQFYTANYVSGVVGKAGAVYEKHAGLCLETQGFPNAINQPNFPSIAVQPGEKY  327

Query  238  DHVMVYRFTT  209
             H M++ F+T
Sbjct  328  RHNMLFEFST  337



>ref|XP_011039151.1| PREDICTED: aldose 1-epimerase-like [Populus euphratica]
Length=337

 Score =   220 bits (561),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 107/197 (54%), Positives = 140/197 (71%), Gaps = 9/197 (5%)
 Frame = -1

Query  790  LTCSLQNQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEK  611
            LT S+  +L   M+A A NKATPV+LA HTYWNL GH SG+IL  ++Q++ S +TPVD+ 
Sbjct  144  LTSSMTMRL--DMEAVAENKATPVSLAQHTYWNLAGHSSGNILDQSVQIWGSHVTPVDQN  201

Query  610  LIPTGAISPVKGTAFDFLQARAIGSELNELPGGYDINYVLD----SHGLKHLGKAAVVVD  443
            ++PTG I PVKGT FDF   + +G+ L+E+  GYD NYVLD      GLKH   AA V D
Sbjct  202  IVPTGEIMPVKGTPFDFTTEKKVGASLHEVGLGYDHNYVLDCGEEKEGLKH---AARVKD  258

Query  442  SKSGRKMELWTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQ  263
              S R ++LWTN PG+QFYT+N +    GKGG VY KH+ LCLETQGFP+++N PNFPS 
Sbjct  259  PSSSRVLDLWTNTPGMQFYTANYVNGIVGKGGAVYGKHSGLCLETQGFPNAINQPNFPSV  318

Query  262  IVNPGETYDHVMVYRFT  212
            ++ PGE Y+H M++ F+
Sbjct  319  VIQPGEKYEHTMLFEFS  335



>ref|XP_004235803.1| PREDICTED: aldose 1-epimerase [Solanum lycopersicum]
Length=335

 Score =   220 bits (560),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 108/196 (55%), Positives = 139/196 (71%), Gaps = 7/196 (4%)
 Frame = -1

Query  787  TCSLQNQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKL  608
            T + +  L + M+A   NKATPV+LA HTYWNLGGH+SGDIL++T Q++ + ITPVD+  
Sbjct  141  TLTSKTTLRLDMEAVPANKATPVSLAQHTYWNLGGHNSGDILNNTAQIWANHITPVDQYT  200

Query  607  IPTGAISPVKGTAFDFLQARAIGSELNELPGGYDINYVLD----SHGLKHLGKAAVVVDS  440
            +PTG I PVKGT FDF   + IG ++ ++  GYD NYVLD      GLKH   AA + D 
Sbjct  201  VPTGEIMPVKGTPFDFTSEKQIGRDIQQVGLGYDHNYVLDCGDKKDGLKH---AAKIKDP  257

Query  439  KSGRKMELWTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQI  260
            KS R ++LWTN PG+QFYT+N +    GKGG VY KHA +CLETQGFP+++N PNFPS +
Sbjct  258  KSSRVLDLWTNAPGMQFYTANYVDGVVGKGGAVYNKHAGVCLETQGFPNAINTPNFPSIV  317

Query  259  VNPGETYDHVMVYRFT  212
            V PG+ Y H MVY F+
Sbjct  318  VQPGDKYIHNMVYEFS  333



>ref|NP_001241954.1| uncharacterized protein LOC100803092 precursor [Glycine max]
 gb|ACU21056.1| unknown [Glycine max]
Length=368

 Score =   221 bits (562),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 106/192 (55%), Positives = 139/192 (72%), Gaps = 3/192 (2%)
 Frame = -1

Query  775  QNQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTG  596
            +N L I MKAKALNK TPVN+ +H YWNLG H+SG+IL   +Q+F S++T  D+ LIPTG
Sbjct  168  KNSLSIIMKAKALNKPTPVNMVNHAYWNLGNHNSGNILDEVVQIFGSQVTLFDDNLIPTG  227

Query  595  AISPVKGTAFDFLQARAIGSELNELP--GGYDINYVLDSH-GLKHLGKAAVVVDSKSGRK  425
              + V+GT  DFL+   +G  +N+LP   GY+INYVLD   G   +  AA+ VD KSGR 
Sbjct  228  QYASVRGTPNDFLEPHIVGERINQLPKTNGYNINYVLDGEKGNAEIKLAAIAVDKKSGRV  287

Query  424  MELWTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGE  245
            M+L+TN PG+QFYT+N + + KGKGG+VY+  +ALCLE+Q FPDSVN PNFPS IV P +
Sbjct  288  MKLFTNAPGLQFYTANFVKNDKGKGGFVYQPRSALCLESQAFPDSVNHPNFPSTIVTPDK  347

Query  244  TYDHVMVYRFTT  209
               HVM+ +F+T
Sbjct  348  PCKHVMLLKFST  359



>ref|XP_009766422.1| PREDICTED: aldose 1-epimerase [Nicotiana sylvestris]
Length=335

 Score =   219 bits (559),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 109/196 (56%), Positives = 137/196 (70%), Gaps = 7/196 (4%)
 Frame = -1

Query  787  TCSLQNQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKL  608
            T + +  L + M+A   NK TPV+LA HTYWNLGGH+SGDIL +T Q++ + ITPVD+ +
Sbjct  141  TLTSKTTLRLDMEAVPANKPTPVSLAQHTYWNLGGHNSGDILDNTAQIWANHITPVDQNI  200

Query  607  IPTGAISPVKGTAFDFLQARAIGSELNELPGGYDINYVLD----SHGLKHLGKAAVVVDS  440
            IPTG I PVKGT FDF   + IG ++ ++  GYD NYVLD      GLKH   AA + D 
Sbjct  201  IPTGEIMPVKGTPFDFTAEKQIGRDIQQVGLGYDHNYVLDCGDVKDGLKH---AAKIKDP  257

Query  439  KSGRKMELWTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQI  260
            KS R + LWTN PG+QFYT+N +    GKGG VY KHA +CLETQGFP++VN PNFPS I
Sbjct  258  KSSRVLNLWTNAPGMQFYTANYVNGVVGKGGAVYNKHAGVCLETQGFPNAVNTPNFPSVI  317

Query  259  VNPGETYDHVMVYRFT  212
            V PG+ Y H M+Y F+
Sbjct  318  VQPGDKYIHNMLYEFS  333



>gb|EYU34099.1| hypothetical protein MIMGU_mgv1a008692mg [Erythranthe guttata]
Length=365

 Score =   221 bits (562),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 114/189 (60%), Positives = 138/189 (73%), Gaps = 3/189 (2%)
 Frame = -1

Query  769  QLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTGAI  590
            +L ++MKAKA  KATPVNLA H+YWNLGGH++G+ILS  +Q+F S ITPVD+KLIPTG  
Sbjct  174  KLSVKMKAKASKKATPVNLAQHSYWNLGGHNTGNILSDELQIFASHITPVDKKLIPTGKF  233

Query  589  SPVKGTAFDFLQARAIGSELNELPGG---YDINYVLDSHGLKHLGKAAVVVDSKSGRKME  419
              VK T +DFL+ R I   + ELP G   YDINYV+D      +   AVV + KSGR M+
Sbjct  234  VSVKATPYDFLEPRVIKGPIKELPNGSRGYDINYVVDGRNGLKMKPIAVVYNKKSGRVMK  293

Query  418  LWTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETY  239
            L  N PGVQ YT N + D +GK GYVYK HAALCLETQGFPDSVN PNFPSQIV PG++Y
Sbjct  294  LSANTPGVQLYTGNYINDVRGKNGYVYKPHAALCLETQGFPDSVNHPNFPSQIVYPGKSY  353

Query  238  DHVMVYRFT  212
             H M++ F+
Sbjct  354  RHYMMFTFS  362



>ref|XP_006341518.1| PREDICTED: aldose 1-epimerase-like [Solanum tuberosum]
Length=335

 Score =   219 bits (558),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 107/196 (55%), Positives = 137/196 (70%), Gaps = 7/196 (4%)
 Frame = -1

Query  787  TCSLQNQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKL  608
            T + +  L + M+A   NKATPV+LA HTYWNLGGH+SGDIL +T Q++ + ITPVD+  
Sbjct  141  TLTSKTTLRLDMEAVPANKATPVSLAQHTYWNLGGHNSGDILDNTAQIWANHITPVDQYT  200

Query  607  IPTGAISPVKGTAFDFLQARAIGSELNELPGGYDINYVLD----SHGLKHLGKAAVVVDS  440
            +PTG I PVKGT FDF   + IG ++ ++  GYD NYVLD      G KH   AA + D 
Sbjct  201  VPTGEIMPVKGTPFDFTSEKQIGRDIQQVGLGYDHNYVLDCGDEKDGFKH---AAKIKDP  257

Query  439  KSGRKMELWTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQI  260
            KS R ++LWTN PG+QFYT+N +    GKGG VY KHA +CLETQGFP+++N PNFPS +
Sbjct  258  KSSRVLDLWTNAPGMQFYTANYVNGVVGKGGAVYNKHAGVCLETQGFPNAINTPNFPSVV  317

Query  259  VNPGETYDHVMVYRFT  212
            V PG+ Y H MVY F+
Sbjct  318  VQPGDKYIHNMVYEFS  333



>ref|XP_004975838.1| PREDICTED: aldose 1-epimerase-like [Setaria italica]
Length=359

 Score =   220 bits (560),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 105/197 (53%), Positives = 136/197 (69%), Gaps = 8/197 (4%)
 Frame = -1

Query  790  LTCSLQNQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEK  611
            L+C  Q  L  RM A ALNKATPVNLA+H YWN+GGH SGD+L   IQ+F S+ TPVD  
Sbjct  167  LSCPYQ--LSARMNATALNKATPVNLANHAYWNVGGHGSGDVLGQVIQVFASRYTPVDRN  224

Query  610  LIPTGAISPVKGTAFDFLQARAIGSELNELPG----GYDINYVLDSHGLKHLGKAAVVVD  443
            +IPTG ++PV GT +D      +G+ +  + G    G+DINY +D  G     K A + D
Sbjct  225  MIPTGEVAPVSGTPYDLRAPTPLGTRIGLVSGAGMAGFDINYAVDGGG--GFRKVARLWD  282

Query  442  SKSGRKMELWTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQ  263
             +SGR +ELW ++PGVQ YTSN L +  GKGG VY ++ A+CLETQGFPD+VN PNFPSQ
Sbjct  283  PQSGRVLELWADQPGVQLYTSNWLGNVTGKGGEVYGQYGAVCLETQGFPDAVNHPNFPSQ  342

Query  262  IVNPGETYDHVMVYRFT  212
            IV PG+ Y H M+++F+
Sbjct  343  IVRPGQAYRHDMLFKFS  359



>gb|KCW84110.1| hypothetical protein EUGRSUZ_B00995 [Eucalyptus grandis]
Length=323

 Score =   219 bits (557),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 107/197 (54%), Positives = 138/197 (70%), Gaps = 8/197 (4%)
 Frame = -1

Query  787  TCSLQNQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKL  608
            T +    + + M+A   NKATP++LA HTYWNL GHDSG+IL+H+IQ++ + ITPVD+  
Sbjct  128  TLTSSTTMRLDMEAVPENKATPISLAQHTYWNLAGHDSGNILNHSIQIWANHITPVDQNT  187

Query  607  IPTGAISPVKGTAFDFLQARAIGSELNELPG-GYDINYVLD----SHGLKHLGKAAVVVD  443
            IPTG I PVKGTAFDF   + IG+ ++E+PG GYD NYVLD      GLKH   AA + D
Sbjct  188  IPTGEIMPVKGTAFDFTTEKKIGTSIHEVPGLGYDHNYVLDCGEEKSGLKH---AAKLKD  244

Query  442  SKSGRKMELWTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQ  263
              S R ++LWTN PG+QFYT N +    GKG   Y KH+ +CLETQGFP+++N PNFPS 
Sbjct  245  PSSSRVLDLWTNAPGMQFYTGNYVNGVVGKGDAAYGKHSGVCLETQGFPNAINQPNFPSV  304

Query  262  IVNPGETYDHVMVYRFT  212
            IV PGE Y H M++ F+
Sbjct  305  IVRPGEKYKHSMLFEFS  321



>gb|KCW84113.1| hypothetical protein EUGRSUZ_B00995 [Eucalyptus grandis]
Length=315

 Score =   218 bits (556),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 107/197 (54%), Positives = 138/197 (70%), Gaps = 8/197 (4%)
 Frame = -1

Query  787  TCSLQNQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKL  608
            T +    + + M+A   NKATP++LA HTYWNL GHDSG+IL+H+IQ++ + ITPVD+  
Sbjct  120  TLTSSTTMRLDMEAVPENKATPISLAQHTYWNLAGHDSGNILNHSIQIWANHITPVDQNT  179

Query  607  IPTGAISPVKGTAFDFLQARAIGSELNELPG-GYDINYVLD----SHGLKHLGKAAVVVD  443
            IPTG I PVKGTAFDF   + IG+ ++E+PG GYD NYVLD      GLKH   AA + D
Sbjct  180  IPTGEIMPVKGTAFDFTTEKKIGTSIHEVPGLGYDHNYVLDCGEEKSGLKH---AAKLKD  236

Query  442  SKSGRKMELWTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQ  263
              S R ++LWTN PG+QFYT N +    GKG   Y KH+ +CLETQGFP+++N PNFPS 
Sbjct  237  PSSSRVLDLWTNAPGMQFYTGNYVNGVVGKGDAAYGKHSGVCLETQGFPNAINQPNFPSV  296

Query  262  IVNPGETYDHVMVYRFT  212
            IV PGE Y H M++ F+
Sbjct  297  IVRPGEKYKHSMLFEFS  313



>ref|XP_010265811.1| PREDICTED: aldose 1-epimerase-like [Nelumbo nucifera]
Length=339

 Score =   219 bits (558),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 109/199 (55%), Positives = 135/199 (68%), Gaps = 8/199 (4%)
 Frame = -1

Query  787  TCSLQNQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKL  608
            T +    + + M+A   NK TP+NLA HTYWNL GH SGD+L H IQ++ S ITPVD+  
Sbjct  144  TLTSSATMKLDMEAVPENKPTPINLAQHTYWNLAGHSSGDVLEHLIQIWGSHITPVDQNS  203

Query  607  IPTGAISPVKGTAFDFLQARAIGSELNELPG-GYDINYVLD----SHGLKHLGKAAVVVD  443
            IPTG I PVKGT FDF   + IG+ +NE+ G GYD NYVLD      GLKH   AA V D
Sbjct  204  IPTGEIMPVKGTPFDFTAEKKIGASINEVSGLGYDHNYVLDFGEEKSGLKH---AAKVKD  260

Query  442  SKSGRKMELWTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQ  263
              S R + LWTN PG+QFYT+N +    GKGG VY KH+ALCLETQGFP+++N P+FPS 
Sbjct  261  PSSSRVLNLWTNAPGMQFYTANYVNGVVGKGGAVYGKHSALCLETQGFPNAINQPSFPSV  320

Query  262  IVNPGETYDHVMVYRFTTH  206
            +V PGE Y H M++ F+  
Sbjct  321  VVQPGEKYKHTMLFEFSVE  339



>ref|XP_010034276.1| PREDICTED: aldose 1-epimerase-like [Eucalyptus grandis]
 gb|KCW84109.1| hypothetical protein EUGRSUZ_B00995 [Eucalyptus grandis]
Length=340

 Score =   219 bits (557),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 107/197 (54%), Positives = 138/197 (70%), Gaps = 8/197 (4%)
 Frame = -1

Query  787  TCSLQNQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKL  608
            T +    + + M+A   NKATP++LA HTYWNL GHDSG+IL+H+IQ++ + ITPVD+  
Sbjct  145  TLTSSTTMRLDMEAVPENKATPISLAQHTYWNLAGHDSGNILNHSIQIWANHITPVDQNT  204

Query  607  IPTGAISPVKGTAFDFLQARAIGSELNELPG-GYDINYVLD----SHGLKHLGKAAVVVD  443
            IPTG I PVKGTAFDF   + IG+ ++E+PG GYD NYVLD      GLKH   AA + D
Sbjct  205  IPTGEIMPVKGTAFDFTTEKKIGTSIHEVPGLGYDHNYVLDCGEEKSGLKH---AAKLKD  261

Query  442  SKSGRKMELWTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQ  263
              S R ++LWTN PG+QFYT N +    GKG   Y KH+ +CLETQGFP+++N PNFPS 
Sbjct  262  PSSSRVLDLWTNAPGMQFYTGNYVNGVVGKGDAAYGKHSGVCLETQGFPNAINQPNFPSV  321

Query  262  IVNPGETYDHVMVYRFT  212
            IV PGE Y H M++ F+
Sbjct  322  IVRPGEKYKHSMLFEFS  338



>ref|XP_002317867.1| aldose 1-epimerase family protein [Populus trichocarpa]
 gb|EEE96087.1| aldose 1-epimerase family protein [Populus trichocarpa]
Length=337

 Score =   219 bits (557),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 106/197 (54%), Positives = 140/197 (71%), Gaps = 9/197 (5%)
 Frame = -1

Query  790  LTCSLQNQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEK  611
            LT S+  +L   M+A A NKATPV+LA HTYWNL GH+SG+IL  ++Q++ S +TPVD+ 
Sbjct  144  LTSSMTMRL--DMEAVAENKATPVSLAQHTYWNLAGHNSGNILDQSVQIWGSHVTPVDQN  201

Query  610  LIPTGAISPVKGTAFDFLQARAIGSELNELPGGYDINYVLD----SHGLKHLGKAAVVVD  443
            ++PTG I PVKGT FDF   + +G+ ++E+  GYD NYVLD      GLKH   AA V D
Sbjct  202  IVPTGEIMPVKGTPFDFTTEKKVGASIHEVGLGYDHNYVLDCGEGKEGLKH---AAKVKD  258

Query  442  SKSGRKMELWTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQ  263
              S R ++LWTN PG+QFYT+N +    GKGG VY KH+ LCLETQGFP+++N PNFPS 
Sbjct  259  PSSSRVLDLWTNTPGMQFYTANYVNGIVGKGGAVYGKHSGLCLETQGFPNAINQPNFPSV  318

Query  262  IVNPGETYDHVMVYRFT  212
            ++ PGE Y H M++ F+
Sbjct  319  VIQPGEKYKHTMLFEFS  335



>ref|XP_008803764.1| PREDICTED: aldose 1-epimerase, partial [Phoenix dactylifera]
Length=306

 Score =   218 bits (554),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 105/190 (55%), Positives = 131/190 (69%), Gaps = 7/190 (4%)
 Frame = -1

Query  766  LGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTGAIS  587
            L + M+A  LNK TP+NLA HTYWNL GH+SG++L H+IQ++ S +TPVDE  IPTG + 
Sbjct  119  LKLEMEAVPLNKPTPINLAQHTYWNLAGHNSGNVLGHSIQIWASHVTPVDENSIPTGELM  178

Query  586  PVKGTAFDFLQARAIGSELNELPGGYDINYVLDS----HGLKHLGKAAVVVDSKSGRKME  419
            PV GT FDF     IGS ++EL  GYD NYVLD      GLKH+ K   V D  S R + 
Sbjct  179  PVSGTPFDFTTENKIGSRIHELAVGYDHNYVLDCGEVKSGLKHVAK---VKDPSSSRVLN  235

Query  418  LWTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETY  239
            LW + PGVQFYT+N +    GK G VY+KHA LCLETQGFP+++N PNFPS +V PG+ Y
Sbjct  236  LWADAPGVQFYTANYVDGVVGKAGAVYQKHAGLCLETQGFPNAINQPNFPSIVVQPGDKY  295

Query  238  DHVMVYRFTT  209
             H M++ F T
Sbjct  296  RHNMLFEFCT  305



>ref|XP_007036806.1| Galactose mutarotase-like superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOY21307.1| Galactose mutarotase-like superfamily protein isoform 1 [Theobroma 
cacao]
Length=336

 Score =   218 bits (556),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 105/196 (54%), Positives = 135/196 (69%), Gaps = 7/196 (4%)
 Frame = -1

Query  787  TCSLQNQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKL  608
            T +    + + M+A   NKATP+NLA HTYWNL GH+SG+IL H+IQ++ S ITPVD+  
Sbjct  142  TLTSSTTMKLEMEAVPENKATPINLAQHTYWNLAGHNSGNILDHSIQIWASHITPVDQNT  201

Query  607  IPTGAISPVKGTAFDFLQARAIGSELNELPGGYDINYVL----DSHGLKHLGKAAVVVDS  440
            IPTG I PVKGT FDF   + +G+ ++E+  GYD NYVL    +  GLKH   AA V D 
Sbjct  202  IPTGEIMPVKGTPFDFTAEKKVGTSIHEVGLGYDHNYVLGGGEEKLGLKH---AAKVKDP  258

Query  439  KSGRKMELWTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQI  260
             S R + LWT+ PGVQFYT+N +    GKGG VY KH+ LCLETQGFP+++N PNFPS +
Sbjct  259  SSARVLNLWTSAPGVQFYTANYVNRVVGKGGAVYNKHSGLCLETQGFPNAINQPNFPSVV  318

Query  259  VNPGETYDHVMVYRFT  212
            V PG  Y H M++ F+
Sbjct  319  VQPGNKYQHTMLFEFS  334



>ref|XP_009620755.1| PREDICTED: aldose 1-epimerase [Nicotiana tomentosiformis]
Length=335

 Score =   218 bits (556),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 109/196 (56%), Positives = 136/196 (69%), Gaps = 7/196 (4%)
 Frame = -1

Query  787  TCSLQNQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKL  608
            T + +  L + M+A   NK TPV+LA HTYWNLGGH+SGDIL +T Q++ + ITPVD+  
Sbjct  141  TLTSKTTLRLDMEAVPANKPTPVSLAQHTYWNLGGHNSGDILDNTAQIWANHITPVDQNT  200

Query  607  IPTGAISPVKGTAFDFLQARAIGSELNELPGGYDINYVLD----SHGLKHLGKAAVVVDS  440
            IPTG I PVKGT FDF   + IG ++ ++  GYD NYVLD      GLKH   AA + D 
Sbjct  201  IPTGEILPVKGTPFDFTAEKQIGRDIQQVGLGYDHNYVLDCVDVKDGLKH---AAKIKDP  257

Query  439  KSGRKMELWTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQI  260
            KS R + LWTN PG+QFYT+N +    GKGG VY KHA +CLETQGFP++VN PNFPS I
Sbjct  258  KSSRVLNLWTNAPGMQFYTANYVNGVVGKGGAVYNKHAGVCLETQGFPNAVNTPNFPSVI  317

Query  259  VNPGETYDHVMVYRFT  212
            V PG+ Y H M+Y F+
Sbjct  318  VQPGDKYIHNMLYEFS  333



>ref|XP_006372579.1| hypothetical protein POPTR_0017s02950g [Populus trichocarpa]
 gb|ERP50376.1| hypothetical protein POPTR_0017s02950g [Populus trichocarpa]
Length=358

 Score =   219 bits (557),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 106/197 (54%), Positives = 136/197 (69%), Gaps = 8/197 (4%)
 Frame = -1

Query  787  TCSLQNQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKL  608
            T +    L + M+A   NK TP+NLA HTYWNL GH SG++L H +Q+  S+ITPVD+  
Sbjct  163  TLTSSKTLRLDMEAVPKNKTTPINLAHHTYWNLAGHSSGNVLEHLVQISGSQITPVDKNS  222

Query  607  IPTGAISPVKGTAFDFLQARAIGSELNELPG-GYDINYVLD----SHGLKHLGKAAVVVD  443
            IPTG + PVKGTAFDF   + +GS + E+PG GYD NYVLD      GLKH+ K   V D
Sbjct  223  IPTGELLPVKGTAFDFTSEKKVGSSIREVPGLGYDHNYVLDYGEKKEGLKHVAK---VKD  279

Query  442  SKSGRKMELWTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQ  263
              S R + LWT+ PGVQFYT+N +    GKGG VY+KH+ LCLETQGFP+++N PNFPS 
Sbjct  280  PSSSRVLNLWTDAPGVQFYTANYVNGVPGKGGAVYEKHSGLCLETQGFPNAINQPNFPSI  339

Query  262  IVNPGETYDHVMVYRFT  212
            +V PG+ Y H M++ F+
Sbjct  340  VVVPGDKYKHSMLFEFS  356



>ref|XP_008453487.1| PREDICTED: aldose 1-epimerase [Cucumis melo]
Length=342

 Score =   218 bits (556),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 105/201 (52%), Positives = 136/201 (68%), Gaps = 7/201 (3%)
 Frame = -1

Query  787  TCSLQNQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKL  608
            T +    + + M+A   NK T +NLA HTYWNLGGH+SGD+L+H+IQL+ + +TPVDE  
Sbjct  145  TLTSSTTMRLDMEAIPENKPTIINLAQHTYWNLGGHNSGDVLNHSIQLWANHVTPVDENT  204

Query  607  IPTGAISPVKGTAFDFLQARAIGSELNELPGGYDINYVLD----SHGLKHLGKAAVVVDS  440
            +PTG I PVKGT FDF   + IG+ ++E+  GYD NYVLD      GLKH+ K   V + 
Sbjct  205  VPTGEIMPVKGTPFDFTSEKKIGTSIHEVGMGYDHNYVLDCGDEKSGLKHVAK---VKEP  261

Query  439  KSGRKMELWTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQI  260
             SGR + LW N PGVQFYT N +    GKGG  Y KHA LCLETQGFP++VN PNFPS +
Sbjct  262  SSGRVLNLWANTPGVQFYTGNYVNGIVGKGGAAYGKHAGLCLETQGFPNAVNQPNFPSVV  321

Query  259  VNPGETYDHVMVYRFTTHDAS  197
            V PG+ Y H M++ F+   ++
Sbjct  322  VKPGDKYQHTMLFEFSVEQSA  342



>ref|XP_006372578.1| hypothetical protein POPTR_0017s02950g [Populus trichocarpa]
 gb|ERP50375.1| hypothetical protein POPTR_0017s02950g [Populus trichocarpa]
Length=357

 Score =   219 bits (557),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 106/197 (54%), Positives = 136/197 (69%), Gaps = 8/197 (4%)
 Frame = -1

Query  787  TCSLQNQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKL  608
            T +    L + M+A   NK TP+NLA HTYWNL GH SG++L H +Q+  S+ITPVD+  
Sbjct  162  TLTSSKTLRLDMEAVPKNKTTPINLAHHTYWNLAGHSSGNVLEHLVQISGSQITPVDKNS  221

Query  607  IPTGAISPVKGTAFDFLQARAIGSELNELPG-GYDINYVLD----SHGLKHLGKAAVVVD  443
            IPTG + PVKGTAFDF   + +GS + E+PG GYD NYVLD      GLKH+ K   V D
Sbjct  222  IPTGELLPVKGTAFDFTSEKKVGSSIREVPGLGYDHNYVLDYGEKKEGLKHVAK---VKD  278

Query  442  SKSGRKMELWTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQ  263
              S R + LWT+ PGVQFYT+N +    GKGG VY+KH+ LCLETQGFP+++N PNFPS 
Sbjct  279  PSSSRVLNLWTDAPGVQFYTANYVNGVPGKGGAVYEKHSGLCLETQGFPNAINQPNFPSI  338

Query  262  IVNPGETYDHVMVYRFT  212
            +V PG+ Y H M++ F+
Sbjct  339  VVVPGDKYKHSMLFEFS  355



>gb|KHG22159.1| Aldose 1-epimerase [Gossypium arboreum]
Length=336

 Score =   218 bits (555),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 103/189 (54%), Positives = 134/189 (71%), Gaps = 3/189 (2%)
 Frame = -1

Query  766  LGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTGAIS  587
            + + M+A   NKATP+NLA HTYWNL GH+SG+IL HTIQ++ S++TPVDE  +PTG I 
Sbjct  149  MKLDMEAVPENKATPINLAQHTYWNLAGHNSGNILDHTIQIWASEMTPVDENTVPTGEIK  208

Query  586  PVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGLKHLG--KAAVVVDSKSGRKMELW  413
            P+KGT FDF   + +G +++E+  GYD NYVL S G + LG  +AA + D  S R + LW
Sbjct  209  PIKGTPFDFTAEKKVGLQVHEVGLGYDRNYVLGS-GEEKLGLKRAAKLKDPSSSRVLNLW  267

Query  412  TNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETYDH  233
            TN PG+QFYT N +    GKGG VY KHA LCLETQGFP+++N PNFPS +V PG  Y H
Sbjct  268  TNAPGMQFYTGNHVNGVVGKGGAVYNKHAGLCLETQGFPNAINQPNFPSVVVQPGSKYQH  327

Query  232  VMVYRFTTH  206
             M++ F+  
Sbjct  328  TMLFEFSVE  336



>gb|KEH24988.1| aldose 1-epimerase family protein [Medicago truncatula]
Length=375

 Score =   219 bits (557),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 107/194 (55%), Positives = 141/194 (73%), Gaps = 5/194 (3%)
 Frame = -1

Query  775  QNQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTG  596
            +N L I M+AKALNK TPVNL +H YWNLG H+SG+IL   +Q+F SK TP D  LIPTG
Sbjct  173  KNSLTIIMQAKALNKPTPVNLVNHAYWNLGNHNSGNILDEVVQIFGSKFTPFDNNLIPTG  232

Query  595  AISPVKGTAFDFLQARAIGSELNELP--GGYDINYVLDSHGLKH---LGKAAVVVDSKSG  431
              S VKGT  DFL+ + +G+ +N+L    GY++NYVL+   L++   L  AA+V+D KSG
Sbjct  233  KFSSVKGTPNDFLKPQIVGARINQLQKTNGYNVNYVLNKGKLENKEGLKVAAIVMDKKSG  292

Query  430  RKMELWTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNP  251
            R M+L TN PG+QFY++N + + KGKGG+VY+  +ALCLE+Q FPDSVN PNFPS IV  
Sbjct  293  RVMKLSTNAPGLQFYSANFVKNDKGKGGFVYQPRSALCLESQAFPDSVNHPNFPSTIVTK  352

Query  250  GETYDHVMVYRFTT  209
             + Y HVM+ +F+T
Sbjct  353  EKPYKHVMLLKFST  366



>ref|XP_012086275.1| PREDICTED: aldose 1-epimerase-like [Jatropha curcas]
 gb|KDP25982.1| hypothetical protein JCGZ_22712 [Jatropha curcas]
Length=339

 Score =   218 bits (554),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 107/198 (54%), Positives = 141/198 (71%), Gaps = 9/198 (5%)
 Frame = -1

Query  787  TCSLQNQLGIRMKAKAL--NKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDE  614
            T +L +   +R+  +A+  +KATPV+LA HTYWNL GH+SG IL H+IQ++ S ITPVDE
Sbjct  143  TYALTSSTTMRLDMEAVPKDKATPVSLAQHTYWNLAGHNSGSILDHSIQIWGSHITPVDE  202

Query  613  KLIPTGAISPVKGTAFDFLQARAIGSELNELPGGYDINYVLD----SHGLKHLGKAAVVV  446
             ++PTG I PVKGT FDF   + IG+ ++E+  GYD NYVLD     +GLKH GK   V 
Sbjct  203  NIVPTGEIMPVKGTPFDFTSEKKIGASIDEVGLGYDHNYVLDCGEEKNGLKHAGK---VK  259

Query  445  DSKSGRKMELWTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPS  266
            D  S R + LWTN PG+QFYT+N +    GKGG VY KH+ LCLETQGFP+++N PNFPS
Sbjct  260  DPSSLRVLNLWTNAPGMQFYTANYVNGVHGKGGAVYGKHSGLCLETQGFPNAINQPNFPS  319

Query  265  QIVNPGETYDHVMVYRFT  212
             ++ PGETY + M++ F+
Sbjct  320  VVIQPGETYRNSMLFEFS  337



>ref|XP_004232229.1| PREDICTED: aldose 1-epimerase-like [Solanum lycopersicum]
Length=355

 Score =   218 bits (555),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 111/196 (57%), Positives = 142/196 (72%), Gaps = 6/196 (3%)
 Frame = -1

Query  790  LTCSLQN--QLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVD  617
            +T +L++  +L +  KAKALNKATP+NL+ H YWN+GGH SG+ILS+ IQ+F S IT VD
Sbjct  160  VTFALKDPYKLSVVFKAKALNKATPINLSHHPYWNIGGHTSGNILSNVIQIFGSHITLVD  219

Query  616  EKLIPTGAISPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHG-LKHLGKAAVVVDS  440
            ++LIPTG I+PVK T +DFL+   +GS + +L  GYDINY LDS   +K +G+   V D 
Sbjct  220  KELIPTGEIAPVKNTPYDFLKPHTVGSRIKKLQNGYDINYALDSSAKMKPVGR---VYDK  276

Query  439  KSGRKMELWTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQI  260
            KSGR M +  + PGVQFYTSN     KGKGG++Y  HAAL LET  FPD+VN PNFPS I
Sbjct  277  KSGRVMSVKASAPGVQFYTSNWDKSKKGKGGFMYPPHAALALETLVFPDAVNHPNFPSSI  336

Query  259  VNPGETYDHVMVYRFT  212
            VNPGE Y H ++Y F+
Sbjct  337  VNPGERYVHSVLYTFS  352



>ref|NP_001169952.1| uncharacterized protein LOC100383851 [Zea mays]
 gb|ACN35341.1| unknown [Zea mays]
 gb|AFW68324.1| hypothetical protein ZEAMMB73_376038 [Zea mays]
Length=184

 Score =   212 bits (540),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 107/186 (58%), Positives = 134/186 (72%), Gaps = 7/186 (4%)
 Frame = -1

Query  754  MKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTGAISPVKG  575
            M+A  LNKATP++LA HTYWNL GH SGD+LSH++Q++ S+ITPVD+  IPTG + PV G
Sbjct  1    MEAIPLNKATPISLAQHTYWNLAGHSSGDVLSHSVQIWGSQITPVDQTSIPTGELMPVTG  60

Query  574  TAFDFLQARAIGSELNELPGGYDINYVLDS----HGLKHLGKAAVVVDSKSGRKMELWTN  407
            T FDFL    IGS ++ +PGGYD NY+LDS     GL+H+   A VVD  S R +++W +
Sbjct  61   TPFDFLTGTRIGSRIDRVPGGYDHNYMLDSGEVRSGLRHV---AHVVDPSSSRALDIWAD  117

Query  406  KPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETYDHVM  227
             PGVQFYT N L    GKGG VY KHA LCLETQGFP++VN PNFPS +  PGE Y H M
Sbjct  118  APGVQFYTGNSLGGVVGKGGAVYGKHAGLCLETQGFPNAVNQPNFPSVVFGPGERYSHTM  177

Query  226  VYRFTT  209
            ++  +T
Sbjct  178  LFELST  183



>ref|XP_002530475.1| aldose-1-epimerase, putative [Ricinus communis]
 gb|EEF31898.1| aldose-1-epimerase, putative [Ricinus communis]
Length=340

 Score =   218 bits (554),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 105/195 (54%), Positives = 137/195 (70%), Gaps = 3/195 (2%)
 Frame = -1

Query  787  TCSLQNQLGIRMKAKAL--NKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDE  614
            T SL +   +R+  +A+  +KATPVNLA HTYWNL GH+SG IL H IQ++ S++TPVD+
Sbjct  144  TYSLASSTTMRLDMEAVPKDKATPVNLAQHTYWNLAGHNSGSILDHAIQIWGSQVTPVDQ  203

Query  613  KLIPTGAISPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGLKH-LGKAAVVVDSK  437
              +PTG I PVKGT FDF   + +G+ + E+  GYD NYVLD    K  L +AA + D  
Sbjct  204  NTVPTGDIMPVKGTPFDFTTEKKVGASIREVGLGYDHNYVLDCGEEKSGLKRAAKLKDPS  263

Query  436  SGRKMELWTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIV  257
            S R + LWTN PG+QFYT+N +    GKGG VY KH+ LCLETQGFP+++N PNFPS +V
Sbjct  264  SSRVLNLWTNAPGMQFYTANYVNGVVGKGGAVYGKHSGLCLETQGFPNAINQPNFPSVVV  323

Query  256  NPGETYDHVMVYRFT  212
             PGETY H M++ F+
Sbjct  324  RPGETYKHTMLFEFS  338



>gb|EMT09272.1| Aldose 1-epimerase [Aegilops tauschii]
Length=304

 Score =   216 bits (551),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 101/188 (54%), Positives = 131/188 (70%), Gaps = 4/188 (2%)
 Frame = -1

Query  766  LGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTGAIS  587
            L I M A A +KATPVNL +H YWNL GH SGD+L H +Q+F S+ TPVD  +IPTG ++
Sbjct  117  LSIHMNATATSKATPVNLVNHAYWNLAGHGSGDVLEHELQMFASRYTPVDGYMIPTGQVA  176

Query  586  PVKGTAFDFLQARAIGSELNELPGG---YDINYVLDSHGLKHLGKAAVVVDSKSGRKMEL  416
            PV GT +DFL    +G+ +  +PGG   YDIN+ +D      +   A V D  SGR +EL
Sbjct  177  PVAGTKYDFLPPTPVGANMEIVPGGGGGYDINFAVDGQ-QNAMRPVARVQDPDSGRALEL  235

Query  415  WTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETYD  236
            W N+PGVQ YT+N L++ KGKGG VY ++ ALCLETQ +PD+VN P+FPS IV PGE Y 
Sbjct  236  WANQPGVQLYTANWLSNDKGKGGKVYGQYGALCLETQAYPDAVNHPDFPSSIVRPGEVYK  295

Query  235  HVMVYRFT  212
            H MV++F+
Sbjct  296  HDMVFKFS  303



>gb|EMT28343.1| Aldose 1-epimerase [Aegilops tauschii]
Length=335

 Score =   217 bits (553),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 103/189 (54%), Positives = 132/189 (70%), Gaps = 7/189 (4%)
 Frame = -1

Query  766  LGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTGAIS  587
            L + M+A   NKATP++LA HTYWNL GH+SG IL H+IQ++   +TPV+E  IPTG I 
Sbjct  149  LRLDMEAIPANKATPISLAQHTYWNLAGHNSGSILDHSIQIWAKHVTPVNENTIPTGEIM  208

Query  586  PVKGTAFDFLQARAIGSELNELPGGYDINYVLDS----HGLKHLGKAAVVVDSKSGRKME  419
            PV+ T FDF     IG  +N +PGGYD NYVLDS    +GLKH   AA + D  S R ++
Sbjct  209  PVQDTPFDFTTEHRIGERINNVPGGYDHNYVLDSGDEKNGLKH---AAKLKDPSSSRTLD  265

Query  418  LWTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETY  239
            LWT+ PG+QFYT+N +    GKGG VY KHA +CLETQGFP+++N PNFPS +V PG  Y
Sbjct  266  LWTDAPGMQFYTANYVNGITGKGGAVYGKHAGVCLETQGFPNAINQPNFPSVVVQPGAKY  325

Query  238  DHVMVYRFT  212
             H M++ F+
Sbjct  326  KHTMLFEFS  334



>ref|XP_008374865.1| PREDICTED: aldose 1-epimerase [Malus domestica]
Length=339

 Score =   217 bits (552),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 105/196 (54%), Positives = 133/196 (68%), Gaps = 7/196 (4%)
 Frame = -1

Query  787  TCSLQNQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKL  608
            T +    + + M+A   NK TPV+LA HTYWNL GH+SG+IL H IQ++ + ITPVDE  
Sbjct  145  TLTSSTTMRLDMEAVPENKPTPVSLAQHTYWNLAGHNSGNILDHAIQIWANHITPVDENT  204

Query  607  IPTGAISPVKGTAFDFLQARAIGSELNELPGGYDINYVLD----SHGLKHLGKAAVVVDS  440
            IPTG I PVKGT FDF   + +G  ++E+  GYD NYVLD      GLKH   AA V D 
Sbjct  205  IPTGEIKPVKGTPFDFTAEKRVGESIHEVGLGYDHNYVLDCGEEKEGLKH---AARVRDP  261

Query  439  KSGRKMELWTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQI  260
             S R + LW+N PG+QFYT+N +    GKGG VY KH+ LCLETQGFP+++N PNFPS +
Sbjct  262  SSSRVLNLWSNAPGMQFYTANYVNGVVGKGGAVYGKHSGLCLETQGFPNAINTPNFPSIV  321

Query  259  VNPGETYDHVMVYRFT  212
            V PGE Y H M++ F+
Sbjct  322  VQPGERYSHTMLFEFS  337



>ref|XP_004137351.1| PREDICTED: aldose 1-epimerase [Cucumis sativus]
 gb|KGN63881.1| hypothetical protein Csa_1G025130 [Cucumis sativus]
Length=339

 Score =   217 bits (552),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 105/196 (54%), Positives = 133/196 (68%), Gaps = 7/196 (4%)
 Frame = -1

Query  787  TCSLQNQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKL  608
            T +    + + M+A   NK T +NLA HTYWNLGGH+SGD+L+H+IQL+ + +TPVDE  
Sbjct  145  TLTSSTTMRLDMEAIPENKPTIINLAQHTYWNLGGHNSGDVLNHSIQLWANHVTPVDENT  204

Query  607  IPTGAISPVKGTAFDFLQARAIGSELNELPGGYDINYVLD----SHGLKHLGKAAVVVDS  440
            +PTG I PVKGT FDF   + IG+ ++E+  GYD NYVLD      GLKH+ K   V + 
Sbjct  205  VPTGEIMPVKGTPFDFTSEKKIGTSIHEVGMGYDHNYVLDCGDEKSGLKHVAK---VKEP  261

Query  439  KSGRKMELWTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQI  260
             SGR + LW   PGVQFYT N +    GKGG  Y KHA LCLETQGFP++VN PNFPS +
Sbjct  262  SSGRVLNLWATTPGVQFYTGNYVNGVVGKGGAAYGKHAGLCLETQGFPNAVNQPNFPSVV  321

Query  259  VNPGETYDHVMVYRFT  212
            V PGE Y H M++ F+
Sbjct  322  VKPGEKYQHTMLFEFS  337



>ref|XP_009356028.1| PREDICTED: aldose 1-epimerase-like [Pyrus x bretschneideri]
Length=339

 Score =   217 bits (552),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 104/196 (53%), Positives = 133/196 (68%), Gaps = 7/196 (4%)
 Frame = -1

Query  787  TCSLQNQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKL  608
            T +    + + M+A   NK TPV+LA HTYWNL GH+SG+IL H IQ++ + ITPVDE  
Sbjct  145  TLTSSTTMRLDMEAVPENKPTPVSLAQHTYWNLAGHNSGNILDHAIQIWANHITPVDENT  204

Query  607  IPTGAISPVKGTAFDFLQARAIGSELNELPGGYDINYVLD----SHGLKHLGKAAVVVDS  440
            +PTG I PVKGT FDF   + +G  ++E+  GYD NYVLD      GLKH   AA V D 
Sbjct  205  VPTGEIKPVKGTPFDFTTEKRVGESIHEVGLGYDHNYVLDCGEEKEGLKH---AARVRDP  261

Query  439  KSGRKMELWTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQI  260
             S R + LW+N PG+QFYT+N +    GKGG VY KH+ LCLETQGFP+++N PNFPS +
Sbjct  262  SSSRVLNLWSNAPGMQFYTANYVNGVVGKGGAVYGKHSGLCLETQGFPNAINTPNFPSIV  321

Query  259  VNPGETYDHVMVYRFT  212
            V PGE Y H M++ F+
Sbjct  322  VQPGERYSHTMLFEFS  337



>ref|XP_009360073.1| PREDICTED: aldose 1-epimerase-like [Pyrus x bretschneideri]
Length=339

 Score =   217 bits (552),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 106/196 (54%), Positives = 132/196 (67%), Gaps = 7/196 (4%)
 Frame = -1

Query  787  TCSLQNQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKL  608
            T +    + + M+A   NK TPV+LA HTYWNL GH+SG+IL H IQ+  + ITPVDE  
Sbjct  145  TLTSSTTMRLDMEAVPENKPTPVSLAQHTYWNLAGHNSGNILDHAIQIRANHITPVDENT  204

Query  607  IPTGAISPVKGTAFDFLQARAIGSELNELPGGYDINYVLD----SHGLKHLGKAAVVVDS  440
            IPTG I PVKGT FDF   + +G  ++E+  GYD NYVLD      GLKH   AA V D 
Sbjct  205  IPTGEIKPVKGTPFDFTAEKRVGESIHEVGIGYDHNYVLDCGEEKQGLKH---AARVKDP  261

Query  439  KSGRKMELWTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQI  260
             S R + LW+N PG+QFYT+N +    GKGG VY KHA LCLETQGFP+++N PNFPS +
Sbjct  262  SSSRVLNLWSNAPGMQFYTANYVNGVVGKGGAVYGKHAGLCLETQGFPNAINTPNFPSIV  321

Query  259  VNPGETYDHVMVYRFT  212
            V PGE Y H M++ F+
Sbjct  322  VQPGEKYSHTMLFEFS  337



>ref|XP_010274745.1| PREDICTED: aldose 1-epimerase-like [Nelumbo nucifera]
Length=339

 Score =   216 bits (551),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 104/197 (53%), Positives = 136/197 (69%), Gaps = 8/197 (4%)
 Frame = -1

Query  787  TCSLQNQLGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKL  608
            T +    + + M+A   NK TP++LA HTYWNL GH SG++L H +Q++ S ITPVDE  
Sbjct  144  TLTSSTTMRLDMEALVENKPTPISLAQHTYWNLSGHSSGNVLEHLVQIWASHITPVDENT  203

Query  607  IPTGAISPVKGTAFDFLQARAIGSELNELPG-GYDINYVLDSH----GLKHLGKAAVVVD  443
            IPTG I PVKGT FDF   + IG+ ++E+PG GYD NYVLD      GL+H   AA V D
Sbjct  204  IPTGEIMPVKGTPFDFTTEKKIGASIHEVPGLGYDHNYVLDCGEEKLGLRH---AAKVKD  260

Query  442  SKSGRKMELWTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQ  263
              S R + LW+N PG+QFYT+N +    GKGG +Y KH+ALCLETQGFP+++N PNFPS 
Sbjct  261  PSSSRVLNLWSNAPGMQFYTANYVNGIVGKGGAIYGKHSALCLETQGFPNAINQPNFPSV  320

Query  262  IVNPGETYDHVMVYRFT  212
            +V PG+ Y H M++ F+
Sbjct  321  VVQPGDKYKHTMLFEFS  337



>ref|XP_006826839.1| PREDICTED: aldose 1-epimerase [Amborella trichopoda]
 gb|ERM94076.1| hypothetical protein AMTR_s00010p00093760 [Amborella trichopoda]
Length=355

 Score =   217 bits (552),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 105/195 (54%), Positives = 136/195 (70%), Gaps = 3/195 (2%)
 Frame = -1

Query  787  TCSLQNQLGIRMKAKAL--NKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDE  614
            T SL   + +R+  +++  NK TP++LA HTYWNL GH++G+ L H IQL+ S ITPVD+
Sbjct  148  TYSLPGPMTLRLDMESIPENKPTPISLAQHTYWNLAGHNAGNTLDHHIQLWGSHITPVDQ  207

Query  613  KLIPTGAISPVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGLKH-LGKAAVVVDSK  437
              +PTG I PVKGT FDFL+ + IGS ++E+PGGYD NYVLD    K  L   A + D  
Sbjct  208  YTVPTGEIMPVKGTPFDFLEEKKIGSRIHEVPGGYDHNYVLDCGEEKMGLKLVARLRDPS  267

Query  436  SGRKMELWTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIV  257
            S R + LW+N PGVQFYT N +    GKGG VY KHA LCLETQGFP+++N PNFPS +V
Sbjct  268  SSRVLTLWSNAPGVQFYTGNYVNGVVGKGGAVYGKHAGLCLETQGFPNAINQPNFPSIVV  327

Query  256  NPGETYDHVMVYRFT  212
             PG+ Y H M++ F+
Sbjct  328  EPGKKYKHTMLFEFS  342



>ref|XP_003573719.1| PREDICTED: aldose 1-epimerase [Brachypodium distachyon]
Length=333

 Score =   216 bits (550),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 102/186 (55%), Positives = 133/186 (72%), Gaps = 1/186 (1%)
 Frame = -1

Query  766  LGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTGAIS  587
            L + M+A A NKATP++LA HTYWNL GH+SGD L H+IQ++    TPVDE  IPTG I 
Sbjct  147  LRLDMEAIAENKATPISLAQHTYWNLAGHNSGDTLGHSIQIWGKYYTPVDENSIPTGEIV  206

Query  586  PVKGTAFDFLQARAIGSELNELPGGYDINYVLDSHGLKH-LGKAAVVVDSKSGRKMELWT  410
            PVK T FDF     +G+ +N++PGGYD NYVLD    K+ L  AA + D  + R + LWT
Sbjct  207  PVKDTPFDFTTLHKVGARINDVPGGYDHNYVLDCGDEKNGLKLAAKLKDPSTSRTLNLWT  266

Query  409  NKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETYDHV  230
            + PG+QFYT+N +    GKGG VY+KH+A+CLETQGFP+++N PNFPS +V PGE Y H 
Sbjct  267  DAPGMQFYTANYVDGITGKGGAVYEKHSAVCLETQGFPNAINQPNFPSVVVQPGEKYKHT  326

Query  229  MVYRFT  212
            M++ F+
Sbjct  327  MLFEFS  332



>gb|EEE61117.1| hypothetical protein OsJ_15041 [Oryza sativa Japonica Group]
Length=380

 Score =   217 bits (553),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 109/204 (53%), Positives = 136/204 (67%), Gaps = 22/204 (11%)
 Frame = -1

Query  766  LGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTGAIS  587
            L + M A A  KATPVNLA H+YWNLGG  SGDIL +T+QLF S+ TPVD +LIPTG ++
Sbjct  179  LSVHMNATAAGKATPVNLAQHSYWNLGGTGSGDILGNTVQLFASRYTPVDAELIPTGQVA  238

Query  586  PVKGTAFDFLQARAIGSELNELPG----------GYDINYVLD--------SHGLKHLGK  461
            PV GT +D      +G+ ++ + G          G+D NY +D        +H L+   +
Sbjct  239  PVTGTPYDLRAPTPVGARVHLVTGGLSKTGATIYGFDTNYAVDGGDDVDAHAHALR---R  295

Query  460  AAVVVDSKSGRKMELWTNKPGVQFYTSNMLT-DTKGKGGYVYKKHAALCLETQGFPDSVN  284
             AVV D KSGR +ELW N+PGVQFYT N LT D KGKGG  Y ++ ALCLETQGFPD+VN
Sbjct  296  VAVVRDGKSGRSLELWANQPGVQFYTGNFLTADVKGKGGKAYGQYGALCLETQGFPDAVN  355

Query  283  FPNFPSQIVNPGETYDHVMVYRFT  212
             PNFPS IV PG+ Y H MVY+F+
Sbjct  356  HPNFPSVIVRPGQVYKHEMVYKFS  379



>gb|EMS45763.1| Aldose 1-epimerase [Triticum urartu]
Length=335

 Score =   216 bits (550),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 102/189 (54%), Positives = 133/189 (70%), Gaps = 7/189 (4%)
 Frame = -1

Query  766  LGIRMKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDEKLIPTGAIS  587
            L + M+A   NKATP++LA HTYWNL GH+SG IL H+IQ++   +TPV+E  IPTG I 
Sbjct  149  LRLDMEAIPANKATPISLAQHTYWNLAGHNSGSILDHSIQIWAKHVTPVNENTIPTGEIM  208

Query  586  PVKGTAFDFLQARAIGSELNELPGGYDINYVLDS----HGLKHLGKAAVVVDSKSGRKME  419
            PV+ T FDF     IG  ++++PGGYD NYVLDS    +GLKH   AA + D  S R ++
Sbjct  209  PVQDTPFDFTTEHKIGDRISDVPGGYDHNYVLDSGDEKNGLKH---AAKLKDPSSSRTLD  265

Query  418  LWTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPSQIVNPGETY  239
            LWT+ PG+QFYT+N +    GKGG VY KHA +CLETQGFP+++N PNFPS +V PG  Y
Sbjct  266  LWTDAPGMQFYTANYVNGITGKGGAVYGKHAGVCLETQGFPNAINQPNFPSVVVQPGAKY  325

Query  238  DHVMVYRFT  212
             H M++ F+
Sbjct  326  KHAMLFEFS  334



>ref|XP_006661643.1| PREDICTED: aldose 1-epimerase-like [Oryza brachyantha]
Length=339

 Score =   216 bits (550),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 105/198 (53%), Positives = 137/198 (69%), Gaps = 9/198 (5%)
 Frame = -1

Query  787  TCSLQNQLGIR--MKAKALNKATPVNLASHTYWNLGGHDSGDILSHTIQLFCSKITPVDE  614
            T SL++   +R  M+A A NKATP+NLA HTYWNL GH+SG  L H+IQ++   ITPVDE
Sbjct  144  TYSLRHSTTLRLDMEAVAENKATPINLAQHTYWNLAGHNSGHTLDHSIQIWGKHITPVDE  203

Query  613  KLIPTGAISPVKGTAFDFLQARAIGSELNELPGGYDINYVLD----SHGLKHLGKAAVVV  446
              IPTG I PVK T FDF     IG+ +N++PGGYD NYVLD     +GLKH   A  + 
Sbjct  204  NTIPTGEIVPVKDTPFDFTTEHKIGARINDVPGGYDHNYVLDCGDEKNGLKH---AVKLK  260

Query  445  DSKSGRKMELWTNKPGVQFYTSNMLTDTKGKGGYVYKKHAALCLETQGFPDSVNFPNFPS  266
            D  + R ++LWT+ PG+QFYT+N +    GK G VY KH+ +CLETQGFP+++N PNFPS
Sbjct  261  DPSNSRTLDLWTDAPGMQFYTANYVDSISGKSGAVYVKHSGVCLETQGFPNAINQPNFPS  320

Query  265  QIVNPGETYDHVMVYRFT  212
             +V PG+ Y H M++ F+
Sbjct  321  VVVQPGDKYKHSMLFEFS  338



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1655620752480