BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig11064

Length=817
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KDO49088.1|  hypothetical protein CISIN_1g016407mg                   357   2e-118   Citrus sinensis [apfelsine]
ref|XP_003631649.1|  PREDICTED: cyclase-associated protein 1            360   2e-118   Vitis vinifera
ref|XP_006423253.1|  hypothetical protein CICLE_v10028340mg             358   6e-118   Citrus clementina [clementine]
ref|XP_006349606.1|  PREDICTED: adenylyl cyclase-associated prote...    358   8e-118   Solanum tuberosum [potatoes]
ref|XP_004248719.1|  PREDICTED: cyclase-associated protein 1            355   2e-116   Solanum lycopersicum
ref|XP_009775243.1|  PREDICTED: cyclase-associated protein 1-like       354   2e-116   Nicotiana sylvestris
ref|XP_012069926.1|  PREDICTED: cyclase-associated protein 1            352   2e-115   Jatropha curcas
ref|XP_002306100.1|  cyclase associated protein 1                       350   6e-115   Populus trichocarpa [western balsam poplar]
gb|KCW55347.1|  hypothetical protein EUGRSUZ_I01265                     348   1e-114   Eucalyptus grandis [rose gum]
ref|XP_010028583.1|  PREDICTED: LOW QUALITY PROTEIN: cyclase-asso...    349   3e-114   Eucalyptus grandis [rose gum]
ref|XP_011037533.1|  PREDICTED: cyclase-associated protein 1-like       348   8e-114   Populus euphratica
ref|XP_009619104.1|  PREDICTED: cyclase-associated protein 1-like       347   2e-113   Nicotiana tomentosiformis
ref|XP_011048631.1|  PREDICTED: cyclase-associated protein 1-like       346   3e-113   Populus euphratica
ref|XP_002313050.2|  cyclase associated protein 1                       345   6e-113   
ref|XP_010254869.1|  PREDICTED: cyclase-associated protein 1-like       343   4e-112   Nelumbo nucifera [Indian lotus]
ref|XP_004148849.1|  PREDICTED: cyclase-associated protein 1-like       343   8e-112   Cucumis sativus [cucumbers]
ref|XP_008457926.1|  PREDICTED: cyclase-associated protein 1-like       342   1e-111   Cucumis melo [Oriental melon]
emb|CDO97057.1|  unnamed protein product                                342   1e-111   Coffea canephora [robusta coffee]
ref|XP_002509481.1|  adenylyl cyclase-associated protein, putative      342   2e-111   Ricinus communis
ref|XP_006856025.1|  PREDICTED: cyclase-associated protein 1            342   2e-111   Amborella trichopoda
ref|XP_007200993.1|  hypothetical protein PRUPE_ppa005136mg             340   6e-111   Prunus persica
gb|EYU37793.1|  hypothetical protein MIMGU_mgv1a005340mg                340   1e-110   Erythranthe guttata [common monkey flower]
gb|AEN70775.1|  adenylyl cyclase-associated protein                     339   1e-110   Gossypium mustelinum
gb|ADZ16112.1|  adenylyl cyclase associated protein                     339   1e-110   Gossypium barbadense [Egyptian cotton]
gb|ABU97498.1|  adenylyl cyclase-associated protein                     339   1e-110   Gossypium arboreum [tree cotton]
gb|AEN70773.1|  adenylyl cyclase-associated protein                     339   1e-110   Gossypium schwendimanii
gb|ADZ16114.1|  adenylyl cyclase associated protein                     339   2e-110   Gossypium herbaceum subsp. africanum
gb|AEN70781.1|  adenylyl cyclase-associated protein                     339   2e-110   Gossypium barbadense var. brasiliense
dbj|BAA36585.1|  adenylyl cyclase associated protein                    339   2e-110   Gossypium hirsutum [American cotton]
gb|AEN70793.1|  adenylyl cyclase-associated protein                     338   3e-110   Gossypium lobatum
gb|AEN70789.1|  adenylyl cyclase-associated protein                     338   3e-110   Gossypium davidsonii
ref|XP_010548053.1|  PREDICTED: cyclase-associated protein 1            339   3e-110   Tarenaya hassleriana [spider flower]
ref|XP_010690893.1|  PREDICTED: cyclase-associated protein 1 isof...    335   3e-110   
gb|AEN70791.1|  adenylyl cyclase-associated protein                     338   3e-110   Gossypium aridum
gb|AEN70772.1|  adenylyl cyclase-associated protein                     338   4e-110   Gossypium laxum
gb|AEN70792.1|  adenylyl cyclase-associated protein                     338   4e-110   Gossypium gossypioides
gb|AEN70794.1|  adenylyl cyclase-associated protein                     338   4e-110   Gossypium trilobum
gb|AEN70771.1|  adenylyl cyclase-associated protein                     338   4e-110   Gossypium thurberi
ref|XP_010939270.1|  PREDICTED: cyclase-associated protein 1-like       338   5e-110   Elaeis guineensis
gb|ABU97500.1|  adenylyl cyclase-associated protein                     337   1e-109   Gossypium arboreum [tree cotton]
ref|XP_010690892.1|  PREDICTED: cyclase-associated protein 1 isof...    337   1e-109   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010936278.1|  PREDICTED: cyclase-associated protein 1            337   2e-109   Elaeis guineensis
ref|XP_007042208.1|  Cyclase associated protein 1, 1,CAP1               336   3e-109   
gb|AFK47086.1|  unknown                                                 335   5e-109   Lotus japonicus
ref|XP_008785664.1|  PREDICTED: LOW QUALITY PROTEIN: cyclase-asso...    334   2e-108   
ref|XP_010263686.1|  PREDICTED: cyclase-associated protein 1-like       333   4e-108   Nelumbo nucifera [Indian lotus]
emb|CDX75438.1|  BnaA01g02640D                                          333   4e-108   
ref|XP_010530841.1|  PREDICTED: cyclase-associated protein 1            333   4e-108   Tarenaya hassleriana [spider flower]
ref|XP_002867116.1|  ATCAP1                                             333   6e-108   
ref|XP_009804915.1|  PREDICTED: cyclase-associated protein 1            333   7e-108   Nicotiana sylvestris
ref|XP_009112095.1|  PREDICTED: cyclase-associated protein 1            333   7e-108   Brassica rapa
emb|CDX69065.1|  BnaC01g03880D                                          333   8e-108   
ref|XP_006286091.1|  hypothetical protein CARUB_v10007634mg             332   1e-107   Capsella rubella
ref|XP_010432407.1|  PREDICTED: cyclase-associated protein 1-like       332   1e-107   Camelina sativa [gold-of-pleasure]
ref|XP_011088387.1|  PREDICTED: cyclase-associated protein 1            332   1e-107   Sesamum indicum [beniseed]
ref|XP_004299093.1|  PREDICTED: cyclase-associated protein 1            331   2e-107   Fragaria vesca subsp. vesca
ref|XP_003537875.1|  PREDICTED: cyclase-associated protein 1-like       330   4e-107   Glycine max [soybeans]
ref|XP_006412221.1|  hypothetical protein EUTSA_v10025082mg             331   4e-107   Eutrema salsugineum [saltwater cress]
ref|XP_010447072.1|  PREDICTED: cyclase-associated protein 1 isof...    330   5e-107   Camelina sativa [gold-of-pleasure]
ref|XP_010447070.1|  PREDICTED: cyclase-associated protein 1 isof...    330   5e-107   Camelina sativa [gold-of-pleasure]
ref|XP_006365096.1|  PREDICTED: adenylyl cyclase-associated prote...    329   1e-106   Solanum tuberosum [potatoes]
ref|XP_004230883.1|  PREDICTED: cyclase-associated protein 1            329   2e-106   Solanum lycopersicum
ref|XP_010437609.1|  PREDICTED: cyclase-associated protein 1-like       329   2e-106   Camelina sativa [gold-of-pleasure]
ref|NP_195175.1|  cyclase associated protein 1                          328   3e-106   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008236881.1|  PREDICTED: cyclase-associated protein 1            336   5e-106   
ref|XP_009419491.1|  PREDICTED: cyclase-associated protein 1-like       327   7e-106   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011092784.1|  PREDICTED: cyclase-associated protein 1-like       327   9e-106   Sesamum indicum [beniseed]
ref|XP_009605961.1|  PREDICTED: cyclase-associated protein 1            327   1e-105   Nicotiana tomentosiformis
ref|XP_009411142.1|  PREDICTED: cyclase-associated protein 1-like       327   1e-105   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY46244.1|  BnaC03g66050D                                          325   8e-105   Brassica napus [oilseed rape]
gb|KFK30061.1|  hypothetical protein AALP_AA7G211700                    325   1e-104   Arabis alpina [alpine rockcress]
ref|XP_003541049.1|  PREDICTED: cyclase-associated protein 1-like       324   1e-104   Glycine max [soybeans]
gb|KHN25370.1|  Adenylyl cyclase-associated protein                     324   1e-104   Glycine soja [wild soybean]
emb|CDX76285.1|  BnaA08g11150D                                          322   1e-103   
ref|XP_009374180.1|  PREDICTED: cyclase-associated protein 1            322   1e-103   Pyrus x bretschneideri [bai li]
ref|XP_008377316.1|  PREDICTED: cyclase-associated protein 1-like       322   1e-103   Malus domestica [apple tree]
ref|XP_009108728.1|  PREDICTED: cyclase-associated protein 1-like       320   5e-103   Brassica rapa
gb|EEC76093.1|  hypothetical protein OsI_13337                          317   1e-101   Oryza sativa Indica Group [Indian rice]
gb|ABF98601.1|  cyclase-associated protein, putative, expressed         317   1e-101   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001145831.1|  adenylyl cyclase-associated protein                313   2e-101   Zea mays [maize]
ref|XP_003606897.1|  Adenylyl cyclase-associated protein                316   2e-101   Medicago truncatula
ref|XP_006650514.1|  PREDICTED: cyclase-associated protein 1-like       316   2e-101   Oryza brachyantha
ref|XP_007131840.1|  hypothetical protein PHAVU_011G045700g             316   3e-101   Phaseolus vulgaris [French bean]
gb|EEE59831.1|  hypothetical protein OsJ_12395                          316   3e-101   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008643463.1|  PREDICTED: uncharacterized protein LOC100279...    315   4e-101   Zea mays [maize]
ref|XP_002463964.1|  hypothetical protein SORBIDRAFT_01g009760          313   6e-101   
ref|XP_009396021.1|  PREDICTED: cyclase-associated protein 1-like       315   8e-101   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008375926.1|  PREDICTED: cyclase-associated protein 1            314   9e-101   Malus domestica [apple tree]
gb|KJB32500.1|  hypothetical protein B456_005G243200                    314   1e-100   Gossypium raimondii
ref|XP_004981942.1|  PREDICTED: adenylyl cyclase-associated prote...    314   1e-100   Setaria italica
ref|XP_008665331.1|  PREDICTED: cyclase-associated protein 1-like       314   2e-100   
gb|KHG11477.1|  Adenylyl cyclase-associated                             313   5e-100   Gossypium arboreum [tree cotton]
gb|EPS61598.1|  adenylyl cyclase-associated protein                     311   1e-99    Genlisea aurea
ref|XP_003560473.1|  PREDICTED: cyclase-associated protein 1            310   9e-99    Brachypodium distachyon [annual false brome]
gb|AAX95693.1|  CAP protein                                             310   9e-99    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010107846.1|  Adenylyl cyclase-associated protein 2              312   3e-98    
ref|XP_004507425.1|  PREDICTED: adenylyl cyclase-associated prote...    307   4e-98    Cicer arietinum [garbanzo]
gb|KJB79113.1|  hypothetical protein B456_013G037400                    293   5e-94    Gossypium raimondii
gb|EMS59857.1|  Adenylyl cyclase-associated protein                     293   9e-94    Triticum urartu
ref|XP_008447035.1|  PREDICTED: cyclase-associated protein 1            296   2e-93    Cucumis melo [Oriental melon]
gb|KJB79114.1|  hypothetical protein B456_013G037400                    295   3e-93    Gossypium raimondii
gb|EMT04895.1|  Adenylyl cyclase-associated protein                     292   7e-93    
ref|XP_008664624.1|  PREDICTED: cyclase-associated protein 1-like       293   9e-93    
ref|XP_004150414.1|  PREDICTED: cyclase-associated protein 1-like       293   2e-92    Cucumis sativus [cucumbers]
gb|ADZ16117.1|  adenylyl cyclase associated protein                     291   2e-92    Gossypium hirsutum [American cotton]
gb|AEN70776.1|  adenylyl cyclase-associated protein                     291   3e-92    Gossypium mustelinum
gb|KJB79115.1|  hypothetical protein B456_013G037400                    291   4e-92    Gossypium raimondii
gb|KJB79111.1|  hypothetical protein B456_013G037400                    291   4e-92    Gossypium raimondii
gb|ADZ16113.1|  adenylyl cyclase associated protein                     291   5e-92    Gossypium barbadense [Egyptian cotton]
gb|ADZ16115.1|  adenylyl cyclase associated protein                     290   9e-92    Gossypium raimondii
ref|NP_001061934.1|  Os08g0447900                                       290   1e-91    
gb|AEN70782.1|  adenylyl cyclase-associated protein                     290   1e-91    Gossypium barbadense var. brasiliense
gb|EAZ07173.1|  hypothetical protein OsI_29418                          290   2e-91    Oryza sativa Indica Group [Indian rice]
ref|XP_004973587.1|  PREDICTED: adenylyl cyclase-associated prote...    287   2e-90    Setaria italica
ref|XP_006659462.1|  PREDICTED: cyclase-associated protein 1-like       287   2e-90    Oryza brachyantha
gb|KJB79112.1|  hypothetical protein B456_013G037400                    286   3e-90    Gossypium raimondii
gb|EYU42620.1|  hypothetical protein MIMGU_mgv1a021022mg                286   4e-90    Erythranthe guttata [common monkey flower]
ref|XP_010235186.1|  PREDICTED: cyclase-associated protein 1-like       286   1e-89    Brachypodium distachyon [annual false brome]
ref|XP_002444442.1|  hypothetical protein SORBIDRAFT_07g022030          284   4e-89    Sorghum bicolor [broomcorn]
emb|CAN61863.1|  hypothetical protein VITISV_043448                     282   3e-88    Vitis vinifera
gb|AEN70786.1|  adenylyl cyclase-associated protein                     280   7e-88    Gossypium hirsutum subsp. latifolium
ref|XP_002976329.1|  hypothetical protein SELMODRAFT_175612             271   2e-83    
ref|XP_002987315.1|  hypothetical protein SELMODRAFT_269241             270   3e-83    Selaginella moellendorffii
ref|XP_001773273.1|  predicted protein                                  252   3e-76    
ref|XP_005650031.1|  hypothetical protein COCSUDRAFT_46736              198   5e-57    Coccomyxa subellipsoidea C-169
ref|XP_003285939.1|  hypothetical protein DICPUDRAFT_53913              184   1e-50    Dictyostelium purpureum
dbj|GAM18318.1|  hypothetical protein SAMD00019534_014930               181   1e-49    Acytostelium subglobosum LB1
ref|XP_636512.1|  cyclase associated protein                            178   2e-48    Dictyostelium discoideum AX4
ref|XP_002505939.1|  predicted protein                                  177   2e-48    Micromonas commoda
gb|EFA82907.1|  cyclase associated protein                              177   7e-48    Heterostelium album PN500
gb|KIZ04861.1|  Adenylyl cyclase-associated protein                     172   1e-47    Monoraphidium neglectum
ref|XP_004354500.1|  cyclase associated protein                         170   2e-45    Cavenderia fasciculata
emb|CDQ79594.1|  unnamed protein product                                169   3e-45    Oncorhynchus mykiss
ref|NP_001133556.1|  Adenylyl cyclase-associated protein 1              169   3e-45    Salmo salar
ref|XP_007245760.1|  PREDICTED: adenylyl cyclase-associated prote...    168   1e-44    Astyanax mexicanus [blind cave fish]
ref|XP_004074190.1|  PREDICTED: adenylyl cyclase-associated prote...    167   3e-44    Oryzias latipes [Japanese rice fish]
ref|XP_001746328.1|  hypothetical protein                               167   1e-43    Monosiga brevicollis MX1
ref|XP_001638431.1|  predicted protein                                  164   2e-43    Nematostella vectensis
ref|XP_005814142.1|  PREDICTED: adenylyl cyclase-associated prote...    164   2e-43    
ref|XP_009066708.1|  hypothetical protein LOTGIDRAFT_109031             164   2e-43    Lottia gigantea
ref|XP_008421240.1|  PREDICTED: LOW QUALITY PROTEIN: adenylyl cyc...    164   2e-43    
ref|XP_010898586.1|  PREDICTED: adenylyl cyclase-associated prote...    164   3e-43    Esox lucius
emb|CDQ65132.1|  unnamed protein product                                164   3e-43    Oncorhynchus mykiss
ref|XP_004368326.1|  adenylyl cyclaseassociated protein                 164   5e-43    Acanthamoeba castellanii str. Neff
ref|XP_003057213.1|  predicted protein                                  164   5e-43    Micromonas pusilla CCMP1545
ref|XP_005842875.1|  hypothetical protein CHLNCDRAFT_142506             164   7e-43    Chlorella variabilis
ref|XP_006681875.1|  hypothetical protein BATDEDRAFT_14125              162   1e-42    Batrachochytrium dendrobatidis JAM81
ref|NP_956203.1|  adenylyl cyclase-associated protein 1                 162   1e-42    Danio rerio [leopard danio]
ref|XP_003127872.3|  PREDICTED: adenylyl cyclase-associated prote...    160   1e-42    
ref|XP_005968024.1|  PREDICTED: adenylyl cyclase-associated prote...    162   1e-42    Pantholops hodgsonii [Tibetan antelope]
gb|AAI50357.1|  Cap1 CAP, adenylate cyclase-associated protein 1        162   1e-42    Danio rerio [leopard danio]
ref|XP_005970523.1|  PREDICTED: adenylyl cyclase-associated prote...    162   1e-42    Pantholops hodgsonii [Tibetan antelope]
ref|XP_005970526.1|  PREDICTED: adenylyl cyclase-associated prote...    162   1e-42    Pantholops hodgsonii [Tibetan antelope]
ref|XP_005968023.1|  PREDICTED: adenylyl cyclase-associated prote...    162   2e-42    Pantholops hodgsonii [Tibetan antelope]
ref|XP_007576532.1|  PREDICTED: adenylyl cyclase-associated prote...    162   2e-42    Poecilia formosa
ref|XP_003447228.1|  PREDICTED: adenylyl cyclase-associated prote...    162   2e-42    Oreochromis niloticus
ref|XP_005656157.1|  PREDICTED: adenylyl cyclase-associated prote...    159   2e-42    
ref|XP_005739752.1|  PREDICTED: adenylyl cyclase-associated prote...    162   2e-42    Pundamilia nyererei
ref|XP_006794538.1|  PREDICTED: adenylyl cyclase-associated prote...    160   3e-42    Neolamprologus brichardi [lyretail cichlid]
ref|XP_008304850.1|  PREDICTED: adenylyl cyclase-associated prote...    161   3e-42    Stegastes partitus
ref|XP_005938812.1|  PREDICTED: adenylyl cyclase-associated prote...    161   4e-42    Haplochromis burtoni
ref|XP_010209099.1|  PREDICTED: adenylyl cyclase-associated prote...    155   4e-42    Colius striatus
ref|XP_004548966.1|  PREDICTED: adenylyl cyclase-associated prote...    161   4e-42    
ref|XP_011396561.1|  Adenylyl cyclase-associated protein 1              159   6e-42    Auxenochlorella protothecoides
ref|XP_010121837.1|  PREDICTED: adenylyl cyclase-associated prote...    154   8e-42    Chlamydotis macqueenii
ref|XP_004548179.1|  PREDICTED: adenylyl cyclase-associated prote...    160   9e-42    
ref|XP_005917513.1|  PREDICTED: adenylyl cyclase-associated prote...    160   1e-41    Haplochromis burtoni
ref|XP_004371955.1|  PREDICTED: adenylyl cyclase-associated prote...    159   1e-41    Trichechus manatus latirostris
ref|XP_006788155.1|  PREDICTED: adenylyl cyclase-associated prote...    158   2e-41    Neolamprologus brichardi [lyretail cichlid]
ref|XP_005678705.1|  PREDICTED: adenylyl cyclase-associated prote...    159   2e-41    Capra hircus [domestic goat]
ref|XP_011959062.1|  PREDICTED: adenylyl cyclase-associated prote...    159   2e-41    
ref|XP_005678703.1|  PREDICTED: adenylyl cyclase-associated prote...    159   2e-41    Capra hircus [domestic goat]
ref|XP_004001884.1|  PREDICTED: adenylyl cyclase-associated prote...    159   2e-41    
ref|XP_008329363.1|  PREDICTED: adenylyl cyclase-associated prote...    159   2e-41    Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_010135264.1|  PREDICTED: adenylyl cyclase-associated prote...    159   2e-41    Buceros rhinoceros silvestris
ref|XP_006061981.1|  PREDICTED: adenylyl cyclase-associated prote...    159   2e-41    
ref|XP_006061979.1|  PREDICTED: adenylyl cyclase-associated prote...    159   2e-41    Bubalus bubalis [domestic water buffalo]
ref|XP_006061980.1|  PREDICTED: adenylyl cyclase-associated prote...    159   2e-41    Bubalus bubalis [domestic water buffalo]
ref|XP_010789579.1|  PREDICTED: LOW QUALITY PROTEIN: adenylyl cyc...    159   2e-41    Notothenia coriiceps [yellowbelly rockcod]
ref|XP_008633293.1|  PREDICTED: adenylyl cyclase-associated prote...    158   3e-41    Corvus brachyrhynchos
ref|XP_008832492.1|  PREDICTED: LOW QUALITY PROTEIN: adenylyl cyc...    159   3e-41    
ref|XP_006114852.1|  PREDICTED: adenylyl cyclase-associated prote...    158   3e-41    Pelodiscus sinensis [Chinese softshell turtle]
gb|EAX07242.1|  CAP, adenylate cyclase-associated protein 1 (yeas...    152   3e-41    Homo sapiens [man]
gb|ELR49684.1|  Adenylyl cyclase-associated protein 1                   158   4e-41    Bos mutus
ref|XP_007077462.1|  PREDICTED: adenylyl cyclase-associated prote...    158   4e-41    Panthera tigris altaica
ref|XP_007077463.1|  PREDICTED: adenylyl cyclase-associated prote...    158   4e-41    Panthera tigris altaica
ref|NP_001030182.1|  adenylyl cyclase-associated protein 1              158   4e-41    Bos taurus [bovine]
ref|XP_002196792.2|  PREDICTED: adenylyl cyclase-associated prote...    158   4e-41    Taeniopygia guttata
ref|XP_004614276.1|  PREDICTED: adenylyl cyclase-associated prote...    158   4e-41    Sorex araneus [Eurasian shrew]
ref|XP_005904935.1|  PREDICTED: adenylyl cyclase-associated prote...    158   4e-41    Bos mutus
ref|XP_005904936.1|  PREDICTED: adenylyl cyclase-associated prote...    158   4e-41    Bos mutus
ref|XP_005204713.1|  PREDICTED: adenylyl cyclase-associated prote...    158   4e-41    Bos taurus [bovine]
ref|XP_009096832.1|  PREDICTED: adenylyl cyclase-associated prote...    158   5e-41    
ref|XP_009096831.1|  PREDICTED: adenylyl cyclase-associated prote...    157   6e-41    
ref|XP_005058254.1|  PREDICTED: adenylyl cyclase-associated prote...    158   6e-41    
ref|XP_008944229.1|  PREDICTED: adenylyl cyclase-associated prote...    152   7e-41    Merops nubicus
ref|XP_005607231.1|  PREDICTED: adenylyl cyclase-associated prote...    157   7e-41    Equus caballus [domestic horse]
ref|XP_003505107.1|  PREDICTED: adenylyl cyclase-associated prote...    157   7e-41    Cricetulus griseus [Chinese hamsters]
ref|NP_001085243.1|  CAP, adenylate cyclase-associated protein, 2       157   7e-41    Xenopus laevis [clawed frog]
ref|XP_001503410.2|  PREDICTED: adenylyl cyclase-associated prote...    157   8e-41    Equus caballus [domestic horse]
ref|XP_005427223.1|  PREDICTED: adenylyl cyclase-associated prote...    157   8e-41    Geospiza fortis
ref|XP_005494743.1|  PREDICTED: adenylyl cyclase-associated prote...    157   8e-41    Zonotrichia albicollis
emb|CEF61777.1|  Adenylyl cyclase-associated protein                    157   8e-41    Strongyloides ratti
ref|XP_010732388.1|  PREDICTED: adenylyl cyclase-associated prote...    157   9e-41    
gb|KFO76850.1|  Adenylyl cyclase-associated protein 1                   156   9e-41    Cuculus canorus
ref|XP_006972902.1|  PREDICTED: adenylyl cyclase-associated prote...    157   9e-41    
ref|XP_006972904.1|  PREDICTED: adenylyl cyclase-associated prote...    157   1e-40    Peromyscus maniculatus bairdii
ref|XP_006972903.1|  PREDICTED: adenylyl cyclase-associated prote...    157   1e-40    
gb|KFP93229.1|  Adenylyl cyclase-associated protein 1                   156   1e-40    Haliaeetus albicilla
ref|XP_009881073.1|  PREDICTED: adenylyl cyclase-associated prote...    157   1e-40    Charadrius vociferus
ref|XP_005529871.1|  PREDICTED: adenylyl cyclase-associated prote...    157   1e-40    
ref|XP_010574378.1|  PREDICTED: adenylyl cyclase-associated prote...    157   1e-40    Haliaeetus leucocephalus
ref|XP_009929138.1|  PREDICTED: adenylyl cyclase-associated prote...    157   1e-40    Haliaeetus albicilla
ref|XP_009813967.1|  PREDICTED: adenylyl cyclase-associated prote...    157   1e-40    Gavia stellata
ref|XP_009560106.1|  PREDICTED: adenylyl cyclase-associated prote...    157   1e-40    Cuculus canorus
ref|XP_007114322.1|  PREDICTED: adenylyl cyclase-associated prote...    157   2e-40    
ref|XP_008169234.1|  PREDICTED: adenylyl cyclase-associated prote...    156   2e-40    Chrysemys picta bellii
ref|XP_004266450.1|  PREDICTED: adenylyl cyclase-associated prote...    156   2e-40    Orcinus orca [Orca]
ref|XP_010861116.1|  PREDICTED: adenylyl cyclase-associated prote...    157   2e-40    Bison bison bison
ref|XP_007114320.1|  PREDICTED: adenylyl cyclase-associated prote...    156   2e-40    
pdb|1K8F|A  Chain A, Crystal Structure Of The Human C-Terminal Ca...    149   2e-40    Homo sapiens [man]
gb|ERE85598.1|  adenylyl cyclase-associated protein 1-like isoform 2    157   2e-40    Cricetulus griseus [Chinese hamsters]
ref|XP_010084383.1|  PREDICTED: adenylyl cyclase-associated prote...    156   2e-40    Pterocles gutturalis
gb|EPY78467.1|  adenylyl cyclase-associated protein 1                   156   2e-40    Camelus ferus
gb|KGL91453.1|  Adenylyl cyclase-associated protein 1                   156   2e-40    Charadrius vociferus
ref|XP_004266448.1|  PREDICTED: adenylyl cyclase-associated prote...    156   2e-40    
ref|XP_007453821.1|  PREDICTED: adenylyl cyclase-associated prote...    156   2e-40    Lipotes vexillifer [baiji]
ref|XP_010308405.1|  PREDICTED: adenylyl cyclase-associated prote...    152   2e-40    Balearica regulorum gibbericeps
gb|KFP61405.1|  Adenylyl cyclase-associated protein 2                   152   2e-40    Cariama cristata
ref|XP_010156281.1|  PREDICTED: adenylyl cyclase-associated prote...    152   2e-40    Eurypyga helias
ref|XP_008303166.1|  PREDICTED: adenylyl cyclase-associated prote...    156   2e-40    Stegastes partitus
ref|XP_011376287.1|  PREDICTED: adenylyl cyclase-associated prote...    156   2e-40    
ref|XP_009068289.1|  PREDICTED: adenylyl cyclase-associated prote...    156   2e-40    Acanthisitta chloris
ref|XP_005512871.1|  PREDICTED: adenylyl cyclase-associated prote...    156   2e-40    Columba livia [carrier pigeon]
ref|XP_006165585.1|  PREDICTED: adenylyl cyclase-associated prote...    156   2e-40    Tupaia chinensis
gb|KFO14665.1|  Adenylyl cyclase-associated protein 2                   152   2e-40    Balearica regulorum gibbericeps
ref|XP_009707197.1|  PREDICTED: adenylyl cyclase-associated prote...    152   2e-40    Cariama cristata
gb|EMC79468.1|  Adenylyl cyclase-associated protein 1                   156   2e-40    
ref|XP_010621211.1|  PREDICTED: adenylyl cyclase-associated prote...    156   2e-40    Fukomys damarensis [Damara mole rat]
ref|XP_002114074.1|  hypothetical protein TRIADDRAFT_63338              155   2e-40    Trichoplax adhaerens
ref|XP_010018923.1|  PREDICTED: adenylyl cyclase-associated prote...    156   2e-40    Nestor notabilis
ref|XP_008939593.1|  PREDICTED: adenylyl cyclase-associated prote...    156   2e-40    Merops nubicus
ref|XP_006904030.1|  PREDICTED: adenylyl cyclase-associated prote...    156   3e-40    Pteropus alecto
ref|XP_007164771.1|  PREDICTED: adenylyl cyclase-associated prote...    156   3e-40    Balaenoptera acutorostrata scammoni
ref|XP_010958115.1|  PREDICTED: adenylyl cyclase-associated prote...    156   3e-40    Camelus bactrianus [camel]
ref|XP_010958112.1|  PREDICTED: adenylyl cyclase-associated prote...    156   3e-40    Camelus bactrianus [camel]
ref|XP_006188099.1|  PREDICTED: adenylyl cyclase-associated prote...    156   3e-40    Camelus ferus
ref|XP_006215927.1|  PREDICTED: adenylyl cyclase-associated prote...    156   3e-40    Vicugna pacos
ref|XP_006215928.1|  PREDICTED: adenylyl cyclase-associated prote...    156   3e-40    Vicugna pacos
ref|XP_006188100.1|  PREDICTED: adenylyl cyclase-associated prote...    156   3e-40    Camelus ferus
ref|XP_008071360.1|  PREDICTED: adenylyl cyclase-associated prote...    155   3e-40    Carlito syrichta
ref|XP_003444120.1|  PREDICTED: adenylyl cyclase-associated prote...    155   3e-40    Oreochromis niloticus
ref|XP_008918818.1|  PREDICTED: adenylyl cyclase-associated prote...    155   4e-40    
gb|ELK19496.1|  Adenylyl cyclase-associated protein 1                   155   4e-40    Pteropus alecto
ref|XP_010128306.1|  PREDICTED: adenylyl cyclase-associated prote...    151   4e-40    Chlamydotis macqueenii
gb|KFP35037.1|  Adenylyl cyclase-associated protein 2                   151   4e-40    Chlamydotis macqueenii
ref|XP_004415423.1|  PREDICTED: adenylyl cyclase-associated prote...    155   4e-40    Odobenus rosmarus divergens
ref|XP_001508035.2|  PREDICTED: adenylyl cyclase-associated prote...    155   4e-40    
ref|XP_007664626.1|  PREDICTED: adenylyl cyclase-associated prote...    155   4e-40    
ref|XP_010175566.1|  PREDICTED: adenylyl cyclase-associated prote...    155   5e-40    Antrostomus carolinensis
gb|KDD71802.1|  hypothetical protein H632_c4375p0                       147   5e-40    Helicosporidium sp. ATCC 50920
ref|XP_004415421.1|  PREDICTED: adenylyl cyclase-associated prote...    155   5e-40    Odobenus rosmarus divergens
ref|XP_004613991.1|  PREDICTED: adenylyl cyclase-associated prote...    153   5e-40    Sorex araneus [Eurasian shrew]
gb|KFP62724.1|  Adenylyl cyclase-associated protein 1                   154   5e-40    Cariama cristata
ref|XP_009666527.1|  PREDICTED: adenylyl cyclase-associated prote...    155   5e-40    Struthio camelus australis
ref|XP_005628948.1|  PREDICTED: adenylyl cyclase-associated prote...    155   6e-40    
ref|NP_446326.1|  adenylyl cyclase-associated protein 2                 155   6e-40    Rattus norvegicus [brown rat]
ref|XP_005628947.1|  PREDICTED: adenylyl cyclase-associated prote...    155   6e-40    
gb|ELV12076.1|  Adenylyl cyclase-associated protein 2                   156   6e-40    Tupaia chinensis
gb|KFQ50900.1|  Adenylyl cyclase-associated protein 1                   154   6e-40    Pelecanus crispus
ref|XP_007950881.1|  PREDICTED: adenylyl cyclase-associated prote...    155   6e-40    Orycteropus afer afer
ref|XP_848565.1|  PREDICTED: adenylyl cyclase-associated protein ...    155   6e-40    Canis lupus familiaris [dogs]
ref|XP_009484726.1|  PREDICTED: adenylyl cyclase-associated prote...    151   6e-40    Pelecanus crispus
ref|XP_003969232.1|  PREDICTED: adenylyl cyclase-associated prote...    155   6e-40    
gb|KFQ53263.1|  Adenylyl cyclase-associated protein 2                   151   6e-40    Pelecanus crispus
gb|ADI33155.1|  adenylate cyclase-associated protein 1                  148   7e-40    Crassostrea gigas
ref|XP_009479692.1|  PREDICTED: adenylyl cyclase-associated prote...    155   7e-40    Pelecanus crispus
ref|XP_006737570.1|  PREDICTED: adenylyl cyclase-associated prote...    155   7e-40    Leptonychotes weddellii
gb|KFP04456.1|  Adenylyl cyclase-associated protein 1                   154   7e-40    Calypte anna
ref|XP_007950882.1|  PREDICTED: adenylyl cyclase-associated prote...    155   7e-40    
gb|KFZ68467.1|  Adenylyl cyclase-associated protein 2                   152   7e-40    
ref|XP_002801538.1|  PREDICTED: adenylyl cyclase-associated prote...    154   7e-40    
ref|XP_010771271.1|  PREDICTED: adenylyl cyclase-associated prote...    155   7e-40    
ref|XP_005317919.1|  PREDICTED: adenylyl cyclase-associated prote...    155   8e-40    
ref|XP_010345855.1|  PREDICTED: adenylyl cyclase-associated prote...    154   9e-40    
ref|XP_002932726.1|  PREDICTED: adenylyl cyclase-associated prote...    155   9e-40    
ref|XP_007245812.1|  PREDICTED: adenylyl cyclase-associated prote...    154   9e-40    
ref|XP_010224665.1|  PREDICTED: LOW QUALITY PROTEIN: adenylyl cyc...    154   9e-40    
ref|XP_006165009.1|  PREDICTED: adenylyl cyclase-associated prote...    154   1e-39    
dbj|BAB46867.1|  hypothetical protein                                   153   1e-39    
ref|XP_003937061.1|  PREDICTED: adenylyl cyclase-associated prote...    154   1e-39    
gb|EYC32482.1|  hypothetical protein Y032_0003g1605                     149   1e-39    
gb|KFP47473.1|  Adenylyl cyclase-associated protein 2                   152   1e-39    
gb|KFP73217.1|  Adenylyl cyclase-associated protein 2                   151   1e-39    
ref|XP_008496674.1|  PREDICTED: adenylyl cyclase-associated prote...    154   1e-39    
ref|XP_009937699.1|  PREDICTED: adenylyl cyclase-associated prote...    154   1e-39    
ref|XP_008163553.1|  PREDICTED: adenylyl cyclase-associated prote...    153   1e-39    
ref|XP_009876212.1|  PREDICTED: adenylyl cyclase-associated prote...    150   1e-39    
dbj|BAH12121.1|  unnamed protein product                                152   1e-39    
ref|XP_002681979.1|  adenylate cyclase-associated protein               154   1e-39    
ref|XP_009019619.1|  hypothetical protein HELRODRAFT_66158              154   1e-39    
ref|XP_009239721.1|  PREDICTED: adenylyl cyclase-associated prote...    153   1e-39    
emb|CAF92650.1|  unnamed protein product                                154   1e-39    
ref|XP_002801537.1|  PREDICTED: adenylyl cyclase-associated prote...    154   1e-39    
ref|XP_003799032.1|  PREDICTED: adenylyl cyclase-associated prote...    153   1e-39    
ref|XP_011810619.1|  PREDICTED: adenylyl cyclase-associated prote...    154   1e-39    
emb|CAI46134.1|  hypothetical protein                                   153   1e-39    
ref|XP_010286700.1|  PREDICTED: adenylyl cyclase-associated prote...    154   1e-39    
ref|XP_011833049.1|  PREDICTED: adenylyl cyclase-associated prote...    154   1e-39    
ref|XP_005481805.1|  PREDICTED: adenylyl cyclase-associated prote...    154   1e-39    
ref|XP_003799028.1|  PREDICTED: adenylyl cyclase-associated prote...    153   1e-39    
ref|XP_008263734.1|  PREDICTED: adenylyl cyclase-associated prote...    154   1e-39    
gb|KFV95615.1|  Adenylyl cyclase-associated protein 1                   154   1e-39    
ref|XP_004591596.1|  PREDICTED: adenylyl cyclase-associated prote...    154   1e-39    
ref|XP_010289159.1|  PREDICTED: adenylyl cyclase-associated prote...    154   1e-39    
ref|XP_009896391.1|  PREDICTED: adenylyl cyclase-associated prote...    154   1e-39    
ref|XP_009693842.1|  PREDICTED: adenylyl cyclase-associated prote...    154   1e-39    
ref|XP_009562447.1|  PREDICTED: adenylyl cyclase-associated prote...    154   1e-39    
gb|KFV00268.1|  Adenylyl cyclase-associated protein 1                   153   1e-39    
ref|XP_002715237.1|  PREDICTED: adenylyl cyclase-associated prote...    154   1e-39    
ref|XP_011833045.1|  PREDICTED: adenylyl cyclase-associated prote...    154   1e-39    
gb|AAC37610.1|  adenylyl cyclase-associated protein                     154   1e-39    
ref|NP_031624.2|  adenylyl cyclase-associated protein 1                 154   1e-39    
ref|XP_010736230.1|  PREDICTED: adenylyl cyclase-associated prote...    154   1e-39    
ref|XP_011810615.1|  PREDICTED: adenylyl cyclase-associated prote...    154   2e-39    
gb|EHH14648.1|  hypothetical protein EGK_00610                          154   2e-39    
ref|XP_009953391.1|  PREDICTED: adenylyl cyclase-associated prote...    154   2e-39    
ref|XP_001365608.1|  PREDICTED: adenylyl cyclase-associated prote...    154   2e-39    
dbj|BAE23277.1|  unnamed protein product                                154   2e-39    
ref|XP_011582296.1|  PREDICTED: adenylyl cyclase-associated prote...    154   2e-39    
ref|XP_003263592.1|  PREDICTED: adenylyl cyclase-associated prote...    153   2e-39    
ref|NP_071778.2|  adenylyl cyclase-associated protein 1                 154   2e-39    
ref|XP_001082428.1|  PREDICTED: adenylyl cyclase-associated prote...    154   2e-39    
ref|XP_009646807.1|  PREDICTED: adenylyl cyclase-associated prote...    154   2e-39    
gb|KFV55605.1|  Adenylyl cyclase-associated protein 2                   151   2e-39    
sp|Q4R4I6.3|CAP1_MACFA  RecName: Full=Adenylyl cyclase-associated...    154   2e-39    
ref|XP_004314134.1|  PREDICTED: adenylyl cyclase-associated prote...    150   2e-39    
ref|XP_002750694.2|  PREDICTED: adenylyl cyclase-associated prote...    154   2e-39    
ref|XP_005433147.1|  PREDICTED: LOW QUALITY PROTEIN: adenylyl cyc...    154   2e-39    
ref|XP_011810614.1|  PREDICTED: adenylyl cyclase-associated prote...    154   2e-39    
ref|XP_005543903.1|  PREDICTED: adenylyl cyclase-associated prote...    154   2e-39    
ref|XP_003799031.1|  PREDICTED: adenylyl cyclase-associated prote...    153   2e-39    
ref|XP_009583379.1|  PREDICTED: adenylyl cyclase-associated prote...    154   2e-39    
ref|XP_010177476.1|  PREDICTED: adenylyl cyclase-associated prote...    154   2e-39    
ref|XP_004939698.1|  PREDICTED: adenylyl cyclase-associated prote...    153   2e-39    
dbj|BAG60395.1|  unnamed protein product                                152   2e-39    
ref|XP_008999210.1|  PREDICTED: adenylyl cyclase-associated prote...    154   2e-39    
ref|XP_009896390.1|  PREDICTED: adenylyl cyclase-associated prote...    154   2e-39    
ref|XP_011833044.1|  PREDICTED: adenylyl cyclase-associated prote...    154   2e-39    
ref|XP_005234222.1|  PREDICTED: LOW QUALITY PROTEIN: adenylyl cyc...    154   2e-39    
ref|XP_005084392.1|  PREDICTED: adenylyl cyclase-associated prote...    154   2e-39    
ref|XP_004450686.1|  PREDICTED: adenylyl cyclase-associated prote...    154   2e-39    
ref|XP_008420222.1|  PREDICTED: adenylyl cyclase-associated prote...    154   2e-39    
ref|XP_009940308.1|  PREDICTED: adenylyl cyclase-associated prote...    154   2e-39    
ref|XP_004365154.1|  adenylyl cyclase-associated protein                154   2e-39    
ref|XP_009978742.1|  PREDICTED: adenylyl cyclase-associated prote...    154   2e-39    
ref|XP_010158245.1|  PREDICTED: adenylyl cyclase-associated prote...    154   2e-39    
gb|KFR16528.1|  Adenylyl cyclase-associated protein 1                   153   2e-39    
ref|XP_007950166.1|  PREDICTED: adenylyl cyclase-associated prote...    152   2e-39    
gb|EHH17975.1|  Adenylyl cyclase-associated protein 2                   154   2e-39    
gb|KFM05524.1|  Adenylyl cyclase-associated protein 1                   153   2e-39    
ref|XP_006135247.1|  PREDICTED: adenylyl cyclase-associated prote...    153   2e-39    
ref|XP_008710219.1|  PREDICTED: adenylyl cyclase-associated prote...    154   2e-39    
ref|XP_010137301.1|  PREDICTED: adenylyl cyclase-associated prote...    153   2e-39    
ref|NP_001253461.1|  adenylyl cyclase-associated protein 2              153   2e-39    
ref|XP_008710220.1|  PREDICTED: adenylyl cyclase-associated prote...    154   2e-39    
gb|KFW72840.1|  Adenylyl cyclase-associated protein 1                   153   2e-39    
ref|XP_418936.2|  PREDICTED: adenylyl cyclase-associated protein ...    154   2e-39    
ref|XP_011822974.1|  PREDICTED: adenylyl cyclase-associated prote...    152   2e-39    
ref|XP_009579010.1|  PREDICTED: adenylyl cyclase-associated prote...    150   2e-39    
ref|XP_009274522.1|  PREDICTED: adenylyl cyclase-associated prote...    153   2e-39    
ref|XP_007971801.1|  PREDICTED: adenylyl cyclase-associated prote...    153   2e-39    
gb|KFW07509.1|  Adenylyl cyclase-associated protein 2                   150   2e-39    
ref|XP_003799030.1|  PREDICTED: adenylyl cyclase-associated prote...    153   2e-39    
gb|EDL30399.1|  CAP, adenylate cyclase-associated protein 1 (yeas...    154   2e-39    
ref|XP_010351029.1|  PREDICTED: adenylyl cyclase-associated prote...    153   2e-39    
ref|XP_003799029.1|  PREDICTED: adenylyl cyclase-associated prote...    153   2e-39    
dbj|BAH11460.1|  unnamed protein product                                152   3e-39    
gb|EDL30398.1|  CAP, adenylate cyclase-associated protein 1 (yeas...    153   3e-39    
dbj|BAG60379.1|  unnamed protein product                                152   3e-39    
gb|KFP10856.1|  Adenylyl cyclase-associated protein 1                   153   3e-39    
ref|XP_007971800.1|  PREDICTED: adenylyl cyclase-associated prote...    153   3e-39    
ref|XP_004882922.1|  PREDICTED: adenylyl cyclase-associated prote...    153   3e-39    
ref|XP_009330424.1|  PREDICTED: adenylyl cyclase-associated prote...    153   3e-39    
ref|XP_009473692.1|  PREDICTED: adenylyl cyclase-associated prote...    153   3e-39    
ref|XP_010303131.1|  PREDICTED: adenylyl cyclase-associated prote...    153   3e-39    
ref|XP_010070712.1|  PREDICTED: adenylyl cyclase-associated prote...    153   3e-39    
ref|XP_008975022.1|  PREDICTED: adenylyl cyclase-associated prote...    153   3e-39    
ref|XP_004847694.1|  PREDICTED: adenylyl cyclase-associated prote...    153   3e-39    
ref|XP_011935796.1|  PREDICTED: adenylyl cyclase-associated prote...    153   3e-39    
gb|KFQ23722.1|  Adenylyl cyclase-associated protein 2                   150   3e-39    
ref|XP_009506252.1|  PREDICTED: adenylyl cyclase-associated prote...    153   3e-39    
sp|Q5R5X8.1|CAP2_PONAB  RecName: Full=Adenylyl cyclase-associated...    153   3e-39    
ref|XP_004678899.1|  PREDICTED: adenylyl cyclase-associated prote...    153   3e-39    
ref|NP_001125913.1|  adenylyl cyclase-associated protein 2              153   3e-39    
ref|XP_011886788.1|  PREDICTED: adenylyl cyclase-associated prote...    152   3e-39    
gb|KFP72797.1|  Adenylyl cyclase-associated protein 1                   152   3e-39    
gb|EMP40380.1|  Adenylyl cyclase-associated protein 2                   153   3e-39    
gb|KFP28229.1|  Adenylyl cyclase-associated protein 2                   152   3e-39    
dbj|BAG62510.1|  unnamed protein product                                152   3e-39    
ref|NP_001082639.1|  CAP, adenylate cyclase-associated protein 1        153   3e-39    
ref|XP_004678898.1|  PREDICTED: adenylyl cyclase-associated prote...    153   3e-39    
ref|XP_010137300.1|  PREDICTED: adenylyl cyclase-associated prote...    153   3e-39    
ref|XP_003263593.1|  PREDICTED: adenylyl cyclase-associated prote...    152   3e-39    
ref|XP_001661940.1|  AAEL011821-PB                                      147   3e-39    
ref|XP_003799027.1|  PREDICTED: adenylyl cyclase-associated prote...    153   3e-39    
gb|KKA74357.1|  cas-1                                                   146   3e-39    
ref|XP_003815466.1|  PREDICTED: adenylyl cyclase-associated prote...    153   3e-39    
ref|XP_011886786.1|  PREDICTED: adenylyl cyclase-associated prote...    153   3e-39    
ref|XP_010207456.1|  PREDICTED: adenylyl cyclase-associated prote...    153   3e-39    
dbj|BAC33131.1|  unnamed protein product                                152   4e-39    
ref|XP_003799026.1|  PREDICTED: adenylyl cyclase-associated prote...    153   4e-39    
ref|XP_005310018.1|  PREDICTED: adenylyl cyclase-associated prote...    153   4e-39    
dbj|BAG60165.1|  unnamed protein product                                152   4e-39    
ref|XP_008920531.1|  PREDICTED: adenylyl cyclase-associated prote...    153   4e-39    
ref|XP_007054937.1|  PREDICTED: LOW QUALITY PROTEIN: adenylyl cyc...    153   4e-39    
ref|XP_009070213.1|  PREDICTED: adenylyl cyclase-associated prote...    153   4e-39    
ref|XP_009084584.1|  PREDICTED: adenylyl cyclase-associated prote...    153   4e-39    
gb|AAA41579.1|  cyclase-associated protein                              153   4e-39    
ref|XP_009964312.1|  PREDICTED: LOW QUALITY PROTEIN: adenylyl cyc...    152   4e-39    
gb|KFQ77825.1|  Adenylyl cyclase-associated protein 1                   152   4e-39    
ref|XP_005525331.1|  PREDICTED: adenylyl cyclase-associated prote...    152   4e-39    
ref|XP_006194353.1|  PREDICTED: adenylyl cyclase-associated prote...    152   4e-39    
ref|XP_005421039.1|  PREDICTED: adenylyl cyclase-associated prote...    153   4e-39    
ref|XP_003263591.1|  PREDICTED: adenylyl cyclase-associated prote...    153   4e-39    
ref|XP_009473691.1|  PREDICTED: adenylyl cyclase-associated prote...    153   4e-39    
ref|XP_008966632.1|  PREDICTED: adenylyl cyclase-associated prote...    152   4e-39    
ref|XP_005041627.1|  PREDICTED: adenylyl cyclase-associated prote...    152   4e-39    
ref|XP_007067663.1|  PREDICTED: adenylyl cyclase-associated prote...    152   4e-39    
gb|KFP03456.1|  Adenylyl cyclase-associated protein 2                   152   4e-39    
ref|XP_005140144.1|  PREDICTED: adenylyl cyclase-associated prote...    152   4e-39    
ref|XP_006631262.1|  PREDICTED: adenylyl cyclase-associated prote...    152   5e-39    
gb|KFW79612.1|  Adenylyl cyclase-associated protein 2                   152   5e-39    
ref|XP_006631263.1|  PREDICTED: adenylyl cyclase-associated prote...    152   5e-39    
ref|XP_009999246.1|  PREDICTED: adenylyl cyclase-associated prote...    152   5e-39    
ref|XP_004043357.1|  PREDICTED: adenylyl cyclase-associated prote...    152   5e-39    
ref|XP_007950159.1|  PREDICTED: adenylyl cyclase-associated prote...    152   5e-39    
gb|KFO91515.1|  Adenylyl cyclase-associated protein 2                   152   5e-39    
ref|XP_009917477.1|  PREDICTED: adenylyl cyclase-associated prote...    152   5e-39    
ref|XP_535897.2|  PREDICTED: adenylyl cyclase-associated protein ...    152   5e-39    
ref|NP_006358.1|  adenylyl cyclase-associated protein 1                 152   5e-39    
ref|XP_006758034.1|  PREDICTED: adenylyl cyclase-associated prote...    152   5e-39    
gb|AAP36887.1|  Homo sapiens adenylyl cyclase-associated protein        152   5e-39    
gb|KFR03498.1|  Adenylyl cyclase-associated protein 1                   152   5e-39    
ref|XP_010185166.1|  PREDICTED: adenylyl cyclase-associated prote...    150   5e-39    
dbj|BAG38086.1|  unnamed protein product                                152   5e-39    
dbj|BAG58350.1|  unnamed protein product                                152   5e-39    
dbj|BAD96233.1|  adenylyl cyclase-associated protein variant            152   5e-39    
ref|XP_007950151.1|  PREDICTED: adenylyl cyclase-associated prote...    152   5e-39    
ref|XP_005797412.1|  PREDICTED: adenylyl cyclase-associated prote...    152   5e-39    
ref|XP_011512535.1|  PREDICTED: adenylyl cyclase-associated prote...    152   5e-39    
gb|EAX07240.1|  CAP, adenylate cyclase-associated protein 1 (yeas...    152   5e-39    
ref|XP_003204773.1|  PREDICTED: adenylyl cyclase-associated prote...    152   5e-39    
ref|XP_011538813.1|  PREDICTED: adenylyl cyclase-associated prote...    152   5e-39    
ref|XP_009452975.1|  PREDICTED: adenylyl cyclase-associated prote...    152   5e-39    
ref|XP_009499806.1|  PREDICTED: adenylyl cyclase-associated prote...    152   5e-39    
ref|XP_005868717.1|  PREDICTED: adenylyl cyclase-associated prote...    152   5e-39    
ref|XP_009882473.1|  PREDICTED: adenylyl cyclase-associated prote...    152   5e-39    
ref|XP_005270425.1|  PREDICTED: adenylyl cyclase-associated prote...    152   6e-39    
ref|XP_009636246.1|  PREDICTED: adenylyl cyclase-associated prote...    152   6e-39    
ref|XP_004025576.1|  PREDICTED: adenylyl cyclase-associated prote...    152   6e-39    
ref|XP_001170339.2|  PREDICTED: adenylyl cyclase-associated prote...    152   6e-39    
dbj|BAH12609.1|  unnamed protein product                                152   6e-39    
ref|XP_005512594.1|  PREDICTED: adenylyl cyclase-associated prote...    152   6e-39    
ref|XP_008495361.1|  PREDICTED: adenylyl cyclase-associated prote...    152   6e-39    
ref|XP_005797413.1|  PREDICTED: adenylyl cyclase-associated prote...    152   6e-39    
ref|XP_008149406.1|  PREDICTED: adenylyl cyclase-associated prote...    152   6e-39    
ref|XP_005355164.1|  PREDICTED: adenylyl cyclase-associated prote...    152   6e-39    
ref|XP_010175819.1|  PREDICTED: adenylyl cyclase-associated prote...    152   6e-39    
dbj|BAE42104.1|  unnamed protein product                                152   6e-39    
ref|XP_009636245.1|  PREDICTED: adenylyl cyclase-associated prote...    152   6e-39    
ref|XP_009917476.1|  PREDICTED: adenylyl cyclase-associated prote...    152   6e-39    
gb|KFZ51904.1|  Adenylyl cyclase-associated protein 2                   152   7e-39    
ref|XP_010175820.1|  PREDICTED: adenylyl cyclase-associated prote...    152   7e-39    
ref|XP_005434963.1|  PREDICTED: adenylyl cyclase-associated prote...    152   7e-39    
ref|XP_003642632.1|  PREDICTED: adenylyl cyclase-associated prote...    153   7e-39    
ref|XP_001661939.1|  AAEL011821-PA                                      147   7e-39    
ref|XP_010871844.1|  PREDICTED: adenylyl cyclase-associated prote...    152   7e-39    
gb|AAX29556.1|  adenylate cyclase-associated protein 2                  152   7e-39    
ref|XP_009499805.1|  PREDICTED: adenylyl cyclase-associated prote...    152   7e-39    
ref|XP_004740745.1|  PREDICTED: adenylyl cyclase-associated prote...    152   7e-39    
ref|XP_001170453.1|  PREDICTED: adenylyl cyclase-associated prote...    152   7e-39    
ref|XP_009870634.1|  PREDICTED: adenylyl cyclase-associated prote...    152   7e-39    
gb|EPQ09246.1|  Adenylyl cyclase-associated protein 1                   153   7e-39    
ref|XP_006031609.1|  PREDICTED: adenylyl cyclase-associated prote...    152   7e-39    
ref|XP_005235119.1|  PREDICTED: adenylyl cyclase-associated prote...    152   7e-39    
ref|XP_009882472.1|  PREDICTED: adenylyl cyclase-associated prote...    152   7e-39    
ref|XP_009469078.1|  PREDICTED: adenylyl cyclase-associated prote...    152   7e-39    
gb|ABM92205.1|  CAP, adenylate cyclase-associated protein, 2 (yeast)    152   7e-39    
ref|XP_006273113.1|  PREDICTED: adenylyl cyclase-associated prote...    152   7e-39    
ref|NP_006357.1|  adenylyl cyclase-associated protein 2                 152   7e-39    
ref|XP_001376362.1|  PREDICTED: adenylyl cyclase-associated prote...    152   7e-39    
ref|XP_006098199.1|  PREDICTED: adenylyl cyclase-associated prote...    152   8e-39    
ref|XP_003416506.1|  PREDICTED: adenylyl cyclase-associated prote...    152   8e-39    
ref|XP_005525330.1|  PREDICTED: adenylyl cyclase-associated prote...    152   8e-39    
ref|XP_005013074.1|  PREDICTED: adenylyl cyclase-associated prote...    152   8e-39    
ref|XP_006098198.1|  PREDICTED: adenylyl cyclase-associated prote...    152   8e-39    
gb|ELK34614.1|  Adenylyl cyclase-associated protein 1                   152   8e-39    
ref|NP_080332.1|  adenylyl cyclase-associated protein 2                 152   8e-39    
gb|EOB06115.1|  Adenylyl cyclase-associated protein 1                   152   8e-39    



>gb|KDO49088.1| hypothetical protein CISIN_1g016407mg [Citrus sinensis]
Length=390

 Score =   357 bits (916),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 165/193 (85%), Positives = 178/193 (92%), Gaps = 0/193 (0%)
 Frame = -3

Query  812  DMKTKNRADRSGIVGASEKEGRVSSPSFSKAGPPKLELQMGRKWVVENQIGKKNLVIDDC  633
            DMKTKNRADRSG+V A EKE R SSPSFSKAGPPKLELQMGRKWVVENQIG+KNLVIDDC
Sbjct  198  DMKTKNRADRSGVVAAGEKESRTSSPSFSKAGPPKLELQMGRKWVVENQIGRKNLVIDDC  257

Query  632  DAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGVA  453
            DAKQSVY+FGCKDSVLQIQGKVNNITIDKCTKMGVVF DVVAAFE+VNC+GVE QCQG A
Sbjct  258  DAKQSVYVFGCKDSVLQIQGKVNNITIDKCTKMGVVFKDVVAAFEIVNCNGVEAQCQGSA  317

Query  452  PTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQYIHVYKD  273
            PTISVDNT GC LYLS+DSL ASITTAKSSE+N+LVPGAGPD+DW EHALPQQ++H YKD
Sbjct  318  PTISVDNTGGCQLYLSQDSLGASITTAKSSEINVLVPGAGPDSDWAEHALPQQFVHTYKD  377

Query  272  GQFITSPATHSGG  234
            G F T+P +HSGG
Sbjct  378  GHFETTPVSHSGG  390



>ref|XP_003631649.1| PREDICTED: cyclase-associated protein 1 [Vitis vinifera]
 emb|CBI32583.3| unnamed protein product [Vitis vinifera]
Length=472

 Score =   360 bits (923),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 166/194 (86%), Positives = 184/194 (95%), Gaps = 0/194 (0%)
 Frame = -3

Query  815  NDMKTKNRADRSGIVGASEKEGRVSSPSFSKAGPPKLELQMGRKWVVENQIGKKNLVIDD  636
            +DMKTKNRADRSG+VGA +KEGRVSSPSFSKAGPPKLELQMGRKWVVENQIG+KNLVIDD
Sbjct  279  DDMKTKNRADRSGVVGAGQKEGRVSSPSFSKAGPPKLELQMGRKWVVENQIGRKNLVIDD  338

Query  635  CDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGV  456
            CDAKQSVY++GCKDSVL+IQGKVNNITIDKCTKMG+VF+DVVAA EVVNC+ VEVQCQG 
Sbjct  339  CDAKQSVYVYGCKDSVLKIQGKVNNITIDKCTKMGIVFADVVAACEVVNCNSVEVQCQGS  398

Query  455  APTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQYIHVYK  276
            APTISVDNT+GC LYL KD+LEASITTAKSSE+N+LVPGA PD DW EHALPQQYIHV+K
Sbjct  399  APTISVDNTAGCQLYLGKDALEASITTAKSSEINVLVPGAEPDGDWGEHALPQQYIHVFK  458

Query  275  DGQFITSPATHSGG  234
            DGQF+T+P +HSGG
Sbjct  459  DGQFVTTPVSHSGG  472



>ref|XP_006423253.1| hypothetical protein CICLE_v10028340mg [Citrus clementina]
 ref|XP_006487151.1| PREDICTED: cyclase-associated protein 1-like [Citrus sinensis]
 gb|ESR36493.1| hypothetical protein CICLE_v10028340mg [Citrus clementina]
Length=479

 Score =   358 bits (920),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 165/193 (85%), Positives = 178/193 (92%), Gaps = 0/193 (0%)
 Frame = -3

Query  812  DMKTKNRADRSGIVGASEKEGRVSSPSFSKAGPPKLELQMGRKWVVENQIGKKNLVIDDC  633
            DMKTKNRADRSG+V A EKE R SSPSFSKAGPPKLELQMGRKWVVENQIG+KNLVIDDC
Sbjct  287  DMKTKNRADRSGVVAAGEKESRTSSPSFSKAGPPKLELQMGRKWVVENQIGRKNLVIDDC  346

Query  632  DAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGVA  453
            DAKQSVY+FGCKDSVLQIQGKVNNITIDKCTKMGVVF DVVAAFE+VNC+GVE QCQG A
Sbjct  347  DAKQSVYVFGCKDSVLQIQGKVNNITIDKCTKMGVVFKDVVAAFEIVNCNGVEAQCQGSA  406

Query  452  PTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQYIHVYKD  273
            PTISVDNT GC LYLS+DSL ASITTAKSSE+N+LVPGAGPD+DW EHALPQQ++H YKD
Sbjct  407  PTISVDNTGGCQLYLSQDSLGASITTAKSSEINVLVPGAGPDSDWAEHALPQQFVHTYKD  466

Query  272  GQFITSPATHSGG  234
            G F T+P +HSGG
Sbjct  467  GHFETTPVSHSGG  479



>ref|XP_006349606.1| PREDICTED: adenylyl cyclase-associated protein 1-like [Solanum 
tuberosum]
Length=471

 Score =   358 bits (919),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 168/194 (87%), Positives = 183/194 (94%), Gaps = 0/194 (0%)
 Frame = -3

Query  815  NDMKTKNRADRSGIVGASEKEGRVSSPSFSKAGPPKLELQMGRKWVVENQIGKKNLVIDD  636
            +DMKTKNRADR+G++ A EKE RVSSPSFSKAGPPKLELQMGRKWVVENQIG+KNLVIDD
Sbjct  278  DDMKTKNRADRTGVISAGEKERRVSSPSFSKAGPPKLELQMGRKWVVENQIGRKNLVIDD  337

Query  635  CDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGV  456
            CDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAA EVVNC+GVEVQCQG 
Sbjct  338  CDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAACEVVNCNGVEVQCQGS  397

Query  455  APTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQYIHVYK  276
            APTISVDNT+GC LYLSKDSLE SITTAKSSE+N+LVPGAG D+DW EHALPQQ+ HVYK
Sbjct  398  APTISVDNTTGCQLYLSKDSLETSITTAKSSEINVLVPGAGADSDWGEHALPQQFSHVYK  457

Query  275  DGQFITSPATHSGG  234
            +GQF+T+P +HSGG
Sbjct  458  NGQFVTTPVSHSGG  471



>ref|XP_004248719.1| PREDICTED: cyclase-associated protein 1 [Solanum lycopersicum]
Length=471

 Score =   355 bits (910),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 167/194 (86%), Positives = 181/194 (93%), Gaps = 0/194 (0%)
 Frame = -3

Query  815  NDMKTKNRADRSGIVGASEKEGRVSSPSFSKAGPPKLELQMGRKWVVENQIGKKNLVIDD  636
            +DMKTKNRADR+G++ A EKE RVSSPSFSKAGPPKLELQMGRKWVVENQIG+KNLVIDD
Sbjct  278  DDMKTKNRADRTGVISAGEKERRVSSPSFSKAGPPKLELQMGRKWVVENQIGRKNLVIDD  337

Query  635  CDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGV  456
            CDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAA EVVNC+GVEVQCQG 
Sbjct  338  CDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAACEVVNCNGVEVQCQGS  397

Query  455  APTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQYIHVYK  276
            APTISVDNT+GC LYLSKDSL  SITTAKSSE+N+LVPGAG D+DW EHALPQQ+ HVYK
Sbjct  398  APTISVDNTTGCQLYLSKDSLGTSITTAKSSEINVLVPGAGADSDWGEHALPQQFSHVYK  457

Query  275  DGQFITSPATHSGG  234
             GQF+T+P +HSGG
Sbjct  458  SGQFVTTPVSHSGG  471



>ref|XP_009775243.1| PREDICTED: cyclase-associated protein 1-like [Nicotiana sylvestris]
Length=474

 Score =   354 bits (909),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 166/194 (86%), Positives = 180/194 (93%), Gaps = 0/194 (0%)
 Frame = -3

Query  815  NDMKTKNRADRSGIVGASEKEGRVSSPSFSKAGPPKLELQMGRKWVVENQIGKKNLVIDD  636
            +DMKTKNRADR+G++ A  KEGRVSSPSFSKAGPPKLELQMGRKWVVEN IGKKNLVIDD
Sbjct  281  DDMKTKNRADRTGVISAGGKEGRVSSPSFSKAGPPKLELQMGRKWVVENHIGKKNLVIDD  340

Query  635  CDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGV  456
            CDAKQSVYIFGCKDSVLQIQGKVNNIT+DKCTKMGVVF DVVAA EVVNC+GVEVQCQG 
Sbjct  341  CDAKQSVYIFGCKDSVLQIQGKVNNITVDKCTKMGVVFMDVVAACEVVNCNGVEVQCQGS  400

Query  455  APTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQYIHVYK  276
            APTISVDNT+GC LYLS  SLE SITTAKSSE+N+LVPGAGPD+DW EHALPQQ+ HVYK
Sbjct  401  APTISVDNTTGCQLYLSNGSLETSITTAKSSEINVLVPGAGPDSDWGEHALPQQFSHVYK  460

Query  275  DGQFITSPATHSGG  234
            DGQF+T+P +HSGG
Sbjct  461  DGQFVTTPVSHSGG  474



>ref|XP_012069926.1| PREDICTED: cyclase-associated protein 1 [Jatropha curcas]
 ref|XP_012069932.1| PREDICTED: cyclase-associated protein 1 [Jatropha curcas]
 gb|KDP46247.1| hypothetical protein JCGZ_10087 [Jatropha curcas]
Length=474

 Score =   352 bits (902),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 162/193 (84%), Positives = 178/193 (92%), Gaps = 0/193 (0%)
 Frame = -3

Query  812  DMKTKNRADRSGIVGASEKEGRVSSPSFSKAGPPKLELQMGRKWVVENQIGKKNLVIDDC  633
            DMKTKNRADR+G+VGASEK  RVSSPSFSKAGPPKLELQMGRKW VENQ+GKKNLVID+C
Sbjct  282  DMKTKNRADRTGVVGASEKAARVSSPSFSKAGPPKLELQMGRKWAVENQVGKKNLVIDNC  341

Query  632  DAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGVA  453
            DAKQSVY+FGCKDSVLQI+GKVNNIT+DKCTKMGV+F+DVVAAFE+VNCS VEVQCQG A
Sbjct  342  DAKQSVYVFGCKDSVLQIKGKVNNITVDKCTKMGVLFTDVVAAFEIVNCSSVEVQCQGSA  401

Query  452  PTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQYIHVYKD  273
            PTIS+DNT GC LYLSKDSL  SITTAKSSEVN+LVPGA PD DW EHALPQQYIH++KD
Sbjct  402  PTISIDNTGGCQLYLSKDSLGGSITTAKSSEVNVLVPGAQPDGDWVEHALPQQYIHLFKD  461

Query  272  GQFITSPATHSGG  234
            G F T+P +HSGG
Sbjct  462  GHFETTPVSHSGG  474



>ref|XP_002306100.1| cyclase associated protein 1 [Populus trichocarpa]
 gb|EEE86611.1| cyclase associated protein 1 [Populus trichocarpa]
Length=466

 Score =   350 bits (899),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 166/194 (86%), Positives = 179/194 (92%), Gaps = 0/194 (0%)
 Frame = -3

Query  815  NDMKTKNRADRSGIVGASEKEGRVSSPSFSKAGPPKLELQMGRKWVVENQIGKKNLVIDD  636
            ++MKTKNRADR+G+VGASEKE R SSPSFSKAGPPKLELQMGRKWVVENQIG+KNLVIDD
Sbjct  273  DNMKTKNRADRTGVVGASEKESRTSSPSFSKAGPPKLELQMGRKWVVENQIGRKNLVIDD  332

Query  635  CDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGV  456
            CDAKQSVYIFGCKDSVLQ+QGKVNNITIDKCTKMGVVF+DVVAA E+VNCSGVEVQCQG 
Sbjct  333  CDAKQSVYIFGCKDSVLQVQGKVNNITIDKCTKMGVVFTDVVAACEIVNCSGVEVQCQGS  392

Query  455  APTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQYIHVYK  276
            APTISVDNT GC LYLSK SL ASITTAKSSE+NILVPGA PD D  EHALPQQ+IH +K
Sbjct  393  APTISVDNTGGCQLYLSKGSLGASITTAKSSEINILVPGAEPDGDLVEHALPQQFIHTFK  452

Query  275  DGQFITSPATHSGG  234
            DGQF T+P +HSGG
Sbjct  453  DGQFETTPVSHSGG  466



>gb|KCW55347.1| hypothetical protein EUGRSUZ_I01265 [Eucalyptus grandis]
Length=427

 Score =   348 bits (894),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 160/193 (83%), Positives = 179/193 (93%), Gaps = 0/193 (0%)
 Frame = -3

Query  812  DMKTKNRADRSGIVGASEKEGRVSSPSFSKAGPPKLELQMGRKWVVENQIGKKNLVIDDC  633
            DMKTKNR DR+G+VGA EKE R +SPSFSKAGPPKLEL MGRKW VENQIGKKNLVIDDC
Sbjct  235  DMKTKNRTDRTGVVGAGEKECRTASPSFSKAGPPKLELLMGRKWAVENQIGKKNLVIDDC  294

Query  632  DAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGVA  453
            D+KQ+VY+FGCKDSVLQIQGKVNNIT+DKCTKMG+VF+DVVAA E+VNC+GVEVQCQG A
Sbjct  295  DSKQTVYVFGCKDSVLQIQGKVNNITVDKCTKMGIVFTDVVAACEIVNCNGVEVQCQGSA  354

Query  452  PTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQYIHVYKD  273
            PTISVDNT+GC LYLSKDSL ASITTAKSSE+N+LVPGA PD+DW EH+LPQQYIH YKD
Sbjct  355  PTISVDNTAGCQLYLSKDSLGASITTAKSSEINVLVPGAEPDSDWAEHSLPQQYIHAYKD  414

Query  272  GQFITSPATHSGG  234
            GQF+T+P +HSGG
Sbjct  415  GQFVTTPVSHSGG  427



>ref|XP_010028583.1| PREDICTED: LOW QUALITY PROTEIN: cyclase-associated protein 1 
[Eucalyptus grandis]
Length=477

 Score =   349 bits (896),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 160/193 (83%), Positives = 179/193 (93%), Gaps = 0/193 (0%)
 Frame = -3

Query  812  DMKTKNRADRSGIVGASEKEGRVSSPSFSKAGPPKLELQMGRKWVVENQIGKKNLVIDDC  633
            DMKTKNR DR+G+VGA EKE R +SPSFSKAGPPKLEL MGRKW VENQIGKKNLVIDDC
Sbjct  285  DMKTKNRTDRTGVVGAGEKECRTASPSFSKAGPPKLELLMGRKWAVENQIGKKNLVIDDC  344

Query  632  DAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGVA  453
            D+KQ+VY+FGCKDSVLQIQGKVNNIT+DKCTKMG+VF+DVVAA E+VNC+GVEVQCQG A
Sbjct  345  DSKQTVYVFGCKDSVLQIQGKVNNITVDKCTKMGIVFTDVVAACEIVNCNGVEVQCQGSA  404

Query  452  PTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQYIHVYKD  273
            PTISVDNT+GC LYLSKDSL ASITTAKSSE+N+LVPGA PD+DW EH+LPQQYIH YKD
Sbjct  405  PTISVDNTAGCQLYLSKDSLGASITTAKSSEINVLVPGAEPDSDWAEHSLPQQYIHAYKD  464

Query  272  GQFITSPATHSGG  234
            GQF+T+P +HSGG
Sbjct  465  GQFVTTPVSHSGG  477



>ref|XP_011037533.1| PREDICTED: cyclase-associated protein 1-like [Populus euphratica]
Length=466

 Score =   348 bits (892),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 164/194 (85%), Positives = 179/194 (92%), Gaps = 0/194 (0%)
 Frame = -3

Query  815  NDMKTKNRADRSGIVGASEKEGRVSSPSFSKAGPPKLELQMGRKWVVENQIGKKNLVIDD  636
            ++MKTKNRADR+G+VGASEKE R SSPSFSKAGPPKLELQMGRKWVVENQIG+KNLVID+
Sbjct  273  DNMKTKNRADRTGVVGASEKESRTSSPSFSKAGPPKLELQMGRKWVVENQIGRKNLVIDE  332

Query  635  CDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGV  456
            CDAKQSVYIFGCKDSVLQ+QGKVNNITIDKCTKMGVVF+DVVAA E+VNCSGVEVQCQG 
Sbjct  333  CDAKQSVYIFGCKDSVLQVQGKVNNITIDKCTKMGVVFTDVVAACEIVNCSGVEVQCQGS  392

Query  455  APTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQYIHVYK  276
            APTISVDNT GC LYLSK SL ASITTAKSSE+N+LVPGA PD D  EHALPQQ+IH +K
Sbjct  393  APTISVDNTGGCQLYLSKGSLGASITTAKSSEINVLVPGAEPDGDLVEHALPQQFIHTFK  452

Query  275  DGQFITSPATHSGG  234
            DGQF T+P +HSGG
Sbjct  453  DGQFETTPVSHSGG  466



>ref|XP_009619104.1| PREDICTED: cyclase-associated protein 1-like [Nicotiana tomentosiformis]
Length=474

 Score =   347 bits (890),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 163/194 (84%), Positives = 179/194 (92%), Gaps = 0/194 (0%)
 Frame = -3

Query  815  NDMKTKNRADRSGIVGASEKEGRVSSPSFSKAGPPKLELQMGRKWVVENQIGKKNLVIDD  636
            +DMKTKN ADR+G++ A  KEG VSSPSFSKAGPPKLELQMGRKWVVEN IGKKNLVIDD
Sbjct  281  DDMKTKNWADRTGVISAGGKEGHVSSPSFSKAGPPKLELQMGRKWVVENHIGKKNLVIDD  340

Query  635  CDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGV  456
            CDAKQSVYIFGCKDSVLQIQGKVNNIT+DKCTKMGVVF+DVVAA EVVNC+GVEVQCQG 
Sbjct  341  CDAKQSVYIFGCKDSVLQIQGKVNNITVDKCTKMGVVFTDVVAACEVVNCNGVEVQCQGS  400

Query  455  APTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQYIHVYK  276
            APTISVDNT+GC LYLSK SLE SITTAKSSE+N+LVP AGPD+DW EHALPQQ+ HVYK
Sbjct  401  APTISVDNTTGCQLYLSKGSLETSITTAKSSEINVLVPDAGPDSDWGEHALPQQFSHVYK  460

Query  275  DGQFITSPATHSGG  234
            +GQF+T+P +HSGG
Sbjct  461  NGQFVTTPVSHSGG  474



>ref|XP_011048631.1| PREDICTED: cyclase-associated protein 1-like [Populus euphratica]
Length=472

 Score =   346 bits (888),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 162/194 (84%), Positives = 178/194 (92%), Gaps = 0/194 (0%)
 Frame = -3

Query  815  NDMKTKNRADRSGIVGASEKEGRVSSPSFSKAGPPKLELQMGRKWVVENQIGKKNLVIDD  636
            +D+KTKNRADR+G+V  ++KEGR S+PSFSKAGPPKLELQMGRKWVVENQIGKKNLVIDD
Sbjct  279  DDLKTKNRADRTGVVAVTKKEGRASAPSFSKAGPPKLELQMGRKWVVENQIGKKNLVIDD  338

Query  635  CDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGV  456
            CDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMG+VF+DVVAA E+VNCSGVEVQCQG 
Sbjct  339  CDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGIVFTDVVAACEIVNCSGVEVQCQGS  398

Query  455  APTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQYIHVYK  276
            APTISVDNT GC LYLSKDSL ASITTAKSSE+N+LVPGA P  D  EHALPQQ+IH +K
Sbjct  399  APTISVDNTGGCQLYLSKDSLGASITTAKSSEINVLVPGAEPGGDLAEHALPQQFIHAFK  458

Query  275  DGQFITSPATHSGG  234
            DGQF T+P +HSGG
Sbjct  459  DGQFETTPVSHSGG  472



>ref|XP_002313050.2| cyclase associated protein 1 [Populus trichocarpa]
 gb|EEE87005.2| cyclase associated protein 1 [Populus trichocarpa]
Length=468

 Score =   345 bits (886),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 162/194 (84%), Positives = 177/194 (91%), Gaps = 0/194 (0%)
 Frame = -3

Query  815  NDMKTKNRADRSGIVGASEKEGRVSSPSFSKAGPPKLELQMGRKWVVENQIGKKNLVIDD  636
            +DMKTKNRADR+G+V  +EK GR S+PSFSKAGPPKLELQMGRKWVVENQIGKKNLVIDD
Sbjct  275  DDMKTKNRADRTGVVAVTEKGGRASAPSFSKAGPPKLELQMGRKWVVENQIGKKNLVIDD  334

Query  635  CDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGV  456
            CDAKQSVY+FGCKDSVLQIQGKVNNITIDKCTKMGVVF+DVVAA E+VNC+GVEVQCQG 
Sbjct  335  CDAKQSVYVFGCKDSVLQIQGKVNNITIDKCTKMGVVFTDVVAACEIVNCTGVEVQCQGS  394

Query  455  APTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQYIHVYK  276
            APTISVDNT GC LYLSKDSL ASITTAKSSE+N+LVPGA P  D  EHALPQQ+IH +K
Sbjct  395  APTISVDNTGGCQLYLSKDSLGASITTAKSSEINVLVPGAEPGGDLAEHALPQQFIHAFK  454

Query  275  DGQFITSPATHSGG  234
            DGQF T+P +HSGG
Sbjct  455  DGQFETTPVSHSGG  468



>ref|XP_010254869.1| PREDICTED: cyclase-associated protein 1-like [Nelumbo nucifera]
Length=475

 Score =   343 bits (881),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 157/194 (81%), Positives = 179/194 (92%), Gaps = 0/194 (0%)
 Frame = -3

Query  815  NDMKTKNRADRSGIVGASEKEGRVSSPSFSKAGPPKLELQMGRKWVVENQIGKKNLVIDD  636
            +DMKTKNRA+R+ IVG+SEK+ R SSPSFSKAGPPKLELQMGRKWVVENQIG+KNLVIDD
Sbjct  282  DDMKTKNRANRTSIVGSSEKDARTSSPSFSKAGPPKLELQMGRKWVVENQIGRKNLVIDD  341

Query  635  CDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGV  456
            CDAKQSVY+FGCKDSVLQIQGKVNNIT+DKCTKMG+VF+DVVAA E+VNC+ +E+QCQG 
Sbjct  342  CDAKQSVYVFGCKDSVLQIQGKVNNITVDKCTKMGIVFTDVVAACEIVNCNAIELQCQGS  401

Query  455  APTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQYIHVYK  276
            APTISVDNT GC LYLSK+SL ASITTAKSSE+N+LVPG G DADW EH+LPQQ++H  K
Sbjct  402  APTISVDNTGGCQLYLSKESLGASITTAKSSEINVLVPGGGLDADWVEHSLPQQFVHTLK  461

Query  275  DGQFITSPATHSGG  234
            DGQF+TSP +HSGG
Sbjct  462  DGQFVTSPVSHSGG  475



>ref|XP_004148849.1| PREDICTED: cyclase-associated protein 1-like [Cucumis sativus]
 gb|KGN61790.1| hypothetical protein Csa_2G246530 [Cucumis sativus]
Length=478

 Score =   343 bits (879),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 160/194 (82%), Positives = 177/194 (91%), Gaps = 0/194 (0%)
 Frame = -3

Query  815  NDMKTKNRADRSGIVGASEKEGRVSSPSFSKAGPPKLELQMGRKWVVENQIGKKNLVIDD  636
            +DMKTKNRADR GIVG+SEK G  +SPSFSK GPPKLELQMGRKWVVENQIG+KNLVIDD
Sbjct  285  DDMKTKNRADRVGIVGSSEKRGPTASPSFSKTGPPKLELQMGRKWVVENQIGRKNLVIDD  344

Query  635  CDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGV  456
            CDAKQSVYIFGCKDSVLQIQGKVNNIT+DKCTK+GVVF DVVAAFE+VN +GVEVQCQG 
Sbjct  345  CDAKQSVYIFGCKDSVLQIQGKVNNITVDKCTKLGVVFRDVVAAFEIVNSNGVEVQCQGS  404

Query  455  APTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQYIHVYK  276
            APTISVDNT GCLLYL+KDSL  SITTAKSSE+N+LVP AG D DW EHALPQQ+IH++K
Sbjct  405  APTISVDNTGGCLLYLNKDSLGTSITTAKSSEINVLVPDAGSDGDWVEHALPQQFIHLFK  464

Query  275  DGQFITSPATHSGG  234
            DG+F T+P +HSGG
Sbjct  465  DGRFETTPVSHSGG  478



>ref|XP_008457926.1| PREDICTED: cyclase-associated protein 1-like [Cucumis melo]
Length=478

 Score =   342 bits (878),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 159/194 (82%), Positives = 177/194 (91%), Gaps = 0/194 (0%)
 Frame = -3

Query  815  NDMKTKNRADRSGIVGASEKEGRVSSPSFSKAGPPKLELQMGRKWVVENQIGKKNLVIDD  636
            +DMKTKNRADR GIVG+SEK G  +SPSFSK GPPKLELQMGRKWVVENQIG+KNLVIDD
Sbjct  285  DDMKTKNRADRVGIVGSSEKRGPTASPSFSKTGPPKLELQMGRKWVVENQIGRKNLVIDD  344

Query  635  CDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGV  456
            CDAKQSVYIFGCKDSVLQIQGKVNNIT+DKCTK+GVVF DVVAAFE+VN +GVEVQCQG 
Sbjct  345  CDAKQSVYIFGCKDSVLQIQGKVNNITVDKCTKLGVVFRDVVAAFEIVNSNGVEVQCQGS  404

Query  455  APTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQYIHVYK  276
            APTISVDNT GCLLYL+KDSL  SITTAKSSE+N+LVP AG D DW EHALPQQ++H++K
Sbjct  405  APTISVDNTGGCLLYLNKDSLGTSITTAKSSEINVLVPDAGSDGDWVEHALPQQFVHLFK  464

Query  275  DGQFITSPATHSGG  234
            DG+F T+P +HSGG
Sbjct  465  DGRFETTPVSHSGG  478



>emb|CDO97057.1| unnamed protein product [Coffea canephora]
Length=479

 Score =   342 bits (878),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 166/201 (83%), Positives = 177/201 (88%), Gaps = 8/201 (4%)
 Frame = -3

Query  812  DMKTKNRADRSGIVGASEKEGRVSSPSFSKAGPPKLELQMGRKWVVENQIGKKNLVIDDC  633
            DMKTKNRADRSG+V A EKE  VSS SFSKAGPPKLELQMGRKWVVENQIGKKNLVIDDC
Sbjct  279  DMKTKNRADRSGVVSAGEKERGVSSSSFSKAGPPKLELQMGRKWVVENQIGKKNLVIDDC  338

Query  632  DAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFS--------DVVAAFEVVNCSGV  477
            DAKQSVYIFGCKDSVLQIQGKVNNITIDKC+KMGVVF         DVVAA E+VNC+G+
Sbjct  339  DAKQSVYIFGCKDSVLQIQGKVNNITIDKCSKMGVVFKASGRIYLIDVVAACEIVNCNGI  398

Query  476  EVQCQGVAPTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQ  297
            EVQCQG APTISVDNT GC LYLSKDSL ASITTAKSSE+N+LVPGAG D DW EHALP 
Sbjct  399  EVQCQGSAPTISVDNTGGCQLYLSKDSLGASITTAKSSEINVLVPGAGQDDDWGEHALPH  458

Query  296  QYIHVYKDGQFITSPATHSGG  234
            QY+HVYKDGQF+T+P +HSGG
Sbjct  459  QYVHVYKDGQFVTTPVSHSGG  479



>ref|XP_002509481.1| adenylyl cyclase-associated protein, putative [Ricinus communis]
 gb|EEF50868.1| adenylyl cyclase-associated protein, putative [Ricinus communis]
Length=475

 Score =   342 bits (876),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 161/194 (83%), Positives = 175/194 (90%), Gaps = 0/194 (0%)
 Frame = -3

Query  815  NDMKTKNRADRSGIVGASEKEGRVSSPSFSKAGPPKLELQMGRKWVVENQIGKKNLVIDD  636
            +DMKTKN ADR+G+VG S+K GR SSPSFSKAGPPKLELQMGRKWVVENQIG+KNLVIDD
Sbjct  282  DDMKTKNHADRTGVVGVSDKGGRTSSPSFSKAGPPKLELQMGRKWVVENQIGRKNLVIDD  341

Query  635  CDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGV  456
            CD+KQSVYI+GCKDSVLQIQGKVNNIT+DKCTKMGVVF DVVAA E+VNCSGVEVQCQG 
Sbjct  342  CDSKQSVYIYGCKDSVLQIQGKVNNITVDKCTKMGVVFLDVVAACEIVNCSGVEVQCQGS  401

Query  455  APTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQYIHVYK  276
            APTISVDNT GC LYLSKDSL ASITTAKSSE+N+LVPGA  D DW EHALPQQYIH +K
Sbjct  402  APTISVDNTGGCQLYLSKDSLRASITTAKSSEINVLVPGAESDGDWVEHALPQQYIHEFK  461

Query  275  DGQFITSPATHSGG  234
             G F T+P +HSGG
Sbjct  462  AGHFETTPVSHSGG  475



>ref|XP_006856025.1| PREDICTED: cyclase-associated protein 1 [Amborella trichopoda]
 gb|ERN17492.1| hypothetical protein AMTR_s00059p00060020 [Amborella trichopoda]
Length=473

 Score =   342 bits (876),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 158/195 (81%), Positives = 179/195 (92%), Gaps = 1/195 (1%)
 Frame = -3

Query  815  NDMKTKNRADRSGIVGASEKE-GRVSSPSFSKAGPPKLELQMGRKWVVENQIGKKNLVID  639
            ++MK+KNRADR+GIVGAS KE GR  SPSFSKAGPPKLELQMGRKW VENQIGKKNLVID
Sbjct  279  DNMKSKNRADRTGIVGASGKETGRSGSPSFSKAGPPKLELQMGRKWAVENQIGKKNLVID  338

Query  638  DCDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQG  459
            DCD+KQSVY++GCKDSVLQ++GKVNNIT+DKCTKMGVVF+DVVAA E+VNC+GVEVQCQG
Sbjct  339  DCDSKQSVYVYGCKDSVLQVKGKVNNITVDKCTKMGVVFTDVVAACEIVNCNGVEVQCQG  398

Query  458  VAPTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQYIHVY  279
            +APTISVDNT+GC LYLSKD+L  SITTAKSSE+N+L PGA  D DW EHALPQQYIH +
Sbjct  399  MAPTISVDNTAGCQLYLSKDALGTSITTAKSSEINVLTPGASSDEDWVEHALPQQYIHTF  458

Query  278  KDGQFITSPATHSGG  234
            KDGQF+TSP +HSGG
Sbjct  459  KDGQFVTSPVSHSGG  473



>ref|XP_007200993.1| hypothetical protein PRUPE_ppa005136mg [Prunus persica]
 gb|EMJ02192.1| hypothetical protein PRUPE_ppa005136mg [Prunus persica]
Length=475

 Score =   340 bits (873),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 157/194 (81%), Positives = 176/194 (91%), Gaps = 0/194 (0%)
 Frame = -3

Query  815  NDMKTKNRADRSGIVGASEKEGRVSSPSFSKAGPPKLELQMGRKWVVENQIGKKNLVIDD  636
            NDMKTKNRADR+GIVG  EKE R SSPSFSKAGPPKLELQMGRKW VENQIGKK+LVI D
Sbjct  281  NDMKTKNRADRTGIVGTQEKESRTSSPSFSKAGPPKLELQMGRKWAVENQIGKKDLVISD  340

Query  635  CDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGV  456
            CD+KQSVYIFGCKDSV+QIQGKVNNITIDKCTKMG++F+DVVAA E+VNC+ VEVQCQG 
Sbjct  341  CDSKQSVYIFGCKDSVVQIQGKVNNITIDKCTKMGILFTDVVAACEIVNCNRVEVQCQGS  400

Query  455  APTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQYIHVYK  276
            APT+SVDNT+GC  YLSKD+L ASITTAKSSEVNILVP +GPD DW EHALP+Q+IHV+K
Sbjct  401  APTVSVDNTAGCQFYLSKDALGASITTAKSSEVNILVPASGPDGDWAEHALPEQFIHVFK  460

Query  275  DGQFITSPATHSGG  234
            DG+F T+P +HS G
Sbjct  461  DGRFETTPVSHSAG  474



>gb|EYU37793.1| hypothetical protein MIMGU_mgv1a005340mg [Erythranthe guttata]
Length=488

 Score =   340 bits (873),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 155/194 (80%), Positives = 175/194 (90%), Gaps = 0/194 (0%)
 Frame = -3

Query  815  NDMKTKNRADRSGIVGASEKEGRVSSPSFSKAGPPKLELQMGRKWVVENQIGKKNLVIDD  636
            +DMKTKNRADRSG+V  +EKEGR  SP+FSK GPPKLELQMGRKWVVENQIG+ NLVIDD
Sbjct  295  DDMKTKNRADRSGVVAVAEKEGRTGSPAFSKVGPPKLELQMGRKWVVENQIGRNNLVIDD  354

Query  635  CDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGV  456
            CD+KQSVYI+GCK+SVL I+GKVNNIT+DKCTKMGVVF DVVAA E+VN SGVEVQCQG 
Sbjct  355  CDSKQSVYIYGCKNSVLHIKGKVNNITVDKCTKMGVVFKDVVAACEIVNSSGVEVQCQGS  414

Query  455  APTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQYIHVYK  276
            APTISVDNT+GC LYLSKD+LE SITTAKSSE+N+LVPG+ PD DW EHALPQQY+H YK
Sbjct  415  APTISVDNTAGCQLYLSKDALETSITTAKSSEINVLVPGSEPDGDWGEHALPQQYVHAYK  474

Query  275  DGQFITSPATHSGG  234
            DGQF+T+P +HSG 
Sbjct  475  DGQFVTTPVSHSGA  488



>gb|AEN70775.1| adenylyl cyclase-associated protein [Gossypium mustelinum]
Length=471

 Score =   339 bits (870),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 162/193 (84%), Positives = 174/193 (90%), Gaps = 1/193 (1%)
 Frame = -3

Query  812  DMKTKNRADRSGIVGASEKEGRVSSPSFSKAGPPKLELQMGRKWVVENQIGKKNLVIDDC  633
            DMKTKNR DR+G+V AS KE R SSPSFSKAGPPKLELQMGRKW VENQIG+KNLVIDDC
Sbjct  280  DMKTKNRTDRTGVVSASGKETRSSSPSFSKAGPPKLELQMGRKWAVENQIGRKNLVIDDC  339

Query  632  DAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGVA  453
            DAKQSVYI+GCKDSVLQIQGKVNNITIDKCTKMGVVF DVVAA EVVNC+GVEVQCQG A
Sbjct  340  DAKQSVYIYGCKDSVLQIQGKVNNITIDKCTKMGVVFKDVVAACEVVNCNGVEVQCQGSA  399

Query  452  PTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQYIHVYKD  273
            PTISVDNTSGC LYLSKDSL  SIT+AKSSE+N+LVP  GPD DW EH+LPQQYIHV+KD
Sbjct  400  PTISVDNTSGCQLYLSKDSLGTSITSAKSSEINVLVP-TGPDGDWGEHSLPQQYIHVFKD  458

Query  272  GQFITSPATHSGG  234
            GQF T+P +HSG 
Sbjct  459  GQFETTPVSHSGA  471



>gb|ADZ16112.1| adenylyl cyclase associated protein [Gossypium barbadense]
 gb|AEN70777.1| adenylyl cyclase-associated protein [Gossypium darwinii]
 gb|AEN70779.1| adenylyl cyclase-associated protein [Gossypium tomentosum]
 gb|AEN70783.1| adenylyl cyclase-associated protein [Gossypium barbadense var. 
peruvianum]
Length=471

 Score =   339 bits (870),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 162/193 (84%), Positives = 174/193 (90%), Gaps = 1/193 (1%)
 Frame = -3

Query  812  DMKTKNRADRSGIVGASEKEGRVSSPSFSKAGPPKLELQMGRKWVVENQIGKKNLVIDDC  633
            DMKTKNR DR+G+V AS KE R SSPSFSKAGPPKLELQMGRKW VENQIG+KNLVIDDC
Sbjct  280  DMKTKNRTDRTGVVSASGKETRSSSPSFSKAGPPKLELQMGRKWAVENQIGRKNLVIDDC  339

Query  632  DAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGVA  453
            DAKQSVYI+GCKDSVLQIQGKVNNITIDKCTKMGVVF DVVAA EVVNC+GVEVQCQG A
Sbjct  340  DAKQSVYIYGCKDSVLQIQGKVNNITIDKCTKMGVVFKDVVAACEVVNCNGVEVQCQGSA  399

Query  452  PTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQYIHVYKD  273
            PTISVDNTSGC LYLSKDSL  SIT+AKSSE+N+LVP  GPD DW EH+LPQQYIHV+KD
Sbjct  400  PTISVDNTSGCQLYLSKDSLGTSITSAKSSEINVLVP-TGPDGDWGEHSLPQQYIHVFKD  458

Query  272  GQFITSPATHSGG  234
            GQF T+P +HSG 
Sbjct  459  GQFETTPVSHSGA  471



>gb|ABU97498.1| adenylyl cyclase-associated protein [Gossypium arboreum]
 gb|ABU97499.1| adenylyl cyclase-associated protein [Gossypium arboreum]
 gb|KHG07838.1| Adenylyl cyclase-associated 1 [Gossypium arboreum]
Length=471

 Score =   339 bits (870),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 162/193 (84%), Positives = 174/193 (90%), Gaps = 1/193 (1%)
 Frame = -3

Query  812  DMKTKNRADRSGIVGASEKEGRVSSPSFSKAGPPKLELQMGRKWVVENQIGKKNLVIDDC  633
            DMKTKNR DR+G+V AS KE R SSPSFSKAGPPKLELQMGRKW VENQIG+KNLVIDDC
Sbjct  280  DMKTKNRTDRTGVVSASGKETRSSSPSFSKAGPPKLELQMGRKWAVENQIGRKNLVIDDC  339

Query  632  DAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGVA  453
            DAKQSVYI+GCKDSVLQIQGKVNNITIDKCTKMGVVF DVVAA EVVNC+GVEVQCQG A
Sbjct  340  DAKQSVYIYGCKDSVLQIQGKVNNITIDKCTKMGVVFKDVVAACEVVNCNGVEVQCQGSA  399

Query  452  PTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQYIHVYKD  273
            PTISVDNTSGC LYLSKDSL  SIT+AKSSE+N+LVP  GPD DW EH+LPQQYIHV+KD
Sbjct  400  PTISVDNTSGCQLYLSKDSLGTSITSAKSSEINVLVP-TGPDGDWGEHSLPQQYIHVFKD  458

Query  272  GQFITSPATHSGG  234
            GQF T+P +HSG 
Sbjct  459  GQFETTPVSHSGA  471



>gb|AEN70773.1| adenylyl cyclase-associated protein [Gossypium schwendimanii]
Length=471

 Score =   339 bits (870),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 162/193 (84%), Positives = 173/193 (90%), Gaps = 1/193 (1%)
 Frame = -3

Query  812  DMKTKNRADRSGIVGASEKEGRVSSPSFSKAGPPKLELQMGRKWVVENQIGKKNLVIDDC  633
            DMKTKNR DR+G+V AS KE   SSPSFSKAGPPKLELQMGRKW VENQIG+KNLVIDDC
Sbjct  280  DMKTKNRTDRTGVVSASGKETHSSSPSFSKAGPPKLELQMGRKWAVENQIGRKNLVIDDC  339

Query  632  DAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGVA  453
            DAKQSVYI+GCKDSVLQIQGKVNNITIDKCTKMGVVF DVVAA EVVNC+GVEVQCQG A
Sbjct  340  DAKQSVYIYGCKDSVLQIQGKVNNITIDKCTKMGVVFKDVVAACEVVNCNGVEVQCQGSA  399

Query  452  PTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQYIHVYKD  273
            PTISVDNTSGC LYLSKDSL  SITTAKSSE+N+LVP  GPD DW EH+LPQQYIHV+KD
Sbjct  400  PTISVDNTSGCQLYLSKDSLGTSITTAKSSEINVLVP-TGPDGDWGEHSLPQQYIHVFKD  458

Query  272  GQFITSPATHSGG  234
            GQF T+P +HSG 
Sbjct  459  GQFETTPVSHSGA  471



>gb|ADZ16114.1| adenylyl cyclase associated protein [Gossypium herbaceum subsp. 
africanum]
Length=471

 Score =   339 bits (870),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 162/193 (84%), Positives = 174/193 (90%), Gaps = 1/193 (1%)
 Frame = -3

Query  812  DMKTKNRADRSGIVGASEKEGRVSSPSFSKAGPPKLELQMGRKWVVENQIGKKNLVIDDC  633
            DMKTKNR DR+G+V AS KE R SSPSFSKAGPPKLELQMGRKW VENQIG+KNLVIDDC
Sbjct  280  DMKTKNRTDRTGVVSASGKETRSSSPSFSKAGPPKLELQMGRKWAVENQIGRKNLVIDDC  339

Query  632  DAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGVA  453
            DAKQSVYI+GCKDSVLQIQGKVNNITIDKCTKMGVVF DVVAA EVVNC+GVEVQCQG A
Sbjct  340  DAKQSVYIYGCKDSVLQIQGKVNNITIDKCTKMGVVFKDVVAACEVVNCNGVEVQCQGSA  399

Query  452  PTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQYIHVYKD  273
            PTISVDNTSGC LYLSKDSL  SIT+AKSSE+N+LVP  GPD DW EH+LPQQYIHV+KD
Sbjct  400  PTISVDNTSGCQLYLSKDSLGTSITSAKSSEINVLVP-TGPDGDWGEHSLPQQYIHVFKD  458

Query  272  GQFITSPATHSGG  234
            GQF T+P +HSG 
Sbjct  459  GQFETTPVSHSGA  471



>gb|AEN70781.1| adenylyl cyclase-associated protein [Gossypium barbadense var. 
brasiliense]
Length=471

 Score =   339 bits (870),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 162/193 (84%), Positives = 174/193 (90%), Gaps = 1/193 (1%)
 Frame = -3

Query  812  DMKTKNRADRSGIVGASEKEGRVSSPSFSKAGPPKLELQMGRKWVVENQIGKKNLVIDDC  633
            DMKTKNR DR+G+V AS KE R SSPSFSKAGPPKLELQMGRKW VENQIG+KNLVIDDC
Sbjct  280  DMKTKNRTDRTGVVSASGKETRSSSPSFSKAGPPKLELQMGRKWAVENQIGRKNLVIDDC  339

Query  632  DAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGVA  453
            DAKQSVYI+GCKDSVLQIQGKVNNITIDKCTKMGVVF DVVAA EVVNC+GVEVQCQG A
Sbjct  340  DAKQSVYIYGCKDSVLQIQGKVNNITIDKCTKMGVVFKDVVAACEVVNCNGVEVQCQGSA  399

Query  452  PTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQYIHVYKD  273
            PTISVDNTSGC LYLSKDSL  SIT+AKSSE+N+LVP  GPD DW EH+LPQQYIHV+KD
Sbjct  400  PTISVDNTSGCQLYLSKDSLGTSITSAKSSEINVLVP-TGPDGDWGEHSLPQQYIHVFKD  458

Query  272  GQFITSPATHSGG  234
            GQF T+P +HSG 
Sbjct  459  GQFETTPVSHSGA  471



>dbj|BAA36585.1| adenylyl cyclase associated protein [Gossypium hirsutum]
 gb|ADZ16116.1| adenylyl cyclase associated protein [Gossypium hirsutum]
 gb|AEN70785.1| adenylyl cyclase-associated protein [Gossypium hirsutum subsp. 
latifolium]
Length=471

 Score =   339 bits (870),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 162/193 (84%), Positives = 174/193 (90%), Gaps = 1/193 (1%)
 Frame = -3

Query  812  DMKTKNRADRSGIVGASEKEGRVSSPSFSKAGPPKLELQMGRKWVVENQIGKKNLVIDDC  633
            DMKTKNR DR+G+V AS KE R SSPSFSKAGPPKLELQMGRKW VENQIG+KNLVIDDC
Sbjct  280  DMKTKNRTDRTGVVSASGKETRSSSPSFSKAGPPKLELQMGRKWAVENQIGRKNLVIDDC  339

Query  632  DAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGVA  453
            DAKQSVYI+GCKDSVLQIQGKVNNITIDKCTKMGVVF DVVAA EVVNC+GVEVQCQG A
Sbjct  340  DAKQSVYIYGCKDSVLQIQGKVNNITIDKCTKMGVVFKDVVAACEVVNCNGVEVQCQGSA  399

Query  452  PTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQYIHVYKD  273
            PTISVDNTSGC LYLSKDSL  SIT+AKSSE+N+LVP  GPD DW EH+LPQQYIHV+KD
Sbjct  400  PTISVDNTSGCQLYLSKDSLGTSITSAKSSEINVLVP-TGPDGDWGEHSLPQQYIHVFKD  458

Query  272  GQFITSPATHSGG  234
            GQF T+P +HSG 
Sbjct  459  GQFETTPVSHSGA  471



>gb|AEN70793.1| adenylyl cyclase-associated protein [Gossypium lobatum]
Length=471

 Score =   338 bits (868),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 162/193 (84%), Positives = 173/193 (90%), Gaps = 1/193 (1%)
 Frame = -3

Query  812  DMKTKNRADRSGIVGASEKEGRVSSPSFSKAGPPKLELQMGRKWVVENQIGKKNLVIDDC  633
            DMKTKNR DR+G+V AS KE   SSPSFSKAGPPKLELQMGRKW VENQIG+KNLVIDDC
Sbjct  280  DMKTKNRTDRTGVVSASGKETHSSSPSFSKAGPPKLELQMGRKWAVENQIGRKNLVIDDC  339

Query  632  DAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGVA  453
            DAKQSVYI+GCKDSVLQIQGKVNNITIDKCTKMGVVF DVVAA EVVNC+GVEVQCQG A
Sbjct  340  DAKQSVYIYGCKDSVLQIQGKVNNITIDKCTKMGVVFKDVVAACEVVNCNGVEVQCQGSA  399

Query  452  PTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQYIHVYKD  273
            PTISVDNTSGC LYLSKDSL  SITTAKSSE+N+LVP  GPD DW EH+LPQQYIHV+KD
Sbjct  400  PTISVDNTSGCQLYLSKDSLGTSITTAKSSEINVLVP-TGPDGDWGEHSLPQQYIHVFKD  458

Query  272  GQFITSPATHSGG  234
            GQF T+P +HSG 
Sbjct  459  GQFETTPVSHSGA  471



>gb|AEN70789.1| adenylyl cyclase-associated protein [Gossypium davidsonii]
 gb|AEN70790.1| adenylyl cyclase-associated protein [Gossypium klotzschianum]
Length=471

 Score =   338 bits (868),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 162/193 (84%), Positives = 173/193 (90%), Gaps = 1/193 (1%)
 Frame = -3

Query  812  DMKTKNRADRSGIVGASEKEGRVSSPSFSKAGPPKLELQMGRKWVVENQIGKKNLVIDDC  633
            DMKTKNR DR+G+V AS KE   SSPSFSKAGPPKLELQMGRKW VENQIG+KNLVIDDC
Sbjct  280  DMKTKNRTDRTGVVSASGKETHSSSPSFSKAGPPKLELQMGRKWAVENQIGRKNLVIDDC  339

Query  632  DAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGVA  453
            DAKQSVYI+GCKDSVLQIQGKVNNITIDKCTKMGVVF DVVAA EVVNC+GVEVQCQG A
Sbjct  340  DAKQSVYIYGCKDSVLQIQGKVNNITIDKCTKMGVVFKDVVAACEVVNCNGVEVQCQGSA  399

Query  452  PTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQYIHVYKD  273
            PTISVDNTSGC LYLSKDSL  SITTAKSSE+N+LVP  GPD DW EH+LPQQYIHV+KD
Sbjct  400  PTISVDNTSGCQLYLSKDSLGTSITTAKSSEINVLVP-TGPDGDWGEHSLPQQYIHVFKD  458

Query  272  GQFITSPATHSGG  234
            GQF T+P +HSG 
Sbjct  459  GQFETTPVSHSGA  471



>ref|XP_010548053.1| PREDICTED: cyclase-associated protein 1 [Tarenaya hassleriana]
Length=478

 Score =   339 bits (869),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 153/194 (79%), Positives = 176/194 (91%), Gaps = 0/194 (0%)
 Frame = -3

Query  815  NDMKTKNRADRSGIVGASEKEGRVSSPSFSKAGPPKLELQMGRKWVVENQIGKKNLVIDD  636
            +DMKTKNRADRSG+VG +EKE R  SP+FSK GPPKLELQMGRKW VENQIGKK+LVID+
Sbjct  285  DDMKTKNRADRSGVVGVAEKESRTRSPAFSKTGPPKLELQMGRKWAVENQIGKKDLVIDE  344

Query  635  CDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGV  456
            CDA+QSVY+FGCKDSVLQIQGKVNNITIDKCTKMG+VF+DVVAAFE+VNC+ VEVQCQG 
Sbjct  345  CDARQSVYVFGCKDSVLQIQGKVNNITIDKCTKMGIVFTDVVAAFEIVNCNNVEVQCQGS  404

Query  455  APTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQYIHVYK  276
            APTISVDNT+GC LYL KD+L A+ITTAKSSE+N++VPGA PD DW EHALPQQY HV+K
Sbjct  405  APTISVDNTTGCQLYLGKDALGAAITTAKSSEINVMVPGAVPDGDWVEHALPQQYNHVFK  464

Query  275  DGQFITSPATHSGG  234
            +G+F T+P +HSG 
Sbjct  465  EGRFETTPVSHSGA  478



>ref|XP_010690893.1| PREDICTED: cyclase-associated protein 1 isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=378

 Score =   335 bits (860),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 158/194 (81%), Positives = 172/194 (89%), Gaps = 0/194 (0%)
 Frame = -3

Query  815  NDMKTKNRADRSGIVGASEKEGRVSSPSFSKAGPPKLELQMGRKWVVENQIGKKNLVIDD  636
            NDMKTKNRADRSG V   EKE R SS +F+K GPPKLELQMGRKWVVENQIGKK+LVID+
Sbjct  185  NDMKTKNRADRSGAVPVVEKEPRASSSAFAKTGPPKLELQMGRKWVVENQIGKKDLVIDE  244

Query  635  CDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGV  456
            CD+KQSVY+FGCKDSVLQIQGKVNNIT+DKCTKMGV+F DVVAA E+VNC+GVEVQCQG 
Sbjct  245  CDSKQSVYVFGCKDSVLQIQGKVNNITVDKCTKMGVLFKDVVAACEIVNCNGVEVQCQGS  304

Query  455  APTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQYIHVYK  276
            APTISVDNTSGC LYLSKDSLE SITTAKSSEVN++VP +  D DW EHALPQQYIH YK
Sbjct  305  APTISVDNTSGCQLYLSKDSLETSITTAKSSEVNVMVPASEADGDWGEHALPQQYIHSYK  364

Query  275  DGQFITSPATHSGG  234
            DG F+TSP  HSGG
Sbjct  365  DGHFVTSPVAHSGG  378



>gb|AEN70791.1| adenylyl cyclase-associated protein [Gossypium aridum]
Length=471

 Score =   338 bits (868),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 162/193 (84%), Positives = 173/193 (90%), Gaps = 1/193 (1%)
 Frame = -3

Query  812  DMKTKNRADRSGIVGASEKEGRVSSPSFSKAGPPKLELQMGRKWVVENQIGKKNLVIDDC  633
            DMKTKNR DR+G+V AS KE   SSPSFSKAGPPKLELQMGRKW VENQIG+KNLVIDDC
Sbjct  280  DMKTKNRTDRTGVVSASGKETHSSSPSFSKAGPPKLELQMGRKWAVENQIGRKNLVIDDC  339

Query  632  DAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGVA  453
            DAKQSVYI+GCKDSVLQIQGKVNNITIDKCTKMGVVF DVVAA EVVNC+GVEVQCQG A
Sbjct  340  DAKQSVYIYGCKDSVLQIQGKVNNITIDKCTKMGVVFKDVVAACEVVNCNGVEVQCQGSA  399

Query  452  PTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQYIHVYKD  273
            PTISVDNTSGC LYLSKDSL  SITTAKSSE+N+LVP  GPD DW EH+LPQQYIHV+KD
Sbjct  400  PTISVDNTSGCQLYLSKDSLGTSITTAKSSEINVLVP-TGPDGDWGEHSLPQQYIHVFKD  458

Query  272  GQFITSPATHSGG  234
            GQF T+P +HSG 
Sbjct  459  GQFETTPVSHSGA  471



>gb|AEN70772.1| adenylyl cyclase-associated protein [Gossypium laxum]
 gb|AEN70774.1| adenylyl cyclase-associated protein [Gossypium turneri]
 gb|AEN70787.1| adenylyl cyclase-associated protein [Gossypium armourianum]
 gb|AEN70788.1| adenylyl cyclase-associated protein [Gossypium harknessii]
Length=471

 Score =   338 bits (867),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 162/193 (84%), Positives = 173/193 (90%), Gaps = 1/193 (1%)
 Frame = -3

Query  812  DMKTKNRADRSGIVGASEKEGRVSSPSFSKAGPPKLELQMGRKWVVENQIGKKNLVIDDC  633
            DMKTKNR DR+G+V AS KE   SSPSFSKAGPPKLELQMGRKW VENQIG+KNLVIDDC
Sbjct  280  DMKTKNRTDRTGVVSASGKETHSSSPSFSKAGPPKLELQMGRKWAVENQIGRKNLVIDDC  339

Query  632  DAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGVA  453
            DAKQSVYI+GCKDSVLQIQGKVNNITIDKCTKMGVVF DVVAA EVVNC+GVEVQCQG A
Sbjct  340  DAKQSVYIYGCKDSVLQIQGKVNNITIDKCTKMGVVFKDVVAACEVVNCNGVEVQCQGSA  399

Query  452  PTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQYIHVYKD  273
            PTISVDNTSGC LYLSKDSL  SITTAKSSE+N+LVP  GPD DW EH+LPQQYIHV+KD
Sbjct  400  PTISVDNTSGCQLYLSKDSLGTSITTAKSSEINVLVP-TGPDGDWGEHSLPQQYIHVFKD  458

Query  272  GQFITSPATHSGG  234
            GQF T+P +HSG 
Sbjct  459  GQFETTPVSHSGA  471



>gb|AEN70792.1| adenylyl cyclase-associated protein [Gossypium gossypioides]
Length=471

 Score =   338 bits (867),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 162/193 (84%), Positives = 173/193 (90%), Gaps = 1/193 (1%)
 Frame = -3

Query  812  DMKTKNRADRSGIVGASEKEGRVSSPSFSKAGPPKLELQMGRKWVVENQIGKKNLVIDDC  633
            DMKTKNR DR+G+V AS KE   SSPSFSKAGPPKLELQMGRKW VENQIG+KNLVIDDC
Sbjct  280  DMKTKNRTDRTGVVSASGKETHSSSPSFSKAGPPKLELQMGRKWAVENQIGRKNLVIDDC  339

Query  632  DAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGVA  453
            DAKQSVYI+GCKDSVLQIQGKVNNITIDKCTKMGVVF DVVAA EVVNC+GVEVQCQG A
Sbjct  340  DAKQSVYIYGCKDSVLQIQGKVNNITIDKCTKMGVVFKDVVAACEVVNCNGVEVQCQGSA  399

Query  452  PTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQYIHVYKD  273
            PTISVDNTSGC LYLSKDSL  SITTAKSSE+N+LVP  GPD DW EH+LPQQYIHV+KD
Sbjct  400  PTISVDNTSGCQLYLSKDSLGTSITTAKSSEINVLVP-TGPDGDWGEHSLPQQYIHVFKD  458

Query  272  GQFITSPATHSGG  234
            GQF T+P +HSG 
Sbjct  459  GQFETTPVSHSGA  471



>gb|AEN70794.1| adenylyl cyclase-associated protein [Gossypium trilobum]
Length=471

 Score =   338 bits (867),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 162/193 (84%), Positives = 173/193 (90%), Gaps = 1/193 (1%)
 Frame = -3

Query  812  DMKTKNRADRSGIVGASEKEGRVSSPSFSKAGPPKLELQMGRKWVVENQIGKKNLVIDDC  633
            DMKTKNR DR+G+V AS KE   SSPSFSKAGPPKLELQMGRKW VENQIG+KNLVIDDC
Sbjct  280  DMKTKNRTDRTGVVSASGKETHSSSPSFSKAGPPKLELQMGRKWAVENQIGRKNLVIDDC  339

Query  632  DAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGVA  453
            DAKQSVYI+GCKDSVLQIQGKVNNITIDKCTKMGVVF DVVAA EVVNC+GVEVQCQG A
Sbjct  340  DAKQSVYIYGCKDSVLQIQGKVNNITIDKCTKMGVVFKDVVAACEVVNCNGVEVQCQGSA  399

Query  452  PTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQYIHVYKD  273
            PTISVDNTSGC LYLSKDSL  SITTAKSSE+N+LVP  GPD DW EH+LPQQYIHV+KD
Sbjct  400  PTISVDNTSGCQLYLSKDSLGTSITTAKSSEINVLVP-TGPDGDWGEHSLPQQYIHVFKD  458

Query  272  GQFITSPATHSGG  234
            GQF T+P +HSG 
Sbjct  459  GQFETTPVSHSGA  471



>gb|AEN70771.1| adenylyl cyclase-associated protein [Gossypium thurberi]
Length=471

 Score =   338 bits (867),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 162/193 (84%), Positives = 173/193 (90%), Gaps = 1/193 (1%)
 Frame = -3

Query  812  DMKTKNRADRSGIVGASEKEGRVSSPSFSKAGPPKLELQMGRKWVVENQIGKKNLVIDDC  633
            DMKTKNR DR+G+V AS KE   SSPSFSKAGPPKLELQMGRKW VENQIG+KNLVIDDC
Sbjct  280  DMKTKNRTDRTGVVSASGKETHSSSPSFSKAGPPKLELQMGRKWAVENQIGRKNLVIDDC  339

Query  632  DAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGVA  453
            DAKQSVYI+GCKDSVLQIQGKVNNITIDKCTKMGVVF DVVAA EVVNC+GVEVQCQG A
Sbjct  340  DAKQSVYIYGCKDSVLQIQGKVNNITIDKCTKMGVVFKDVVAACEVVNCNGVEVQCQGSA  399

Query  452  PTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQYIHVYKD  273
            PTISVDNTSGC LYLSKDSL  SITTAKSSE+N+LVP  GPD DW EH+LPQQYIHV+KD
Sbjct  400  PTISVDNTSGCQLYLSKDSLGTSITTAKSSEINVLVP-TGPDGDWGEHSLPQQYIHVFKD  458

Query  272  GQFITSPATHSGG  234
            GQF T+P +HSG 
Sbjct  459  GQFETTPVSHSGA  471



>ref|XP_010939270.1| PREDICTED: cyclase-associated protein 1-like [Elaeis guineensis]
Length=477

 Score =   338 bits (867),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 152/194 (78%), Positives = 177/194 (91%), Gaps = 0/194 (0%)
 Frame = -3

Query  815  NDMKTKNRADRSGIVGASEKEGRVSSPSFSKAGPPKLELQMGRKWVVENQIGKKNLVIDD  636
            +DMKTKNR DR+G++G +EK+ R SS S SK GPPKLELQMGR+WVVENQIGKK+LVIDD
Sbjct  284  DDMKTKNRTDRTGVIGTTEKDSRASSFSCSKTGPPKLELQMGRRWVVENQIGKKDLVIDD  343

Query  635  CDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGV  456
            CD+KQSVY+FGCKDSVLQ++GKVNNIT+DKC KMG+VF DVVAA E+VNC+GVEVQCQG 
Sbjct  344  CDSKQSVYVFGCKDSVLQVKGKVNNITVDKCIKMGIVFKDVVAACEIVNCNGVEVQCQGS  403

Query  455  APTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQYIHVYK  276
            APTIS+DNTSGC LYLSK+SLEASITTAKSSE+N+++PGAGPD DW EHALPQQY+H +K
Sbjct  404  APTISIDNTSGCQLYLSKNSLEASITTAKSSEINVMIPGAGPDDDWAEHALPQQYVHAFK  463

Query  275  DGQFITSPATHSGG  234
            DGQFITSP +HS G
Sbjct  464  DGQFITSPLSHSAG  477



>gb|ABU97500.1| adenylyl cyclase-associated protein [Gossypium arboreum]
Length=471

 Score =   337 bits (865),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 161/193 (83%), Positives = 173/193 (90%), Gaps = 1/193 (1%)
 Frame = -3

Query  812  DMKTKNRADRSGIVGASEKEGRVSSPSFSKAGPPKLELQMGRKWVVENQIGKKNLVIDDC  633
            DMKTKNR DR+G+V AS KE R SSPSFSKAGPPKLELQMGRKW VENQIG+KNLVIDDC
Sbjct  280  DMKTKNRTDRTGVVSASGKETRSSSPSFSKAGPPKLELQMGRKWAVENQIGRKNLVIDDC  339

Query  632  DAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGVA  453
            DAKQSVYI+GCKDSVLQIQGKVNNITIDKCTKMGVVF DVVAA EVVNC+GVEVQCQG A
Sbjct  340  DAKQSVYIYGCKDSVLQIQGKVNNITIDKCTKMGVVFKDVVAACEVVNCNGVEVQCQGSA  399

Query  452  PTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQYIHVYKD  273
            PTISVDNTSGC LYLSKDSL  SI +AKSSE+N+LVP  GPD DW EH+LPQQYIHV+KD
Sbjct  400  PTISVDNTSGCQLYLSKDSLGTSIASAKSSEINVLVP-TGPDGDWGEHSLPQQYIHVFKD  458

Query  272  GQFITSPATHSGG  234
            GQF T+P +HSG 
Sbjct  459  GQFETTPVSHSGA  471



>ref|XP_010690892.1| PREDICTED: cyclase-associated protein 1 isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=470

 Score =   337 bits (864),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 158/194 (81%), Positives = 172/194 (89%), Gaps = 0/194 (0%)
 Frame = -3

Query  815  NDMKTKNRADRSGIVGASEKEGRVSSPSFSKAGPPKLELQMGRKWVVENQIGKKNLVIDD  636
            NDMKTKNRADRSG V   EKE R SS +F+K GPPKLELQMGRKWVVENQIGKK+LVID+
Sbjct  277  NDMKTKNRADRSGAVPVVEKEPRASSSAFAKTGPPKLELQMGRKWVVENQIGKKDLVIDE  336

Query  635  CDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGV  456
            CD+KQSVY+FGCKDSVLQIQGKVNNIT+DKCTKMGV+F DVVAA E+VNC+GVEVQCQG 
Sbjct  337  CDSKQSVYVFGCKDSVLQIQGKVNNITVDKCTKMGVLFKDVVAACEIVNCNGVEVQCQGS  396

Query  455  APTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQYIHVYK  276
            APTISVDNTSGC LYLSKDSLE SITTAKSSEVN++VP +  D DW EHALPQQYIH YK
Sbjct  397  APTISVDNTSGCQLYLSKDSLETSITTAKSSEVNVMVPASEADGDWGEHALPQQYIHSYK  456

Query  275  DGQFITSPATHSGG  234
            DG F+TSP  HSGG
Sbjct  457  DGHFVTSPVAHSGG  470



>ref|XP_010936278.1| PREDICTED: cyclase-associated protein 1 [Elaeis guineensis]
Length=476

 Score =   337 bits (863),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 153/194 (79%), Positives = 174/194 (90%), Gaps = 0/194 (0%)
 Frame = -3

Query  815  NDMKTKNRADRSGIVGASEKEGRVSSPSFSKAGPPKLELQMGRKWVVENQIGKKNLVIDD  636
            NDMKTKNR DR+G+V  SEK+   SS SFSK GPPKLELQMGRKW VENQI KK+LVIDD
Sbjct  283  NDMKTKNRTDRTGVVSTSEKDSHASSFSFSKTGPPKLELQMGRKWAVENQIRKKDLVIDD  342

Query  635  CDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGV  456
            CD+KQSVY+FGCKDSVLQ++GKVNNIT+DKCTKMG+VF DVVAA E+VNC+GVEVQCQG 
Sbjct  343  CDSKQSVYVFGCKDSVLQVKGKVNNITVDKCTKMGIVFMDVVAACEIVNCNGVEVQCQGS  402

Query  455  APTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQYIHVYK  276
            APTIS+DNTSGC LYLSKDSLEASITTAKSSE+N+++PGAGP+ DW EHALPQQY+H +K
Sbjct  403  APTISIDNTSGCQLYLSKDSLEASITTAKSSEINVMIPGAGPNDDWVEHALPQQYVHTFK  462

Query  275  DGQFITSPATHSGG  234
            +GQF TSP  HSGG
Sbjct  463  NGQFTTSPVFHSGG  476



>ref|XP_007042208.1| Cyclase associated protein 1, 1,CAP1 [Theobroma cacao]
 gb|EOX98039.1| Cyclase associated protein 1, 1,CAP1 [Theobroma cacao]
Length=472

 Score =   336 bits (862),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 164/193 (85%), Positives = 175/193 (91%), Gaps = 0/193 (0%)
 Frame = -3

Query  812  DMKTKNRADRSGIVGASEKEGRVSSPSFSKAGPPKLELQMGRKWVVENQIGKKNLVIDDC  633
            DMK KNR DR+GIV A EKE R SS SFSKAGPPKLELQMGRKWVVENQIG+KNLVIDDC
Sbjct  280  DMKAKNRTDRTGIVSAGEKETRSSSSSFSKAGPPKLELQMGRKWVVENQIGRKNLVIDDC  339

Query  632  DAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGVA  453
            DAKQSVYIFGCKDS+LQIQGKVNNITIDKCTKMGVVF DVVAA E+VNC+GVEVQCQG A
Sbjct  340  DAKQSVYIFGCKDSILQIQGKVNNITIDKCTKMGVVFKDVVAACEIVNCNGVEVQCQGFA  399

Query  452  PTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQYIHVYKD  273
            PTISVDNTSGC LYLSKDSL ASITTAKSSE+N+LVP A  D+DW EHALPQQYIHV+KD
Sbjct  400  PTISVDNTSGCQLYLSKDSLGASITTAKSSEINVLVPAAEADSDWGEHALPQQYIHVFKD  459

Query  272  GQFITSPATHSGG  234
            GQF T+P +HSGG
Sbjct  460  GQFETTPVSHSGG  472



>gb|AFK47086.1| unknown [Lotus japonicus]
Length=469

 Score =   335 bits (860),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 156/194 (80%), Positives = 176/194 (91%), Gaps = 0/194 (0%)
 Frame = -3

Query  815  NDMKTKNRADRSGIVGASEKEGRVSSPSFSKAGPPKLELQMGRKWVVENQIGKKNLVIDD  636
            +DMKTKNR DR+G+VG+SEKE R  S +FSK GPPK ELQMGRKWVVENQIGKK+LVI+D
Sbjct  276  DDMKTKNRTDRTGVVGSSEKESRAGSRAFSKTGPPKFELQMGRKWVVENQIGKKDLVIED  335

Query  635  CDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGV  456
            CD+KQSVY++GCKDSVLQIQGKVNNITIDKCTKMGVVF DVVAA E+VNC+GVEVQCQG 
Sbjct  336  CDSKQSVYVYGCKDSVLQIQGKVNNITIDKCTKMGVVFKDVVAACEIVNCNGVEVQCQGS  395

Query  455  APTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQYIHVYK  276
            APTISVDNTSGC LYLSKDSLE SI+TAKSSE+N+LVPGA PD D  EH+LPQQYIH +K
Sbjct  396  APTISVDNTSGCQLYLSKDSLETSISTAKSSEINVLVPGAEPDGDLVEHSLPQQYIHAFK  455

Query  275  DGQFITSPATHSGG  234
            DG+F T+PA+HSGG
Sbjct  456  DGRFETTPASHSGG  469



>ref|XP_008785664.1| PREDICTED: LOW QUALITY PROTEIN: cyclase-associated protein 1-like 
[Phoenix dactylifera]
Length=475

 Score =   334 bits (857),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 149/194 (77%), Positives = 174/194 (90%), Gaps = 0/194 (0%)
 Frame = -3

Query  815  NDMKTKNRADRSGIVGASEKEGRVSSPSFSKAGPPKLELQMGRKWVVENQIGKKNLVIDD  636
            +DMKTKNR DR+  VG +EK+ R SS SFSK GPPKLELQMGRKW +ENQIG+K+LVIDD
Sbjct  282  DDMKTKNRTDRTVDVGTTEKDSRASSFSFSKTGPPKLELQMGRKWAIENQIGRKDLVIDD  341

Query  635  CDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGV  456
            CD+KQSVY+FGCKDSVLQ++GK+NNIT+DKCTKM +VF+D VAA E+VNC+GVEVQCQG 
Sbjct  342  CDSKQSVYLFGCKDSVLQVKGKMNNITVDKCTKMAIVFTDAVAACEIVNCNGVEVQCQGS  401

Query  455  APTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQYIHVYK  276
            APTIS+DNTSGC LYLSKDSLEASITTAKSSE+N+++PGAGPD DW EHALPQQY+H +K
Sbjct  402  APTISIDNTSGCQLYLSKDSLEASITTAKSSEINVMIPGAGPDDDWAEHALPQQYVHAFK  461

Query  275  DGQFITSPATHSGG  234
            DGQF TSP +HS G
Sbjct  462  DGQFTTSPVSHSAG  475



>ref|XP_010263686.1| PREDICTED: cyclase-associated protein 1-like [Nelumbo nucifera]
Length=470

 Score =   333 bits (854),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 154/194 (79%), Positives = 174/194 (90%), Gaps = 0/194 (0%)
 Frame = -3

Query  815  NDMKTKNRADRSGIVGASEKEGRVSSPSFSKAGPPKLELQMGRKWVVENQIGKKNLVIDD  636
            +DMKTKNR DR+ IVGASEKE R +S S SKAGPPK ELQMGRKWVVENQIG K LVIDD
Sbjct  277  DDMKTKNRTDRTSIVGASEKETRTTSLSSSKAGPPKFELQMGRKWVVENQIGNKGLVIDD  336

Query  635  CDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGV  456
            CDAKQSVY+FGCKDSVLQI+ KVNNIT+DKCTKMG+VF+DVVAA E+VNC+GVE+QCQG 
Sbjct  337  CDAKQSVYVFGCKDSVLQIKEKVNNITLDKCTKMGIVFTDVVAACEIVNCNGVELQCQGS  396

Query  455  APTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQYIHVYK  276
            APTISVDNT GC LYL KDSL+ASITTAKSSE+N+L+PG GPDADW EHALP Q++HV+K
Sbjct  397  APTISVDNTGGCQLYLGKDSLKASITTAKSSEINVLIPGEGPDADWVEHALPHQFVHVFK  456

Query  275  DGQFITSPATHSGG  234
            DGQ +TSP +HSGG
Sbjct  457  DGQLVTSPVSHSGG  470



>emb|CDX75438.1| BnaA01g02640D [Brassica napus]
Length=469

 Score =   333 bits (854),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 151/194 (78%), Positives = 172/194 (89%), Gaps = 0/194 (0%)
 Frame = -3

Query  815  NDMKTKNRADRSGIVGASEKEGRVSSPSFSKAGPPKLELQMGRKWVVENQIGKKNLVIDD  636
            +DMKTKNRADRSG V + EKE R + P+FSK GPPKLELQMGRKW VENQIGKK+LVI D
Sbjct  276  DDMKTKNRADRSGAVSSIEKETRTTKPAFSKTGPPKLELQMGRKWAVENQIGKKDLVISD  335

Query  635  CDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGV  456
            CDAKQSVY+FGCKDSVLQIQGKVNNITIDKCTKMGVVF+DVVAAFE+VNC+ VEVQCQG 
Sbjct  336  CDAKQSVYVFGCKDSVLQIQGKVNNITIDKCTKMGVVFTDVVAAFEIVNCTNVEVQCQGS  395

Query  455  APTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQYIHVYK  276
            APT+SVDNT+GC LYL+KDSLE +ITTAKSSE+N++VPG  PD DW EHALPQQY HV+ 
Sbjct  396  APTVSVDNTTGCQLYLNKDSLETAITTAKSSEINVMVPGTSPDGDWVEHALPQQYNHVFT  455

Query  275  DGQFITSPATHSGG  234
            +G+F T+P +HSG 
Sbjct  456  EGKFETTPVSHSGA  469



>ref|XP_010530841.1| PREDICTED: cyclase-associated protein 1 [Tarenaya hassleriana]
Length=475

 Score =   333 bits (854),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 153/194 (79%), Positives = 175/194 (90%), Gaps = 0/194 (0%)
 Frame = -3

Query  815  NDMKTKNRADRSGIVGASEKEGRVSSPSFSKAGPPKLELQMGRKWVVENQIGKKNLVIDD  636
            +DMKTKNRADRSG+VG +EKE R S+ +FSK GPPKLELQMGRKW VENQIGKK+LVID+
Sbjct  282  DDMKTKNRADRSGVVGVAEKEIRTSTQAFSKTGPPKLELQMGRKWAVENQIGKKDLVIDE  341

Query  635  CDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGV  456
            CDAKQSVY+FGCKDSVLQIQGKVNNITIDKCTKMGVVF+DVVAAFE VNC+ VEVQCQG 
Sbjct  342  CDAKQSVYVFGCKDSVLQIQGKVNNITIDKCTKMGVVFTDVVAAFETVNCNNVEVQCQGS  401

Query  455  APTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQYIHVYK  276
            APTISVDNT+GC LYL KD+L A+ITTAKSSE+N++VPGA PD DW EHALPQQY HV++
Sbjct  402  APTISVDNTTGCQLYLGKDALGAAITTAKSSEINVMVPGADPDGDWVEHALPQQYNHVFE  461

Query  275  DGQFITSPATHSGG  234
            +G+F T+P +HSG 
Sbjct  462  EGKFETTPVSHSGA  475



>ref|XP_002867116.1| ATCAP1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43375.1| ATCAP1 [Arabidopsis lyrata subsp. lyrata]
Length=478

 Score =   333 bits (853),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 152/194 (78%), Positives = 173/194 (89%), Gaps = 0/194 (0%)
 Frame = -3

Query  815  NDMKTKNRADRSGIVGASEKEGRVSSPSFSKAGPPKLELQMGRKWVVENQIGKKNLVIDD  636
            +DMKTKNRADRSG V A EKE R S P+FSK GPPK+ELQMGRKW VENQIGKK+LVI +
Sbjct  285  DDMKTKNRADRSGAVSAVEKETRTSKPAFSKTGPPKMELQMGRKWAVENQIGKKDLVISE  344

Query  635  CDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGV  456
            CD+KQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVF+DVVAAFE+VNC+ VEVQCQG 
Sbjct  345  CDSKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFTDVVAAFEIVNCTNVEVQCQGS  404

Query  455  APTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQYIHVYK  276
            APT+SVDNT+GC LYL+KDSLE +ITTAKSSE+N++VPGA PD DW EHALPQQY HV+ 
Sbjct  405  APTVSVDNTTGCQLYLNKDSLETAITTAKSSEINVMVPGATPDGDWVEHALPQQYNHVFT  464

Query  275  DGQFITSPATHSGG  234
            +G+F T+P +HSG 
Sbjct  465  EGKFETTPVSHSGA  478



>ref|XP_009804915.1| PREDICTED: cyclase-associated protein 1 [Nicotiana sylvestris]
Length=475

 Score =   333 bits (853),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 154/193 (80%), Positives = 173/193 (90%), Gaps = 0/193 (0%)
 Frame = -3

Query  815  NDMKTKNRADRSGIVGASEKEGRVSSPSFSKAGPPKLELQMGRKWVVENQIGKKNLVIDD  636
            +DMK KNRADR+G+V A EKE R+SSP  SK GP KLELQMGRKWVVENQ+G+KNLVIDD
Sbjct  282  DDMKAKNRADRTGVVNAGEKEARMSSPYISKTGPAKLELQMGRKWVVENQVGEKNLVIDD  341

Query  635  CDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGV  456
            CDAKQSVY++GCK SVL+I+GKVNNITIDKCTKMGVVF+ VVAA EVVNC+GVEVQCQG 
Sbjct  342  CDAKQSVYVYGCKGSVLEIKGKVNNITIDKCTKMGVVFAGVVAACEVVNCNGVEVQCQGS  401

Query  455  APTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQYIHVYK  276
            APTISVDNT+GC LYLSKDSL  SITTAKSSE+N++VPGAGPD DW EHALPQQY HVYK
Sbjct  402  APTISVDNTTGCQLYLSKDSLGGSITTAKSSEINVMVPGAGPDDDWGEHALPQQYAHVYK  461

Query  275  DGQFITSPATHSG  237
            DG F+T+P +HSG
Sbjct  462  DGHFVTTPVSHSG  474



>ref|XP_009112095.1| PREDICTED: cyclase-associated protein 1 [Brassica rapa]
Length=477

 Score =   333 bits (853),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 151/194 (78%), Positives = 172/194 (89%), Gaps = 0/194 (0%)
 Frame = -3

Query  815  NDMKTKNRADRSGIVGASEKEGRVSSPSFSKAGPPKLELQMGRKWVVENQIGKKNLVIDD  636
            +DMKTKNRADRSG V + EKE R + P+FSK GPPKLELQMGRKW VENQIGKK+LVI D
Sbjct  284  DDMKTKNRADRSGAVSSIEKETRTTKPAFSKTGPPKLELQMGRKWAVENQIGKKDLVISD  343

Query  635  CDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGV  456
            CDAKQSVY+FGCKDSVLQIQGKVNNITIDKCTKMGVVF+DVVAAFE+VNC+ VEVQCQG 
Sbjct  344  CDAKQSVYVFGCKDSVLQIQGKVNNITIDKCTKMGVVFTDVVAAFEIVNCTNVEVQCQGS  403

Query  455  APTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQYIHVYK  276
            APT+SVDNT+GC LYL+KDSLE +ITTAKSSE+N++VPG  PD DW EHALPQQY HV+ 
Sbjct  404  APTVSVDNTTGCQLYLNKDSLETAITTAKSSEINVMVPGTSPDGDWVEHALPQQYNHVFT  463

Query  275  DGQFITSPATHSGG  234
            +G+F T+P +HSG 
Sbjct  464  EGKFETTPVSHSGA  477



>emb|CDX69065.1| BnaC01g03880D [Brassica napus]
Length=480

 Score =   333 bits (853),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 151/194 (78%), Positives = 172/194 (89%), Gaps = 0/194 (0%)
 Frame = -3

Query  815  NDMKTKNRADRSGIVGASEKEGRVSSPSFSKAGPPKLELQMGRKWVVENQIGKKNLVIDD  636
            +DMKTKNRADRSG V + EKE R + P+FSK GPPKLELQMGRKW VENQIGKK+LVI D
Sbjct  287  DDMKTKNRADRSGAVSSIEKETRATKPAFSKTGPPKLELQMGRKWAVENQIGKKDLVISD  346

Query  635  CDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGV  456
            CDAKQSVY+FGCKDSVLQIQGKVNNITIDKCTKMGVVF+DVVAAFE+VNC+ VEVQCQG 
Sbjct  347  CDAKQSVYVFGCKDSVLQIQGKVNNITIDKCTKMGVVFTDVVAAFEIVNCTNVEVQCQGS  406

Query  455  APTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQYIHVYK  276
            APT+SVDNT+GC LYL+KDSLE +ITTAKSSE+N++VPG  PD DW EHALPQQY HV+ 
Sbjct  407  APTVSVDNTTGCQLYLNKDSLETAITTAKSSEINVMVPGTSPDGDWVEHALPQQYNHVFT  466

Query  275  DGQFITSPATHSGG  234
            +G+F T+P +HSG 
Sbjct  467  EGKFETTPVSHSGA  480



>ref|XP_006286091.1| hypothetical protein CARUB_v10007634mg [Capsella rubella]
 gb|EOA18989.1| hypothetical protein CARUB_v10007634mg [Capsella rubella]
Length=475

 Score =   332 bits (852),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 151/194 (78%), Positives = 173/194 (89%), Gaps = 0/194 (0%)
 Frame = -3

Query  815  NDMKTKNRADRSGIVGASEKEGRVSSPSFSKAGPPKLELQMGRKWVVENQIGKKNLVIDD  636
            +DMKTKNRADRSG V A EKE R + P+FSK GPPK+ELQMGRKW VENQIGKK+LVI +
Sbjct  282  DDMKTKNRADRSGAVSAIEKETRATKPAFSKTGPPKMELQMGRKWAVENQIGKKDLVISE  341

Query  635  CDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGV  456
            CD+KQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVF+DVVAAFE+VNC+ VEVQCQG 
Sbjct  342  CDSKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFTDVVAAFEIVNCTNVEVQCQGS  401

Query  455  APTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQYIHVYK  276
            APT+SVDNT+GC LYL+KDSLE +ITTAKSSE+N++VPGA PD DW EHALPQQY HV+ 
Sbjct  402  APTVSVDNTTGCQLYLNKDSLETAITTAKSSEINVMVPGATPDGDWVEHALPQQYNHVFT  461

Query  275  DGQFITSPATHSGG  234
            +G+F T+P +HSG 
Sbjct  462  EGKFETTPVSHSGA  475



>ref|XP_010432407.1| PREDICTED: cyclase-associated protein 1-like [Camelina sativa]
Length=478

 Score =   332 bits (852),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 152/194 (78%), Positives = 173/194 (89%), Gaps = 0/194 (0%)
 Frame = -3

Query  815  NDMKTKNRADRSGIVGASEKEGRVSSPSFSKAGPPKLELQMGRKWVVENQIGKKNLVIDD  636
            +DMKTKNRADRSG V A EKE R S P+FSK GPPK+ELQMGRKW VENQIGKK+LVI +
Sbjct  285  DDMKTKNRADRSGAVSAIEKETRASKPAFSKTGPPKMELQMGRKWAVENQIGKKDLVISE  344

Query  635  CDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGV  456
            CD+KQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVF+DVVAAFE+VNC+ VEVQCQG 
Sbjct  345  CDSKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFTDVVAAFEIVNCNNVEVQCQGS  404

Query  455  APTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQYIHVYK  276
            APT+SVDNT+GC LYL+KDSLE +ITTAKSSE+N++VPGA PD DW EHALPQQY HV+ 
Sbjct  405  APTVSVDNTTGCQLYLNKDSLETAITTAKSSEINVMVPGATPDGDWVEHALPQQYNHVFT  464

Query  275  DGQFITSPATHSGG  234
            +G+F T+P +HSG 
Sbjct  465  EGKFETTPVSHSGA  478



>ref|XP_011088387.1| PREDICTED: cyclase-associated protein 1 [Sesamum indicum]
Length=472

 Score =   332 bits (851),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 154/194 (79%), Positives = 171/194 (88%), Gaps = 0/194 (0%)
 Frame = -3

Query  815  NDMKTKNRADRSGIVGASEKEGRVSSPSFSKAGPPKLELQMGRKWVVENQIGKKNLVIDD  636
            +DMK+KNRADRSG+V   EKEGR + P+ SK G PKLELQMGRKWVVENQ G+ NLVI D
Sbjct  279  DDMKSKNRADRSGVVSLPEKEGRAAPPAISKTGRPKLELQMGRKWVVENQTGQNNLVIGD  338

Query  635  CDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGV  456
            CDAKQSVY+FGCK+SVLQIQGKVNNIT+DKCTKMGVVF DVVAA E+VNCS VEVQCQG 
Sbjct  339  CDAKQSVYVFGCKNSVLQIQGKVNNITVDKCTKMGVVFKDVVAACEIVNCSSVEVQCQGS  398

Query  455  APTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQYIHVYK  276
            APTISVDNT+GC LYLSKD+LEASITTAKSSE+N+LVPGA PD DW EHALPQQY+H YK
Sbjct  399  APTISVDNTAGCQLYLSKDALEASITTAKSSEINVLVPGAEPDGDWVEHALPQQYVHAYK  458

Query  275  DGQFITSPATHSGG  234
            DG F T+P +HSGG
Sbjct  459  DGHFETTPVSHSGG  472



>ref|XP_004299093.1| PREDICTED: cyclase-associated protein 1 [Fragaria vesca subsp. 
vesca]
Length=474

 Score =   331 bits (849),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 151/194 (78%), Positives = 171/194 (88%), Gaps = 0/194 (0%)
 Frame = -3

Query  815  NDMKTKNRADRSGIVGASEKEGRVSSPSFSKAGPPKLELQMGRKWVVENQIGKKNLVIDD  636
            +DMKTKNRADR+G+VG  EKE   S+P+ SK GPPK ELQMGRKW VENQIGKK+LVI +
Sbjct  280  DDMKTKNRADRTGVVGTQEKESHTSAPAVSKVGPPKFELQMGRKWAVENQIGKKDLVISE  339

Query  635  CDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGV  456
            CDAKQSVY++GCKDSVLQIQGKVNNITIDKCTKMGVVF DVVAAFE+VNC+ VEVQCQG 
Sbjct  340  CDAKQSVYVYGCKDSVLQIQGKVNNITIDKCTKMGVVFQDVVAAFEIVNCNRVEVQCQGS  399

Query  455  APTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQYIHVYK  276
            APT+S+DNT+GC  YLSKD+L  SITTAKSSEVNILVPGA PD DW EHALP+Q+IHVYK
Sbjct  400  APTVSIDNTAGCQFYLSKDALSVSITTAKSSEVNILVPGAEPDGDWGEHALPEQFIHVYK  459

Query  275  DGQFITSPATHSGG  234
            DG+F T+P +HS G
Sbjct  460  DGRFETTPVSHSAG  473



>ref|XP_003537875.1| PREDICTED: cyclase-associated protein 1-like [Glycine max]
Length=469

 Score =   330 bits (847),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 156/194 (80%), Positives = 173/194 (89%), Gaps = 0/194 (0%)
 Frame = -3

Query  815  NDMKTKNRADRSGIVGASEKEGRVSSPSFSKAGPPKLELQMGRKWVVENQIGKKNLVIDD  636
            NDMKTKNR DR+G+VGA EKE   SS  FSKAGPPK ELQMGRKWVVENQI KK+LVI+D
Sbjct  276  NDMKTKNRTDRTGVVGAIEKETPASSRVFSKAGPPKFELQMGRKWVVENQIEKKDLVIED  335

Query  635  CDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGV  456
            CD+KQSVYI+GCK+SVLQI GKVNNITIDKCTKMGVVF DVVAA E+VN +GVEVQCQG 
Sbjct  336  CDSKQSVYIYGCKNSVLQISGKVNNITIDKCTKMGVVFKDVVAACEIVNSNGVEVQCQGA  395

Query  455  APTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQYIHVYK  276
            APTISVDNTSGC LYLSKDSLEASITTAKSSE+N++VPGA PD DW EH+LPQQYIH++K
Sbjct  396  APTISVDNTSGCQLYLSKDSLEASITTAKSSEINVMVPGADPDGDWVEHSLPQQYIHLFK  455

Query  275  DGQFITSPATHSGG  234
            +G F T+PA HSGG
Sbjct  456  NGHFETTPAAHSGG  469



>ref|XP_006412221.1| hypothetical protein EUTSA_v10025082mg [Eutrema salsugineum]
 gb|ESQ53674.1| hypothetical protein EUTSA_v10025082mg [Eutrema salsugineum]
Length=478

 Score =   331 bits (848),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 151/194 (78%), Positives = 172/194 (89%), Gaps = 0/194 (0%)
 Frame = -3

Query  815  NDMKTKNRADRSGIVGASEKEGRVSSPSFSKAGPPKLELQMGRKWVVENQIGKKNLVIDD  636
            +DMKTKNRADRSG V A EKE R S P+F+K GPPKLELQMGRKW VENQ GKK+LVI +
Sbjct  285  DDMKTKNRADRSGAVSAIEKETRTSKPAFAKTGPPKLELQMGRKWAVENQNGKKDLVISE  344

Query  635  CDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGV  456
            CD+KQSVY+FGCKDSVLQIQGKVNNITIDKCTKMGVVF+DVVAAFE+VNC+ VEVQCQG 
Sbjct  345  CDSKQSVYVFGCKDSVLQIQGKVNNITIDKCTKMGVVFTDVVAAFEIVNCTNVEVQCQGS  404

Query  455  APTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQYIHVYK  276
            APT+SVDNT+GC LYLSKDSLE +ITTAKSSE+N++VPGA PD DW EHALPQQY HV+ 
Sbjct  405  APTVSVDNTTGCQLYLSKDSLETAITTAKSSEINVMVPGASPDGDWVEHALPQQYNHVFT  464

Query  275  DGQFITSPATHSGG  234
            +G+F T+P +HSG 
Sbjct  465  EGKFETTPVSHSGA  478



>ref|XP_010447072.1| PREDICTED: cyclase-associated protein 1 isoform X2 [Camelina 
sativa]
Length=475

 Score =   330 bits (847),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 151/194 (78%), Positives = 172/194 (89%), Gaps = 0/194 (0%)
 Frame = -3

Query  815  NDMKTKNRADRSGIVGASEKEGRVSSPSFSKAGPPKLELQMGRKWVVENQIGKKNLVIDD  636
            +DMKTKNR DRSG V A EKE R S P+FSK GPPK+ELQMGRKW VENQIGKK+LVI +
Sbjct  282  DDMKTKNRTDRSGAVSAIEKETRASKPAFSKTGPPKMELQMGRKWAVENQIGKKDLVISE  341

Query  635  CDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGV  456
            CD+KQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVF+DVVAAFE+VNC+ VEVQCQG 
Sbjct  342  CDSKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFTDVVAAFEIVNCNNVEVQCQGS  401

Query  455  APTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQYIHVYK  276
            APT+SVDNT+GC LYL+KDSLE +ITTAKSSE+N++VPGA PD DW EHALPQQY HV+ 
Sbjct  402  APTVSVDNTTGCQLYLNKDSLETAITTAKSSEINVMVPGATPDGDWVEHALPQQYNHVFT  461

Query  275  DGQFITSPATHSGG  234
            +G+F T+P +HSG 
Sbjct  462  EGKFETTPVSHSGA  475



>ref|XP_010447070.1| PREDICTED: cyclase-associated protein 1 isoform X1 [Camelina 
sativa]
Length=476

 Score =   330 bits (847),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 151/194 (78%), Positives = 172/194 (89%), Gaps = 0/194 (0%)
 Frame = -3

Query  815  NDMKTKNRADRSGIVGASEKEGRVSSPSFSKAGPPKLELQMGRKWVVENQIGKKNLVIDD  636
            +DMKTKNR DRSG V A EKE R S P+FSK GPPK+ELQMGRKW VENQIGKK+LVI +
Sbjct  283  DDMKTKNRTDRSGAVSAIEKETRASKPAFSKTGPPKMELQMGRKWAVENQIGKKDLVISE  342

Query  635  CDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGV  456
            CD+KQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVF+DVVAAFE+VNC+ VEVQCQG 
Sbjct  343  CDSKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFTDVVAAFEIVNCNNVEVQCQGS  402

Query  455  APTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQYIHVYK  276
            APT+SVDNT+GC LYL+KDSLE +ITTAKSSE+N++VPGA PD DW EHALPQQY HV+ 
Sbjct  403  APTVSVDNTTGCQLYLNKDSLETAITTAKSSEINVMVPGATPDGDWVEHALPQQYNHVFT  462

Query  275  DGQFITSPATHSGG  234
            +G+F T+P +HSG 
Sbjct  463  EGKFETTPVSHSGA  476



>ref|XP_006365096.1| PREDICTED: adenylyl cyclase-associated protein-like [Solanum 
tuberosum]
Length=472

 Score =   329 bits (844),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 153/193 (79%), Positives = 172/193 (89%), Gaps = 0/193 (0%)
 Frame = -3

Query  815  NDMKTKNRADRSGIVGASEKEGRVSSPSFSKAGPPKLELQMGRKWVVENQIGKKNLVIDD  636
            +DMKTKNRADR+G+V A EK  RVSSPS SK GPPK ELQMGRKWVVENQ+G+KNLVIDD
Sbjct  279  DDMKTKNRADRTGVVNAGEKGARVSSPSVSKTGPPKFELQMGRKWVVENQVGEKNLVIDD  338

Query  635  CDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGV  456
            CD KQSVY++GCK SVL I+GKVNNITIDKCTKMGVVF+ VVAA EVVNC+GVEVQCQG 
Sbjct  339  CDTKQSVYVYGCKGSVLLIKGKVNNITIDKCTKMGVVFAGVVAACEVVNCNGVEVQCQGS  398

Query  455  APTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQYIHVYK  276
            APTIS+DNT+GC LYL+KDSL+ SITTAKSSE+N+LVPG GPD DW EHALPQQY H YK
Sbjct  399  APTISIDNTNGCQLYLNKDSLDGSITTAKSSEINVLVPGDGPDDDWGEHALPQQYAHEYK  458

Query  275  DGQFITSPATHSG  237
            DG+F+TSP +HSG
Sbjct  459  DGRFVTSPVSHSG  471



>ref|XP_004230883.1| PREDICTED: cyclase-associated protein 1 [Solanum lycopersicum]
 ref|XP_010315302.1| PREDICTED: cyclase-associated protein 1 [Solanum lycopersicum]
Length=472

 Score =   329 bits (844),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 153/193 (79%), Positives = 173/193 (90%), Gaps = 0/193 (0%)
 Frame = -3

Query  815  NDMKTKNRADRSGIVGASEKEGRVSSPSFSKAGPPKLELQMGRKWVVENQIGKKNLVIDD  636
            +DMKTKNRADR+G+V A EKE RVSS S SK GPPK ELQMGRKWVVENQ+G+KNLVIDD
Sbjct  279  DDMKTKNRADRTGVVNAGEKEVRVSSASVSKTGPPKFELQMGRKWVVENQVGEKNLVIDD  338

Query  635  CDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGV  456
            CD KQSVY++GCK SVLQI+GKVNNITIDKCTKMGVVF+ VVAA EVVNC+GVEVQCQG 
Sbjct  339  CDTKQSVYVYGCKASVLQIKGKVNNITIDKCTKMGVVFAGVVAACEVVNCNGVEVQCQGS  398

Query  455  APTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQYIHVYK  276
            APTIS+DNT+GC LYL+K+SLE SITTAKSSE+N+LVPG GPD DW EHALPQQY H YK
Sbjct  399  APTISIDNTNGCQLYLNKNSLEGSITTAKSSEINVLVPGDGPDDDWGEHALPQQYAHEYK  458

Query  275  DGQFITSPATHSG  237
            DG+F+T+P +HSG
Sbjct  459  DGRFVTTPVSHSG  471



>ref|XP_010437609.1| PREDICTED: cyclase-associated protein 1-like [Camelina sativa]
Length=478

 Score =   329 bits (843),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 151/194 (78%), Positives = 171/194 (88%), Gaps = 0/194 (0%)
 Frame = -3

Query  815  NDMKTKNRADRSGIVGASEKEGRVSSPSFSKAGPPKLELQMGRKWVVENQIGKKNLVIDD  636
            +DMKTKNRADRSG V A EKE R S P+FSK GPPK+ELQMGRKW VENQIGKK+LVI +
Sbjct  285  DDMKTKNRADRSGAVSAIEKETRASKPAFSKTGPPKMELQMGRKWAVENQIGKKDLVISE  344

Query  635  CDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGV  456
            CD+KQSVYIFGCKDSVLQIQGKVNNITIDKC KMGVVF+DVVAAFE+VNC+ VEVQCQG 
Sbjct  345  CDSKQSVYIFGCKDSVLQIQGKVNNITIDKCNKMGVVFTDVVAAFEIVNCNNVEVQCQGS  404

Query  455  APTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQYIHVYK  276
            APT+SVDNT+GC LYL+KDSLE +ITTAKSSE+N++VPGA PD DW EHALPQQY HV+ 
Sbjct  405  APTVSVDNTTGCQLYLNKDSLETAITTAKSSEINVMVPGATPDGDWVEHALPQQYNHVFT  464

Query  275  DGQFITSPATHSGG  234
            +G+F T P +HSG 
Sbjct  465  EGKFETIPVSHSGA  478



>ref|NP_195175.1| cyclase associated protein 1 [Arabidopsis thaliana]
 sp|O65902.1|ACAP1_ARATH RecName: Full=Cyclase-associated protein 1; Short=AtCAP1; AltName: 
Full=Adenylyl cyclase-associated protein [Arabidopsis 
thaliana]
 emb|CAA18828.1| putative cyclase associated protein CAP [Arabidopsis thaliana]
 dbj|BAA28621.1| Atcap1 [Arabidopsis thaliana]
 emb|CAB80166.1| putative cyclase associated protein CAP [Arabidopsis thaliana]
 gb|ABJ17096.1| At4g34490 [Arabidopsis thaliana]
 gb|AEE86385.1| cyclase associated protein 1 [Arabidopsis thaliana]
Length=476

 Score =   328 bits (842),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 150/194 (77%), Positives = 173/194 (89%), Gaps = 0/194 (0%)
 Frame = -3

Query  815  NDMKTKNRADRSGIVGASEKEGRVSSPSFSKAGPPKLELQMGRKWVVENQIGKKNLVIDD  636
            +DMKTKNRADRSG V A EKE R S P+FSK GPPK+ELQMGRKW VENQIGKK+LVI +
Sbjct  283  DDMKTKNRADRSGAVSAVEKETRTSKPAFSKTGPPKMELQMGRKWAVENQIGKKDLVISE  342

Query  635  CDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGV  456
            CD+KQSVYI+GCKDSVLQIQGKVNNITIDKCTK+GVVF+DVVAAFE+VNC+ VEVQCQG 
Sbjct  343  CDSKQSVYIYGCKDSVLQIQGKVNNITIDKCTKVGVVFTDVVAAFEIVNCNNVEVQCQGS  402

Query  455  APTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQYIHVYK  276
            APT+SVDNT+GC LYL+KDSLE +ITTAKSSE+N++VPGA PD DW EHALPQQY HV+ 
Sbjct  403  APTVSVDNTTGCQLYLNKDSLETAITTAKSSEINVMVPGATPDGDWVEHALPQQYNHVFT  462

Query  275  DGQFITSPATHSGG  234
            +G+F T+P +HSG 
Sbjct  463  EGKFETTPVSHSGA  476



>ref|XP_008236881.1| PREDICTED: cyclase-associated protein 1 [Prunus mume]
Length=743

 Score =   336 bits (861),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 154/194 (79%), Positives = 175/194 (90%), Gaps = 0/194 (0%)
 Frame = -3

Query  815  NDMKTKNRADRSGIVGASEKEGRVSSPSFSKAGPPKLELQMGRKWVVENQIGKKNLVIDD  636
            +DMKTKNR DR+GIVG  EKE R SSPSFSKAGPPKLELQMGRKW VENQIGKK+LVI D
Sbjct  549  DDMKTKNRVDRTGIVGTQEKESRTSSPSFSKAGPPKLELQMGRKWAVENQIGKKDLVISD  608

Query  635  CDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGV  456
            CD+KQSVYIFGCKDSV+QIQGKVNNITIDKCTKMG++F+DVVAA E+VNC+ VEVQCQG 
Sbjct  609  CDSKQSVYIFGCKDSVVQIQGKVNNITIDKCTKMGILFTDVVAACEIVNCNRVEVQCQGS  668

Query  455  APTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQYIHVYK  276
            APT+SVDNT+GC  YLSKD+L AS+TTAKSSEVNILVP +GPD DW EHALP+Q+IHV+K
Sbjct  669  APTVSVDNTAGCQFYLSKDALGASVTTAKSSEVNILVPASGPDGDWAEHALPEQFIHVFK  728

Query  275  DGQFITSPATHSGG  234
            DG+F T+P +HS G
Sbjct  729  DGRFETTPVSHSAG  742



>ref|XP_009419491.1| PREDICTED: cyclase-associated protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=476

 Score =   327 bits (839),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 149/194 (77%), Positives = 172/194 (89%), Gaps = 0/194 (0%)
 Frame = -3

Query  815  NDMKTKNRADRSGIVGASEKEGRVSSPSFSKAGPPKLELQMGRKWVVENQIGKKNLVIDD  636
            +DMKTKNRADRS +V  +EK  R +S SF K GPPKLELQMGRKW VENQIGKKNLVIDD
Sbjct  283  DDMKTKNRADRSSVVAVTEKGSRANSFSFRKEGPPKLELQMGRKWAVENQIGKKNLVIDD  342

Query  635  CDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGV  456
            CD+KQ+VY +GCKDSVLQ++GKVNNIT+DKCTKMG+VF DVVAA E+VNC+GVEVQCQG 
Sbjct  343  CDSKQTVYAYGCKDSVLQVKGKVNNITVDKCTKMGIVFMDVVAACEIVNCNGVEVQCQGS  402

Query  455  APTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQYIHVYK  276
            APTISVDNTSGC LYLSKDSL ASITTAKSSE+N++VPGAGP++DW EHALPQQ++H +K
Sbjct  403  APTISVDNTSGCQLYLSKDSLGASITTAKSSEINVMVPGAGPESDWVEHALPQQFVHTFK  462

Query  275  DGQFITSPATHSGG  234
            + QF TS  +HSGG
Sbjct  463  NSQFTTSAVSHSGG  476



>ref|XP_011092784.1| PREDICTED: cyclase-associated protein 1-like [Sesamum indicum]
Length=467

 Score =   327 bits (838),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 151/193 (78%), Positives = 169/193 (88%), Gaps = 0/193 (0%)
 Frame = -3

Query  812  DMKTKNRADRSGIVGASEKEGRVSSPSFSKAGPPKLELQMGRKWVVENQIGKKNLVIDDC  633
            DMKTKNRADR+ +V  SEKE   +SP  SK GPPKLEL+MGRKWVVENQIG+ +L I DC
Sbjct  275  DMKTKNRADRTSVVSLSEKESHANSPRVSKTGPPKLELEMGRKWVVENQIGRNDLSIADC  334

Query  632  DAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGVA  453
            DAKQS+YIFGCK+SVLQIQGKVNNIT+DKCTKMGVVF DVVAA E+VNC+ VEVQCQG A
Sbjct  335  DAKQSIYIFGCKNSVLQIQGKVNNITVDKCTKMGVVFKDVVAACEIVNCNSVEVQCQGSA  394

Query  452  PTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQYIHVYKD  273
            PTISVDNT+GC LYLSKDSLEASITTAKSSEVN+LVP +  D DW EH+LPQQY HVYKD
Sbjct  395  PTISVDNTAGCQLYLSKDSLEASITTAKSSEVNVLVPASESDGDWGEHSLPQQYAHVYKD  454

Query  272  GQFITSPATHSGG  234
            GQF+T+P +HSGG
Sbjct  455  GQFVTTPVSHSGG  467



>ref|XP_009605961.1| PREDICTED: cyclase-associated protein 1 [Nicotiana tomentosiformis]
Length=475

 Score =   327 bits (838),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 153/193 (79%), Positives = 171/193 (89%), Gaps = 0/193 (0%)
 Frame = -3

Query  815  NDMKTKNRADRSGIVGASEKEGRVSSPSFSKAGPPKLELQMGRKWVVENQIGKKNLVIDD  636
            +DMK KNRADR+G+V A EKE  +SSP  SK GP KLELQMGRKWVVENQ+G+KNLVIDD
Sbjct  282  DDMKAKNRADRTGVVNAGEKEAHMSSPYISKTGPAKLELQMGRKWVVENQVGEKNLVIDD  341

Query  635  CDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGV  456
            CDAKQSVY++GCK SVLQI+GKVNNITIDKCTKMGVV + VVAA EVVNC+GVEVQCQG 
Sbjct  342  CDAKQSVYVYGCKGSVLQIKGKVNNITIDKCTKMGVVCAGVVAACEVVNCNGVEVQCQGS  401

Query  455  APTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQYIHVYK  276
            APTISVDNT+GC LYLSKDSL  SITTAKSSE+N++VPGAGPD DW EHALPQQY HVYK
Sbjct  402  APTISVDNTTGCQLYLSKDSLGGSITTAKSSEINVMVPGAGPDDDWGEHALPQQYAHVYK  461

Query  275  DGQFITSPATHSG  237
            DG F+T+P +HSG
Sbjct  462  DGHFVTTPVSHSG  474



>ref|XP_009411142.1| PREDICTED: cyclase-associated protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=474

 Score =   327 bits (837),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 151/194 (78%), Positives = 174/194 (90%), Gaps = 1/194 (1%)
 Frame = -3

Query  815  NDMKTKNRADRSGIVGASEKEGRVSSPSFSKAGPPKLELQMGRKWVVENQIGKKNLVIDD  636
            +DMKTKNRADR+G++ A+EK  R +S SFS+A PPKLELQMGRKW VENQIGKKNLVIDD
Sbjct  282  DDMKTKNRADRTGVIAATEKSPRANSFSFSRA-PPKLELQMGRKWAVENQIGKKNLVIDD  340

Query  635  CDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGV  456
            CD+KQSVYIFGCKDSVLQ++GKVNNIT+DKC KMG+VF+DVVAA EVVNC+GVEVQCQG 
Sbjct  341  CDSKQSVYIFGCKDSVLQVKGKVNNITVDKCNKMGIVFTDVVAACEVVNCNGVEVQCQGS  400

Query  455  APTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQYIHVYK  276
            APTISVDNTSGC LYLS  SL ASITTAKSSE+N+LVPGAGPD+DW EH+LPQQ++H +K
Sbjct  401  APTISVDNTSGCQLYLSSSSLGASITTAKSSEINVLVPGAGPDSDWVEHSLPQQFVHTFK  460

Query  275  DGQFITSPATHSGG  234
            DG+  TSP +HSG 
Sbjct  461  DGEMRTSPVSHSGA  474



>emb|CDY46244.1| BnaC03g66050D [Brassica napus]
Length=466

 Score =   325 bits (832),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 149/195 (76%), Positives = 173/195 (89%), Gaps = 1/195 (1%)
 Frame = -3

Query  815  NDMKTKNRADRSGIVGASEKEGRVSS-PSFSKAGPPKLELQMGRKWVVENQIGKKNLVID  639
            +DMKTKNRADRSG V A EKE R ++ P+ SK GPPK+ELQMGRKW VENQIGKK+LVI 
Sbjct  272  DDMKTKNRADRSGAVSAVEKETRTTTKPAVSKTGPPKMELQMGRKWAVENQIGKKDLVIS  331

Query  638  DCDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQG  459
            +CD+KQSVY+FGCKDSVLQIQGKVNNITIDKCTKMGVVF+DVVAAFE+VNC+ VEVQCQG
Sbjct  332  ECDSKQSVYVFGCKDSVLQIQGKVNNITIDKCTKMGVVFTDVVAAFEIVNCTNVEVQCQG  391

Query  458  VAPTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQYIHVY  279
             APT+SVDNT+GC LYL+KDSLE +ITTAKSSE+N++VPGA PD DW EHALPQQY HV+
Sbjct  392  SAPTVSVDNTTGCQLYLNKDSLETAITTAKSSEINVMVPGASPDGDWVEHALPQQYNHVF  451

Query  278  KDGQFITSPATHSGG  234
             +G+F T+P +HSG 
Sbjct  452  TEGKFETTPVSHSGA  466



>gb|KFK30061.1| hypothetical protein AALP_AA7G211700 [Arabis alpina]
Length=475

 Score =   325 bits (832),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 150/194 (77%), Positives = 171/194 (88%), Gaps = 2/194 (1%)
 Frame = -3

Query  815  NDMKTKNRADRSGIVGASEKEGRVSSPSFSKAGPPKLELQMGRKWVVENQIGKKNLVIDD  636
            +DMKTKNRADRSG V A EKE R S P+FSK GPPKLELQMGRKW VENQIGKK+LVI D
Sbjct  284  DDMKTKNRADRSGAVSAIEKETRTSKPAFSKTGPPKLELQMGRKWAVENQIGKKDLVISD  343

Query  635  CDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGV  456
            CD+KQSVY+FGCKDSVLQIQGKVNNITIDKCTK+GVVF+DVVAAFE+VNC+ VEVQCQG 
Sbjct  344  CDSKQSVYVFGCKDSVLQIQGKVNNITIDKCTKLGVVFTDVVAAFEIVNCTNVEVQCQGS  403

Query  455  APTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQYIHVYK  276
            APT+SVDNT+GC LYLSKDSLE +ITTAKSSE+N++VPG   D DW EHALPQQY H++ 
Sbjct  404  APTVSVDNTTGCQLYLSKDSLETAITTAKSSEINVMVPGT--DGDWVEHALPQQYNHLFT  461

Query  275  DGQFITSPATHSGG  234
            +G+F T+P +HSG 
Sbjct  462  EGKFETTPVSHSGA  475



>ref|XP_003541049.1| PREDICTED: cyclase-associated protein 1-like [Glycine max]
Length=469

 Score =   324 bits (831),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 154/194 (79%), Positives = 172/194 (89%), Gaps = 0/194 (0%)
 Frame = -3

Query  815  NDMKTKNRADRSGIVGASEKEGRVSSPSFSKAGPPKLELQMGRKWVVENQIGKKNLVIDD  636
            NDMKTKNR DR+G+VGA EKE   SS  FSKAGPPK ELQMGRKWVVENQI KK+LVI+D
Sbjct  276  NDMKTKNRTDRTGVVGAIEKETPASSRVFSKAGPPKFELQMGRKWVVENQIEKKDLVIED  335

Query  635  CDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGV  456
            CD+KQSVYI+GCK+SVLQI GKVNNITIDKCTK+GVVF DVVAA E+VN +GVEVQCQG 
Sbjct  336  CDSKQSVYIYGCKNSVLQILGKVNNITIDKCTKIGVVFKDVVAACEIVNSNGVEVQCQGA  395

Query  455  APTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQYIHVYK  276
            APTISVDNTSGC LYLSKDSLEASI+TAKSSE+N+LVPGA PD DW EH+LPQQYIH++K
Sbjct  396  APTISVDNTSGCQLYLSKDSLEASISTAKSSEINVLVPGADPDGDWVEHSLPQQYIHLFK  455

Query  275  DGQFITSPATHSGG  234
            +  F T+PA HSGG
Sbjct  456  NEHFETTPAAHSGG  469



>gb|KHN25370.1| Adenylyl cyclase-associated protein [Glycine soja]
Length=474

 Score =   324 bits (831),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 154/194 (79%), Positives = 172/194 (89%), Gaps = 0/194 (0%)
 Frame = -3

Query  815  NDMKTKNRADRSGIVGASEKEGRVSSPSFSKAGPPKLELQMGRKWVVENQIGKKNLVIDD  636
            NDMKTKNR DR+G+VGA EKE   SS  FSKAGPPK ELQMGRKWVVENQI KK+LVI+D
Sbjct  281  NDMKTKNRTDRTGVVGAIEKETPASSRVFSKAGPPKFELQMGRKWVVENQIEKKDLVIED  340

Query  635  CDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGV  456
            CD+KQSVYI+GCK+SVLQI GKVNNITIDKCTK+GVVF DVVAA E+VN +GVEVQCQG 
Sbjct  341  CDSKQSVYIYGCKNSVLQILGKVNNITIDKCTKIGVVFKDVVAACEIVNSNGVEVQCQGA  400

Query  455  APTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQYIHVYK  276
            APTISVDNTSGC LYLSKDSLEASI+TAKSSE+N+LVPGA PD DW EH+LPQQYIH++K
Sbjct  401  APTISVDNTSGCQLYLSKDSLEASISTAKSSEINVLVPGADPDGDWVEHSLPQQYIHLFK  460

Query  275  DGQFITSPATHSGG  234
            +  F T+PA HSGG
Sbjct  461  NEHFETTPAAHSGG  474



>emb|CDX76285.1| BnaA08g11150D [Brassica napus]
Length=466

 Score =   322 bits (824),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 148/195 (76%), Positives = 172/195 (88%), Gaps = 1/195 (1%)
 Frame = -3

Query  815  NDMKTKNRADRSGIVGASEKEGRVSS-PSFSKAGPPKLELQMGRKWVVENQIGKKNLVID  639
            +DMKTKNRADRSG V A EKE R ++ P+ SK GP K+ELQMGRKW VENQIGKK+LVI 
Sbjct  272  DDMKTKNRADRSGAVSAIEKETRTTTKPAVSKTGPAKMELQMGRKWAVENQIGKKDLVIS  331

Query  638  DCDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQG  459
            +CD+KQSVY+FGCKDSVLQIQGKVNNITIDKCTKMGVVF+DVVAAFE+VNC+ VEVQCQG
Sbjct  332  ECDSKQSVYVFGCKDSVLQIQGKVNNITIDKCTKMGVVFTDVVAAFEIVNCTNVEVQCQG  391

Query  458  VAPTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQYIHVY  279
             APT+SVDNT+GC LYL+KDSLE +ITTAKSSE+N++VPGA PD DW EHALPQQY HV+
Sbjct  392  SAPTVSVDNTTGCQLYLNKDSLETAITTAKSSEINVMVPGASPDGDWVEHALPQQYNHVF  451

Query  278  KDGQFITSPATHSGG  234
             +G+F T+P +HSG 
Sbjct  452  TEGKFETTPVSHSGA  466



>ref|XP_009374180.1| PREDICTED: cyclase-associated protein 1 [Pyrus x bretschneideri]
Length=475

 Score =   322 bits (824),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 148/193 (77%), Positives = 169/193 (88%), Gaps = 0/193 (0%)
 Frame = -3

Query  812  DMKTKNRADRSGIVGASEKEGRVSSPSFSKAGPPKLELQMGRKWVVENQIGKKNLVIDDC  633
            DMKTKNRADRSG+VG  EKE R SSP+ +K GPPK ELQMGRKWVVENQI KK+LVI +C
Sbjct  282  DMKTKNRADRSGVVGTHEKESRTSSPAVAKVGPPKFELQMGRKWVVENQIAKKDLVISEC  341

Query  632  DAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGVA  453
            D+KQSVYIFGCKDSVLQIQGKVNNITIDKC  MGV+F+DVVAA E+VNC+ VEVQCQG A
Sbjct  342  DSKQSVYIFGCKDSVLQIQGKVNNITIDKCANMGVLFTDVVAACEIVNCNRVEVQCQGSA  401

Query  452  PTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQYIHVYKD  273
            PT+SVDNT+GC  YLSKD+L ASITTAKSSEVNILVP +G D DW EHALP+Q+IH++KD
Sbjct  402  PTVSVDNTTGCQFYLSKDALGASITTAKSSEVNILVPSSGADGDWAEHALPEQFIHMFKD  461

Query  272  GQFITSPATHSGG  234
            G+F T+P +HS G
Sbjct  462  GRFETTPVSHSAG  474



>ref|XP_008377316.1| PREDICTED: cyclase-associated protein 1-like [Malus domestica]
Length=476

 Score =   322 bits (824),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 147/193 (76%), Positives = 170/193 (88%), Gaps = 0/193 (0%)
 Frame = -3

Query  812  DMKTKNRADRSGIVGASEKEGRVSSPSFSKAGPPKLELQMGRKWVVENQIGKKNLVIDDC  633
            DMKTKNRADRSG+VG  EKE R+SSP+ +K GPPK ELQMGRKWVVENQI KK+LVI +C
Sbjct  283  DMKTKNRADRSGVVGTHEKESRMSSPAVAKVGPPKFELQMGRKWVVENQIAKKDLVISEC  342

Query  632  DAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGVA  453
            D+KQSVYIFGCKDSVLQIQGKVNNITIDKC  MGV+F+DVVAA E+VNC+ VEVQCQG A
Sbjct  343  DSKQSVYIFGCKDSVLQIQGKVNNITIDKCANMGVLFTDVVAACEIVNCNRVEVQCQGSA  402

Query  452  PTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQYIHVYKD  273
            PT+SVDNT+GC  YLSKD++ ASITTAKSSEVNILVP +G D DW EHALP+Q+IH++KD
Sbjct  403  PTVSVDNTTGCQFYLSKDAMGASITTAKSSEVNILVPSSGADGDWAEHALPEQFIHMFKD  462

Query  272  GQFITSPATHSGG  234
            G+F T+P +HS G
Sbjct  463  GRFETTPVSHSAG  475



>ref|XP_009108728.1| PREDICTED: cyclase-associated protein 1-like [Brassica rapa]
Length=476

 Score =   320 bits (820),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 147/195 (75%), Positives = 172/195 (88%), Gaps = 1/195 (1%)
 Frame = -3

Query  815  NDMKTKNRADRSGIVGASEKEGRVSS-PSFSKAGPPKLELQMGRKWVVENQIGKKNLVID  639
            +DMKTKNRADRSG V A EKE R ++ P+ SK GP K+ELQMGRKW VENQIGKK+LVI 
Sbjct  282  DDMKTKNRADRSGAVSAIEKETRTTTKPAVSKTGPAKMELQMGRKWAVENQIGKKDLVIS  341

Query  638  DCDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQG  459
            +CD+KQSVY+FGCKDSVLQIQGKVNNITIDKCTKMGVVF+DVVAAFE+VNC+ VEVQCQG
Sbjct  342  ECDSKQSVYVFGCKDSVLQIQGKVNNITIDKCTKMGVVFTDVVAAFEIVNCTNVEVQCQG  401

Query  458  VAPTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQYIHVY  279
             APT+SVDNT+GC LYL+KDSLE +ITTAKSSE+N++VPGA PD DW EHALPQQY H++
Sbjct  402  SAPTVSVDNTTGCQLYLNKDSLETAITTAKSSEINVMVPGASPDGDWVEHALPQQYNHMF  461

Query  278  KDGQFITSPATHSGG  234
             +G+F T+P +HSG 
Sbjct  462  TEGKFETTPVSHSGA  476



>gb|EEC76093.1| hypothetical protein OsI_13337 [Oryza sativa Indica Group]
Length=471

 Score =   317 bits (811),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 149/202 (74%), Positives = 170/202 (84%), Gaps = 9/202 (4%)
 Frame = -3

Query  815  NDMKTKNRADRSGIVGAS--------EKEGRVSSPSFSKAGPPKLELQMGRKWVVENQIG  660
            +DMKTKNR+DRSG+V +S        EK  R  S SF K+GPPKLELQMGRKWVVENQ+G
Sbjct  271  DDMKTKNRSDRSGVVSSSTAAPAAAPEKTSRAGSFSF-KSGPPKLELQMGRKWVVENQVG  329

Query  659  KKNLVIDDCDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSG  480
            KKNL IDDCDA+QSVY++GCKDSVLQ+ GKVNNIT+DKCTK+G+VF  VVAAFEVVNC+G
Sbjct  330  KKNLAIDDCDARQSVYVYGCKDSVLQVNGKVNNITVDKCTKVGIVFKHVVAAFEVVNCNG  389

Query  479  VEVQCQGVAPTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALP  300
            VEVQCQG APTIS+DNTSGC LYLS DSL ASIT+AKSSE+N++VP    D DW EHALP
Sbjct  390  VEVQCQGTAPTISIDNTSGCQLYLSNDSLGASITSAKSSEINVMVPSGATDGDWVEHALP  449

Query  299  QQYIHVYKDGQFITSPATHSGG  234
            QQYIH +KDGQFITSP +HSG 
Sbjct  450  QQYIHSFKDGQFITSPVSHSGA  471



>gb|ABF98601.1| cyclase-associated protein, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAH01193.1| unnamed protein product [Oryza sativa Japonica Group]
Length=492

 Score =   317 bits (812),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 149/202 (74%), Positives = 170/202 (84%), Gaps = 9/202 (4%)
 Frame = -3

Query  815  NDMKTKNRADRSGIVGAS--------EKEGRVSSPSFSKAGPPKLELQMGRKWVVENQIG  660
            +DMKTKNR+DRSG+V +S        EK  R  S SF K+GPPKLELQMGRKWVVENQ+G
Sbjct  292  DDMKTKNRSDRSGVVSSSTAAPAAAPEKTSRAGSFSF-KSGPPKLELQMGRKWVVENQVG  350

Query  659  KKNLVIDDCDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSG  480
            KKNL IDDCDA+QSVY++GCKDSVLQ+ GKVNNIT+DKCTK+G+VF  VVAAFEVVNC+G
Sbjct  351  KKNLAIDDCDARQSVYVYGCKDSVLQVNGKVNNITVDKCTKVGIVFKHVVAAFEVVNCNG  410

Query  479  VEVQCQGVAPTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALP  300
            VEVQCQG APTIS+DNTSGC LYLS DSL ASIT+AKSSE+N++VP    D DW EHALP
Sbjct  411  VEVQCQGTAPTISIDNTSGCQLYLSNDSLGASITSAKSSEINVMVPSGATDGDWVEHALP  470

Query  299  QQYIHVYKDGQFITSPATHSGG  234
            QQYIH +KDGQFITSP +HSG 
Sbjct  471  QQYIHSFKDGQFITSPVSHSGA  492



>ref|NP_001145831.1| adenylyl cyclase-associated protein [Zea mays]
 gb|ACL52671.1| unknown [Zea mays]
Length=389

 Score =   313 bits (802),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 146/202 (72%), Positives = 170/202 (84%), Gaps = 9/202 (4%)
 Frame = -3

Query  815  NDMKTKNRADRSGIVGAS--------EKEGRVSSPSFSKAGPPKLELQMGRKWVVENQIG  660
            +DMK+KNRADRSG+V ++        EK  R  S SF K+GPPKLELQMGRKWVVENQ+G
Sbjct  189  DDMKSKNRADRSGVVSSTAPAPAAAPEKTSRAGSFSF-KSGPPKLELQMGRKWVVENQVG  247

Query  659  KKNLVIDDCDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSG  480
            KK L IDDCD++QSVY++GCKDSVLQ+ GKVNNIT+DKCTK G+VF DVVAAFE+VNC+G
Sbjct  248  KKTLAIDDCDSRQSVYVYGCKDSVLQVNGKVNNITVDKCTKFGIVFKDVVAAFEIVNCNG  307

Query  479  VEVQCQGVAPTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALP  300
            VEVQCQG +PTIS+DNTSGC LYLSKDSL ASIT+AKSSE+N++VP  G D DW EHALP
Sbjct  308  VEVQCQGTSPTISIDNTSGCQLYLSKDSLGASITSAKSSEINVMVPSGGADGDWVEHALP  367

Query  299  QQYIHVYKDGQFITSPATHSGG  234
            QQYIH +KDGQF TSP +HSG 
Sbjct  368  QQYIHSFKDGQFTTSPVSHSGA  389



>ref|XP_003606897.1| Adenylyl cyclase-associated protein [Medicago truncatula]
 gb|AES89094.1| adenylyl cyclase-associated protein [Medicago truncatula]
Length=472

 Score =   316 bits (809),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 147/194 (76%), Positives = 171/194 (88%), Gaps = 0/194 (0%)
 Frame = -3

Query  815  NDMKTKNRADRSGIVGASEKEGRVSSPSFSKAGPPKLELQMGRKWVVENQIGKKNLVIDD  636
            +DMKTKNRADRSG+VG S KE + +  +FSK GPPKLELQMGRKWVVENQI +K+LVI+D
Sbjct  279  DDMKTKNRADRSGVVGNSVKESQAAPRAFSKVGPPKLELQMGRKWVVENQIDQKSLVIED  338

Query  635  CDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGV  456
            CD+KQSVY++GCK+SVLQIQGKVNNITID C K GVVF DVVAAFEVVN +GVEVQCQG 
Sbjct  339  CDSKQSVYVYGCKNSVLQIQGKVNNITIDNCKKTGVVFKDVVAAFEVVNSNGVEVQCQGS  398

Query  455  APTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQYIHVYK  276
            APTISVDNTSGC +YLSKDSLE SI+TAKSSE+N+LVP    D DW EH+LPQQYIH++K
Sbjct  399  APTISVDNTSGCQIYLSKDSLETSISTAKSSEINVLVPNVESDGDWVEHSLPQQYIHLFK  458

Query  275  DGQFITSPATHSGG  234
            +G+F T+PA+HSGG
Sbjct  459  EGRFETTPASHSGG  472



>ref|XP_006650514.1| PREDICTED: cyclase-associated protein 1-like [Oryza brachyantha]
Length=491

 Score =   316 bits (810),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 150/202 (74%), Positives = 171/202 (85%), Gaps = 9/202 (4%)
 Frame = -3

Query  815  NDMKTKNRADRSGIVGAS--------EKEGRVSSPSFSKAGPPKLELQMGRKWVVENQIG  660
            +DMKTKNR+DRSG+V +S        EK  R  S SF K+GPPKLELQMGRKWVVENQ+G
Sbjct  291  DDMKTKNRSDRSGVVSSSTAAPAATPEKTPRAGSFSF-KSGPPKLELQMGRKWVVENQVG  349

Query  659  KKNLVIDDCDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSG  480
            KKNL IDDCDA+QSVY++GCKDSVLQ+ GKVNNIT+DKCTK+GVVF DVVAAFEVVNC+G
Sbjct  350  KKNLAIDDCDARQSVYVYGCKDSVLQVNGKVNNITVDKCTKVGVVFKDVVAAFEVVNCNG  409

Query  479  VEVQCQGVAPTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALP  300
            VEVQCQG APTIS+DNTSGC LYLSK SL ASIT+AKSSE+N++VP    D DW EHALP
Sbjct  410  VEVQCQGTAPTISIDNTSGCQLYLSKGSLGASITSAKSSEINVMVPSGTTDGDWVEHALP  469

Query  299  QQYIHVYKDGQFITSPATHSGG  234
            QQYIH +KDGQF+TSP +HSG 
Sbjct  470  QQYIHSFKDGQFVTSPVSHSGA  491



>ref|XP_007131840.1| hypothetical protein PHAVU_011G045700g [Phaseolus vulgaris]
 ref|XP_007131841.1| hypothetical protein PHAVU_011G045700g [Phaseolus vulgaris]
 gb|ESW03834.1| hypothetical protein PHAVU_011G045700g [Phaseolus vulgaris]
 gb|ESW03835.1| hypothetical protein PHAVU_011G045700g [Phaseolus vulgaris]
Length=472

 Score =   316 bits (809),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 149/193 (77%), Positives = 168/193 (87%), Gaps = 0/193 (0%)
 Frame = -3

Query  812  DMKTKNRADRSGIVGASEKEGRVSSPSFSKAGPPKLELQMGRKWVVENQIGKKNLVIDDC  633
            DMKTKNR DR+G+VG  E+E   +S   SKAGPPK ELQMGRKWVVENQI  K+LVI +C
Sbjct  280  DMKTKNRTDRTGVVGTIERESHATSRVPSKAGPPKFELQMGRKWVVENQIENKDLVIGEC  339

Query  632  DAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGVA  453
            DAKQSVYI+GCK+SVLQI GKVNNITIDKC+KMGVVF DVVAAFE+VN +GVEVQCQG A
Sbjct  340  DAKQSVYIYGCKNSVLQIPGKVNNITIDKCSKMGVVFKDVVAAFEIVNSNGVEVQCQGAA  399

Query  452  PTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQYIHVYKD  273
            PTISVDNTSGC LYLSKDSL+A+ITTAKSSE+N+LVPGA  D DW EH+LPQQYIHV+KD
Sbjct  400  PTISVDNTSGCQLYLSKDSLQATITTAKSSEINVLVPGAETDGDWVEHSLPQQYIHVFKD  459

Query  272  GQFITSPATHSGG  234
            G F T+ A+HSGG
Sbjct  460  GHFETTSASHSGG  472



>gb|EEE59831.1| hypothetical protein OsJ_12395 [Oryza sativa Japonica Group]
Length=493

 Score =   316 bits (810),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 149/202 (74%), Positives = 170/202 (84%), Gaps = 9/202 (4%)
 Frame = -3

Query  815  NDMKTKNRADRSGIVGAS--------EKEGRVSSPSFSKAGPPKLELQMGRKWVVENQIG  660
            +DMKTKNR+DRSG+V +S        EK  R  S SF K+GPPKLELQMGRKWVVENQ+G
Sbjct  293  DDMKTKNRSDRSGVVSSSTAAPAAAPEKTSRAGSFSF-KSGPPKLELQMGRKWVVENQVG  351

Query  659  KKNLVIDDCDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSG  480
            KKNL IDDCDA+QSVY++GCKDSVLQ+ GKVNNIT+DKCTK+G+VF  VVAAFEVVNC+G
Sbjct  352  KKNLAIDDCDARQSVYVYGCKDSVLQVNGKVNNITVDKCTKVGIVFKHVVAAFEVVNCNG  411

Query  479  VEVQCQGVAPTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALP  300
            VEVQCQG APTIS+DNTSGC LYLS DSL ASIT+AKSSE+N++VP    D DW EHALP
Sbjct  412  VEVQCQGTAPTISIDNTSGCQLYLSNDSLGASITSAKSSEINVMVPSGATDGDWVEHALP  471

Query  299  QQYIHVYKDGQFITSPATHSGG  234
            QQYIH +KDGQFITSP +HSG 
Sbjct  472  QQYIHSFKDGQFITSPVSHSGA  493



>ref|XP_008643463.1| PREDICTED: uncharacterized protein LOC100279338 isoform X1 [Zea 
mays]
 gb|AFW67774.1| adenylyl cyclase-associated protein [Zea mays]
Length=488

 Score =   315 bits (808),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 146/202 (72%), Positives = 170/202 (84%), Gaps = 9/202 (4%)
 Frame = -3

Query  815  NDMKTKNRADRSGIVGAS--------EKEGRVSSPSFSKAGPPKLELQMGRKWVVENQIG  660
            +DMK+KNRADRSG+V ++        EK  R  S SF K+GPPKLELQMGRKWVVENQ+G
Sbjct  288  DDMKSKNRADRSGVVSSTAPAPAAAPEKTSRAGSFSF-KSGPPKLELQMGRKWVVENQVG  346

Query  659  KKNLVIDDCDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSG  480
            KK L IDDCD++QSVY++GCKDSVLQ+ GKVNNIT+DKCTK G+VF DVVAAFE+VNC+G
Sbjct  347  KKTLAIDDCDSRQSVYVYGCKDSVLQVNGKVNNITVDKCTKFGIVFKDVVAAFEIVNCNG  406

Query  479  VEVQCQGVAPTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALP  300
            VEVQCQG +PTIS+DNTSGC LYLSKDSL ASIT+AKSSE+N++VP  G D DW EHALP
Sbjct  407  VEVQCQGTSPTISIDNTSGCQLYLSKDSLGASITSAKSSEINVMVPSGGADGDWVEHALP  466

Query  299  QQYIHVYKDGQFITSPATHSGG  234
            QQYIH +KDGQF TSP +HSG 
Sbjct  467  QQYIHSFKDGQFTTSPVSHSGA  488



>ref|XP_002463964.1| hypothetical protein SORBIDRAFT_01g009760 [Sorghum bicolor]
 gb|EER90962.1| hypothetical protein SORBIDRAFT_01g009760 [Sorghum bicolor]
Length=409

 Score =   313 bits (801),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 150/202 (74%), Positives = 170/202 (84%), Gaps = 9/202 (4%)
 Frame = -3

Query  815  NDMKTKNRADRSGIVGAS--------EKEGRVSSPSFSKAGPPKLELQMGRKWVVENQIG  660
            +DMKTKNRADRSG+V +S        EK  R  S SF K+GPPKLELQMGRKWVVENQ+G
Sbjct  209  DDMKTKNRADRSGVVSSSVAAPAAAPEKTSRAGSFSF-KSGPPKLELQMGRKWVVENQVG  267

Query  659  KKNLVIDDCDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSG  480
            KK L IDDCD++QSVY++GCKDSVLQ+ GKVNNIT+DKCTK G+VF DVVAAFEVVNC+G
Sbjct  268  KKTLAIDDCDSRQSVYVYGCKDSVLQVNGKVNNITVDKCTKFGIVFKDVVAAFEVVNCNG  327

Query  479  VEVQCQGVAPTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALP  300
            VEVQCQG APTIS+DNTSGC LYLSKDSL ASIT+AKSSE+N++VP  G D DW EHALP
Sbjct  328  VEVQCQGTAPTISIDNTSGCQLYLSKDSLGASITSAKSSEINVMVPSGGTDGDWVEHALP  387

Query  299  QQYIHVYKDGQFITSPATHSGG  234
            QQYIH +KDGQF TSP +HSG 
Sbjct  388  QQYIHSFKDGQFTTSPVSHSGA  409



>ref|XP_009396021.1| PREDICTED: cyclase-associated protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=473

 Score =   315 bits (806),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 143/194 (74%), Positives = 167/194 (86%), Gaps = 0/194 (0%)
 Frame = -3

Query  815  NDMKTKNRADRSGIVGASEKEGRVSSPSFSKAGPPKLELQMGRKWVVENQIGKKNLVIDD  636
            +DMKTKNR DRSG V A+EK G  SS S +    PK ELQMGRKW VENQIG KNL+IDD
Sbjct  280  DDMKTKNRVDRSGAVAATEKRGHTSSFSNNSKASPKFELQMGRKWSVENQIGNKNLIIDD  339

Query  635  CDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGV  456
            CD+KQSVYIFGCKDSVLQ++GKVNNIT+DKCTK+G+VF DVVAA E+VNC+GVEVQCQG 
Sbjct  340  CDSKQSVYIFGCKDSVLQVKGKVNNITLDKCTKVGIVFMDVVAACEIVNCNGVEVQCQGS  399

Query  455  APTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQYIHVYK  276
            APT+S+DNTSGC LYLS DSL  SITTAKSSE+NIL+PGAGPD+DW EH+LPQQY+H +K
Sbjct  400  APTVSIDNTSGCQLYLSNDSLGTSITTAKSSEINILIPGAGPDSDWVEHSLPQQYLHNFK  459

Query  275  DGQFITSPATHSGG  234
            +G+F T+P +HSG 
Sbjct  460  NGEFTTAPVSHSGA  473



>ref|XP_008375926.1| PREDICTED: cyclase-associated protein 1 [Malus domestica]
Length=476

 Score =   314 bits (805),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 145/194 (75%), Positives = 169/194 (87%), Gaps = 0/194 (0%)
 Frame = -3

Query  815  NDMKTKNRADRSGIVGASEKEGRVSSPSFSKAGPPKLELQMGRKWVVENQIGKKNLVIDD  636
            +DMKTKNRADR+G++G  EKE R SSP+ +K G PK ELQMGRKWVVENQI KK+LVI +
Sbjct  282  DDMKTKNRADRTGVIGTHEKESRTSSPAVAKVGTPKFELQMGRKWVVENQIAKKDLVISE  341

Query  635  CDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGV  456
             D+KQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGV+F+DVVAA E+VNC+ VEVQCQG 
Sbjct  342  SDSKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVLFTDVVAACEIVNCNCVEVQCQGS  401

Query  455  APTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQYIHVYK  276
            APT+SVDNT+GC  YLSKD+L ASITTAKSSEVN+LVP +G D DW EHALP+Q+IHV+K
Sbjct  402  APTVSVDNTAGCQFYLSKDALGASITTAKSSEVNVLVPSSGADGDWAEHALPEQFIHVFK  461

Query  275  DGQFITSPATHSGG  234
            DG+F T+  +HS G
Sbjct  462  DGRFETTSVSHSAG  475



>gb|KJB32500.1| hypothetical protein B456_005G243200 [Gossypium raimondii]
Length=478

 Score =   314 bits (805),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 148/198 (75%), Positives = 165/198 (83%), Gaps = 4/198 (2%)
 Frame = -3

Query  815  NDMKTKNRADRSGIVGASEKEGRVSSPS----FSKAGPPKLELQMGRKWVVENQIGKKNL  648
            +DMK KNR DR+G+V  SEK+   +  +      K  PPKLELQMGRKW VEN IG KNL
Sbjct  281  DDMKAKNRTDRTGVVSTSEKQTSSTPSTTTPTVKKVAPPKLELQMGRKWAVENHIGNKNL  340

Query  647  VIDDCDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQ  468
            VIDDCDAKQSVY+FGCKDSVLQIQGKVNNIT+DKCTKMGV+F DVVAAFE+VNC+GVE Q
Sbjct  341  VIDDCDAKQSVYVFGCKDSVLQIQGKVNNITLDKCTKMGVLFKDVVAAFEIVNCNGVEAQ  400

Query  467  CQGVAPTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQYI  288
            CQG APTISVDNTSG  LYLSKDSLEA+ITTAKS ++N+LVPGA  DADW EH LPQQYI
Sbjct  401  CQGSAPTISVDNTSGAQLYLSKDSLEAAITTAKSIDINVLVPGATSDADWAEHPLPQQYI  460

Query  287  HVYKDGQFITSPATHSGG  234
            HVYK+GQF TSP +HSG 
Sbjct  461  HVYKNGQFETSPVSHSGA  478



>ref|XP_004981942.1| PREDICTED: adenylyl cyclase-associated protein-like [Setaria 
italica]
Length=486

 Score =   314 bits (805),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 146/201 (73%), Positives = 169/201 (84%), Gaps = 8/201 (4%)
 Frame = -3

Query  815  NDMKTKNRADRSGIVGAS-------EKEGRVSSPSFSKAGPPKLELQMGRKWVVENQIGK  657
            +DMK+KNR DRSG+V ++       EK  R  S SF K+GPPKLELQMGRKWVVENQ+GK
Sbjct  287  DDMKSKNRTDRSGVVSSTAAAPAAPEKTSRAGSFSF-KSGPPKLELQMGRKWVVENQVGK  345

Query  656  KNLVIDDCDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGV  477
            K L IDDCD++QS+Y++GCKDSVLQ+ GKVNNIT+DKCTK G+VF DVVAAFEVVNC+GV
Sbjct  346  KTLAIDDCDSRQSIYVYGCKDSVLQVNGKVNNITVDKCTKFGIVFKDVVAAFEVVNCNGV  405

Query  476  EVQCQGVAPTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQ  297
            EVQCQG APTIS+DNTSGC LYLSKDSL ASIT+AKSSE+N++VP    D DW EHALPQ
Sbjct  406  EVQCQGTAPTISIDNTSGCQLYLSKDSLGASITSAKSSEINVMVPSGATDGDWVEHALPQ  465

Query  296  QYIHVYKDGQFITSPATHSGG  234
            QYIH +KDGQFITSP +HSG 
Sbjct  466  QYIHSFKDGQFITSPVSHSGA  486



>ref|XP_008665331.1| PREDICTED: cyclase-associated protein 1-like [Zea mays]
 tpg|DAA51084.1| TPA: hypothetical protein ZEAMMB73_069661 [Zea mays]
Length=488

 Score =   314 bits (804),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 147/201 (73%), Positives = 170/201 (85%), Gaps = 8/201 (4%)
 Frame = -3

Query  815  NDMKTKNRADRSGIVGAS-------EKEGRVSSPSFSKAGPPKLELQMGRKWVVENQIGK  657
            +DMKTKNRA+RSG+V ++       EK  R  S SF K+GPPKLELQMGRKWVVENQ+GK
Sbjct  289  DDMKTKNRAERSGVVSSAATPAAAPEKTSRAGSFSF-KSGPPKLELQMGRKWVVENQVGK  347

Query  656  KNLVIDDCDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGV  477
            K L IDDCD++QSVY++GCKDSVLQ+ GKVNNIT+DKCTK G+VF DVVAAFEVVNC+GV
Sbjct  348  KTLAIDDCDSRQSVYVYGCKDSVLQVNGKVNNITVDKCTKFGIVFKDVVAAFEVVNCNGV  407

Query  476  EVQCQGVAPTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQ  297
            EVQCQG +PTIS+DNTSGC LYLSKDSL ASIT+AKSSE+N++VP  G D DW EHALPQ
Sbjct  408  EVQCQGTSPTISIDNTSGCQLYLSKDSLGASITSAKSSEINVMVPSGGSDGDWVEHALPQ  467

Query  296  QYIHVYKDGQFITSPATHSGG  234
            QYIH +KDGQF TSP +HSG 
Sbjct  468  QYIHSFKDGQFTTSPVSHSGA  488



>gb|KHG11477.1| Adenylyl cyclase-associated [Gossypium arboreum]
Length=478

 Score =   313 bits (801),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 147/198 (74%), Positives = 164/198 (83%), Gaps = 4/198 (2%)
 Frame = -3

Query  815  NDMKTKNRADRSGIVGASEKEGRVSSPS----FSKAGPPKLELQMGRKWVVENQIGKKNL  648
            +DMK KNR DR+G+V   EK+   +  +      K  PPKLELQMGRKW VEN IG KNL
Sbjct  281  DDMKAKNRTDRTGVVSTGEKQTSSTPSTTTPTIKKVAPPKLELQMGRKWAVENHIGNKNL  340

Query  647  VIDDCDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQ  468
            VIDDCDAKQSVY+FGCKDSVLQIQGKVNNIT+DKCTKMGV+F DVVAAFE+VNC+GVE Q
Sbjct  341  VIDDCDAKQSVYVFGCKDSVLQIQGKVNNITLDKCTKMGVLFKDVVAAFEIVNCNGVEAQ  400

Query  467  CQGVAPTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQYI  288
            CQG APTISVDNTSG  LYLSKDSLEA+ITTAKS ++N+LVPGA  DADW EH LPQQYI
Sbjct  401  CQGSAPTISVDNTSGAQLYLSKDSLEAAITTAKSIDINVLVPGATSDADWAEHPLPQQYI  460

Query  287  HVYKDGQFITSPATHSGG  234
            HVYK+GQF TSP +HSG 
Sbjct  461  HVYKNGQFETSPVSHSGA  478



>gb|EPS61598.1| adenylyl cyclase-associated protein [Genlisea aurea]
Length=472

 Score =   311 bits (798),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 143/194 (74%), Positives = 169/194 (87%), Gaps = 0/194 (0%)
 Frame = -3

Query  815  NDMKTKNRADRSGIVGASEKEGRVSSPSFSKAGPPKLELQMGRKWVVENQIGKKNLVIDD  636
            +DMKTKN+ DRS +V AS+++     P+FSKAGPPKLELQMGRKW+VENQ+G+ NLVI++
Sbjct  279  DDMKTKNQVDRSFLVTASDQKSVAPKPAFSKAGPPKLELQMGRKWMVENQVGRSNLVIEE  338

Query  635  CDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGV  456
            CDAKQSVY++ C +SVL I+GKVNNITIDKCTK+GVVF DVVAA E+VNC  V+VQCQG 
Sbjct  339  CDAKQSVYVYKCNESVLHIRGKVNNITIDKCTKLGVVFKDVVAACEIVNCDSVKVQCQGT  398

Query  455  APTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQYIHVYK  276
            APTISVDNTSGC LYLSKDSL+ASITTAKSSEVN+LVP +  + DW EHALPQQY+HVYK
Sbjct  399  APTISVDNTSGCQLYLSKDSLKASITTAKSSEVNVLVPASESEEDWGEHALPQQYVHVYK  458

Query  275  DGQFITSPATHSGG  234
            DGQF+TS  +HSGG
Sbjct  459  DGQFVTSAVSHSGG  472



>ref|XP_003560473.1| PREDICTED: cyclase-associated protein 1 [Brachypodium distachyon]
Length=487

 Score =   310 bits (793),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 147/201 (73%), Positives = 169/201 (84%), Gaps = 8/201 (4%)
 Frame = -3

Query  815  NDMKTKNRADRSGIVG-------ASEKEGRVSSPSFSKAGPPKLELQMGRKWVVENQIGK  657
            +DMKTKNRADRSG+V        A EK  R +S +F K+GPPKLELQMGRKWVVENQ+GK
Sbjct  288  DDMKTKNRADRSGVVNSTAATAPAPEKTSRGASFAF-KSGPPKLELQMGRKWVVENQVGK  346

Query  656  KNLVIDDCDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGV  477
            K+L IDDCD++QS+Y++GCKDSVLQ+ GKVNNIT+DKC K G+VF DVVAAFEVVNC+GV
Sbjct  347  KDLAIDDCDSRQSIYVYGCKDSVLQVNGKVNNITVDKCAKFGIVFKDVVAAFEVVNCNGV  406

Query  476  EVQCQGVAPTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQ  297
            EVQCQG APTIS+DNTSGC LYLSK SL ASIT+AKSSE+N+LVP    D DW EHALPQ
Sbjct  407  EVQCQGTAPTISIDNTSGCQLYLSKHSLGASITSAKSSEMNVLVPSGVTDGDWVEHALPQ  466

Query  296  QYIHVYKDGQFITSPATHSGG  234
            QYIH +KDGQFITSP +HSG 
Sbjct  467  QYIHSFKDGQFITSPVSHSGA  487



>gb|AAX95693.1| CAP protein [Oryza sativa Japonica Group]
Length=500

 Score =   310 bits (794),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 149/210 (71%), Positives = 170/210 (81%), Gaps = 17/210 (8%)
 Frame = -3

Query  815  NDMKTKNRADRSGIVGAS--------EKEGRVSSPSFSKAGPPKLELQMGRKWVVENQIG  660
            +DMKTKNR+DRSG+V +S        EK  R  S SF K+GPPKLELQMGRKWVVENQ+G
Sbjct  292  DDMKTKNRSDRSGVVSSSTAAPAAAPEKTSRAGSFSF-KSGPPKLELQMGRKWVVENQVG  350

Query  659  KKNLVIDDCDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSG  480
            KKNL IDDCDA+QSVY++GCKDSVLQ+ GKVNNIT+DKCTK+G+VF  VVAAFEVVNC+G
Sbjct  351  KKNLAIDDCDARQSVYVYGCKDSVLQVNGKVNNITVDKCTKVGIVFKHVVAAFEVVNCNG  410

Query  479  VEVQC--------QGVAPTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDA  324
            VEVQC        QG APTIS+DNTSGC LYLS DSL ASIT+AKSSE+N++VP    D 
Sbjct  411  VEVQCQRLKFFNLQGTAPTISIDNTSGCQLYLSNDSLGASITSAKSSEINVMVPSGATDG  470

Query  323  DWEEHALPQQYIHVYKDGQFITSPATHSGG  234
            DW EHALPQQYIH +KDGQFITSP +HSG 
Sbjct  471  DWVEHALPQQYIHSFKDGQFITSPVSHSGA  500



>ref|XP_010107846.1| Adenylyl cyclase-associated protein 2 [Morus notabilis]
 gb|EXC17246.1| Adenylyl cyclase-associated protein 2 [Morus notabilis]
Length=627

 Score =   312 bits (800),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 145/166 (87%), Positives = 159/166 (96%), Gaps = 0/166 (0%)
 Frame = -3

Query  815  NDMKTKNRADRSGIVGASEKEGRVSSPSFSKAGPPKLELQMGRKWVVENQIGKKNLVIDD  636
            +DMKTKNR DR+  VGASEKE R SSPSFSKAGPPKLELQMGRKWVVENQIG+KNLVIDD
Sbjct  282  DDMKTKNRTDRTSFVGASEKETRTSSPSFSKAGPPKLELQMGRKWVVENQIGRKNLVIDD  341

Query  635  CDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGV  456
            CDAKQSVYIFGCK+SVLQ+QGKVNNIT+DKCTKMGVVF+DVVAAFE+VNC+GVEVQCQG 
Sbjct  342  CDAKQSVYIFGCKESVLQVQGKVNNITVDKCTKMGVVFTDVVAAFEIVNCNGVEVQCQGS  401

Query  455  APTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADW  318
            APTISVDNT+GC LYLSKDSLEASITTAKSSE+N+LVPG+GPD+DW
Sbjct  402  APTISVDNTAGCQLYLSKDSLEASITTAKSSEINVLVPGSGPDSDW  447



>ref|XP_004507425.1| PREDICTED: adenylyl cyclase-associated protein-like [Cicer arietinum]
Length=469

 Score =   307 bits (787),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 144/194 (74%), Positives = 167/194 (86%), Gaps = 0/194 (0%)
 Frame = -3

Query  815  NDMKTKNRADRSGIVGASEKEGRVSSPSFSKAGPPKLELQMGRKWVVENQIGKKNLVIDD  636
            +DMKTKNR DRSG+VG++ KE    S +  K GPPK ELQMGRKWVVENQI +K+LVI+D
Sbjct  276  DDMKTKNRTDRSGVVGSTVKESHAGSRAAPKVGPPKFELQMGRKWVVENQIDQKSLVIED  335

Query  635  CDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGV  456
            CDAKQSVYI+GCK+SVLQ+QGKVNNITID C KMGVVF DVVAA E+VN +GVEVQCQG 
Sbjct  336  CDAKQSVYIYGCKNSVLQVQGKVNNITIDNCRKMGVVFKDVVAACEIVNSNGVEVQCQGS  395

Query  455  APTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQYIHVYK  276
            APTISVDNTSGC +YLSKDSLE SI+TAKSSE+N+LVPG   D DW EH+LPQQY H++K
Sbjct  396  APTISVDNTSGCQIYLSKDSLETSISTAKSSEINVLVPGTVSDGDWVEHSLPQQYNHLFK  455

Query  275  DGQFITSPATHSGG  234
            DG+F T+PA+HSGG
Sbjct  456  DGRFETTPASHSGG  469



>gb|KJB79113.1| hypothetical protein B456_013G037400 [Gossypium raimondii]
 gb|KJB79116.1| hypothetical protein B456_013G037400 [Gossypium raimondii]
Length=338

 Score =   293 bits (749),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 143/175 (82%), Positives = 153/175 (87%), Gaps = 1/175 (1%)
 Frame = -3

Query  812  DMKTKNRADRSGIVGASEKEGRVSSPSFSKAGPPKLELQMGRKWVVENQIGKKNLVIDDC  633
            DMKTKNR DR+G+V AS KE   SSPSFSKAGPPKLELQMGRKW VENQIG+KNLVIDDC
Sbjct  153  DMKTKNRTDRTGVVSASGKETHSSSPSFSKAGPPKLELQMGRKWAVENQIGRKNLVIDDC  212

Query  632  DAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGVA  453
            DAKQSVYI+GCKDSVLQIQGKVNNITIDKCTKMGVVF DVVAA EVVNC+GVEVQCQG A
Sbjct  213  DAKQSVYIYGCKDSVLQIQGKVNNITIDKCTKMGVVFKDVVAACEVVNCNGVEVQCQGSA  272

Query  452  PTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQYI  288
            PTISVDNTSGC LYLSKDSL  SITTAKSSE+N+LVP  GPD DW +    + Y+
Sbjct  273  PTISVDNTSGCQLYLSKDSLGTSITTAKSSEINVLVP-TGPDGDWSDLTHQKHYL  326



>gb|EMS59857.1| Adenylyl cyclase-associated protein [Triticum urartu]
Length=380

 Score =   293 bits (750),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 138/199 (69%), Positives = 163/199 (82%), Gaps = 5/199 (3%)
 Frame = -3

Query  815  NDMKTKNRADRSGIVGASEKEGRVSSPSF-----SKAGPPKLELQMGRKWVVENQIGKKN  651
            +DMK KNRADRSG+V +S      +  S      SK G PKLELQMGRKWVVENQ+G+K+
Sbjct  182  DDMKAKNRADRSGVVTSSAAAPAPAKTSRAGTFGSKTGTPKLELQMGRKWVVENQVGRKD  241

Query  650  LVIDDCDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEV  471
            L ID+CD+KQS+Y+FGCKDSVLQ+ GKVNNIT+DKCTK G+VF DVVAAFEVVNC+GVEV
Sbjct  242  LAIDECDSKQSIYVFGCKDSVLQVNGKVNNITVDKCTKFGIVFKDVVAAFEVVNCNGVEV  301

Query  470  QCQGVAPTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQY  291
            QCQG APTIS+DNT+GC LYL+K+SL ASIT+AKSSE+N+LVP    D DW EH LPQQY
Sbjct  302  QCQGTAPTISIDNTAGCQLYLNKESLAASITSAKSSEMNVLVPSDETDGDWVEHPLPQQY  361

Query  290  IHVYKDGQFITSPATHSGG  234
            IH ++DGQF TSP +HSG 
Sbjct  362  IHFFQDGQFTTSPVSHSGA  380



>ref|XP_008447035.1| PREDICTED: cyclase-associated protein 1 [Cucumis melo]
Length=474

 Score =   296 bits (757),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 142/197 (72%), Positives = 166/197 (84%), Gaps = 4/197 (2%)
 Frame = -3

Query  815  NDMKTKNRADRSGIVGASEKEGRVSSPSFSK---AGPPKLELQMGRKWVVENQIGKKNLV  645
            +DMKTKNRA+R+GIV  +E  G  +SPS SK   A  PK ELQMGRKW +E+QIGKK+LV
Sbjct  279  DDMKTKNRAERTGIVNTNEI-GHRNSPSVSKPVVAPNPKFELQMGRKWAIEHQIGKKDLV  337

Query  644  IDDCDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQC  465
            I DCD+KQSVYI+GCKDSVLQ+QGKVNNITIDKC+K GVVF+DVVAA EVVNC+G+E+QC
Sbjct  338  ISDCDSKQSVYIYGCKDSVLQVQGKVNNITIDKCSKTGVVFTDVVAACEVVNCNGIEIQC  397

Query  464  QGVAPTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQYIH  285
            QG APTISVDNT GC LYLS DSL+ASITTAKSSE+N+LV G+ PD DW EHALPQQ++H
Sbjct  398  QGSAPTISVDNTGGCQLYLSNDSLKASITTAKSSEINVLVRGSDPDGDWVEHALPQQFVH  457

Query  284  VYKDGQFITSPATHSGG  234
            V KDG   T+P +HSG 
Sbjct  458  VLKDGHIETTPVSHSGA  474



>gb|KJB79114.1| hypothetical protein B456_013G037400 [Gossypium raimondii]
Length=465

 Score =   295 bits (754),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 143/177 (81%), Positives = 154/177 (87%), Gaps = 1/177 (1%)
 Frame = -3

Query  812  DMKTKNRADRSGIVGASEKEGRVSSPSFSKAGPPKLELQMGRKWVVENQIGKKNLVIDDC  633
            DMKTKNR DR+G+V AS KE   SSPSFSKAGPPKLELQMGRKW VENQIG+KNLVIDDC
Sbjct  280  DMKTKNRTDRTGVVSASGKETHSSSPSFSKAGPPKLELQMGRKWAVENQIGRKNLVIDDC  339

Query  632  DAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGVA  453
            DAKQSVYI+GCKDSVLQIQGKVNNITIDKCTKMGVVF DVVAA EVVNC+GVEVQCQG A
Sbjct  340  DAKQSVYIYGCKDSVLQIQGKVNNITIDKCTKMGVVFKDVVAACEVVNCNGVEVQCQGSA  399

Query  452  PTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQYIHV  282
            PTISVDNTSGC LYLSKDSL  SITTAKSSE+N+LVP  GPD DW +    + Y+ +
Sbjct  400  PTISVDNTSGCQLYLSKDSLGTSITTAKSSEINVLVP-TGPDGDWSDLTHQKHYLKL  455



>gb|EMT04895.1| Adenylyl cyclase-associated protein [Aegilops tauschii]
Length=413

 Score =   292 bits (748),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 139/200 (70%), Positives = 164/200 (82%), Gaps = 7/200 (4%)
 Frame = -3

Query  815  NDMKTKNRADRSGIV------GASEKEGRVSSPSFSKAGPPKLELQMGRKWVVENQIGKK  654
            +DMK KNRADRSG+V       A  K  R  + + SK G PKLELQMGRKWVVENQ+G+K
Sbjct  215  DDMKAKNRADRSGVVTSSAAAPAPAKTSRAGTFA-SKTGTPKLELQMGRKWVVENQVGRK  273

Query  653  NLVIDDCDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVE  474
            +L ID+CD+KQS+YI+GCKDSVLQ+ GKVNNIT+DKCTK G+VF DVVAAFEVVNC+GVE
Sbjct  274  DLAIDECDSKQSIYIYGCKDSVLQVNGKVNNITVDKCTKFGIVFKDVVAAFEVVNCNGVE  333

Query  473  VQCQGVAPTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQ  294
            VQCQG APTIS+DNT+GC LYL+K+SL ASIT+AKSSE+N+LVP    D DW EH LPQQ
Sbjct  334  VQCQGTAPTISIDNTAGCQLYLNKESLGASITSAKSSEMNVLVPSDETDGDWVEHPLPQQ  393

Query  293  YIHVYKDGQFITSPATHSGG  234
            YIH ++DGQF TSP +HSG 
Sbjct  394  YIHFFQDGQFTTSPVSHSGA  413



>ref|XP_008664624.1| PREDICTED: cyclase-associated protein 1-like [Zea mays]
 tpg|DAA48845.1| TPA: hypothetical protein ZEAMMB73_354941 [Zea mays]
Length=458

 Score =   293 bits (750),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 136/194 (70%), Positives = 158/194 (81%), Gaps = 0/194 (0%)
 Frame = -3

Query  815  NDMKTKNRADRSGIVGASEKEGRVSSPSFSKAGPPKLELQMGRKWVVENQIGKKNLVIDD  636
            +DMK+KNR DR+G+V A  KE R S P  S  GP KLELQMGRKWVVE+ +G K+L I+ 
Sbjct  265  DDMKSKNRTDRTGVVAAEGKETRNSPPFSSTKGPAKLELQMGRKWVVEHHVGNKSLTIEG  324

Query  635  CDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGV  456
            CD KQSVY++GCKD VLQ++GKVNNITIDKCTK+GV+F  VVAA E+VNCS  EVQC+G 
Sbjct  325  CDTKQSVYVYGCKDCVLQVKGKVNNITIDKCTKVGVLFKGVVAACEIVNCSSAEVQCEGS  384

Query  455  APTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQYIHVYK  276
             PTIS+DNTSGC LYLSK+SLEASITTAKSSE+N LVP A  D DW EH+LPQQYIH +K
Sbjct  385  VPTISIDNTSGCQLYLSKESLEASITTAKSSEINALVPDANSDGDWAEHSLPQQYIHAFK  444

Query  275  DGQFITSPATHSGG  234
            DGQF TSP +HSG 
Sbjct  445  DGQFTTSPVSHSGA  458



>ref|XP_004150414.1| PREDICTED: cyclase-associated protein 1-like [Cucumis sativus]
 gb|KGN44349.1| hypothetical protein Csa_7G267970 [Cucumis sativus]
Length=474

 Score =   293 bits (750),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 141/197 (72%), Positives = 167/197 (85%), Gaps = 4/197 (2%)
 Frame = -3

Query  815  NDMKTKNRADRSGIVGASEKEGRVSSPSFSK---AGPPKLELQMGRKWVVENQIGKKNLV  645
            +DMKTKNRA+R+GIV  +E  G  +SPS SK   A  PK ELQMGRKW +E+QIGKK+LV
Sbjct  279  DDMKTKNRAERTGIVNTNEI-GHKNSPSVSKPVVAPKPKFELQMGRKWAIEHQIGKKDLV  337

Query  644  IDDCDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQC  465
            I DCD+KQSVYI+GCKDSVLQ+QGKVNNITIDKC+K GVVF+DVVAA EVVNC+G+E+QC
Sbjct  338  ISDCDSKQSVYIYGCKDSVLQVQGKVNNITIDKCSKTGVVFTDVVAACEVVNCNGIEIQC  397

Query  464  QGVAPTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQYIH  285
            QG APTISVDNT GC LYLS +SL+ASITTAKSSE+N+LV G+ P  DW EHALPQQ++H
Sbjct  398  QGSAPTISVDNTGGCQLYLSNESLKASITTAKSSEINVLVRGSDPLGDWVEHALPQQFVH  457

Query  284  VYKDGQFITSPATHSGG  234
            V KDG+  T+P +HSGG
Sbjct  458  VLKDGRIETTPVSHSGG  474



>gb|ADZ16117.1| adenylyl cyclase associated protein [Gossypium hirsutum]
Length=445

 Score =   291 bits (746),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 142/165 (86%), Positives = 149/165 (90%), Gaps = 1/165 (1%)
 Frame = -3

Query  812  DMKTKNRADRSGIVGASEKEGRVSSPSFSKAGPPKLELQMGRKWVVENQIGKKNLVIDDC  633
            DMKTKNR DR+G+V AS KE   SSPSFSKAGPPKLELQMGRKW VENQIG+KNLVIDDC
Sbjct  280  DMKTKNRTDRTGVVSASGKETHSSSPSFSKAGPPKLELQMGRKWAVENQIGRKNLVIDDC  339

Query  632  DAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGVA  453
            DAKQSVYI+GCKDSVLQIQGKVNNITIDKCTKMGVVF DVVAA EVVNC+GVEVQCQG A
Sbjct  340  DAKQSVYIYGCKDSVLQIQGKVNNITIDKCTKMGVVFKDVVAACEVVNCNGVEVQCQGSA  399

Query  452  PTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADW  318
            PTISVDNTSGC LYLSKDSL  SITTAKSSE+N+LVP  GPD DW
Sbjct  400  PTISVDNTSGCQLYLSKDSLGTSITTAKSSEINVLVP-TGPDGDW  443



>gb|AEN70776.1| adenylyl cyclase-associated protein [Gossypium mustelinum]
Length=445

 Score =   291 bits (746),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 142/165 (86%), Positives = 149/165 (90%), Gaps = 1/165 (1%)
 Frame = -3

Query  812  DMKTKNRADRSGIVGASEKEGRVSSPSFSKAGPPKLELQMGRKWVVENQIGKKNLVIDDC  633
            DMKTKNR DR+G+V AS KE   SSPSFSKAGPPKLELQMGRKW VENQIG+KNLVIDDC
Sbjct  280  DMKTKNRTDRTGVVSASGKETHSSSPSFSKAGPPKLELQMGRKWAVENQIGRKNLVIDDC  339

Query  632  DAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGVA  453
            DAKQSVYI+GCKDSVLQIQGKVNNITIDKCTKMGVVF DVVAA EVVNC+GVEVQCQG A
Sbjct  340  DAKQSVYIYGCKDSVLQIQGKVNNITIDKCTKMGVVFKDVVAACEVVNCNGVEVQCQGSA  399

Query  452  PTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADW  318
            PTISVDNTSGC LYLSKDSL  SITTAKSSE+N+LVP  GPD DW
Sbjct  400  PTISVDNTSGCQLYLSKDSLGTSITTAKSSEINVLVP-TGPDGDW  443



>gb|KJB79115.1| hypothetical protein B456_013G037400 [Gossypium raimondii]
Length=454

 Score =   291 bits (746),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 142/165 (86%), Positives = 149/165 (90%), Gaps = 1/165 (1%)
 Frame = -3

Query  812  DMKTKNRADRSGIVGASEKEGRVSSPSFSKAGPPKLELQMGRKWVVENQIGKKNLVIDDC  633
            DMKTKNR DR+G+V AS KE   SSPSFSKAGPPKLELQMGRKW VENQIG+KNLVIDDC
Sbjct  280  DMKTKNRTDRTGVVSASGKETHSSSPSFSKAGPPKLELQMGRKWAVENQIGRKNLVIDDC  339

Query  632  DAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGVA  453
            DAKQSVYI+GCKDSVLQIQGKVNNITIDKCTKMGVVF DVVAA EVVNC+GVEVQCQG A
Sbjct  340  DAKQSVYIYGCKDSVLQIQGKVNNITIDKCTKMGVVFKDVVAACEVVNCNGVEVQCQGSA  399

Query  452  PTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADW  318
            PTISVDNTSGC LYLSKDSL  SITTAKSSE+N+LVP  GPD DW
Sbjct  400  PTISVDNTSGCQLYLSKDSLGTSITTAKSSEINVLVP-TGPDGDW  443



>gb|KJB79111.1| hypothetical protein B456_013G037400 [Gossypium raimondii]
Length=445

 Score =   291 bits (745),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 142/165 (86%), Positives = 149/165 (90%), Gaps = 1/165 (1%)
 Frame = -3

Query  812  DMKTKNRADRSGIVGASEKEGRVSSPSFSKAGPPKLELQMGRKWVVENQIGKKNLVIDDC  633
            DMKTKNR DR+G+V AS KE   SSPSFSKAGPPKLELQMGRKW VENQIG+KNLVIDDC
Sbjct  280  DMKTKNRTDRTGVVSASGKETHSSSPSFSKAGPPKLELQMGRKWAVENQIGRKNLVIDDC  339

Query  632  DAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGVA  453
            DAKQSVYI+GCKDSVLQIQGKVNNITIDKCTKMGVVF DVVAA EVVNC+GVEVQCQG A
Sbjct  340  DAKQSVYIYGCKDSVLQIQGKVNNITIDKCTKMGVVFKDVVAACEVVNCNGVEVQCQGSA  399

Query  452  PTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADW  318
            PTISVDNTSGC LYLSKDSL  SITTAKSSE+N+LVP  GPD DW
Sbjct  400  PTISVDNTSGCQLYLSKDSLGTSITTAKSSEINVLVP-TGPDGDW  443



>gb|ADZ16113.1| adenylyl cyclase associated protein [Gossypium barbadense]
 gb|AEN70778.1| adenylyl cyclase-associated protein [Gossypium darwinii]
 gb|AEN70780.1| adenylyl cyclase-associated protein [Gossypium tomentosum]
Length=445

 Score =   291 bits (744),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 141/165 (85%), Positives = 149/165 (90%), Gaps = 1/165 (1%)
 Frame = -3

Query  812  DMKTKNRADRSGIVGASEKEGRVSSPSFSKAGPPKLELQMGRKWVVENQIGKKNLVIDDC  633
            DMKTKNR DR+G+V AS KE   SSPSFSKAGPPKLELQMGRKW VENQIG+KNLVIDDC
Sbjct  280  DMKTKNRTDRTGVVSASGKETHSSSPSFSKAGPPKLELQMGRKWAVENQIGRKNLVIDDC  339

Query  632  DAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGVA  453
            DAKQSVYI+GCKDSVLQIQGKVNNITIDKCTKMGVVF DVVAA EVVNC+GVEVQCQG A
Sbjct  340  DAKQSVYIYGCKDSVLQIQGKVNNITIDKCTKMGVVFKDVVAACEVVNCNGVEVQCQGSA  399

Query  452  PTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADW  318
            PTISVDNTSGC LYLSKDSL  SITTAKSSE+N+L+P  GPD DW
Sbjct  400  PTISVDNTSGCQLYLSKDSLGTSITTAKSSEINVLMP-TGPDGDW  443



>gb|ADZ16115.1| adenylyl cyclase associated protein [Gossypium raimondii]
Length=445

 Score =   290 bits (743),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 141/165 (85%), Positives = 148/165 (90%), Gaps = 1/165 (1%)
 Frame = -3

Query  812  DMKTKNRADRSGIVGASEKEGRVSSPSFSKAGPPKLELQMGRKWVVENQIGKKNLVIDDC  633
            DMKTKNR DR+G+V AS KE   SSPSFSKAGPPKLELQMGRKW VENQIG+KNLVIDDC
Sbjct  280  DMKTKNRTDRTGVVSASGKETHSSSPSFSKAGPPKLELQMGRKWAVENQIGRKNLVIDDC  339

Query  632  DAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGVA  453
            DAKQSVYI+GCKDSVLQIQGKVNNITIDKCTKMGV F DVVAA EVVNC+GVEVQCQG A
Sbjct  340  DAKQSVYIYGCKDSVLQIQGKVNNITIDKCTKMGVAFKDVVAACEVVNCNGVEVQCQGSA  399

Query  452  PTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADW  318
            PTISVDNTSGC LYLSKDSL  SITTAKSSE+N+LVP  GPD DW
Sbjct  400  PTISVDNTSGCQLYLSKDSLGTSITTAKSSEINVLVP-TGPDGDW  443



>ref|NP_001061934.1| Os08g0447900 [Oryza sativa Japonica Group]
 dbj|BAD09441.1| putative adenylyl cyclase associated protein [Oryza sativa Japonica 
Group]
 dbj|BAD09824.1| putative adenylyl cyclase associated protein [Oryza sativa Japonica 
Group]
 dbj|BAF23848.1| Os08g0447900 [Oryza sativa Japonica Group]
 dbj|BAG92501.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE68786.1| hypothetical protein OsJ_27511 [Oryza sativa Japonica Group]
Length=464

 Score =   290 bits (743),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 133/193 (69%), Positives = 157/193 (81%), Gaps = 0/193 (0%)
 Frame = -3

Query  812  DMKTKNRADRSGIVGASEKEGRVSSPSFSKAGPPKLELQMGRKWVVENQIGKKNLVIDDC  633
            DMK+KNR DR+G+V A  KE      S S   P KLELQMGRKW+VE+ +G KNLVI+DC
Sbjct  272  DMKSKNRTDRTGVVAAEGKEAHKKPSSSSTKLPSKLELQMGRKWIVEHHVGNKNLVIEDC  331

Query  632  DAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGVA  453
            D KQS+Y+FGCKDSVLQ++GKVNNITIDKC+KMG++F  VVAA E+VNC+ +EVQC+G  
Sbjct  332  DTKQSIYVFGCKDSVLQVKGKVNNITIDKCSKMGLLFKGVVAACEIVNCNSIEVQCEGSV  391

Query  452  PTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQYIHVYKD  273
            PTIS+DNTSGC LYLSK+SLE SITTAKSSE+N LVP A  D DW EH+LPQQ+IH +KD
Sbjct  392  PTISIDNTSGCQLYLSKESLETSITTAKSSEINALVPDANSDGDWAEHSLPQQFIHAFKD  451

Query  272  GQFITSPATHSGG  234
            GQF T PA HSGG
Sbjct  452  GQFTTLPACHSGG  464



>gb|AEN70782.1| adenylyl cyclase-associated protein [Gossypium barbadense var. 
brasiliense]
 gb|AEN70784.1| adenylyl cyclase-associated protein [Gossypium barbadense var. 
peruvianum]
Length=445

 Score =   290 bits (742),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 141/165 (85%), Positives = 148/165 (90%), Gaps = 1/165 (1%)
 Frame = -3

Query  812  DMKTKNRADRSGIVGASEKEGRVSSPSFSKAGPPKLELQMGRKWVVENQIGKKNLVIDDC  633
            DMKTKNR DR+G+V AS KE   SSPSFSKAGPPKLELQMGRKW VENQIG+KNLVIDDC
Sbjct  280  DMKTKNRTDRTGVVSASGKETHSSSPSFSKAGPPKLELQMGRKWAVENQIGRKNLVIDDC  339

Query  632  DAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGVA  453
            DAKQSVYI+GCKDSVLQIQGKVNNITIDKCTKMGVVF DVVAA EVVNC+GVEVQCQG A
Sbjct  340  DAKQSVYIYGCKDSVLQIQGKVNNITIDKCTKMGVVFKDVVAACEVVNCNGVEVQCQGSA  399

Query  452  PTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADW  318
            PTISVDNTSGC LYL KDSL  SITTAKSSE+N+LVP  GPD DW
Sbjct  400  PTISVDNTSGCQLYLRKDSLGTSITTAKSSEINVLVP-TGPDGDW  443



>gb|EAZ07173.1| hypothetical protein OsI_29418 [Oryza sativa Indica Group]
Length=464

 Score =   290 bits (742),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 133/193 (69%), Positives = 157/193 (81%), Gaps = 0/193 (0%)
 Frame = -3

Query  812  DMKTKNRADRSGIVGASEKEGRVSSPSFSKAGPPKLELQMGRKWVVENQIGKKNLVIDDC  633
            DMK+KNR DR+G+V A  KE      S S   P KLELQMGRKW+VE+ +G KNLVI+DC
Sbjct  272  DMKSKNRTDRTGVVTAEGKEAHKKPSSSSTKLPSKLELQMGRKWIVEHHVGNKNLVIEDC  331

Query  632  DAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGVA  453
            D KQS+Y+FGCKDSVLQ++GKVNNITIDKC+KMG++F  VVAA E+VNC+ +EVQC+G  
Sbjct  332  DTKQSIYVFGCKDSVLQVKGKVNNITIDKCSKMGLLFKGVVAACEIVNCNSIEVQCEGSV  391

Query  452  PTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQYIHVYKD  273
            PTIS+DNTSGC LYLSK+SLE SITTAKSSE+N LVP A  D DW EH+LPQQ+IH +KD
Sbjct  392  PTISIDNTSGCQLYLSKESLETSITTAKSSEINALVPDANSDGDWAEHSLPQQFIHAFKD  451

Query  272  GQFITSPATHSGG  234
            GQF T PA HSGG
Sbjct  452  GQFTTLPACHSGG  464



>ref|XP_004973587.1| PREDICTED: adenylyl cyclase-associated protein-like [Setaria 
italica]
Length=462

 Score =   287 bits (735),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 137/195 (70%), Positives = 160/195 (82%), Gaps = 2/195 (1%)
 Frame = -3

Query  815  NDMKTKNRADRSGIVGASEKEGRVSSPSF-SKAGPPKLELQMGRKWVVENQIGKKNLVID  639
            +DMK+K+R DR+G+V A  KE R ++PSF S  GP KLELQMGRKWVVE+ IG K L I+
Sbjct  269  DDMKSKHRTDRTGVVTADGKETR-NAPSFGSNKGPAKLELQMGRKWVVEHHIGNKGLTIE  327

Query  638  DCDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQG  459
            DCD KQSVY +GCKD VLQI+GKVNNITIDKCTK+GV+F  VVAA E+VNC+ VEVQC+G
Sbjct  328  DCDTKQSVYAYGCKDCVLQIKGKVNNITIDKCTKVGVLFKGVVAACEIVNCNSVEVQCEG  387

Query  458  VAPTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQYIHVY  279
              PTIS+DNTSGC LYLSK+SLE SITTAKSSE+N LVP A  D DW EH+LPQQYIH +
Sbjct  388  SVPTISIDNTSGCQLYLSKESLETSITTAKSSEINALVPDANSDGDWAEHSLPQQYIHAF  447

Query  278  KDGQFITSPATHSGG  234
            +DGQF TSP +HSG 
Sbjct  448  QDGQFTTSPVSHSGA  462



>ref|XP_006659462.1| PREDICTED: cyclase-associated protein 1-like [Oryza brachyantha]
Length=466

 Score =   287 bits (735),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 134/196 (68%), Positives = 157/196 (80%), Gaps = 3/196 (2%)
 Frame = -3

Query  812  DMKTKNRADRSGIV---GASEKEGRVSSPSFSKAGPPKLELQMGRKWVVENQIGKKNLVI  642
            DMK+KNR DR+G+V   G   KE   +  S S   P +LELQMGRKW+VE+ IG KNL+I
Sbjct  271  DMKSKNRTDRTGVVATEGKERKEAHKAPYSSSTKSPARLELQMGRKWIVEHHIGNKNLII  330

Query  641  DDCDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQ  462
            +DCD KQSVY+FGCKD VLQ++GKVNNITIDKC KMG++F  VVAA E+VNC+ VEVQC+
Sbjct  331  EDCDTKQSVYVFGCKDCVLQVKGKVNNITIDKCGKMGLLFKGVVAACEIVNCNSVEVQCE  390

Query  461  GVAPTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQYIHV  282
            G  PTIS+DNTSGC LYLSK+SLE SITTAKSSE+N LVP A  D DW EH+LPQQ+IH 
Sbjct  391  GSVPTISIDNTSGCQLYLSKESLETSITTAKSSEINALVPDANSDGDWAEHSLPQQFIHA  450

Query  281  YKDGQFITSPATHSGG  234
            +KDGQF TSPA HSGG
Sbjct  451  FKDGQFTTSPACHSGG  466



>gb|KJB79112.1| hypothetical protein B456_013G037400 [Gossypium raimondii]
Length=446

 Score =   286 bits (733),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 142/166 (86%), Positives = 149/166 (90%), Gaps = 2/166 (1%)
 Frame = -3

Query  812  DMKTKNRADRSGIVGASEKEGRVSSPSFSKAGPPKLELQMGRKWVVENQIGKKNLVIDDC  633
            DMKTKNR DR+G+V AS KE   SSPSFSKAGPPKLELQMGRKW VENQIG+KNLVIDDC
Sbjct  280  DMKTKNRTDRTGVVSASGKETHSSSPSFSKAGPPKLELQMGRKWAVENQIGRKNLVIDDC  339

Query  632  DAKQSVYIFGCKDSVLQIQ-GKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGV  456
            DAKQSVYI+GCKDSVLQIQ GKVNNITIDKCTKMGVVF DVVAA EVVNC+GVEVQCQG 
Sbjct  340  DAKQSVYIYGCKDSVLQIQAGKVNNITIDKCTKMGVVFKDVVAACEVVNCNGVEVQCQGS  399

Query  455  APTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADW  318
            APTISVDNTSGC LYLSKDSL  SITTAKSSE+N+LVP  GPD DW
Sbjct  400  APTISVDNTSGCQLYLSKDSLGTSITTAKSSEINVLVP-TGPDGDW  444



>gb|EYU42620.1| hypothetical protein MIMGU_mgv1a021022mg [Erythranthe guttata]
Length=456

 Score =   286 bits (733),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 135/193 (70%), Positives = 155/193 (80%), Gaps = 15/193 (8%)
 Frame = -3

Query  812  DMKTKNRADRSGIVGASEKEGRVSSPSFSKAGPPKLELQMGRKWVVENQIGKKNLVIDDC  633
            +MK KNR DR G+V  SEKE R SSP+ +K GPPKLELQM               VID+C
Sbjct  279  EMKAKNRTDRVGVVSISEKESRASSPALTKTGPPKLELQM---------------VIDEC  323

Query  632  DAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGVA  453
            DAKQ+VY++GCK+SVLQIQGKVNNIT+DKCTKMG+VF DVVAA E+VNC+ VEVQCQG A
Sbjct  324  DAKQTVYVYGCKNSVLQIQGKVNNITLDKCTKMGIVFKDVVAACEIVNCNSVEVQCQGSA  383

Query  452  PTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQYIHVYKD  273
            PTISVDNT+GC LYLSKDSLE SITTAKSSE+N+LVP +  D DW EHALPQQYIHVYKD
Sbjct  384  PTISVDNTAGCQLYLSKDSLETSITTAKSSEINVLVPASETDGDWGEHALPQQYIHVYKD  443

Query  272  GQFITSPATHSGG  234
            GQ +T+P +HSG 
Sbjct  444  GQIVTTPVSHSGA  456



>ref|XP_010235186.1| PREDICTED: cyclase-associated protein 1-like [Brachypodium distachyon]
Length=465

 Score =   286 bits (731),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 134/196 (68%), Positives = 158/196 (81%), Gaps = 2/196 (1%)
 Frame = -3

Query  815  NDMKTKNRADRSGIVGASEKEGR-VSSPSFSKA-GPPKLELQMGRKWVVENQIGKKNLVI  642
            +DMK+KNR DR+G+V    K+ R VS+P+ +K   P K ELQMGRKWVVE+ IG K L I
Sbjct  270  DDMKSKNRTDRTGVVATEGKQSRNVSAPTSTKGPAPAKFELQMGRKWVVEHHIGNKGLTI  329

Query  641  DDCDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQ  462
            +DCD KQSVY+FGCKDSVLQ++GKVNNIT+DKCTK+GV+F  VVAAFEVVNC+ VEVQC+
Sbjct  330  EDCDTKQSVYVFGCKDSVLQVKGKVNNITMDKCTKLGVLFKGVVAAFEVVNCNSVEVQCE  389

Query  461  GVAPTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQYIHV  282
            G  PTIS+DNTSGC LYLS +SLEASITTAKSSEVN LVP    + DW EH LPQQYIH 
Sbjct  390  GSVPTISIDNTSGCQLYLSNESLEASITTAKSSEVNALVPDVNSEGDWTEHPLPQQYIHA  449

Query  281  YKDGQFITSPATHSGG  234
            +K+GQF T P +HSG 
Sbjct  450  FKEGQFTTLPVSHSGA  465



>ref|XP_002444442.1| hypothetical protein SORBIDRAFT_07g022030 [Sorghum bicolor]
 gb|EES13937.1| hypothetical protein SORBIDRAFT_07g022030 [Sorghum bicolor]
Length=459

 Score =   284 bits (726),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 133/195 (68%), Positives = 162/195 (83%), Gaps = 2/195 (1%)
 Frame = -3

Query  815  NDMKTKNRADRSGIVGASEKEGRVSSPSFSKA-GPPKLELQMGRKWVVENQIGKKNLVID  639
            +DMK+KNR D++G+V A+E +G  ++ SFS    P KLELQMGRKWVVE+ +G K+L+I+
Sbjct  266  DDMKSKNRTDKTGVV-AAEGKGTRNALSFSSTKAPAKLELQMGRKWVVEHHVGNKSLIIE  324

Query  638  DCDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQG  459
            DCD KQSVY++GCKD VLQ++GKVNNITIDKCTK+GV+F  VVAA E+VNC+  EVQC+G
Sbjct  325  DCDTKQSVYVYGCKDCVLQVKGKVNNITIDKCTKVGVLFKGVVAACEIVNCNSAEVQCEG  384

Query  458  VAPTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQYIHVY  279
              PTIS+DNTSGC LYLSK+SLEASITTAKSSE+N LVP A  D DW EH+LPQQYIH +
Sbjct  385  SVPTISIDNTSGCQLYLSKESLEASITTAKSSEINALVPDANNDGDWAEHSLPQQYIHAF  444

Query  278  KDGQFITSPATHSGG  234
            KDGQF TSP +HSG 
Sbjct  445  KDGQFTTSPVSHSGA  459



>emb|CAN61863.1| hypothetical protein VITISV_043448 [Vitis vinifera]
Length=479

 Score =   282 bits (722),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 136/167 (81%), Positives = 150/167 (90%), Gaps = 8/167 (5%)
 Frame = -3

Query  815  NDMKTKNRADRSGIVGASEKEGRVSSPSFSKAGPPKLELQMGRKWVVENQIGKKNLVIDD  636
            +DMKTKNRADRSG+VGA +KEGRVSSPSFSKAGPPK        WVVENQIG+KNLVIDD
Sbjct  279  DDMKTKNRADRSGVVGAGQKEGRVSSPSFSKAGPPK--------WVVENQIGRKNLVIDD  330

Query  635  CDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGV  456
            CDAKQSVY++GCKDSVL+IQGKVNNITIDKCTKMG+VF+DVVAA EVVNC+ VEVQCQG 
Sbjct  331  CDAKQSVYVYGCKDSVLKIQGKVNNITIDKCTKMGIVFADVVAACEVVNCNSVEVQCQGS  390

Query  455  APTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWE  315
            APTISVDNT+GC LYL KD+LEASITTAKSSE+N+LVPGA PD DW 
Sbjct  391  APTISVDNTAGCQLYLGKDALEASITTAKSSEINVLVPGAEPDGDWR  437



>gb|AEN70786.1| adenylyl cyclase-associated protein [Gossypium hirsutum subsp. 
latifolium]
Length=445

 Score =   280 bits (717),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 142/165 (86%), Positives = 149/165 (90%), Gaps = 1/165 (1%)
 Frame = -3

Query  812  DMKTKNRADRSGIVGASEKEGRVSSPSFSKAGPPKLELQMGRKWVVENQIGKKNLVIDDC  633
            DMKTKNR DR+G+V AS KE R SSPS SKAGPPKLELQMGRKW VENQIG+KNLVIDDC
Sbjct  280  DMKTKNRTDRTGVVSASGKETRSSSPSSSKAGPPKLELQMGRKWAVENQIGRKNLVIDDC  339

Query  632  DAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGVA  453
            DAKQSVYI+GCKDSVLQIQGKVNNITIDKCTKMGVVF DVVAA EVVNC+GVEVQCQG A
Sbjct  340  DAKQSVYIYGCKDSVLQIQGKVNNITIDKCTKMGVVFKDVVAACEVVNCNGVEVQCQGSA  399

Query  452  PTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADW  318
            PTISVDNTSGC LYLSKDSL  SITTAKSSE+N+LVP  GPD DW
Sbjct  400  PTISVDNTSGCQLYLSKDSLGTSITTAKSSEINVLVP-TGPDGDW  443



>ref|XP_002976329.1| hypothetical protein SELMODRAFT_175612 [Selaginella moellendorffii]
 gb|EFJ22589.1| hypothetical protein SELMODRAFT_175612 [Selaginella moellendorffii]
Length=501

 Score =   271 bits (692),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 125/194 (64%), Positives = 159/194 (82%), Gaps = 1/194 (1%)
 Frame = -3

Query  815  NDMKTKNRADRSGIVGASEKEGRVSSPSFSKAGPPKLELQMGRKWVVENQIGKKNLVIDD  636
            +DMKTKNRA+R G V ASEK   V+     KA  P  ELQ+ RKWVVENQ   K ++I +
Sbjct  309  DDMKTKNRAERPGFVQASEKTSNVAVTQ-PKASTPVFELQLDRKWVVENQTNNKEIIISE  367

Query  635  CDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGV  456
            C+ +QSVYIFGCK SV+QI+GKVNN+T DKC+K G+VF DVVAA EVVNC+ VEVQCQG+
Sbjct  368  CNPRQSVYIFGCKGSVIQIRGKVNNVTFDKCSKTGLVFKDVVAACEVVNCTSVEVQCQGM  427

Query  455  APTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQYIHVYK  276
            APTI+VDNT+GC LYLS++SL+ASITTAKSSE+N+LVPG+  + D+ EHALP+Q+++VY+
Sbjct  428  APTIAVDNTNGCQLYLSRESLKASITTAKSSEINVLVPGSTAEDDYVEHALPEQFVNVYE  487

Query  275  DGQFITSPATHSGG  234
            DG+F+T+P  HSGG
Sbjct  488  DGRFVTTPVAHSGG  501



>ref|XP_002987315.1| hypothetical protein SELMODRAFT_269241 [Selaginella moellendorffii]
 gb|EFJ11630.1| hypothetical protein SELMODRAFT_269241 [Selaginella moellendorffii]
Length=491

 Score =   270 bits (689),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 125/194 (64%), Positives = 158/194 (81%), Gaps = 1/194 (1%)
 Frame = -3

Query  815  NDMKTKNRADRSGIVGASEKEGRVSSPSFSKAGPPKLELQMGRKWVVENQIGKKNLVIDD  636
            +DMKTKNRA+R G V ASEK   V+     KA  P  ELQ+ RKWVVENQ   K ++I +
Sbjct  299  DDMKTKNRAERPGFVQASEKTSNVAVTQ-PKASTPVFELQLDRKWVVENQTNNKEIIISE  357

Query  635  CDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGV  456
            C+ +QSVYIFGCK SV+QI+GKVNN+T DKC+K G+VF DVVAA EVVNC+ VEVQCQG+
Sbjct  358  CNPRQSVYIFGCKGSVIQIRGKVNNVTFDKCSKTGLVFKDVVAACEVVNCTSVEVQCQGM  417

Query  455  APTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQYIHVYK  276
            APTI+VDNT+GC LYLS +SL+ASITTAKSSE+N+LVPG+  + D+ EHALP+Q+++VY+
Sbjct  418  APTIAVDNTNGCQLYLSTESLKASITTAKSSEINVLVPGSTAEDDYVEHALPEQFVNVYE  477

Query  275  DGQFITSPATHSGG  234
            DG+F+T+P  HSGG
Sbjct  478  DGRFVTTPVAHSGG  491



>ref|XP_001773273.1| predicted protein [Physcomitrella patens]
 gb|EDQ61963.1| predicted protein [Physcomitrella patens]
Length=512

 Score =   252 bits (644),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 123/198 (62%), Positives = 152/198 (77%), Gaps = 5/198 (3%)
 Frame = -3

Query  815  NDMKTKNRADRSGIVGA----SEKEGRVSSPSFSKAGPPKLELQMGRKWVVENQIGKKNL  648
            +DMKTKNRADRSG V A    SEK    S+ +  K G PK EL  GRKWVVE Q+G +N+
Sbjct  316  DDMKTKNRADRSGAVPAGSAPSEKITDASTAASPKIGTPKCELD-GRKWVVEYQVGNRNI  374

Query  647  VIDDCDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQ  468
            ++D C   +S+YIFGCKDSV+Q+QGKVN I  DKC K  +VF+DVVAA E+VNC+ VEVQ
Sbjct  375  ILDSCKPNESIYIFGCKDSVIQVQGKVNAIAFDKCIKSALVFTDVVAACEIVNCTSVEVQ  434

Query  467  CQGVAPTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQYI  288
            C G APTIS+DNT+GC LYL   SL+A+ITTAKSS VN+LVPGA  D+D  EHALP+Q++
Sbjct  435  CMGTAPTISIDNTNGCQLYLGLKSLDAAITTAKSSAVNVLVPGATEDSDPVEHALPEQFL  494

Query  287  HVYKDGQFITSPATHSGG  234
            + +KDGQF T+P +HSGG
Sbjct  495  NSFKDGQFTTTPVSHSGG  512



>ref|XP_005650031.1| hypothetical protein COCSUDRAFT_46736 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE25487.1| hypothetical protein COCSUDRAFT_46736 [Coccomyxa subellipsoidea 
C-169]
Length=376

 Score =   198 bits (504),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 88/170 (52%), Positives = 126/170 (74%), Gaps = 2/170 (1%)
 Frame = -3

Query  743  SSPSFSKAGPPKLELQMGRKWVVENQIGKKNLVIDDCDAKQSVYIFGCKDSVLQIQGKVN  564
            + P+ SK  PP+ E + GRKWV+EN +G   +VI D + +Q+VYI+ C +S +Q++GKVN
Sbjct  209  AKPAASK--PPRTECEQGRKWVIENHVGNPEIVISDTNPRQAVYIYKCSNSTIQVKGKVN  266

Query  563  NITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGVAPTISVDNTSGCLLYLSKDSLEAS  384
             I++D C ++G++F D+VAA E+VN + ++ Q  GV PTI+VD   G  LYLS DSL   
Sbjct  267  AISVDSCQRVGLLFEDIVAACELVNSTRIQAQATGVVPTIAVDKCDGVQLYLSADSLGVD  326

Query  383  ITTAKSSEVNILVPGAGPDADWEEHALPQQYIHVYKDGQFITSPATHSGG  234
            ITTAKSSEVN++VPGA P+AD  EHA+P+QY+  YK+G+F+T+P +HS G
Sbjct  327  ITTAKSSEVNVIVPGATPEADLVEHAIPEQYLSQYKNGKFVTAPVSHSAG  376



>ref|XP_003285939.1| hypothetical protein DICPUDRAFT_53913 [Dictyostelium purpureum]
 gb|EGC37548.1| hypothetical protein DICPUDRAFT_53913 [Dictyostelium purpureum]
Length=471

 Score =   184 bits (467),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 84/191 (44%), Positives = 132/191 (69%), Gaps = 5/191 (3%)
 Frame = -3

Query  815  NDMKTKNRADRSGIVGASEKEGRVSSPSFSKAGPPKLELQMGRKWVVENQIGKKNLVIDD  636
            NDMK+KN  D+S +V AS K+ +V +P    A PPK  L+ G KW VE Q+  K ++I +
Sbjct  285  NDMKSKNFTDKSSVVKASSKQEKVVAP----AKPPKFGLE-GNKWCVEYQVNNKEIIISE  339

Query  635  CDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGV  456
             D++Q+VYI+ C ++V+QI+GKVN IT+D C K  +VF + +++ EVVNC+ +E+Q  G 
Sbjct  340  TDSRQTVYIYQCVNTVVQIKGKVNAITLDGCKKTAIVFENAISSCEVVNCTSIEIQVTGR  399

Query  455  APTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQYIHVYK  276
             P++++D TSG  +YLS  SL+  I ++KSSE+N+L+PGA P+ D  E A+P+Q+  + +
Sbjct  400  VPSVAIDKTSGAQVYLSATSLDTEIVSSKSSEMNVLIPGATPNDDLVEIAIPEQFKTIVR  459

Query  275  DGQFITSPATH  243
            D + +T   +H
Sbjct  460  DNKLVTESVSH  470



>dbj|GAM18318.1| hypothetical protein SAMD00019534_014930 [Acytostelium subglobosum 
LB1]
Length=483

 Score =   181 bits (460),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 91/197 (46%), Positives = 130/197 (66%), Gaps = 9/197 (5%)
 Frame = -3

Query  815  NDMKTKNRADRSGIVGASEKEGRVSS------PSFSKAGPPKLELQMGRKWVVENQIGKK  654
            NDMK+KN  ++S +V A   +  VS+      P+  K  PPK  L+   KW VE Q+G K
Sbjct  289  NDMKSKNNPNKSSVVKADAIKSTVSTTTPTGKPAVVK--PPKFALE-SNKWCVEFQVGNK  345

Query  653  NLVIDDCDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVE  474
            N+VI + D++Q+VYI+ C DSV+QI+GK+N IT+D C K  VVF + VA+ E+VNC+ VE
Sbjct  346  NIVIGETDSRQTVYIYQCTDSVIQIKGKINAITLDNCKKTAVVFENAVASCEIVNCNSVE  405

Query  473  VQCQGVAPTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQ  294
            VQ  G  P +++D  +GC +YLSKDSLE    T+KSSE+NIL+PGA  + D  E A+P+Q
Sbjct  406  VQVTGKVPAMAIDKCNGCQIYLSKDSLETEFVTSKSSEMNILIPGATANDDMIEIAVPEQ  465

Query  293  YIHVYKDGQFITSPATH  243
            +  V +  + +T   +H
Sbjct  466  FKTVVRGNRLVTESMSH  482



>ref|XP_636512.1| cyclase associated protein [Dictyostelium discoideum AX4]
 sp|P54654.1|CAP_DICDI RecName: Full=Adenylyl cyclase-associated protein; Short=CAP 
[Dictyostelium discoideum]
 gb|AAB09713.1| cyclase associated protein [Dictyostelium discoideum AX3]
 gb|EAL63006.1| cyclase associated protein [Dictyostelium discoideum AX4]
Length=464

 Score =   178 bits (451),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 90/192 (47%), Positives = 130/192 (68%), Gaps = 6/192 (3%)
 Frame = -3

Query  815  NDMKTKNRADRSGIVGASE-KEGRVSSPSFSKAGPPKLELQMGRKWVVENQIGKKNLVID  639
            NDMK+KN  D+S +V A++ K  +V +PS     P    LQ G KW +E Q+  K +VI 
Sbjct  277  NDMKSKNFTDKSSVVKAADTKVAKVDAPS----RPAVFALQ-GNKWSIEYQVNNKEIVIA  331

Query  638  DCDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQG  459
            + D++Q+VYIF C +S++QI+GKVN IT+D C K  +VF + +++ EVVNC+GVE+Q  G
Sbjct  332  EPDSRQTVYIFQCVNSLVQIKGKVNAITLDGCKKTSIVFENAISSCEVVNCNGVEIQVTG  391

Query  458  VAPTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQYIHVY  279
              P+I++D TSGC +YLSKDSLE  I ++KSSE+N+L+PGA  + D  E A+P+QY    
Sbjct  392  RVPSIAIDKTSGCQIYLSKDSLETEIVSSKSSEMNVLIPGATENDDLVELAIPEQYKTSV  451

Query  278  KDGQFITSPATH  243
            K  +  T   +H
Sbjct  452  KGNKLHTESTSH  463



>ref|XP_002505939.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO67197.1| predicted protein [Micromonas sp. RCC299]
Length=458

 Score =   177 bits (450),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 97/202 (48%), Positives = 132/202 (65%), Gaps = 9/202 (4%)
 Frame = -3

Query  815  NDMKTKNRADRSGIVGASEKEGRVSS----PSFSK-AGPPKLELQMGRKWVVENQIGKKN  651
            +DMK+KNRADRSG+V      G   +     + SK A PPK  L  G+KW VE+Q+G + 
Sbjct  258  DDMKSKNRADRSGLVATGGGAGGAPAVAAVTNVSKTAKPPKFALD-GKKWAVEHQVGNRT  316

Query  650  LVIDDCDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEV  471
            LVI+D + KQ+VY++ C D V+QI+GK NNIT+DKC K GVVF DV+A  E+VNC  ++V
Sbjct  317  LVIEDVNPKQTVYVYDCVDCVIQIKGKANNITLDKCAKTGVVFEDVLATCELVNCVSMQV  376

Query  470  QCQGVAPTISVDNTSGCLLYLSKDSLEASITTAKSSEVNIL-VPGAGPDADWEEHALPQQ  294
            QC G  PT+++D   GC ++L   S  A ITTAK SEVN++ VP  G DAD  E  +P+Q
Sbjct  377  QCTGAVPTVAIDKVDGCQVFLGPKSYGAEITTAKCSEVNVVCVPAEGSDADAIETPVPEQ  436

Query  293  YIHVYK--DGQFITSPATHSGG  234
            ++       G+++T P  HSG 
Sbjct  437  FVTTRDPGTGKWVTVPMGHSGA  458



>gb|EFA82907.1| cyclase associated protein [Polysphondylium pallidum PN500]
Length=476

 Score =   177 bits (448),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 85/197 (43%), Positives = 130/197 (66%), Gaps = 9/197 (5%)
 Frame = -3

Query  815  NDMKTKNRADRSGIVGASEKEGRV------SSPSFSKAGPPKLELQMGRKWVVENQIGKK  654
            NDMK+KN  ++S +V A + + +       S P+  K  PPK  L+   KW VE+Q+G K
Sbjct  282  NDMKSKNNPNKSSVVKADDLKPKTTTTATGSKPAVVK--PPKFALE-SNKWAVEHQVGNK  338

Query  653  NLVIDDCDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVE  474
            N++I + D +Q+VY++ C DSV+Q++GKVN IT+D C K  +VF + +A+ E+VNC+ VE
Sbjct  339  NIIIAETDPRQTVYVYQCTDSVIQVKGKVNAITLDGCKKTAIVFENAIASCEIVNCTSVE  398

Query  473  VQCQGVAPTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQ  294
            +Q  G  P++S+D  SG  +YLSKDSL   I T+KSSE+N+L+PGA  + D  E A+P+Q
Sbjct  399  IQVTGKVPSVSIDKCSGAQIYLSKDSLATEIVTSKSSEMNVLIPGATENDDMVEIAIPEQ  458

Query  293  YIHVYKDGQFITSPATH  243
            +  V +  + +T   +H
Sbjct  459  FKTVVQGTRLVTESMSH  475



>gb|KIZ04861.1| Adenylyl cyclase-associated protein [Monoraphidium neglectum]
Length=310

 Score =   172 bits (436),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 88/203 (43%), Positives = 128/203 (63%), Gaps = 9/203 (4%)
 Frame = -3

Query  815  NDMKTKNRADRSGIVGASEKEGRVSSPSFSKA-----GPPKLELQMGRKWVVENQIGKKN  651
            +DMK KNR D+SG V +S      +            G PK+EL+  RKWVVE+  G + 
Sbjct  108  DDMKAKNRTDKSGHVPSSGGGAAAAPAPAKAKAGPPMGNPKIELEGDRKWVVEHHSGNRE  167

Query  650  LVIDDCDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEV  471
            +V+D  D + +VYI+ C + V+QI+GKVN ++ID C + GVVF  V+A  E+VNC  ++V
Sbjct  168  IVVDRTDPRHTVYIYNCHNCVVQIKGKVNAVSIDGCKRTGVVFEQVIATCELVNCGSMQV  227

Query  470  QCQGVAPTISVDNTSGCLLYLSKDSLEA--SITTAKSSEVNILVPGAGP--DADWEEHAL  303
            QC G  PT+S+D   GC +++++D  +    + TAKSSEVN+ V  A P  DAD  EH +
Sbjct  228  QCLGHVPTVSIDKCDGCQVFINQDVAQGDFQLVTAKSSEVNLTVVPADPESDADAVEHPV  287

Query  302  PQQYIHVYKDGQFITSPATHSGG  234
            P+Q+I  +K G+ +T  A+HSGG
Sbjct  288  PEQFISSFKAGRLVTVAASHSGG  310



>ref|XP_004354500.1| cyclase associated protein [Dictyostelium fasciculatum]
 gb|EGG15753.1| cyclase associated protein [Dictyostelium fasciculatum]
Length=483

 Score =   170 bits (431),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 87/194 (45%), Positives = 127/194 (65%), Gaps = 3/194 (2%)
 Frame = -3

Query  815  NDMKTKNRADRSGIVGASEKEGRVSSPSFSKAGPPKLELQMG---RKWVVENQIGKKNLV  645
            +DMK+KN  ++S +V A + +   ++ +   A  P    +      KW VE Q G KN+V
Sbjct  289  DDMKSKNNPNKSSVVKADDLKTTTTTTTAKAAAAPAKPPKFALESNKWCVEFQKGNKNIV  348

Query  644  IDDCDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQC  465
            I D D +Q+VYI+ C+DSV+QI+GKVN IT+D C K  +VF + +++ E+VNC  VEVQ 
Sbjct  349  IADTDPRQTVYIYQCQDSVIQIKGKVNAITVDNCKKTAIVFENAISSCELVNCISVEVQV  408

Query  464  QGVAPTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQYIH  285
             G  P++S+D TSGC LYLS++SL   I T+KSSE+N+L+PGA P+ D  E A+P+QY  
Sbjct  409  TGKVPSVSIDKTSGCQLYLSQESLATEIVTSKSSEMNVLIPGATPNDDLVEIAVPEQYKT  468

Query  284  VYKDGQFITSPATH  243
            + K  + IT   +H
Sbjct  469  LVKGNRLITESMSH  482



>emb|CDQ79594.1| unnamed protein product [Oncorhynchus mykiss]
Length=463

 Score =   169 bits (428),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 90/193 (47%), Positives = 127/193 (66%), Gaps = 4/193 (2%)
 Frame = -3

Query  812  DMKTKNRADRSGIVGASEKEGRVSSPSFSKAGPPKLELQMGRKWVVENQIGKKNLVIDDC  633
            +++T+    R+G    +  +  V++ + S+  PP LEL  G+KW VENQ G + LVI D 
Sbjct  275  NLRTQTGPVRTGPKPFTTSKPAVTAAAASRKLPPVLELD-GKKWKVENQEGVQGLVISDT  333

Query  632  DAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGVA  453
            + KQ VY F C +S LQI+GK+N+IT+D C K+G+VF DVV   EV+NC  V+VQ  G  
Sbjct  334  ELKQVVYAFKCNNSTLQIKGKINSITLDNCKKLGLVFDDVVGIIEVINCRDVKVQVLGKV  393

Query  452  PTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQYIHVYKD  273
            PTIS++ T GC +YLSKDSLE  I +AKSSE+N+LVPG   D D+ E  +P+Q+  V+ D
Sbjct  394  PTISINKTDGCHVYLSKDSLECEIVSAKSSEMNVLVPGK--DGDYTEIPVPEQFKTVW-D  450

Query  272  GQFITSPATHSGG  234
            G+ + +  T   G
Sbjct  451  GKKLVTTCTEIAG  463



>ref|NP_001133556.1| Adenylyl cyclase-associated protein 1 [Salmo salar]
 gb|ACI33472.1| Adenylyl cyclase-associated protein 1 [Salmo salar]
Length=467

 Score =   169 bits (428),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 93/195 (48%), Positives = 123/195 (63%), Gaps = 8/195 (4%)
 Frame = -3

Query  806  KTKNRADRSGIVGASEKEGRVSSPSFSKAG----PPKLELQMGRKWVVENQIGKKNLVID  639
            K  N   ++G V    K    S P+ + A     PP LEL  G+KW VENQ G + LVI 
Sbjct  277  KNPNLRTQTGPVRTGPKPFTTSKPAVAAAASRKLPPVLELD-GKKWKVENQEGAQGLVIS  335

Query  638  DCDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQG  459
            D + KQ VY F C +S LQI+GK+N+IT+D C K+G+VF DVV   EV+NC  V+VQ  G
Sbjct  336  DTELKQVVYAFKCNNSTLQIKGKINSITLDNCKKLGLVFDDVVGIIEVINCRDVKVQVLG  395

Query  458  VAPTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQYIHVY  279
              PTIS++ T GC +YLSKDSLE  I +AKSSE+N+LVPG   D D+ E  +P+Q+  V+
Sbjct  396  KVPTISINKTDGCHVYLSKDSLECEIVSAKSSEMNVLVPGK--DGDYTEIPVPEQFKTVW  453

Query  278  KDGQFITSPATHSGG  234
             DG+ + +  T   G
Sbjct  454  -DGKKLVTTCTEIAG  467



>ref|XP_007245760.1| PREDICTED: adenylyl cyclase-associated protein 1 [Astyanax mexicanus]
Length=471

 Score =   168 bits (425),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 93/195 (48%), Positives = 121/195 (62%), Gaps = 8/195 (4%)
 Frame = -3

Query  806  KTKNRADRSGIVGASEKEGRVSSPSFSKAG----PPKLELQMGRKWVVENQIGKKNLVID  639
            K  N   ++G V    K      P+ + A     PP LEL  G+KW VENQ G + LVI 
Sbjct  281  KNPNLRSQAGPVHTGPKPFTAPRPTATTAPARKLPPVLELD-GKKWKVENQEGAQGLVIS  339

Query  638  DCDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQG  459
            D + KQ VY F C +S LQ++GK+N+ITID C KMG+VF DVV   EV+NC  V+VQ  G
Sbjct  340  DTELKQVVYAFKCNNSTLQVKGKINSITIDNCKKMGLVFDDVVGIIEVINCKDVKVQVMG  399

Query  458  VAPTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQYIHVY  279
              PTIS++ T GC +YLSKDSL   I +AKSSE+N+LVPG   D D+ E  +P+Q+  V+
Sbjct  400  KVPTISINKTDGCHVYLSKDSLSCEIVSAKSSEMNVLVPGK--DGDYTEIPVPEQFKTVW  457

Query  278  KDGQFITSPATHSGG  234
             DG  + + AT   G
Sbjct  458  -DGSKLVTTATEIAG  471



>ref|XP_004074190.1| PREDICTED: adenylyl cyclase-associated protein 1 [Oryzias latipes]
Length=472

 Score =   167 bits (422),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 87/177 (49%), Positives = 117/177 (66%), Gaps = 8/177 (5%)
 Frame = -3

Query  752  GRVSSPSFSKAG----PPKLELQMGRKWVVENQIGKKNLVIDDCDAKQSVYIFGCKDSVL  585
            G  S P+ S A     PP LEL+ G+KW VENQ G +NLVI D + KQ VY F C +S L
Sbjct  300  GSTSQPAASSAPVRKLPPVLELE-GKKWKVENQEGAQNLVISDTELKQVVYAFKCNNSTL  358

Query  584  QIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGVAPTISVDNTSGCLLYLS  405
            Q++GK+N+IT+D C KMG+VF D V   EV+NC  V++Q  G  PTIS++ T GC +YLS
Sbjct  359  QVKGKINSITMDNCKKMGLVFEDAVGIVEVINCKDVKIQVTGKVPTISINKTDGCHVYLS  418

Query  404  KDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQYIHVYKDGQFITSPATHSGG  234
            KDSL   + +AKSSE+N+LVP    D ++ E  +P+Q+  V+ DGQ + + AT   G
Sbjct  419  KDSLSCELVSAKSSEMNVLVPNK--DGEFTELPVPEQFKTVW-DGQKLVTTATEIAG  472



>ref|XP_001746328.1| hypothetical protein [Monosiga brevicollis MX1]
 gb|EDQ88715.1| predicted protein [Monosiga brevicollis MX1]
Length=775

 Score =   167 bits (424),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 83/159 (52%), Positives = 110/159 (69%), Gaps = 3/159 (2%)
 Frame = -3

Query  713  PKLELQMGRKWVVENQIGKKNLVIDDCDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKM  534
            P  EL  G+KWV+E+Q G  NLVIDDC+ KQ+ YI+ C+D  +QI+GK+N+I++D C K+
Sbjct  620  PVFEL-AGKKWVIEHQRGNHNLVIDDCNNKQTAYIYKCEDCTIQIKGKINSISVDGCKKI  678

Query  533  GVVFSDVVAAFEVVNCSGVEVQCQGVAPTISVDNTSGCLLYLSKDSLEASITTAKSSEVN  354
            G+VF  VVAAFEVVN   V++Q  G   TIS+D T G  +YLSKDSL+A I TAKSSE+N
Sbjct  679  GIVFDTVVAAFEVVNTQRVQIQVTGKVATISIDKTDGAQVYLSKDSLDAQIVTAKSSELN  738

Query  353  ILVPGAGPDADWEEHALPQQYIHVYKDGQFITSPATHSG  237
            + VP    D D+ E  LP+QY  VY   +F+T     +G
Sbjct  739  VSVP--KDDGDFVEFPLPEQYKSVYDGSKFVTEATDIAG  775



>ref|XP_001638431.1| predicted protein [Nematostella vectensis]
 gb|EDO46368.1| predicted protein [Nematostella vectensis]
Length=463

 Score =   164 bits (416),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 94/195 (48%), Positives = 120/195 (62%), Gaps = 6/195 (3%)
 Frame = -3

Query  815  NDMKT-KNRADR-SGIVGASEKEGRVSSPSFSKAGPPKLELQMGRKWVVENQIGKKNLVI  642
            +D KT KN   R S +V    K      P      PP  ELQ G+KW+VE+Q G KNL I
Sbjct  273  DDQKTHKNPNLRASSVVKDKPKPTIAKKPVAVTKKPPVFELQ-GKKWMVEHQEGNKNLTI  331

Query  641  DDCDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQ  462
            +     Q VYI+ CKDSV+ I+GK+N+IT+D C K  VVF D +A  E VNC  V+ Q  
Sbjct  332  EG-SMSQVVYIYSCKDSVVIIKGKINSITLDNCKKCAVVFDDAIATVEFVNCQSVQCQVN  390

Query  461  GVAPTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQYIHV  282
            G  PT+S+D T GC +YLSKDSL++ I TAKSSE+NILV  A  D D+ E+ LP+QY  V
Sbjct  391  GKVPTVSIDKTDGCQVYLSKDSLQSEIVTAKSSEMNILVQQA--DGDYVENPLPEQYKSV  448

Query  281  YKDGQFITSPATHSG  237
            +    F+T+P    G
Sbjct  449  WDGKAFVTTPVASHG  463



>ref|XP_005814142.1| PREDICTED: adenylyl cyclase-associated protein 1-like [Xiphophorus 
maculatus]
Length=430

 Score =   164 bits (414),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 85/165 (52%), Positives = 112/165 (68%), Gaps = 4/165 (2%)
 Frame = -3

Query  728  SKAGPPKLELQMGRKWVVENQIGKKNLVIDDCDAKQSVYIFGCKDSVLQIQGKVNNITID  549
            ++  PP LEL+ G+KW VENQ G + LVI + + KQ VY F C  S LQ++GK+N+ITID
Sbjct  270  TRTLPPVLELE-GKKWKVENQEGAQGLVISNTELKQVVYAFKCNQSTLQVKGKINSITID  328

Query  548  KCTKMGVVFSDVVAAFEVVNCSGVEVQCQGVAPTISVDNTSGCLLYLSKDSLEASITTAK  369
             C KMG+VF DVV   EV+NC  V+VQ  G  PTIS++ T GC +YLSKDSL   I +AK
Sbjct  329  SCKKMGLVFDDVVGIVEVINCRDVKVQVMGKIPTISINKTDGCHVYLSKDSLSCEIISAK  388

Query  368  SSEVNILVPGAGPDADWEEHALPQQYIHVYKDGQFITSPATHSGG  234
            SSE+NILVP    D ++ E  +P+Q+  V+ DGQ + + AT   G
Sbjct  389  SSEMNILVPNK--DGEFTELPVPEQFKTVW-DGQKLVTTATEIAG  430



>ref|XP_009066708.1| hypothetical protein LOTGIDRAFT_109031, partial [Lottia gigantea]
 gb|ESO82922.1| hypothetical protein LOTGIDRAFT_109031, partial [Lottia gigantea]
Length=454

 Score =   164 bits (415),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 89/194 (46%), Positives = 122/194 (63%), Gaps = 9/194 (5%)
 Frame = -3

Query  815  NDMKT-KNRADRSGI------VGASEKEGRVSSPSFSKAGPPKLELQMGRKWVVENQIGK  657
            +DMKT KN A R G       + +   +G   + +   A PP LELQ G+KW+VE Q+  
Sbjct  258  DDMKTHKNPALRQGPAPYKPPLASKPVKGPSPTKTVIAAKPPVLELQNGKKWLVEYQVDN  317

Query  656  KNLVIDDCDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGV  477
            K +VID    KQ+VYIF C +S +Q++GKVN+I +D C K GVVF D++++ E VNC  V
Sbjct  318  KGIVIDQTQMKQTVYIFKCVNSTIQVKGKVNSIIMDSCKKCGVVFDDILSSMEFVNCQSV  377

Query  476  EVQCQGVAPTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQ  297
            + Q  G   T+SVD T GC++YLSKDS+ A I TAKSSE+NIL+P    D D +E  LP+
Sbjct  378  QGQVVGKVNTVSVDKTDGCMIYLSKDSMGAEIVTAKSSEMNILIPTD--DGDMKEFPLPE  435

Query  296  QYIHVYKDGQFITS  255
            Q+   +    F T+
Sbjct  436  QFKTTWNGKTFQTT  449



>ref|XP_008421240.1| PREDICTED: LOW QUALITY PROTEIN: adenylyl cyclase-associated protein 
1 [Poecilia reticulata]
Length=452

 Score =   164 bits (415),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 87/172 (51%), Positives = 116/172 (67%), Gaps = 6/172 (3%)
 Frame = -3

Query  749  RVSSPSFSKAGPPKLELQMGRKWVVENQIGKKNLVIDDCDAKQSVYIFGCKDSVLQIQGK  570
            R ++P+  +  PP LEL+ G+KW VENQ G + LVI + + KQ VY F C  S LQ++GK
Sbjct  287  RPAAPT--RTLPPVLELE-GKKWKVENQEGAQGLVISNTELKQVVYAFKCNQSTLQVKGK  343

Query  569  VNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGVAPTISVDNTSGCLLYLSKDSLE  390
            +N+ITID C KMG+VF DVV   EV+NC  V+VQ  G  PTIS++ T GC +YLSKDSL 
Sbjct  344  INSITIDSCKKMGLVFDDVVGIVEVINCRDVKVQVMGKIPTISINKTDGCHVYLSKDSLS  403

Query  389  ASITTAKSSEVNILVPGAGPDADWEEHALPQQYIHVYKDGQFITSPATHSGG  234
              I +AKSSE+NILVP    D ++ E  +P+Q+  V+ DGQ + + AT   G
Sbjct  404  CEIISAKSSEMNILVPNK--DGEFTELPVPEQFKTVW-DGQRLVTTATEIAG  452



>ref|XP_010898586.1| PREDICTED: adenylyl cyclase-associated protein 1 [Esox lucius]
Length=470

 Score =   164 bits (414),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 80/154 (52%), Positives = 108/154 (70%), Gaps = 3/154 (2%)
 Frame = -3

Query  716  PPKLELQMGRKWVVENQIGKKNLVIDDCDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTK  537
            PP LEL  G+KW VENQ G + LVI D + KQ VY F C +S LQ++GK+N+IT+D C K
Sbjct  314  PPVLELD-GKKWKVENQEGVQGLVISDTELKQVVYAFKCNNSTLQVKGKINSITLDNCRK  372

Query  536  MGVVFSDVVAAFEVVNCSGVEVQCQGVAPTISVDNTSGCLLYLSKDSLEASITTAKSSEV  357
            +G+VF DVV   EV+NC  V++Q  G  PTIS++ T GC +YLSKDSLE  I +AKSSE+
Sbjct  373  LGLVFDDVVGIVEVINCRDVKIQVMGKVPTISINKTDGCHVYLSKDSLECEIVSAKSSEM  432

Query  356  NILVPGAGPDADWEEHALPQQYIHVYKDGQFITS  255
            N+LVPG   D D+ E  +P+Q+  V+   + +T+
Sbjct  433  NVLVPGK--DGDYTELPVPEQFKTVWDGSKLVTT  464



>emb|CDQ65132.1| unnamed protein product [Oncorhynchus mykiss]
Length=472

 Score =   164 bits (414),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 88/178 (49%), Positives = 119/178 (67%), Gaps = 6/178 (3%)
 Frame = -3

Query  767  ASEKEGRVSSPSFSKAGPPKLELQMGRKWVVENQIGKKNLVIDDCDAKQSVYIFGCKDSV  588
            +S K    ++PS  +  PP LEL  G+KW VENQ G + +VI D + KQ VY F C +S 
Sbjct  301  SSPKTEATATPS--RKLPPVLELD-GKKWKVENQEGVQGMVISDTELKQVVYAFKCNNST  357

Query  587  LQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGVAPTISVDNTSGCLLYL  408
            LQI+GK+N+IT+D C K+G+VF DVV   EV+NC  V+VQ  G  PTIS++ T GC +YL
Sbjct  358  LQIKGKINSITLDNCKKLGLVFDDVVGIVEVINCRDVKVQVLGKVPTISINKTDGCHVYL  417

Query  407  SKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQYIHVYKDGQFITSPATHSGG  234
            SKDSLE  I +AKSSE+N+LVPG   D D+ E  +P+Q+  V+ DG+ + +  T   G
Sbjct  418  SKDSLECEIVSAKSSEMNVLVPGN--DGDYTEIPVPEQFKTVW-DGKKLVTTCTEIAG  472



>ref|XP_004368326.1| adenylyl cyclaseassociated protein [Acanthamoeba castellanii 
str. Neff]
 gb|ELR25571.1| adenylyl cyclaseassociated protein [Acanthamoeba castellanii 
str. Neff]
Length=486

 Score =   164 bits (414),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 83/192 (43%), Positives = 129/192 (67%), Gaps = 1/192 (1%)
 Frame = -3

Query  812  DMKTKNRADRSGIVGASEKEGRVSSPSFSKAGPPKLELQMGRKWVVENQIGKKNLVIDDC  633
            DMKTKN    +  V A+    + ++ +  K GPPK EL  G+KW +ENQ+G KN+VI++ 
Sbjct  296  DMKTKNMEKTAAPVPAAAPVRKPAAAAAPKLGPPKFELD-GQKWKIENQVGNKNIVIENP  354

Query  632  DAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGVA  453
            + +Q+VYI+ C DSV+QI+GKVN+I +D C K G+VF + ++  EVVNC+ V+VQ  G  
Sbjct  355  EVRQTVYIYKCHDSVIQIKGKVNSIMLDSCKKTGLVFENAISVAEVVNCASVQVQVTGKV  414

Query  452  PTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQYIHVYKD  273
            P++++D TSGC ++LS +  +  I T+KS E+N+++PG  P+ D  E  +P+Q+  + KD
Sbjct  415  PSVAIDKTSGCQVFLSAEGFDTEIVTSKSDEMNVVLPGLNPNDDIIEIPIPEQFRTLIKD  474

Query  272  GQFITSPATHSG  237
             + +T    HSG
Sbjct  475  RKLVTEAVAHSG  486



>ref|XP_003057213.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH58858.1| predicted protein [Micromonas pusilla CCMP1545]
Length=510

 Score =   164 bits (414),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 85/199 (43%), Positives = 127/199 (64%), Gaps = 9/199 (5%)
 Frame = -3

Query  815  NDMKTKNRADRSGIVG------ASEKEGRVSSPSFSKAGPPKLELQMGRKWVVENQIGKK  654
            +DMKTKNRADRSG+VG      A+      ++ +      PKL L+ G+KW VEN +G K
Sbjct  313  DDMKTKNRADRSGLVGDAPAAGAAAATKPATAAAAPATKAPKLSLE-GKKWAVENHVGNK  371

Query  653  NLVIDDCDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVE  474
             + ++D + KQ+VY++ C+D V++I GK N +T+D C K  +VF DV+A  E++NC+ V+
Sbjct  372  TIELNDVNPKQTVYVYNCRDCVIKINGKANAVTMDACAKSAIVFDDVLATCEIINCASVQ  431

Query  473  VQCQGVAPTISVDNTSGCLLYLSKDSLEASITTAKSSEVNIL-VPGAGPDADWEEHALPQ  297
            VQC G  PT+++D   GC +YL + S  A +TTAK SEVN+  VP  G   +  E A+P+
Sbjct  432  VQCMGTVPTVAIDKVDGCQVYLGEKSWSAEVTTAKCSEVNVTCVPAEGSAEEATETAIPE  491

Query  296  QYIHVY-KDGQFITSPATH  243
            Q++    +DG++ T P  H
Sbjct  492  QFVTRRGEDGKWRTVPMGH  510



>ref|XP_005842875.1| hypothetical protein CHLNCDRAFT_142506 [Chlorella variabilis]
 gb|EFN50763.1| hypothetical protein CHLNCDRAFT_142506 [Chlorella variabilis]
Length=517

 Score =   164 bits (414),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 92/199 (46%), Positives = 125/199 (63%), Gaps = 11/199 (6%)
 Frame = -3

Query  812  DMKTKNRADRSGIVGASEKEGRVSSPSFSKA-----GPPKLELQMGRKWVVENQIGKKNL  648
            DMKTKNRADR+G V A+      ++ +         GPP+LE + GRKWVVENQ+G + +
Sbjct  324  DMKTKNRADRAGAVPAAAAAAGAAAVAVKPKAAAAAGPPRLECEQGRKWVVENQVGNREI  383

Query  647  VIDDCDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQ  468
            VI+    KQ VYI+ C  S   IQ +       +  + G +    VA  E+VN S VEVQ
Sbjct  384  VIEQMQPKQVVYIYNCSGST--IQARRGGADPRQGQEPGRLL---VATVELVNSSSVEVQ  438

Query  467  CQGVAPTISVDNTSGCLLYLSKDSLEAS-ITTAKSSEVNILVPGAGPDADWEEHALPQQY  291
            C G  PT++VD   GC LYL + SLE + ITTAKSSEVN++VPGA  +AD  E A+P+Q+
Sbjct  439  CTGAVPTVAVDKCDGCQLYLPRGSLEVTDITTAKSSEVNVVVPGASEEADPVESAIPEQF  498

Query  290  IHVYKDGQFITSPATHSGG  234
            +  Y+ G+++T P +HSGG
Sbjct  499  VSRYRGGRWVTEPVSHSGG  517



>ref|XP_006681875.1| hypothetical protein BATDEDRAFT_14125 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF77353.1| hypothetical protein BATDEDRAFT_14125 [Batrachochytrium dendrobatidis 
JAM81]
Length=470

 Score =   162 bits (411),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 85/193 (44%), Positives = 124/193 (64%), Gaps = 6/193 (3%)
 Frame = -3

Query  812  DMKTKNRADR-SGIVGASEKEGRVSSPSFSKAGPPKLELQMGRKWVVENQIGKKNLVIDD  636
            +M  KN   R + +V AS+    +S+      GP KL L+ G+KW+VENQIG+KNLVI+ 
Sbjct  283  EMTHKNPELRATSVVKASDTHASISTGPIR--GPAKLALE-GKKWIVENQIGQKNLVIEG  339

Query  635  CDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGV  456
             + +  VYI+ C DS +QI+GK N +T+D C K GVV  +V++  +++N   V+VQ  G 
Sbjct  340  VELQHVVYIYNCHDSTIQIKGKANAVTVDGCKKTGVVLENVLSTVDIINSKSVQVQITGK  399

Query  455  APTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQYIHVYK  276
            AP + VD T G  +YLSK+S +A I TAKSSE+N+L+ GA  D ++ E A+P+Q+  V+K
Sbjct  400  APILVVDKTDGFQVYLSKESEDAEIFTAKSSEMNVLIQGA--DGEYVERAIPEQFKTVFK  457

Query  275  DGQFITSPATHSG  237
            +G   T    H G
Sbjct  458  NGALATVAVEHKG  470



>ref|NP_956203.1| adenylyl cyclase-associated protein 1 [Danio rerio]
 gb|AAO24759.1| cyclase-associated protein-1 [Danio rerio]
Length=463

 Score =   162 bits (411),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 91/200 (46%), Positives = 124/200 (62%), Gaps = 10/200 (5%)
 Frame = -3

Query  815  NDMKTKNRADRSGIVGASEKEGRVSSP------SFSKAGPPKLELQMGRKWVVENQIGKK  654
            +D KT       G  G S    +  +P      S +++ PP LEL  G+KW VENQ G +
Sbjct  268  DDQKTHKNPGLRGQTGPSVSGPKPFTPRPTATASPARSLPPVLELD-GKKWKVENQEGAQ  326

Query  653  NLVIDDCDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVE  474
            NLVI D + KQ VY F C +S LQ++GK+N+IT+D C KMG+VF DVV   EV+NC  V+
Sbjct  327  NLVISDTELKQVVYGFKCNNSTLQVKGKINSITLDNCKKMGLVFDDVVGIVEVINCRDVK  386

Query  473  VQCQGVAPTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQ  294
            +Q  G  PTIS++ T GC +YLSKDSL   I +AKSSE+N+LVP    D ++ E  +P+Q
Sbjct  387  IQVIGKVPTISINKTDGCHVYLSKDSLSCEIVSAKSSEMNVLVPNK--DGEFTEIPVPEQ  444

Query  293  YIHVYKDGQFITSPATHSGG  234
            +  V+ DG  + + AT   G
Sbjct  445  FKTVW-DGSKLVTTATEIAG  463



>ref|XP_003127872.3| PREDICTED: adenylyl cyclase-associated protein 1, partial [Sus 
scrofa]
Length=374

 Score =   160 bits (406),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 93/204 (46%), Positives = 126/204 (62%), Gaps = 14/204 (7%)
 Frame = -3

Query  815  NDMKT-KNRA--DRSGIVGASEKEGRVSSPSFS-------KAGPPKLELQMGRKWVVENQ  666
            +DMKT KN A   +SG V    K    S P  S       K  P  LEL+ G+KW VENQ
Sbjct  175  DDMKTHKNPALKAQSGPVRTGPKPFSASKPGISPSPKPVTKKEPALLELE-GKKWRVENQ  233

Query  665  IGKKNLVIDDCDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNC  486
                NLVIDD + KQ  YIF C +S LQI+GK+N+IT+D C K+G+VF DVV   E++N 
Sbjct  234  ENVSNLVIDDTELKQVAYIFKCVNSTLQIKGKINSITVDNCKKLGLVFDDVVGIVEIINS  293

Query  485  SGVEVQCQGVAPTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHA  306
              V+VQ  G  PTIS++ T GC +YLSK+SL+  I +AKSSE+N+L+P  G   D+ E  
Sbjct  294  RDVKVQVMGKVPTISINKTDGCHIYLSKNSLDCEIVSAKSSEMNVLIPTEG--GDFNEFP  351

Query  305  LPQQYIHVYKDGQFITSPATHSGG  234
            +P+Q+  ++ +GQ + +  T   G
Sbjct  352  VPEQFKTIW-NGQKLVTTVTEIAG  374



>ref|XP_005968024.1| PREDICTED: adenylyl cyclase-associated protein 1-like isoform 
X2 [Pantholops hodgsonii]
Length=474

 Score =   162 bits (411),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 92/201 (46%), Positives = 128/201 (64%), Gaps = 11/201 (5%)
 Frame = -3

Query  815  NDMKT-KNRA--DRSGIVGASEKEGRVSSPS----FSKAGPPKLELQMGRKWVVENQIGK  657
            NDMKT KN A   +SG++    K    S P      +K GP  LEL+ G+KW VENQ   
Sbjct  278  NDMKTHKNPALKAQSGLMKWPPKPFSASKPDPPKPVTKKGPALLELE-GKKWRVENQENV  336

Query  656  KNLVIDDCDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGV  477
             NLVI+D + KQ  YIF C +S LQI+GK+N+IT+D C K+G+VF DVV   E++N   V
Sbjct  337  SNLVIEDTELKQVAYIFKCVNSTLQIKGKINSITVDNCKKLGLVFDDVVGIVEIINSKDV  396

Query  476  EVQCQGVAPTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQ  297
            +VQ  G  PTIS++ T GC +YLSK+SL+  I +AKSSE+N+L+P  G   D+ E  +P+
Sbjct  397  KVQVMGKVPTISINKTDGCHVYLSKNSLDCEIVSAKSSEMNVLIPTEG--GDFNEFPVPE  454

Query  296  QYIHVYKDGQFITSPATHSGG  234
            Q+  ++ +GQ + +  T   G
Sbjct  455  QFKTLW-NGQKLVTTVTEIAG  474



>gb|AAI50357.1| Cap1 CAP, adenylate cyclase-associated protein 1 [Danio rerio]
Length=463

 Score =   162 bits (410),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 91/200 (46%), Positives = 124/200 (62%), Gaps = 10/200 (5%)
 Frame = -3

Query  815  NDMKTKNRADRSGIVGASEKEGRVSSP------SFSKAGPPKLELQMGRKWVVENQIGKK  654
            +D KT       G  G S    +  +P      S +++ PP LEL  G+KW VENQ G +
Sbjct  268  DDQKTHKNPGLRGQTGPSVSGPKPFTPRPTATASPARSLPPVLELD-GKKWKVENQEGAQ  326

Query  653  NLVIDDCDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVE  474
            NLVI D + KQ VY F C +S LQ++GK+N+IT+D C KMG+VF DVV   EV+NC  V+
Sbjct  327  NLVISDSELKQVVYGFKCNNSTLQVKGKINSITLDNCKKMGLVFDDVVGIVEVINCRDVK  386

Query  473  VQCQGVAPTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQ  294
            +Q  G  PTIS++ T GC +YLSKDSL   I +AKSSE+N+LVP    D ++ E  +P+Q
Sbjct  387  IQVIGKVPTISINKTDGCHVYLSKDSLSCEIVSAKSSEMNVLVPNK--DGEFTEIPVPEQ  444

Query  293  YIHVYKDGQFITSPATHSGG  234
            +  V+ DG  + + AT   G
Sbjct  445  FKTVW-DGSKLVTTATEIAG  463



>ref|XP_005970523.1| PREDICTED: adenylyl cyclase-associated protein 1 isoform X1 [Pantholops 
hodgsonii]
 ref|XP_005970524.1| PREDICTED: adenylyl cyclase-associated protein 1 isoform X2 [Pantholops 
hodgsonii]
 ref|XP_005970525.1| PREDICTED: adenylyl cyclase-associated protein 1 isoform X3 [Pantholops 
hodgsonii]
Length=472

 Score =   162 bits (410),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 91/201 (45%), Positives = 129/201 (64%), Gaps = 11/201 (5%)
 Frame = -3

Query  815  NDMKT-KNRA--DRSGIVGASEKEGRVSSPS----FSKAGPPKLELQMGRKWVVENQIGK  657
            +DMKT KN A   +SG++ +  K    S P      +K GP  LEL+ G+KW VENQ   
Sbjct  276  DDMKTHKNPALKAQSGLIRSGPKPFSASKPDPPKPVTKKGPALLELE-GKKWRVENQENV  334

Query  656  KNLVIDDCDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGV  477
             NLVI+D + KQ  YIF C +S LQI+GK+N+IT+D C K+G+VF DVV   E++N   V
Sbjct  335  SNLVIEDTELKQVAYIFKCVNSTLQIKGKINSITVDNCKKLGLVFDDVVGIVEIINSKDV  394

Query  476  EVQCQGVAPTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQ  297
            +VQ  G  PTIS++ T GC +YLSK+SL+  I +AKSSE+N+L+P  G   D+ E  +P+
Sbjct  395  KVQVMGKVPTISINKTDGCHVYLSKNSLDCEIVSAKSSEMNVLIPTEG--GDFNEFPVPE  452

Query  296  QYIHVYKDGQFITSPATHSGG  234
            Q+  ++ +GQ + +  T   G
Sbjct  453  QFKTLW-NGQKLVTTVTEIAG  472



>ref|XP_005970526.1| PREDICTED: adenylyl cyclase-associated protein 1 isoform X4 [Pantholops 
hodgsonii]
Length=471

 Score =   162 bits (410),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 91/201 (45%), Positives = 129/201 (64%), Gaps = 11/201 (5%)
 Frame = -3

Query  815  NDMKT-KNRA--DRSGIVGASEKEGRVSSPS----FSKAGPPKLELQMGRKWVVENQIGK  657
            +DMKT KN A   +SG++ +  K    S P      +K GP  LEL+ G+KW VENQ   
Sbjct  275  DDMKTHKNPALKAQSGLIRSGPKPFSASKPDPPKPVTKKGPALLELE-GKKWRVENQENV  333

Query  656  KNLVIDDCDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGV  477
             NLVI+D + KQ  YIF C +S LQI+GK+N+IT+D C K+G+VF DVV   E++N   V
Sbjct  334  SNLVIEDTELKQVAYIFKCVNSTLQIKGKINSITVDNCKKLGLVFDDVVGIVEIINSKDV  393

Query  476  EVQCQGVAPTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQ  297
            +VQ  G  PTIS++ T GC +YLSK+SL+  I +AKSSE+N+L+P  G   D+ E  +P+
Sbjct  394  KVQVMGKVPTISINKTDGCHVYLSKNSLDCEIVSAKSSEMNVLIPTEG--GDFNEFPVPE  451

Query  296  QYIHVYKDGQFITSPATHSGG  234
            Q+  ++ +GQ + +  T   G
Sbjct  452  QFKTLW-NGQKLVTTVTEIAG  471



>ref|XP_005968023.1| PREDICTED: adenylyl cyclase-associated protein 1-like isoform 
X1 [Pantholops hodgsonii]
Length=474

 Score =   162 bits (410),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 89/194 (46%), Positives = 125/194 (64%), Gaps = 10/194 (5%)
 Frame = -3

Query  815  NDMKT-KNRA--DRSGIVGASEKEGRVSSPS----FSKAGPPKLELQMGRKWVVENQIGK  657
            NDMKT KN A   +SG++    K    S P      +K GP  LEL+ G+KW VENQ   
Sbjct  278  NDMKTHKNPALKAQSGLMKWPPKPFSASKPDPPKPVTKKGPALLELE-GKKWRVENQENV  336

Query  656  KNLVIDDCDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGV  477
             NLVI+D + KQ  YIF C +S LQI+GK+N+IT+D C K+G+VF DVV   E++N   V
Sbjct  337  SNLVIEDTELKQVAYIFKCVNSTLQIKGKINSITVDNCKKLGLVFDDVVGIVEIINSKDV  396

Query  476  EVQCQGVAPTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQ  297
            +VQ  G  PTIS++ T GC +YLSK+SL+  I +AKSSE+N+L+P  G   D+ E  +P+
Sbjct  397  KVQVMGKVPTISINKTDGCHVYLSKNSLDCEIVSAKSSEMNVLIPTEG--GDFNEFPVPE  454

Query  296  QYIHVYKDGQFITS  255
            Q+  ++   + +T+
Sbjct  455  QFKTLWNGQKLVTT  468



>ref|XP_007576532.1| PREDICTED: adenylyl cyclase-associated protein 1 [Poecilia formosa]
Length=476

 Score =   162 bits (409),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 83/165 (50%), Positives = 112/165 (68%), Gaps = 4/165 (2%)
 Frame = -3

Query  728  SKAGPPKLELQMGRKWVVENQIGKKNLVIDDCDAKQSVYIFGCKDSVLQIQGKVNNITID  549
            ++  PP LEL+ G+KW VENQ G + LVI + + KQ VY + C  S LQ++GK+N+ITID
Sbjct  316  TRTLPPVLELE-GKKWKVENQEGAQGLVISNTELKQVVYAYKCNQSTLQVKGKINSITID  374

Query  548  KCTKMGVVFSDVVAAFEVVNCSGVEVQCQGVAPTISVDNTSGCLLYLSKDSLEASITTAK  369
             C KMG+VF DVV   EV+NC  V+VQ  G  PTIS++ T GC +YLSKDSL   + +AK
Sbjct  375  SCKKMGLVFDDVVGIVEVINCRDVKVQVMGKIPTISINKTDGCHVYLSKDSLSCEVISAK  434

Query  368  SSEVNILVPGAGPDADWEEHALPQQYIHVYKDGQFITSPATHSGG  234
            SSE+NILVP    D ++ E  +P+Q+  V+ DGQ + + AT   G
Sbjct  435  SSEMNILVPNK--DGEFTELPVPEQFKTVW-DGQKLVTTATEIAG  476



>ref|XP_003447228.1| PREDICTED: adenylyl cyclase-associated protein 1-like [Oreochromis 
niloticus]
Length=472

 Score =   162 bits (409),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 84/178 (47%), Positives = 117/178 (66%), Gaps = 4/178 (2%)
 Frame = -3

Query  767  ASEKEGRVSSPSFSKAGPPKLELQMGRKWVVENQIGKKNLVIDDCDAKQSVYIFGCKDSV  588
            AS      +S + ++  PP LEL+ G+KW VEN  G +NLVI D + KQ VY F C  S 
Sbjct  299  ASSATRPAASATPTRTLPPVLELE-GKKWKVENHEGAQNLVISDTELKQVVYAFKCNKST  357

Query  587  LQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGVAPTISVDNTSGCLLYL  408
            LQ++GK+N+IT+D C KMG+VF DVV   E++NC  V+VQ  G  PTIS++ T GC +YL
Sbjct  358  LQVKGKINSITLDNCKKMGLVFDDVVGIVEIINCKDVKVQVMGKVPTISINKTDGCHVYL  417

Query  407  SKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQYIHVYKDGQFITSPATHSGG  234
            S+DSL+  I +AKSSE+N+LVP    D ++ E  +P+Q+  V+ DG  + + AT   G
Sbjct  418  SQDSLKCEIISAKSSEMNVLVPNK--DGEFTEIPVPEQFKTVW-DGSKLVTTATEIAG  472



>ref|XP_005656157.1| PREDICTED: adenylyl cyclase-associated protein 1-like [Sus scrofa]
Length=363

 Score =   159 bits (403),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 93/204 (46%), Positives = 126/204 (62%), Gaps = 14/204 (7%)
 Frame = -3

Query  815  NDMKT-KNRADR--SGIVGASEKEGRVSSPSFS-------KAGPPKLELQMGRKWVVENQ  666
            +DMKT KN A +  SG V    K    S P  S       K  P  LEL+ G+KW VENQ
Sbjct  164  DDMKTHKNPALKAQSGPVRTGPKPFSASKPGISPSPKPVTKKEPALLELE-GKKWRVENQ  222

Query  665  IGKKNLVIDDCDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNC  486
                NLVIDD + KQ  YIF C +S LQI+GK+N+IT+D C K+G+VF DVV   E++N 
Sbjct  223  ENVSNLVIDDTELKQVAYIFKCVNSTLQIKGKINSITVDNCKKLGLVFDDVVGIVEIINS  282

Query  485  SGVEVQCQGVAPTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHA  306
              V+VQ  G  PTIS++ T GC +YLSK+SL+  I +AKSSE+N+L+P  G   D+ E  
Sbjct  283  RDVKVQVMGKVPTISINKTDGCHIYLSKNSLDCEIVSAKSSEMNVLIPTEG--GDFNEFP  340

Query  305  LPQQYIHVYKDGQFITSPATHSGG  234
            +P+Q+  ++ +GQ + +  T   G
Sbjct  341  VPEQFKTIW-NGQKLVTTVTEIAG  363



>ref|XP_005739752.1| PREDICTED: adenylyl cyclase-associated protein 1-like [Pundamilia 
nyererei]
Length=472

 Score =   162 bits (409),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 84/178 (47%), Positives = 117/178 (66%), Gaps = 4/178 (2%)
 Frame = -3

Query  767  ASEKEGRVSSPSFSKAGPPKLELQMGRKWVVENQIGKKNLVIDDCDAKQSVYIFGCKDSV  588
            AS      +S + ++  PP LEL+ G+KW VENQ   +NLVI D + KQ VY F C  S 
Sbjct  299  ASSATRPAASATPTRTLPPVLELE-GKKWKVENQEDAQNLVISDTELKQVVYAFKCNKST  357

Query  587  LQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGVAPTISVDNTSGCLLYL  408
            LQ++GK+N+IT+D C KMG+VF DVV   E++NC  V++Q  G  PTIS++ T GC +YL
Sbjct  358  LQVKGKINSITLDNCKKMGLVFDDVVGIVEMINCKDVKIQVMGKVPTISINKTDGCHIYL  417

Query  407  SKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQYIHVYKDGQFITSPATHSGG  234
            SKDSL+  I +AKSSE+N+LVP    D ++ E  +P+Q+  V+ DG  + + AT   G
Sbjct  418  SKDSLKCEIISAKSSEMNVLVPNK--DGEFTEIPVPEQFKTVW-DGSKLVTTATEIAG  472



>ref|XP_006794538.1| PREDICTED: adenylyl cyclase-associated protein 1-like [Neolamprologus 
brichardi]
Length=404

 Score =   160 bits (404),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 81/165 (49%), Positives = 112/165 (68%), Gaps = 4/165 (2%)
 Frame = -3

Query  728  SKAGPPKLELQMGRKWVVENQIGKKNLVIDDCDAKQSVYIFGCKDSVLQIQGKVNNITID  549
            ++  PP LEL+ G+KW VENQ   +NLVI D + KQ VY F C  S LQ++GK+N+IT+D
Sbjct  244  TRTLPPVLELE-GKKWKVENQEDAQNLVISDTELKQVVYAFKCNKSTLQVKGKINSITLD  302

Query  548  KCTKMGVVFSDVVAAFEVVNCSGVEVQCQGVAPTISVDNTSGCLLYLSKDSLEASITTAK  369
             C KMG+VF DVV   E++NC  V++Q  G  PTIS++ T GC +YLSKDSL+  I +AK
Sbjct  303  NCKKMGLVFDDVVGIVEMINCKDVKIQVMGKVPTISINKTDGCHIYLSKDSLKCEIISAK  362

Query  368  SSEVNILVPGAGPDADWEEHALPQQYIHVYKDGQFITSPATHSGG  234
            SSE+N+LVP    D ++ E  +P+Q+  V+ DG  + + AT   G
Sbjct  363  SSEMNVLVPNK--DGEFTEIPVPEQFKTVW-DGSKLVTTATEIAG  404



>ref|XP_008304850.1| PREDICTED: adenylyl cyclase-associated protein 2 [Stegastes partitus]
Length=474

 Score =   161 bits (407),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 82/177 (46%), Positives = 118/177 (67%), Gaps = 4/177 (2%)
 Frame = -3

Query  764  SEKEGRVSSPS-FSKAGPPKLELQMGRKWVVENQIGKKNLVIDDCDAKQSVYIFGCKDSV  588
            S+K G V+SP   ++  PP LEL+ G+KW VEN     +LVIDD + KQ VY+F C +S 
Sbjct  301  SKKPGAVNSPRPAAQKKPPLLELE-GKKWRVENFEQTHDLVIDDTELKQVVYVFSCNNST  359

Query  587  LQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGVAPTISVDNTSGCLLYL  408
            +Q++GK+N+I ID C K+G+VF +VV   E++N   +++Q  G  PTIS++ T GC +YL
Sbjct  360  VQVKGKMNSIIIDNCKKLGLVFENVVGIVEIINSKAIQLQVLGTVPTISINKTEGCQVYL  419

Query  407  SKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQYIHVYKDGQFITSPATHSG  237
            SKDSL   I +AKSSE+NIL+P  G D D+ E  +P+QY  V+   + +T P   +G
Sbjct  420  SKDSLNCDIVSAKSSEMNILIP-EGED-DYREFPVPEQYKTVWNGSKLVTEPTEIAG  474



>ref|XP_005938812.1| PREDICTED: adenylyl cyclase-associated protein 1-like [Haplochromis 
burtoni]
Length=472

 Score =   161 bits (407),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 81/165 (49%), Positives = 112/165 (68%), Gaps = 4/165 (2%)
 Frame = -3

Query  728  SKAGPPKLELQMGRKWVVENQIGKKNLVIDDCDAKQSVYIFGCKDSVLQIQGKVNNITID  549
            ++  PP LEL+ G+KW VENQ   +NLVI D + KQ VY F C  S LQ++GK+N+IT+D
Sbjct  312  TRTLPPVLELE-GKKWKVENQEDAQNLVISDTELKQVVYAFKCNKSTLQVKGKINSITLD  370

Query  548  KCTKMGVVFSDVVAAFEVVNCSGVEVQCQGVAPTISVDNTSGCLLYLSKDSLEASITTAK  369
             C KMG+VF DVV   E++NC  V++Q  G  PTIS++ T GC +YLSKDSL+  I +AK
Sbjct  371  NCKKMGLVFDDVVGIVEMINCKDVKIQVMGKVPTISINKTDGCHIYLSKDSLKCEIISAK  430

Query  368  SSEVNILVPGAGPDADWEEHALPQQYIHVYKDGQFITSPATHSGG  234
            SSE+N+LVP    D ++ E  +P+Q+  V+ DG  + + AT   G
Sbjct  431  SSEMNVLVPNK--DGEFTEIPVPEQFKTVW-DGSKLVTTATEIAG  472



>ref|XP_010209099.1| PREDICTED: adenylyl cyclase-associated protein 1, partial [Colius 
striatus]
Length=235

 Score =   155 bits (392),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 76/162 (47%), Positives = 107/162 (66%), Gaps = 3/162 (2%)
 Frame = -3

Query  740  SPSFSKAGPPKLELQMGRKWVVENQIGKKNLVIDDCDAKQSVYIFGCKDSVLQIQGKVNN  561
            SP  S   P  LEL+ G+KW VENQ    NLVI D + KQ  Y+F C +S LQI+GK+N+
Sbjct  71   SPKTSPKAPALLELE-GKKWRVENQENATNLVISDTELKQVAYVFKCTNSTLQIKGKINS  129

Query  560  ITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGVAPTISVDNTSGCLLYLSKDSLEASI  381
            IT+D C K+G+VF DVV   E++N   ++VQ  G  PTIS++ T GC +YLSK SL+  I
Sbjct  130  ITLDNCKKLGLVFDDVVGIVEIINSRDIKVQVMGKVPTISINKTDGCHVYLSKGSLDCEI  189

Query  380  TTAKSSEVNILVPGAGPDADWEEHALPQQYIHVYKDGQFITS  255
             +AKSSE+N+L+P  G   D+ E  +P+Q+  V+   + +T+
Sbjct  190  VSAKSSEMNVLIPADG--GDFTEFPVPEQFKTVWNGQKLVTT  229



>ref|XP_004548966.1| PREDICTED: adenylyl cyclase-associated protein 1-like [Maylandia 
zebra]
Length=472

 Score =   161 bits (407),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 81/165 (49%), Positives = 112/165 (68%), Gaps = 4/165 (2%)
 Frame = -3

Query  728  SKAGPPKLELQMGRKWVVENQIGKKNLVIDDCDAKQSVYIFGCKDSVLQIQGKVNNITID  549
            ++  PP LEL+ G+KW VENQ   +NLVI D + KQ VY F C  S LQ++GK+N+IT+D
Sbjct  312  TRTLPPVLELE-GKKWKVENQEDAQNLVISDTELKQVVYAFKCNKSTLQVKGKINSITLD  370

Query  548  KCTKMGVVFSDVVAAFEVVNCSGVEVQCQGVAPTISVDNTSGCLLYLSKDSLEASITTAK  369
             C KMG+VF DVV   E++NC  V++Q  G  PTIS++ T GC +YLSKDSL+  I +AK
Sbjct  371  NCKKMGLVFDDVVGIVEMINCKDVKIQVMGKVPTISINKTDGCHIYLSKDSLKCEIISAK  430

Query  368  SSEVNILVPGAGPDADWEEHALPQQYIHVYKDGQFITSPATHSGG  234
            SSE+N+LVP    D ++ E  +P+Q+  V+ DG  + + AT   G
Sbjct  431  SSEMNVLVPNK--DGEFTEIPVPEQFKTVW-DGSKLVTTATEIAG  472



>ref|XP_011396561.1| Adenylyl cyclase-associated protein 1 [Auxenochlorella protothecoides]
 gb|KFM23687.1| Adenylyl cyclase-associated protein 1 [Auxenochlorella protothecoides]
Length=404

 Score =   159 bits (402),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 72/161 (45%), Positives = 114/161 (71%), Gaps = 5/161 (3%)
 Frame = -3

Query  704  ELQMGRKWVVENQIGKKNLVIDDCDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVV  525
            +L  G+KW VE+Q+G  +LV+ D + K +VY++GC++S +Q++GKVN I++DKC+++G++
Sbjct  243  KLVQGQKWAVEHQVGVPDLVVADTEPKHTVYVYGCRNSTIQVKGKVNAISLDKCSRVGLL  302

Query  524  FSDVVAAFEVVNCSGVEVQCQGVAPTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILV  345
            F  VVA+ E+VN S V+VQC G  PT+++D   G  LYL + SL+  +TTAKSS VNI+V
Sbjct  303  FDRVVASVELVNSSSVDVQCTGGVPTLAIDACDGVQLYLPRSSLDTDVTTAKSSGVNIIV  362

Query  344  PGAGPDADWE-----EHALPQQYIHVYKDGQFITSPATHSG  237
                 D   E     E A+P+Q++  ++DG ++T+P +HSG
Sbjct  363  LAGDEDGGKEAEGPAEAAVPEQFVTRFRDGAWVTTPVSHSG  403



>ref|XP_010121837.1| PREDICTED: adenylyl cyclase-associated protein 1, partial [Chlamydotis 
macqueenii]
 gb|KFP43454.1| Adenylyl cyclase-associated protein 1, partial [Chlamydotis macqueenii]
Length=232

 Score =   154 bits (390),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 88/198 (44%), Positives = 122/198 (62%), Gaps = 14/198 (7%)
 Frame = -3

Query  815  NDMKT-KNRADRS--GIVGASEKEGRVSSPS--------FSKAGPPKLELQMGRKWVVEN  669
            +DMKT KN A +S  G V +  K      P+         S   P  LEL+ G+KW VEN
Sbjct  32   DDMKTHKNPALKSQGGPVRSGPKPFTAPKPACNANPSQKTSPKAPALLELE-GKKWRVEN  90

Query  668  QIGKKNLVIDDCDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVN  489
            Q    NLVI D + KQ  Y+F C +S LQI+GK+N+IT+D C K+G+VF DVV   E++N
Sbjct  91   QENAPNLVISDTELKQVAYVFKCTNSTLQIKGKINSITLDNCKKLGLVFDDVVGIVEIIN  150

Query  488  CSGVEVQCQGVAPTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEH  309
               V+VQ  G  PTIS++ T GC +YLSK+SL+  I +AKSSE+N+LVP  G   D+ E 
Sbjct  151  SRDVKVQVMGKVPTISINKTDGCHVYLSKNSLDCEIVSAKSSEMNVLVPTEG--GDFTEF  208

Query  308  ALPQQYIHVYKDGQFITS  255
             +P+Q+  V+   + +T+
Sbjct  209  PVPEQFKTVWNGQKLVTT  226



>ref|XP_004548179.1| PREDICTED: adenylyl cyclase-associated protein 2-like isoform 
X1 [Maylandia zebra]
 ref|XP_004548180.1| PREDICTED: adenylyl cyclase-associated protein 2-like isoform 
X2 [Maylandia zebra]
 ref|XP_005728467.1| PREDICTED: adenylyl cyclase-associated protein 2-like [Pundamilia 
nyererei]
Length=474

 Score =   160 bits (404),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 79/191 (41%), Positives = 120/191 (63%), Gaps = 4/191 (2%)
 Frame = -3

Query  806  KTKNRADRSGIVGASEKEGRVSSPSF-SKAGPPKLELQMGRKWVVENQIGKKNLVIDDCD  630
            K  N   +       +  G V+SP+  ++  PP LEL+ G+KW VEN   K +LVI++ +
Sbjct  287  KNPNLRSQQPTTAKGKNAGPVASPTTPAQKRPPLLELE-GKKWRVENFEQKHDLVIEETE  345

Query  629  AKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGVAP  450
             KQ  Y+F C +S LQI+GK+N+I ID C K+GVVF +VV   E++NC  +++Q  G  P
Sbjct  346  LKQVAYVFSCNNSTLQIKGKINSIIIDNCKKLGVVFENVVGIVEIINCKSIQLQVLGTVP  405

Query  449  TISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQYIHVYKDG  270
            TIS++ T GC +YLSKDS+   I +AKSSE+NI++P    + D+ E  +P+Q+  V+   
Sbjct  406  TISINKTEGCQVYLSKDSVSCDIVSAKSSEMNIMIPEG--EGDYREFPVPEQFKTVWNGA  463

Query  269  QFITSPATHSG  237
            + +T P   +G
Sbjct  464  KLVTEPTEIAG  474



>ref|XP_005917513.1| PREDICTED: adenylyl cyclase-associated protein 2-like [Haplochromis 
burtoni]
Length=474

 Score =   160 bits (404),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 81/191 (42%), Positives = 121/191 (63%), Gaps = 4/191 (2%)
 Frame = -3

Query  806  KTKNRADRSGIVGASEKEGRVSSPSF-SKAGPPKLELQMGRKWVVENQIGKKNLVIDDCD  630
            K  N   +       +  G V+SP+  ++  PP LEL+ G+KW VEN   K +LVI++ +
Sbjct  287  KNPNLRSQQPTTAKGKNAGPVASPTTPAQKRPPLLELE-GKKWRVENFEQKHDLVIEETE  345

Query  629  AKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGVAP  450
             KQ  Y+F C +S LQI+GK+N+I ID C K+GVVF +VV   E++NC  +++Q  G  P
Sbjct  346  LKQVAYVFSCNNSTLQIKGKINSIIIDNCKKLGVVFENVVGIVEIINCKSIQLQVLGTVP  405

Query  449  TISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQYIHVYKDG  270
            TIS++ T GC +YLSKDS+   I +AKSSE+NI++P  G D D+ E  +P+Q+  V+   
Sbjct  406  TISINKTEGCQVYLSKDSVSCDIVSAKSSEMNIMIP-EGED-DYREFPVPEQFKTVWNGA  463

Query  269  QFITSPATHSG  237
            + +T P   +G
Sbjct  464  KLVTEPTEIAG  474



>ref|XP_004371955.1| PREDICTED: adenylyl cyclase-associated protein 1 [Trichechus 
manatus latirostris]
Length=474

 Score =   159 bits (403),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 89/197 (45%), Positives = 123/197 (62%), Gaps = 13/197 (7%)
 Frame = -3

Query  815  NDMKT-KNRA--DRSGIVGASEKEGRVSSPSFS-------KAGPPKLELQMGRKWVVENQ  666
            +DMKT KN A   +SG V +  K      P  S       K  PP LELQ G+KW VENQ
Sbjct  275  DDMKTHKNPALKAQSGPVRSGPKPFSAPKPGVSPSPKPAAKKEPPLLELQ-GKKWRVENQ  333

Query  665  IGKKNLVIDDCDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNC  486
                NLVIDD + KQ  YI+ C ++ LQI+GK+N+IT+D C K+G+VF DVV   E++N 
Sbjct  334  ENVSNLVIDDTELKQVAYIYKCVNTTLQIKGKINSITVDNCKKLGLVFDDVVGIVEIINS  393

Query  485  SGVEVQCQGVAPTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHA  306
              V+VQ  G  PTIS++ T GC  YLS++SL+  I +AKSSE+N+L+P  G   D+ E  
Sbjct  394  RDVKVQVMGKVPTISINKTDGCHTYLSRNSLDCEIVSAKSSEMNVLIPTEG--GDFNEFP  451

Query  305  LPQQYIHVYKDGQFITS  255
            +P+Q+  V+   + +T+
Sbjct  452  VPEQFKTVWNGQKLVTT  468



>ref|XP_006788155.1| PREDICTED: adenylyl cyclase-associated protein 2-like, partial 
[Neolamprologus brichardi]
Length=413

 Score =   158 bits (400),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 78/168 (46%), Positives = 115/168 (68%), Gaps = 4/168 (2%)
 Frame = -3

Query  752  GRVSSPSF-SKAGPPKLELQMGRKWVVENQIGKKNLVIDDCDAKQSVYIFGCKDSVLQIQ  576
            G V+SP+  ++  PP LEL+ G+KW VEN   K +LVI++ + KQ  Y+F C +S LQI+
Sbjct  249  GPVASPTTPAQKRPPLLELE-GKKWRVENFEQKHDLVIEETELKQVAYVFSCNNSTLQIK  307

Query  575  GKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGVAPTISVDNTSGCLLYLSKDS  396
            GK+N+I ID C K+GVVF +VV   E++NC  +++Q  G  PTIS++ T GC +YLSKDS
Sbjct  308  GKINSIIIDNCKKLGVVFENVVGIVEIINCKSIQLQVLGTVPTISINKTEGCQVYLSKDS  367

Query  395  LEASITTAKSSEVNILVPGAGPDADWEEHALPQQYIHVYKDGQFITSP  252
            +   I +AKSSE+NI++P  G D D+ E  +P+Q+  V+   + +T P
Sbjct  368  VSCDIVSAKSSEMNIMIP-EGED-DYREFPVPEQFKTVWNGSKLVTEP  413



>ref|XP_005678705.1| PREDICTED: adenylyl cyclase-associated protein 1 isoform X3 [Capra 
hircus]
Length=471

 Score =   159 bits (402),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 90/201 (45%), Positives = 128/201 (64%), Gaps = 11/201 (5%)
 Frame = -3

Query  815  NDMKT-KNRA--DRSGIVGASEKEGRVSSPS----FSKAGPPKLELQMGRKWVVENQIGK  657
            +DMKT KN A   +SG++ +  K    S P      +K  P  LEL+ G+KW VENQ   
Sbjct  275  DDMKTHKNPALKAQSGLIRSGPKPFSASKPDPPKPVTKKEPALLELE-GKKWRVENQENV  333

Query  656  KNLVIDDCDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGV  477
             NLVI+D + KQ  YIF C +S LQI+GK+N+IT+D C K+G+VF DVV   E++N   V
Sbjct  334  SNLVIEDTELKQVAYIFKCVNSTLQIKGKINSITVDNCKKLGLVFDDVVGIVEIINSKDV  393

Query  476  EVQCQGVAPTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQ  297
            +VQ  G  PTIS++ T GC +YLSK+SL+  I +AKSSE+N+L+P  G   D+ E  +P+
Sbjct  394  KVQVMGKVPTISINKTDGCHVYLSKNSLDCEIVSAKSSEMNVLIPTEG--GDFNEFPVPE  451

Query  296  QYIHVYKDGQFITSPATHSGG  234
            Q+  ++ +GQ + +  T   G
Sbjct  452  QFKTLW-NGQKLVTTVTEIAG  471



>ref|XP_011959062.1| PREDICTED: adenylyl cyclase-associated protein 1 isoform X2 [Ovis 
aries]
 ref|XP_011959129.1| PREDICTED: adenylyl cyclase-associated protein 1 isoform X2 [Ovis 
aries]
 ref|XP_012024451.1| PREDICTED: adenylyl cyclase-associated protein 1 isoform X2 [Ovis 
aries musimon]
 ref|XP_012024452.1| PREDICTED: adenylyl cyclase-associated protein 1 isoform X2 [Ovis 
aries musimon]
Length=471

 Score =   159 bits (402),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 90/201 (45%), Positives = 128/201 (64%), Gaps = 11/201 (5%)
 Frame = -3

Query  815  NDMKT-KNRA--DRSGIVGASEKEGRVSSPS----FSKAGPPKLELQMGRKWVVENQIGK  657
            +DMKT KN A   +SG++ +  K    S P      +K  P  LEL+ G+KW VENQ   
Sbjct  275  DDMKTHKNPALKAQSGLIRSGPKPFSASKPDPPKPVTKKEPALLELE-GKKWRVENQENV  333

Query  656  KNLVIDDCDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGV  477
             NLVI+D + KQ  YIF C +S LQI+GK+N+IT+D C K+G+VF DVV   E++N   V
Sbjct  334  SNLVIEDTELKQVAYIFKCVNSTLQIKGKINSITVDNCKKLGLVFDDVVGIVEIINSKDV  393

Query  476  EVQCQGVAPTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQ  297
            +VQ  G  PTIS++ T GC +YLSK+SL+  I +AKSSE+N+L+P  G   D+ E  +P+
Sbjct  394  KVQVMGKVPTISINKTDGCHVYLSKNSLDCEIVSAKSSEMNVLIPTEG--GDFNEFPVPE  451

Query  296  QYIHVYKDGQFITSPATHSGG  234
            Q+  ++ +GQ + +  T   G
Sbjct  452  QFKTLW-NGQKLVTTVTEIAG  471



>ref|XP_005678703.1| PREDICTED: adenylyl cyclase-associated protein 1 isoform X1 [Capra 
hircus]
 ref|XP_005678704.1| PREDICTED: adenylyl cyclase-associated protein 1 isoform X2 [Capra 
hircus]
Length=472

 Score =   159 bits (402),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 90/201 (45%), Positives = 128/201 (64%), Gaps = 11/201 (5%)
 Frame = -3

Query  815  NDMKT-KNRA--DRSGIVGASEKEGRVSSPS----FSKAGPPKLELQMGRKWVVENQIGK  657
            +DMKT KN A   +SG++ +  K    S P      +K  P  LEL+ G+KW VENQ   
Sbjct  276  DDMKTHKNPALKAQSGLIRSGPKPFSASKPDPPKPVTKKEPALLELE-GKKWRVENQENV  334

Query  656  KNLVIDDCDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGV  477
             NLVI+D + KQ  YIF C +S LQI+GK+N+IT+D C K+G+VF DVV   E++N   V
Sbjct  335  SNLVIEDTELKQVAYIFKCVNSTLQIKGKINSITVDNCKKLGLVFDDVVGIVEIINSKDV  394

Query  476  EVQCQGVAPTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQ  297
            +VQ  G  PTIS++ T GC +YLSK+SL+  I +AKSSE+N+L+P  G   D+ E  +P+
Sbjct  395  KVQVMGKVPTISINKTDGCHVYLSKNSLDCEIVSAKSSEMNVLIPTEG--GDFNEFPVPE  452

Query  296  QYIHVYKDGQFITSPATHSGG  234
            Q+  ++ +GQ + +  T   G
Sbjct  453  QFKTLW-NGQKLVTTVTEIAG  472



>ref|XP_004001884.1| PREDICTED: adenylyl cyclase-associated protein 1 isoform X1 [Ovis 
aries]
 ref|XP_006061982.1| PREDICTED: adenylyl cyclase-associated protein 1 isoform X4 [Bubalus 
bubalis]
 ref|XP_006061983.1| PREDICTED: adenylyl cyclase-associated protein 1 isoform X5 [Bubalus 
bubalis]
 ref|XP_011958948.1| PREDICTED: adenylyl cyclase-associated protein 1 isoform X1 [Ovis 
aries]
 ref|XP_012024449.1| PREDICTED: adenylyl cyclase-associated protein 1 isoform X1 [Ovis 
aries musimon]
 ref|XP_012024450.1| PREDICTED: adenylyl cyclase-associated protein 1 isoform X1 [Ovis 
aries musimon]
Length=472

 Score =   159 bits (402),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 90/201 (45%), Positives = 128/201 (64%), Gaps = 11/201 (5%)
 Frame = -3

Query  815  NDMKT-KNRA--DRSGIVGASEKEGRVSSPS----FSKAGPPKLELQMGRKWVVENQIGK  657
            +DMKT KN A   +SG++ +  K    S P      +K  P  LEL+ G+KW VENQ   
Sbjct  276  DDMKTHKNPALKAQSGLIRSGPKPFSASKPDPPKPVTKKEPALLELE-GKKWRVENQENV  334

Query  656  KNLVIDDCDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGV  477
             NLVI+D + KQ  YIF C +S LQI+GK+N+IT+D C K+G+VF DVV   E++N   V
Sbjct  335  SNLVIEDTELKQVAYIFKCVNSTLQIKGKINSITVDNCKKLGLVFDDVVGIVEIINSKDV  394

Query  476  EVQCQGVAPTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQ  297
            +VQ  G  PTIS++ T GC +YLSK+SL+  I +AKSSE+N+L+P  G   D+ E  +P+
Sbjct  395  KVQVMGKVPTISINKTDGCHVYLSKNSLDCEIVSAKSSEMNVLIPTEG--GDFNEFPVPE  452

Query  296  QYIHVYKDGQFITSPATHSGG  234
            Q+  ++ +GQ + +  T   G
Sbjct  453  QFKTLW-NGQKLVTTVTEIAG  472



>ref|XP_008329363.1| PREDICTED: adenylyl cyclase-associated protein 1 [Cynoglossus 
semilaevis]
Length=472

 Score =   159 bits (402),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 78/168 (46%), Positives = 113/168 (67%), Gaps = 4/168 (2%)
 Frame = -3

Query  737  PSFSKAGPPKLELQMGRKWVVENQIGKKNLVIDDCDAKQSVYIFGCKDSVLQIQGKVNNI  558
            P+ ++A PP LEL+ G+KW VEN +G ++LVI   + +  VY + C  S LQ++GK+N+I
Sbjct  309  PAPTRAQPPVLELE-GKKWKVENHVGVQDLVISQTELRHVVYAYNCNKSTLQVKGKLNSI  367

Query  557  TIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGVAPTISVDNTSGCLLYLSKDSLEASIT  378
            T+D C KMG+VF DVV   E++NC  V++Q  G  P ISV+ T GC +YLSKDSL+  I 
Sbjct  368  TLDSCKKMGLVFDDVVGIVEIINCRDVKIQVMGKVPIISVNKTDGCHIYLSKDSLDCEIV  427

Query  377  TAKSSEVNILVPGAGPDADWEEHALPQQYIHVYKDGQFITSPATHSGG  234
            +AKSSE+N+L+     D D+ E A+P+Q+  V+ DG  + + AT   G
Sbjct  428  SAKSSEMNVLI--VKEDGDYTEFAVPEQFKTVW-DGTKLVTTATEIAG  472



>ref|XP_010135264.1| PREDICTED: adenylyl cyclase-associated protein 1 [Buceros rhinoceros 
silvestris]
Length=465

 Score =   159 bits (402),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 78/162 (48%), Positives = 109/162 (67%), Gaps = 3/162 (2%)
 Frame = -3

Query  740  SPSFSKAGPPKLELQMGRKWVVENQIGKKNLVIDDCDAKQSVYIFGCKDSVLQIQGKVNN  561
            SP  S   PP LEL+ G+KW VENQ    NLVI + + KQ  Y+F C +S LQI+GK+N+
Sbjct  301  SPKTSPKAPPLLELE-GKKWRVENQENATNLVISNTELKQVAYVFKCTNSTLQIKGKINS  359

Query  560  ITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGVAPTISVDNTSGCLLYLSKDSLEASI  381
            IT+D C K+G+VF DVV   E++N   V+VQ  G  PTIS++ T GC +YLSK+SL+  I
Sbjct  360  ITLDNCKKLGLVFDDVVGIVEIINSRDVKVQVMGKVPTISINKTDGCHVYLSKNSLDCEI  419

Query  380  TTAKSSEVNILVPGAGPDADWEEHALPQQYIHVYKDGQFITS  255
             +AKSSE+N+L+P  G   D+ E  +P+Q+  V+   + IT+
Sbjct  420  VSAKSSEMNVLIPTEG--GDFTEFPVPEQFKTVWNGQKLITT  459



>ref|XP_006061981.1| PREDICTED: adenylyl cyclase-associated protein 1 isoform X3 [Bubalus 
bubalis]
Length=499

 Score =   159 bits (403),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 90/201 (45%), Positives = 128/201 (64%), Gaps = 11/201 (5%)
 Frame = -3

Query  815  NDMKT-KNRA--DRSGIVGASEKEGRVSSPS----FSKAGPPKLELQMGRKWVVENQIGK  657
            +DMKT KN A   +SG++ +  K    S P      +K  P  LEL+ G+KW VENQ   
Sbjct  303  DDMKTHKNPALKAQSGLIRSGPKPFSASKPDPPKPVTKKEPALLELE-GKKWRVENQENV  361

Query  656  KNLVIDDCDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGV  477
             NLVI+D + KQ  YIF C +S LQI+GK+N+IT+D C K+G+VF DVV   E++N   V
Sbjct  362  SNLVIEDTELKQVAYIFKCVNSTLQIKGKINSITVDNCKKLGLVFDDVVGIVEIINSKDV  421

Query  476  EVQCQGVAPTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQ  297
            +VQ  G  PTIS++ T GC +YLSK+SL+  I +AKSSE+N+L+P  G   D+ E  +P+
Sbjct  422  KVQVMGKVPTISINKTDGCHVYLSKNSLDCEIVSAKSSEMNVLIPTEG--GDFNEFPVPE  479

Query  296  QYIHVYKDGQFITSPATHSGG  234
            Q+  ++ +GQ + +  T   G
Sbjct  480  QFKTLW-NGQKLVTTVTEIAG  499



>ref|XP_006061979.1| PREDICTED: adenylyl cyclase-associated protein 1 isoform X1 [Bubalus 
bubalis]
Length=500

 Score =   159 bits (403),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 90/201 (45%), Positives = 128/201 (64%), Gaps = 11/201 (5%)
 Frame = -3

Query  815  NDMKT-KNRA--DRSGIVGASEKEGRVSSPS----FSKAGPPKLELQMGRKWVVENQIGK  657
            +DMKT KN A   +SG++ +  K    S P      +K  P  LEL+ G+KW VENQ   
Sbjct  304  DDMKTHKNPALKAQSGLIRSGPKPFSASKPDPPKPVTKKEPALLELE-GKKWRVENQENV  362

Query  656  KNLVIDDCDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGV  477
             NLVI+D + KQ  YIF C +S LQI+GK+N+IT+D C K+G+VF DVV   E++N   V
Sbjct  363  SNLVIEDTELKQVAYIFKCVNSTLQIKGKINSITVDNCKKLGLVFDDVVGIVEIINSKDV  422

Query  476  EVQCQGVAPTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQ  297
            +VQ  G  PTIS++ T GC +YLSK+SL+  I +AKSSE+N+L+P  G   D+ E  +P+
Sbjct  423  KVQVMGKVPTISINKTDGCHVYLSKNSLDCEIVSAKSSEMNVLIPTEG--GDFNEFPVPE  480

Query  296  QYIHVYKDGQFITSPATHSGG  234
            Q+  ++ +GQ + +  T   G
Sbjct  481  QFKTLW-NGQKLVTTVTEIAG  500



>ref|XP_006061980.1| PREDICTED: adenylyl cyclase-associated protein 1 isoform X2 [Bubalus 
bubalis]
Length=499

 Score =   159 bits (402),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 90/201 (45%), Positives = 128/201 (64%), Gaps = 11/201 (5%)
 Frame = -3

Query  815  NDMKT-KNRA--DRSGIVGASEKEGRVSSPS----FSKAGPPKLELQMGRKWVVENQIGK  657
            +DMKT KN A   +SG++ +  K    S P      +K  P  LEL+ G+KW VENQ   
Sbjct  303  DDMKTHKNPALKAQSGLIRSGPKPFSASKPDPPKPVTKKEPALLELE-GKKWRVENQENV  361

Query  656  KNLVIDDCDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGV  477
             NLVI+D + KQ  YIF C +S LQI+GK+N+IT+D C K+G+VF DVV   E++N   V
Sbjct  362  SNLVIEDTELKQVAYIFKCVNSTLQIKGKINSITVDNCKKLGLVFDDVVGIVEIINSKDV  421

Query  476  EVQCQGVAPTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQ  297
            +VQ  G  PTIS++ T GC +YLSK+SL+  I +AKSSE+N+L+P  G   D+ E  +P+
Sbjct  422  KVQVMGKVPTISINKTDGCHVYLSKNSLDCEIVSAKSSEMNVLIPTEG--GDFNEFPVPE  479

Query  296  QYIHVYKDGQFITSPATHSGG  234
            Q+  ++ +GQ + +  T   G
Sbjct  480  QFKTLW-NGQKLVTTVTEIAG  499



>ref|XP_010789579.1| PREDICTED: LOW QUALITY PROTEIN: adenylyl cyclase-associated protein 
1 [Notothenia coriiceps]
Length=469

 Score =   159 bits (401),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 80/170 (47%), Positives = 116/170 (68%), Gaps = 4/170 (2%)
 Frame = -3

Query  743  SSPSFSKAGPPKLELQMGRKWVVENQIGKKNLVIDDCDAKQSVYIFGCKDSVLQIQGKVN  564
            ++P+ ++  PP LEL  G+KW VENQ G ++LVI D + KQ VY + C  S LQI+GK+N
Sbjct  304  AAPTPTRTLPPVLELD-GKKWKVENQEGAQDLVISDTELKQVVYAYKCNKSTLQIKGKIN  362

Query  563  NITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGVAPTISVDNTSGCLLYLSKDSLEAS  384
            +IT+D C K+G+VF DVV   E++NC  V+VQ  G  PTIS++ T GC +YLS+DSL   
Sbjct  363  SITLDNCKKLGLVFDDVVGIVEIINCKDVKVQVMGKIPTISINKTDGCHVYLSQDSLACE  422

Query  383  ITTAKSSEVNILVPGAGPDADWEEHALPQQYIHVYKDGQFITSPATHSGG  234
            I +AKSSE+NILVP    + ++ E  +P+Q+  V+ DG+ + + +T   G
Sbjct  423  IVSAKSSEMNILVPNK--EGEFTELPVPEQFKTVW-DGKKLVTTSTEIAG  469



>ref|XP_008633293.1| PREDICTED: adenylyl cyclase-associated protein 1 [Corvus brachyrhynchos]
 ref|XP_010406374.1| PREDICTED: adenylyl cyclase-associated protein 1 [Corvus cornix 
cornix]
Length=463

 Score =   158 bits (400),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 87/194 (45%), Positives = 123/194 (63%), Gaps = 10/194 (5%)
 Frame = -3

Query  815  NDMKT-KNRA--DRSGIVGASEKEGRVSSPSF----SKAGPPKLELQMGRKWVVENQIGK  657
            +DMKT KN A  ++ G V +  K      P+     S   PP LEL+ G+KW VENQ   
Sbjct  267  DDMKTHKNPALKNQGGPVRSGPKPFTAPKPACNANPSPKAPPLLELE-GKKWRVENQENA  325

Query  656  KNLVIDDCDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGV  477
             NLVI D + KQ  Y+F C +S LQI+GK+N+IT+D C K+G+VF DVV   E++N   V
Sbjct  326  TNLVISDTELKQVAYVFKCTNSTLQIKGKINSITLDNCKKLGLVFDDVVGIVEIINSRDV  385

Query  476  EVQCQGVAPTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQ  297
            +VQ  G  PTIS++ T GC +YLSK+SL+  I +AKSSE+N+L+P  G   D+ E  +P+
Sbjct  386  KVQVMGKVPTISINKTDGCHVYLSKNSLDCEIVSAKSSEMNVLIPTEG--GDFTEFPVPE  443

Query  296  QYIHVYKDGQFITS  255
            Q+  V+   + +T+
Sbjct  444  QFKTVWNGQKLVTT  457



>ref|XP_008832492.1| PREDICTED: LOW QUALITY PROTEIN: adenylyl cyclase-associated protein 
1 [Nannospalax galili]
Length=473

 Score =   159 bits (401),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 89/197 (45%), Positives = 124/197 (63%), Gaps = 13/197 (7%)
 Frame = -3

Query  815  NDMKTKNRAD---RSGIVGASEKEGRV----SSPS---FSKAGPPKLELQMGRKWVVENQ  666
            +DMKT        +SG V +  K   V    SSPS    SK  PP LEL+ G+KW VENQ
Sbjct  274  DDMKTHKNPSLKAQSGPVRSGPKPFSVPKPQSSPSPKPASKKEPPLLELE-GKKWRVENQ  332

Query  665  IGKKNLVIDDCDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNC  486
                NLVIDD + KQ  YI+ C ++ LQI+GK+N+IT+D C K+G+VF DVV   E++N 
Sbjct  333  ENVSNLVIDDTELKQVAYIYKCVNTTLQIKGKINSITVDNCKKLGLVFDDVVGIVEIINS  392

Query  485  SGVEVQCQGVAPTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHA  306
              V+VQ  G  PTIS++ T GC  YLSK+SL+  I +AKSSE+N+L+P  G   D+ E  
Sbjct  393  RDVKVQVMGKVPTISINKTDGCHAYLSKNSLDCEIVSAKSSEMNVLIPTEG--GDFNEFP  450

Query  305  LPQQYIHVYKDGQFITS  255
            +P+Q+  ++   + +T+
Sbjct  451  VPEQFKTLWNGQKLVTT  467



>ref|XP_006114852.1| PREDICTED: adenylyl cyclase-associated protein 1 [Pelodiscus 
sinensis]
Length=472

 Score =   158 bits (400),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 78/165 (47%), Positives = 110/165 (67%), Gaps = 6/165 (4%)
 Frame = -3

Query  749  RVSSPSFSKAGPPKLELQMGRKWVVENQIGKKNLVIDDCDAKQSVYIFGCKDSVLQIQGK  570
            ++SSP   K  PP LEL+ G+KW VENQ    NLVI D + KQ  YI+ C  S LQI+GK
Sbjct  308  KISSP---KKEPPMLELE-GKKWRVENQENASNLVIRDTELKQVAYIYKCMSSTLQIKGK  363

Query  569  VNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGVAPTISVDNTSGCLLYLSKDSLE  390
            +N+IT+D C K+G+VF DVV   E++NC  V++Q  G  PTIS++ T GC +YLSK SL+
Sbjct  364  INSITVDNCKKLGLVFDDVVGIVEIINCRDVKIQVMGKVPTISINKTDGCHVYLSKSSLD  423

Query  389  ASITTAKSSEVNILVPGAGPDADWEEHALPQQYIHVYKDGQFITS  255
              I +AKSSE+N+L+P      D+ E  +P+Q+  ++   + +TS
Sbjct  424  CEIVSAKSSEMNVLIPTES--GDFSEFPVPEQFKSLWNGQKLVTS  466



>gb|EAX07242.1| CAP, adenylate cyclase-associated protein 1 (yeast), isoform 
CRA_c [Homo sapiens]
Length=192

 Score =   152 bits (383),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 87/196 (44%), Positives = 124/196 (63%), Gaps = 8/196 (4%)
 Frame = -3

Query  809  MKT-KNRADR--SGIVGASEKEGRVSSP-SFSKAGPPKLELQMGRKWVVENQIGKKNLVI  642
            MKT KN A +  SG V +  K      P + +K  P  LEL+ G+KW VENQ    NLVI
Sbjct  1    MKTHKNPALKAQSGPVRSGPKPFSAPKPQTTTKKEPAVLELE-GKKWRVENQENVSNLVI  59

Query  641  DDCDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQ  462
            +D + KQ  YI+ C ++ LQI+GK+N+IT+D C K+G+VF DVV   E++N   V+VQ  
Sbjct  60   EDTELKQVAYIYKCVNTTLQIKGKINSITVDNCKKLGLVFDDVVGIVEIINSKDVKVQVM  119

Query  461  GVAPTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQYIHV  282
            G  PTIS++ T GC  YLSK+SL+  I +AKSSE+N+L+P  G   D+ E  +P+Q+  +
Sbjct  120  GKVPTISINKTDGCHAYLSKNSLDCEIVSAKSSEMNVLIPTEG--GDFNEFPVPEQFKTL  177

Query  281  YKDGQFITSPATHSGG  234
            + +GQ + +  T   G
Sbjct  178  W-NGQKLVTTVTEIAG  192



>gb|ELR49684.1| Adenylyl cyclase-associated protein 1 [Bos mutus]
Length=476

 Score =   158 bits (400),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 89/201 (44%), Positives = 128/201 (64%), Gaps = 11/201 (5%)
 Frame = -3

Query  815  NDMKT-KNRA--DRSGIVGASEKEGRVSSPS----FSKAGPPKLELQMGRKWVVENQIGK  657
            +DMKT KN A   +SG++ +  K    S P      +K  P  LEL+ G+KW VENQ   
Sbjct  280  DDMKTHKNPALKAQSGLIRSGPKPFSASKPDPPKPVTKKEPALLELE-GKKWRVENQENV  338

Query  656  KNLVIDDCDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGV  477
             NL+I+D + KQ  YIF C +S LQI+GK+N+IT+D C K+G+VF DVV   E++N   V
Sbjct  339  SNLMIEDTELKQVAYIFKCVNSTLQIKGKINSITVDNCKKLGLVFDDVVGIVEIINSKDV  398

Query  476  EVQCQGVAPTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQ  297
            +VQ  G  PTIS++ T GC +YLSK+SL+  I +AKSSE+N+L+P  G   D+ E  +P+
Sbjct  399  KVQVMGKVPTISINKTDGCHVYLSKNSLDCEIVSAKSSEMNVLIPTEG--GDFNEFPVPE  456

Query  296  QYIHVYKDGQFITSPATHSGG  234
            Q+  ++ +GQ + +  T   G
Sbjct  457  QFKTLW-NGQKLVTTVTEIAG  476



>ref|XP_007077462.1| PREDICTED: adenylyl cyclase-associated protein 1 isoform X1 [Panthera 
tigris altaica]
 ref|XP_011283013.1| PREDICTED: adenylyl cyclase-associated protein 1 isoform X1 [Felis 
catus]
 ref|XP_011283014.1| PREDICTED: adenylyl cyclase-associated protein 1 isoform X1 [Felis 
catus]
Length=475

 Score =   158 bits (400),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 88/197 (45%), Positives = 124/197 (63%), Gaps = 13/197 (7%)
 Frame = -3

Query  815  NDMKT-KNRA--DRSGIVGASEKEGRVSSPSFS-------KAGPPKLELQMGRKWVVENQ  666
            +DMKT KN A   +SG V +  K      P  S       K  PP LEL+ G+KW VENQ
Sbjct  276  DDMKTHKNPALKAQSGPVRSGPKPFSAPKPGVSPSPKPTTKKEPPVLELE-GKKWRVENQ  334

Query  665  IGKKNLVIDDCDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNC  486
                NLVIDD + KQ  YI+ C ++ LQI+GK+N+IT+D C K+G+VF DVV   E++N 
Sbjct  335  ENVSNLVIDDTELKQVAYIYKCVNTTLQIKGKINSITVDNCKKLGLVFDDVVGIVEIINS  394

Query  485  SGVEVQCQGVAPTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHA  306
              V+VQ  G  PTIS++ T GC +YLSK+SL+  I +AKSSE+N+L+P  G   D+ E  
Sbjct  395  RDVKVQVMGKVPTISINKTDGCHVYLSKNSLDCEIVSAKSSEMNVLIPTEG--GDFNEFP  452

Query  305  LPQQYIHVYKDGQFITS  255
            +P+Q+  ++   + +T+
Sbjct  453  VPEQFKTLWNGQKLVTT  469



>ref|XP_007077463.1| PREDICTED: adenylyl cyclase-associated protein 1 isoform X2 [Panthera 
tigris altaica]
 ref|XP_011283015.1| PREDICTED: adenylyl cyclase-associated protein 1 isoform X2 [Felis 
catus]
Length=474

 Score =   158 bits (400),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 88/197 (45%), Positives = 124/197 (63%), Gaps = 13/197 (7%)
 Frame = -3

Query  815  NDMKT-KNRA--DRSGIVGASEKEGRVSSPSFS-------KAGPPKLELQMGRKWVVENQ  666
            +DMKT KN A   +SG V +  K      P  S       K  PP LEL+ G+KW VENQ
Sbjct  275  DDMKTHKNPALKAQSGPVRSGPKPFSAPKPGVSPSPKPTTKKEPPVLELE-GKKWRVENQ  333

Query  665  IGKKNLVIDDCDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNC  486
                NLVIDD + KQ  YI+ C ++ LQI+GK+N+IT+D C K+G+VF DVV   E++N 
Sbjct  334  ENVSNLVIDDTELKQVAYIYKCVNTTLQIKGKINSITVDNCKKLGLVFDDVVGIVEIINS  393

Query  485  SGVEVQCQGVAPTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHA  306
              V+VQ  G  PTIS++ T GC +YLSK+SL+  I +AKSSE+N+L+P  G   D+ E  
Sbjct  394  RDVKVQVMGKVPTISINKTDGCHVYLSKNSLDCEIVSAKSSEMNVLIPTEG--GDFNEFP  451

Query  305  LPQQYIHVYKDGQFITS  255
            +P+Q+  ++   + +T+
Sbjct  452  VPEQFKTLWNGQKLVTT  468



>ref|NP_001030182.1| adenylyl cyclase-associated protein 1 [Bos taurus]
 ref|XP_005204711.1| PREDICTED: adenylyl cyclase-associated protein 1 isoform X1 [Bos 
taurus]
 ref|XP_005204712.1| PREDICTED: adenylyl cyclase-associated protein 1 isoform X1 [Bos 
taurus]
 sp|Q3SYV4.3|CAP1_BOVIN RecName: Full=Adenylyl cyclase-associated protein 1; Short=CAP 
1 [Bos taurus]
 gb|AAI03367.1| CAP, adenylate cyclase-associated protein 1 (yeast) [Bos taurus]
 tpg|DAA30966.1| TPA: adenylyl cyclase-associated protein 1 [Bos taurus]
Length=472

 Score =   158 bits (400),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 89/201 (44%), Positives = 128/201 (64%), Gaps = 11/201 (5%)
 Frame = -3

Query  815  NDMKT-KNRA--DRSGIVGASEKEGRVSSPS----FSKAGPPKLELQMGRKWVVENQIGK  657
            +DMKT KN A   +SG++ +  K    S P      +K  P  LEL+ G+KW VENQ   
Sbjct  276  DDMKTHKNPALKAQSGLIRSGPKPFSASKPDPPKPVAKKEPALLELE-GKKWRVENQENV  334

Query  656  KNLVIDDCDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGV  477
             NL+I+D + KQ  YIF C +S LQI+GK+N+IT+D C K+G+VF DVV   E++N   V
Sbjct  335  SNLMIEDTELKQVAYIFKCVNSTLQIKGKINSITVDNCKKLGLVFDDVVGIVEIINSKDV  394

Query  476  EVQCQGVAPTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQ  297
            +VQ  G  PTIS++ T GC +YLSK+SL+  I +AKSSE+N+L+P  G   D+ E  +P+
Sbjct  395  KVQVMGKVPTISINKTDGCHVYLSKNSLDCEIVSAKSSEMNVLIPTEG--GDFNEFPVPE  452

Query  296  QYIHVYKDGQFITSPATHSGG  234
            Q+  ++ +GQ + +  T   G
Sbjct  453  QFKTLW-NGQKLVTTVTEIAG  472



>ref|XP_002196792.2| PREDICTED: adenylyl cyclase-associated protein 1 [Taeniopygia 
guttata]
Length=465

 Score =   158 bits (399),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 87/194 (45%), Positives = 122/194 (63%), Gaps = 10/194 (5%)
 Frame = -3

Query  815  NDMKT-KNRA--DRSGIVGASEKEGRVSSPSF----SKAGPPKLELQMGRKWVVENQIGK  657
            +DMKT KN A  ++ G V +  K      P+     S   PP LEL+ G+KW VENQ   
Sbjct  269  DDMKTHKNPALKNQGGPVRSGPKPFTAPKPACNSNPSPKAPPLLELE-GKKWRVENQENA  327

Query  656  KNLVIDDCDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGV  477
             NLVI D + KQ  Y+F C +S LQI+GK+N+IT+D C K+G+VF DVV   E++N   V
Sbjct  328  TNLVISDTELKQVAYVFKCTNSTLQIKGKINSITLDNCKKLGLVFDDVVGIVEIINSRDV  387

Query  476  EVQCQGVAPTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQ  297
            +VQ  G  PTIS++ T GC +YLSK SL+  I +AKSSE+N+L+P  G   D+ E  +P+
Sbjct  388  KVQVMGKVPTISINKTDGCHVYLSKSSLDCEIVSAKSSEMNVLIPTEG--GDFTEFPVPE  445

Query  296  QYIHVYKDGQFITS  255
            Q+  V+   + +T+
Sbjct  446  QFKTVWNGQKLVTT  459



>ref|XP_004614276.1| PREDICTED: adenylyl cyclase-associated protein 1 [Sorex araneus]
Length=473

 Score =   158 bits (400),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 88/196 (45%), Positives = 127/196 (65%), Gaps = 12/196 (6%)
 Frame = -3

Query  815  NDMKT-KNRA--DRSGIVGA------SEKEGRVSSPSFSKAGPPKLELQMGRKWVVENQI  663
            +DMKT KN A   +SG V +      + K G  SSP  +   PP LEL+ G+KW VENQ 
Sbjct  275  DDMKTHKNPALKAQSGPVRSGPKPFSAPKPGVSSSPKPATKEPPLLELE-GKKWRVENQE  333

Query  662  GKKNLVIDDCDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCS  483
               NLVI+D + KQ  YI+ C ++ LQI+GK+N+IT+D C K+G+VF DVV   E++N  
Sbjct  334  NVSNLVIEDTELKQVSYIYKCVNTTLQIKGKINSITVDNCKKLGLVFDDVVGIVEIINSR  393

Query  482  GVEVQCQGVAPTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHAL  303
             V+VQ  G  PTIS++ T GC +YLSK+SL+  I +AKSSE+N+L+P  G   D+ E  +
Sbjct  394  DVKVQVMGKVPTISINKTDGCHVYLSKNSLDCEIVSAKSSEMNVLIPTEG--GDFNEFPV  451

Query  302  PQQYIHVYKDGQFITS  255
            P+Q+  ++   + +T+
Sbjct  452  PEQFKTLWNGQKLVTT  467



>ref|XP_005904935.1| PREDICTED: adenylyl cyclase-associated protein 1 isoform X1 [Bos 
mutus]
Length=471

 Score =   158 bits (399),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 89/201 (44%), Positives = 128/201 (64%), Gaps = 11/201 (5%)
 Frame = -3

Query  815  NDMKT-KNRA--DRSGIVGASEKEGRVSSPS----FSKAGPPKLELQMGRKWVVENQIGK  657
            +DMKT KN A   +SG++ +  K    S P      +K  P  LEL+ G+KW VENQ   
Sbjct  275  DDMKTHKNPALKAQSGLIRSGPKPFSASKPDPPKPVTKKEPALLELE-GKKWRVENQENV  333

Query  656  KNLVIDDCDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGV  477
             NL+I+D + KQ  YIF C +S LQI+GK+N+IT+D C K+G+VF DVV   E++N   V
Sbjct  334  SNLMIEDTELKQVAYIFKCVNSTLQIKGKINSITVDNCKKLGLVFDDVVGIVEIINSKDV  393

Query  476  EVQCQGVAPTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQ  297
            +VQ  G  PTIS++ T GC +YLSK+SL+  I +AKSSE+N+L+P  G   D+ E  +P+
Sbjct  394  KVQVMGKVPTISINKTDGCHVYLSKNSLDCEIVSAKSSEMNVLIPTEG--GDFNEFPVPE  451

Query  296  QYIHVYKDGQFITSPATHSGG  234
            Q+  ++ +GQ + +  T   G
Sbjct  452  QFKTLW-NGQKLVTTVTEIAG  471



>ref|XP_005904936.1| PREDICTED: adenylyl cyclase-associated protein 1 isoform X2 [Bos 
mutus]
Length=472

 Score =   158 bits (399),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 89/201 (44%), Positives = 128/201 (64%), Gaps = 11/201 (5%)
 Frame = -3

Query  815  NDMKT-KNRA--DRSGIVGASEKEGRVSSPS----FSKAGPPKLELQMGRKWVVENQIGK  657
            +DMKT KN A   +SG++ +  K    S P      +K  P  LEL+ G+KW VENQ   
Sbjct  276  DDMKTHKNPALKAQSGLIRSGPKPFSASKPDPPKPVTKKEPALLELE-GKKWRVENQENV  334

Query  656  KNLVIDDCDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGV  477
             NL+I+D + KQ  YIF C +S LQI+GK+N+IT+D C K+G+VF DVV   E++N   V
Sbjct  335  SNLMIEDTELKQVAYIFKCVNSTLQIKGKINSITVDNCKKLGLVFDDVVGIVEIINSKDV  394

Query  476  EVQCQGVAPTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQ  297
            +VQ  G  PTIS++ T GC +YLSK+SL+  I +AKSSE+N+L+P  G   D+ E  +P+
Sbjct  395  KVQVMGKVPTISINKTDGCHVYLSKNSLDCEIVSAKSSEMNVLIPTEG--GDFNEFPVPE  452

Query  296  QYIHVYKDGQFITSPATHSGG  234
            Q+  ++ +GQ + +  T   G
Sbjct  453  QFKTLW-NGQKLVTTVTEIAG  472



>ref|XP_005204713.1| PREDICTED: adenylyl cyclase-associated protein 1 isoform X2 [Bos 
taurus]
 ref|XP_005204714.1| PREDICTED: adenylyl cyclase-associated protein 1 isoform X2 [Bos 
taurus]
 ref|XP_005204715.1| PREDICTED: adenylyl cyclase-associated protein 1 isoform X2 [Bos 
taurus]
 ref|XP_005204716.1| PREDICTED: adenylyl cyclase-associated protein 1 isoform X2 [Bos 
taurus]
 gb|AAI47908.1| CAP1 protein [Bos taurus]
Length=471

 Score =   158 bits (399),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 89/201 (44%), Positives = 128/201 (64%), Gaps = 11/201 (5%)
 Frame = -3

Query  815  NDMKT-KNRA--DRSGIVGASEKEGRVSSPS----FSKAGPPKLELQMGRKWVVENQIGK  657
            +DMKT KN A   +SG++ +  K    S P      +K  P  LEL+ G+KW VENQ   
Sbjct  275  DDMKTHKNPALKAQSGLIRSGPKPFSASKPDPPKPVAKKEPALLELE-GKKWRVENQENV  333

Query  656  KNLVIDDCDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGV  477
             NL+I+D + KQ  YIF C +S LQI+GK+N+IT+D C K+G+VF DVV   E++N   V
Sbjct  334  SNLMIEDTELKQVAYIFKCVNSTLQIKGKINSITVDNCKKLGLVFDDVVGIVEIINSKDV  393

Query  476  EVQCQGVAPTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQ  297
            +VQ  G  PTIS++ T GC +YLSK+SL+  I +AKSSE+N+L+P  G   D+ E  +P+
Sbjct  394  KVQVMGKVPTISINKTDGCHVYLSKNSLDCEIVSAKSSEMNVLIPTEG--GDFNEFPVPE  451

Query  296  QYIHVYKDGQFITSPATHSGG  234
            Q+  ++ +GQ + +  T   G
Sbjct  452  QFKTLW-NGQKLVTTVTEIAG  471



>ref|XP_009096832.1| PREDICTED: adenylyl cyclase-associated protein 1 isoform X2 [Serinus 
canaria]
Length=464

 Score =   158 bits (399),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 87/194 (45%), Positives = 122/194 (63%), Gaps = 10/194 (5%)
 Frame = -3

Query  815  NDMKT-KNRA--DRSGIVGASEKEGRVSSPSF----SKAGPPKLELQMGRKWVVENQIGK  657
            +DMKT KN A  ++ G V +  K      P+     S   PP LEL+ G+KW VENQ   
Sbjct  268  DDMKTHKNPALKNQGGPVRSGPKPFTAPKPACNANPSPKAPPLLELE-GKKWRVENQENA  326

Query  656  KNLVIDDCDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGV  477
             NLVI D + KQ  Y+F C +S LQI+GK+N+IT+D C K+G+VF DVV   E++N   V
Sbjct  327  TNLVISDTELKQVAYVFKCTNSTLQIKGKINSITLDNCKKLGLVFDDVVGIVEIINSRDV  386

Query  476  EVQCQGVAPTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQ  297
            +VQ  G  PTIS++ T GC +YLSK SL+  I +AKSSE+N+L+P  G   D+ E  +P+
Sbjct  387  KVQVMGKVPTISINKTDGCHVYLSKSSLDCEIVSAKSSEMNVLIPTEG--GDFTEFPVPE  444

Query  296  QYIHVYKDGQFITS  255
            Q+  V+   + +T+
Sbjct  445  QFKTVWNGQKLVTT  458



>ref|XP_009096831.1| PREDICTED: adenylyl cyclase-associated protein 1 isoform X1 [Serinus 
canaria]
Length=465

 Score =   157 bits (398),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 87/194 (45%), Positives = 122/194 (63%), Gaps = 10/194 (5%)
 Frame = -3

Query  815  NDMKT-KNRA--DRSGIVGASEKEGRVSSPSF----SKAGPPKLELQMGRKWVVENQIGK  657
            +DMKT KN A  ++ G V +  K      P+     S   PP LEL+ G+KW VENQ   
Sbjct  269  DDMKTHKNPALKNQGGPVRSGPKPFTAPKPACNANPSPKAPPLLELE-GKKWRVENQENA  327

Query  656  KNLVIDDCDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGV  477
             NLVI D + KQ  Y+F C +S LQI+GK+N+IT+D C K+G+VF DVV   E++N   V
Sbjct  328  TNLVISDTELKQVAYVFKCTNSTLQIKGKINSITLDNCKKLGLVFDDVVGIVEIINSRDV  387

Query  476  EVQCQGVAPTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQ  297
            +VQ  G  PTIS++ T GC +YLSK SL+  I +AKSSE+N+L+P  G   D+ E  +P+
Sbjct  388  KVQVMGKVPTISINKTDGCHVYLSKSSLDCEIVSAKSSEMNVLIPTEG--GDFTEFPVPE  445

Query  296  QYIHVYKDGQFITS  255
            Q+  V+   + +T+
Sbjct  446  QFKTVWNGQKLVTT  459



>ref|XP_005058254.1| PREDICTED: adenylyl cyclase-associated protein 1 [Ficedula albicollis]
Length=482

 Score =   158 bits (399),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 88/198 (44%), Positives = 122/198 (62%), Gaps = 14/198 (7%)
 Frame = -3

Query  815  NDMKT-KNRA--DRSGIVGASEKEGRVSSPS--------FSKAGPPKLELQMGRKWVVEN  669
            +DMKT KN A  ++ G V +  K      P+         S   PP LEL+ G+KW VEN
Sbjct  282  DDMKTHKNPALKNQGGPVRSGPKPFTAPKPACNANPSQGSSPKAPPLLELE-GKKWRVEN  340

Query  668  QIGKKNLVIDDCDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVN  489
            Q    NLVI D + KQ  Y+F C +S LQI+GK+N+IT+D C K+G+VF DVV   E++N
Sbjct  341  QENATNLVISDTELKQVAYVFKCTNSTLQIKGKINSITLDNCKKLGLVFDDVVGIVEIIN  400

Query  488  CSGVEVQCQGVAPTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEH  309
               V+VQ  G  PTIS++ T GC +YLSK SL+  I +AKSSE+N+L+P  G   D+ E 
Sbjct  401  SRDVKVQVMGKVPTISINKTDGCHVYLSKSSLDCEIVSAKSSEMNVLIPAEG--GDFTEF  458

Query  308  ALPQQYIHVYKDGQFITS  255
             +P+Q+  V+   + +TS
Sbjct  459  PVPEQFKTVWNGQKLVTS  476



>ref|XP_008944229.1| PREDICTED: adenylyl cyclase-associated protein 2-like, partial 
[Merops nubicus]
Length=222

 Score =   152 bits (383),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 78/177 (44%), Positives = 111/177 (63%), Gaps = 9/177 (5%)
 Frame = -3

Query  764  SEKEGRVSSPSFSKAGP-----PKLELQMGRKWVVENQIGKKNLVIDDCDAKQSVYIFGC  600
            S  +    SP+  K  P     P LEL+ G+KW VE Q  K +LVI++ + KQ  YIF C
Sbjct  46   SPTKSHTPSPTSPKNSPQQSHAPVLELE-GKKWRVEYQEDKNDLVINNTELKQVAYIFKC  104

Query  599  KDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGVAPTISVDNTSGC  420
              S LQI+GK+N+ITID C K G+VF +VV   EV+N   +++Q  G  PTIS++ T GC
Sbjct  105  NKSTLQIKGKINSITIDNCNKFGLVFDNVVGIVEVINSRDIQIQVMGKVPTISINKTEGC  164

Query  419  LLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQYIHVYKDGQFITSPA  249
             +YLS++SL+  I +AKSSE+NIL+P    D D+ E  +P+Q+   +   + +T PA
Sbjct  165  HIYLSEESLDCEIVSAKSSEMNILIPQ---DGDYREFPVPEQFKTAWDGSKLVTEPA  218



>ref|XP_005607231.1| PREDICTED: adenylyl cyclase-associated protein 1 isoform X2 [Equus 
caballus]
 ref|XP_005607232.1| PREDICTED: adenylyl cyclase-associated protein 1 isoform X3 [Equus 
caballus]
 ref|XP_005607233.1| PREDICTED: adenylyl cyclase-associated protein 1 isoform X4 [Equus 
caballus]
 ref|XP_008522383.1| PREDICTED: adenylyl cyclase-associated protein 1 isoform X1 [Equus 
przewalskii]
 ref|XP_008522384.1| PREDICTED: adenylyl cyclase-associated protein 1 isoform X1 [Equus 
przewalskii]
 ref|XP_008522385.1| PREDICTED: adenylyl cyclase-associated protein 1 isoform X1 [Equus 
przewalskii]
Length=475

 Score =   157 bits (398),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 88/197 (45%), Positives = 124/197 (63%), Gaps = 13/197 (7%)
 Frame = -3

Query  815  NDMKT-KNRA--DRSGIVGASEKEGRVSSPSFS-------KAGPPKLELQMGRKWVVENQ  666
            +DMKT KN A   +SG V +  K      P  S       K  PP LEL+ G+KW VENQ
Sbjct  276  DDMKTHKNPALKAQSGPVRSGPKPFSAPKPGGSPSPKPATKKEPPLLELE-GKKWRVENQ  334

Query  665  IGKKNLVIDDCDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNC  486
                NLVIDD + KQ  YI+ C ++ LQI+GK+N+IT+D C K+G+VF DVV   E++N 
Sbjct  335  ENVSNLVIDDTELKQVAYIYKCVNTTLQIKGKINSITVDNCKKLGLVFDDVVGIVEIINS  394

Query  485  SGVEVQCQGVAPTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHA  306
              V+VQ  G  PTIS++ T GC +YLSK+SL+  I +AKSSE+N+L+P  G   D+ E  
Sbjct  395  RDVKVQVMGKVPTISINKTDGCHVYLSKNSLDCEIVSAKSSEMNVLIPTEG--GDFNEFP  452

Query  305  LPQQYIHVYKDGQFITS  255
            +P+Q+  ++   + +T+
Sbjct  453  VPEQFKTLWNGQKLVTT  469



>ref|XP_003505107.1| PREDICTED: adenylyl cyclase-associated protein 1 [Cricetulus 
griseus]
 ref|XP_007643764.1| PREDICTED: adenylyl cyclase-associated protein 1 [Cricetulus 
griseus]
 ref|XP_007643765.1| PREDICTED: adenylyl cyclase-associated protein 1 [Cricetulus 
griseus]
 ref|XP_007643766.1| PREDICTED: adenylyl cyclase-associated protein 1 [Cricetulus 
griseus]
 ref|XP_007643767.1| PREDICTED: adenylyl cyclase-associated protein 1 [Cricetulus 
griseus]
 ref|XP_007633744.1| PREDICTED: adenylyl cyclase-associated protein 1 [Cricetulus 
griseus]
 ref|XP_007633745.1| PREDICTED: adenylyl cyclase-associated protein 1 [Cricetulus 
griseus]
 ref|XP_007633746.1| PREDICTED: adenylyl cyclase-associated protein 1 [Cricetulus 
griseus]
 ref|XP_007633747.1| PREDICTED: adenylyl cyclase-associated protein 1 [Cricetulus 
griseus]
 ref|XP_007633748.1| PREDICTED: adenylyl cyclase-associated protein 1 [Cricetulus 
griseus]
 gb|EGV92588.1| Adenylyl cyclase-associated protein 1 [Cricetulus griseus]
Length=474

 Score =   157 bits (398),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 91/204 (45%), Positives = 126/204 (62%), Gaps = 14/204 (7%)
 Frame = -3

Query  815  NDMKT-KNRA--DRSGIVGASEKEGRVSSPSFS-------KAGPPKLELQMGRKWVVENQ  666
            +DMKT KN A   +SG V +  K      P  S       K  PP LEL+ G+KW VENQ
Sbjct  275  DDMKTHKNPALKAQSGPVRSGPKPFSAPKPQTSPSPKPATKKEPPLLELE-GKKWRVENQ  333

Query  665  IGKKNLVIDDCDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNC  486
                NLVIDD + KQ  YI+ C ++ LQI+GK+N+IT+D C K+G+VF DVV   E++N 
Sbjct  334  ENVSNLVIDDTELKQVAYIYKCVNTTLQIKGKINSITVDNCKKLGLVFDDVVGIVEIINS  393

Query  485  SGVEVQCQGVAPTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHA  306
              V+VQ  G  PTIS++ T GC  YLSK+SL+  I +AKSSE+N+L+P  G   D+ E  
Sbjct  394  RDVKVQVMGKVPTISINKTDGCHAYLSKNSLDCEIVSAKSSEMNVLIPTEG--GDFNEFP  451

Query  305  LPQQYIHVYKDGQFITSPATHSGG  234
            +P+Q+  ++ +GQ + +  T   G
Sbjct  452  VPEQFKTLW-NGQKLVTTVTEIAG  474



>ref|NP_001085243.1| CAP, adenylate cyclase-associated protein, 2 [Xenopus laevis]
 gb|AAQ75549.1| cyclase associated protein 2 [Xenopus laevis]
Length=482

 Score =   157 bits (398),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 76/169 (45%), Positives = 113/169 (67%), Gaps = 4/169 (2%)
 Frame = -3

Query  743  SSPSFSKAGPPKLELQMGRKWVVENQIGKKNLVIDDCDAKQSVYIFGCKDSVLQIQGKVN  564
            ++P   ++ PP LEL+ G+KW VE Q G + LVI + + KQ VYIF CK + +Q++GK+N
Sbjct  318  TTPPAHQSYPPLLELE-GKKWRVEYQEGSQGLVISETELKQVVYIFKCKKTTVQVKGKIN  376

Query  563  NITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGVAPTISVDNTSGCLLYLSKDSLEAS  384
            +I ID C K+G+VF DVV   EV+N   +E+Q  G  PTIS++ T GC +YLS++S++  
Sbjct  377  SIIIDNCAKLGLVFDDVVGIVEVINSKNIEIQVLGKVPTISINKTGGCHVYLSENSIDCE  436

Query  383  ITTAKSSEVNILVPGAGPDADWEEHALPQQYIHVYKDGQFITSPATHSG  237
            I +AKSSE+NILVP    D D++E  +P+Q+   +   + +T PA   G
Sbjct  437  IVSAKSSEMNILVPH---DGDYKEFPVPEQFKTSWDGSKLVTEPAEMMG  482



>ref|XP_001503410.2| PREDICTED: adenylyl cyclase-associated protein 1 isoform X1 [Equus 
caballus]
 ref|XP_008522386.1| PREDICTED: adenylyl cyclase-associated protein 1 isoform X2 [Equus 
przewalskii]
Length=474

 Score =   157 bits (398),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 88/197 (45%), Positives = 124/197 (63%), Gaps = 13/197 (7%)
 Frame = -3

Query  815  NDMKT-KNRA--DRSGIVGASEKEGRVSSPSFS-------KAGPPKLELQMGRKWVVENQ  666
            +DMKT KN A   +SG V +  K      P  S       K  PP LEL+ G+KW VENQ
Sbjct  275  DDMKTHKNPALKAQSGPVRSGPKPFSAPKPGGSPSPKPATKKEPPLLELE-GKKWRVENQ  333

Query  665  IGKKNLVIDDCDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNC  486
                NLVIDD + KQ  YI+ C ++ LQI+GK+N+IT+D C K+G+VF DVV   E++N 
Sbjct  334  ENVSNLVIDDTELKQVAYIYKCVNTTLQIKGKINSITVDNCKKLGLVFDDVVGIVEIINS  393

Query  485  SGVEVQCQGVAPTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHA  306
              V+VQ  G  PTIS++ T GC +YLSK+SL+  I +AKSSE+N+L+P  G   D+ E  
Sbjct  394  RDVKVQVMGKVPTISINKTDGCHVYLSKNSLDCEIVSAKSSEMNVLIPTEG--GDFNEFP  451

Query  305  LPQQYIHVYKDGQFITS  255
            +P+Q+  ++   + +T+
Sbjct  452  VPEQFKTLWNGQKLVTT  468



>ref|XP_005427223.1| PREDICTED: adenylyl cyclase-associated protein 1 [Geospiza fortis]
Length=500

 Score =   157 bits (398),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 87/194 (45%), Positives = 122/194 (63%), Gaps = 10/194 (5%)
 Frame = -3

Query  815  NDMKT-KNRA--DRSGIVGASEKEGRVSSPSF----SKAGPPKLELQMGRKWVVENQIGK  657
            +DMKT KN A  ++ G V +  K      P+     S   PP LEL+ G+KW VENQ   
Sbjct  304  DDMKTHKNPALKNQGGPVRSGPKPFTAPKPACNANPSPKAPPLLELE-GKKWRVENQENA  362

Query  656  KNLVIDDCDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGV  477
             NLVI D + KQ  Y+F C +S LQI+GK+N+IT+D C K+G+VF DVV   E++N   V
Sbjct  363  TNLVISDTELKQVAYVFKCTNSTLQIKGKINSITLDNCKKLGLVFDDVVGIVEIINSRDV  422

Query  476  EVQCQGVAPTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQ  297
            +VQ  G  PTIS++ T GC +YLSK SL+  I +AKSSE+N+L+P  G   D+ E  +P+
Sbjct  423  KVQVMGKVPTISINKTDGCHVYLSKSSLDCEIVSAKSSEMNVLIPTEG--GDFTEFPVPE  480

Query  296  QYIHVYKDGQFITS  255
            Q+  V+   + +T+
Sbjct  481  QFKTVWNGQKLVTT  494



>ref|XP_005494743.1| PREDICTED: adenylyl cyclase-associated protein 1 [Zonotrichia 
albicollis]
Length=471

 Score =   157 bits (397),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 87/194 (45%), Positives = 122/194 (63%), Gaps = 10/194 (5%)
 Frame = -3

Query  815  NDMKT-KNRA--DRSGIVGASEKEGRVSSPSF----SKAGPPKLELQMGRKWVVENQIGK  657
            +DMKT KN A  ++ G V +  K      P+     S   PP LEL+ G+KW VENQ   
Sbjct  275  DDMKTHKNPALKNQGGPVRSGPKPFTAPKPACNANPSPKAPPLLELE-GKKWRVENQENA  333

Query  656  KNLVIDDCDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGV  477
             NLVI D + KQ  Y+F C +S LQI+GK+N+IT+D C K+G+VF DVV   E++N   V
Sbjct  334  TNLVISDTELKQVAYVFKCTNSTLQIKGKINSITLDNCKKLGLVFDDVVGIVEIINSRDV  393

Query  476  EVQCQGVAPTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQ  297
            +VQ  G  PTIS++ T GC +YLSK SL+  I +AKSSE+N+L+P  G   D+ E  +P+
Sbjct  394  KVQVMGKVPTISINKTDGCHVYLSKSSLDCEIVSAKSSEMNVLIPTDG--GDFTEFPVPE  451

Query  296  QYIHVYKDGQFITS  255
            Q+  V+   + +T+
Sbjct  452  QFKTVWNGQKLVTT  465



>emb|CEF61777.1| Adenylyl cyclase-associated protein [Strongyloides ratti]
Length=488

 Score =   157 bits (398),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 82/183 (45%), Positives = 118/183 (64%), Gaps = 6/183 (3%)
 Frame = -3

Query  812  DMKT-KNRADR-SGIVGASEKEGRVSS---PSFSKAGPPKLELQMGRKWVVENQIGKKNL  648
            DM+T KN + R S +V  + K    SS   P      PP+LEL+ G+ W VE     KN+
Sbjct  293  DMQTHKNPSLRISSVVSDTNKNKTSSSQNVPKVETVKPPRLELEQGKNWCVEYYKNDKNV  352

Query  647  VIDDCDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQ  468
            V++  D KQ+VY+F C+ SV+QI+GKVN+I +D C K  +VF ++++  EV+NC  ++VQ
Sbjct  353  VVNINDMKQTVYVFKCEGSVIQIKGKVNSIILDSCKKTSIVFENLLSQIEVINCQSIQVQ  412

Query  467  CQGVAPTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQYI  288
              G  PTIS+  T GC +YLSK+S +A I  +KSSE+N+L+P  G D ++ E ALP+QY 
Sbjct  413  TMGKLPTISIQKTDGCQVYLSKESFDAEIVHSKSSEMNVLIPN-GEDGEFIEFALPEQYK  471

Query  287  HVY  279
              Y
Sbjct  472  TTY  474



>ref|XP_010732388.1| PREDICTED: adenylyl cyclase-associated protein 1 [Larimichthys 
crocea]
Length=470

 Score =   157 bits (397),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 83/178 (47%), Positives = 113/178 (63%), Gaps = 4/178 (2%)
 Frame = -3

Query  767  ASEKEGRVSSPSFSKAGPPKLELQMGRKWVVENQIGKKNLVIDDCDAKQSVYIFGCKDSV  588
            AS      +S + ++  PP LEL  G+KW VENQ G ++LVI   + KQ VY F C  S 
Sbjct  297  ASPAPRPAASATPTRTLPPVLELD-GKKWKVENQEGAQDLVISKTELKQVVYAFKCNKST  355

Query  587  LQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGVAPTISVDNTSGCLLYL  408
            LQ++GK+N+I +D C KMG+VF DVV   E++NC  V+VQ  G  PTIS++ T GC +YL
Sbjct  356  LQVKGKINSIIVDNCKKMGLVFDDVVGIIEIINCKDVKVQVMGKVPTISINKTDGCHIYL  415

Query  407  SKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQYIHVYKDGQFITSPATHSGG  234
            S DSL   I +AKSSE+NILVP    D ++ E  +P+Q+  V+ DG  + + AT   G
Sbjct  416  SNDSLNCEIVSAKSSEMNILVPNK--DGEFTELPVPEQFKTVW-DGNKLVTTATEIAG  470



>gb|KFO76850.1| Adenylyl cyclase-associated protein 1, partial [Cuculus canorus]
Length=417

 Score =   156 bits (395),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 89/198 (45%), Positives = 122/198 (62%), Gaps = 14/198 (7%)
 Frame = -3

Query  815  NDMKT-KNRA--DRSGIVGASEKEGRVSSPS--------FSKAGPPKLELQMGRKWVVEN  669
            +DMKT KN A  ++ G V +  K      P+         S   P  LEL+ G+KW VEN
Sbjct  217  DDMKTHKNPALKNQGGPVRSGPKPFTAPKPACNANPSQKNSPKAPALLELE-GKKWRVEN  275

Query  668  QIGKKNLVIDDCDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVN  489
            Q    NLVI D + KQ  Y+F C +S LQI+GK+N+IT+D C K+G+VF DVV   E++N
Sbjct  276  QENATNLVISDTELKQVAYVFKCSNSTLQIKGKINSITLDNCKKLGLVFDDVVGIVEIIN  335

Query  488  CSGVEVQCQGVAPTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEH  309
               V+VQ  G  PTIS++ T GC +YLSKDSL+  I +AKSSE+NIL+P  G   D+ E 
Sbjct  336  SRDVKVQVMGKVPTISINKTDGCHVYLSKDSLDCEIVSAKSSEMNILIPTEG--GDFTEF  393

Query  308  ALPQQYIHVYKDGQFITS  255
             +P+Q+  V+   + IT+
Sbjct  394  PVPEQFKTVWNGQKLITT  411



>ref|XP_006972902.1| PREDICTED: adenylyl cyclase-associated protein 2 isoform X1 [Peromyscus 
maniculatus bairdii]
Length=482

 Score =   157 bits (397),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 84/195 (43%), Positives = 122/195 (63%), Gaps = 10/195 (5%)
 Frame = -3

Query  815  NDMKT-KNRADRSGIVGASEKEGRVSSPSFSKAGPPK-----LELQMGRKWVVENQIGKK  654
            +D KT KN + R+     S  +    SP+  K+ PP+     LEL+ G+KW VE Q  K 
Sbjct  288  DDQKTYKNPSLRAQGQARSPTKTHTPSPTSPKSNPPQKHAPVLELE-GKKWRVEYQEDKN  346

Query  653  NLVIDDCDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVE  474
            +LVI + + KQ  YIF C+ S LQI+GKVN+IT+D C K G+VF +VV   EV+N   ++
Sbjct  347  DLVISETELKQVAYIFKCEKSTLQIKGKVNSITVDNCKKFGLVFDNVVGIVEVINSKDIQ  406

Query  473  VQCQGVAPTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQ  294
            +Q  G  PTIS++ T GC LYLS+D+L+  I +AKSSE+N+L+P      D+ E  +P+Q
Sbjct  407  IQVMGRVPTISINKTEGCHLYLSEDALDCEIVSAKSSEMNVLIPQGD---DYREFPVPEQ  463

Query  293  YIHVYKDGQFITSPA  249
            +  V+   + +T PA
Sbjct  464  FKTVWDGSKLVTEPA  478



>ref|XP_006972904.1| PREDICTED: adenylyl cyclase-associated protein 2 isoform X3 [Peromyscus 
maniculatus bairdii]
Length=476

 Score =   157 bits (397),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 84/195 (43%), Positives = 122/195 (63%), Gaps = 10/195 (5%)
 Frame = -3

Query  815  NDMKT-KNRADRSGIVGASEKEGRVSSPSFSKAGPPK-----LELQMGRKWVVENQIGKK  654
            +D KT KN + R+     S  +    SP+  K+ PP+     LEL+ G+KW VE Q  K 
Sbjct  282  DDQKTYKNPSLRAQGQARSPTKTHTPSPTSPKSNPPQKHAPVLELE-GKKWRVEYQEDKN  340

Query  653  NLVIDDCDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVE  474
            +LVI + + KQ  YIF C+ S LQI+GKVN+IT+D C K G+VF +VV   EV+N   ++
Sbjct  341  DLVISETELKQVAYIFKCEKSTLQIKGKVNSITVDNCKKFGLVFDNVVGIVEVINSKDIQ  400

Query  473  VQCQGVAPTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQ  294
            +Q  G  PTIS++ T GC LYLS+D+L+  I +AKSSE+N+L+P      D+ E  +P+Q
Sbjct  401  IQVMGRVPTISINKTEGCHLYLSEDALDCEIVSAKSSEMNVLIPQGD---DYREFPVPEQ  457

Query  293  YIHVYKDGQFITSPA  249
            +  V+   + +T PA
Sbjct  458  FKTVWDGSKLVTEPA  472



>ref|XP_006972903.1| PREDICTED: adenylyl cyclase-associated protein 2 isoform X2 [Peromyscus 
maniculatus bairdii]
Length=481

 Score =   157 bits (397),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 84/195 (43%), Positives = 122/195 (63%), Gaps = 10/195 (5%)
 Frame = -3

Query  815  NDMKT-KNRADRSGIVGASEKEGRVSSPSFSKAGPPK-----LELQMGRKWVVENQIGKK  654
            +D KT KN + R+     S  +    SP+  K+ PP+     LEL+ G+KW VE Q  K 
Sbjct  287  DDQKTYKNPSLRAQGQARSPTKTHTPSPTSPKSNPPQKHAPVLELE-GKKWRVEYQEDKN  345

Query  653  NLVIDDCDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVE  474
            +LVI + + KQ  YIF C+ S LQI+GKVN+IT+D C K G+VF +VV   EV+N   ++
Sbjct  346  DLVISETELKQVAYIFKCEKSTLQIKGKVNSITVDNCKKFGLVFDNVVGIVEVINSKDIQ  405

Query  473  VQCQGVAPTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQ  294
            +Q  G  PTIS++ T GC LYLS+D+L+  I +AKSSE+N+L+P      D+ E  +P+Q
Sbjct  406  IQVMGRVPTISINKTEGCHLYLSEDALDCEIVSAKSSEMNVLIPQGD---DYREFPVPEQ  462

Query  293  YIHVYKDGQFITSPA  249
            +  V+   + +T PA
Sbjct  463  FKTVWDGSKLVTEPA  477



>gb|KFP93229.1| Adenylyl cyclase-associated protein 1, partial [Haliaeetus albicilla]
Length=441

 Score =   156 bits (395),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 77/162 (48%), Positives = 108/162 (67%), Gaps = 3/162 (2%)
 Frame = -3

Query  740  SPSFSKAGPPKLELQMGRKWVVENQIGKKNLVIDDCDAKQSVYIFGCKDSVLQIQGKVNN  561
            SP  S   P  LEL+ G+KW VENQ    NLVI D + KQ  Y+F C +S LQI+GK+N+
Sbjct  277  SPKTSPKAPALLELE-GKKWRVENQENATNLVISDTELKQVAYVFKCTNSTLQIKGKINS  335

Query  560  ITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGVAPTISVDNTSGCLLYLSKDSLEASI  381
            IT+D C K+G+VF DVV   E++N   V+VQ  G  PTIS++ T GC +YLSK+SL+  I
Sbjct  336  ITLDNCKKLGLVFDDVVGIVEIINSRDVKVQVMGKVPTISINKTDGCHVYLSKNSLDCEI  395

Query  380  TTAKSSEVNILVPGAGPDADWEEHALPQQYIHVYKDGQFITS  255
             +AKSSE+N+L+P  G   D+ E  +P+Q+  V+   + +T+
Sbjct  396  VSAKSSEMNVLIPTEG--GDFTEFPVPEQFKTVWNGQKLVTT  435



>ref|XP_009881073.1| PREDICTED: adenylyl cyclase-associated protein 1 [Charadrius 
vociferus]
Length=469

 Score =   157 bits (396),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 77/162 (48%), Positives = 108/162 (67%), Gaps = 3/162 (2%)
 Frame = -3

Query  740  SPSFSKAGPPKLELQMGRKWVVENQIGKKNLVIDDCDAKQSVYIFGCKDSVLQIQGKVNN  561
            SP  S   P  LEL+ G+KW VENQ    NLVI D + KQ  Y+F C +S LQI+GK+N+
Sbjct  305  SPKTSPKAPALLELE-GKKWRVENQENATNLVISDTELKQVAYVFKCTNSTLQIKGKINS  363

Query  560  ITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGVAPTISVDNTSGCLLYLSKDSLEASI  381
            IT+D C K+G+VF DVV   E++N   V+VQ  G  PTIS++ T GC +YLSK+SL+  I
Sbjct  364  ITLDNCKKLGLVFDDVVGIVEIINSRDVKVQVMGKVPTISINKTDGCHVYLSKNSLDCEI  423

Query  380  TTAKSSEVNILVPGAGPDADWEEHALPQQYIHVYKDGQFITS  255
             +AKSSE+N+L+P  G   D+ E  +P+Q+  V+   + +T+
Sbjct  424  VSAKSSEMNVLIPTEG--GDFTEFPVPEQFKTVWNGQKLVTT  463



>ref|XP_005529871.1| PREDICTED: adenylyl cyclase-associated protein 1 [Pseudopodoces 
humilis]
Length=482

 Score =   157 bits (396),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 90/205 (44%), Positives = 125/205 (61%), Gaps = 15/205 (7%)
 Frame = -3

Query  815  NDMKT-KNRA--DRSGIVGASEKEGRVSSPS--------FSKAGPPKLELQMGRKWVVEN  669
            +DMKT KN A  ++ G V +  K      P+         S   PP LEL+ G+KW VEN
Sbjct  282  DDMKTHKNPALKNQGGPVRSGPKPFTAPKPACNANPSQGTSPKAPPLLELE-GKKWRVEN  340

Query  668  QIGKKNLVIDDCDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVN  489
            Q    NLVI D + KQ  Y+F C +S LQI+GK+N+IT+D C K+G+VF DVV   E++N
Sbjct  341  QENATNLVISDTELKQVAYVFKCTNSTLQIKGKINSITLDNCKKLGLVFDDVVGIVEIIN  400

Query  488  CSGVEVQCQGVAPTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEH  309
               V+VQ  G  PTIS++ T GC +YLSK SL+  I +AKSSE+N+L+P  G   D+ E 
Sbjct  401  SRDVKVQVMGKVPTISINKTDGCHVYLSKSSLDCEIVSAKSSEMNVLIPSEG--GDFTEF  458

Query  308  ALPQQYIHVYKDGQFITSPATHSGG  234
             +P+Q+  V+ +GQ + +  T   G
Sbjct  459  PVPEQFKTVW-NGQKLVTTVTEIAG  482



>ref|XP_010574378.1| PREDICTED: adenylyl cyclase-associated protein 1 [Haliaeetus 
leucocephalus]
Length=469

 Score =   157 bits (396),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 77/162 (48%), Positives = 108/162 (67%), Gaps = 3/162 (2%)
 Frame = -3

Query  740  SPSFSKAGPPKLELQMGRKWVVENQIGKKNLVIDDCDAKQSVYIFGCKDSVLQIQGKVNN  561
            SP  S   P  LEL+ G+KW VENQ    NLVI D + KQ  Y+F C +S LQI+GK+N+
Sbjct  305  SPKTSPKAPALLELE-GKKWRVENQENATNLVISDTELKQVAYVFKCTNSTLQIKGKINS  363

Query  560  ITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGVAPTISVDNTSGCLLYLSKDSLEASI  381
            IT+D C K+G+VF DVV   E++N   V+VQ  G  PTIS++ T GC +YLSK+SL+  I
Sbjct  364  ITLDNCKKLGLVFDDVVGIVEIINSRDVKVQVMGKVPTISINKTDGCHVYLSKNSLDCEI  423

Query  380  TTAKSSEVNILVPGAGPDADWEEHALPQQYIHVYKDGQFITS  255
             +AKSSE+N+L+P  G   D+ E  +P+Q+  V+   + +T+
Sbjct  424  VSAKSSEMNVLIPTEG--GDFTEFPVPEQFKTVWNGQKLVTT  463



>ref|XP_009929138.1| PREDICTED: adenylyl cyclase-associated protein 1 [Haliaeetus 
albicilla]
Length=469

 Score =   157 bits (396),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 77/162 (48%), Positives = 108/162 (67%), Gaps = 3/162 (2%)
 Frame = -3

Query  740  SPSFSKAGPPKLELQMGRKWVVENQIGKKNLVIDDCDAKQSVYIFGCKDSVLQIQGKVNN  561
            SP  S   P  LEL+ G+KW VENQ    NLVI D + KQ  Y+F C +S LQI+GK+N+
Sbjct  305  SPKTSPKAPALLELE-GKKWRVENQENATNLVISDTELKQVAYVFKCTNSTLQIKGKINS  363

Query  560  ITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGVAPTISVDNTSGCLLYLSKDSLEASI  381
            IT+D C K+G+VF DVV   E++N   V+VQ  G  PTIS++ T GC +YLSK+SL+  I
Sbjct  364  ITLDNCKKLGLVFDDVVGIVEIINSRDVKVQVMGKVPTISINKTDGCHVYLSKNSLDCEI  423

Query  380  TTAKSSEVNILVPGAGPDADWEEHALPQQYIHVYKDGQFITS  255
             +AKSSE+N+L+P  G   D+ E  +P+Q+  V+   + +T+
Sbjct  424  VSAKSSEMNVLIPTEG--GDFTEFPVPEQFKTVWNGQKLVTT  463



>ref|XP_009813967.1| PREDICTED: adenylyl cyclase-associated protein 1 [Gavia stellata]
Length=469

 Score =   157 bits (396),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 77/162 (48%), Positives = 108/162 (67%), Gaps = 3/162 (2%)
 Frame = -3

Query  740  SPSFSKAGPPKLELQMGRKWVVENQIGKKNLVIDDCDAKQSVYIFGCKDSVLQIQGKVNN  561
            SP  S   P  LEL+ G+KW VENQ    NLVI D + KQ  Y+F C +S LQI+GK+N+
Sbjct  305  SPKTSPKAPALLELE-GKKWRVENQENATNLVISDTELKQVAYVFKCTNSTLQIKGKINS  363

Query  560  ITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGVAPTISVDNTSGCLLYLSKDSLEASI  381
            IT+D C K+G+VF DVV   E++N   V+VQ  G  PTIS++ T GC +YLSK+SL+  I
Sbjct  364  ITLDNCKKLGLVFDDVVGIVEIINSRDVKVQVMGKVPTISINKTDGCHVYLSKNSLDCEI  423

Query  380  TTAKSSEVNILVPGAGPDADWEEHALPQQYIHVYKDGQFITS  255
             +AKSSE+N+L+P  G   D+ E  +P+Q+  V+   + +T+
Sbjct  424  VSAKSSEMNVLIPTEG--GDFTEFPVPEQFKTVWNGQKLVTT  463



>ref|XP_009560106.1| PREDICTED: adenylyl cyclase-associated protein 1 [Cuculus canorus]
Length=469

 Score =   157 bits (396),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 78/158 (49%), Positives = 106/158 (67%), Gaps = 3/158 (2%)
 Frame = -3

Query  728  SKAGPPKLELQMGRKWVVENQIGKKNLVIDDCDAKQSVYIFGCKDSVLQIQGKVNNITID  549
            S   P  LEL+ G+KW VENQ    NLVI D + KQ  Y+F C +S LQI+GK+N+IT+D
Sbjct  309  SPKAPALLELE-GKKWRVENQENATNLVISDTELKQVAYVFKCSNSTLQIKGKINSITLD  367

Query  548  KCTKMGVVFSDVVAAFEVVNCSGVEVQCQGVAPTISVDNTSGCLLYLSKDSLEASITTAK  369
             C K+G+VF DVV   E++N   V+VQ  G  PTIS++ T GC +YLSKDSL+  I +AK
Sbjct  368  NCKKLGLVFDDVVGIVEIINSRDVKVQVMGKVPTISINKTDGCHVYLSKDSLDCEIVSAK  427

Query  368  SSEVNILVPGAGPDADWEEHALPQQYIHVYKDGQFITS  255
            SSE+NIL+P  G   D+ E  +P+Q+  V+   + IT+
Sbjct  428  SSEMNILIPTEG--GDFTEFPVPEQFKTVWNGQKLITT  463



>ref|XP_007114322.1| PREDICTED: adenylyl cyclase-associated protein 1 isoform X3 [Physeter 
catodon]
 ref|XP_007114323.1| PREDICTED: adenylyl cyclase-associated protein 1 isoform X4 [Physeter 
catodon]
Length=474

 Score =   157 bits (396),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 81/172 (47%), Positives = 114/172 (66%), Gaps = 4/172 (2%)
 Frame = -3

Query  767  ASEKEGRVSSPS-FSKAGPPKLELQMGRKWVVENQIGKKNLVIDDCDAKQSVYIFGCKDS  591
            ++ K G   SP   +K  P  LEL+ G+KW VENQ    NLVIDD + KQ  YIF C +S
Sbjct  300  SASKPGVSPSPKPVTKKEPALLELE-GKKWRVENQENVSNLVIDDTELKQVAYIFKCVNS  358

Query  590  VLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGVAPTISVDNTSGCLLY  411
             LQI+GK+N+IT+D C K+G+VF DVV   E++N   V+VQ  G  PTIS++ T GC +Y
Sbjct  359  TLQIKGKINSITVDNCKKLGLVFDDVVGIVEIINSRDVKVQVMGKVPTISINKTDGCHVY  418

Query  410  LSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQYIHVYKDGQFITS  255
            LSK+SL+  I +AKSSE+N+L+P  G   D+ E  +P+Q+  V+   + +T+
Sbjct  419  LSKNSLDCEIVSAKSSEMNVLIPTEGD--DFNEFPVPEQFKTVWNGRKLVTT  468



>ref|XP_008169234.1| PREDICTED: adenylyl cyclase-associated protein 1 [Chrysemys picta 
bellii]
Length=473

 Score =   156 bits (395),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 79/163 (48%), Positives = 108/163 (66%), Gaps = 6/163 (4%)
 Frame = -3

Query  743  SSPSFSKAGPPKLELQMGRKWVVENQIGKKNLVIDDCDAKQSVYIFGCKDSVLQIQGKVN  564
            SSP   K  P  LEL+ G+KW VENQ    NLVI D + KQ  YI+ C +S LQI+GK+N
Sbjct  311  SSP---KKEPAMLELE-GKKWRVENQEMASNLVISDTELKQVAYIYNCTNSTLQIKGKIN  366

Query  563  NITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGVAPTISVDNTSGCLLYLSKDSLEAS  384
            +IT+D C K+G+VF DVV   E++NC  V+VQ  G  PTIS++ T GC +YLSK SLE  
Sbjct  367  SITVDNCKKLGLVFDDVVGIVEIINCRDVKVQVMGKVPTISINKTDGCHVYLSKSSLECE  426

Query  383  ITTAKSSEVNILVPGAGPDADWEEHALPQQYIHVYKDGQFITS  255
            I +AKSSE+N+L+P      D+ E  +P+Q+  ++   + +TS
Sbjct  427  IVSAKSSEMNVLIPTE--SGDFNEFPIPEQFKSLWNGQKLVTS  467



>ref|XP_004266450.1| PREDICTED: adenylyl cyclase-associated protein 1 isoform 3 [Orcinus 
orca]
Length=474

 Score =   156 bits (395),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 81/172 (47%), Positives = 114/172 (66%), Gaps = 4/172 (2%)
 Frame = -3

Query  767  ASEKEGRVSSPS-FSKAGPPKLELQMGRKWVVENQIGKKNLVIDDCDAKQSVYIFGCKDS  591
            ++ K G   SP   +K  P  LEL+ G+KW VENQ    NLVIDD + KQ  YIF C +S
Sbjct  300  SASKPGVSPSPKPVTKKEPALLELE-GKKWRVENQENVSNLVIDDTELKQVAYIFKCVNS  358

Query  590  VLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGVAPTISVDNTSGCLLY  411
             LQI+GK+N+IT+D C K+G+VF DVV   E++N   V+VQ  G  PTIS++ T GC +Y
Sbjct  359  TLQIKGKINSITVDNCKKLGLVFDDVVGIVEIINSRDVKVQVMGKVPTISINKTDGCHVY  418

Query  410  LSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQYIHVYKDGQFITS  255
            LSK+SL+  I +AKSSE+N+L+P  G   D+ E  +P+Q+  V+   + +T+
Sbjct  419  LSKNSLDCEIVSAKSSEMNVLIPTEGD--DFNEFPVPEQFKTVWNGRKLVTT  468



>ref|XP_010861116.1| PREDICTED: adenylyl cyclase-associated protein 1 [Bison bison 
bison]
Length=547

 Score =   157 bits (398),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 86/194 (44%), Positives = 125/194 (64%), Gaps = 10/194 (5%)
 Frame = -3

Query  815  NDMKT-KNRA--DRSGIVGASEKEGRVSSPS----FSKAGPPKLELQMGRKWVVENQIGK  657
            +DMKT KN A   +SG++ +  K    S P      +K  P  LEL+ G+KW VENQ   
Sbjct  351  DDMKTHKNPALKAQSGLIRSGPKPFSASKPDPPKPVAKKEPALLELE-GKKWRVENQENV  409

Query  656  KNLVIDDCDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGV  477
             NL+I+D + KQ  YIF C +S LQI+GK+N+IT+D C K+G+VF DVV   E++N   V
Sbjct  410  SNLMIEDTELKQVAYIFKCVNSTLQIKGKINSITVDNCKKLGLVFDDVVGIVEIINSKDV  469

Query  476  EVQCQGVAPTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQ  297
            +VQ  G  PTIS++ T GC +YLSK+SL+  I +AKSSE+N+L+P  G   D+ E  +P+
Sbjct  470  KVQVMGKVPTISINKTDGCHVYLSKNSLDCEIVSAKSSEMNVLIPTEG--GDFNEFPVPE  527

Query  296  QYIHVYKDGQFITS  255
            Q+  ++   + +T+
Sbjct  528  QFKTLWNGQKLVTT  541



>ref|XP_007114320.1| PREDICTED: adenylyl cyclase-associated protein 1 isoform X1 [Physeter 
catodon]
 ref|XP_007114321.1| PREDICTED: adenylyl cyclase-associated protein 1 isoform X2 [Physeter 
catodon]
Length=475

 Score =   156 bits (395),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 81/172 (47%), Positives = 114/172 (66%), Gaps = 4/172 (2%)
 Frame = -3

Query  767  ASEKEGRVSSPS-FSKAGPPKLELQMGRKWVVENQIGKKNLVIDDCDAKQSVYIFGCKDS  591
            ++ K G   SP   +K  P  LEL+ G+KW VENQ    NLVIDD + KQ  YIF C +S
Sbjct  301  SASKPGVSPSPKPVTKKEPALLELE-GKKWRVENQENVSNLVIDDTELKQVAYIFKCVNS  359

Query  590  VLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGVAPTISVDNTSGCLLY  411
             LQI+GK+N+IT+D C K+G+VF DVV   E++N   V+VQ  G  PTIS++ T GC +Y
Sbjct  360  TLQIKGKINSITVDNCKKLGLVFDDVVGIVEIINSRDVKVQVMGKVPTISINKTDGCHVY  419

Query  410  LSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQYIHVYKDGQFITS  255
            LSK+SL+  I +AKSSE+N+L+P  G   D+ E  +P+Q+  V+   + +T+
Sbjct  420  LSKNSLDCEIVSAKSSEMNVLIPTEGD--DFNEFPVPEQFKTVWNGRKLVTT  469



>pdb|1K8F|A Chain A, Crystal Structure Of The Human C-Terminal Cap1-Adenylyl 
Cyclase Associated Protein
 pdb|1K8F|B Chain B, Crystal Structure Of The Human C-Terminal Cap1-Adenylyl 
Cyclase Associated Protein
 pdb|1K8F|C Chain C, Crystal Structure Of The Human C-Terminal Cap1-Adenylyl 
Cyclase Associated Protein
 pdb|1K8F|D Chain D, Crystal Structure Of The Human C-Terminal Cap1-Adenylyl 
Cyclase Associated Protein
Length=157

 Score =   149 bits (375),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 75/161 (47%), Positives = 108/161 (67%), Gaps = 4/161 (2%)
 Frame = -3

Query  716  PPKLELQMGRKWVVENQIGKKNLVIDDCDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTK  537
            P  LEL+ G+KW VENQ    NLVI+D + KQ  YI+ C ++ LQI+GK+N+IT+D C K
Sbjct  1    PAVLELE-GKKWRVENQENVSNLVIEDTELKQVAYIYKCVNTTLQIKGKINSITVDNCKK  59

Query  536  MGVVFSDVVAAFEVVNCSGVEVQCQGVAPTISVDNTSGCLLYLSKDSLEASITTAKSSEV  357
            +G+VF DVV   E++N   V+VQ  G  PTIS++ T GC  YLSK+SL+  I +AKSSE+
Sbjct  60   LGLVFDDVVGIVEIINSKDVKVQVMGKVPTISINKTDGCHAYLSKNSLDCEIVSAKSSEM  119

Query  356  NILVPGAGPDADWEEHALPQQYIHVYKDGQFITSPATHSGG  234
            N+L+P  G   D+ E  +P+Q+  ++ +GQ + +  T   G
Sbjct  120  NVLIPTEG--GDFNEFPVPEQFKTLW-NGQKLVTTVTEIAG  157



>gb|ERE85598.1| adenylyl cyclase-associated protein 1-like isoform 2 [Cricetulus 
griseus]
Length=544

 Score =   157 bits (397),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 88/197 (45%), Positives = 123/197 (62%), Gaps = 13/197 (7%)
 Frame = -3

Query  815  NDMKT-KNRA--DRSGIVGASEKEGRVSSPSFS-------KAGPPKLELQMGRKWVVENQ  666
            +DMKT KN A   +SG V +  K      P  S       K  PP LEL+ G+KW VENQ
Sbjct  345  DDMKTHKNPALKAQSGPVRSGPKPFSAPKPQTSPSPKPATKKEPPLLELE-GKKWRVENQ  403

Query  665  IGKKNLVIDDCDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNC  486
                NLVIDD + KQ  YI+ C ++ LQI+GK+N+IT+D C K+G+VF DVV   E++N 
Sbjct  404  ENVSNLVIDDTELKQVAYIYKCVNTTLQIKGKINSITVDNCKKLGLVFDDVVGIVEIINS  463

Query  485  SGVEVQCQGVAPTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHA  306
              V+VQ  G  PTIS++ T GC  YLSK+SL+  I +AKSSE+N+L+P  G   D+ E  
Sbjct  464  RDVKVQVMGKVPTISINKTDGCHAYLSKNSLDCEIVSAKSSEMNVLIPTEG--GDFNEFP  521

Query  305  LPQQYIHVYKDGQFITS  255
            +P+Q+  ++   + +T+
Sbjct  522  VPEQFKTLWNGQKLVTT  538



>ref|XP_010084383.1| PREDICTED: adenylyl cyclase-associated protein 1 [Pterocles gutturalis]
Length=469

 Score =   156 bits (395),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 77/162 (48%), Positives = 109/162 (67%), Gaps = 3/162 (2%)
 Frame = -3

Query  740  SPSFSKAGPPKLELQMGRKWVVENQIGKKNLVIDDCDAKQSVYIFGCKDSVLQIQGKVNN  561
            SP  S   P  LEL+ G+KW VENQ    +LVI D + KQ VY+F C +S LQI+GK+N+
Sbjct  305  SPKTSPKAPALLELE-GKKWRVENQENATDLVISDTELKQVVYVFKCTNSTLQIKGKINS  363

Query  560  ITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGVAPTISVDNTSGCLLYLSKDSLEASI  381
            IT+D C K+G+VF DVV   E++N   V+VQ  G  PTIS++ T GC +YLSK+SL+  I
Sbjct  364  ITLDNCKKLGLVFDDVVGIVEIINSRDVKVQVMGKVPTISINKTDGCHVYLSKNSLDCEI  423

Query  380  TTAKSSEVNILVPGAGPDADWEEHALPQQYIHVYKDGQFITS  255
             +AKSSE+N+L+P  G   D+ E  +P+Q+  V+   + +T+
Sbjct  424  VSAKSSEMNVLIPTEG--GDFTEFPVPEQFKTVWNGQKLVTT  463



>gb|EPY78467.1| adenylyl cyclase-associated protein 1 [Camelus ferus]
Length=433

 Score =   156 bits (394),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 92/204 (45%), Positives = 126/204 (62%), Gaps = 14/204 (7%)
 Frame = -3

Query  815  NDMKT-KNRA--DRSGIVGASEKEGRVSSPSFS-------KAGPPKLELQMGRKWVVENQ  666
            +DMKT KN A   +SG V +  K    S P  S       K  P  LEL+ G+KW VENQ
Sbjct  234  DDMKTHKNPALKAQSGPVRSGPKPFSASKPGISPSPKPPTKKEPALLELE-GKKWRVENQ  292

Query  665  IGKKNLVIDDCDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNC  486
                NLVID  + KQ  YIF C +S LQI+GK+N+IT+D C K+G+VF DVV   E++N 
Sbjct  293  ENVSNLVIDGTELKQVAYIFKCVNSTLQIKGKINSITVDNCKKLGLVFDDVVGIVEIINS  352

Query  485  SGVEVQCQGVAPTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHA  306
              V+VQ  G  PTIS++ T GC +YLSK+SL+  I +AKSSE+N+L+P  G   D+ E  
Sbjct  353  KDVKVQVMGKVPTISINKTDGCHVYLSKNSLDCEIVSAKSSEMNVLIPTDG--GDFNEFP  410

Query  305  LPQQYIHVYKDGQFITSPATHSGG  234
            +P+Q+  ++ +GQ + +  T   G
Sbjct  411  VPEQFKTLW-NGQKLVTTVTEIAG  433



>gb|KGL91453.1| Adenylyl cyclase-associated protein 1, partial [Charadrius vociferus]
Length=452

 Score =   156 bits (394),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 77/162 (48%), Positives = 108/162 (67%), Gaps = 3/162 (2%)
 Frame = -3

Query  740  SPSFSKAGPPKLELQMGRKWVVENQIGKKNLVIDDCDAKQSVYIFGCKDSVLQIQGKVNN  561
            SP  S   P  LEL+ G+KW VENQ    NLVI D + KQ  Y+F C +S LQI+GK+N+
Sbjct  288  SPKTSPKAPALLELE-GKKWRVENQENATNLVISDTELKQVAYVFKCTNSTLQIKGKINS  346

Query  560  ITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGVAPTISVDNTSGCLLYLSKDSLEASI  381
            IT+D C K+G+VF DVV   E++N   V+VQ  G  PTIS++ T GC +YLSK+SL+  I
Sbjct  347  ITLDNCKKLGLVFDDVVGIVEIINSRDVKVQVMGKVPTISINKTDGCHVYLSKNSLDCEI  406

Query  380  TTAKSSEVNILVPGAGPDADWEEHALPQQYIHVYKDGQFITS  255
             +AKSSE+N+L+P  G   D+ E  +P+Q+  V+   + +T+
Sbjct  407  VSAKSSEMNVLIPTEG--GDFTEFPVPEQFKTVWNGQKLVTT  446



>ref|XP_004266448.1| PREDICTED: adenylyl cyclase-associated protein 1 isoform 1 [Orcinus 
orca]
 ref|XP_004266449.1| PREDICTED: adenylyl cyclase-associated protein 1 isoform 2 [Orcinus 
orca]
Length=475

 Score =   156 bits (395),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 81/172 (47%), Positives = 114/172 (66%), Gaps = 4/172 (2%)
 Frame = -3

Query  767  ASEKEGRVSSPS-FSKAGPPKLELQMGRKWVVENQIGKKNLVIDDCDAKQSVYIFGCKDS  591
            ++ K G   SP   +K  P  LEL+ G+KW VENQ    NLVIDD + KQ  YIF C +S
Sbjct  301  SASKPGVSPSPKPVTKKEPALLELE-GKKWRVENQENVSNLVIDDTELKQVAYIFKCVNS  359

Query  590  VLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGVAPTISVDNTSGCLLY  411
             LQI+GK+N+IT+D C K+G+VF DVV   E++N   V+VQ  G  PTIS++ T GC +Y
Sbjct  360  TLQIKGKINSITVDNCKKLGLVFDDVVGIVEIINSRDVKVQVMGKVPTISINKTDGCHVY  419

Query  410  LSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQYIHVYKDGQFITS  255
            LSK+SL+  I +AKSSE+N+L+P  G   D+ E  +P+Q+  V+   + +T+
Sbjct  420  LSKNSLDCEIVSAKSSEMNVLIPTEGD--DFNEFPVPEQFKTVWNGRKLVTT  469



>ref|XP_007453821.1| PREDICTED: adenylyl cyclase-associated protein 1 [Lipotes vexillifer]
Length=474

 Score =   156 bits (395),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 81/172 (47%), Positives = 114/172 (66%), Gaps = 4/172 (2%)
 Frame = -3

Query  767  ASEKEGRVSSPS-FSKAGPPKLELQMGRKWVVENQIGKKNLVIDDCDAKQSVYIFGCKDS  591
            ++ K G   SP   +K  P  LEL+ G+KW VENQ    NLVIDD + KQ  YIF C +S
Sbjct  300  SASKPGVSPSPKPVTKKEPALLELE-GKKWRVENQENVSNLVIDDTELKQVAYIFKCVNS  358

Query  590  VLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGVAPTISVDNTSGCLLY  411
             LQI+GK+N+IT+D C K+G+VF DVV   E++N   V+VQ  G  PTIS++ T GC +Y
Sbjct  359  TLQIKGKINSITVDNCKKLGLVFDDVVGIVEIINSRDVKVQVMGKVPTISINKTDGCHVY  418

Query  410  LSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQYIHVYKDGQFITS  255
            LSK+SL+  I +AKSSE+N+L+P  G   D+ E  +P+Q+  V+   + +T+
Sbjct  419  LSKNSLDCEIVSAKSSEMNVLIPTEGD--DFNEFPVPEQFKTVWNGRKLVTT  468



>ref|XP_010308405.1| PREDICTED: adenylyl cyclase-associated protein 2-like, partial 
[Balearica regulorum gibbericeps]
Length=266

 Score =   152 bits (383),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 78/177 (44%), Positives = 112/177 (63%), Gaps = 9/177 (5%)
 Frame = -3

Query  764  SEKEGRVSSPSFSKAGP-----PKLELQMGRKWVVENQIGKKNLVIDDCDAKQSVYIFGC  600
            S  +    SP+  K  P     P LEL+ G+KW VE Q  K +LVI++ + KQ  YIF C
Sbjct  90   SPTKSHTPSPTSPKNSPQQSHAPVLELE-GKKWRVEYQEDKNDLVINNTELKQVAYIFKC  148

Query  599  KDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGVAPTISVDNTSGC  420
              S LQI+GK+N+ITID C K G+VF +VV   EV+N   +++Q  G  PTIS++ T GC
Sbjct  149  NKSTLQIKGKINSITIDNCKKFGLVFDNVVGIVEVINSRDIQIQVMGKVPTISINKTEGC  208

Query  419  LLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQYIHVYKDGQFITSPA  249
             +YLS++SL+  I +AKSSE+NIL+P    D D++E  +P+Q+   +   + +T PA
Sbjct  209  HIYLSEESLDCEIVSAKSSEMNILIPQ---DGDYKEFPVPEQFKTAWDGSKLVTEPA  262



>gb|KFP61405.1| Adenylyl cyclase-associated protein 2, partial [Cariama cristata]
Length=269

 Score =   152 bits (383),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 78/177 (44%), Positives = 112/177 (63%), Gaps = 9/177 (5%)
 Frame = -3

Query  764  SEKEGRVSSPSFSKAGP-----PKLELQMGRKWVVENQIGKKNLVIDDCDAKQSVYIFGC  600
            S  +    SP+  K  P     P LEL+ G+KW VE Q  K +LVI++ + KQ  YIF C
Sbjct  93   SPTKSHTPSPTSPKNSPQQSHAPVLELE-GKKWRVEYQEDKNDLVINNTELKQVAYIFKC  151

Query  599  KDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGVAPTISVDNTSGC  420
              S LQI+GK+N+ITID C K G+VF +VV   EV+N   +++Q  G  PTIS++ T GC
Sbjct  152  NKSTLQIKGKINSITIDNCKKFGLVFDNVVGIVEVINSRDIQIQVMGKVPTISINKTEGC  211

Query  419  LLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQYIHVYKDGQFITSPA  249
             +YLS++SL+  I +AKSSE+NIL+P    D D++E  +P+Q+   +   + +T PA
Sbjct  212  HIYLSEESLDCEIVSAKSSEMNILIPQ---DGDYKEFPVPEQFKTAWDGSKLVTEPA  265



>ref|XP_010156281.1| PREDICTED: adenylyl cyclase-associated protein 2-like, partial 
[Eurypyga helias]
 gb|KFV95900.1| Adenylyl cyclase-associated protein 2, partial [Eurypyga helias]
Length=266

 Score =   152 bits (383),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 78/177 (44%), Positives = 112/177 (63%), Gaps = 9/177 (5%)
 Frame = -3

Query  764  SEKEGRVSSPSFSKAGP-----PKLELQMGRKWVVENQIGKKNLVIDDCDAKQSVYIFGC  600
            S  +    SP+  K  P     P LEL+ G+KW VE Q  K +LVI++ + KQ  YIF C
Sbjct  90   SPTKSHTPSPTSPKNSPQQSHAPVLELE-GKKWRVEYQEDKNDLVINNTELKQVAYIFKC  148

Query  599  KDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGVAPTISVDNTSGC  420
              S LQI+GK+N+ITID C K G+VF +VV   EV+N   +++Q  G  PTIS++ T GC
Sbjct  149  NKSTLQIKGKINSITIDNCKKFGLVFDNVVGIVEVINSRDIQIQVMGKVPTISINKTEGC  208

Query  419  LLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQYIHVYKDGQFITSPA  249
             +YLS++SL+  I +AKSSE+NIL+P    D D++E  +P+Q+   +   + +T PA
Sbjct  209  HIYLSEESLDCEIVSAKSSEMNILIPQ---DGDYKEFPVPEQFKTAWDGSKLVTEPA  262



>ref|XP_008303166.1| PREDICTED: adenylyl cyclase-associated protein 1 [Stegastes partitus]
Length=473

 Score =   156 bits (395),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 81/161 (50%), Positives = 108/161 (67%), Gaps = 4/161 (2%)
 Frame = -3

Query  716  PPKLELQMGRKWVVENQIGKKNLVIDDCDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTK  537
            PP  EL  G+KW VENQ G  NLVI D + KQ VY + C  S LQ++GK+N+ITID C K
Sbjct  317  PPVFELD-GKKWKVENQEGALNLVISDTELKQVVYAYKCNKSTLQVKGKLNSITIDNCKK  375

Query  536  MGVVFSDVVAAFEVVNCSGVEVQCQGVAPTISVDNTSGCLLYLSKDSLEASITTAKSSEV  357
            MG+VF DVV   +V+NC  V+VQ  G  PTIS++ T GC +YLS DSL+  I +AKSSE+
Sbjct  376  MGLVFDDVVGIVDVINCKDVKVQVMGKVPTISINKTDGCHVYLSNDSLQCEIVSAKSSEM  435

Query  356  NILVPGAGPDADWEEHALPQQYIHVYKDGQFITSPATHSGG  234
            NILVP    D ++ E  +P+Q+  V+ DG+ + + +T   G
Sbjct  436  NILVPQK--DGEFTELPVPEQFKTVW-DGKKLVTTSTEIAG  473



>ref|XP_011376287.1| PREDICTED: adenylyl cyclase-associated protein 1 [Pteropus vampyrus]
Length=471

 Score =   156 bits (395),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 91/204 (45%), Positives = 126/204 (62%), Gaps = 14/204 (7%)
 Frame = -3

Query  815  NDMKT-KNRA--DRSGIVGASEKEGRVSSPSFS-------KAGPPKLELQMGRKWVVENQ  666
            +DMKT KN A   +SG V +  K      P  S       K  P  LEL+ G+KW VENQ
Sbjct  272  DDMKTHKNPALKAQSGPVRSGPKPFSAPKPGVSPSPKPAMKKEPALLELE-GKKWRVENQ  330

Query  665  IGKKNLVIDDCDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNC  486
                NLVIDD + KQ  Y++ C +S LQI+GK+N+ITID C K+G+VF DVV   E++N 
Sbjct  331  ENVSNLVIDDTELKQVAYVYKCVNSTLQIKGKINSITIDNCKKLGLVFDDVVGIVEIINS  390

Query  485  SGVEVQCQGVAPTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHA  306
              V+VQ  G  PTIS++ T GC +YLSK+SL+  I +AKSSE+N+L+P  G   D+ E  
Sbjct  391  RDVKVQVMGKVPTISINKTDGCHVYLSKNSLDCEIVSAKSSEMNVLIPTEG--GDFNEFP  448

Query  305  LPQQYIHVYKDGQFITSPATHSGG  234
            +P+Q+  ++ +GQ + +  T   G
Sbjct  449  VPEQFKTLW-NGQKLVTTVTEIAG  471



>ref|XP_009068289.1| PREDICTED: adenylyl cyclase-associated protein 1 [Acanthisitta 
chloris]
Length=467

 Score =   156 bits (395),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 87/198 (44%), Positives = 122/198 (62%), Gaps = 14/198 (7%)
 Frame = -3

Query  815  NDMKT-KNRA--DRSGIVGASEKEGRVSSPS--------FSKAGPPKLELQMGRKWVVEN  669
            +DMKT KN A  ++ G V +  K      P+         S   PP LEL+ G+KW VEN
Sbjct  267  DDMKTHKNPALKNQGGPVRSGPKPFTAPKPACNANPSQITSPKAPPLLELE-GKKWRVEN  325

Query  668  QIGKKNLVIDDCDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVN  489
            Q    NLVI D + KQ  Y+F C +S LQI+GK+N+IT+D C K+G+VF DVV   E++N
Sbjct  326  QENATNLVISDTELKQVAYVFKCTNSTLQIKGKINSITLDNCKKLGLVFDDVVGIVEIIN  385

Query  488  CSGVEVQCQGVAPTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEH  309
               V+VQ  G  PTIS++ T GC +YLS+ SL+  I +AKSSE+NIL+P  G   D+ E 
Sbjct  386  SRDVKVQVMGKVPTISINKTDGCHVYLSQSSLDCEIVSAKSSEMNILIPTEG--GDFTEF  443

Query  308  ALPQQYIHVYKDGQFITS  255
             +P+Q+  V+   + +T+
Sbjct  444  PVPEQFKTVWNGQKLVTT  461



>ref|XP_005512871.1| PREDICTED: adenylyl cyclase-associated protein 1 [Columba livia]
Length=469

 Score =   156 bits (395),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 87/198 (44%), Positives = 122/198 (62%), Gaps = 14/198 (7%)
 Frame = -3

Query  815  NDMKT-KNRA--DRSGIVGASEKEGRVSSPS--------FSKAGPPKLELQMGRKWVVEN  669
            +DMKT KN A  ++ G V +  K      P+         S   P  LEL+ G+KW VEN
Sbjct  269  DDMKTHKNPALKNQGGPVRSGPKPFTAPKPACNANPSQKTSPKAPALLELE-GKKWRVEN  327

Query  668  QIGKKNLVIDDCDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVN  489
            Q    NLVI D + KQ  Y+F C +S LQI+GK+N+IT+D C K+G+VF DVV   E++N
Sbjct  328  QENATNLVISDTELKQVAYVFKCTNSTLQIKGKINSITLDNCKKLGLVFDDVVGIVEIIN  387

Query  488  CSGVEVQCQGVAPTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEH  309
               V+VQ  G  PTIS++ T GC +YLSKDSL+  I +AKSSE+N+L+P  G   D+ E 
Sbjct  388  SRDVKVQVMGKVPTISINKTDGCHVYLSKDSLDCEIVSAKSSEMNVLIPAEG--GDFTEF  445

Query  308  ALPQQYIHVYKDGQFITS  255
             +P+Q+  V+   + +T+
Sbjct  446  PVPEQFKTVWNGQKLVTT  463



>ref|XP_006165585.1| PREDICTED: adenylyl cyclase-associated protein 2 [Tupaia chinensis]
Length=476

 Score =   156 bits (395),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 83/195 (43%), Positives = 120/195 (62%), Gaps = 10/195 (5%)
 Frame = -3

Query  815  NDMKT-KNRADRSGIVGASEKEGRVSSPSFSKAGP-----PKLELQMGRKWVVENQIGKK  654
            +D KT KN + R+     S  +    SP+  K+ P     P  EL+ G+KW VE Q  + 
Sbjct  282  DDQKTYKNPSLRAQGQAPSPTKSHTPSPTPPKSHPAPRHAPVFELE-GKKWRVEYQEDRN  340

Query  653  NLVIDDCDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVE  474
            +LVI D + KQ  YIF C  S LQI+GK+N+ITID C K G+VF +VV   EV+N   ++
Sbjct  341  DLVISDAELKQVAYIFKCDKSTLQIRGKINSITIDNCKKFGLVFDNVVGIVEVINSKDIQ  400

Query  473  VQCQGVAPTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQ  294
            +Q  G  PT+S++ T GC +YLS+D+L+  I +AKSSE+NILVP    D D+ E  +P+Q
Sbjct  401  IQVMGRVPTMSINKTEGCHIYLSEDALDCEIVSAKSSEMNILVPQ---DGDYREFPVPEQ  457

Query  293  YIHVYKDGQFITSPA  249
            +  ++   + +T PA
Sbjct  458  FKTIWDGSKLVTEPA  472



>gb|KFO14665.1| Adenylyl cyclase-associated protein 2, partial [Balearica regulorum 
gibbericeps]
Length=268

 Score =   152 bits (383),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 78/177 (44%), Positives = 112/177 (63%), Gaps = 9/177 (5%)
 Frame = -3

Query  764  SEKEGRVSSPSFSKAGP-----PKLELQMGRKWVVENQIGKKNLVIDDCDAKQSVYIFGC  600
            S  +    SP+  K  P     P LEL+ G+KW VE Q  K +LVI++ + KQ  YIF C
Sbjct  92   SPTKSHTPSPTSPKNSPQQSHAPVLELE-GKKWRVEYQEDKNDLVINNTELKQVAYIFKC  150

Query  599  KDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGVAPTISVDNTSGC  420
              S LQI+GK+N+ITID C K G+VF +VV   EV+N   +++Q  G  PTIS++ T GC
Sbjct  151  NKSTLQIKGKINSITIDNCKKFGLVFDNVVGIVEVINSRDIQIQVMGKVPTISINKTEGC  210

Query  419  LLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQYIHVYKDGQFITSPA  249
             +YLS++SL+  I +AKSSE+NIL+P    D D++E  +P+Q+   +   + +T PA
Sbjct  211  HIYLSEESLDCEIVSAKSSEMNILIPQ---DGDYKEFPVPEQFKTAWDGSKLVTEPA  264



>ref|XP_009707197.1| PREDICTED: adenylyl cyclase-associated protein 2-like, partial 
[Cariama cristata]
Length=266

 Score =   152 bits (383),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 78/177 (44%), Positives = 112/177 (63%), Gaps = 9/177 (5%)
 Frame = -3

Query  764  SEKEGRVSSPSFSKAGP-----PKLELQMGRKWVVENQIGKKNLVIDDCDAKQSVYIFGC  600
            S  +    SP+  K  P     P LEL+ G+KW VE Q  K +LVI++ + KQ  YIF C
Sbjct  90   SPTKSHTPSPTSPKNSPQQSHAPVLELE-GKKWRVEYQEDKNDLVINNTELKQVAYIFKC  148

Query  599  KDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGVAPTISVDNTSGC  420
              S LQI+GK+N+ITID C K G+VF +VV   EV+N   +++Q  G  PTIS++ T GC
Sbjct  149  NKSTLQIKGKINSITIDNCKKFGLVFDNVVGIVEVINSRDIQIQVMGKVPTISINKTEGC  208

Query  419  LLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQYIHVYKDGQFITSPA  249
             +YLS++SL+  I +AKSSE+NIL+P    D D++E  +P+Q+   +   + +T PA
Sbjct  209  HIYLSEESLDCEIVSAKSSEMNILIPQ---DGDYKEFPVPEQFKTAWDGSKLVTEPA  262



>gb|EMC79468.1| Adenylyl cyclase-associated protein 1, partial [Columba livia]
Length=476

 Score =   156 bits (395),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 90/205 (44%), Positives = 125/205 (61%), Gaps = 15/205 (7%)
 Frame = -3

Query  815  NDMKT-KNRA--DRSGIVGASEKEGRVSSPS--------FSKAGPPKLELQMGRKWVVEN  669
            +DMKT KN A  ++ G V +  K      P+         S   P  LEL+ G+KW VEN
Sbjct  276  DDMKTHKNPALKNQGGPVRSGPKPFTAPKPACNANPSQKTSPKAPALLELE-GKKWRVEN  334

Query  668  QIGKKNLVIDDCDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVN  489
            Q    NLVI D + KQ  Y+F C +S LQI+GK+N+IT+D C K+G+VF DVV   E++N
Sbjct  335  QENATNLVISDTELKQVAYVFKCTNSTLQIKGKINSITLDNCKKLGLVFDDVVGIVEIIN  394

Query  488  CSGVEVQCQGVAPTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEH  309
               V+VQ  G  PTIS++ T GC +YLSKDSL+  I +AKSSE+N+L+P  G   D+ E 
Sbjct  395  SRDVKVQVMGKVPTISINKTDGCHVYLSKDSLDCEIVSAKSSEMNVLIPAEG--GDFTEF  452

Query  308  ALPQQYIHVYKDGQFITSPATHSGG  234
             +P+Q+  V+ +GQ + +  T   G
Sbjct  453  PVPEQFKTVW-NGQKLVTTVTEIAG  476



>ref|XP_010621211.1| PREDICTED: adenylyl cyclase-associated protein 2 [Fukomys damarensis]
 gb|KFO33819.1| Adenylyl cyclase-associated protein 2 [Fukomys damarensis]
Length=472

 Score =   156 bits (394),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 81/189 (43%), Positives = 118/189 (62%), Gaps = 9/189 (5%)
 Frame = -3

Query  800  KNRADRSGIVGASEKEGRVSSPSFSKAGPPK-----LELQMGRKWVVENQIGKKNLVIDD  636
            KN + R+     S  +    SP+  K+  P+     LEL+ G+KW VE Q G+ +LVI +
Sbjct  284  KNPSLRAQGQTRSPTKSHTQSPTSPKSHSPQKHAPVLELE-GKKWRVEYQEGRNDLVISE  342

Query  635  CDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGV  456
             + KQ  YIF C  S LQI+GK+N+ITID C K+G+VF +VV   EV+N   +++Q  G 
Sbjct  343  TELKQVAYIFKCDQSTLQIKGKINSITIDNCKKLGLVFDNVVGIVEVINSRDIQIQVMGR  402

Query  455  APTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQYIHVYK  276
             PTIS++ T GC +YLS+D+L+  I +AKSSE+NIL+P    D D+ E  +P+Q+   + 
Sbjct  403  VPTISINKTEGCHIYLSEDALDCEIVSAKSSEMNILIPQ---DGDYREFPIPEQFKTTWD  459

Query  275  DGQFITSPA  249
              + IT PA
Sbjct  460  GSKLITEPA  468



>ref|XP_002114074.1| hypothetical protein TRIADDRAFT_63338 [Trichoplax adhaerens]
 gb|EDV23164.1| hypothetical protein TRIADDRAFT_63338 [Trichoplax adhaerens]
Length=441

 Score =   155 bits (393),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 84/189 (44%), Positives = 124/189 (66%), Gaps = 10/189 (5%)
 Frame = -3

Query  815  NDMKT-KNRADR-SGIVGASEKEGRVS---SPSFSKA---GPPKLELQMGRKWVVENQIG  660
            NDMKT KN A R SG+V ++   G+ +    P+ +K     PP   L  G+KW+VENQ G
Sbjct  241  NDMKTHKNPALRASGVVSSTSTPGKPAVSPKPAATKPVAKKPPVFRLD-GKKWIVENQEG  299

Query  659  KKNLVIDDCDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSG  480
             ++LVI D + +QSVYI+ C + V+Q++GKVN+I +D C K  +VF  V++  + VNC  
Sbjct  300  NQDLVISDTNMRQSVYIYKCNNCVIQVKGKVNSIAMDTCKKSAIVFDHVISVMDFVNCQS  359

Query  479  VEVQCQGVAPTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALP  300
            V+VQ  G  PTIS+ NT G  +YLSK++++ +I ++KSSE+NI  P  G D D  E+A+P
Sbjct  360  VKVQVNGAVPTISIGNTDGIQVYLSKEAMQTTIISSKSSEMNISTP-TGNDGDMVENAVP  418

Query  299  QQYIHVYKD  273
            +Q+  V+ D
Sbjct  419  EQFTTVWDD  427



>ref|XP_010018923.1| PREDICTED: adenylyl cyclase-associated protein 1 [Nestor notabilis]
Length=469

 Score =   156 bits (394),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 86/198 (43%), Positives = 122/198 (62%), Gaps = 14/198 (7%)
 Frame = -3

Query  815  NDMKT-KNRA--DRSGIVGASEKEGRVSSPS--------FSKAGPPKLELQMGRKWVVEN  669
            +DMKT KN A  ++ G V +  K      P+         S   PP LEL+ G+KW VEN
Sbjct  269  DDMKTHKNPALKNQGGPVRSGPKPFTAPKPACNANPAQITSPKAPPLLELE-GKKWRVEN  327

Query  668  QIGKKNLVIDDCDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVN  489
            Q    NLVI D + KQ  Y+F C +S LQI+GK+N+IT+D C K+G+VF DVV   E++N
Sbjct  328  QENATNLVISDTELKQVAYVFKCTNSTLQIKGKINSITLDNCKKLGLVFDDVVGIVEIIN  387

Query  488  CSGVEVQCQGVAPTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEH  309
               ++VQ  G  PTIS++ T GC +YLSK SL+  I +AKSSE+N+L+P  G   D+ E 
Sbjct  388  SRDIKVQVMGKVPTISINKTDGCHVYLSKSSLDCEIVSAKSSEMNVLIPTEG--GDFTEF  445

Query  308  ALPQQYIHVYKDGQFITS  255
             +P+Q+  V+   + +T+
Sbjct  446  PVPEQFKTVWNGQKLVTT  463



>ref|XP_008939593.1| PREDICTED: adenylyl cyclase-associated protein 1, partial [Merops 
nubicus]
Length=473

 Score =   156 bits (394),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 77/162 (48%), Positives = 107/162 (66%), Gaps = 3/162 (2%)
 Frame = -3

Query  740  SPSFSKAGPPKLELQMGRKWVVENQIGKKNLVIDDCDAKQSVYIFGCKDSVLQIQGKVNN  561
            SP  S   P  LEL+ G+KW VENQ    NLVI D + KQ  Y+F C +S LQI+GK+N+
Sbjct  309  SPKTSPKAPALLELE-GKKWRVENQENAPNLVISDTELKQVAYVFKCTNSTLQIKGKINS  367

Query  560  ITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGVAPTISVDNTSGCLLYLSKDSLEASI  381
            IT+D C K+G+VF DVV   E++N   V+VQ  G  PTIS++ T GC +YLSK SL+  I
Sbjct  368  ITLDNCKKLGLVFDDVVGIVEIINSRDVKVQVMGKVPTISINKTDGCHVYLSKSSLDCEI  427

Query  380  TTAKSSEVNILVPGAGPDADWEEHALPQQYIHVYKDGQFITS  255
             +AKSSE+N+L+P  G   D+ E  +P+Q+  V+   + +T+
Sbjct  428  VSAKSSEMNVLIPTEG--GDFTEFPVPEQFKTVWNGQKLVTT  467



>ref|XP_006904030.1| PREDICTED: adenylyl cyclase-associated protein 1 isoform X1 [Pteropus 
alecto]
 ref|XP_006904031.1| PREDICTED: adenylyl cyclase-associated protein 1 isoform X2 [Pteropus 
alecto]
 ref|XP_006904032.1| PREDICTED: adenylyl cyclase-associated protein 1 isoform X3 [Pteropus 
alecto]
Length=474

 Score =   156 bits (394),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 91/204 (45%), Positives = 126/204 (62%), Gaps = 14/204 (7%)
 Frame = -3

Query  815  NDMKT-KNRA--DRSGIVGASEKEGRVSSPSFS-------KAGPPKLELQMGRKWVVENQ  666
            +DMKT KN A   +SG V +  K      P  S       K  P  LEL+ G+KW VENQ
Sbjct  275  DDMKTHKNPALKAQSGPVRSGPKPFSAPKPGVSPSPKPAMKKEPALLELE-GKKWRVENQ  333

Query  665  IGKKNLVIDDCDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNC  486
                NLVIDD + KQ  Y++ C +S LQI+GK+N+ITID C K+G+VF DVV   E++N 
Sbjct  334  ENVSNLVIDDTELKQVAYVYKCVNSTLQIKGKINSITIDNCKKLGLVFDDVVGIVEIINS  393

Query  485  SGVEVQCQGVAPTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHA  306
              V+VQ  G  PTIS++ T GC +YLSK+SL+  I +AKSSE+N+L+P  G   D+ E  
Sbjct  394  RDVKVQVMGKVPTISINKTDGCHVYLSKNSLDCEIVSAKSSEMNVLIPTEG--GDFNEFP  451

Query  305  LPQQYIHVYKDGQFITSPATHSGG  234
            +P+Q+  ++ +GQ + +  T   G
Sbjct  452  VPEQFKTLW-NGQKLVTTVTEIAG  474



>ref|XP_007164771.1| PREDICTED: adenylyl cyclase-associated protein 1 [Balaenoptera 
acutorostrata scammoni]
Length=475

 Score =   156 bits (394),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 85/187 (45%), Positives = 120/187 (64%), Gaps = 5/187 (3%)
 Frame = -3

Query  809  MKTKNRADRSGIVGASEKEGRVSS--PSFSKAGPPKLELQMGRKWVVENQIGKKNLVIDD  636
            +KT++   RSG    S  +  VS      +K  P  LEL+ G+KW VENQ    NLVIDD
Sbjct  286  LKTQSAPVRSGPKPFSASKPGVSPCPKPVTKKEPALLELE-GKKWRVENQENVSNLVIDD  344

Query  635  CDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNCSGVEVQCQGV  456
             + KQ  YIF C +S LQI+GK+N+IT+D C K+G+VF DVV   E++N   V+VQ  G 
Sbjct  345  TELKQVAYIFKCVNSTLQIKGKINSITVDNCKKLGLVFDDVVGIVEIINSRDVKVQVMGK  404

Query  455  APTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHALPQQYIHVYK  276
             PTIS++ T GC +YLSK+SL+  I +AKSSE+N+L+P  G   D+ E  +P+Q+  V+ 
Sbjct  405  VPTISINKTDGCHVYLSKNSLDCEIVSAKSSEMNVLIPTEG--DDFNEFPVPEQFKTVWN  462

Query  275  DGQFITS  255
              + +T+
Sbjct  463  GRKLVTT  469



>ref|XP_010958115.1| PREDICTED: adenylyl cyclase-associated protein 1 isoform X2 [Camelus 
bactrianus]
Length=474

 Score =   156 bits (394),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 92/204 (45%), Positives = 126/204 (62%), Gaps = 14/204 (7%)
 Frame = -3

Query  815  NDMKT-KNRA--DRSGIVGASEKEGRVSSPSFS-------KAGPPKLELQMGRKWVVENQ  666
            +DMKT KN A   +SG V +  K    S P  S       K  P  LEL+ G+KW VENQ
Sbjct  275  DDMKTHKNPALKAQSGPVRSGPKPFSASKPGISPSPKPPTKKEPALLELE-GKKWRVENQ  333

Query  665  IGKKNLVIDDCDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNC  486
                NLVID  + KQ  YIF C +S LQI+GK+N+IT+D C K+G+VF DVV   E++N 
Sbjct  334  ENVSNLVIDGTELKQVAYIFKCVNSTLQIKGKINSITVDNCKKLGLVFDDVVGIVEIINS  393

Query  485  SGVEVQCQGVAPTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHA  306
              V+VQ  G  PTIS++ T GC +YLSK+SL+  I +AKSSE+N+L+P  G   D+ E  
Sbjct  394  KDVKVQVMGKVPTISINKTDGCHVYLSKNSLDCEIVSAKSSEMNVLIPTDG--GDFNEFP  451

Query  305  LPQQYIHVYKDGQFITSPATHSGG  234
            +P+Q+  ++ +GQ + +  T   G
Sbjct  452  VPEQFKTLW-NGQKLVTTVTEIAG  474



>ref|XP_010958112.1| PREDICTED: adenylyl cyclase-associated protein 1 isoform X1 [Camelus 
bactrianus]
 ref|XP_010958113.1| PREDICTED: adenylyl cyclase-associated protein 1 isoform X1 [Camelus 
bactrianus]
 ref|XP_010958114.1| PREDICTED: adenylyl cyclase-associated protein 1 isoform X1 [Camelus 
bactrianus]
Length=475

 Score =   156 bits (394),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 92/204 (45%), Positives = 126/204 (62%), Gaps = 14/204 (7%)
 Frame = -3

Query  815  NDMKT-KNRA--DRSGIVGASEKEGRVSSPSFS-------KAGPPKLELQMGRKWVVENQ  666
            +DMKT KN A   +SG V +  K    S P  S       K  P  LEL+ G+KW VENQ
Sbjct  276  DDMKTHKNPALKAQSGPVRSGPKPFSASKPGISPSPKPPTKKEPALLELE-GKKWRVENQ  334

Query  665  IGKKNLVIDDCDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNC  486
                NLVID  + KQ  YIF C +S LQI+GK+N+IT+D C K+G+VF DVV   E++N 
Sbjct  335  ENVSNLVIDGTELKQVAYIFKCVNSTLQIKGKINSITVDNCKKLGLVFDDVVGIVEIINS  394

Query  485  SGVEVQCQGVAPTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHA  306
              V+VQ  G  PTIS++ T GC +YLSK+SL+  I +AKSSE+N+L+P  G   D+ E  
Sbjct  395  KDVKVQVMGKVPTISINKTDGCHVYLSKNSLDCEIVSAKSSEMNVLIPTDG--GDFNEFP  452

Query  305  LPQQYIHVYKDGQFITSPATHSGG  234
            +P+Q+  ++ +GQ + +  T   G
Sbjct  453  VPEQFKTLW-NGQKLVTTVTEIAG  475



>ref|XP_006188099.1| PREDICTED: adenylyl cyclase-associated protein 1 isoform X1 [Camelus 
ferus]
 ref|XP_010995243.1| PREDICTED: adenylyl cyclase-associated protein 1 isoform X1 [Camelus 
dromedarius]
 ref|XP_010995244.1| PREDICTED: adenylyl cyclase-associated protein 1 isoform X1 [Camelus 
dromedarius]
 ref|XP_010995245.1| PREDICTED: adenylyl cyclase-associated protein 1 isoform X1 [Camelus 
dromedarius]
Length=475

 Score =   156 bits (394),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 89/197 (45%), Positives = 123/197 (62%), Gaps = 13/197 (7%)
 Frame = -3

Query  815  NDMKT-KNRA--DRSGIVGASEKEGRVSSPSFS-------KAGPPKLELQMGRKWVVENQ  666
            +DMKT KN A   +SG V +  K    S P  S       K  P  LEL+ G+KW VENQ
Sbjct  276  DDMKTHKNPALKAQSGPVRSGPKPFSASKPGISPSPKPPTKKEPALLELE-GKKWRVENQ  334

Query  665  IGKKNLVIDDCDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNC  486
                NLVID  + KQ  YIF C +S LQI+GK+N+IT+D C K+G+VF DVV   E++N 
Sbjct  335  ENVSNLVIDGTELKQVAYIFKCVNSTLQIKGKINSITVDNCKKLGLVFDDVVGIVEIINS  394

Query  485  SGVEVQCQGVAPTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHA  306
              V+VQ  G  PTIS++ T GC +YLSK+SL+  I +AKSSE+N+L+P  G   D+ E  
Sbjct  395  KDVKVQVMGKVPTISINKTDGCHVYLSKNSLDCEIVSAKSSEMNVLIPTDG--GDFNEFP  452

Query  305  LPQQYIHVYKDGQFITS  255
            +P+Q+  ++   + +T+
Sbjct  453  VPEQFKTLWNGQKLVTT  469



>ref|XP_006215927.1| PREDICTED: adenylyl cyclase-associated protein 1 isoform X1 [Vicugna 
pacos]
Length=475

 Score =   156 bits (394),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 89/197 (45%), Positives = 123/197 (62%), Gaps = 13/197 (7%)
 Frame = -3

Query  815  NDMKT-KNRA--DRSGIVGASEKEGRVSSPSFS-------KAGPPKLELQMGRKWVVENQ  666
            +DMKT KN A   +SG V +  K    S P  S       K  P  LEL+ G+KW VENQ
Sbjct  276  DDMKTHKNPALKAQSGPVRSGPKPFSASKPGISPSPKPPTKKEPALLELE-GKKWRVENQ  334

Query  665  IGKKNLVIDDCDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNC  486
                NLVID  + KQ  YIF C +S LQI+GK+N+IT+D C K+G+VF DVV   E++N 
Sbjct  335  ESVSNLVIDGTELKQVAYIFKCVNSTLQIKGKINSITVDNCKKLGLVFDDVVGIVEIINS  394

Query  485  SGVEVQCQGVAPTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHA  306
              V+VQ  G  PTIS++ T GC +YLSK+SL+  I +AKSSE+N+L+P  G   D+ E  
Sbjct  395  KDVKVQVMGKVPTISINKTDGCHVYLSKNSLDCEIVSAKSSEMNVLIPTDG--GDFNEFP  452

Query  305  LPQQYIHVYKDGQFITS  255
            +P+Q+  ++   + +T+
Sbjct  453  VPEQFKTLWNGQKLVTT  469



>ref|XP_006215928.1| PREDICTED: adenylyl cyclase-associated protein 1 isoform X2 [Vicugna 
pacos]
Length=474

 Score =   156 bits (394),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 89/197 (45%), Positives = 123/197 (62%), Gaps = 13/197 (7%)
 Frame = -3

Query  815  NDMKT-KNRA--DRSGIVGASEKEGRVSSPSFS-------KAGPPKLELQMGRKWVVENQ  666
            +DMKT KN A   +SG V +  K    S P  S       K  P  LEL+ G+KW VENQ
Sbjct  275  DDMKTHKNPALKAQSGPVRSGPKPFSASKPGISPSPKPPTKKEPALLELE-GKKWRVENQ  333

Query  665  IGKKNLVIDDCDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNC  486
                NLVID  + KQ  YIF C +S LQI+GK+N+IT+D C K+G+VF DVV   E++N 
Sbjct  334  ESVSNLVIDGTELKQVAYIFKCVNSTLQIKGKINSITVDNCKKLGLVFDDVVGIVEIINS  393

Query  485  SGVEVQCQGVAPTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHA  306
              V+VQ  G  PTIS++ T GC +YLSK+SL+  I +AKSSE+N+L+P  G   D+ E  
Sbjct  394  KDVKVQVMGKVPTISINKTDGCHVYLSKNSLDCEIVSAKSSEMNVLIPTDG--GDFNEFP  451

Query  305  LPQQYIHVYKDGQFITS  255
            +P+Q+  ++   + +T+
Sbjct  452  VPEQFKTLWNGQKLVTT  468



>ref|XP_006188100.1| PREDICTED: adenylyl cyclase-associated protein 1 isoform X2 [Camelus 
ferus]
 ref|XP_010995246.1| PREDICTED: adenylyl cyclase-associated protein 1 isoform X2 [Camelus 
dromedarius]
Length=474

 Score =   156 bits (394),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 92/204 (45%), Positives = 126/204 (62%), Gaps = 14/204 (7%)
 Frame = -3

Query  815  NDMKT-KNRA--DRSGIVGASEKEGRVSSPSFS-------KAGPPKLELQMGRKWVVENQ  666
            +DMKT KN A   +SG V +  K    S P  S       K  P  LEL+ G+KW VENQ
Sbjct  275  DDMKTHKNPALKAQSGPVRSGPKPFSASKPGISPSPKPPTKKEPALLELE-GKKWRVENQ  333

Query  665  IGKKNLVIDDCDAKQSVYIFGCKDSVLQIQGKVNNITIDKCTKMGVVFSDVVAAFEVVNC  486
                NLVID  + KQ  YIF C +S LQI+GK+N+IT+D C K+G+VF DVV   E++N 
Sbjct  334  ENVSNLVIDGTELKQVAYIFKCVNSTLQIKGKINSITVDNCKKLGLVFDDVVGIVEIINS  393

Query  485  SGVEVQCQGVAPTISVDNTSGCLLYLSKDSLEASITTAKSSEVNILVPGAGPDADWEEHA  306
              V+VQ  G  PTIS++ T GC +YLSK+SL+  I +AKSSE+N+L+P  G   D+ E  
Sbjct  394  KDVKVQVMGKVPTISINKTDGCHVYLSKNSLDCEIVSAKSSEMNVLIPTDG--GDFNEFP  451

Query  305  LPQQYIHVYKDGQFITSPATHSGG  234
            +P+Q+  ++ +GQ + +  T   G
Sbjct  452  VPEQFKTLW-NGQKLVTTVTEIAG  474



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1724604950500