BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig11052

Length=969
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009801783.1|  PREDICTED: probable calcium-binding protein ...    374   3e-126   Nicotiana sylvestris
ref|XP_009619221.1|  PREDICTED: probable calcium-binding protein ...    370   8e-125   Nicotiana tomentosiformis
ref|XP_009619224.1|  PREDICTED: probable calcium-binding protein ...    364   1e-122   
ref|XP_009619226.1|  PREDICTED: probable calcium-binding protein ...    363   3e-122   
ref|XP_009619227.1|  PREDICTED: probable calcium-binding protein ...    362   1e-121   
ref|XP_009619225.1|  PREDICTED: probable calcium-binding protein ...    361   2e-121   
ref|XP_004247862.1|  PREDICTED: probable calcium-binding protein ...    340   4e-113   Solanum lycopersicum
ref|XP_006366840.1|  PREDICTED: probable calcium-binding protein ...    340   9e-113   Solanum tuberosum [potatoes]
ref|XP_009374596.1|  PREDICTED: probable calcium-binding protein ...    334   1e-110   Pyrus x bretschneideri [bai li]
ref|XP_008380562.1|  PREDICTED: probable calcium-binding protein ...    332   8e-110   Malus domestica [apple tree]
ref|XP_007034372.1|  Calcium-binding EF-hand family protein isofo...    327   6e-108   
ref|XP_009374597.1|  PREDICTED: probable calcium-binding protein ...    326   9e-108   Pyrus x bretschneideri [bai li]
ref|XP_007223706.1|  hypothetical protein PRUPE_ppa010393mg             326   1e-107   Prunus persica
ref|XP_008224499.1|  PREDICTED: probable calcium-binding protein ...    325   3e-107   Prunus mume [ume]
ref|XP_008380563.1|  PREDICTED: probable calcium-binding protein ...    324   6e-107   Malus domestica [apple tree]
ref|XP_004299109.1|  PREDICTED: probable calcium-binding protein ...    321   1e-105   Fragaria vesca subsp. vesca
ref|XP_002300172.2|  hypothetical protein POPTR_0001s32210g             320   4e-105   
ref|XP_011045652.1|  PREDICTED: probable calcium-binding protein ...    318   2e-104   Populus euphratica
gb|KJB72094.1|  hypothetical protein B456_011G158400                    315   2e-103   Gossypium raimondii
ref|XP_002266666.1|  PREDICTED: probable calcium-binding protein ...    312   4e-102   Vitis vinifera
gb|KHG12326.1|  putative calcium-binding CML22 -like protein            310   1e-101   Gossypium arboreum [tree cotton]
ref|XP_012071147.1|  PREDICTED: probable calcium-binding protein ...    310   2e-101   
ref|XP_006493812.1|  PREDICTED: probable calcium-binding protein ...    309   6e-101   Citrus sinensis [apfelsine]
ref|XP_006420904.1|  hypothetical protein CICLE_v10005743mg             306   6e-100   Citrus clementina [clementine]
gb|KDO61178.1|  hypothetical protein CISIN_1g0262681mg                  305   2e-99    Citrus sinensis [apfelsine]
ref|XP_008438356.1|  PREDICTED: probable calcium-binding protein ...    301   3e-98    Cucumis melo [Oriental melon]
ref|XP_011650876.1|  PREDICTED: probable calcium-binding protein ...    300   6e-98    Cucumis sativus [cucumbers]
gb|KJB72093.1|  hypothetical protein B456_011G158400                    299   3e-97    Gossypium raimondii
ref|XP_010650355.1|  PREDICTED: probable calcium-binding protein ...    298   7e-97    Vitis vinifera
ref|XP_010650356.1|  PREDICTED: probable calcium-binding protein ...    295   5e-96    Vitis vinifera
ref|XP_012071148.1|  PREDICTED: probable calcium-binding protein ...    295   1e-95    Jatropha curcas
ref|XP_010326837.1|  PREDICTED: probable calcium-binding protein ...    292   9e-95    
ref|XP_006493813.1|  PREDICTED: probable calcium-binding protein ...    292   1e-94    
ref|XP_010241365.1|  PREDICTED: probable calcium-binding protein ...    285   1e-91    Nelumbo nucifera [Indian lotus]
ref|XP_002518103.1|  conserved hypothetical protein                     283   5e-91    
gb|EYU32662.1|  hypothetical protein MIMGU_mgv1a012635mg                282   2e-90    Erythranthe guttata [common monkey flower]
ref|XP_010107777.1|  putative calcium-binding protein CML22             282   2e-90    
ref|XP_007034374.1|  Calcium-binding EF-hand family protein isofo...    280   5e-90    
ref|XP_007034373.1|  Calcium-binding EF-hand family protein isofo...    276   2e-88    
ref|XP_010023705.1|  PREDICTED: probable calcium-binding protein ...    272   3e-86    Eucalyptus grandis [rose gum]
emb|CDO99460.1|  unnamed protein product                                265   2e-84    Coffea canephora [robusta coffee]
gb|KCW60054.1|  hypothetical protein EUGRSUZ_H02783                     265   7e-84    Eucalyptus grandis [rose gum]
ref|XP_010532790.1|  PREDICTED: probable calcium-binding protein ...    257   7e-81    Tarenaya hassleriana [spider flower]
ref|XP_010532789.1|  PREDICTED: probable calcium-binding protein ...    256   6e-80    Tarenaya hassleriana [spider flower]
gb|KFK39709.1|  hypothetical protein AALP_AA3G278300                    253   2e-79    Arabis alpina [alpine rockcress]
ref|XP_010513185.1|  PREDICTED: probable calcium-binding protein ...    249   5e-78    Camelina sativa [gold-of-pleasure]
ref|XP_010909319.1|  PREDICTED: probable calcium-binding protein ...    250   6e-78    Elaeis guineensis
ref|XP_010691270.1|  PREDICTED: probable calcium-binding protein ...    250   9e-78    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010466782.1|  PREDICTED: probable calcium-binding protein ...    246   2e-76    Camelina sativa [gold-of-pleasure]
ref|XP_006418801.1|  hypothetical protein EUTSA_v10002654mg             245   2e-76    
ref|NP_189053.1|  putative calcium-binding protein CML22                243   2e-75    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010488497.1|  PREDICTED: probable calcium-binding protein ...    242   8e-75    Camelina sativa [gold-of-pleasure]
ref|XP_009106153.1|  PREDICTED: probable calcium-binding protein ...    241   1e-74    Brassica rapa
emb|CDY18071.1|  BnaA01g23320D                                          239   4e-74    Brassica napus [oilseed rape]
emb|CDY46335.1|  BnaC01g30350D                                          239   6e-74    Brassica napus [oilseed rape]
emb|CDX85172.1|  BnaC07g07340D                                          246   6e-73    
ref|XP_010691275.1|  PREDICTED: probable calcium-binding protein ...    236   2e-72    
gb|KEH22470.1|  calcium-binding EF-hand protein                         233   2e-71    Medicago truncatula
ref|XP_009102544.1|  PREDICTED: probable calcium-binding protein ...    233   2e-71    
ref|XP_007140756.1|  hypothetical protein PHAVU_008G139100g             232   3e-71    Phaseolus vulgaris [French bean]
emb|CDX77458.1|  BnaA07g05960D                                          231   8e-71    
ref|XP_009102545.1|  PREDICTED: probable calcium-binding protein ...    231   8e-71    Brassica rapa
gb|KEH22469.1|  calcium-binding EF-hand protein                         229   3e-70    Medicago truncatula
gb|AFK36647.1|  unknown                                                 229   3e-70    Lotus japonicus
ref|XP_003530839.1|  PREDICTED: probable calcium-binding protein ...    229   4e-70    Glycine max [soybeans]
ref|XP_009406355.1|  PREDICTED: probable calcium-binding protein ...    230   1e-69    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008778084.1|  PREDICTED: probable calcium-binding protein ...    228   2e-69    Phoenix dactylifera
ref|XP_002883485.1|  calcium-binding EF hand family protein             226   5e-69    
ref|XP_003563635.1|  PREDICTED: probable calcium-binding protein ...    226   7e-69    Brachypodium distachyon [annual false brome]
ref|XP_004509621.1|  PREDICTED: probable calcium-binding protein ...    223   7e-68    Cicer arietinum [garbanzo]
ref|XP_009409857.1|  PREDICTED: probable calcium-binding protein ...    222   2e-67    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006370792.1|  hypothetical protein POPTR_0001s47510g             221   9e-67    Populus trichocarpa [western balsam poplar]
ref|XP_006584629.1|  PREDICTED: uncharacterized protein LOC100820...    220   2e-66    Glycine max [soybeans]
gb|EMT01046.1|  Putative calcium-binding protein CML21                  219   2e-66    
gb|KJB11853.1|  hypothetical protein B456_002G104000                    219   3e-66    Gossypium raimondii
gb|KHG01864.1|  putative calcium-binding CML21 -like protein            219   3e-66    Gossypium arboreum [tree cotton]
ref|XP_003628952.1|  hypothetical protein MTR_8g070510                  219   5e-66    
gb|AET03429.2|  EF hand calcium-binding family protein                  218   1e-65    Medicago truncatula
gb|ACN85218.1|  calcium ion binding protein                             217   2e-65    Oryza punctata
ref|XP_010691273.1|  PREDICTED: probable calcium-binding protein ...    218   2e-65    
ref|XP_006857595.1|  PREDICTED: probable calcium-binding protein ...    217   2e-65    Amborella trichopoda
gb|ACN85246.1|  calcium ion binding protein                             217   3e-65    Oryza officinalis
gb|ACN85259.1|  calcium ion binding protein                             216   4e-65    Oryza alta
gb|KHG00196.1|  putative calcium-binding CML21 -like protein            216   7e-65    Gossypium arboreum [tree cotton]
gb|AFJ15127.1|  putative calcium-binding protein CML21                  216   7e-65    Camellia sinensis [black tea]
ref|XP_008782977.1|  PREDICTED: probable calcium-binding protein ...    215   9e-65    Phoenix dactylifera
ref|XP_010691274.1|  PREDICTED: probable calcium-binding protein ...    216   9e-65    
ref|XP_003547815.1|  PREDICTED: probable calcium-binding protein ...    215   1e-64    Glycine max [soybeans]
gb|EMS55923.1|  putative calcium-binding protein CML21                  215   1e-64    Triticum urartu
ref|NP_001242483.1|  uncharacterized protein LOC100820628               215   2e-64    Glycine max [soybeans]
ref|XP_008794706.1|  PREDICTED: probable calcium-binding protein ...    214   2e-64    Phoenix dactylifera
gb|KHN01846.1|  Putative calcium-binding protein CML22                  213   2e-64    Glycine soja [wild soybean]
ref|XP_010913274.1|  PREDICTED: probable calcium-binding protein ...    214   3e-64    
gb|ACN85272.1|  calcium ion binding protein                             214   3e-64    Oryza alta
ref|XP_006656237.1|  PREDICTED: probable calcium-binding protein ...    214   4e-64    Oryza brachyantha
ref|XP_011039863.1|  PREDICTED: probable calcium-binding protein ...    214   5e-64    Populus euphratica
ref|NP_001058046.1|  Os06g0609600                                       213   5e-64    
gb|ACN85201.1|  calcium ion binding protein                             213   6e-64    Oryza glaberrima
ref|XP_010928993.1|  PREDICTED: probable calcium-binding protein ...    213   6e-64    Elaeis guineensis
gb|ACN85168.1|  calcium ion binding protein                             211   3e-63    Oryza sativa f. spontanea
ref|XP_007156300.1|  hypothetical protein PHAVU_003G275000g             211   3e-63    Phaseolus vulgaris [French bean]
gb|ACN85332.1|  calcium ion binding protein                             211   5e-63    Oryza meyeriana var. granulata
ref|XP_002268527.1|  PREDICTED: probable calcium-binding protein ...    211   7e-63    Vitis vinifera
ref|XP_010244812.1|  PREDICTED: probable calcium-binding protein ...    211   8e-63    Nelumbo nucifera [Indian lotus]
emb|CAN71481.1|  hypothetical protein VITISV_006244                     211   1e-62    Vitis vinifera
ref|XP_002438663.1|  hypothetical protein SORBIDRAFT_10g023890          209   2e-62    Sorghum bicolor [broomcorn]
ref|XP_010644632.1|  PREDICTED: probable calcium-binding protein ...    209   2e-62    Vitis vinifera
ref|XP_012074155.1|  PREDICTED: probable calcium-binding protein ...    209   3e-62    Jatropha curcas
ref|XP_010092394.1|  putative calcium-binding protein CML21             209   3e-62    Morus notabilis
ref|XP_003628953.1|  hypothetical protein MTR_8g070510                  207   8e-62    
ref|XP_007020327.1|  Calcium-binding EF-hand family protein             207   1e-61    
ref|XP_008219144.1|  PREDICTED: probable calcium-binding protein ...    207   2e-61    Prunus mume [ume]
ref|XP_009346680.1|  PREDICTED: probable calcium-binding protein ...    207   2e-61    Pyrus x bretschneideri [bai li]
emb|CDP13649.1|  unnamed protein product                                207   2e-61    Coffea canephora [robusta coffee]
ref|XP_002532937.1|  Troponin C, skeletal muscle, putative              207   2e-61    Ricinus communis
ref|XP_002300587.1|  calcium-binding EF hand family protein             207   3e-61    
ref|XP_008353863.1|  PREDICTED: probable calcium-binding protein ...    206   4e-61    Malus domestica [apple tree]
ref|XP_008449066.1|  PREDICTED: probable calcium-binding protein ...    206   6e-61    Cucumis melo [Oriental melon]
ref|XP_008805537.1|  PREDICTED: probable calcium-binding protein ...    206   6e-61    
ref|XP_010063214.1|  PREDICTED: LOW QUALITY PROTEIN: probable cal...    206   7e-61    Eucalyptus grandis [rose gum]
ref|XP_007205832.1|  hypothetical protein PRUPE_ppa010999mg             205   7e-61    Prunus persica
ref|XP_008384627.1|  PREDICTED: probable calcium-binding protein ...    205   8e-61    Malus domestica [apple tree]
ref|XP_004294881.1|  PREDICTED: probable calcium-binding protein ...    205   1e-60    Fragaria vesca subsp. vesca
ref|XP_010676135.1|  PREDICTED: probable calcium-binding protein ...    205   1e-60    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004965909.1|  PREDICTED: probable calcium-binding protein ...    204   2e-60    Setaria italica
ref|XP_006647028.1|  PREDICTED: probable calcium-binding protein ...    204   2e-60    Oryza brachyantha
ref|XP_004516273.1|  PREDICTED: probable calcium-binding protein ...    204   2e-60    
ref|XP_011097697.1|  PREDICTED: probable calcium-binding protein ...    204   3e-60    Sesamum indicum [beniseed]
ref|NP_001132390.1|  uncharacterized protein LOC100193836               204   3e-60    Zea mays [maize]
ref|XP_009379121.1|  PREDICTED: probable calcium-binding protein ...    203   5e-60    Pyrus x bretschneideri [bai li]
gb|EEC72684.1|  hypothetical protein OsI_06250                          203   7e-60    Oryza sativa Indica Group [Indian rice]
ref|NP_001046205.1|  Os02g0198200                                       202   8e-60    
gb|EMT21140.1|  Putative calcium-binding protein CML21                  202   9e-60    
ref|XP_010327214.1|  PREDICTED: probable calcium-binding protein ...    202   9e-60    Solanum lycopersicum
ref|XP_011095629.1|  PREDICTED: probable calcium-binding protein ...    202   1e-59    Sesamum indicum [beniseed]
ref|NP_001148425.1|  calcium ion binding protein                        202   1e-59    Zea mays [maize]
ref|XP_008358900.1|  PREDICTED: LOW QUALITY PROTEIN: probable cal...    202   1e-59    
ref|XP_002451725.1|  hypothetical protein SORBIDRAFT_04g006670          202   1e-59    Sorghum bicolor [broomcorn]
ref|XP_006352556.1|  PREDICTED: probable calcium-binding protein ...    202   2e-59    Solanum tuberosum [potatoes]
gb|EEC78513.1|  hypothetical protein OsI_18448                          202   2e-59    Oryza sativa Indica Group [Indian rice]
gb|AFW66169.1|  calcium ion binding protein                             202   2e-59    
ref|XP_010233984.1|  PREDICTED: probable calcium-binding protein ...    202   2e-59    Brachypodium distachyon [annual false brome]
ref|XP_004149571.1|  PREDICTED: probable calcium-binding protein ...    201   3e-59    Cucumis sativus [cucumbers]
ref|XP_003571276.1|  PREDICTED: probable calcium-binding protein ...    202   5e-59    Brachypodium distachyon [annual false brome]
gb|EYU33744.1|  hypothetical protein MIMGU_mgv1a013136mg                201   6e-59    Erythranthe guttata [common monkey flower]
ref|XP_004951561.1|  PREDICTED: probable calcium-binding protein ...    200   9e-59    Setaria italica
ref|XP_006654041.1|  PREDICTED: probable calcium-binding protein ...    199   3e-58    Oryza brachyantha
ref|XP_009608207.1|  PREDICTED: probable calcium-binding protein ...    199   3e-58    Nicotiana tomentosiformis
gb|ABK22178.1|  unknown                                                 198   4e-58    Picea sitchensis
ref|NP_001131792.1|  calcium ion binding protein                        198   4e-58    Zea mays [maize]
dbj|BAK07400.1|  predicted protein                                      196   2e-57    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009776689.1|  PREDICTED: probable calcium-binding protein ...    196   4e-57    Nicotiana sylvestris
ref|XP_010231716.1|  PREDICTED: probable calcium-binding protein ...    194   1e-56    Brachypodium distachyon [annual false brome]
ref|XP_006474771.1|  PREDICTED: probable calcium-binding protein ...    194   2e-56    Citrus sinensis [apfelsine]
ref|XP_006452756.1|  hypothetical protein CICLE_v10009385mg             194   2e-56    Citrus clementina [clementine]
ref|XP_003568950.2|  PREDICTED: probable calcium-binding protein ...    194   2e-56    Brachypodium distachyon [annual false brome]
ref|XP_010545296.1|  PREDICTED: LOW QUALITY PROTEIN: probable cal...    194   2e-56    Tarenaya hassleriana [spider flower]
ref|XP_002869609.1|  calcium ion binding protein                        194   2e-56    
ref|NP_194377.2|  putative calcium-binding protein CML21                194   2e-56    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006285834.1|  hypothetical protein CARUB_v10007314mg             193   4e-56    Capsella rubella
ref|XP_009142368.1|  PREDICTED: probable calcium-binding protein ...    193   5e-56    Brassica rapa
ref|XP_006413177.1|  hypothetical protein EUTSA_v10026168mg             192   6e-56    Eutrema salsugineum [saltwater cress]
ref|XP_004960294.1|  PREDICTED: probable calcium-binding protein ...    192   3e-55    Setaria italica
ref|XP_002447440.1|  hypothetical protein SORBIDRAFT_06g001080          190   7e-55    
ref|XP_010448264.1|  PREDICTED: probable calcium-binding protein ...    190   9e-55    Camelina sativa [gold-of-pleasure]
gb|KJB63079.1|  hypothetical protein B456_009G454500                    189   9e-55    Gossypium raimondii
ref|XP_010433497.1|  PREDICTED: probable calcium-binding protein ...    190   9e-55    Camelina sativa [gold-of-pleasure]
ref|XP_010438747.1|  PREDICTED: probable calcium-binding protein ...    189   1e-54    Camelina sativa [gold-of-pleasure]
gb|KEH22471.1|  calcium-binding EF-hand protein                         186   1e-53    Medicago truncatula
ref|NP_001148758.1|  calcium ion binding protein                        184   1e-52    Zea mays [maize]
ref|XP_010691276.1|  PREDICTED: probable calcium-binding protein ...    184   1e-52    
gb|KDO73987.1|  hypothetical protein CISIN_1g026998mg                   184   2e-52    Citrus sinensis [apfelsine]
gb|KCW70421.1|  hypothetical protein EUGRSUZ_F03649                     183   2e-52    Eucalyptus grandis [rose gum]
gb|KEH22472.1|  calcium-binding EF-hand protein                         182   3e-52    Medicago truncatula
gb|EMS52340.1|  putative calcium-binding protein CML22                  186   4e-52    Triticum urartu
ref|XP_010421964.1|  PREDICTED: probable calcium-binding protein ...    181   5e-52    Camelina sativa [gold-of-pleasure]
emb|CAA18223.1|  putative protein                                       182   8e-52    Arabidopsis thaliana [mouse-ear cress]
tpg|DAA38718.1|  TPA: calcium ion binding protein                       182   1e-51    
ref|XP_004509620.1|  PREDICTED: probable calcium-binding protein ...    181   2e-51    
ref|XP_001784911.1|  predicted protein                                  180   4e-51    
ref|XP_001775820.1|  predicted protein                                  180   6e-51    
emb|CDX92818.1|  BnaC07g40760D                                          177   5e-50    
ref|XP_009137599.1|  PREDICTED: probable calcium-binding protein ...    176   2e-49    Brassica rapa
emb|CDY42732.1|  BnaA03g48070D                                          176   3e-49    Brassica napus [oilseed rape]
emb|CDX94327.1|  BnaC01g18570D                                          169   9e-47    
ref|XP_002990940.1|  hypothetical protein SELMODRAFT_132549             165   2e-45    
ref|XP_008667961.1|  PREDICTED: calcium ion binding protein isofo...    165   6e-45    Zea mays [maize]
gb|ERN01821.1|  hypothetical protein AMTR_s00089p00059230               163   1e-44    Amborella trichopoda
ref|XP_002982786.1|  hypothetical protein SELMODRAFT_422194             159   4e-43    
ref|XP_002990719.1|  hypothetical protein SELMODRAFT_429138             155   1e-41    
ref|NP_001078450.1|  putative calcium-binding protein CML21             154   2e-41    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002986712.1|  hypothetical protein SELMODRAFT_425580             154   3e-41    
gb|EMS67685.1|  putative calcium-binding protein CML21                  155   2e-40    Triticum urartu
gb|AFK48479.1|  unknown                                                 148   5e-40    Medicago truncatula
ref|XP_002323775.2|  hypothetical protein POPTR_0017s08200g             143   6e-38    
ref|XP_011621825.1|  PREDICTED: probable calcium-binding protein ...    125   2e-30    
ref|XP_002862334.1|  predicted protein                                  121   8e-30    Arabidopsis lyrata subsp. lyrata
gb|AFW87515.1|  hypothetical protein ZEAMMB73_336887                    120   3e-29    
gb|ACR34117.1|  unknown                                                 111   7e-26    Zea mays [maize]
gb|KJB63080.1|  hypothetical protein B456_009G454500                    107   2e-24    Gossypium raimondii
gb|KJB63081.1|  hypothetical protein B456_009G454500                    107   3e-24    Gossypium raimondii
ref|XP_003062470.1|  predicted protein                                  108   3e-24    Micromonas pusilla CCMP1545
emb|CDY70736.1|  BnaCnng69600D                                        97.1    2e-21    Brassica napus [oilseed rape]
ref|XP_008619093.1|  hypothetical protein SDRG_14719                    101   3e-21    Saprolegnia diclina VS20
ref|XP_010468449.1|  PREDICTED: probable calcium-binding protein ...  98.2    6e-21    Camelina sativa [gold-of-pleasure]
ref|XP_009840757.1|  hypothetical protein H257_14590                  93.2    3e-18    Aphanomyces astaci
ref|XP_008878820.1|  hypothetical protein H310_13196                  92.8    4e-18    Aphanomyces invadans
gb|KDO27543.1|  hypothetical protein SPRG_06811                       91.3    9e-18    Saprolegnia parasitica CBS 223.65
gb|EAZ22107.1|  hypothetical protein OsJ_05766                        87.0    9e-18    Oryza sativa Japonica Group [Japonica rice]
emb|CBN76140.1|  calcium ion binding                                  91.3    2e-17    Ectocarpus siliculosus
ref|XP_006299579.1|  hypothetical protein CARUB_v10015753mg           85.9    8e-17    
gb|ETI45580.1|  hypothetical protein F443_09884                       88.6    1e-16    Phytophthora parasitica P1569
gb|ETK85532.1|  hypothetical protein L915_09682                       88.6    1e-16    Phytophthora parasitica
ref|XP_008892917.1|  hypothetical protein PPTG_01392                  88.2    1e-16    Phytophthora parasitica INRA-310
ref|XP_008909760.1|  hypothetical protein PPTG_14587                  84.7    1e-15    Phytophthora parasitica INRA-310
gb|ETL87187.1|  hypothetical protein L917_13535                       84.7    2e-15    Phytophthora parasitica
ref|XP_002907045.1|  conserved hypothetical protein                   83.6    4e-15    Phytophthora infestans T30-4
ref|XP_007224348.1|  hypothetical protein PRUPE_ppa020720mg           81.3    4e-15    
ref|XP_009526471.1|  hypothetical protein PHYSODRAFT_502537           82.4    4e-15    Phytophthora sojae
emb|CCI44687.1|  unnamed protein product                              83.2    5e-15    Albugo candida
ref|XP_009526469.1|  hypothetical protein PHYSODRAFT_264348           84.0    5e-15    Phytophthora sojae
ref|XP_002896992.1|  conserved hypothetical protein                   80.1    3e-14    Phytophthora infestans T30-4
emb|CCA15835.1|  conserved hypothetical protein                       80.5    4e-14    Albugo laibachii Nc14
ref|XP_009519854.1|  hypothetical protein PHYSODRAFT_325675           79.7    1e-13    Phytophthora sojae
ref|XP_002507740.1|  predicted protein                                76.6    8e-13    Micromonas commoda
ref|XP_005850665.1|  hypothetical protein CHLNCDRAFT_140699           75.1    3e-12    Chlorella variabilis
ref|XP_006823620.1|  PREDICTED: calmodulin-like                       72.4    8e-12    Saccoglossus kowalevskii
ref|XP_008863480.1|  hypothetical protein H310_01913                  73.9    1e-11    Aphanomyces invadans
ref|XP_009040569.1|  hypothetical protein AURANDRAFT_66979            71.2    2e-10    Aureococcus anophagefferens
ref|XP_008620055.1|  hypothetical protein SDRG_15654                  69.3    5e-10    Saprolegnia diclina VS20
emb|CCK71480.1|  hypothetical protein KNAG_0H00640                    66.6    6e-10    Kazachstania naganishii CBS 8797
ref|XP_002287177.1|  predicted protein                                68.6    2e-09    Thalassiosira pseudonana CCMP1335
ref|XP_009825682.1|  hypothetical protein H257_03354                  67.4    2e-09    Aphanomyces astaci
gb|KJB17909.1|  hypothetical protein B456_003G023300                  64.3    5e-09    Gossypium raimondii
gb|KJB17910.1|  hypothetical protein B456_003G023300                  64.3    6e-09    Gossypium raimondii
emb|CBY17793.1|  unnamed protein product                              63.9    7e-09    Oikopleura dioica
ref|XP_005099702.1|  PREDICTED: uncharacterized protein LOC101861733  66.6    8e-09    
gb|ELU06160.1|  hypothetical protein CAPTEDRAFT_227531                63.5    8e-09    Capitella teleta
gb|EPB82214.1|  calmodulin                                            63.5    9e-09    Mucor circinelloides f. circinelloides 1006PhL
ref|XP_001691376.1|  flagellar associated protein                     65.5    1e-08    Chlamydomonas reinhardtii
ref|XP_010923302.1|  PREDICTED: calcium-dependent protein kinase ...  66.2    1e-08    Elaeis guineensis
ref|XP_011397401.1|  Palmitoyl-monogalactosyldiacylglycerol delta...  65.9    1e-08    Auxenochlorella protothecoides
dbj|GAN06811.1|  calmodulin                                           62.8    2e-08    Mucor ambiguus
gb|ERG82025.1|  calcyphosin-like protein                              64.3    2e-08    
ref|XP_010269961.1|  PREDICTED: caltractin-like                       62.8    2e-08    Nelumbo nucifera [Indian lotus]
ref|XP_011402686.1|  PREDICTED: LOW QUALITY PROTEIN: calmodulin-l...  65.5    2e-08    
ref|XP_004288038.2|  PREDICTED: caltractin                            63.2    2e-08    Fragaria vesca subsp. vesca
gb|ABR16212.1|  unknown                                               62.8    2e-08    Picea sitchensis
gb|EKC42677.1|  Calmodulin                                            65.1    3e-08    Crassostrea gigas
sp|P41210.1|CATR_ATRNU  RecName: Full=Caltractin; AltName: Full=C...  62.0    3e-08    Atriplex nummularia
emb|CDS09630.1|  hypothetical protein LRAMOSA10990                    62.0    3e-08    Lichtheimia ramosa
gb|KJB71091.1|  hypothetical protein B456_011G105500                  62.0    3e-08    Gossypium raimondii
ref|XP_008619594.1|  hypothetical protein SDRG_15205                  65.5    3e-08    Saprolegnia diclina VS20
ref|XP_008619593.1|  hypothetical protein, variant                    65.1    3e-08    Saprolegnia diclina VS20
ref|XP_009025821.1|  hypothetical protein HELRODRAFT_156044           62.4    3e-08    Helobdella robusta
gb|EYB86371.1|  hypothetical protein Y032_0280g1224                   63.2    4e-08    Ancylostoma ceylanicum
ref|XP_010674374.1|  PREDICTED: caltractin isoform X2                 62.0    4e-08    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_005099701.1|  PREDICTED: calmodulin-like protein 12-like       63.9    4e-08    
ref|XP_007047245.1|  Centrin2 isoform 1                               61.6    4e-08    
ref|XP_010674373.1|  PREDICTED: caltractin isoform X1                 61.6    4e-08    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007202670.1|  hypothetical protein PRUPE_ppa012454mg           61.6    5e-08    Prunus persica
ref|XP_006088486.1|  PREDICTED: calmodulin-like protein 3             61.2    5e-08    Myotis lucifugus
gb|ABF38946.2|  calmodulin                                            61.2    6e-08    Phytomonas serpens
ref|XP_004691277.1|  PREDICTED: calmodulin-like protein 3             61.2    6e-08    
ref|XP_002645274.1|  Hypothetical protein CBG00175                    62.4    6e-08    Caenorhabditis briggsae
ref|XP_002876026.1|  predicted protein                                61.2    6e-08    Arabidopsis lyrata subsp. lyrata
gb|EPB73982.1|  EF hand                                               62.0    6e-08    Ancylostoma ceylanicum
gb|KFK40707.1|  hypothetical protein AALP_AA2G030900                  61.2    7e-08    Arabis alpina [alpine rockcress]
ref|XP_002063560.1|  GK19414                                          60.8    7e-08    Drosophila willistoni
ref|XP_009589844.1|  PREDICTED: caltractin-like                       61.2    7e-08    Nicotiana tomentosiformis
ref|XP_002523573.1|  Caltractin, putative                             61.2    7e-08    Ricinus communis
ref|XP_005869569.1|  PREDICTED: calmodulin-like protein 3             60.8    7e-08    Myotis brandtii
gb|AGQ20410.1|  calcium dependent protein kinase 1                    63.5    8e-08    Zingiber officinale [ginger]
ref|XP_004588547.1|  PREDICTED: calmodulin-like protein 3             60.5    8e-08    Ochotona princeps [southern American pika]
ref|XP_009797840.1|  PREDICTED: caltractin                            60.8    8e-08    Nicotiana sylvestris
ref|XP_004232035.1|  PREDICTED: caltractin                            60.8    9e-08    Solanum lycopersicum
ref|XP_006339902.1|  PREDICTED: caltractin-like                       60.8    9e-08    Solanum tuberosum [potatoes]
ref|NP_190605.1|  centrin2                                            60.8    9e-08    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006891943.1|  PREDICTED: calmodulin-like protein 5             60.5    9e-08    Elephantulus edwardii [Cape long-eared elephant shrew]
ref|NP_509544.1|  Protein B0563.7                                     61.6    1e-07    
ref|XP_010050053.1|  PREDICTED: calmodulin-like protein 7             62.0    1e-07    
gb|KDO31373.1|  hypothetical protein SPRG_03990                       63.9    1e-07    
gb|AHA51331.1|  EF-hand_1 domain-containing protein                   61.6    1e-07    
ref|XP_006415032.1|  hypothetical protein EUTSA_v10008929mg           60.5    1e-07    
emb|CAB40133.1|  calmodulin-like protein                              60.1    1e-07    
ref|XP_008805271.1|  PREDICTED: caltractin-like isoform X2            60.5    1e-07    
ref|XP_008241453.1|  PREDICTED: caltractin                            60.5    1e-07    
ref|XP_003101114.1|  hypothetical protein CRE_14767                   61.2    1e-07    
ref|XP_006338886.1|  PREDICTED: probable calcium-binding protein ...  60.5    1e-07    
ref|XP_004336073.1|  Calmodulin, putative                             60.1    1e-07    
ref|XP_004422784.1|  PREDICTED: calcyphosin-like protein isoform 1    61.2    1e-07    
gb|AHA51330.1|  EF-hand_1 domain-containing protein                   61.2    2e-07    
gb|KIH66928.1|  EF hand                                               60.5    2e-07    
gb|AHA51329.1|  EF-hand_1 domain-containing protein                   60.8    2e-07    
dbj|BAF48780.1|  hypothetical protein                                 60.8    2e-07    
gb|EEE59725.1|  hypothetical protein OsJ_12163                        62.0    2e-07    
gb|EEC75972.1|  hypothetical protein OsI_13081                        62.0    2e-07    
ref|NP_001050944.1|  Os03g0688300                                     62.4    2e-07    
ref|XP_002307263.1|  caltractin family protein                        59.7    2e-07    
ref|XP_011441730.1|  PREDICTED: neo-calmodulin-like isoform X3        59.3    2e-07    
ref|XP_009388458.1|  PREDICTED: calcium-dependent protein kinase ...  62.4    2e-07    
ref|XP_011441728.1|  PREDICTED: neo-calmodulin-like isoform X1        59.7    2e-07    
gb|EKC43016.1|  Low-density lipoprotein receptor-related protein 6    62.4    2e-07    
ref|XP_008796649.1|  PREDICTED: calcium-dependent protein kinase ...  62.4    2e-07    
ref|XP_010916613.1|  PREDICTED: probable calcium-binding protein ...  59.7    3e-07    
gb|KHJ97775.1|  EF hand                                               60.1    3e-07    
gb|ELK31721.1|  Calcyphosin-like protein                              60.8    3e-07    
ref|XP_010477091.1|  PREDICTED: calcium-dependent protein kinase ...  62.0    3e-07    
ref|XP_009396383.1|  PREDICTED: calcium-dependent protein kinase ...  62.0    3e-07    
gb|KKA66573.1|  HLH domain-containing protein                         59.7    3e-07    
gb|AIU98506.1|  calcium-dependent protein kinase                      62.0    3e-07    
ref|XP_009101784.1|  PREDICTED: probable calcium-binding protein ...  59.3    3e-07    
gb|KJB43707.1|  hypothetical protein B456_007G212700                  62.0    3e-07    
ref|XP_004237269.1|  PREDICTED: caltractin-like                       59.3    3e-07    
gb|KHG23483.1|  Caltractin                                            62.0    3e-07    
ref|XP_008796650.1|  PREDICTED: calcium-dependent protein kinase ...  61.6    3e-07    
ref|XP_011441729.1|  PREDICTED: neo-calmodulin-like isoform X2        58.9    3e-07    
ref|XP_005835328.1|  hypothetical protein GUITHDRAFT_151865           60.1    3e-07    
ref|NP_001127790.1|  calmodulin-like                                  61.6    3e-07    
gb|AHA51333.1|  EF-hand_1 domain-containing protein                   60.8    3e-07    
gb|ELT88403.1|  hypothetical protein CAPTEDRAFT_107528                58.9    3e-07    
ref|XP_006291947.1|  hypothetical protein CARUB_v10018135mg           59.3    3e-07    
ref|XP_005617262.1|  PREDICTED: calmodulin-like protein 3             58.5    3e-07    
emb|CDX83123.1|  BnaA01g21230D                                        59.3    3e-07    
ref|XP_004806636.1|  PREDICTED: calmodulin-like protein 3             58.9    4e-07    
ref|XP_010916612.1|  PREDICTED: caltractin isoform X1                 59.3    4e-07    
ref|XP_004757981.1|  PREDICTED: calmodulin-like protein 3             58.5    4e-07    
ref|XP_009032408.1|  hypothetical protein AURANDRAFT_16285            58.5    4e-07    
ref|XP_002016665.1|  GL11704                                          58.5    4e-07    
gb|AHA51332.1|  EF-hand_1 domain-containing protein                   60.8    4e-07    
ref|XP_006396673.1|  hypothetical protein EUTSA_v10028617mg           61.2    4e-07    
emb|CEF60717.1|  Calmodulin-like protein 3                            58.5    4e-07    
ref|XP_010042872.1|  PREDICTED: probable calcium-binding protein ...  60.8    4e-07    
ref|NP_001131342.1|  uncharacterized protein LOC100192661             59.3    4e-07    
ref|XP_001637998.1|  predicted protein                                58.5    5e-07    
ref|XP_007047248.1|  ARM repeat protein interacting with ABF2 iso...  58.5    5e-07    
gb|EPB84784.1|  calmodulin                                            58.5    5e-07    
ref|XP_006651702.1|  PREDICTED: calcium-dependent protein kinase ...  61.2    5e-07    
gb|EJK73322.1|  hypothetical protein THAOC_05060                      61.2    5e-07    
ref|XP_010426580.1|  PREDICTED: probable calcium-binding protein ...  58.5    5e-07    
ref|XP_003674056.1|  hypothetical protein NCAS_0A11170                58.2    5e-07    
ref|XP_001743025.1|  hypothetical protein                             58.5    5e-07    
dbj|GAN02697.1|  calmodulin                                           58.2    6e-07    
ref|XP_009404018.1|  PREDICTED: caltractin                            58.5    6e-07    
ref|XP_004367608.1|  EF hand domain containing protein                57.8    6e-07    
ref|XP_010619737.1|  PREDICTED: calmodulin-like protein 3             58.2    6e-07    
ref|XP_002920391.1|  PREDICTED: calmodulin-like protein 3             58.2    6e-07    
gb|ELU09134.1|  hypothetical protein CAPTEDRAFT_228814                60.8    7e-07    
ref|XP_008559867.1|  PREDICTED: calcyphosin-like protein              58.9    7e-07    
ref|XP_007047246.1|  ARM repeat protein interacting with ABF2 iso...  58.5    7e-07    
ref|XP_002973044.1|  hypothetical protein SELMODRAFT_413463           58.2    7e-07    
emb|CDY62753.1|  BnaC01g42220D                                        58.5    7e-07    
ref|XP_010931028.1|  PREDICTED: calcium-dependent protein kinase 32   60.8    7e-07    
ref|XP_008703623.1|  PREDICTED: calmodulin-like protein 3             57.8    8e-07    
emb|CDH59824.1|  calmodulin                                           57.8    8e-07    
ref|XP_011312409.1|  PREDICTED: calcyphosin-like protein isoform X2   58.5    8e-07    
ref|XP_009375705.1|  PREDICTED: probable calcium-binding protein ...  58.2    8e-07    
gb|KFK30981.1|  hypothetical protein AALP_AA6G053300                  60.5    8e-07    
ref|XP_011045425.1|  PREDICTED: calcium-dependent protein kinase ...  60.5    8e-07    
ref|XP_008654305.1|  PREDICTED: uncharacterized protein LOC100192...  60.5    9e-07    
pdb|3WLC|A  Chain A, Crystal Structure Of Dimeric Gcamp6m             60.5    9e-07    
ref|XP_010070343.1|  PREDICTED: caltractin                            57.8    9e-07    
ref|XP_010503705.1|  PREDICTED: probable calcium-binding protein ...  57.8    9e-07    
ref|XP_010515395.1|  PREDICTED: probable calcium-binding protein ...  57.8    1e-06    
ref|XP_010098464.1|  putative calcium-binding protein CML20           58.2    1e-06    
ref|XP_002601220.1|  hypothetical protein BRAFLDRAFT_187874           57.4    1e-06    
emb|CDP14599.1|  unnamed protein product                              58.9    1e-06    
gb|ABY59013.1|  calcium-dependent protein kinase                      60.5    1e-06    
ref|XP_003688167.1|  hypothetical protein TPHA_0M01580                57.4    1e-06    
gb|AFW76342.1|  hypothetical protein ZEAMMB73_373728                  55.8    1e-06    
ref|XP_008654304.1|  PREDICTED: uncharacterized protein LOC100192...  60.1    1e-06    
ref|XP_003678123.1|  hypothetical protein NCAS_0I01100                57.4    1e-06    
ref|XP_003957053.1|  hypothetical protein KAFR_0D02700                57.4    1e-06    
ref|XP_010278963.1|  PREDICTED: calcium-dependent protein kinase ...  60.1    1e-06    
ref|NP_001149916.1|  calcium-dependent protein kinase, isoform AK1    60.1    1e-06    
pdb|2LHI|A  Chain A, Solution Structure Of Ca2+CNA1 PEPTIDE-Bound...  57.8    1e-06    
gb|ACH72985.1|  calmodulin 2                                          57.4    1e-06    
ref|XP_011061020.1|  PREDICTED: calcyphosin-like protein isoform X1   58.5    1e-06    
ref|NP_177612.2|  calcium-dependent protein kinase 30                 60.1    1e-06    
ref|XP_011312408.1|  PREDICTED: calcyphosin-like protein isoform X1   58.2    1e-06    
ref|XP_008361400.1|  PREDICTED: probable calcium-binding protein ...  57.4    1e-06    
gb|AAC68892.1|  VU91D calmodulin                                      57.0    1e-06    
dbj|BAJ85309.1|  predicted protein                                    59.3    1e-06    
ref|XP_010548415.1|  PREDICTED: calcium-binding protein CML19         57.4    1e-06    
gb|KFO53706.1|  Centrin-2                                             57.4    1e-06    
ref|XP_011681894.1|  PREDICTED: calmodulin-like protein 12            59.3    1e-06    
ref|XP_011005867.1|  PREDICTED: caltractin                            57.4    1e-06    
dbj|GAN11009.1|  calmodulin-like isoform 1                            57.4    1e-06    
ref|XP_008835071.1|  PREDICTED: calmodulin-like protein 5             57.0    1e-06    
gb|EKC39257.1|  Calcium-dependent protein kinase isoform 2            58.5    1e-06    
ref|XP_009367049.1|  PREDICTED: probable calcium-binding protein ...  57.4    1e-06    
ref|XP_002299904.1|  calcium-dependent protein kinase 1               59.7    1e-06    
pdb|2LHH|A  Chain A, Solution Structure Of Ca2+-Bound Ycam            56.6    1e-06    
ref|XP_005354981.1|  PREDICTED: calmodulin-4-like                     57.0    1e-06    
ref|XP_004477431.1|  PREDICTED: calmodulin-like protein 3             57.0    1e-06    
gb|ADN07535.1|  calmodulin 4                                          57.0    1e-06    
gb|ADN07528.1|  calmodulin 4                                          57.0    1e-06    
ref|XP_001622774.1|  predicted protein                                57.4    2e-06    
ref|XP_006933271.1|  PREDICTED: calmodulin-like protein 3             57.0    2e-06    
gb|KFK41910.1|  hypothetical protein AALP_AA2G188200                  59.7    2e-06    
emb|CDH56635.1|  calmodulin                                           57.0    2e-06    
ref|XP_005320369.1|  PREDICTED: calmodulin-like protein 3             57.0    2e-06    
gb|ETO23432.1|  calcium-dependent protein kinase                      58.9    2e-06    
ref|XP_002138728.1|  GA24240                                          57.0    2e-06    
gb|AAC68890.1|  VU91B calmodulin                                      57.0    2e-06    
ref|XP_008583911.1|  PREDICTED: calmodulin-like protein 3             56.6    2e-06    
ref|XP_004970457.1|  PREDICTED: calcium-dependent protein kinase ...  59.7    2e-06    
ref|XP_011015067.1|  PREDICTED: calmodulin-like protein 1             57.8    2e-06    
gb|KFK30323.1|  hypothetical protein AALP_AA7G246900                  57.0    2e-06    
dbj|GAA21657.1|  K7_Cmd1p                                             56.6    2e-06    
gb|ACJ86047.1|  unknown                                               57.4    2e-06    
ref|XP_005872658.1|  PREDICTED: calcyphosin-like protein isoform X1   57.8    2e-06    
ref|XP_006390395.1|  hypothetical protein EUTSA_v10018366mg           59.7    2e-06    
ref|NP_009667.1|  calmodulin                                          56.6    2e-06    
emb|CCK68596.1|  hypothetical protein KNAG_0B01480                    56.6    2e-06    
ref|XP_010923438.1|  PREDICTED: calcium-dependent protein kinase ...  59.3    2e-06    
gb|AJQ11574.1|  Cmd1p                                                 56.6    2e-06    
ref|XP_006761824.1|  PREDICTED: calcyphosin-like protein isoform X1   57.4    2e-06    
pdb|1LKJ|A  Chain A, Nmr Structure Of Apo Calmodulin From Yeast S...  56.6    2e-06    
ref|XP_010401639.1|  PREDICTED: centrin-2                             58.2    2e-06    
ref|XP_003939101.1|  PREDICTED: calmodulin-like protein 5             56.6    2e-06    
ref|XP_006823622.1|  PREDICTED: calmodulin-B-like                     57.8    2e-06    
gb|AHA51383.1|  EF-hand_1 domain-containing protein                   56.6    2e-06    
gb|AHA51306.1|  EF-hand_1 domain-containing protein                   56.6    2e-06    
gb|EPQ11677.1|  Calcyphosin-like protein                              58.2    2e-06    
ref|XP_445478.1|  hypothetical protein                                56.6    2e-06    
ref|XP_011061021.1|  PREDICTED: calcyphosin-like protein isoform X2   57.4    2e-06    
ref|XP_004411877.1|  PREDICTED: calmodulin-like protein 3             56.6    2e-06    
ref|XP_010923436.1|  PREDICTED: calcium-dependent protein kinase ...  59.3    2e-06    
gb|AJK93879.1|  calmodulin                                            55.8    2e-06    
ref|XP_002496350.1|  ZYRO0C16346p                                     56.2    2e-06    
sp|P11118.2|CALM_EUGGR  RecName: Full=Calmodulin; Short=CaM           56.2    2e-06    
gb|ETO05528.1|  Protein kinase domain containing protein              59.3    2e-06    
emb|CBJ49201.1|  conserved unknown protein                            59.3    2e-06    
ref|XP_003114118.1|  CRE-CAL-1 protein                                57.0    2e-06    
ref|XP_002185837.1|  predicted protein                                58.9    2e-06    
ref|XP_002016663.1|  GL11701                                          56.2    2e-06    
ref|XP_011265207.1|  PREDICTED: neo-calmodulin isoform X4             58.2    2e-06    
ref|XP_010852102.1|  PREDICTED: calcyphosin-like protein isoform X2   57.0    2e-06    
gb|AHA51357.1|  EF-hand_1 domain-containing protein                   57.0    3e-06    
ref|XP_010459535.1|  PREDICTED: calcium-dependent protein kinase 10   58.9    3e-06    
gb|AGI21023.1|  calcium-dependent protein kinase 3                    58.9    3e-06    
ref|XP_011155602.1|  PREDICTED: calcyphosin-like protein isoform X2   57.4    3e-06    
ref|XP_011155601.1|  PREDICTED: calcyphosin-like protein isoform X1   57.8    3e-06    
gb|EJT41753.1|  CMD1-like protein                                     56.2    3e-06    
ref|XP_002310148.2|  hypothetical protein POPTR_0007s11130g           57.0    3e-06    
ref|XP_001693482.1|  predicted protein                                58.9    3e-06    
emb|CDF89641.1|  ZYBA0S04-09142g1_1                                   56.2    3e-06    
ref|XP_010918135.1|  PREDICTED: calcium-dependent protein kinase 29   58.9    3e-06    
ref|XP_006158525.1|  PREDICTED: calmodulin-like protein 3             56.2    3e-06    
ref|XP_005704341.1|  calmodulin isoform 1                             56.2    3e-06    
ref|XP_003680602.1|  hypothetical protein TDEL_0C05020                56.2    3e-06    
ref|XP_008340035.1|  PREDICTED: probable calcium-binding protein ...  56.6    3e-06    
ref|XP_002946821.1|  hypothetical protein VOLCADRAFT_87187            57.8    3e-06    
ref|XP_003958635.1|  hypothetical protein KAFR_0H00900                56.2    3e-06    
ref|XP_011265206.1|  PREDICTED: calmodulin isoform X3                 57.8    3e-06    
gb|ELU15623.1|  hypothetical protein CAPTEDRAFT_154562                56.2    3e-06    
ref|XP_004367650.1|  EF hand domain containing protein                57.0    3e-06    
ref|XP_006646451.1|  PREDICTED: calcium-dependent protein kinase ...  58.9    3e-06    
ref|XP_011265205.1|  PREDICTED: calmodulin isoform X2                 58.2    3e-06    
ref|XP_009615900.1|  PREDICTED: caltractin-like isoform X2            56.2    3e-06    
gb|KJB27979.1|  hypothetical protein B456_005G019800                  58.9    3e-06    
ref|XP_010540753.1|  PREDICTED: probable calcium-binding protein ...  56.2    3e-06    
gb|KFB42224.1|  AGAP006622-PA-like protein                            55.8    3e-06    
ref|XP_002739903.1|  PREDICTED: calmodulin-like                       55.8    3e-06    
dbj|BAE31439.1|  unnamed protein product                              55.8    3e-06    
ref|XP_011265204.1|  PREDICTED: calmodulin isoform X1                 58.2    3e-06    
ref|XP_009141613.1|  PREDICTED: calcium-dependent protein kinase ...  58.5    3e-06    
emb|CDX87164.1|  BnaC09g04790D                                        58.5    3e-06    
ref|XP_001361466.1|  GA10810                                          55.8    3e-06    
gb|AGG35965.1|  calcium-dependent protein kinase 12                   58.5    3e-06    
ref|XP_003408023.1|  PREDICTED: calcyphosin-like protein              56.6    4e-06    
gb|EGT38909.1|  hypothetical protein CAEBREN_30810                    56.2    4e-06    
ref|NP_001256428.1|  Protein CAL-1, isoform b                         56.2    4e-06    
ref|XP_002977282.1|  hypothetical protein SELMODRAFT_106606           55.8    4e-06    
ref|XP_008805269.1|  PREDICTED: caltractin-like isoform X1            56.6    4e-06    
ref|XP_002554663.1|  KLTH0F10626p                                     55.8    4e-06    
ref|XP_002499897.1|  predicted protein                                58.5    4e-06    
gb|AJK93511.1|  calmodulin                                            55.5    4e-06    
gb|AHA51307.1|  EF-hand_1 domain-containing protein                   55.8    4e-06    
ref|XP_002992169.1|  hypothetical protein SELMODRAFT_134862           55.8    4e-06    
gb|EKC24243.1|  Calmodulin                                            58.5    4e-06    
ref|NP_001256429.1|  Protein CAL-1, isoform a                         55.8    4e-06    
ref|NP_001099887.1|  calcyphosin-like protein                         56.6    4e-06    
gb|ETO30623.1|  hypothetical protein RFI_06494                        56.2    4e-06    
gb|ETN74544.1|  EF hand                                               55.8    4e-06    
ref|XP_003473474.1|  PREDICTED: calmodulin-like protein 3             55.5    4e-06    
dbj|GAN06810.1|  calmodulin                                           55.5    4e-06    
gb|AJK93862.1|  calmodulin                                            55.1    5e-06    
ref|XP_009395591.1|  PREDICTED: calcium-dependent protein kinase ...  58.2    5e-06    
ref|XP_004712675.1|  PREDICTED: calmodulin-like protein 3             55.5    5e-06    
emb|CEP61531.1|  LALA0S03e04940g1_1                                   55.5    5e-06    
gb|EYC01138.1|  hypothetical protein Y032_0110g186                    55.8    5e-06    
ref|XP_006101105.1|  PREDICTED: calmodulin-like                       56.2    5e-06    
gb|AJK93530.1|  calmodulin                                            55.1    5e-06    
gb|EYC01137.1|  hypothetical protein Y032_0110g186                    55.8    5e-06    
ref|XP_003056424.1|  flagellar outer dynein arm light chain 5         55.5    5e-06    
ref|XP_008758985.1|  PREDICTED: calcyphosin-like protein isoform X1   56.2    5e-06    
ref|XP_009022608.1|  hypothetical protein HELRODRAFT_138077           53.9    5e-06    
ref|XP_004986274.1|  PREDICTED: calmodulin-like                       55.5    5e-06    



>ref|XP_009801783.1| PREDICTED: probable calcium-binding protein CML22 [Nicotiana 
sylvestris]
Length=247

 Score =   374 bits (959),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 179/246 (73%), Positives = 212/246 (86%), Gaps = 0/246 (0%)
 Frame = -3

Query  877  MKGSVGLSRPCLSLKLVSDKVGSLLCCHGSPNKYSRLDSKLETKVLEVKRNAPATLSIRS  698
            MK SVG ++ C  LKL+S+KVG++LC   +PNKY RLD+KLE K++E+KR++    + RS
Sbjct  1    MKDSVGSAQSCPVLKLLSNKVGNILCFWNAPNKYRRLDAKLEAKMMELKRSSSVQTNFRS  60

Query  697  INALILKFPHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRS  518
            IN++ILKFP F+EGLKEI+ VFEQFDEDSNG IDREELKKC++KLQFHV EEEID+LF S
Sbjct  61   INSIILKFPQFKEGLKEIKGVFEQFDEDSNGTIDREELKKCVKKLQFHVKEEEIDDLFHS  120

Query  517  CDVDDNEKIKFNEFIVLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGD  338
            CDVD+ E I+FNEFIVLLCLIYLL D+ SS +TSKIGSP +E+TFNTIVEAFLFLDKNGD
Sbjct  121  CDVDEKEGIQFNEFIVLLCLIYLLTDSSSSRNTSKIGSPELEATFNTIVEAFLFLDKNGD  180

Query  337  GKLHKKDVVKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDD  158
            GKLHKK+VVKA ND  P EKSPSHVTR RFKEMDWDRSGK+SFR+FLFAFLDWVG++ DD
Sbjct  181  GKLHKKEVVKALNDDCPSEKSPSHVTRIRFKEMDWDRSGKVSFRQFLFAFLDWVGVNTDD  240

Query  157  EDHMAE  140
            E+H  E
Sbjct  241  ENHATE  246



>ref|XP_009619221.1| PREDICTED: probable calcium-binding protein CML22 isoform X1 
[Nicotiana tomentosiformis]
 ref|XP_009619222.1| PREDICTED: probable calcium-binding protein CML22 isoform X1 
[Nicotiana tomentosiformis]
Length=248

 Score =   370 bits (949),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 178/247 (72%), Positives = 212/247 (86%), Gaps = 1/247 (0%)
 Frame = -3

Query  877  MKGSVGLSRPCLSLKLVSDKVGSLLCCHGSPNKYSRLDSKLETKVLEVKRNAPATLSIRS  698
            MK SVG ++ C  LKL+S+KVG++LC   +P KY RLD+KLETK++E+KR++    + RS
Sbjct  1    MKDSVGSAQSCPVLKLLSNKVGNILCFRNAPKKYRRLDAKLETKMIELKRSSSGQTNFRS  60

Query  697  INALILKFPHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRS  518
            IN++ILKFP FREGLKEI+ VFEQFDEDSNG IDREELKKC++KLQFHV EEEI++LF S
Sbjct  61   INSIILKFPQFREGLKEIKAVFEQFDEDSNGTIDREELKKCVKKLQFHVKEEEINDLFHS  120

Query  517  CDVDDNEKIKFNEFIVLLCLIYLLMDAPSSG-STSKIGSPVVESTFNTIVEAFLFLDKNG  341
            CDVD+NE I+FNEFIVLLCLIYLL D+ SS  +T KIGSP +E+TFNTIVEAFLFLDKNG
Sbjct  121  CDVDENEGIQFNEFIVLLCLIYLLTDSSSSSRNTPKIGSPELEATFNTIVEAFLFLDKNG  180

Query  340  DGKLHKKDVVKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGD  161
            DGKLHKK+VVKA ND  P EKSPSHVTR RFKEMDWDRSGK+SFR+FLFAFLDW+G++ D
Sbjct  181  DGKLHKKEVVKALNDDCPSEKSPSHVTRIRFKEMDWDRSGKVSFRQFLFAFLDWIGVNTD  240

Query  160  DEDHMAE  140
            DE+H  E
Sbjct  241  DENHATE  247



>ref|XP_009619224.1| PREDICTED: probable calcium-binding protein CML22 isoform X2 
[Nicotiana tomentosiformis]
Length=246

 Score =   364 bits (934),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 178/247 (72%), Positives = 210/247 (85%), Gaps = 3/247 (1%)
 Frame = -3

Query  877  MKGSVGLSRPCLSLKLVSDKVGSLLCCHGSPNKYSRLDSKLETKVLEVKRNAPATLSIRS  698
            MK SV  S  C  LKL+S+KVG++LC   +P KY RLD+KLETK++E+KR++    + RS
Sbjct  1    MKDSVAQS--CPVLKLLSNKVGNILCFRNAPKKYRRLDAKLETKMIELKRSSSGQTNFRS  58

Query  697  INALILKFPHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRS  518
            IN++ILKFP FREGLKEI+ VFEQFDEDSNG IDREELKKC++KLQFHV EEEI++LF S
Sbjct  59   INSIILKFPQFREGLKEIKAVFEQFDEDSNGTIDREELKKCVKKLQFHVKEEEINDLFHS  118

Query  517  CDVDDNEKIKFNEFIVLLCLIYLLMDAPSSG-STSKIGSPVVESTFNTIVEAFLFLDKNG  341
            CDVD+NE I+FNEFIVLLCLIYLL D+ SS  +T KIGSP +E+TFNTIVEAFLFLDKNG
Sbjct  119  CDVDENEGIQFNEFIVLLCLIYLLTDSSSSSRNTPKIGSPELEATFNTIVEAFLFLDKNG  178

Query  340  DGKLHKKDVVKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGD  161
            DGKLHKK+VVKA ND  P EKSPSHVTR RFKEMDWDRSGK+SFR+FLFAFLDW+G++ D
Sbjct  179  DGKLHKKEVVKALNDDCPSEKSPSHVTRIRFKEMDWDRSGKVSFRQFLFAFLDWIGVNTD  238

Query  160  DEDHMAE  140
            DE+H  E
Sbjct  239  DENHATE  245



>ref|XP_009619226.1| PREDICTED: probable calcium-binding protein CML22 isoform X4 
[Nicotiana tomentosiformis]
Length=245

 Score =   363 bits (932),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 174/242 (72%), Positives = 208/242 (86%), Gaps = 1/242 (0%)
 Frame = -3

Query  862  GLSRPCLSLKLVSDKVGSLLCCHGSPNKYSRLDSKLETKVLEVKRNAPATLSIRSINALI  683
            G ++ C  LKL+S+KVG++LC   +P KY RLD+KLETK++E+KR++    + RSIN++I
Sbjct  3    GSAQSCPVLKLLSNKVGNILCFRNAPKKYRRLDAKLETKMIELKRSSSGQTNFRSINSII  62

Query  682  LKFPHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDD  503
            LKFP FREGLKEI+ VFEQFDEDSNG IDREELKKC++KLQFHV EEEI++LF SCDVD+
Sbjct  63   LKFPQFREGLKEIKAVFEQFDEDSNGTIDREELKKCVKKLQFHVKEEEINDLFHSCDVDE  122

Query  502  NEKIKFNEFIVLLCLIYLLMDAPSSG-STSKIGSPVVESTFNTIVEAFLFLDKNGDGKLH  326
            NE I+FNEFIVLLCLIYLL D+ SS  +T KIGSP +E+TFNTIVEAFLFLDKNGDGKLH
Sbjct  123  NEGIQFNEFIVLLCLIYLLTDSSSSSRNTPKIGSPELEATFNTIVEAFLFLDKNGDGKLH  182

Query  325  KKDVVKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDEDHM  146
            KK+VVKA ND  P EKSPSHVTR RFKEMDWDRSGK+SFR+FLFAFLDW+G++ DDE+H 
Sbjct  183  KKEVVKALNDDCPSEKSPSHVTRIRFKEMDWDRSGKVSFRQFLFAFLDWIGVNTDDENHA  242

Query  145  AE  140
             E
Sbjct  243  TE  244



>ref|XP_009619227.1| PREDICTED: probable calcium-binding protein CML22 isoform X5 
[Nicotiana tomentosiformis]
Length=243

 Score =   362 bits (928),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 173/240 (72%), Positives = 207/240 (86%), Gaps = 1/240 (0%)
 Frame = -3

Query  856  SRPCLSLKLVSDKVGSLLCCHGSPNKYSRLDSKLETKVLEVKRNAPATLSIRSINALILK  677
            ++ C  LKL+S+KVG++LC   +P KY RLD+KLETK++E+KR++    + RSIN++ILK
Sbjct  3    AQSCPVLKLLSNKVGNILCFRNAPKKYRRLDAKLETKMIELKRSSSGQTNFRSINSIILK  62

Query  676  FPHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNE  497
            FP FREGLKEI+ VFEQFDEDSNG IDREELKKC++KLQFHV EEEI++LF SCDVD+NE
Sbjct  63   FPQFREGLKEIKAVFEQFDEDSNGTIDREELKKCVKKLQFHVKEEEINDLFHSCDVDENE  122

Query  496  KIKFNEFIVLLCLIYLLMDAPSSG-STSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKK  320
             I+FNEFIVLLCLIYLL D+ SS  +T KIGSP +E+TFNTIVEAFLFLDKNGDGKLHKK
Sbjct  123  GIQFNEFIVLLCLIYLLTDSSSSSRNTPKIGSPELEATFNTIVEAFLFLDKNGDGKLHKK  182

Query  319  DVVKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDEDHMAE  140
            +VVKA ND  P EKSPSHVTR RFKEMDWDRSGK+SFR+FLFAFLDW+G++ DDE+H  E
Sbjct  183  EVVKALNDDCPSEKSPSHVTRIRFKEMDWDRSGKVSFRQFLFAFLDWIGVNTDDENHATE  242



>ref|XP_009619225.1| PREDICTED: probable calcium-binding protein CML22 isoform X3 
[Nicotiana tomentosiformis]
Length=246

 Score =   361 bits (927),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 176/247 (71%), Positives = 210/247 (85%), Gaps = 3/247 (1%)
 Frame = -3

Query  877  MKGSVGLSRPCLSLKLVSDKVGSLLCCHGSPNKYSRLDSKLETKVLEVKRNAPATLSIRS  698
            MK SVG ++ C  LKL+S+KVG++LC   +P KY RLD+KLETK++E+KR++    + RS
Sbjct  1    MKDSVGSAQSCPVLKLLSNKVGNILCFRNAPKKYRRLDAKLETKMIELKRSSSGQTNFRS  60

Query  697  INALILKFPHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRS  518
            IN++ILKFP FREGLKEI+ VFEQFD  SNG IDREELKKC++KLQFHV EEEI++LF S
Sbjct  61   INSIILKFPQFREGLKEIKAVFEQFD--SNGTIDREELKKCVKKLQFHVKEEEINDLFHS  118

Query  517  CDVDDNEKIKFNEFIVLLCLIYLLMDAPSSG-STSKIGSPVVESTFNTIVEAFLFLDKNG  341
            CDVD+NE I+FNEFIVLLCLIYLL D+ SS  +T KIGSP +E+TFNTIVEAFLFLDKNG
Sbjct  119  CDVDENEGIQFNEFIVLLCLIYLLTDSSSSSRNTPKIGSPELEATFNTIVEAFLFLDKNG  178

Query  340  DGKLHKKDVVKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGD  161
            DGKLHKK+VVKA ND  P EKSPSHVTR RFKEMDWDRSGK+SFR+FLFAFLDW+G++ D
Sbjct  179  DGKLHKKEVVKALNDDCPSEKSPSHVTRIRFKEMDWDRSGKVSFRQFLFAFLDWIGVNTD  238

Query  160  DEDHMAE  140
            DE+H  E
Sbjct  239  DENHATE  245



>ref|XP_004247862.1| PREDICTED: probable calcium-binding protein CML22 isoform X1 
[Solanum lycopersicum]
Length=252

 Score =   340 bits (872),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 172/237 (73%), Positives = 207/237 (87%), Gaps = 1/237 (0%)
 Frame = -3

Query  862  GLSRPCLSLKLVSDKVGSLLCCHGSPNKYSRLDSKLETKVLEVKRNAPATLSIRSINALI  683
            G ++PCL LKL+S+K+GSLLC   SP KY RLD+KLE K++E+KR++      RSIN +I
Sbjct  3    GSAQPCLVLKLLSNKIGSLLCFWNSPKKYRRLDTKLEMKMVELKRSSSGESKFRSINGII  62

Query  682  LKFPHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDD  503
            LKFPHF+EGLKEI+ VFEQFDEDSNG IDR+ELKKC++KL FH  +EE+++LF SCDVD+
Sbjct  63   LKFPHFKEGLKEIKDVFEQFDEDSNGTIDRDELKKCVKKLHFHAKDEEVNDLFDSCDVDE  122

Query  502  NEKIKFNEFIVLLCLIYLLMD-APSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLH  326
            NE I+FNEFIVLLCL+YLL+D + SSG+T+KIGSP +E+TFNTIVEAFLFLDKNGDGKLH
Sbjct  123  NEGIQFNEFIVLLCLLYLLIDSSSSSGNTTKIGSPELEATFNTIVEAFLFLDKNGDGKLH  182

Query  325  KKDVVKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDE  155
            KKDV+KA ND  P EKSPSHVTRTRF+EMDW+RSGK+SFR+FLFAFLDWVGID DDE
Sbjct  183  KKDVLKALNDECPCEKSPSHVTRTRFREMDWNRSGKVSFRQFLFAFLDWVGIDTDDE  239



>ref|XP_006366840.1| PREDICTED: probable calcium-binding protein CML22-like [Solanum 
tuberosum]
Length=262

 Score =   340 bits (871),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 174/242 (72%), Positives = 211/242 (87%), Gaps = 1/242 (0%)
 Frame = -3

Query  862  GLSRPCLSLKLVSDKVGSLLCCHGSPNKYSRLDSKLETKVLEVKRNAPATLSIRSINALI  683
            G ++PCL LKL+S+KVGSLLC   +P KY RLD+KLETK++E+KR++      RSIN++I
Sbjct  3    GSAQPCLVLKLLSNKVGSLLCFWNAPKKYRRLDTKLETKMVELKRSSSGQSKFRSINSII  62

Query  682  LKFPHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDD  503
            LKFPHF+EGLKEI+ VFEQFDEDSNG IDR+ELKKC++KL FHV +EE+++LF SCDVD+
Sbjct  63   LKFPHFKEGLKEIKGVFEQFDEDSNGTIDRDELKKCVKKLHFHVKDEEVNDLFDSCDVDE  122

Query  502  NEKIKFNEFIVLLCLIYLLMDAPSSG-STSKIGSPVVESTFNTIVEAFLFLDKNGDGKLH  326
             E I+FNEFIVLLCL+YLL+D+ SS  +TSKIGSP +E+TFNTIVEAFLFLDKNGDGKLH
Sbjct  123  KEGIQFNEFIVLLCLLYLLIDSSSSSENTSKIGSPELEATFNTIVEAFLFLDKNGDGKLH  182

Query  325  KKDVVKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDEDHM  146
            KKDV+KA ND  P EKSPSHVTRTRF+EMDW+RSGK+SFR+FLFAFLDWVGID DDE+H 
Sbjct  183  KKDVLKALNDECPCEKSPSHVTRTRFREMDWNRSGKVSFRQFLFAFLDWVGIDTDDENHT  242

Query  145  AE  140
             +
Sbjct  243  TK  244



>ref|XP_009374596.1| PREDICTED: probable calcium-binding protein CML22 isoform X1 
[Pyrus x bretschneideri]
Length=253

 Score =   334 bits (856),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 160/244 (66%), Positives = 199/244 (82%), Gaps = 0/244 (0%)
 Frame = -3

Query  886  LKTMKGSVGLSRPCLSLKLVSDKVGSLLCCHGSPNKYSRLDSKLETKVLEVKRNAPATLS  707
            +KT   S G S     LK +S+KVG +LCC  SPNKYSRLD+KLE K++EVKR      +
Sbjct  1    MKTSSPSAGTSHLRSQLKSMSNKVGGMLCCCSSPNKYSRLDAKLEKKMVEVKRGYLGRSN  60

Query  706  IRSINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDEL  527
             +SI+++I++FP FRE LK+IR VFEQ+DEDSNG IDREELKKCLQKLQ H+  EEI++L
Sbjct  61   FKSIDSIIMRFPQFREELKKIRDVFEQYDEDSNGTIDREELKKCLQKLQLHLTAEEIEDL  120

Query  526  FRSCDVDDNEKIKFNEFIVLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDK  347
            F SCD+D +E I+FNEFIVLLCLIYLL +  SS + SKI SP +E+TF+T+VE F FLDK
Sbjct  121  FHSCDMDGSEGIQFNEFIVLLCLIYLLKEPSSSHTISKINSPQLEATFDTVVEVFSFLDK  180

Query  346  NGDGKLHKKDVVKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGID  167
            NGDGKL+K D+VKA N+A PLEKSP+HVTRTRFKEMDWD++GK++FR+FLFAF+DWVGID
Sbjct  181  NGDGKLNKTDMVKALNEASPLEKSPAHVTRTRFKEMDWDKNGKVTFREFLFAFIDWVGID  240

Query  166  GDDE  155
             D+E
Sbjct  241  TDEE  244



>ref|XP_008380562.1| PREDICTED: probable calcium-binding protein CML22 isoform X1 
[Malus domestica]
Length=253

 Score =   332 bits (850),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 160/244 (66%), Positives = 198/244 (81%), Gaps = 0/244 (0%)
 Frame = -3

Query  886  LKTMKGSVGLSRPCLSLKLVSDKVGSLLCCHGSPNKYSRLDSKLETKVLEVKRNAPATLS  707
            +KT   S G S     LK +S+KVG +LCC  SPNKYSRLD+KLE K++EVKR +    +
Sbjct  1    MKTSSPSAGTSHLRSQLKSMSNKVGGMLCCCSSPNKYSRLDAKLEKKMVEVKRGSLGRSN  60

Query  706  IRSINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDEL  527
             +SI+++I++FP FRE LK+IR VFEQ+DEDSNG IDREELKKCLQKLQ H+  EEI++L
Sbjct  61   FKSIDSIIMRFPQFREELKKIRDVFEQYDEDSNGTIDREELKKCLQKLQLHLTAEEIEDL  120

Query  526  FRSCDVDDNEKIKFNEFIVLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDK  347
            F SCD+D +E I+FNEFIVLLCLIYLL +  SS + SKI SP +E+TF+T+VE F FLDK
Sbjct  121  FHSCDMDGSEGIQFNEFIVLLCLIYLLKEPSSSHTISKINSPQLEATFDTVVEVFSFLDK  180

Query  346  NGDGKLHKKDVVKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGID  167
            NGDGKL+K DVVKA N+A PLEKSP+ VTRTRFKEMDWD++GK++FR+FLFAF+DWVGID
Sbjct  181  NGDGKLNKTDVVKALNEASPLEKSPARVTRTRFKEMDWDKNGKVTFREFLFAFIDWVGID  240

Query  166  GDDE  155
             D E
Sbjct  241  TDGE  244



>ref|XP_007034372.1| Calcium-binding EF-hand family protein isoform 1 [Theobroma cacao]
 gb|EOY05298.1| Calcium-binding EF-hand family protein isoform 1 [Theobroma cacao]
Length=244

 Score =   327 bits (837),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 155/241 (64%), Positives = 203/241 (84%), Gaps = 4/241 (2%)
 Frame = -3

Query  865  VGLSRPCLSLKLVSDKVGSLLCCHGSPNKYSRLDSKLETKVLEVKRNAPATLSIRSINAL  686
            +G  RPC SLK +S  +G +LC  GSPNKY +LDSKLE K++E+KR+A    + +SI+++
Sbjct  1    MGKCRPCPSLKSLSSTIGGMLCHCGSPNKYKKLDSKLERKMIEMKRSASGQSNFKSIDSI  60

Query  685  ILKFPHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVD  506
            I++FP FR+GLK +R VFEQ+DEDSNG IDREEL KCL+KLQFH+ +EE+++LF SCD+D
Sbjct  61   IVRFPQFRDGLKNLRGVFEQYDEDSNGTIDREELNKCLEKLQFHLTKEEVEDLFHSCDID  120

Query  505  DNEKIKFNEFIVLLCLIYLLMD---APSSGSTS-KIGSPVVESTFNTIVEAFLFLDKNGD  338
             +E I+FNEFIVLLCLIYLLM    +P + ST+ KI SP +E+TF+TIVEAFLFLDKNGD
Sbjct  121  GSEGIQFNEFIVLLCLIYLLMKPSPSPDTVSTTLKIDSPQLEATFDTIVEAFLFLDKNGD  180

Query  337  GKLHKKDVVKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDD  158
            GKL+KKD++KA N+A P E+SP+HVTRTRFKEMDWD++GK+SFR+FLFAF++WVGI+ D+
Sbjct  181  GKLNKKDMIKALNEASPWERSPAHVTRTRFKEMDWDKNGKVSFREFLFAFINWVGIESDE  240

Query  157  E  155
            E
Sbjct  241  E  241



>ref|XP_009374597.1| PREDICTED: probable calcium-binding protein CML22 isoform X2 
[Pyrus x bretschneideri]
Length=234

 Score =   326 bits (835),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 153/225 (68%), Positives = 191/225 (85%), Gaps = 0/225 (0%)
 Frame = -3

Query  829  VSDKVGSLLCCHGSPNKYSRLDSKLETKVLEVKRNAPATLSIRSINALILKFPHFREGLK  650
            +S+KVG +LCC  SPNKYSRLD+KLE K++EVKR      + +SI+++I++FP FRE LK
Sbjct  1    MSNKVGGMLCCCSSPNKYSRLDAKLEKKMVEVKRGYLGRSNFKSIDSIIMRFPQFREELK  60

Query  649  EIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIV  470
            +IR VFEQ+DEDSNG IDREELKKCLQKLQ H+  EEI++LF SCD+D +E I+FNEFIV
Sbjct  61   KIRDVFEQYDEDSNGTIDREELKKCLQKLQLHLTAEEIEDLFHSCDMDGSEGIQFNEFIV  120

Query  469  LLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAF  290
            LLCLIYLL +  SS + SKI SP +E+TF+T+VE F FLDKNGDGKL+K D+VKA N+A 
Sbjct  121  LLCLIYLLKEPSSSHTISKINSPQLEATFDTVVEVFSFLDKNGDGKLNKTDMVKALNEAS  180

Query  289  PLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDE  155
            PLEKSP+HVTRTRFKEMDWD++GK++FR+FLFAF+DWVGID D+E
Sbjct  181  PLEKSPAHVTRTRFKEMDWDKNGKVTFREFLFAFIDWVGIDTDEE  225



>ref|XP_007223706.1| hypothetical protein PRUPE_ppa010393mg [Prunus persica]
 gb|EMJ24905.1| hypothetical protein PRUPE_ppa010393mg [Prunus persica]
Length=251

 Score =   326 bits (835),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 157/242 (65%), Positives = 198/242 (82%), Gaps = 1/242 (0%)
 Frame = -3

Query  877  MKGSVGL-SRPCLSLKLVSDKVGSLLCCHGSPNKYSRLDSKLETKVLEVKRNAPATLSIR  701
            MKGS    +  C  LK +S+KVGS+LCC GS NKYSRLD+KLE K++E KR +    + +
Sbjct  1    MKGSTSTGTSHCPYLKSLSNKVGSMLCCRGSTNKYSRLDAKLEKKMVEFKRGSLGRSNFK  60

Query  700  SINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFR  521
            SI+++I++FP FRE LK+IR VFEQ+DEDSNG ID EELKKCLQKL+ H+  EEI++LF 
Sbjct  61   SIDSIIMRFPQFREELKKIRDVFEQYDEDSNGTIDLEELKKCLQKLELHLTAEEIEDLFH  120

Query  520  SCDVDDNEKIKFNEFIVLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNG  341
            SCD+D +E I+FNEFIVLLCLIYLL +  SS +TSKI SP +E+TF+T++E F FLDKNG
Sbjct  121  SCDMDGSEGIQFNEFIVLLCLIYLLKEPSSSHNTSKIDSPQLEATFDTVIEVFSFLDKNG  180

Query  340  DGKLHKKDVVKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGD  161
            DGKL+K D+VKA N+A PLEKSP+HVTRTRFKEMDW + GK+SFR+FLFAF+DWVGID +
Sbjct  181  DGKLNKTDMVKALNEASPLEKSPAHVTRTRFKEMDWSKRGKVSFREFLFAFIDWVGIDTN  240

Query  160  DE  155
            +E
Sbjct  241  EE  242



>ref|XP_008224499.1| PREDICTED: probable calcium-binding protein CML22 [Prunus mume]
 ref|XP_008224500.1| PREDICTED: probable calcium-binding protein CML22 [Prunus mume]
Length=251

 Score =   325 bits (833),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 157/242 (65%), Positives = 198/242 (82%), Gaps = 1/242 (0%)
 Frame = -3

Query  877  MKGSVGL-SRPCLSLKLVSDKVGSLLCCHGSPNKYSRLDSKLETKVLEVKRNAPATLSIR  701
            MKGS    +  C  LK +S+KVGS+LCC  S NKYSRLD+KLE K++EVKR +    + +
Sbjct  1    MKGSTSTGTSHCPYLKSLSNKVGSMLCCRDSTNKYSRLDAKLEKKMVEVKRASLGRSNFK  60

Query  700  SINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFR  521
            SI+++I++FP FRE LK+IR VFEQ+DEDSNG ID EELKKCLQKL+ H+  EEI++LF 
Sbjct  61   SIDSIIMRFPQFREELKKIRDVFEQYDEDSNGTIDLEELKKCLQKLELHLTAEEIEDLFH  120

Query  520  SCDVDDNEKIKFNEFIVLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNG  341
            SCD+D +E I+FNEFIVLLCLIYLL +  SS +TSKI SP +E+TF+T++E F FLDKNG
Sbjct  121  SCDMDGSEGIQFNEFIVLLCLIYLLKEPSSSHNTSKIDSPQLEATFDTVIEVFSFLDKNG  180

Query  340  DGKLHKKDVVKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGD  161
            DGKL+K D+VKA N+A PLEKSP+HVTRTRFKEMDW + GK+SFR+FLFAF+DWVGID +
Sbjct  181  DGKLNKTDMVKALNEASPLEKSPAHVTRTRFKEMDWSKRGKVSFREFLFAFIDWVGIDTN  240

Query  160  DE  155
            +E
Sbjct  241  EE  242



>ref|XP_008380563.1| PREDICTED: probable calcium-binding protein CML22 isoform X2 
[Malus domestica]
Length=234

 Score =   324 bits (830),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 153/225 (68%), Positives = 190/225 (84%), Gaps = 0/225 (0%)
 Frame = -3

Query  829  VSDKVGSLLCCHGSPNKYSRLDSKLETKVLEVKRNAPATLSIRSINALILKFPHFREGLK  650
            +S+KVG +LCC  SPNKYSRLD+KLE K++EVKR +    + +SI+++I++FP FRE LK
Sbjct  1    MSNKVGGMLCCCSSPNKYSRLDAKLEKKMVEVKRGSLGRSNFKSIDSIIMRFPQFREELK  60

Query  649  EIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIV  470
            +IR VFEQ+DEDSNG IDREELKKCLQKLQ H+  EEI++LF SCD+D +E I+FNEFIV
Sbjct  61   KIRDVFEQYDEDSNGTIDREELKKCLQKLQLHLTAEEIEDLFHSCDMDGSEGIQFNEFIV  120

Query  469  LLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAF  290
            LLCLIYLL +  SS + SKI SP +E+TF+T+VE F FLDKNGDGKL+K DVVKA N+A 
Sbjct  121  LLCLIYLLKEPSSSHTISKINSPQLEATFDTVVEVFSFLDKNGDGKLNKTDVVKALNEAS  180

Query  289  PLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDE  155
            PLEKSP+ VTRTRFKEMDWD++GK++FR+FLFAF+DWVGID D E
Sbjct  181  PLEKSPARVTRTRFKEMDWDKNGKVTFREFLFAFIDWVGIDTDGE  225



>ref|XP_004299109.1| PREDICTED: probable calcium-binding protein CML22 [Fragaria vesca 
subsp. vesca]
Length=243

 Score =   321 bits (822),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 155/241 (64%), Positives = 194/241 (80%), Gaps = 4/241 (2%)
 Frame = -3

Query  877  MKGSVGLSRPCLSLKLVSDKVGSLLCCHGSPNKYSRLDSKLETKVLEVKRNAPATLSIRS  698
            MK S G S  C S+K +SDKVG +LCC GS NKYSRLD+KLE ++ E KR +    + RS
Sbjct  1    MKAS-GTSHLCCSVKTLSDKVGGMLCCRGSANKYSRLDAKLEKRMAEFKRVSSGQSNFRS  59

Query  697  INALILKFPHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRS  518
            I+++IL+FP FRE LK IR VF+ +DEDSNG IDREELKKCLQKLQ H+  EEI++LF S
Sbjct  60   IDSIILRFPQFREELKNIRNVFDLYDEDSNGTIDREELKKCLQKLQLHLTAEEIEDLFHS  119

Query  517  CDVDDNEKIKFNEFIVLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGD  338
            CD+D +E I+FNEFIVLLCLIYLL D     +TSKI  P +E+TF+T++E F+FLDKNGD
Sbjct  120  CDMDGSEGIQFNEFIVLLCLIYLLKDP---NTTSKIDCPQLEATFDTVIEVFVFLDKNGD  176

Query  337  GKLHKKDVVKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDD  158
            GKL+K +VVKA N+A P EKSPSHV+R RFKEMDWD++GK++FR+FLFAF+DWVGI+ D+
Sbjct  177  GKLNKTEVVKALNEASPREKSPSHVSRNRFKEMDWDKNGKVTFRQFLFAFIDWVGIETDE  236

Query  157  E  155
            E
Sbjct  237  E  237



>ref|XP_002300172.2| hypothetical protein POPTR_0001s32210g [Populus trichocarpa]
 gb|EEE84977.2| hypothetical protein POPTR_0001s32210g [Populus trichocarpa]
Length=249

 Score =   320 bits (819),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 148/242 (61%), Positives = 201/242 (83%), Gaps = 1/242 (0%)
 Frame = -3

Query  877  MKGSVGLSRPCLSLKLVSDKVGSLLCCHGSPNKYSRLDSKLETKVLEVKRNAPATLSIRS  698
            MK S+G S+PC SLK ++ K+G + C  GSPNKY RLD+KLE K++E+KR++    + +S
Sbjct  1    MKDSLGTSQPCPSLKSLTSKLGGMFCHCGSPNKYKRLDAKLEKKLIELKRSSSGKTNFKS  60

Query  697  INALILKFPHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRS  518
            +N++I++FP F+E LK IR VFEQ+DED+NG ID EELKKCLQ LQ ++ EEE+++LF S
Sbjct  61   MNSIIMRFPQFKEELKHIRGVFEQYDEDANGNIDMEELKKCLQNLQLNLKEEEVEDLFHS  120

Query  517  CDVDDNEKIKFNEFIVLLCLIYLLMDAPSSG-STSKIGSPVVESTFNTIVEAFLFLDKNG  341
            CD+D +E I+FNEFIVLLCLIYLL++  SS   TSK+GSP +E+TF+TIV+AFLFLDKNG
Sbjct  121  CDIDQSEGIQFNEFIVLLCLIYLLVEHSSSPLRTSKMGSPELEATFDTIVKAFLFLDKNG  180

Query  340  DGKLHKKDVVKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGD  161
             GKL+KKD++KA N+  P EKSP+H+TR+RFKEMDWDR+GK+SFR+FLF+ ++W+GID D
Sbjct  181  AGKLNKKDMIKALNEDSPWEKSPAHITRSRFKEMDWDRNGKVSFREFLFSLINWIGIDAD  240

Query  160  DE  155
            ++
Sbjct  241  ED  242



>ref|XP_011045652.1| PREDICTED: probable calcium-binding protein CML22 [Populus euphratica]
 ref|XP_011045653.1| PREDICTED: probable calcium-binding protein CML22 [Populus euphratica]
Length=248

 Score =   318 bits (814),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 148/242 (61%), Positives = 201/242 (83%), Gaps = 1/242 (0%)
 Frame = -3

Query  877  MKGSVGLSRPCLSLKLVSDKVGSLLCCHGSPNKYSRLDSKLETKVLEVKRNAPATLSIRS  698
            MK S+G S+PC SLK ++ K+G +L   GSPNKY RLD+KLE K++E+KR++    + +S
Sbjct  1    MKDSLGTSQPCPSLKSLTSKLGGMLHRCGSPNKYKRLDAKLEKKLIELKRSSSGKTNFKS  60

Query  697  INALILKFPHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRS  518
            +N++I++FP F+E LK IR VFEQ+DED+NG ID +ELKKCLQ LQ ++ EEE+++LF S
Sbjct  61   MNSIIMRFPQFKEELKHIRGVFEQYDEDANGNIDMKELKKCLQNLQLNLKEEEVEDLFHS  120

Query  517  CDVDDNEKIKFNEFIVLLCLIYLLMDAPSSG-STSKIGSPVVESTFNTIVEAFLFLDKNG  341
            CD+D +E I+FNEFIVLLCLIYLL++  SS   TSK+GSP +E+TF+TI++AFLFLDKNG
Sbjct  121  CDIDQSEGIQFNEFIVLLCLIYLLVEHSSSPLRTSKMGSPELEATFDTIIKAFLFLDKNG  180

Query  340  DGKLHKKDVVKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGD  161
             GKL+KKD++KA N+  P EKSP+H+TR+RFKEMDWDR+GK+SFR+FLF+ +DW+GID D
Sbjct  181  AGKLNKKDMIKALNEDSPWEKSPTHITRSRFKEMDWDRNGKVSFREFLFSLIDWIGIDAD  240

Query  160  DE  155
            +E
Sbjct  241  EE  242



>gb|KJB72094.1| hypothetical protein B456_011G158400 [Gossypium raimondii]
Length=244

 Score =   315 bits (807),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 149/238 (63%), Positives = 196/238 (82%), Gaps = 1/238 (0%)
 Frame = -3

Query  865  VGLSRPCLSLKLVSDKVGSLLCCHGSPNKYSRLDSKLETKVLEVKRNAPATLSIRSINAL  686
            +G   PC  LK +S ++G +LC +GS NKY +LDSKLE K++E+KR+A    + +SI+++
Sbjct  1    MGKCHPCPPLKSLSSRIGGMLCNYGSSNKYKKLDSKLERKMIEMKRSASGQSNFKSIDSI  60

Query  685  ILKFPHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVD  506
            IL+FP FREGL+ +R VFEQ+DEDSNG IDREEL +CL+KLQ H  +EE+++LF SCD+D
Sbjct  61   ILRFPQFREGLRNLRGVFEQYDEDSNGTIDREELNRCLEKLQLHFTKEEVEDLFHSCDID  120

Query  505  DNEKIKFNEFIVLLCLIYLLMDAPSS-GSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKL  329
             +E I+FNEFIVLLCLIYLLM   SS  +T K+ S  +E+TF+TIVEAFLFLDKNGDGKL
Sbjct  121  GSEGIQFNEFIVLLCLIYLLMKPSSSPDNTLKMHSLQLEATFDTIVEAFLFLDKNGDGKL  180

Query  328  HKKDVVKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDE  155
            +KKD+VKA N+A P E+SP+ VTRTRFKEMDWD++GK+SFR+FLFAF++WVGI+ D+E
Sbjct  181  NKKDMVKALNEASPWERSPARVTRTRFKEMDWDKNGKVSFREFLFAFINWVGIESDEE  238



>ref|XP_002266666.1| PREDICTED: probable calcium-binding protein CML22 isoform X1 
[Vitis vinifera]
 emb|CBI17320.3| unnamed protein product [Vitis vinifera]
Length=248

 Score =   312 bits (799),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 154/242 (64%), Positives = 191/242 (79%), Gaps = 1/242 (0%)
 Frame = -3

Query  877  MKGSVGLSRPCLSLKLVSDKVGSLLCCHGSPNKYSRLDSKLETKVLEVKRNAPATLSIRS  698
            MK SVG   P  +LK  S KVG +L   GS NKY +LD+KLE K++EVKRN     + RS
Sbjct  1    MKQSVGTFYPRTALKSFSSKVGVMLFRCGSSNKYKKLDAKLERKMMEVKRNTSGRNNFRS  60

Query  697  INALILKFPHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRS  518
             +++I++FP F+EGLK IR VF Q+DEDSNG ID EELKKCLQKLQ H+ E+EID+LF S
Sbjct  61   FDSIIMRFPQFKEGLKNIRGVFAQYDEDSNGIIDHEELKKCLQKLQLHLTEQEIDDLFCS  120

Query  517  CDVDDNEKIKFNEFIVLLCLIYLLMD-APSSGSTSKIGSPVVESTFNTIVEAFLFLDKNG  341
            CD D ++ I+FNEFIV+LCLIYLLM+ + S+  TSK+GSP +E+TF+TIVEAFLFLD NG
Sbjct  121  CDADGSQGIQFNEFIVILCLIYLLMEPSTSTHPTSKMGSPQLEATFDTIVEAFLFLDNNG  180

Query  340  DGKLHKKDVVKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGD  161
            DGKL+K+D+VKA N+A P EKS +H+TRTRFKEMD +RSGK  FR FLFA  DWVG+DGD
Sbjct  181  DGKLNKRDMVKALNEASPCEKSSAHITRTRFKEMDGNRSGKAGFRDFLFALTDWVGLDGD  240

Query  160  DE  155
            +E
Sbjct  241  EE  242



>gb|KHG12326.1| putative calcium-binding CML22 -like protein [Gossypium arboreum]
Length=244

 Score =   310 bits (795),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 147/238 (62%), Positives = 196/238 (82%), Gaps = 1/238 (0%)
 Frame = -3

Query  865  VGLSRPCLSLKLVSDKVGSLLCCHGSPNKYSRLDSKLETKVLEVKRNAPATLSIRSINAL  686
            +G   PC SLK +S ++G +LC +GS +KY +LDSKLE K++E+K +A    + +SI+++
Sbjct  1    MGKCHPCPSLKSLSSRIGGMLCNYGSSSKYKKLDSKLERKMIEMKGSASGQSNFKSIDSI  60

Query  685  ILKFPHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVD  506
            IL+FP FREGL+ +R VF+Q+DEDSNG IDREEL +CL+KLQ H  +EE+++LF SCD+D
Sbjct  61   ILRFPQFREGLRNLRGVFKQYDEDSNGTIDREELNRCLEKLQLHFTKEEVEDLFHSCDID  120

Query  505  DNEKIKFNEFIVLLCLIYLLMDAPSS-GSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKL  329
             +E I+FNEFIVLLCLIYLLM   SS  +T K+ S  +E+TF+TIVEAFLFLDKNGDGKL
Sbjct  121  GSEGIQFNEFIVLLCLIYLLMKPSSSPDNTLKMHSLQLEATFDTIVEAFLFLDKNGDGKL  180

Query  328  HKKDVVKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDE  155
            +KKDV+KA N+A P E+SP+ VTRTRFKEMDWD++GK+SFR+FLFAF++WVGI+ D+E
Sbjct  181  NKKDVMKALNEASPWERSPARVTRTRFKEMDWDKNGKVSFREFLFAFINWVGIESDEE  238



>ref|XP_012071147.1| PREDICTED: probable calcium-binding protein CML22 isoform X1 
[Jatropha curcas]
Length=248

 Score =   310 bits (795),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 149/242 (62%), Positives = 198/242 (82%), Gaps = 1/242 (0%)
 Frame = -3

Query  877  MKGSVGLSRPCLSLKLVSDKVGSLLCCHGSPNKYSRLDSKLETKVLEVKRNAPATLSIRS  698
            MK S+G S  C +LK +  K+  + C  GS NKY RLD+KLE K++EVKR++    + +S
Sbjct  1    MKVSLGTSYSCPALKSLCSKIAEMFCHCGSQNKYKRLDAKLEKKMIEVKRSSTGHTNFKS  60

Query  697  INALILKFPHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRS  518
            I+++IL+FP F++GLK IR VFE +DED+NG IDR ELK+CLQKLQ ++ E+EI++LF S
Sbjct  61   IDSIILRFPQFKDGLKNIRGVFELYDEDANGIIDRGELKRCLQKLQLNLKEQEIEDLFHS  120

Query  517  CDVDDNEKIKFNEFIVLLCLIYLLMDAPSS-GSTSKIGSPVVESTFNTIVEAFLFLDKNG  341
            CD+D ++ I+FNEFIVLLCLIYLL++  SS  STSK+GS  +E+TF+TIVEAFLFLDKNG
Sbjct  121  CDIDGSQGIQFNEFIVLLCLIYLLVEPSSSPHSTSKVGSRELEATFDTIVEAFLFLDKNG  180

Query  340  DGKLHKKDVVKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGD  161
            DGKL+KKDV+KA N+A P EKSP+ VT++RF+EMDWDR+GK+SFR+FLFA ++WVGID D
Sbjct  181  DGKLNKKDVLKALNEASPWEKSPARVTKSRFREMDWDRNGKVSFREFLFALINWVGIDAD  240

Query  160  DE  155
            +E
Sbjct  241  EE  242



>ref|XP_006493812.1| PREDICTED: probable calcium-binding protein CML22-like isoform 
X1 [Citrus sinensis]
Length=241

 Score =   309 bits (791),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 150/237 (63%), Positives = 200/237 (84%), Gaps = 1/237 (0%)
 Frame = -3

Query  865  VGLSRPCLSLKLVSDKVGSLLCCHGSPNKYSRLDSKLETKVLEVKRNAPATLSIRSINAL  686
            +G S PC  LK +S+KV  +LC  GS NKY+RLD+KLE K++EVK+++    + +SI+++
Sbjct  1    MGTSHPCPPLKYLSNKVRGMLCHCGSQNKYARLDAKLEKKMIEVKKSSSGHSNFKSIDSV  60

Query  685  ILKFPHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVD  506
            IL+FP F++GLK I++VFEQ+DEDSNG IDREELKKCL++LQ H+ EEEI++LF+SCD+D
Sbjct  61   ILRFPQFKDGLKNIKSVFEQYDEDSNGTIDREELKKCLEELQLHLKEEEIEDLFKSCDID  120

Query  505  DNEKIKFNEFIVLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLH  326
             +E I+FNEFIVLLCLIYLL   PSS S SK+GSP +++TF+ IVE FLFLDKNGDG+L+
Sbjct  121  GSEGIQFNEFIVLLCLIYLLT-TPSSSSMSKMGSPQLKATFDAIVEVFLFLDKNGDGRLN  179

Query  325  KKDVVKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDE  155
            KKD+VK  N+++P EKSP+HVTRTRF+EMDWDR+GK+SFR+FLFA + W+GID D+E
Sbjct  180  KKDMVKTLNESYPREKSPAHVTRTRFEEMDWDRNGKVSFREFLFALISWIGIDNDEE  236



>ref|XP_006420904.1| hypothetical protein CICLE_v10005743mg [Citrus clementina]
 gb|ESR34144.1| hypothetical protein CICLE_v10005743mg [Citrus clementina]
Length=241

 Score =   306 bits (784),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 148/237 (62%), Positives = 200/237 (84%), Gaps = 1/237 (0%)
 Frame = -3

Query  865  VGLSRPCLSLKLVSDKVGSLLCCHGSPNKYSRLDSKLETKVLEVKRNAPATLSIRSINAL  686
            +G S PC  LK +S+KV  +LC  GS NKY+RLD+KLE K++EVK+++    + +SI+++
Sbjct  1    MGTSHPCPPLKYLSNKVRGMLCHCGSQNKYARLDAKLEKKMIEVKKSSSGHSNFKSIDSV  60

Query  685  ILKFPHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVD  506
            I++FP F++GLK I++VFEQ+D+DSNG IDREELKKCL++LQ H+ EEEI++LF+SCD+D
Sbjct  61   IVRFPQFKDGLKNIKSVFEQYDKDSNGTIDREELKKCLEELQLHLKEEEIEDLFKSCDID  120

Query  505  DNEKIKFNEFIVLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLH  326
             +E I+FNEFIVLLCLIYLL   PSS S SK+GSP +++TF+ IVE FLFLDKNGDG+L+
Sbjct  121  GSEGIQFNEFIVLLCLIYLLT-TPSSSSMSKMGSPQLKATFDAIVEVFLFLDKNGDGRLN  179

Query  325  KKDVVKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDE  155
            KKD+VK  N+++P EKSP+HVTRTRF+EMDWDR+GK+SFR+FLFA + W+GID D+E
Sbjct  180  KKDMVKTLNESYPREKSPAHVTRTRFEEMDWDRNGKVSFREFLFALISWIGIDNDEE  236



>gb|KDO61178.1| hypothetical protein CISIN_1g0262681mg, partial [Citrus sinensis]
Length=239

 Score =   305 bits (780),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 148/234 (63%), Positives = 198/234 (85%), Gaps = 1/234 (0%)
 Frame = -3

Query  856  SRPCLSLKLVSDKVGSLLCCHGSPNKYSRLDSKLETKVLEVKRNAPATLSIRSINALILK  677
            S PC  LK +S+KV  +LC  GS NKY+RLD+KLE K++EVK+++    + +SI+++I++
Sbjct  2    SHPCPPLKYLSNKVRGMLCHCGSQNKYARLDAKLEKKMIEVKKSSSGHSNFKSIDSVIVR  61

Query  676  FPHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNE  497
            FP F++GLK I++VFEQ+DEDSNG IDREELKKCL++LQ H+ EEEI++LF+SCD+D +E
Sbjct  62   FPQFKDGLKNIKSVFEQYDEDSNGTIDREELKKCLEELQLHLKEEEIEDLFKSCDIDGSE  121

Query  496  KIKFNEFIVLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKD  317
             I+FNEFIVLLCLIYLL   PSS S SK+GSP +++TF+ IVE FLFLDKNGDG+L+KKD
Sbjct  122  GIQFNEFIVLLCLIYLLT-TPSSSSMSKMGSPQLKATFDAIVEVFLFLDKNGDGRLNKKD  180

Query  316  VVKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDE  155
            +VK  N+++P EKSP+HVTRTRF+EMDWDR+GK+SFR+FLFA + W+GID D+E
Sbjct  181  MVKTLNESYPREKSPAHVTRTRFEEMDWDRNGKVSFREFLFALISWIGIDNDEE  234



>ref|XP_008438356.1| PREDICTED: probable calcium-binding protein CML22 [Cucumis melo]
 ref|XP_008438357.1| PREDICTED: probable calcium-binding protein CML22 [Cucumis melo]
Length=227

 Score =   301 bits (771),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 139/222 (63%), Positives = 186/222 (84%), Gaps = 1/222 (0%)
 Frame = -3

Query  820  KVGSLLCCHGSPNKYSRLDSKLETKVLEVKRNAPATLSIRSINALILKFPHFREGLKEIR  641
            KVGS+  C  S NKY+RLD+KL  K++EVKRN+    + +S+N +IL+FP F+EGL+ IR
Sbjct  3    KVGSIFFCCSSSNKYNRLDAKLGRKMVEVKRNSAGHDNFKSLNGIILRFPQFKEGLQNIR  62

Query  640  TVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  461
             VFEQ+DEDSNG+IDREELKKCLQKLQ H+ EEE+++LF SCD+D +  I+FNEFIVLLC
Sbjct  63   GVFEQYDEDSNGSIDREELKKCLQKLQMHMTEEEVEDLFHSCDIDGSAGIQFNEFIVLLC  122

Query  460  LIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPLE  281
            LIYLL D  S  + SK+GSP +E+TF+TI++AF+FLDKNGDGKL++K++VKA N+A P E
Sbjct  123  LIYLLKDEHSL-TKSKLGSPQLEATFDTIIQAFIFLDKNGDGKLNRKEMVKALNEASPYE  181

Query  280  KSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDE  155
            +SP+ +T+TRFKEMDW+ SGK++FR+FLF F++WVG+D DD+
Sbjct  182  RSPARITKTRFKEMDWNNSGKVNFREFLFGFINWVGVDTDDD  223



>ref|XP_011650876.1| PREDICTED: probable calcium-binding protein CML22 [Cucumis sativus]
 gb|KGN56734.1| hypothetical protein Csa_3G130890 [Cucumis sativus]
Length=227

 Score =   300 bits (769),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 138/222 (62%), Positives = 186/222 (84%), Gaps = 1/222 (0%)
 Frame = -3

Query  820  KVGSLLCCHGSPNKYSRLDSKLETKVLEVKRNAPATLSIRSINALILKFPHFREGLKEIR  641
            KVGS+  C  S NKY+RLD+KL  K++EVKRN+    + +S+N +IL+FP F+EGL+ IR
Sbjct  3    KVGSIFFCCSSSNKYNRLDAKLGRKMVEVKRNSAGHDNFKSLNGIILRFPQFKEGLQNIR  62

Query  640  TVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  461
             VFEQ+DEDSNG+IDREELKKCLQ+LQ H+ EEE+++LF SCD+D +  I+FNEFIVLLC
Sbjct  63   GVFEQYDEDSNGSIDREELKKCLQQLQMHMTEEEVEDLFHSCDIDGSAGIQFNEFIVLLC  122

Query  460  LIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPLE  281
            LIYLL D  S  + SK+GSP +E+TF+TI++AF+FLDKNGDGKL++K++VKA N+A P E
Sbjct  123  LIYLLKDEHSL-TKSKLGSPQLEATFDTIIQAFIFLDKNGDGKLNRKEMVKALNEASPYE  181

Query  280  KSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDE  155
            +SP+ +T+TRFKEMDW+ SGK++FR+FLF F++WVG+D DD+
Sbjct  182  RSPARITKTRFKEMDWNNSGKVNFREFLFGFINWVGVDTDDD  223



>gb|KJB72093.1| hypothetical protein B456_011G158400 [Gossypium raimondii]
Length=238

 Score =   299 bits (766),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 145/238 (61%), Positives = 191/238 (80%), Gaps = 7/238 (3%)
 Frame = -3

Query  865  VGLSRPCLSLKLVSDKVGSLLCCHGSPNKYSRLDSKLETKVLEVKRNAPATLSIRSINAL  686
            +G   PC  LK +S ++G +LC +GS NKY +LDSKLE K++E+KR+A    + +SI+++
Sbjct  1    MGKCHPCPPLKSLSSRIGGMLCNYGSSNKYKKLDSKLERKMIEMKRSASGQSNFKSIDSI  60

Query  685  ILKFPHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVD  506
            IL+FP FREGL+ +R      DEDSNG IDREEL +CL+KLQ H  +EE+++LF SCD+D
Sbjct  61   ILRFPQFREGLRNLR------DEDSNGTIDREELNRCLEKLQLHFTKEEVEDLFHSCDID  114

Query  505  DNEKIKFNEFIVLLCLIYLLMDAPSS-GSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKL  329
             +E I+FNEFIVLLCLIYLLM   SS  +T K+ S  +E+TF+TIVEAFLFLDKNGDGKL
Sbjct  115  GSEGIQFNEFIVLLCLIYLLMKPSSSPDNTLKMHSLQLEATFDTIVEAFLFLDKNGDGKL  174

Query  328  HKKDVVKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDE  155
            +KKD+VKA N+A P E+SP+ VTRTRFKEMDWD++GK+SFR+FLFAF++WVGI+ D+E
Sbjct  175  NKKDMVKALNEASPWERSPARVTRTRFKEMDWDKNGKVSFREFLFAFINWVGIESDEE  232



>ref|XP_010650355.1| PREDICTED: probable calcium-binding protein CML22 isoform X2 
[Vitis vinifera]
Length=242

 Score =   298 bits (764),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 151/242 (62%), Positives = 187/242 (77%), Gaps = 7/242 (3%)
 Frame = -3

Query  877  MKGSVGLSRPCLSLKLVSDKVGSLLCCHGSPNKYSRLDSKLETKVLEVKRNAPATLSIRS  698
            MK SVG   P  +LK  S KVG +L   GS NKY +LD+KLE K++EVKRN     + RS
Sbjct  1    MKQSVGTFYPRTALKSFSSKVGVMLFRCGSSNKYKKLDAKLERKMMEVKRNTSGRNNFRS  60

Query  697  INALILKFPHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRS  518
             +++I++FP F+EGLK IR      DEDSNG ID EELKKCLQKLQ H+ E+EID+LF S
Sbjct  61   FDSIIMRFPQFKEGLKNIR------DEDSNGIIDHEELKKCLQKLQLHLTEQEIDDLFCS  114

Query  517  CDVDDNEKIKFNEFIVLLCLIYLLMD-APSSGSTSKIGSPVVESTFNTIVEAFLFLDKNG  341
            CD D ++ I+FNEFIV+LCLIYLLM+ + S+  TSK+GSP +E+TF+TIVEAFLFLD NG
Sbjct  115  CDADGSQGIQFNEFIVILCLIYLLMEPSTSTHPTSKMGSPQLEATFDTIVEAFLFLDNNG  174

Query  340  DGKLHKKDVVKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGD  161
            DGKL+K+D+VKA N+A P EKS +H+TRTRFKEMD +RSGK  FR FLFA  DWVG+DGD
Sbjct  175  DGKLNKRDMVKALNEASPCEKSSAHITRTRFKEMDGNRSGKAGFRDFLFALTDWVGLDGD  234

Query  160  DE  155
            +E
Sbjct  235  EE  236



>ref|XP_010650356.1| PREDICTED: probable calcium-binding protein CML22 isoform X3 
[Vitis vinifera]
Length=225

 Score =   295 bits (756),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 141/214 (66%), Positives = 176/214 (82%), Gaps = 1/214 (0%)
 Frame = -3

Query  793  GSPNKYSRLDSKLETKVLEVKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDED  614
            GS NKY +LD+KLE K++EVKRN     + RS +++I++FP F+EGLK IR VF Q+DED
Sbjct  6    GSSNKYKKLDAKLERKMMEVKRNTSGRNNFRSFDSIIMRFPQFKEGLKNIRGVFAQYDED  65

Query  613  SNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMD-A  437
            SNG ID EELKKCLQKLQ H+ E+EID+LF SCD D ++ I+FNEFIV+LCLIYLLM+ +
Sbjct  66   SNGIIDHEELKKCLQKLQLHLTEQEIDDLFCSCDADGSQGIQFNEFIVILCLIYLLMEPS  125

Query  436  PSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPLEKSPSHVTR  257
             S+  TSK+GSP +E+TF+TIVEAFLFLD NGDGKL+K+D+VKA N+A P EKS +H+TR
Sbjct  126  TSTHPTSKMGSPQLEATFDTIVEAFLFLDNNGDGKLNKRDMVKALNEASPCEKSSAHITR  185

Query  256  TRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDE  155
            TRFKEMD +RSGK  FR FLFA  DWVG+DGD+E
Sbjct  186  TRFKEMDGNRSGKAGFRDFLFALTDWVGLDGDEE  219



>ref|XP_012071148.1| PREDICTED: probable calcium-binding protein CML22 isoform X2 
[Jatropha curcas]
 ref|XP_012071149.1| PREDICTED: probable calcium-binding protein CML22 isoform X2 
[Jatropha curcas]
 gb|KDP39372.1| hypothetical protein JCGZ_01129 [Jatropha curcas]
Length=225

 Score =   295 bits (754),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 140/219 (64%), Positives = 185/219 (84%), Gaps = 1/219 (0%)
 Frame = -3

Query  808  LLCCHGSPNKYSRLDSKLETKVLEVKRNAPATLSIRSINALILKFPHFREGLKEIRTVFE  629
            + C  GS NKY RLD+KLE K++EVKR++    + +SI+++IL+FP F++GLK IR VFE
Sbjct  1    MFCHCGSQNKYKRLDAKLEKKMIEVKRSSTGHTNFKSIDSIILRFPQFKDGLKNIRGVFE  60

Query  628  QFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYL  449
             +DED+NG IDR ELK+CLQKLQ ++ E+EI++LF SCD+D ++ I+FNEFIVLLCLIYL
Sbjct  61   LYDEDANGIIDRGELKRCLQKLQLNLKEQEIEDLFHSCDIDGSQGIQFNEFIVLLCLIYL  120

Query  448  LMDAPSS-GSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPLEKSP  272
            L++  SS  STSK+GS  +E+TF+TIVEAFLFLDKNGDGKL+KKDV+KA N+A P EKSP
Sbjct  121  LVEPSSSPHSTSKVGSRELEATFDTIVEAFLFLDKNGDGKLNKKDVLKALNEASPWEKSP  180

Query  271  SHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDE  155
            + VT++RF+EMDWDR+GK+SFR+FLFA ++WVGID D+E
Sbjct  181  ARVTKSRFREMDWDRNGKVSFREFLFALINWVGIDADEE  219



>ref|XP_010326837.1| PREDICTED: probable calcium-binding protein CML22 isoform X2 
[Solanum lycopersicum]
Length=213

 Score =   292 bits (747),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 148/199 (74%), Positives = 177/199 (89%), Gaps = 1/199 (1%)
 Frame = -3

Query  748  KVLEVKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQ  569
            K++E+KR++      RSIN +ILKFPHF+EGLKEI+ VFEQFDEDSNG IDR+ELKKC++
Sbjct  2    KMVELKRSSSGESKFRSINGIILKFPHFKEGLKEIKDVFEQFDEDSNGTIDRDELKKCVK  61

Query  568  KLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMDAPSS-GSTSKIGSPVVE  392
            KL FH  +EE+++LF SCDVD+NE I+FNEFIVLLCL+YLL+D+ SS G+T+KIGSP +E
Sbjct  62   KLHFHAKDEEVNDLFDSCDVDENEGIQFNEFIVLLCLLYLLIDSSSSSGNTTKIGSPELE  121

Query  391  STFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKIS  212
            +TFNTIVEAFLFLDKNGDGKLHKKDV+KA ND  P EKSPSHVTRTRF+EMDW+RSGK+S
Sbjct  122  ATFNTIVEAFLFLDKNGDGKLHKKDVLKALNDECPCEKSPSHVTRTRFREMDWNRSGKVS  181

Query  211  FRKFLFAFLDWVGIDGDDE  155
            FR+FLFAFLDWVGID DDE
Sbjct  182  FRQFLFAFLDWVGIDTDDE  200



>ref|XP_006493813.1| PREDICTED: probable calcium-binding protein CML22-like isoform 
X2 [Citrus sinensis]
Length=222

 Score =   292 bits (747),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 141/218 (65%), Positives = 188/218 (86%), Gaps = 1/218 (0%)
 Frame = -3

Query  808  LLCCHGSPNKYSRLDSKLETKVLEVKRNAPATLSIRSINALILKFPHFREGLKEIRTVFE  629
            +LC  GS NKY+RLD+KLE K++EVK+++    + +SI+++IL+FP F++GLK I++VFE
Sbjct  1    MLCHCGSQNKYARLDAKLEKKMIEVKKSSSGHSNFKSIDSVILRFPQFKDGLKNIKSVFE  60

Query  628  QFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYL  449
            Q+DEDSNG IDREELKKCL++LQ H+ EEEI++LF+SCD+D +E I+FNEFIVLLCLIYL
Sbjct  61   QYDEDSNGTIDREELKKCLEELQLHLKEEEIEDLFKSCDIDGSEGIQFNEFIVLLCLIYL  120

Query  448  LMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPLEKSPS  269
            L   PSS S SK+GSP +++TF+ IVE FLFLDKNGDG+L+KKD+VK  N+++P EKSP+
Sbjct  121  LT-TPSSSSMSKMGSPQLKATFDAIVEVFLFLDKNGDGRLNKKDMVKTLNESYPREKSPA  179

Query  268  HVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDE  155
            HVTRTRF+EMDWDR+GK+SFR+FLFA + W+GID D+E
Sbjct  180  HVTRTRFEEMDWDRNGKVSFREFLFALISWIGIDNDEE  217



>ref|XP_010241365.1| PREDICTED: probable calcium-binding protein CML22 [Nelumbo nucifera]
Length=247

 Score =   285 bits (729),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 140/245 (57%), Positives = 193/245 (79%), Gaps = 4/245 (2%)
 Frame = -3

Query  877  MKGSVGLSRPCLSLK-LVSDKVGSLLCCHGSPNKYSRLDSKLETKVLEVKRNAPAT--LS  707
            MK S G    C +LK   ++KVG LL    S NKY +LD+KLE K++EV ++  ++   +
Sbjct  1    MKESPGKFHLCPTLKSFFTEKVGGLLSHCNSSNKYKKLDAKLEGKMIEVIKHKGSSEKKT  60

Query  706  IRSINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDEL  527
             +S+N++I++FP F+E ++ I+ VFEQ+DEDSNG+IDR+EL+KCL KLQ  + E+E+++L
Sbjct  61   FKSMNSIIMRFPQFKEEMRLIKDVFEQYDEDSNGSIDRDELRKCLGKLQVQLTEKEMEDL  120

Query  526  FRSCDVDDNEKIKFNEFIVLLCLIYLLMDAPSSGST-SKIGSPVVESTFNTIVEAFLFLD  350
            F+SCD+D NE I+FNEFIVLLCL+YLLM+  SS +T S++GSP +E+ F+TI++AFLFLD
Sbjct  121  FQSCDIDKNEGIQFNEFIVLLCLVYLLMEPSSSSNTKSQMGSPQLEAVFDTIIQAFLFLD  180

Query  349  KNGDGKLHKKDVVKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGI  170
            KNGDGKL+KKD+ KAFN+A   EK P H+T++RFKEMDW+RSGK+SF+ FLFA   WVGI
Sbjct  181  KNGDGKLNKKDLAKAFNEAPTQEKLPRHITKSRFKEMDWNRSGKVSFKDFLFALTKWVGI  240

Query  169  DGDDE  155
            D DDE
Sbjct  241  DTDDE  245



>ref|XP_002518103.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF44236.1| conserved hypothetical protein [Ricinus communis]
Length=240

 Score =   283 bits (725),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 136/234 (58%), Positives = 180/234 (77%), Gaps = 18/234 (8%)
 Frame = -3

Query  856  SRPCLSLKLVSDKVGSLLCCHGSPNKYSRLDSKLETKVLEVKRNAPATLSIRSINALILK  677
            + P   LK  S K+  + C  GS NKY RLD+KLE K++E KR++    + +SI+++IL+
Sbjct  12   TSPFGLLKSYSSKIAGMFCHCGSQNKYKRLDAKLEKKMIEFKRSSSGPTNFKSIDSIILR  71

Query  676  FPHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNE  497
            FP F+EGLK IR VFEQ+DED+NGAIDREELK+CLQKLQ ++ E+E+++LF SCD+D ++
Sbjct  72   FPRFKEGLKNIRGVFEQYDEDANGAIDREELKRCLQKLQINLKEQEVEDLFHSCDIDGSQ  131

Query  496  KIKFNEFIVLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKD  317
             I+FNEFIVLLCLIYLL                  +TF+TIVEAFLFLDKNG GKL KKD
Sbjct  132  GIQFNEFIVLLCLIYLL------------------ATFDTIVEAFLFLDKNGVGKLKKKD  173

Query  316  VVKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDE  155
            V+KA N+A P EKSP+H+T++RF+E+DWDR+GK+SFR+FLFA ++WVGID D+E
Sbjct  174  VLKALNEASPWEKSPAHITKSRFQELDWDRNGKVSFREFLFALVNWVGIDADEE  227



>gb|EYU32662.1| hypothetical protein MIMGU_mgv1a012635mg [Erythranthe guttata]
Length=244

 Score =   282 bits (722),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 146/246 (59%), Positives = 194/246 (79%), Gaps = 8/246 (3%)
 Frame = -3

Query  877  MKGSVGLSRPCLSLKLVSDKVGSLLCCHGS-PNKYSRLDSKLETKVLEVKRNAPAT-LSI  704
            MK S G S     LK + DK   ++CCH   PN Y RLD+KLE K++E+K++  A  ++ 
Sbjct  1    MKDSQGTS----VLKSLYDKAQDIICCHVLLPNTYKRLDTKLERKMMEIKKSTSAHHINF  56

Query  703  RSINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELF  524
            +SI+++I+KFP FR+GLKEIR VFE++DEDSNG ID +ELKKCL  L+F V ++EID+LF
Sbjct  57   KSIDSIIMKFPQFRDGLKEIRQVFEKYDEDSNGTIDNDELKKCLHALEFSVKDDEIDDLF  116

Query  523  RSCDVDDNEKIKFNEFIVLLCLIYLLMDAPSSGSTS--KIGSPVVESTFNTIVEAFLFLD  350
              CD+D+NE I+F EFIVLLCL YLL D+ +S S +  K+ SP +E+TFNTIVE FLFLD
Sbjct  117  LYCDMDENEGIQFKEFIVLLCLNYLLTDSSTSSSHATLKMCSPKIEATFNTIVEVFLFLD  176

Query  349  KNGDGKLHKKDVVKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGI  170
            K GDGKL++KDVVKA N+A P EKSPSH+TRTRFKEMDWD++GK+SF++FLF+F+ WVG+
Sbjct  177  KTGDGKLNRKDVVKALNEASPKEKSPSHITRTRFKEMDWDKNGKVSFKEFLFSFISWVGV  236

Query  169  DGDDED  152
            D D+++
Sbjct  237  DCDEDE  242



>ref|XP_010107777.1| putative calcium-binding protein CML22 [Morus notabilis]
 gb|EXC16942.1| putative calcium-binding protein CML22 [Morus notabilis]
Length=233

 Score =   282 bits (721),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 142/241 (59%), Positives = 184/241 (76%), Gaps = 17/241 (7%)
 Frame = -3

Query  877  MKGSVGLSRPCLSLKLVSDKVGSLLCCHGSPNKYSRLDSKLETKVLEVKRNAPATLSIRS  698
            MK S G S  C SLK +S+KVG + C  GSPNKY RLD+KLE K++EVKR +    + +S
Sbjct  1    MKTSSGTSHLCPSLKSLSNKVGGMFCHCGSPNKYKRLDTKLEKKLVEVKRGSQGVGNFKS  60

Query  697  INALILKFPHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRS  518
            IN++I+KFP FRE LK IR+VFEQ+DEDSNGAIDR ELK  LQ+LQ  + EEE+D+LF S
Sbjct  61   INSIIMKFPQFREELKRIRSVFEQYDEDSNGAIDRVELKNSLQQLQLQLSEEEVDDLFHS  120

Query  517  CDVDDNEKIKFNEFIVLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGD  338
            CD+D +E I+FNEFI+                 SK+GSP +E+TF+TI+E FLFLDKNGD
Sbjct  121  CDIDGSEGIQFNEFIM-----------------SKMGSPQLEATFDTIIEVFLFLDKNGD  163

Query  337  GKLHKKDVVKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDD  158
            GKL+KKD+V+A ND+   E+SP+H+TR+RF+EMDWDR+G +SFR+FLFAF+ WVGI+ D+
Sbjct  164  GKLNKKDMVRALNDSNTSERSPAHITRSRFREMDWDRNGHVSFREFLFAFIHWVGIETDE  223

Query  157  E  155
            E
Sbjct  224  E  224



>ref|XP_007034374.1| Calcium-binding EF-hand family protein isoform 3 [Theobroma cacao]
 gb|EOY05300.1| Calcium-binding EF-hand family protein isoform 3 [Theobroma cacao]
Length=217

 Score =   280 bits (716),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 134/209 (64%), Positives = 173/209 (83%), Gaps = 1/209 (0%)
 Frame = -3

Query  865  VGLSRPCLSLKLVSDKVGSLLCCHGSPNKYSRLDSKLETKVLEVKRNAPATLSIRSINAL  686
            +G  RPC SLK +S  +G +LC  GSPNKY +LDSKLE K++E+KR+A    + +SI+++
Sbjct  1    MGKCRPCPSLKSLSSTIGGMLCHCGSPNKYKKLDSKLERKMIEMKRSASGQSNFKSIDSI  60

Query  685  ILKFPHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVD  506
            I++FP FR+GLK +R VFEQ+DEDSNG IDREEL KCL+KLQFH+ +EE+++LF SCD+D
Sbjct  61   IVRFPQFRDGLKNLRGVFEQYDEDSNGTIDREELNKCLEKLQFHLTKEEVEDLFHSCDID  120

Query  505  DNEKIKFNEFIVLLCLIYLLMD-APSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKL  329
             +E I+FNEFIVLLCLIYLLM  +PS  +T KI SP +E+TF+TIVEAFLFLDKNGDGKL
Sbjct  121  GSEGIQFNEFIVLLCLIYLLMKPSPSPDTTLKIDSPQLEATFDTIVEAFLFLDKNGDGKL  180

Query  328  HKKDVVKAFNDAFPLEKSPSHVTRTRFKE  242
            +KKD++KA N+A P E+SP+HVTRTRF E
Sbjct  181  NKKDMIKALNEASPWERSPAHVTRTRFME  209



>ref|XP_007034373.1| Calcium-binding EF-hand family protein isoform 2 [Theobroma cacao]
 gb|EOY05299.1| Calcium-binding EF-hand family protein isoform 2 [Theobroma cacao]
Length=220

 Score =   276 bits (706),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 134/212 (63%), Positives = 174/212 (82%), Gaps = 4/212 (2%)
 Frame = -3

Query  865  VGLSRPCLSLKLVSDKVGSLLCCHGSPNKYSRLDSKLETKVLEVKRNAPATLSIRSINAL  686
            +G  RPC SLK +S  +G +LC  GSPNKY +LDSKLE K++E+KR+A    + +SI+++
Sbjct  1    MGKCRPCPSLKSLSSTIGGMLCHCGSPNKYKKLDSKLERKMIEMKRSASGQSNFKSIDSI  60

Query  685  ILKFPHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVD  506
            I++FP FR+GLK +R VFEQ+DEDSNG IDREEL KCL+KLQFH+ +EE+++LF SCD+D
Sbjct  61   IVRFPQFRDGLKNLRGVFEQYDEDSNGTIDREELNKCLEKLQFHLTKEEVEDLFHSCDID  120

Query  505  DNEKIKFNEFIVLLCLIYLLMD---APSSGSTS-KIGSPVVESTFNTIVEAFLFLDKNGD  338
             +E I+FNEFIVLLCLIYLLM    +P + ST+ KI SP +E+TF+TIVEAFLFLDKNGD
Sbjct  121  GSEGIQFNEFIVLLCLIYLLMKPSPSPDTVSTTLKIDSPQLEATFDTIVEAFLFLDKNGD  180

Query  337  GKLHKKDVVKAFNDAFPLEKSPSHVTRTRFKE  242
            GKL+KKD++KA N+A P E+SP+HVTRTRF E
Sbjct  181  GKLNKKDMIKALNEASPWERSPAHVTRTRFME  212



>ref|XP_010023705.1| PREDICTED: probable calcium-binding protein CML22 [Eucalyptus 
grandis]
Length=260

 Score =   272 bits (695),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 137/240 (57%), Positives = 187/240 (78%), Gaps = 1/240 (0%)
 Frame = -3

Query  877  MKGSVGLSRPCLSLKLVSDKVGSLLCCHGSPNKYSRLDSKLETKVLEVKRNAPATLS-IR  701
            MK  +G S PC S K +S+KVG++LC   S  +Y RLD+KLE KVLEVK  + +  +  +
Sbjct  1    MKDQIGTSCPCPSFKSLSNKVGNILCHRPSQIRYKRLDTKLEKKVLEVKNTSSSRHNEFQ  60

Query  700  SINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFR  521
             I+++I+KFP F+EGLK I  V+ Q+DE+SNG ID+EELKKCL ++Q H+ E+++++LF 
Sbjct  61   RIDSIIMKFPQFKEGLKNIEAVYHQYDENSNGKIDKEELKKCLDEVQLHLSEKDMEDLFH  120

Query  520  SCDVDDNEKIKFNEFIVLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNG  341
            SCD+D+N++I+F EFIVLLCLIYLL ++ S+  T K+GSP +++TF+TI+EAFLFLDK+G
Sbjct  121  SCDIDENQEIRFTEFIVLLCLIYLLKESSSTNETEKVGSPSIQATFDTIIEAFLFLDKDG  180

Query  340  DGKLHKKDVVKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGD  161
            DGKL KK V+KA ND  P EKSP HVT  RFKEMDW R G +SFR+FLF F+DWVG++ +
Sbjct  181  DGKLKKKHVIKALNDTSPREKSPRHVTGKRFKEMDWRRKGNVSFREFLFTFIDWVGVETN  240



>emb|CDO99460.1| unnamed protein product [Coffea canephora]
Length=204

 Score =   265 bits (678),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 123/198 (62%), Positives = 161/198 (81%), Gaps = 1/198 (1%)
 Frame = -3

Query  745  VLEVKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQK  566
            ++E+K++A    + RSIN++I+KFP F+EGLKEIR +F+Q+DED+N  I+REELKKC Q+
Sbjct  1    MIEIKKSASGQSNFRSINSIIMKFPQFKEGLKEIRDIFQQYDEDNNATIEREELKKCSQE  60

Query  565  LQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMD-APSSGSTSKIGSPVVES  389
            LQ  + EEEID+LF  CD+++NE I+ NEFIVLLCLIY L D +  S + S I SP +++
Sbjct  61   LQLTIREEEIDDLFYYCDINENEGIQLNEFIVLLCLIYFLTDYSIPSHTASDILSPQLQA  120

Query  388  TFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISF  209
            TFN I+EAFLFLDK G GKL++KDVV+A N+A  LE+SPSHVT TRFKEMDW+R GK+ F
Sbjct  121  TFNIIIEAFLFLDKKGKGKLNRKDVVQALNEASSLERSPSHVTHTRFKEMDWNRKGKVGF  180

Query  208  RKFLFAFLDWVGIDGDDE  155
            R+FLFAF+DWVG+D DDE
Sbjct  181  REFLFAFIDWVGMDSDDE  198



>gb|KCW60054.1| hypothetical protein EUGRSUZ_H02783, partial [Eucalyptus grandis]
Length=236

 Score =   265 bits (677),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 134/233 (58%), Positives = 183/233 (79%), Gaps = 1/233 (0%)
 Frame = -3

Query  856  SRPCLSLKLVSDKVGSLLCCHGSPNKYSRLDSKLETKVLEVKRNAPATLS-IRSINALIL  680
            S PC S K +S+KVG++LC   S  +Y RLD+KLE KVLEVK  + +  +  + I+++I+
Sbjct  2    SCPCPSFKSLSNKVGNILCHRPSQIRYKRLDTKLEKKVLEVKNTSSSRHNEFQRIDSIIM  61

Query  679  KFPHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDN  500
            KFP F+EGLK I  V+ Q+DE+SNG ID+EELKKCL ++Q H+ E+++++LF SCD+D+N
Sbjct  62   KFPQFKEGLKNIEAVYHQYDENSNGKIDKEELKKCLDEVQLHLSEKDMEDLFHSCDIDEN  121

Query  499  EKIKFNEFIVLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKK  320
            ++I+F EFIVLLCLIYLL ++ S+  T K+GSP +++TF+TI+EAFLFLDK+GDGKL KK
Sbjct  122  QEIRFTEFIVLLCLIYLLKESSSTNETEKVGSPSIQATFDTIIEAFLFLDKDGDGKLKKK  181

Query  319  DVVKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGD  161
             V+KA ND  P EKSP HVT  RFKEMDW R G +SFR+FLF F+DWVG++ +
Sbjct  182  HVIKALNDTSPREKSPRHVTGKRFKEMDWRRKGNVSFREFLFTFIDWVGVETN  234



>ref|XP_010532790.1| PREDICTED: probable calcium-binding protein CML22 isoform X2 
[Tarenaya hassleriana]
Length=228

 Score =   257 bits (656),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 119/215 (55%), Positives = 165/215 (77%), Gaps = 2/215 (1%)
 Frame = -3

Query  808  LLCCHGSPNKYSRLDSKLETKVLEVKRNAPATLSIRSINALILKFPHFREGLKEIRTVFE  629
            + CC  S NKY+ LD+KLE +++E +RN PA  S RS++++I+KFP  REGL+ IR VFE
Sbjct  1    MFCCCVSKNKYAELDAKLERRMVECRRNFPAHRSFRSLDSVIMKFPRLREGLRNIRGVFE  60

Query  628  QFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYL  449
             +D+D NG ID EELK CL++L  ++ EEE+++L+  CDVD ++ I+FNEFIVLLCLIYL
Sbjct  61   SYDKDGNGTIDLEELKNCLEELNLNMSEEEVEDLYGWCDVDGSKGIQFNEFIVLLCLIYL  120

Query  448  LMD--APSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPLEKS  275
            L +  +PS+ ++ +IG   + +TF+ I+E FLFLDKNGDG L+K DV   +N A+P EKS
Sbjct  121  LAEPSSPSNTTSPEIGERGLGATFDPIIEIFLFLDKNGDGMLNKLDVRTTWNGAYPREKS  180

Query  274  PSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGI  170
            PSHVT+ RF+EMDW R GK+ FR+F+FAF+ WVG+
Sbjct  181  PSHVTKMRFEEMDWGRKGKVGFREFMFAFISWVGL  215



>ref|XP_010532789.1| PREDICTED: probable calcium-binding protein CML22 isoform X1 
[Tarenaya hassleriana]
Length=267

 Score =   256 bits (654),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 119/215 (55%), Positives = 165/215 (77%), Gaps = 2/215 (1%)
 Frame = -3

Query  808  LLCCHGSPNKYSRLDSKLETKVLEVKRNAPATLSIRSINALILKFPHFREGLKEIRTVFE  629
            + CC  S NKY+ LD+KLE +++E +RN PA  S RS++++I+KFP  REGL+ IR VFE
Sbjct  40   MFCCCVSKNKYAELDAKLERRMVECRRNFPAHRSFRSLDSVIMKFPRLREGLRNIRGVFE  99

Query  628  QFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYL  449
             +D+D NG ID EELK CL++L  ++ EEE+++L+  CDVD ++ I+FNEFIVLLCLIYL
Sbjct  100  SYDKDGNGTIDLEELKNCLEELNLNMSEEEVEDLYGWCDVDGSKGIQFNEFIVLLCLIYL  159

Query  448  LMD--APSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPLEKS  275
            L +  +PS+ ++ +IG   + +TF+ I+E FLFLDKNGDG L+K DV   +N A+P EKS
Sbjct  160  LAEPSSPSNTTSPEIGERGLGATFDPIIEIFLFLDKNGDGMLNKLDVRTTWNGAYPREKS  219

Query  274  PSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGI  170
            PSHVT+ RF+EMDW R GK+ FR+F+FAF+ WVG+
Sbjct  220  PSHVTKMRFEEMDWGRKGKVGFREFMFAFISWVGL  254



>gb|KFK39709.1| hypothetical protein AALP_AA3G278300 [Arabis alpina]
Length=228

 Score =   253 bits (646),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 124/225 (55%), Positives = 166/225 (74%), Gaps = 6/225 (3%)
 Frame = -3

Query  802  CCHGSPN--KYSRLDSKLETKVLEVKRNAPATLSIRSINALILKFPHFREGLKEIRTVFE  629
            CC  S N  KY+ LDSKLE K++E +RN P   S++S++++I+KFP  REGL+ IR VFE
Sbjct  4    CCVSSENNKKYAELDSKLERKMVESRRNYPGHRSLKSMDSIIMKFPTLREGLRNIRNVFE  63

Query  628  QFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYL  449
             +D+D NG ID EELKKCL++L+  + EEE+  L+  CDVD ++ I+FNEF+VLLCLIYL
Sbjct  64   SYDKDRNGTIDMEELKKCLEELKLSLSEEEVKGLYGWCDVDGSKGIQFNEFVVLLCLIYL  123

Query  448  LM--DAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDA-FPLEK  278
            L      SS  + ++G  +VES F+ I E FLFLDK+G GKL+K DV+K  N+  +P E+
Sbjct  124  LAKPSPKSSAESREMGPKLVESIFDPIAEVFLFLDKDGKGKLNKADVIKTLNNEDYPFER  183

Query  277  SPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDEDHMA  143
            SPSHVT  RF+EMDW R GK+ FR+FLFAF+ WVG+D D ED+M+
Sbjct  184  SPSHVTNMRFEEMDWGRKGKVGFREFLFAFMSWVGLD-DAEDYMS  227



>ref|XP_010513185.1| PREDICTED: probable calcium-binding protein CML22 [Camelina sativa]
Length=229

 Score =   249 bits (637),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 125/227 (55%), Positives = 167/227 (74%), Gaps = 7/227 (3%)
 Frame = -3

Query  808  LLCCHGSPN--KYSRLDSKLETKVLEVKRNAPATLSIRSINALILKFPHFREGLKEIRTV  635
            + CC  S N  KY+ LD+KL  K++E +R  P   S++S++++I+KFP  REGL+ IR V
Sbjct  2    ICCCVKSENNKKYAELDAKLARKMVESRRIYPGHKSLKSMDSIIMKFPKLREGLRNIRNV  61

Query  634  FEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLI  455
            FE +D DSNG ID EELKKCL++LQ  + +EE+  L+  CDVD ++ I+FNEFIVLLCLI
Sbjct  62   FESYDNDSNGTIDIEELKKCLEELQLSLSDEEVKGLYGWCDVDGSKGIQFNEFIVLLCLI  121

Query  454  YLLMDAPSSGSTS---KIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDA-FP  287
            YLL   PSS S +   ++G  +VES F+ IVE FLFLDK+G GKL+K DV+K  N+  +P
Sbjct  122  YLL-SKPSSESNAESREMGPKLVESIFDPIVEVFLFLDKDGKGKLNKADVIKTLNNEDYP  180

Query  286  LEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDEDHM  146
            LE+SPSHVT  RF+EMDW R GK+ FR+FLFAF+ WVG+D  D+ +M
Sbjct  181  LERSPSHVTNMRFEEMDWGRKGKVGFREFLFAFMSWVGLDDADDYYM  227



>ref|XP_010909319.1| PREDICTED: probable calcium-binding protein CML22 [Elaeis guineensis]
Length=249

 Score =   250 bits (638),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 135/248 (54%), Positives = 179/248 (72%), Gaps = 4/248 (2%)
 Frame = -3

Query  877  MKGSVGLSRPCLSL-KLVSDKVGSLLCCHGSPNKYSRLDSKLETKVLEV--KRNAPATLS  707
            MK + G   PC +L      K+G  L     PNKY R + KLE KV E   +R A    S
Sbjct  1    MKATSGSFHPCPALTSFFFHKLGGALIKCEFPNKYRRQNQKLEKKVTEAIKQRAASRKRS  60

Query  706  IRSINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDEL  527
             RS+N++I++FPHF++GL  I+ VFEQ+DEDSNG ID EELKKCL  LQ H+ EEEI+ L
Sbjct  61   FRSMNSIIMRFPHFKDGLGNIKDVFEQYDEDSNGTIDLEELKKCLSTLQVHLTEEEINGL  120

Query  526  FRSCDVDDNEKIKFNEFIVLLCLIYLLMD-APSSGSTSKIGSPVVESTFNTIVEAFLFLD  350
            +  CDVD NE I+ NEFI+LLCLIYLLM+ A ++   S+IGSP VE+TF+ IV+AFLFLD
Sbjct  121  YHYCDVDGNEGIQVNEFIILLCLIYLLMEPASATDRMSRIGSPQVEATFDAIVDAFLFLD  180

Query  349  KNGDGKLHKKDVVKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGI  170
            KNGDGK+ +KD++ AFN+    EKSP H+T  RFKEMDW++ GK++F++FLF+F  W+G+
Sbjct  181  KNGDGKIKRKDMMLAFNETTTKEKSPKHITLRRFKEMDWNKKGKVNFKEFLFSFTKWIGM  240

Query  169  DGDDEDHM  146
            D DD++ +
Sbjct  241  DADDQESL  248



>ref|XP_010691270.1| PREDICTED: probable calcium-binding protein CML22 isoform X1 
[Beta vulgaris subsp. vulgaris]
 ref|XP_010691272.1| PREDICTED: probable calcium-binding protein CML22 isoform X1 
[Beta vulgaris subsp. vulgaris]
Length=264

 Score =   250 bits (639),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 125/246 (51%), Positives = 173/246 (70%), Gaps = 10/246 (4%)
 Frame = -3

Query  865  VGLSRPCLSLKLVSDKVGSLL----CCHGSPNKYSRLDSKLETKVLEVKRNAPAT----L  710
             G SR C +LK +  KVGS+L    C   + NKY RLD+KLE K++E+KR A  +     
Sbjct  10   TGRSRSCPALKSICYKVGSMLWGCNCASSTTNKYRRLDAKLERKMIELKRQASTSGHTNK  69

Query  709  SIRSINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDE  530
              RSIN++I+KFP  +E +K++R VFE +DED +G+IDREELK+C ++LQ ++  EE D+
Sbjct  70   KFRSINSVIMKFPQLKEQVKKLRGVFEHYDEDGDGSIDREELKQCFKELQVNLTVEEFDD  129

Query  529  LFRSCDVDDNEKIKFNEFIVLLCLIYLLMDAPS-SGSTSKIGSPVVESTFNTIVEAFLFL  353
            LF SCDVD N +I+F EFIVLLCLIYL+    S + + S+  SP  E+TF+ IV+ F+++
Sbjct  130  LFESCDVDRNGRIQFREFIVLLCLIYLITKPSSPTDAVSRTESPNWEATFDIIVQVFIYM  189

Query  352  DKNGDGKLHKKDVVKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVG  173
            DKNGDGKL KKD+V A  +  P E+SPSHV +TRF EMD D+ G ++FR++LF    W+G
Sbjct  190  DKNGDGKLSKKDMVAALTEP-PWERSPSHVMKTRFMEMDKDKDGNVTFREYLFGLTSWLG  248

Query  172  IDGDDE  155
            ID D +
Sbjct  249  IDSDSD  254



>ref|XP_010466782.1| PREDICTED: probable calcium-binding protein CML22 [Camelina sativa]
 ref|XP_010466783.1| PREDICTED: probable calcium-binding protein CML22 [Camelina sativa]
Length=229

 Score =   246 bits (627),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 123/228 (54%), Positives = 165/228 (72%), Gaps = 7/228 (3%)
 Frame = -3

Query  808  LLCCHGSPN--KYSRLDSKLETKVLEVKRNAPATLSIRSINALILKFPHFREGLKEIRTV  635
            + CC  S N  KY+ LD+KL  K++E +R  P   S++S++++I+KFP  REGL+ IR V
Sbjct  2    ICCCLNSENNKKYAELDAKLARKMVESRRIYPGHKSLKSMDSIIMKFPKLREGLRNIRNV  61

Query  634  FEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLI  455
            FE +D D NG ID EELKKCL++LQ  + +EE+  L+  CDVD ++ I+FNEFIVLLCLI
Sbjct  62   FESYDNDKNGTIDIEELKKCLEELQLSLSDEEVKGLYGWCDVDGSKGIQFNEFIVLLCLI  121

Query  454  YLLMDAPSSGSTS---KIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDA-FP  287
            YLL   PSS S +   ++G  +VES F+ IVE FLFLDK+G GKL+K DV    N+  +P
Sbjct  122  YLL-SKPSSESNAESREMGPKLVESIFDPIVEVFLFLDKDGKGKLNKADVTTTLNNEDYP  180

Query  286  LEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDEDHMA  143
            LE+SPSHVT  RF+EMDW R GK+ FR+FLFAF+ WVG+D  D+ +M+
Sbjct  181  LERSPSHVTNMRFEEMDWGRKGKVGFREFLFAFMSWVGLDVADDYYMS  228



>ref|XP_006418801.1| hypothetical protein EUTSA_v10002654mg [Eutrema salsugineum]
 gb|ESQ37237.1| hypothetical protein EUTSA_v10002654mg [Eutrema salsugineum]
Length=226

 Score =   245 bits (626),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 124/223 (56%), Positives = 165/223 (74%), Gaps = 5/223 (2%)
 Frame = -3

Query  808  LLCCHGSPN--KYSRLDSKLETKVLEVKRNAPATLSIRSINALILKFPHFREGLKEIRTV  635
            L CC  S N  KY+ LDSKLE K++E +RN P    ++S++++I+KFP  REGL+ IR+V
Sbjct  2    LCCCVKSENNKKYAELDSKLERKMVESRRNYPGHRRLKSMDSIIMKFPKLREGLRNIRSV  61

Query  634  FEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLI  455
            FE +D+D NG ID EELKKCL++L+  + EEE+  L+  CDVD ++ I+FNEFIVLLCLI
Sbjct  62   FESYDKDGNGTIDMEELKKCLEELKLSLSEEEVKGLYGWCDVDGSKGIEFNEFIVLLCLI  121

Query  454  YLLMDA--PSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDA-FPL  284
            YLL      SS  + ++G  +VES F+ IVE FLFLDK+G GKL+K DV+K  N+  +PL
Sbjct  122  YLLAKPSSESSLESREMGPKLVESVFDPIVEVFLFLDKDGKGKLNKADVIKTLNNEDYPL  181

Query  283  EKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDE  155
            E+SPSHVT  RF+EMDW R GK+ FR+FLFAF+ WVG+D  D+
Sbjct  182  ERSPSHVTNMRFEEMDWGRKGKVGFREFLFAFIGWVGLDDADD  224



>ref|NP_189053.1| putative calcium-binding protein CML22 [Arabidopsis thaliana]
 sp|Q9LRN6.1|CML22_ARATH RecName: Full=Probable calcium-binding protein CML22; AltName: 
Full=Calmodulin-like protein 22 [Arabidopsis thaliana]
 dbj|BAB01352.1| unnamed protein product [Arabidopsis thaliana]
 gb|AEE76858.1| putative calcium-binding protein CML22 [Arabidopsis thaliana]
Length=229

 Score =   243 bits (620),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 122/227 (54%), Positives = 166/227 (73%), Gaps = 5/227 (2%)
 Frame = -3

Query  808  LLCCHGSPN--KYSRLDSKLETKVLEVKRNAPATLSIRSINALILKFPHFREGLKEIRTV  635
            L CC  S N  KY+ LD+KL  K++E +   P   S++S++++I+KFP  REGL+ IR+V
Sbjct  2    LCCCVNSENNKKYAELDAKLARKMVESRSIYPGHRSLKSMDSIIMKFPKLREGLRNIRSV  61

Query  634  FEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLI  455
            FE +D D+NG ID EELKKCL++L+  + +EE+  L+  CDVD ++ I+FNEFIVLLCLI
Sbjct  62   FESYDNDTNGTIDIEELKKCLEELKLSLSDEEVKGLYSWCDVDGSKGIQFNEFIVLLCLI  121

Query  454  YLLMDA--PSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDA-FPL  284
            YLL      SS  + ++G  +VES F+ IVE FLFLDK+G GKL+K DV+K  N+  +PL
Sbjct  122  YLLAKPSSESSTESREMGPKLVESIFDPIVEVFLFLDKDGKGKLNKADVIKTLNNEDYPL  181

Query  283  EKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDEDHMA  143
            E+SPSHVT  RF+EMDW R GK+ FR+FLFAF+ WVG+D  D+D M+
Sbjct  182  ERSPSHVTNMRFEEMDWGRKGKVGFREFLFAFMSWVGLDDADDDFMS  228



>ref|XP_010488497.1| PREDICTED: probable calcium-binding protein CML22 [Camelina sativa]
 ref|XP_010488498.1| PREDICTED: probable calcium-binding protein CML22 [Camelina sativa]
Length=240

 Score =   242 bits (617),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 123/229 (54%), Positives = 167/229 (73%), Gaps = 8/229 (3%)
 Frame = -3

Query  808  LLCCHGSPN--KYSRLDSKLETKVLEVKRNAPATLSIRSINALILKFPHFREGLKEIRTV  635
            + CC  S N  KY+ LD+KL  K++E +R  P   S++S++++I+KFP  REGL+ IR+V
Sbjct  2    ICCCVKSENNKKYAELDAKLARKMVESRRIYPGHKSLKSMDSIIMKFPKLREGLRNIRSV  61

Query  634  FEQFDEDSNGAIDREELKKCLQKLQF-HVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCL  458
            FE +D D NG ID EELKKCL++LQ   + +EE+  L+  CDVD ++ I+FNEFIVLLCL
Sbjct  62   FESYDNDKNGTIDIEELKKCLEELQLISLSDEEVKGLYGWCDVDGSKGIQFNEFIVLLCL  121

Query  457  IYLLMDAPSSGSTS---KIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDA-F  290
            IYLL   PSS S +   ++G  +VES F+ IVE FLFLDK+G GKL+K DV+K  N+  +
Sbjct  122  IYLL-SKPSSESNAESREMGPKLVESIFDPIVEVFLFLDKDGKGKLNKADVIKTLNNEDY  180

Query  289  PLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDEDHMA  143
            PLE+SPSHVT  RF+EMDW R GK+ FR+FLFAF+ WVG+D  D+ ++ 
Sbjct  181  PLERSPSHVTNMRFEEMDWGRKGKVGFREFLFAFMSWVGLDDADDYYIV  229



>ref|XP_009106153.1| PREDICTED: probable calcium-binding protein CML22 [Brassica rapa]
Length=233

 Score =   241 bits (615),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 126/231 (55%), Positives = 169/231 (73%), Gaps = 9/231 (4%)
 Frame = -3

Query  811  SLLCC---HGSPNKYSRLDSKLETKVLEVKRNAPATLSIRSINALILKFPHFREGLKEIR  641
            S+LCC    GS  KY+ LD+KL  K++E +R  P   S++SI+++I+KFP  REGL++IR
Sbjct  3    SMLCCCVSSGSNKKYAELDAKLARKMVESRRYYPGHRSLKSIDSVIMKFPKLREGLRKIR  62

Query  640  TVFEQFDEDSNGAIDREELKKCLQKLQF-HVGEEEIDELFRSCDVDDNEKIKFNEFIVLL  464
            TVFE +D D NG ID EELKKCL +L+   + EEE+  L+  CDVD ++ I+FNEFIVLL
Sbjct  63   TVFESYDSDGNGTIDMEELKKCLVELELMSLSEEEVKGLYGWCDVDGSKGIQFNEFIVLL  122

Query  463  CLIYLLMD---APSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDA  293
            CLIYLL       SS  +S++G  +VES F+ IVE FLFLDK+G GKL+K DV+K  N+ 
Sbjct  123  CLIYLLAKPSSPSSSEESSEMGPKLVESIFDPIVEVFLFLDKDGKGKLNKADVIKRLNNE  182

Query  292  -FPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDEDHMA  143
             +PLE+SP HVT  RF+EMDW R GK+ FR+FLFAF+ WVG+D D +D+++
Sbjct  183  DYPLERSPKHVTNMRFEEMDWGRKGKVGFREFLFAFMSWVGLD-DADDYIS  232



>emb|CDY18071.1| BnaA01g23320D [Brassica napus]
Length=229

 Score =   239 bits (611),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 126/229 (55%), Positives = 170/229 (74%), Gaps = 8/229 (3%)
 Frame = -3

Query  808  LLCC---HGSPNKYSRLDSKLETKVLEVKRNAPATLSIRSINALILKFPHFREGLKEIRT  638
            +LCC    GS  KY+ LD+KL  K++E +R  P   S++SI+++I+KFP  REGL++IRT
Sbjct  1    MLCCCVSSGSNKKYAELDAKLARKMVESRRYYPGHRSLKSIDSVIMKFPKLREGLRKIRT  60

Query  637  VFEQFDEDSNGAIDREELKKCLQKLQF-HVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  461
            VFE +D D NG ID EELKKCL +L+   + EEE+  L+  CDVD ++ I+FNEFIVLLC
Sbjct  61   VFESYDSDGNGTIDMEELKKCLVELELMSLSEEEVKGLYGWCDVDGSKGIQFNEFIVLLC  120

Query  460  LIYLLMD--APSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDA-F  290
            LIYLL    +PSS  +S++G  +VES F+ IVE FLFLDK+G GKL+K DV+K  N+  +
Sbjct  121  LIYLLAKPSSPSSSESSEMGPKLVESIFDPIVEVFLFLDKDGKGKLNKADVIKRLNNEDY  180

Query  289  PLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDEDHMA  143
            PLE+SP HVT  RF+EMDW R GK+ FR+FLFAF+ WVG+D D +D+++
Sbjct  181  PLERSPKHVTNMRFEEMDWGRKGKVGFREFLFAFMSWVGLD-DADDYIS  228



>emb|CDY46335.1| BnaC01g30350D [Brassica napus]
 emb|CDY18072.1| BnaA01g23330D [Brassica napus]
Length=230

 Score =   239 bits (610),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 125/230 (54%), Positives = 168/230 (73%), Gaps = 9/230 (4%)
 Frame = -3

Query  808  LLCC---HGSPNKYSRLDSKLETKVLEVKRNAPATLSIRSINALILKFPHFREGLKEIRT  638
            +LCC    GS  KY+ LD+KL  K++E +R  P   S++SI+++I+KFP  REGL++IRT
Sbjct  1    MLCCCVSSGSNKKYAELDAKLARKMVESRRYYPGHRSLKSIDSVIMKFPKLREGLRKIRT  60

Query  637  VFEQFDEDSNGAIDREELKKCLQKLQF-HVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  461
            VFE +D D NG ID EELKKCL +L+   + EEE+  L+  CDVD ++ I+FNEFIVLLC
Sbjct  61   VFESYDSDGNGTIDMEELKKCLVELELMSLSEEEVKGLYGWCDVDGSKGIQFNEFIVLLC  120

Query  460  LIYLLMD---APSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDA-  293
            LIYLL       SS  +S++G  +VES F+ IVE FLFLDK+G GKL+K DV+K  N+  
Sbjct  121  LIYLLAKPSSPSSSEESSEMGPKLVESIFDPIVEVFLFLDKDGKGKLNKADVIKRLNNED  180

Query  292  FPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDEDHMA  143
            +PLE+SP HVT  RF+EMDW R GK+ FR+FLFAF+ WVG+D D +D+++
Sbjct  181  YPLERSPKHVTNMRFEEMDWGRKGKVGFREFLFAFMSWVGLD-DADDYIS  229



>emb|CDX85172.1| BnaC07g07340D [Brassica napus]
Length=526

 Score =   246 bits (627),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 124/232 (53%), Positives = 167/232 (72%), Gaps = 10/232 (4%)
 Frame = -3

Query  826  SDKVGSLLCC---HGSPNKYSRLDSKLETKVLEVKRNAPATLSIRSINALILKFPHFREG  656
            S  +GS+LCC     S  KY+ LD+KLE K++E +R  P   S++S++++I+ FP  REG
Sbjct  291  SSTIGSMLCCCVNSESNKKYAELDAKLERKMVERRRYYPGHRSLKSMDSIIMMFPKLREG  350

Query  655  LKEIRTVFEQFDEDSNGAIDREELKKCLQKLQF-HVGEEEIDELFRSCDVDDNEKIKFNE  479
            L+ IR VFE +D+D NG ID EELKKCL++L+   + EEE+  L+  CDVD ++ I+FNE
Sbjct  351  LRNIRNVFESYDQDRNGTIDMEELKKCLEELKLMSLSEEEVKGLYGWCDVDGSKGIQFNE  410

Query  478  FIVLLCLIYLLMDAPSSGS----TSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVV  311
            FIVLLCLIYLL   PS+ S    + ++G  +VES F+ I+E FLFLDK+G GKL+K DV+
Sbjct  411  FIVLLCLIYLLAK-PSAESNVEESIELGPKLVESIFDPILEVFLFLDKDGKGKLNKADVI  469

Query  310  KAFNDA-FPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDD  158
            K  N+  +PLE+SP HVT  RF+EMDW R GK+ FR+FLFAF+ WVGID  D
Sbjct  470  KTLNNEDYPLERSPKHVTNMRFEEMDWGRKGKVGFREFLFAFMSWVGIDDAD  521



>ref|XP_010691275.1| PREDICTED: probable calcium-binding protein CML22 isoform X4 
[Beta vulgaris subsp. vulgaris]
Length=236

 Score =   236 bits (601),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 114/219 (52%), Positives = 158/219 (72%), Gaps = 6/219 (3%)
 Frame = -3

Query  802  CCHGSPNKYSRLDSKLETKVLEVKRNAPAT----LSIRSINALILKFPHFREGLKEIRTV  635
            C   + NKY RLD+KLE K++E+KR A  +       RSIN++I+KFP  +E +K++R V
Sbjct  7    CASSTTNKYRRLDAKLERKMIELKRQASTSGHTNKKFRSINSVIMKFPQLKEQVKKLRGV  66

Query  634  FEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLI  455
            FE +DED +G+IDREELK+C ++LQ ++  EE D+LF SCDVD N +I+F EFIVLLCLI
Sbjct  67   FEHYDEDGDGSIDREELKQCFKELQVNLTVEEFDDLFESCDVDRNGRIQFREFIVLLCLI  126

Query  454  YLLMDAPS-SGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPLEK  278
            YL+    S + + S+  SP  E+TF+ IV+ F+++DKNGDGKL KKD+V A  +  P E+
Sbjct  127  YLITKPSSPTDAVSRTESPNWEATFDIIVQVFIYMDKNGDGKLSKKDMVAALTEP-PWER  185

Query  277  SPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGD  161
            SPSHV +TRF EMD D+ G ++FR++LF    W+GID D
Sbjct  186  SPSHVMKTRFMEMDKDKDGNVTFREYLFGLTSWLGIDSD  224



>gb|KEH22470.1| calcium-binding EF-hand protein [Medicago truncatula]
Length=238

 Score =   233 bits (595),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 104/225 (46%), Positives = 164/225 (73%), Gaps = 0/225 (0%)
 Frame = -3

Query  832  LVSDKVGSLLCCHGSPNKYSRLDSKLETKVLEVKRNAPATLSIRSINALILKFPHFREGL  653
             +++K+G+++CC     +   L+ KLE K+ E++RN      ++SI+++++ FP F+E L
Sbjct  14   FLANKMGAVICCISEQGEKKSLERKLEKKIAEIRRNKFGQTKLKSIDSIVMLFPMFKERL  73

Query  652  KEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFI  473
            K +R +FEQ+DEDSN +I+  EL+  L+ LQ H+ E EI+  F+ CD+D ++ I+FNEFI
Sbjct  74   KTLRGMFEQYDEDSNESIEPHELQTFLEDLQLHLPENEIENFFQYCDIDGSKGIQFNEFI  133

Query  472  VLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDA  293
            VLLCLI++L +  SS ++ K     +   F+ I+E FLF D+NGDGKL+KKD+V+  N+ 
Sbjct  134  VLLCLIHILTEPLSSDNSPKEELAQLGQVFDKIIEIFLFFDQNGDGKLNKKDMVRTMNET  193

Query  292  FPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDD  158
             P E+SP+HVT+ RF+EMDWD++G+++FR+FLF F++WVGID D+
Sbjct  194  NPRERSPAHVTKNRFREMDWDKNGQVTFREFLFGFINWVGIDVDE  238



>ref|XP_009102544.1| PREDICTED: probable calcium-binding protein CML22 isoform X1 
[Brassica rapa]
Length=246

 Score =   233 bits (595),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 118/233 (51%), Positives = 162/233 (70%), Gaps = 8/233 (3%)
 Frame = -3

Query  832  LVSDKVGSLLCC---HGSPNKYSRLDSKLETKVLEVKRNAPATLSIRSINALILKFPHFR  662
            L    + S+LCC     S  KY+ LD+KLE K++E +R  P   S++S++++I+ FP  +
Sbjct  9    LSRSSIRSMLCCCVNSESNKKYAELDAKLERKMVESRRYYPGHRSLKSMDSIIMMFPKLK  68

Query  661  EGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQF-HVGEEEIDELFRSCDVDDNEKIKF  485
            EGL+ IR VFE +D+D NG ID EELKKCL++L+   + +EE+  L+  CDVD ++ I+F
Sbjct  69   EGLRNIRNVFESYDQDGNGTIDMEELKKCLEELKLMSLSDEEVKGLYGWCDVDGSKGIQF  128

Query  484  NEFIVLLCLIYLLMDA---PSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDV  314
            NEFIVLLCLIYLL           + ++G  +VES F+ IVE FLFLDK+G GKL+K DV
Sbjct  129  NEFIVLLCLIYLLAKPSSESREEESRELGPKLVESIFDPIVEVFLFLDKDGKGKLNKADV  188

Query  313  VKAFNDA-FPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDD  158
            +K  N+  +PLE+SP HVT  RF+EMDW R GK+ FR+FLFAF+ WVG+D  D
Sbjct  189  IKTLNNEDYPLERSPKHVTNMRFEEMDWGRKGKVGFREFLFAFMSWVGLDDVD  241



>ref|XP_007140756.1| hypothetical protein PHAVU_008G139100g [Phaseolus vulgaris]
 gb|ESW12750.1| hypothetical protein PHAVU_008G139100g [Phaseolus vulgaris]
Length=220

 Score =   232 bits (591),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 109/220 (50%), Positives = 163/220 (74%), Gaps = 0/220 (0%)
 Frame = -3

Query  817  VGSLLCCHGSPNKYSRLDSKLETKVLEVKRNAPATLSIRSINALILKFPHFREGLKEIRT  638
            +G +L C G  +K   LD K+E K++E++R+      ++S++ +++ FP F+E LK +R 
Sbjct  1    MGVILSCIGKSSKSMSLDDKIERKIVEMRRHKFGESKLKSVDGIVMMFPMFKEKLKTLRG  60

Query  637  VFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCL  458
            +FEQ+DEDSNG+I+  ELKK L+ L  H+ E+EI+ LF  CD+D ++ I+FNEFIVLLCL
Sbjct  61   MFEQYDEDSNGSIEPNELKKFLEHLDLHLKEKEIETLFEYCDIDGSKGIQFNEFIVLLCL  120

Query  457  IYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPLEK  278
            I+LL +  SS ++SK G   V   FN IVE F+F DKNGDGKL+KKD+V+  N+  P E+
Sbjct  121  IHLLEEPSSSNNSSKAGLERVGEIFNAIVETFVFFDKNGDGKLNKKDMVRTLNETNPRER  180

Query  277  SPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDD  158
            SP+ +++ RF+EMDWD++G+++FR+FLF F++WVGID D+
Sbjct  181  SPARISKHRFQEMDWDKNGQVTFREFLFGFINWVGIDADE  220



>emb|CDX77458.1| BnaA07g05960D [Brassica napus]
Length=230

 Score =   231 bits (589),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 116/225 (52%), Positives = 159/225 (71%), Gaps = 8/225 (4%)
 Frame = -3

Query  808  LLCC---HGSPNKYSRLDSKLETKVLEVKRNAPATLSIRSINALILKFPHFREGLKEIRT  638
            +LCC     S  KY+ LD+KLE K++E +R  P   S++S++++I+ FP  +EGL+ IR 
Sbjct  1    MLCCCVNSESNKKYAELDAKLERKMVESRRYYPGHRSLKSMDSIIMMFPKLKEGLRNIRN  60

Query  637  VFEQFDEDSNGAIDREELKKCLQKLQF-HVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  461
            VFE +D+D NG ID EELKKCL++L+   + +EE+  L+  CDVD ++ I+FNEFIVLLC
Sbjct  61   VFESYDQDGNGTIDMEELKKCLEELKLMSLSDEEVKGLYGWCDVDGSKGIQFNEFIVLLC  120

Query  460  LIYLLMDA---PSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDA-  293
            LIYLL           + ++G  +VES F+ IVE FLFLDK+G GKL+K DV+K  N+  
Sbjct  121  LIYLLAKPSSESREEESRELGPKLVESIFDPIVEVFLFLDKDGKGKLNKADVIKTLNNED  180

Query  292  FPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDD  158
            +PLE+SP HVT  RF+EMDW R GK+ FR+FLFAF+ WVG+D  D
Sbjct  181  YPLERSPKHVTNMRFEEMDWGRKGKVGFREFLFAFMSWVGLDDVD  225



>ref|XP_009102545.1| PREDICTED: probable calcium-binding protein CML22 isoform X2 
[Brassica rapa]
Length=230

 Score =   231 bits (589),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 116/225 (52%), Positives = 159/225 (71%), Gaps = 8/225 (4%)
 Frame = -3

Query  808  LLCC---HGSPNKYSRLDSKLETKVLEVKRNAPATLSIRSINALILKFPHFREGLKEIRT  638
            +LCC     S  KY+ LD+KLE K++E +R  P   S++S++++I+ FP  +EGL+ IR 
Sbjct  1    MLCCCVNSESNKKYAELDAKLERKMVESRRYYPGHRSLKSMDSIIMMFPKLKEGLRNIRN  60

Query  637  VFEQFDEDSNGAIDREELKKCLQKLQF-HVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  461
            VFE +D+D NG ID EELKKCL++L+   + +EE+  L+  CDVD ++ I+FNEFIVLLC
Sbjct  61   VFESYDQDGNGTIDMEELKKCLEELKLMSLSDEEVKGLYGWCDVDGSKGIQFNEFIVLLC  120

Query  460  LIYLLMDA---PSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDA-  293
            LIYLL           + ++G  +VES F+ IVE FLFLDK+G GKL+K DV+K  N+  
Sbjct  121  LIYLLAKPSSESREEESRELGPKLVESIFDPIVEVFLFLDKDGKGKLNKADVIKTLNNED  180

Query  292  FPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDD  158
            +PLE+SP HVT  RF+EMDW R GK+ FR+FLFAF+ WVG+D  D
Sbjct  181  YPLERSPKHVTNMRFEEMDWGRKGKVGFREFLFAFMSWVGLDDVD  225



>gb|KEH22469.1| calcium-binding EF-hand protein [Medicago truncatula]
Length=220

 Score =   229 bits (585),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 103/220 (47%), Positives = 160/220 (73%), Gaps = 0/220 (0%)
 Frame = -3

Query  817  VGSLLCCHGSPNKYSRLDSKLETKVLEVKRNAPATLSIRSINALILKFPHFREGLKEIRT  638
            +G+++CC     +   L+ KLE K+ E++RN      ++SI+++++ FP F+E LK +R 
Sbjct  1    MGAVICCISEQGEKKSLERKLEKKIAEIRRNKFGQTKLKSIDSIVMLFPMFKERLKTLRG  60

Query  637  VFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCL  458
            +FEQ+DEDSN +I+  EL+  L+ LQ H+ E EI+  F+ CD+D ++ I+FNEFIVLLCL
Sbjct  61   MFEQYDEDSNESIEPHELQTFLEDLQLHLPENEIENFFQYCDIDGSKGIQFNEFIVLLCL  120

Query  457  IYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPLEK  278
            I++L +  SS ++ K     +   F+ I+E FLF D+NGDGKL+KKD+V+  N+  P E+
Sbjct  121  IHILTEPLSSDNSPKEELAQLGQVFDKIIEIFLFFDQNGDGKLNKKDMVRTMNETNPRER  180

Query  277  SPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDD  158
            SP+HVT+ RF+EMDWD++G+++FR+FLF F++WVGID D+
Sbjct  181  SPAHVTKNRFREMDWDKNGQVTFREFLFGFINWVGIDVDE  220



>gb|AFK36647.1| unknown [Lotus japonicus]
Length=220

 Score =   229 bits (585),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 104/220 (47%), Positives = 158/220 (72%), Gaps = 0/220 (0%)
 Frame = -3

Query  817  VGSLLCCHGSPNKYSRLDSKLETKVLEVKRNAPATLSIRSINALILKFPHFREGLKEIRT  638
            +G+ +CC    ++   LD KL  K+ E++RN      +++++++++ FP F E LK +R 
Sbjct  1    MGATMCCITKSSERKSLDGKLGKKIAEIRRNKFGQSRLKTVDSIVMLFPMFHERLKTLRG  60

Query  637  VFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCL  458
            +FEQFDEDSNG+I+  ELK  L  L+ H+ E+EI+ LF  CD+D ++ I+FNEFIVLLCL
Sbjct  61   MFEQFDEDSNGSIEPNELKGFLDHLELHLPEQEIENLFHYCDIDGSKGIQFNEFIVLLCL  120

Query  457  IYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPLEK  278
            I+LL +  S  ++ K     +   FNTIVE FLF DKNGDGKL++KD+++  N+  P E+
Sbjct  121  IHLLTEPLSYDTSPKAELAKLGEVFNTIVEVFLFFDKNGDGKLNQKDMIRTLNETNPRER  180

Query  277  SPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDD  158
            SP+ +T+ RF+EMDWD++G+++FR+FLF F++WVGID D+
Sbjct  181  SPARITKDRFREMDWDKNGQVTFREFLFGFINWVGIDVDE  220



>ref|XP_003530839.1| PREDICTED: probable calcium-binding protein CML22-like [Glycine 
max]
Length=216

 Score =   229 bits (583),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 108/217 (50%), Positives = 161/217 (74%), Gaps = 1/217 (0%)
 Frame = -3

Query  805  LCCHGSPNKYSRLDSKLETKVLEVKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQ  626
            + C G  +K   LD KLE K+ E++R       ++S++++++ FP F+E LK +R +FEQ
Sbjct  1    MSCIGISSKKMCLDDKLERKIAEMRRYKFGQSKLKSVDSVVMLFPMFKERLKTLRGMFEQ  60

Query  625  FDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLL  446
            +DEDSNG+I+  ELKK L+ L+ H+ E+EI+ LF+ CD+D ++ I+FNEFIVLLCLI+LL
Sbjct  61   YDEDSNGSIEPNELKKFLEHLELHLKEQEIEHLFQYCDLDGSKGIQFNEFIVLLCLIHLL  120

Query  445  MDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPLEKSPSH  266
             +  SS  +SK     V   FNTIVE F+F D+NGDGKL++KD+V+  N+  P E+SP+ 
Sbjct  121  AEPSSSDISSKAELAQVGEIFNTIVEVFVFFDQNGDGKLNQKDMVRTLNETNPRERSPAR  180

Query  265  VTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDE  155
            +++ RF+EMDWD++G+++FR+FLF F++WVGI GDDE
Sbjct  181  ISKHRFQEMDWDKNGQVTFREFLFGFINWVGI-GDDE  216



>ref|XP_009406355.1| PREDICTED: probable calcium-binding protein CML22 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009406356.1| PREDICTED: probable calcium-binding protein CML22 [Musa acuminata 
subsp. malaccensis]
Length=291

 Score =   230 bits (586),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 116/245 (47%), Positives = 165/245 (67%), Gaps = 3/245 (1%)
 Frame = -3

Query  880  TMKGSVGLSRPCLSLKLVSDKVGSLLCCHGSPNKYSRLDSKLETKVLEV--KRNAPATLS  707
            +MK + GL R   +LK  SDKVG       S  K+ +    L+ ++LE   +R      +
Sbjct  37   SMKETSGLLRSFSALKSFSDKVGDAFAKLSSSIKHRKDHQNLKRRLLEAMKQRGYSNQNT  96

Query  706  IRSINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDEL  527
             RSIN++I+ FPHF+EGL+ I+ +FE++DEDSNG +  EELKKCL+ LQ  + E++ID L
Sbjct  97   FRSINSIIMWFPHFKEGLQNIKNIFEKYDEDSNGTMHHEELKKCLRMLQIQLSEKDIDRL  156

Query  526  FRSCDVDDNEKIKFNEFIVLLCLIYLLMDAPS-SGSTSKIGSPVVESTFNTIVEAFLFLD  350
            +  C +D+N+ I+++EFIVLLC  YLL    S + + S   S  VE+TF+ + EAF FLD
Sbjct  157  YHYCGMDENKGIQYHEFIVLLCFAYLLAGPDSATNNMSNSASRHVEATFDKLAEAFAFLD  216

Query  349  KNGDGKLHKKDVVKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGI  170
            KNGDGKL KKD++ A N+A   EKSP+H+T  RFKEMD ++ G +SF++FLF+ + W+GI
Sbjct  217  KNGDGKLDKKDIILALNEAPSKEKSPTHITSRRFKEMDRNKDGTVSFKEFLFSLIKWIGI  276

Query  169  DGDDE  155
            D D E
Sbjct  277  DTDHE  281



>ref|XP_008778084.1| PREDICTED: probable calcium-binding protein CML22 [Phoenix dactylifera]
Length=227

 Score =   228 bits (580),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 117/209 (56%), Positives = 163/209 (78%), Gaps = 3/209 (1%)
 Frame = -3

Query  763  SKLETKVLEV--KRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDRE  590
            S L  K++E   +R+A      RS+N++I++FPHF++GL  I+ VFEQ+DEDSNG IDRE
Sbjct  18   SLLREKLIEAIKQRSASRKQPFRSMNSIIMRFPHFKDGLGNIKDVFEQYDEDSNGTIDRE  77

Query  589  ELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMD-APSSGSTSK  413
            ELKKCL  LQ H+ EEEI+ L+  CDVD NE ++FNEFI+LLCLIYLLM+ A ++ +  +
Sbjct  78   ELKKCLSTLQVHLTEEEINGLYHYCDVDGNEGMQFNEFIILLCLIYLLMEPASATDNMPR  137

Query  412  IGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPLEKSPSHVTRTRFKEMDW  233
            IGSP +E+ F+ IV+AFLFLDKNGDGKL +KD++ AFN+    EKSP+H+T  RFKEMDW
Sbjct  138  IGSPQLEAAFDAIVDAFLFLDKNGDGKLKRKDMMLAFNETTTKEKSPNHITLRRFKEMDW  197

Query  232  DRSGKISFRKFLFAFLDWVGIDGDDEDHM  146
            ++ GK++F++FLF+F  W+G+D DD++ +
Sbjct  198  NKDGKVNFKEFLFSFSKWIGMDNDDQESL  226



>ref|XP_002883485.1| calcium-binding EF hand family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59744.1| calcium-binding EF hand family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=217

 Score =   226 bits (576),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 120/227 (53%), Positives = 160/227 (70%), Gaps = 17/227 (7%)
 Frame = -3

Query  808  LLCCHGSPN--KYSRLDSKLETKVLEVKRNAPATLSIRSINALILKFPHFREGLKEIRTV  635
            L CC  S N  KY+ LD+KL  K++E +R  P   S++S++++I+KFP  REGL+ IR+V
Sbjct  2    LCCCVNSENNRKYAELDAKLARKMVESRRIYPGHRSLKSMDSIIMKFPKLREGLRNIRSV  61

Query  634  FEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLI  455
            FE +D D NG ID EELKKCL++L+  + EEE+  L+  CDVD ++ I+FNEFIVLLCLI
Sbjct  62   FETYDSDKNGTIDIEELKKCLEELKLCLSEEEVKGLYGWCDVDGSKGIQFNEFIVLLCLI  121

Query  454  YLLMDAPSSGSTS---KIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPL  284
            YLL   PSS S +   ++G  +VES F+ IVE FLFLDK+G GKL+K D+  +F      
Sbjct  122  YLL-SKPSSESNTESKEMGPKLVESIFDPIVEVFLFLDKDGKGKLNKADI--SF------  172

Query  283  EKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDEDHMA  143
              + SHVT  RF+EMDW R GK+ FR+FLFAF+ WVG+D D ED+M 
Sbjct  173  --TSSHVTNMRFEEMDWGRKGKVGFREFLFAFMSWVGLD-DAEDYMT  216



>ref|XP_003563635.1| PREDICTED: probable calcium-binding protein CML21 [Brachypodium 
distachyon]
 ref|XP_010227514.1| PREDICTED: probable calcium-binding protein CML21 [Brachypodium 
distachyon]
Length=224

 Score =   226 bits (576),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 109/223 (49%), Positives = 165/223 (74%), Gaps = 3/223 (1%)
 Frame = -3

Query  817  VGSLLCCHGSPNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIR  641
            +G +   H S +K S   SKLETK++E +++ A    S++S N++I+KFP   EGL++ +
Sbjct  1    MGGVFGRHDS-SKRSSHGSKLETKMVESMRQRAAHGTSVKSFNSIIMKFPKIDEGLRKCK  59

Query  640  TVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  461
            T+FEQFDEDSNG ID++ELK C QKL+    EE+I +LF +CD++++  +KFNEFIV LC
Sbjct  60   TIFEQFDEDSNGEIDKDELKHCFQKLEISFTEEDITDLFEACDINEHMGMKFNEFIVFLC  119

Query  460  LIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPLE  281
            ++YLL D P+S + +K+G   +ESTF T+V+AF+FLDKN DG + K ++++A N++ P E
Sbjct  120  IVYLLNDPPASEAKAKMGLGNLESTFETLVDAFVFLDKNKDGYVSKDEMIQAINESIPGE  179

Query  280  KSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDED  152
            +S   +   RF+EMDWD++G ++F++FLFAF  WVGI G++ED
Sbjct  180  RSSGRIAMKRFEEMDWDKNGMVTFKEFLFAFTRWVGI-GENED  221



>ref|XP_004509621.1| PREDICTED: probable calcium-binding protein CML21-like isoform 
X2 [Cicer arietinum]
Length=229

 Score =   223 bits (569),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 111/228 (49%), Positives = 160/228 (70%), Gaps = 2/228 (1%)
 Frame = -3

Query  817  VGSLLCCHGSPNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIR  641
            +G  L    SP K    ++KLE K++E ++R      S++S N +ILKFP   E  ++ R
Sbjct  1    MGGALGKDESPKKSWTPETKLEAKMVEAMQRRECHGCSVKSFNTIILKFPKIDESFRKCR  60

Query  640  TVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  461
             +FEQFDEDSNGAID+EELKKC  KL+    EEEI++LF +CD++D+  +KFNEFIVLLC
Sbjct  61   AIFEQFDEDSNGAIDQEELKKCFSKLEISFSEEEINDLFEACDINDDLGMKFNEFIVLLC  120

Query  460  LIYLLMDAPSS-GSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPL  284
            L+YLL D P++  + S+IG P +E+TF T+V+ F+FLDKN DG + K ++V+A N+    
Sbjct  121  LVYLLKDDPAALHAKSRIGMPNLEATFETLVDTFVFLDKNKDGYVSKSEMVQAINETTSG  180

Query  283  EKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDEDHMAE  140
            E+S   +   RF+EMDWD++G ++F++FLFAF  WVGID  +++  AE
Sbjct  181  ERSSGRIAMKRFEEMDWDKNGMVNFKEFLFAFTRWVGIDEFEDEENAE  228



>ref|XP_009409857.1| PREDICTED: probable calcium-binding protein CML21 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009409859.1| PREDICTED: probable calcium-binding protein CML21 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009409860.1| PREDICTED: probable calcium-binding protein CML21 [Musa acuminata 
subsp. malaccensis]
Length=223

 Score =   222 bits (566),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 104/206 (50%), Positives = 152/206 (74%), Gaps = 1/206 (0%)
 Frame = -3

Query  781  KYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDEDSNG  605
            + S  +SKLE K++E ++R A    S++S N++I+KFP   E L++ +++FEQFDEDSNG
Sbjct  12   RRSSPESKLEAKMVEAMQRRASEGTSVKSFNSIIMKFPKIDESLRKCKSIFEQFDEDSNG  71

Query  604  AIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMDAPSSG  425
            AID+EELK C QKL+    E+EI +LF +CD+D+N  +KFNEFIVLLCL+YLL +  +  
Sbjct  72   AIDQEELKHCFQKLEISFNEQEIGDLFLACDIDENMGMKFNEFIVLLCLVYLLKEPAAVQ  131

Query  424  STSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPLEKSPSHVTRTRFK  245
            + S++G P +E+TF T+V+AF+FLDKN DG + K ++V A N+    E+S   +   RF+
Sbjct  132  ANSRMGLPDLETTFETLVDAFVFLDKNKDGYVSKNEMVHAINETTGGERSSGRIAMKRFE  191

Query  244  EMDWDRSGKISFRKFLFAFLDWVGID  167
            EMDWD++G ++F++FLFAF  WVGID
Sbjct  192  EMDWDKNGMVTFKEFLFAFTRWVGID  217



>ref|XP_006370792.1| hypothetical protein POPTR_0001s47510g [Populus trichocarpa]
 gb|ERP67361.1| hypothetical protein POPTR_0001s47510g [Populus trichocarpa]
Length=224

 Score =   221 bits (562),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 112/225 (50%), Positives = 162/225 (72%), Gaps = 5/225 (2%)
 Frame = -3

Query  817  VGSLLCCHGSPNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIR  641
            +G  +   GSP K    ++K+ETKV+E ++R      SI+S N++ILKFP   E  ++ +
Sbjct  1    MGGAVGKAGSPQKAWIPETKIETKVVEAMRRRETHGSSIKSFNSIILKFPKIDESFRKCK  60

Query  640  TVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  461
              FEQFDEDSNG+ID+EEL+KC  KL+    +EEI++LF +CDV+++  +KFNEFIVLLC
Sbjct  61   ATFEQFDEDSNGSIDKEELRKCFHKLETAFTDEEINDLFETCDVNEDMGMKFNEFIVLLC  120

Query  460  LIYLLMDAPS-SGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPL  284
            L+YLL D P+   + S+IG P +E+TF T+V AF+FLDKN DG + K ++V+A N++   
Sbjct  121  LVYLLKDDPAIPQAKSRIGMPDLEATFETLVGAFVFLDKNKDGYVSKSEMVQAINES--G  178

Query  283  EKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDEDH  149
            E+S   +   RF+EMDWDR+G ++F++FLFAF +WVGID D+ED 
Sbjct  179  ERSSGRIAMKRFEEMDWDRNGMVNFKEFLFAFTNWVGID-DNEDE  222



>ref|XP_006584629.1| PREDICTED: uncharacterized protein LOC100820628 isoform X1 [Glycine 
max]
 ref|XP_006584630.1| PREDICTED: uncharacterized protein LOC100820628 isoform X2 [Glycine 
max]
 gb|KHN31582.1| Putative calcium-binding protein CML21 [Glycine soja]
Length=229

 Score =   220 bits (560),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 106/218 (49%), Positives = 155/218 (71%), Gaps = 2/218 (1%)
 Frame = -3

Query  817  VGSLLCCHGSPNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIR  641
            +G  L    SP K S  ++KLE K++E ++R      S++S N +ILKFP   E L++ +
Sbjct  1    MGGALGKSESPRKGSMPETKLEAKMVEAMQRRESQGSSVKSFNTIILKFPKIDESLRKCK  60

Query  640  TVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  461
             +FEQFDEDSNGAID+EELKKC  KL+    EEEI++LF +CD++++  +KFNEFIVLLC
Sbjct  61   AIFEQFDEDSNGAIDQEELKKCFSKLEISFSEEEINDLFEACDINEDMGMKFNEFIVLLC  120

Query  460  LIYLLMDAPSS-GSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPL  284
            ++YLL + P++  + S+IG P +E TF T+V+ F+FLDKN DG + K ++V+A N+    
Sbjct  121  VVYLLKNDPAALHAKSRIGMPKLEGTFETLVDTFVFLDKNKDGYVSKNEMVQAINETTSG  180

Query  283  EKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGI  170
            E+S   +   RF+EMDWD++G ++F++FLFAF  WVGI
Sbjct  181  ERSSGRIAMKRFEEMDWDKNGMVNFKEFLFAFTRWVGI  218



>gb|EMT01046.1| Putative calcium-binding protein CML21 [Aegilops tauschii]
Length=224

 Score =   219 bits (559),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 102/204 (50%), Positives = 154/204 (75%), Gaps = 2/204 (1%)
 Frame = -3

Query  760  KLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDREEL  584
            KLE++++E +K+ A    S++S N++I+KFP   EGL++ +T+FEQFDEDSNG ID+EEL
Sbjct  19   KLESRMVESMKQRAAHGTSVKSFNSIIMKFPKIDEGLRKCKTIFEQFDEDSNGEIDKEEL  78

Query  583  KKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMDAPSSGSTSKIGS  404
            K C  KL+    EEEI +LF +CD++++  +K+NEFIV LCL+YLL D  +S + +K+G 
Sbjct  79   KNCFHKLEISFTEEEISDLFEACDINEDMGMKYNEFIVFLCLVYLLNDPAASEAKTKMGL  138

Query  403  PVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPLEKSPSHVTRTRFKEMDWDRS  224
              +ESTF T+V+AF+FLDKN DG + K ++++A N++ P E+S   +   RF+EMDWD++
Sbjct  139  GDLESTFETLVDAFVFLDKNKDGYVSKDEMIQAINESIPGERSAGRIAMKRFEEMDWDKN  198

Query  223  GKISFRKFLFAFLDWVGIDGDDED  152
            G ++F++FLFAF  WVGI G++ED
Sbjct  199  GMVTFKEFLFAFTRWVGI-GENED  221



>gb|KJB11853.1| hypothetical protein B456_002G104000 [Gossypium raimondii]
Length=215

 Score =   219 bits (558),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 108/201 (54%), Positives = 147/201 (73%), Gaps = 4/201 (2%)
 Frame = -3

Query  766  DSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDRE  590
            ++KLE K++E ++R A    +++S N++ILKFP   E L+  + VFEQFDEDSNGAID E
Sbjct  3    ETKLEAKMVEAMQRRASVGTAMKSFNSVILKFPKIDESLRNCKAVFEQFDEDSNGAIDNE  62

Query  589  ELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMD-APSSGSTSK  413
            ELKKC  KLQ    EEEI +LF++CD + N  IKFNEFIVLLCL+YLL D AP     S+
Sbjct  63   ELKKCFNKLQISFTEEEISDLFKACDFNQNMGIKFNEFIVLLCLVYLLKDNAPGHEGKSR  122

Query  412  IGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPLEKSPSHVTRTRFKEMDW  233
            +G P +E+TF T V+AF+FLDKN DG + K ++V+A N++   E+S   +   RF+EMDW
Sbjct  123  MGMPNLEATFETFVDAFVFLDKNKDGFVSKNEMVQAINES--GERSSGRIAMKRFEEMDW  180

Query  232  DRSGKISFRKFLFAFLDWVGI  170
            D++G +SF++FLFAF +WVGI
Sbjct  181  DKNGSVSFKEFLFAFTNWVGI  201



>gb|KHG01864.1| putative calcium-binding CML21 -like protein [Gossypium arboreum]
Length=215

 Score =   219 bits (557),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 108/201 (54%), Positives = 147/201 (73%), Gaps = 4/201 (2%)
 Frame = -3

Query  766  DSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDRE  590
            ++KLE K++E ++R A    +++S N++ILKFP   E L+  + VFEQFDEDSNGAID E
Sbjct  3    ETKLEAKMVEAMQRRASEGTAMKSFNSIILKFPKIDESLRNCKAVFEQFDEDSNGAIDNE  62

Query  589  ELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMD-APSSGSTSK  413
            ELKKC  KLQ    EEEI +LF++CD + N  IKFNEFIVLLCL+YLL D AP     S+
Sbjct  63   ELKKCFNKLQISFTEEEISDLFKACDFNQNMGIKFNEFIVLLCLVYLLKDNAPGHEGKSR  122

Query  412  IGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPLEKSPSHVTRTRFKEMDW  233
            +G P +E+TF T V+AF+FLDKN DG + K ++V+A N++   E+S   +   RF+EMDW
Sbjct  123  MGMPNLEATFETFVDAFVFLDKNKDGFVSKNEMVQAINES--GERSSGRIAMKRFEEMDW  180

Query  232  DRSGKISFRKFLFAFLDWVGI  170
            D++G +SF++FLFAF +WVGI
Sbjct  181  DKNGSVSFKEFLFAFTNWVGI  201



>ref|XP_003628952.1| hypothetical protein MTR_8g070510 [Medicago truncatula]
 gb|AET03428.1| EF hand calcium-binding family protein [Medicago truncatula]
 gb|AFK43589.1| unknown [Medicago truncatula]
Length=227

 Score =   219 bits (557),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 105/219 (48%), Positives = 154/219 (70%), Gaps = 2/219 (1%)
 Frame = -3

Query  817  VGSLLCCHGSPNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIR  641
            +G  +    SP K+   ++KLE K++E ++R      S++S N +ILKFP   E  ++ R
Sbjct  1    MGGAMGKGDSPKKFWVAETKLEAKMVEAMQRRECQGCSMKSFNTIILKFPKIDESFRKCR  60

Query  640  TVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  461
             +FEQFDEDSNG ID+EELKKC  KL+    EEE ++LF +CD++D+  +KF+EFIVLLC
Sbjct  61   AIFEQFDEDSNGTIDQEELKKCFSKLEISFSEEETNDLFEACDINDDLGMKFSEFIVLLC  120

Query  460  LIYLLMDAPSS-GSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPL  284
            L+YLL D P++  + S+IG P +E+TF T+V+ F+FLDKN DG + K ++V+A N+    
Sbjct  121  LVYLLKDDPAALHAKSRIGMPNLEATFETLVDTFVFLDKNKDGYVSKNEMVQAINETTSG  180

Query  283  EKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGID  167
            E+S   +   RF+EMDWD++G ++F++FLFAF  WVGID
Sbjct  181  ERSSGRIAMKRFEEMDWDKNGMVNFKEFLFAFTRWVGID  219



>gb|AET03429.2| EF hand calcium-binding family protein [Medicago truncatula]
Length=223

 Score =   218 bits (555),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 104/210 (50%), Positives = 151/210 (72%), Gaps = 2/210 (1%)
 Frame = -3

Query  790  SPNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDED  614
            SP K+   ++KLE K++E ++R      S++S N +ILKFP   E  ++ R +FEQFDED
Sbjct  6    SPKKFWVAETKLEAKMVEAMQRRECQGCSMKSFNTIILKFPKIDESFRKCRAIFEQFDED  65

Query  613  SNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMDAP  434
            SNG ID+EELKKC  KL+    EEE ++LF +CD++D+  +KF+EFIVLLCL+YLL D P
Sbjct  66   SNGTIDQEELKKCFSKLEISFSEEETNDLFEACDINDDLGMKFSEFIVLLCLVYLLKDDP  125

Query  433  SS-GSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPLEKSPSHVTR  257
            ++  + S+IG P +E+TF T+V+ F+FLDKN DG + K ++V+A N+    E+S   +  
Sbjct  126  AALHAKSRIGMPNLEATFETLVDTFVFLDKNKDGYVSKNEMVQAINETTSGERSSGRIAM  185

Query  256  TRFKEMDWDRSGKISFRKFLFAFLDWVGID  167
             RF+EMDWD++G ++F++FLFAF  WVGID
Sbjct  186  KRFEEMDWDKNGMVNFKEFLFAFTRWVGID  215



>gb|ACN85218.1| calcium ion binding protein [Oryza punctata]
Length=224

 Score =   217 bits (553),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 105/223 (47%), Positives = 162/223 (73%), Gaps = 2/223 (1%)
 Frame = -3

Query  817  VGSLLCCHGSPNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIR  641
            +G +L  H +  + S   SKLETK++E +++ A    S++S++++I+KFP   E L++ +
Sbjct  1    MGGILGRHDTMKRSSH-GSKLETKMVESMQQRASHGTSLKSLDSIIMKFPKIDESLRKCK  59

Query  640  TVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  461
            T+FEQFDEDSNG ID++ELK C QKL+    EEEI+ELF +CD++++  +KFNEFIV LC
Sbjct  60   TIFEQFDEDSNGEIDKQELKHCFQKLEISFTEEEINELFEACDINEDMGMKFNEFIVFLC  119

Query  460  LIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPLE  281
            LIYLL +   S +  K+G   +E+TF T+V+AF+FLDKN DG + K+++V++ N+    E
Sbjct  120  LIYLLNEPAVSEAKIKMGLGNLEATFETLVDAFVFLDKNKDGYVSKEEMVQSINETATGE  179

Query  280  KSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDED  152
            +S   +   RF+EMDWD++G ++F++FLFAF  WVGID +++D
Sbjct  180  RSSGRIAMRRFEEMDWDKNGMVTFKEFLFAFTRWVGIDENEDD  222



>ref|XP_010691273.1| PREDICTED: probable calcium-binding protein CML22 isoform X2 
[Beta vulgaris subsp. vulgaris]
Length=250

 Score =   218 bits (555),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 111/215 (52%), Positives = 152/215 (71%), Gaps = 10/215 (5%)
 Frame = -3

Query  865  VGLSRPCLSLKLVSDKVGSLL----CCHGSPNKYSRLDSKLETKVLEVKRNAPAT----L  710
             G SR C +LK +  KVGS+L    C   + NKY RLD+KLE K++E+KR A  +     
Sbjct  10   TGRSRSCPALKSICYKVGSMLWGCNCASSTTNKYRRLDAKLERKMIELKRQASTSGHTNK  69

Query  709  SIRSINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDE  530
              RSIN++I+KFP  +E +K++R VFE +DED +G+IDREELK+C ++LQ ++  EE D+
Sbjct  70   KFRSINSVIMKFPQLKEQVKKLRGVFEHYDEDGDGSIDREELKQCFKELQVNLTVEEFDD  129

Query  529  LFRSCDVDDNEKIKFNEFIVLLCLIYLLMDAPS-SGSTSKIGSPVVESTFNTIVEAFLFL  353
            LF SCDVD N +I+F EFIVLLCLIYL+    S + + S+  SP  E+TF+ IV+ F+++
Sbjct  130  LFESCDVDRNGRIQFREFIVLLCLIYLITKPSSPTDAVSRTESPNWEATFDIIVQVFIYM  189

Query  352  DKNGDGKLHKKDVVKAFNDAFPLEKSPSHVTRTRF  248
            DKNGDGKL KKD+V A  +  P E+SPSHV +TRF
Sbjct  190  DKNGDGKLSKKDMVAALTEP-PWERSPSHVMKTRF  223



>ref|XP_006857595.1| PREDICTED: probable calcium-binding protein CML21 [Amborella 
trichopoda]
 gb|ERN19062.1| hypothetical protein AMTR_s00061p00095500 [Amborella trichopoda]
Length=226

 Score =   217 bits (552),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 104/219 (47%), Positives = 150/219 (68%), Gaps = 1/219 (0%)
 Frame = -3

Query  817  VGSLLCCHGSPNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIR  641
            +G ++    SP +     SKLE K++E ++R A    +++S N++I+KFP   E L+ ++
Sbjct  1    MGGVIGKCDSPRRQGLPISKLEAKMVEAMRRKAAEGTTVKSFNSIIMKFPKIDENLRNVK  60

Query  640  TVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  461
            T+FEQFDEDSNG+ID EELK C  KLQ    EEE+ +LF +CD+ + + +KFNEFIVLLC
Sbjct  61   TIFEQFDEDSNGSIDPEELKHCFNKLQISFTEEEVSDLFEACDISETQGMKFNEFIVLLC  120

Query  460  LIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPLE  281
            L+YLL +     +  K+G P +ESTF  +V AF+FLDKN DG + K ++V+A N+    E
Sbjct  121  LVYLLKEPAVLPAKLKLGLPQLESTFEKLVNAFVFLDKNKDGYVSKYEMVQAINETTSGE  180

Query  280  KSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDG  164
            +S   +   RF+EMDWD++G +SF++FLFAF  WVGID 
Sbjct  181  RSSGRIAMRRFEEMDWDKNGMVSFKEFLFAFTHWVGIDA  219



>gb|ACN85246.1| calcium ion binding protein [Oryza officinalis]
Length=224

 Score =   217 bits (552),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 105/223 (47%), Positives = 162/223 (73%), Gaps = 2/223 (1%)
 Frame = -3

Query  817  VGSLLCCHGSPNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIR  641
            +G++L  H +  + S   SKLETK++E +++ A    S++S +++I+KFP   E L++ +
Sbjct  1    MGAILGRHDTLKRSSH-GSKLETKMVESMQQRASHGTSLKSFDSIIMKFPKIDESLRKCK  59

Query  640  TVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  461
            T+FEQFDEDSNG ID++ELK C QKL+    EEEI+ELF +CD++++  +KFNEFIV LC
Sbjct  60   TIFEQFDEDSNGEIDKQELKHCFQKLEISFTEEEINELFEACDINEDMGMKFNEFIVFLC  119

Query  460  LIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPLE  281
            LIYLL +   S +  K+G   +E+TF T+V+AF+FLDKN DG + K+++V++ N+    E
Sbjct  120  LIYLLNEPAVSEAKIKMGLGNLEATFETLVDAFVFLDKNKDGYVSKEEMVQSINETATGE  179

Query  280  KSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDED  152
            +S   +   RF+EMDWD++G ++F++FLFAF  WVGID +++D
Sbjct  180  RSSGRIAMRRFEEMDWDKNGMVTFKEFLFAFTRWVGIDENEDD  222



>gb|ACN85259.1| calcium ion binding protein [Oryza alta]
Length=224

 Score =   216 bits (551),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 105/223 (47%), Positives = 161/223 (72%), Gaps = 2/223 (1%)
 Frame = -3

Query  817  VGSLLCCHGSPNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIR  641
            +G +L  H +  + S   SKLETK++E +++ A    S++S +++I+KFP   E L++ +
Sbjct  1    MGGILGRHDTLKRSSH-GSKLETKMVESMQQRASHGTSLKSFDSIIMKFPKIDESLRKCK  59

Query  640  TVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  461
            T+FEQFDEDSNG ID++ELK C QKL+    EEEI+ELF +CD++++  +KFNEFIV LC
Sbjct  60   TIFEQFDEDSNGEIDKQELKHCFQKLEISFTEEEINELFEACDINEDMGMKFNEFIVFLC  119

Query  460  LIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPLE  281
            LIYLL +   S +  K+G   +E+TF T+V+AF+FLDKN DG + K+++V++ N+    E
Sbjct  120  LIYLLNEPAVSEAKIKMGLGNLEATFETLVDAFVFLDKNKDGYVSKEEMVQSINETATGE  179

Query  280  KSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDED  152
            +S   +   RF+EMDWD++G ++F++FLFAF  WVGID +++D
Sbjct  180  RSSGRIAMRRFEEMDWDKNGMVTFKEFLFAFTHWVGIDENEDD  222



>gb|KHG00196.1| putative calcium-binding CML21 -like protein [Gossypium arboreum]
Length=220

 Score =   216 bits (549),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 110/219 (50%), Positives = 158/219 (72%), Gaps = 6/219 (3%)
 Frame = -3

Query  793  GSPNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDE  617
            G   K    ++KLE K++E ++  A    +I+S N++ILKFP     L++ + +FEQFDE
Sbjct  3    GVVGKSESPETKLEAKMVEAMQHRASKGTTIKSFNSIILKFPKIDHTLRKCKAIFEQFDE  62

Query  616  DSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMD-  440
            DSNGAID EELKKCL KLQ    EEEI++LF++CD++++  IKFNEFIVLLCL+YLL D 
Sbjct  63   DSNGAIDHEELKKCLHKLQVCFTEEEIEDLFKACDMNEDMGIKFNEFIVLLCLVYLLKDN  122

Query  439  APSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPLEKSPSHVT  260
            A    + S++G P +E+TF T+V+AF+ LDKN DG + K ++V+A N++   E+S   + 
Sbjct  123  ATEFEAKSRMGVPNLEATFETLVDAFVLLDKNKDGYVSKNEMVQAINESG--ERSSGPIA  180

Query  259  RTRFKEMDWDRSGKISFRKFLFAFLDWVGID--GDDEDH  149
              RF+EMDWD++G +SF++FLFAF  WVGI+  GDD++H
Sbjct  181  TKRFEEMDWDKNGSVSFKEFLFAFTTWVGIEEVGDDDEH  219



>gb|AFJ15127.1| putative calcium-binding protein CML21 [Camellia sinensis]
Length=230

 Score =   216 bits (550),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 106/225 (47%), Positives = 160/225 (71%), Gaps = 3/225 (1%)
 Frame = -3

Query  817  VGSLLCCHGSPNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIR  641
            +G  L    +P K +  ++KLE K++E ++R A    S++S N++ILKFP   E L++ +
Sbjct  1    MGGALSTGDAP-KDNITETKLEAKMVEAMQRRASEGSSMKSFNSIILKFPKIDESLRKCK  59

Query  640  TVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  461
             +FEQFDED+NG ID EELK+C  KL+ ++ EEEI++LF +CD+ +N  +KFNEFIVLLC
Sbjct  60   AIFEQFDEDANGTIDPEELKRCFLKLEINLPEEEINDLFEACDIYENLGMKFNEFIVLLC  119

Query  460  LIYLLMDAPSS-GSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPL  284
            L+YLL + P++  + S++G P +E+TF T+V AF+FLDKN DG + K +++ A N+    
Sbjct  120  LVYLLKENPTALHAKSRMGMPSLEATFETLVNAFVFLDKNKDGYVSKSEMIDAINETTTG  179

Query  283  EKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDEDH  149
            E+S   +   RF+EMDWDR+G ++F++FLFAF  WVGID  ++D 
Sbjct  180  ERSSGRIAMKRFEEMDWDRNGMVNFKEFLFAFTRWVGIDDIEDDE  224



>ref|XP_008782977.1| PREDICTED: probable calcium-binding protein CML21 [Phoenix dactylifera]
Length=226

 Score =   215 bits (548),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 101/205 (49%), Positives = 149/205 (73%), Gaps = 1/205 (0%)
 Frame = -3

Query  781  KYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDEDSNG  605
            + S  +SKLE K++E +++ A    S++S N++I+KFP   E L+  +T+FEQFDEDSNG
Sbjct  12   RRSAPESKLEAKMVEAMQKRASEGTSMKSFNSIIMKFPKIDESLRNCKTIFEQFDEDSNG  71

Query  604  AIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMDAPSSG  425
            AID EELK C QKL+    EEEI +LF++CD++++  I F+EFIVLLCL+YLL +  +  
Sbjct  72   AIDPEELKHCFQKLEISATEEEISDLFKACDINESMGINFSEFIVLLCLVYLLKEPAAVQ  131

Query  424  STSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPLEKSPSHVTRTRFK  245
              S++G P +E+TF T+V+AF+FLDKN DG + K ++V+A N+    E+S   +   RF+
Sbjct  132  VKSRMGLPSLEATFETLVDAFVFLDKNKDGYVSKNEMVQAINETTTGERSSGRIAMKRFE  191

Query  244  EMDWDRSGKISFRKFLFAFLDWVGI  170
            EMDWD++G ++F++FLFAF  WVGI
Sbjct  192  EMDWDKNGTVTFKEFLFAFTRWVGI  216



>ref|XP_010691274.1| PREDICTED: probable calcium-binding protein CML22 isoform X3 
[Beta vulgaris subsp. vulgaris]
Length=247

 Score =   216 bits (550),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 111/215 (52%), Positives = 152/215 (71%), Gaps = 10/215 (5%)
 Frame = -3

Query  865  VGLSRPCLSLKLVSDKVGSLL----CCHGSPNKYSRLDSKLETKVLEVKRNAPAT----L  710
             G SR C +LK +  KVGS+L    C   + NKY RLD+KLE K++E+KR A  +     
Sbjct  10   TGRSRSCPALKSICYKVGSMLWGCNCASSTTNKYRRLDAKLERKMIELKRQASTSGHTNK  69

Query  709  SIRSINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDE  530
              RSIN++I+KFP  +E +K++R VFE +DED +G+IDREELK+C ++LQ ++  EE D+
Sbjct  70   KFRSINSVIMKFPQLKEQVKKLRGVFEHYDEDGDGSIDREELKQCFKELQVNLTVEEFDD  129

Query  529  LFRSCDVDDNEKIKFNEFIVLLCLIYLLMDAPS-SGSTSKIGSPVVESTFNTIVEAFLFL  353
            LF SCDVD N +I+F EFIVLLCLIYL+    S + + S+  SP  E+TF+ IV+ F+++
Sbjct  130  LFESCDVDRNGRIQFREFIVLLCLIYLITKPSSPTDAVSRTESPNWEATFDIIVQVFIYM  189

Query  352  DKNGDGKLHKKDVVKAFNDAFPLEKSPSHVTRTRF  248
            DKNGDGKL KKD+V A  +  P E+SPSHV +TRF
Sbjct  190  DKNGDGKLSKKDMVAALTEP-PWERSPSHVMKTRF  223



>ref|XP_003547815.1| PREDICTED: probable calcium-binding protein CML21-like isoform 
X1 [Glycine max]
 ref|XP_006599197.1| PREDICTED: probable calcium-binding protein CML21-like isoform 
X2 [Glycine max]
 ref|XP_006599198.1| PREDICTED: probable calcium-binding protein CML21-like isoform 
X3 [Glycine max]
 gb|KHN14062.1| Putative calcium-binding protein CML21 [Glycine soja]
Length=229

 Score =   215 bits (548),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 106/218 (49%), Positives = 153/218 (70%), Gaps = 2/218 (1%)
 Frame = -3

Query  817  VGSLLCCHGSPNKYSRLDSKLETKVLEVK-RNAPATLSIRSINALILKFPHFREGLKEIR  641
            +G  L    SP K S  ++KLE K++E   R      S++S N +ILKFP   E L++ +
Sbjct  1    MGGALGKIESPKKGSVPETKLEAKMVEAMLRRESQGSSVKSFNTIILKFPKIDESLRKCK  60

Query  640  TVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  461
             +FEQFDEDSNGAID+EELKKC  KL+    EEEI++LF +CD++++  +KF+EFIVLLC
Sbjct  61   AIFEQFDEDSNGAIDQEELKKCFSKLEISFTEEEINDLFEACDINEDMVMKFSEFIVLLC  120

Query  460  LIYLLMDAPSS-GSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPL  284
            ++YLL D P++  + S+IG P +E TF T+V+ F+FLDKN DG + K ++V+A N+    
Sbjct  121  VVYLLKDDPAALHAKSRIGMPKLERTFETLVDTFVFLDKNKDGYVSKNEMVQAINETTSG  180

Query  283  EKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGI  170
            E+S   +   RF+EMDWD++G ++F++FLFAF  WVGI
Sbjct  181  ERSSGRIAMKRFEEMDWDKNGMVNFKEFLFAFTRWVGI  218



>gb|EMS55923.1| putative calcium-binding protein CML21 [Triticum urartu]
Length=223

 Score =   215 bits (547),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 103/204 (50%), Positives = 153/204 (75%), Gaps = 3/204 (1%)
 Frame = -3

Query  760  KLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDREEL  584
            KLE+K++E +K+ A    S++S N +I+KFP   EGL++ +T+FEQFDEDSNG ID+EEL
Sbjct  19   KLESKMVESMKQRAAHGTSVKSFNTIIMKFPKIDEGLRKCKTIFEQFDEDSNGEIDKEEL  78

Query  583  KKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMDAPSSGSTSKIGS  404
            K C QKL+     EEI +LF +CD++++  +K+NEFIV LCL+YLL D  +S + +K+G 
Sbjct  79   KHCFQKLEISF-TEEIGDLFEACDINEDMGMKYNEFIVFLCLVYLLNDPTASEAKTKMGL  137

Query  403  PVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPLEKSPSHVTRTRFKEMDWDRS  224
              +ESTF T+V+AF+FLDKN DG + K ++++A N++ P E+S   +   RF+EMDWD++
Sbjct  138  GDLESTFETLVDAFVFLDKNKDGYVSKDEMIQAINESIPGERSAGRIAMKRFEEMDWDKN  197

Query  223  GKISFRKFLFAFLDWVGIDGDDED  152
            G ++F++FLFAF  WVGI G++ED
Sbjct  198  GMVTFKEFLFAFTRWVGI-GENED  220



>ref|NP_001242483.1| uncharacterized protein LOC100820628 [Glycine max]
 gb|ACU21290.1| unknown [Glycine max]
Length=229

 Score =   215 bits (547),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 107/226 (47%), Positives = 158/226 (70%), Gaps = 3/226 (1%)
 Frame = -3

Query  817  VGSLLCCHGSPNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIR  641
            +G  L    SP K S  ++KLE K++E ++R      S++S N +ILKFP   E L++ +
Sbjct  1    MGGTLGKSESPRKGSMPETKLEAKMVEAMQRRESQGSSVKSFNTIILKFPKIDESLRKCK  60

Query  640  TVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  461
             +FE FD DSNGAID+EELKKC  KL+    EEEI++LF +CD++++  +KFNEFIVLLC
Sbjct  61   AIFEPFDGDSNGAIDQEELKKCFSKLEISFSEEEINDLFEACDINEDMGMKFNEFIVLLC  120

Query  460  LIYLLMDAPSS-GSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPL  284
            ++YLL + P++  + S+IG P +E TF T+V+ F+FLDKN DG + K ++V+A N+    
Sbjct  121  VVYLLKNDPAALHAKSRIGMPKLEGTFETLVDTFVFLDKNKDGYVSKNEMVQAINETTSG  180

Query  283  EKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDG-DDEDH  149
            E+S   +   RF+EMDWD++G  +F++FLFAF  WVGI+  DDE++
Sbjct  181  ERSSGRIAMKRFEEMDWDKNGMANFKEFLFAFTRWVGINEVDDEEN  226



>ref|XP_008794706.1| PREDICTED: probable calcium-binding protein CML21 [Phoenix dactylifera]
Length=226

 Score =   214 bits (546),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 101/205 (49%), Positives = 150/205 (73%), Gaps = 1/205 (0%)
 Frame = -3

Query  781  KYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDEDSNG  605
            + S  +SKLE K++E +++ A    S++S N++I+KF    E L+  +T+FE+FDEDSNG
Sbjct  12   RCSAPESKLEAKMVEAMQKRASEGSSMKSFNSIIMKFSKIDESLRNCKTIFERFDEDSNG  71

Query  604  AIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMDAPSSG  425
            AID EELK+C Q L+    EEEI++LF++CD+++N  IKFNEFIVLLCL+YLL +  ++ 
Sbjct  72   AIDPEELKRCFQNLEISATEEEINDLFKACDINENMGIKFNEFIVLLCLVYLLKEPAAAR  131

Query  424  STSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPLEKSPSHVTRTRFK  245
              S +G P +E+TF T+V+AF+FLDKN DG + K ++V+A N+    E+S   +   RF+
Sbjct  132  VKSSMGLPSLEATFETLVDAFVFLDKNKDGYVSKNEMVQAINETTTGERSSGRIAMKRFE  191

Query  244  EMDWDRSGKISFRKFLFAFLDWVGI  170
            EMDWD++G ++F++FLFAF  WVGI
Sbjct  192  EMDWDKNGMVTFKEFLFAFTCWVGI  216



>gb|KHN01846.1| Putative calcium-binding protein CML22 [Glycine soja]
Length=193

 Score =   213 bits (543),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 98/194 (51%), Positives = 148/194 (76%), Gaps = 1/194 (1%)
 Frame = -3

Query  736  VKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQF  557
            ++R       ++S++++++ FP F+E LK +R +FEQ+DEDSNG+I+  ELKK L+ L+ 
Sbjct  1    MRRYKFGQSKLKSVDSVVMLFPMFKERLKTLRGMFEQYDEDSNGSIEPNELKKFLEHLEL  60

Query  556  HVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMDAPSSGSTSKIGSPVVESTFNT  377
            H+ E+EI+ LF+ CD+D ++ I+FNEFIVLLCLI+LL +  SS  +SK     V   FNT
Sbjct  61   HLKEQEIEHLFQYCDLDGSKGIQFNEFIVLLCLIHLLAEPSSSDISSKAELAQVGEIFNT  120

Query  376  IVEAFLFLDKNGDGKLHKKDVVKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFL  197
            IVE F+F D+NGDGKL++KD+V+  N+  P E+SP+ +++ RF+EMDWD++G+++FR+FL
Sbjct  121  IVEVFVFFDQNGDGKLNQKDMVRTLNETNPRERSPARISKHRFQEMDWDKNGQVTFREFL  180

Query  196  FAFLDWVGIDGDDE  155
            F F++WVGI GDDE
Sbjct  181  FGFINWVGI-GDDE  193



>ref|XP_010913274.1| PREDICTED: probable calcium-binding protein CML21 [Elaeis guineensis]
 ref|XP_010913275.1| PREDICTED: probable calcium-binding protein CML21 [Elaeis guineensis]
 ref|XP_010913276.1| PREDICTED: probable calcium-binding protein CML21 [Elaeis guineensis]
 ref|XP_010913277.1| PREDICTED: probable calcium-binding protein CML21 [Elaeis guineensis]
 ref|XP_010913278.1| PREDICTED: probable calcium-binding protein CML21 [Elaeis guineensis]
Length=227

 Score =   214 bits (545),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 103/206 (50%), Positives = 147/206 (71%), Gaps = 1/206 (0%)
 Frame = -3

Query  766  DSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDRE  590
            +SKLE +++E ++R A    +I+S N++ILKFP   E L+  +T+F+QFDEDSNG ID E
Sbjct  17   ESKLEAEMVEAIRRKASKGSAIKSFNSIILKFPKIDESLRNCKTIFDQFDEDSNGMIDPE  76

Query  589  ELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMDAPSSGSTSKI  410
            ELK C  KL+    EEEI +LF +CD+ +N  +KFNEFIVLLCL+YLL +  +  + S +
Sbjct  77   ELKHCFHKLEISCPEEEISDLFEACDIRENMGMKFNEFIVLLCLVYLLKEPAALQAKSGM  136

Query  409  GSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPLEKSPSHVTRTRFKEMDWD  230
            G P +E+TF T+VEAF+ LDKN DG + K ++V A N+    E+S  H+   RF+EMDWD
Sbjct  137  GLPNLEATFETLVEAFVLLDKNKDGYVSKNEMVDAINETTAGERSSGHIAMRRFEEMDWD  196

Query  229  RSGKISFRKFLFAFLDWVGIDGDDED  152
            ++G +SF++FLFA + WVGID  +E+
Sbjct  197  KNGMVSFKEFLFACIRWVGIDDAEEE  222



>gb|ACN85272.1| calcium ion binding protein [Oryza alta]
Length=216

 Score =   214 bits (544),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 104/217 (48%), Positives = 156/217 (72%), Gaps = 2/217 (1%)
 Frame = -3

Query  817  VGSLLCCHGSPNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIR  641
            +G +L  H +  + S   SKLETK++E +++ A    S++S +++I+KFP   E L++ +
Sbjct  1    MGGILGRHDTMKRSSH-GSKLETKMVESMQQRASHGTSLKSFDSIIMKFPKIDESLRKCK  59

Query  640  TVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  461
            T+FEQFDEDSNG ID++ELK C QKL+    EEEI+ELF +CD++++  +KFNEFIV LC
Sbjct  60   TIFEQFDEDSNGEIDKQELKHCFQKLEISFTEEEINELFEACDINEDMGMKFNEFIVFLC  119

Query  460  LIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPLE  281
            LIYLL +   S +  K+G   +E+TF T+V+AF+FLDKN DG + K+++V++ N+    E
Sbjct  120  LIYLLNEPAVSEAKIKMGLGNLEATFETLVDAFVFLDKNKDGYVSKEEMVQSINETVTGE  179

Query  280  KSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGI  170
            +S   +   RF+EMDWD++G ++F+KFLFAF  WVGI
Sbjct  180  RSSGRIAVRRFEEMDWDKNGMVTFKKFLFAFTRWVGI  216



>ref|XP_006656237.1| PREDICTED: probable calcium-binding protein CML21-like [Oryza 
brachyantha]
Length=225

 Score =   214 bits (544),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 103/223 (46%), Positives = 159/223 (71%), Gaps = 2/223 (1%)
 Frame = -3

Query  817  VGSLLCCHGSPNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIR  641
            +G +L  H +  + S   SKLE K++E +++ A    S++S +++I+KFP   E L++ +
Sbjct  1    MGGILGRHDTMKRNSH-GSKLEAKMVEAIQQRAAHGTSLKSFDSIIMKFPKIDESLRKCK  59

Query  640  TVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  461
            T+FEQFDEDSNG ID++ELK C QKL+    EEEI++LF +CD++++  +KFNEFIV LC
Sbjct  60   TIFEQFDEDSNGEIDKQELKHCFQKLEISFTEEEINDLFEACDINEDMGMKFNEFIVFLC  119

Query  460  LIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPLE  281
            LIYLL +   S +  K+G   ++ TF T+V+AF+FLDKN DG + K+++V+A N+    E
Sbjct  120  LIYLLNEPAVSEAKLKMGLGNLQGTFETLVDAFVFLDKNKDGYVSKEEMVQALNETATGE  179

Query  280  KSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDED  152
            +S   +   RF+EMDWD++G ++F++FLFAF  WVGID +++D
Sbjct  180  RSSGRIAMRRFEEMDWDKNGMVTFKEFLFAFTHWVGIDENEDD  222



>ref|XP_011039863.1| PREDICTED: probable calcium-binding protein CML21 [Populus euphratica]
 ref|XP_011039864.1| PREDICTED: probable calcium-binding protein CML21 [Populus euphratica]
 ref|XP_011039865.1| PREDICTED: probable calcium-binding protein CML21 [Populus euphratica]
Length=229

 Score =   214 bits (544),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 106/218 (49%), Positives = 157/218 (72%), Gaps = 4/218 (2%)
 Frame = -3

Query  817  VGSLLCCHGSPNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIR  641
            +G  +   GSP K    ++K+E KV+E ++R      SI+S N++ILKFP   E  ++ +
Sbjct  1    MGGAVGKAGSPKKAWIPETKIEAKVVEAMRRREIHGSSIKSFNSIILKFPKIDESFRKCK  60

Query  640  TVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  461
              FEQFDEDSNG+ID+EEL+KC  KL+    +EEI++LF +CDV+++  +KFNEFIVLLC
Sbjct  61   ATFEQFDEDSNGSIDKEELRKCFHKLETAFTDEEINDLFETCDVNEDMGVKFNEFIVLLC  120

Query  460  LIYLLMDAPSS-GSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPL  284
            L+YLL D P++  + S+IG P +E+TF T+V AF+FLDKN DG + K ++V+A N++   
Sbjct  121  LVYLLKDDPATPQAKSRIGMPDLEATFETLVGAFVFLDKNKDGYVSKSEMVQAINES--G  178

Query  283  EKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGI  170
            E+S   +   RF+EMDWD++G ++F++FLFAF +WVGI
Sbjct  179  ERSSGRIAMKRFEEMDWDKNGMVNFKEFLFAFTNWVGI  216



>ref|NP_001058046.1| Os06g0609600 [Oryza sativa Japonica Group]
 dbj|BAD35633.1| calcium-binding EF hand-like protein [Oryza sativa Japonica Group]
 dbj|BAD35476.1| calcium-binding EF hand-like protein [Oryza sativa Japonica Group]
 dbj|BAF19960.1| Os06g0609600 [Oryza sativa Japonica Group]
 gb|EAZ01634.1| hypothetical protein OsI_23671 [Oryza sativa Indica Group]
 gb|EAZ37606.1| hypothetical protein OsJ_21942 [Oryza sativa Japonica Group]
 dbj|BAG93019.1| unnamed protein product [Oryza sativa Japonica Group]
Length=224

 Score =   213 bits (543),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 103/224 (46%), Positives = 161/224 (72%), Gaps = 2/224 (1%)
 Frame = -3

Query  817  VGSLLCCHGSPNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIR  641
            +G +L  H +  + S   SKLETK++E +++ A    S++S +++I+KFP   E L++ +
Sbjct  1    MGGILGRHDTMKRSSH-GSKLETKMVESMQQRASHGTSLKSFDSIIMKFPKIDESLRKCK  59

Query  640  TVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  461
             +FEQFDEDSNG ID++ELK C QKL+    EEEI++LF +CD++++  +KFNEFIV LC
Sbjct  60   IIFEQFDEDSNGEIDKQELKHCFQKLEISFTEEEINDLFEACDINEDMGMKFNEFIVFLC  119

Query  460  LIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPLE  281
            LIYLL +   S +  K+G   +E+TF T+V+AF+FLDKN DG + K+++V++ N+    E
Sbjct  120  LIYLLNEPAVSEAKIKMGLGNLEATFETLVDAFVFLDKNKDGYVSKEEMVQSMNETATGE  179

Query  280  KSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDEDH  149
            +S   +   RF+EMDWD++G ++F++FLFAF  WVGID +++D+
Sbjct  180  RSSGRIAMKRFEEMDWDKNGMVTFKEFLFAFTRWVGIDENEDDN  223



>gb|ACN85201.1| calcium ion binding protein [Oryza glaberrima]
Length=224

 Score =   213 bits (543),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 103/223 (46%), Positives = 160/223 (72%), Gaps = 2/223 (1%)
 Frame = -3

Query  817  VGSLLCCHGSPNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIR  641
            +G +L  H +  + S   SKLETK++E +++ A    S++S +++I+KFP   E L++ +
Sbjct  1    MGGILGRHDTMKRSSH-GSKLETKMVESMQQRASHGTSLKSFDSIIMKFPKIDESLRKCK  59

Query  640  TVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  461
             +FEQFDEDSNG ID++ELK C QKL+    EEEI++LF +CD++++  +KFNEFIV LC
Sbjct  60   IIFEQFDEDSNGEIDKQELKHCFQKLEISFTEEEINDLFEACDINEDMGMKFNEFIVFLC  119

Query  460  LIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPLE  281
            LIYLL +   S +  K+G   +E+TF T+V+AF+FLDKN DG + K+++V++ N+    E
Sbjct  120  LIYLLNEPAVSEAKIKMGLGNLEATFETLVDAFVFLDKNKDGYVSKEEMVQSMNETATGE  179

Query  280  KSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDED  152
            +S   +   RF+EMDWD++G ++F++FLFAF  WVGID +++D
Sbjct  180  RSSGRIAMKRFEEMDWDKNGMVTFKEFLFAFTRWVGIDENEDD  222



>ref|XP_010928993.1| PREDICTED: probable calcium-binding protein CML21 [Elaeis guineensis]
Length=226

 Score =   213 bits (543),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 101/205 (49%), Positives = 148/205 (72%), Gaps = 1/205 (0%)
 Frame = -3

Query  781  KYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDEDSNG  605
            + S  +SKLE K++E +++ A    S++S N++I+KFP   E L+  +T+FEQFDEDSNG
Sbjct  12   RRSAPESKLEVKMVEAMQKRASEGTSMKSFNSIIMKFPKIDESLRNCKTIFEQFDEDSNG  71

Query  604  AIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMDAPSSG  425
            AID EELK C QKL+    EEEI +LF +CD++++  I F+EFIVLLCL+YLL +  +  
Sbjct  72   AIDPEELKHCFQKLEISAMEEEISDLFMACDINESMGINFSEFIVLLCLVYLLKEPAALQ  131

Query  424  STSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPLEKSPSHVTRTRFK  245
              S++G P +E+TF T+V+AF+FLDKN DG + K ++V+A N+    E+S   +   RF+
Sbjct  132  VKSRMGLPSLEATFETLVDAFVFLDKNKDGYVSKNEMVQAINETTAGERSSGRIAMKRFE  191

Query  244  EMDWDRSGKISFRKFLFAFLDWVGI  170
            EMDWD++G ++F++FLFAF  WVGI
Sbjct  192  EMDWDKNGTVTFKEFLFAFTRWVGI  216



>gb|ACN85168.1| calcium ion binding protein [Oryza nivara]
 gb|ACN85185.1| calcium ion binding protein [Oryza rufipogon]
Length=224

 Score =   211 bits (538),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 102/224 (46%), Positives = 160/224 (71%), Gaps = 2/224 (1%)
 Frame = -3

Query  817  VGSLLCCHGSPNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIR  641
            +G +L  H +  + S   SKLE K++E +++ A    S++S +++I+KFP   E L++ +
Sbjct  1    MGGILGRHDTMKRSSH-GSKLEMKMVESMQQRASHGTSLKSFDSIIMKFPKIDESLRKCK  59

Query  640  TVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  461
             +FEQFDEDSNG ID++ELK C QKL+    EEEI++LF +CD++++  +KFNEFIV LC
Sbjct  60   IIFEQFDEDSNGEIDKQELKHCFQKLEISFTEEEINDLFEACDINEDMGMKFNEFIVFLC  119

Query  460  LIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPLE  281
            LIYLL +   S +  K+G   +E+TF T+V+AF+FLDKN DG + K+++V++ N+    E
Sbjct  120  LIYLLNEPAVSEAKIKMGLGNLEATFETLVDAFVFLDKNKDGYVSKEEMVQSMNETATGE  179

Query  280  KSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDEDH  149
            +S   +   RF+EMDWD++G ++F++FLFAF  WVGID +++D+
Sbjct  180  RSSGRIAMKRFEEMDWDKNGMVTFKEFLFAFTRWVGIDENEDDN  223



>ref|XP_007156300.1| hypothetical protein PHAVU_003G275000g [Phaseolus vulgaris]
 gb|ESW28294.1| hypothetical protein PHAVU_003G275000g [Phaseolus vulgaris]
Length=228

 Score =   211 bits (538),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 100/222 (45%), Positives = 158/222 (71%), Gaps = 2/222 (1%)
 Frame = -3

Query  817  VGSLLCCHGSPNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIR  641
            +G+ L    SP K    ++K+E K++E ++R      S++S N +ILKFP   E L++ +
Sbjct  3    MGATLGKSDSPKKGWMPETKIEAKMVEAMQRRESHGSSVKSFNTIILKFPKIDESLRKCK  62

Query  640  TVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  461
             +FEQFDEDSNG I++EELKK   KL+  + EEEI++LF +CD++D+  ++F+EFIVLLC
Sbjct  63   AIFEQFDEDSNGTIEKEELKKSFSKLEIPLTEEEINDLFEACDINDDMGMEFSEFIVLLC  122

Query  460  LIYLLMDAPSSG-STSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPL  284
            L+YLL D P++  + S++G P +E+TF T+V+ F+FLDKN DG + K ++V+A N+    
Sbjct  123  LVYLLKDDPAAAHAKSQVGMPNLEATFETLVDTFVFLDKNKDGYVSKNEMVQAINETTSG  182

Query  283  EKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDD  158
            E+S   +   RF+EMDWD++G ++F++FLFAF  WVG++ ++
Sbjct  183  ERSSGRIAMKRFEEMDWDKNGMVNFKEFLFAFTRWVGLEDEE  224



>gb|ACN85332.1| calcium ion binding protein [Oryza granulata]
Length=224

 Score =   211 bits (537),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 102/222 (46%), Positives = 159/222 (72%), Gaps = 2/222 (1%)
 Frame = -3

Query  817  VGSLLCCHGSPNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIR  641
            +G +L  H +  + S   SKLETK+++ +++ A    S++S +++I+KFP   E L++ +
Sbjct  1    MGGILGRHDTLKRSSH-GSKLETKMVQAIQQRALHGTSLKSFDSIIMKFPKIDESLRKCK  59

Query  640  TVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  461
             +FEQFDEDSNG ID++ELK C QKL+    EEEI++LF +CD++++  +KFNEFIV LC
Sbjct  60   AIFEQFDEDSNGEIDKQELKHCFQKLEISFTEEEINDLFEACDINEDMGMKFNEFIVFLC  119

Query  460  LIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPLE  281
            LIYLL +   S +  K+G   +E+TF T+V+AF+FLDKN DG + K+++V+A N+    E
Sbjct  120  LIYLLNEPAVSEAKIKMGLGNLEATFETLVDAFVFLDKNKDGYVSKEEMVQAINETATGE  179

Query  280  KSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDE  155
            +S   +   RF+EMDWD++G ++F++FLFAF  WVGID +++
Sbjct  180  RSSGRIAMRRFEEMDWDKNGMVTFKEFLFAFTRWVGIDENED  221



>ref|XP_002268527.1| PREDICTED: probable calcium-binding protein CML21 isoform X2 
[Vitis vinifera]
 emb|CBI39804.3| unnamed protein product [Vitis vinifera]
Length=232

 Score =   211 bits (536),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 101/216 (47%), Positives = 154/216 (71%), Gaps = 2/216 (1%)
 Frame = -3

Query  817  VGSLLCCHGSPNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIR  641
            +G ++    SP K    ++KLE K++E ++R A    +++S N++ILKFP   E L+  +
Sbjct  1    MGGVVGKGDSPRKAWVPETKLEAKMVEAMQRRASEGSTMKSFNSIILKFPKIDESLRNCK  60

Query  640  TVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  461
             +F+QFDEDSNGAID EELK+C  KL+    EEEI++LF +CD++++  +KFNEFIVLLC
Sbjct  61   AIFQQFDEDSNGAIDHEELKRCFLKLEISFSEEEINDLFEACDINEDMGMKFNEFIVLLC  120

Query  460  LIYLLMDAPSS-GSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPL  284
            L+YLL + P++  + S++G P +E+TF T+V+AF+FLDKN DG + K ++V A N+    
Sbjct  121  LVYLLKEDPAALQAKSRMGMPNLEATFETLVDAFVFLDKNKDGYVSKSEMVHAINETTAG  180

Query  283  EKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWV  176
            E+S   +   RF+EMDWD++G ++F++FLFAF  WV
Sbjct  181  ERSSGRIAMKRFEEMDWDKNGMVNFKEFLFAFTRWV  216



>ref|XP_010244812.1| PREDICTED: probable calcium-binding protein CML21 [Nelumbo nucifera]
 ref|XP_010244813.1| PREDICTED: probable calcium-binding protein CML21 [Nelumbo nucifera]
 ref|XP_010244814.1| PREDICTED: probable calcium-binding protein CML21 [Nelumbo nucifera]
 ref|XP_010244815.1| PREDICTED: probable calcium-binding protein CML21 [Nelumbo nucifera]
Length=230

 Score =   211 bits (536),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 104/218 (48%), Positives = 151/218 (69%), Gaps = 2/218 (1%)
 Frame = -3

Query  817  VGSLLCCHGSPNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIR  641
            +G  L    SP K    ++KLE K++E ++R A     ++S ++++LKFP   E  +  +
Sbjct  1    MGGTLGKGDSPRKGWTPETKLEAKMVEAMQRRASKGCVMKSFDSIVLKFPKIDESFRNCK  60

Query  640  TVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  461
            T+FEQFDEDSNGAID EELK C  KL+    EEEI +LF +CD+ +N  +KFNEFIVLLC
Sbjct  61   TIFEQFDEDSNGAIDPEELKHCFHKLEISFTEEEISDLFEACDIHENMGMKFNEFIVLLC  120

Query  460  LIYLLMDAPSSGS-TSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPL  284
            L+YLL + P++    SK+G P +E+TF T+V+AF+FLDKN DG + K ++V+A N+    
Sbjct  121  LVYLLKEDPAALQFKSKMGFPNLEATFETLVDAFVFLDKNRDGYVSKNEMVQAINETTSG  180

Query  283  EKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGI  170
            E+S   +   RF+EMDWD++G ++F++FLFAF  WVG+
Sbjct  181  ERSSGRIAMKRFEEMDWDKNGMVTFKEFLFAFTRWVGM  218



>emb|CAN71481.1| hypothetical protein VITISV_006244 [Vitis vinifera]
Length=257

 Score =   211 bits (537),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 102/220 (46%), Positives = 154/220 (70%), Gaps = 5/220 (2%)
 Frame = -3

Query  817  VGSLLCCHGSPNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIR  641
            +G ++    SP K    ++KLE K++E ++R A    +++S N++ILKFP   E L+  +
Sbjct  1    MGGVVGKGDSPRKAWVPETKLEAKMVEAMQRRASEGSTMKSFNSIILKFPKIDESLRNCK  60

Query  640  TVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  461
             +F+QFDEDSNGAID EELK+C  KL+    EEEI++LF +CD++++  +KFNEFIVLLC
Sbjct  61   AIFQQFDEDSNGAIDHEELKRCFLKLEISFSEEEINDLFEACDINEDMGMKFNEFIVLLC  120

Query  460  LIYLLMDAPSS----GSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDA  293
            L+YLL + P++       S++G P +E+TF T+V+AF+FLDKN DG + K ++V A N+ 
Sbjct  121  LVYLLKEDPTALQAVSKKSRMGMPNLEATFETLVDAFVFLDKNKDGYVSKSEMVHAINET  180

Query  292  FPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVG  173
               E+S   +   RF+EMDWD++G ++F++FLFAF  WVG
Sbjct  181  TAGERSSGRIAMKRFEEMDWDKNGMVNFKEFLFAFTRWVG  220



>ref|XP_002438663.1| hypothetical protein SORBIDRAFT_10g023890 [Sorghum bicolor]
 gb|EER90030.1| hypothetical protein SORBIDRAFT_10g023890 [Sorghum bicolor]
Length=224

 Score =   209 bits (533),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 102/223 (46%), Positives = 160/223 (72%), Gaps = 2/223 (1%)
 Frame = -3

Query  817  VGSLLCCHGSPNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIR  641
            +G++L  H + +K S   SKLE+K+++ +++ A    S++S +++I+KFP   E  ++ +
Sbjct  1    MGAVLGRHDT-HKRSFHGSKLESKMVDAMQKRALHGTSLKSFDSIIMKFPKIDESFRKCK  59

Query  640  TVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  461
            T+FEQFDEDSNG ID+EELK C QKL+    EEEI +LF +CD++++  +KFNEFIV LC
Sbjct  60   TIFEQFDEDSNGEIDKEELKHCFQKLEISFTEEEISDLFEACDINEDMGMKFNEFIVFLC  119

Query  460  LIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPLE  281
            L+YLL +   S +  K+G   +E+TF T+V+AF+FLDKN DG + K ++++A N+    E
Sbjct  120  LVYLLNEPAVSEAKIKMGLGNLEATFETLVDAFVFLDKNKDGYVSKDEMIQAINETTTGE  179

Query  280  KSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDED  152
            +S   +   RF+EMDWD++G ++F++FLFAF  WVGID +++D
Sbjct  180  RSSGRIAMKRFEEMDWDKNGMVTFKEFLFAFTRWVGIDENEDD  222



>ref|XP_010644632.1| PREDICTED: probable calcium-binding protein CML21 isoform X1 
[Vitis vinifera]
 ref|XP_010644633.1| PREDICTED: probable calcium-binding protein CML21 isoform X1 
[Vitis vinifera]
 ref|XP_010644634.1| PREDICTED: probable calcium-binding protein CML21 isoform X1 
[Vitis vinifera]
Length=235

 Score =   209 bits (533),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 101/219 (46%), Positives = 153/219 (70%), Gaps = 5/219 (2%)
 Frame = -3

Query  817  VGSLLCCHGSPNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIR  641
            +G ++    SP K    ++KLE K++E ++R A    +++S N++ILKFP   E L+  +
Sbjct  1    MGGVVGKGDSPRKAWVPETKLEAKMVEAMQRRASEGSTMKSFNSIILKFPKIDESLRNCK  60

Query  640  TVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  461
             +F+QFDEDSNGAID EELK+C  KL+    EEEI++LF +CD++++  +KFNEFIVLLC
Sbjct  61   AIFQQFDEDSNGAIDHEELKRCFLKLEISFSEEEINDLFEACDINEDMGMKFNEFIVLLC  120

Query  460  LIYLLMDAPSS----GSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDA  293
            L+YLL + P++       S++G P +E+TF T+V+AF+FLDKN DG + K ++V A N+ 
Sbjct  121  LVYLLKEDPAALQAVSKKSRMGMPNLEATFETLVDAFVFLDKNKDGYVSKSEMVHAINET  180

Query  292  FPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWV  176
               E+S   +   RF+EMDWD++G ++F++FLFAF  WV
Sbjct  181  TAGERSSGRIAMKRFEEMDWDKNGMVNFKEFLFAFTRWV  219



>ref|XP_012074155.1| PREDICTED: probable calcium-binding protein CML21 [Jatropha curcas]
 ref|XP_012074156.1| PREDICTED: probable calcium-binding protein CML21 [Jatropha curcas]
 gb|KDP36321.1| hypothetical protein JCGZ_09536 [Jatropha curcas]
Length=222

 Score =   209 bits (532),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 106/219 (48%), Positives = 155/219 (71%), Gaps = 5/219 (2%)
 Frame = -3

Query  817  VGSLLCCHGSPNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIR  641
            +GS+     SP +Y   ++KLE K++E ++R      +I+S N++ILKFP   E L++ +
Sbjct  1    MGSVKVQDDSP-RYWIPETKLEAKMVEAMQRREAEGCAIKSFNSIILKFPKIDESLRKCK  59

Query  640  TVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  461
             +FEQFDEDSNG IDREEL+KC  KL+    EEEID+LF +CD +++  ++FNEFIVLLC
Sbjct  60   DIFEQFDEDSNGIIDREELRKCFHKLELSFTEEEIDDLFLACDFNEDMGMEFNEFIVLLC  119

Query  460  LIYLL-MDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPL  284
            L+YLL  D  +  S S++G P +E+TF T+V AF+FLDKN DG + K ++V+A N++   
Sbjct  120  LVYLLKYDTAAVHSKSRMGMPNLEATFETLVNAFVFLDKNKDGYVSKNEMVQAINES--G  177

Query  283  EKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGID  167
            E+    +   RF+EMDWD++G ++F++FLFAF  WVGID
Sbjct  178  ERPSGRIAMKRFEEMDWDKNGTVNFKEFLFAFTRWVGID  216



>ref|XP_010092394.1| putative calcium-binding protein CML21 [Morus notabilis]
 gb|EXB51070.1| putative calcium-binding protein CML21 [Morus notabilis]
Length=229

 Score =   209 bits (532),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 104/219 (47%), Positives = 149/219 (68%), Gaps = 2/219 (1%)
 Frame = -3

Query  817  VGSLLCCHGSPNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIR  641
            +G ++    SP K    ++KLE K++E +KR A    S++S + +ILKFP   E L+  +
Sbjct  1    MGGIVGKSESPKKVCTPETKLEAKIVEAMKRRAIQGTSMKSFDNIILKFPKIDESLRNCK  60

Query  640  TVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  461
             +FE FDEDSNGAID+EE+KKC  KL     EEEI + F +CD++++  IKFNEFIVLLC
Sbjct  61   AIFELFDEDSNGAIDQEEMKKCFHKLGISFTEEEISDFFNACDINEDMGIKFNEFIVLLC  120

Query  460  LIYLLMDAPSSGSTS-KIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPL  284
            L+YLL D  ++  T  K+  P  E+TF T+V+AF+FLDKN DG + + ++V+A N+    
Sbjct  121  LVYLLKDGQTAIHTKLKVVMPNQETTFETLVDAFVFLDKNKDGYVSRSEMVEAINETTSG  180

Query  283  EKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGID  167
            E+S   +   RF+EMDWD++G +S ++FLFAF  WVGID
Sbjct  181  ERSSGRIAMKRFEEMDWDKNGMVSVKEFLFAFTRWVGID  219



>ref|XP_003628953.1| hypothetical protein MTR_8g070510 [Medicago truncatula]
Length=203

 Score =   207 bits (527),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 97/194 (50%), Positives = 139/194 (72%), Gaps = 1/194 (1%)
 Frame = -3

Query  745  VLEVKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQK  566
            V  ++R      S++S N +ILKFP   E  ++ R +FEQFDEDSNG ID+EELKKC  K
Sbjct  2    VEAMQRRECQGCSMKSFNTIILKFPKIDESFRKCRAIFEQFDEDSNGTIDQEELKKCFSK  61

Query  565  LQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMDAPSS-GSTSKIGSPVVES  389
            L+    EEE ++LF +CD++D+  +KF+EFIVLLCL+YLL D P++  + S+IG P +E+
Sbjct  62   LEISFSEEETNDLFEACDINDDLGMKFSEFIVLLCLVYLLKDDPAALHAKSRIGMPNLEA  121

Query  388  TFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISF  209
            TF T+V+ F+FLDKN DG + K ++V+A N+    E+S   +   RF+EMDWD++G ++F
Sbjct  122  TFETLVDTFVFLDKNKDGYVSKNEMVQAINETTSGERSSGRIAMKRFEEMDWDKNGMVNF  181

Query  208  RKFLFAFLDWVGID  167
            ++FLFAF  WVGID
Sbjct  182  KEFLFAFTRWVGID  195



>ref|XP_007020327.1| Calcium-binding EF-hand family protein [Theobroma cacao]
 gb|EOY11852.1| Calcium-binding EF-hand family protein [Theobroma cacao]
Length=230

 Score =   207 bits (528),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 103/209 (49%), Positives = 152/209 (73%), Gaps = 4/209 (2%)
 Frame = -3

Query  790  SPNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDED  614
            SP      ++KLE K++E ++R A    +++S N++ILKFP   E L++ + +FEQFDED
Sbjct  10   SPEMVWVPETKLEAKMVEAMQRRASKGTAMKSFNSIILKFPKIDENLRKCKAIFEQFDED  69

Query  613  SNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMD-A  437
            SNGAID EELKKCL KL+    EEEI++LF +CD++++  +KFNEFIVLLCL++L  D A
Sbjct  70   SNGAIDHEELKKCLNKLEVSFTEEEINDLFNACDINEDMGMKFNEFIVLLCLVHLFKDNA  129

Query  436  PSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPLEKSPSHVTR  257
             S  + S++G   +E+TF T+V+AF+FLDKN DG + K ++V+A N++   E+S   +  
Sbjct  130  TSLEAKSRMGMQNLEATFETLVDAFVFLDKNKDGYVSKNEMVQAINESG--ERSSGRIAM  187

Query  256  TRFKEMDWDRSGKISFRKFLFAFLDWVGI  170
             RF+EMDWD++G ++F++FLFAF  WVGI
Sbjct  188  KRFEEMDWDKNGSVNFKEFLFAFTRWVGI  216



>ref|XP_008219144.1| PREDICTED: probable calcium-binding protein CML21 [Prunus mume]
 ref|XP_008219151.1| PREDICTED: probable calcium-binding protein CML21 [Prunus mume]
Length=227

 Score =   207 bits (527),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 102/218 (47%), Positives = 154/218 (71%), Gaps = 2/218 (1%)
 Frame = -3

Query  817  VGSLLCCHGSPNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIR  641
            +G+++    SP ++S  ++KLE K++E +KR A     ++S N+LILKF    E L++ +
Sbjct  1    MGAVVGKGDSPRQFSIHETKLEAKMVEAMKRRAVKGSVMKSFNSLILKFRKIDESLRKCK  60

Query  640  TVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  461
             +FEQFDEDSNGAID+EE+KKC  KL+    +EEI +LF +CD++++  IKFNEFIVL+C
Sbjct  61   AIFEQFDEDSNGAIDQEEMKKCFYKLEVSFTDEEISDLFEACDINEDMGIKFNEFIVLIC  120

Query  460  LIYLLMDAPSSGSTS-KIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPL  284
            L+YLL D  +   T   +  P +E+TF T+V+AF+FLDKN DG + K ++V+A N+    
Sbjct  121  LVYLLKDDSNDVHTKLHMEMPDLEATFETLVDAFVFLDKNKDGYVSKSEMVQAINETTTG  180

Query  283  EKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGI  170
            E+S   +   RF+EMDWD++G ++F++FLFAF  W+GI
Sbjct  181  ERSSGRIAMKRFEEMDWDKNGMVNFKEFLFAFTRWIGI  218



>ref|XP_009346680.1| PREDICTED: probable calcium-binding protein CML21 [Pyrus x bretschneideri]
Length=227

 Score =   207 bits (526),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 100/218 (46%), Positives = 153/218 (70%), Gaps = 2/218 (1%)
 Frame = -3

Query  817  VGSLLCCHGSPNKYSRLDSKLETKVLEVKRNAPATLSI-RSINALILKFPHFREGLKEIR  641
            +G+++    +  ++S  ++KLE K++E  +   A  SI +S N+LILKFP   E L+  +
Sbjct  1    MGAVVGKSENARRFSIHETKLEAKMVEAMQRRAAKGSIMKSFNSLILKFPKIDESLRNCK  60

Query  640  TVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  461
             +FEQFDEDSNG ID+EE+KKC  KL+    +EEID+LF +CD++++  IKFNEFIVL+C
Sbjct  61   AIFEQFDEDSNGMIDQEEMKKCFYKLEVSFTDEEIDDLFEACDINEDMGIKFNEFIVLIC  120

Query  460  LIYLLMDAPSSGSTS-KIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPL  284
            L++LL D   +  T  ++G P +E+TF T+V+ F+FLDKN DG + K ++V+A N+    
Sbjct  121  LVHLLKDDNKAVHTKLQLGMPEMEATFETLVDGFVFLDKNKDGYVSKSEMVEAINETTTG  180

Query  283  EKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGI  170
            E+S   +   RF+EMDWD++G ++F++FLFAF  W+GI
Sbjct  181  ERSSGRIAMKRFEEMDWDKNGMVNFKEFLFAFTRWIGI  218



>emb|CDP13649.1| unnamed protein product [Coffea canephora]
Length=229

 Score =   207 bits (526),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 100/219 (46%), Positives = 156/219 (71%), Gaps = 3/219 (1%)
 Frame = -3

Query  817  VGSLLCCHGSPNKYSRLDSKLETKVL-EVKRNAPATLSIRSINALILKFPHFREGLKEIR  641
            +G +L    SP  Y   ++KLE K++  ++R      S +S N++ILKFP   E L++ +
Sbjct  1    MGGVLQKGESPKAYLP-ETKLEAKIIGAMQRRESEGSSAKSFNSIILKFPKIDENLRKCK  59

Query  640  TVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  461
             +F++FD D NGAID +ELK+C +KL+    +EEI++LF +CD++D+  +KFNEFIVLLC
Sbjct  60   AIFQEFDMDGNGAIDPQELKQCFRKLEISFSDEEINDLFEACDINDDMGMKFNEFIVLLC  119

Query  460  LIYLLMDAPSS-GSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPL  284
            L+YLL + P++  + S+IG P +E+TF T+V+AF+FLDKN DG++ K ++V+A N+    
Sbjct  120  LVYLLKNDPAAEHAKSRIGLPNLEATFETLVDAFVFLDKNKDGQVSKNEMVEAINETTSG  179

Query  283  EKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGID  167
            E+S   +   RF+EMDWD++G ++F++FLFAF  WVGI+
Sbjct  180  ERSSGRIAMKRFEEMDWDKNGMVNFKEFLFAFTRWVGIE  218



>ref|XP_002532937.1| Troponin C, skeletal muscle, putative [Ricinus communis]
 gb|EEF29441.1| Troponin C, skeletal muscle, putative [Ricinus communis]
Length=227

 Score =   207 bits (526),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 100/202 (50%), Positives = 148/202 (73%), Gaps = 4/202 (2%)
 Frame = -3

Query  766  DSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDRE  590
            ++KLE K++E ++R      SI+S N++ILKFP   E L++ + +FEQFDEDSNG ID+E
Sbjct  16   ETKLEAKMVEAMRRRGAEGCSIKSFNSIILKFPKIDESLRKCKAIFEQFDEDSNGTIDQE  75

Query  589  ELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLM-DAPSSGSTSK  413
            EL+KC  KL+    EEE ++LF +CD++++  +KFNEFIVLLCL+YLL  D+ +  + SK
Sbjct  76   ELRKCFCKLEISFTEEETNDLFEACDINEDMGMKFNEFIVLLCLVYLLKDDSAAVHAKSK  135

Query  412  IGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPLEKSPSHVTRTRFKEMDW  233
            +G P +E+TF T+V+ F FLDKN DG + K ++V+A N++   E+S   +   RF+EMDW
Sbjct  136  MGMPNLEATFETLVDTFAFLDKNKDGYVSKNEMVQAINESG--ERSSGRIAMKRFEEMDW  193

Query  232  DRSGKISFRKFLFAFLDWVGID  167
            D++G ++F++FLFAF  WVGID
Sbjct  194  DKNGMVNFKEFLFAFTRWVGID  215



>ref|XP_002300587.1| calcium-binding EF hand family protein [Populus trichocarpa]
 gb|EEE85392.1| calcium-binding EF hand family protein [Populus trichocarpa]
Length=248

 Score =   207 bits (527),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 112/249 (45%), Positives = 162/249 (65%), Gaps = 29/249 (12%)
 Frame = -3

Query  817  VGSLLCCHGSPNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIR  641
            +G  +   GSP K    ++K+ETKV+E ++R      SI+S N++ILKFP   E  ++ +
Sbjct  1    MGGAVGKAGSPQKAWIPETKIETKVVEAMRRRETHGSSIKSFNSIILKFPKIDESFRKCK  60

Query  640  TVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  461
              FEQFDEDSNG+ID+EEL+KC  KL+    +EEI++LF +CDV+++  +KFNEFIVLLC
Sbjct  61   ATFEQFDEDSNGSIDKEELRKCFHKLETAFTDEEINDLFETCDVNEDMGMKFNEFIVLLC  120

Query  460  LIYLLMDAPS-SGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPL  284
            L+YLL D P+   + S+IG P +E+TF T+V AF+FLDKN DG + K ++V+A N++   
Sbjct  121  LVYLLKDDPAIPQAKSRIGMPDLEATFETLVGAFVFLDKNKDGYVSKSEMVQAINES--G  178

Query  283  EKSPSHVTRTRF------------------------KEMDWDRSGKISFRKFLFAFLDWV  176
            E+S   +   RF                        +EMDWDR+G ++F++FLFAF +WV
Sbjct  179  ERSSGRIAMKRFATRGRYFCLKKLTGTNLGPQFTIAEEMDWDRNGMVNFKEFLFAFTNWV  238

Query  175  GIDGDDEDH  149
            GID D+ED 
Sbjct  239  GID-DNEDE  246



>ref|XP_008353863.1| PREDICTED: probable calcium-binding protein CML21 [Malus domestica]
 ref|XP_008353869.1| PREDICTED: probable calcium-binding protein CML21 [Malus domestica]
Length=227

 Score =   206 bits (524),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 101/218 (46%), Positives = 153/218 (70%), Gaps = 2/218 (1%)
 Frame = -3

Query  817  VGSLLCCHGSPNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIR  641
            +G ++    S  K+S  ++KLE K++E ++R A     ++S N+LILKFP   E L+  +
Sbjct  1    MGGVVGKSESYRKFSIHETKLEAKMVEAMQRRAAKGSVMKSFNSLILKFPKIDESLRNCK  60

Query  640  TVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  461
             +FEQFDEDSNG ID+EE+KKC  KL+    +EEI +LF +CD++++  IKFNEFIVL+C
Sbjct  61   AIFEQFDEDSNGMIDQEEMKKCFSKLEVSFTDEEIIDLFEACDINEDMGIKFNEFIVLIC  120

Query  460  LIYLLMDAPSSGSTS-KIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPL  284
            L++LL D   +  T  ++G P +E+TF T+V+AF+FLDKN DG + K ++V+A N+    
Sbjct  121  LVHLLKDDNKAVHTKLQLGMPELEATFETLVDAFVFLDKNKDGYVSKSEMVEAINETTTG  180

Query  283  EKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGI  170
            E+S   +   RF+EMDWD++G ++F++FLFAF  W+GI
Sbjct  181  ERSSGRIAMKRFEEMDWDKNGMVNFKEFLFAFTRWIGI  218



>ref|XP_008449066.1| PREDICTED: probable calcium-binding protein CML21 [Cucumis melo]
Length=224

 Score =   206 bits (523),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 101/208 (49%), Positives = 145/208 (70%), Gaps = 2/208 (1%)
 Frame = -3

Query  766  DSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDRE  590
            ++KLE K++E ++R A     IRS + ++LKFP   + L+  +T+F+QFDED NG IDR 
Sbjct  17   ETKLEAKMVETMRRRATKGSIIRSFDCILLKFPKIDDSLRNCKTIFQQFDEDLNGIIDRR  76

Query  589  ELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMDAPSSG-STSK  413
            ELKKC   L+  + EEEID+LF +CD+     IKFNEFIVLLCL+YLL D P +  S S+
Sbjct  77   ELKKCFDGLEILLTEEEIDDLFEACDISAAMGIKFNEFIVLLCLVYLLKDDPDAVFSKSQ  136

Query  412  IGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPLEKSPSHVTRTRFKEMDW  233
             G P +E TF ++V+AF+FLDKN DG + K +++ A N+    E+S   +   RF+EMDW
Sbjct  137  FGMPKLEETFESLVDAFVFLDKNKDGYVSKSEMISAINETTSGERSSGRIAMRRFEEMDW  196

Query  232  DRSGKISFRKFLFAFLDWVGIDGDDEDH  149
            D++G ++F++FLFAF  WVGID ++E+ 
Sbjct  197  DKNGMVNFKEFLFAFTRWVGIDENEEEE  224



>ref|XP_008805537.1| PREDICTED: probable calcium-binding protein CML21 [Phoenix dactylifera]
 ref|XP_008805538.1| PREDICTED: probable calcium-binding protein CML21 [Phoenix dactylifera]
Length=227

 Score =   206 bits (523),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 98/208 (47%), Positives = 144/208 (69%), Gaps = 1/208 (0%)
 Frame = -3

Query  790  SPNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDED  614
            + +K+   +S LE K++E ++R A    +I+S N++ILKFP   E L+  + +F+QFDED
Sbjct  9    ASSKHCLPESNLEVKIVEAIRRKASKGSAIKSFNSIILKFPKIDESLRNCKAIFDQFDED  68

Query  613  SNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMDAP  434
            SNG ID EELK+C  KL+    EEEI +LF +CD+ +N  ++FNEFIVLLCL+YLL +  
Sbjct  69   SNGMIDPEELKRCFHKLEISCTEEEISDLFEACDIRENMGMRFNEFIVLLCLVYLLKEPA  128

Query  433  SSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPLEKSPSHVTRT  254
            +  + S +G P +E+TF T+V+AF+ LDKN DG + K ++V A N+    E+S   +   
Sbjct  129  ALQAKSGMGLPNLEATFETLVDAFVLLDKNKDGYVSKNEMVDAINETTAGERSSGCIAMN  188

Query  253  RFKEMDWDRSGKISFRKFLFAFLDWVGI  170
            RF+EMDWD++G +SF++FLFA   WVGI
Sbjct  189  RFEEMDWDKNGMVSFKEFLFACTRWVGI  216



>ref|XP_010063214.1| PREDICTED: LOW QUALITY PROTEIN: probable calcium-binding protein 
CML21 [Eucalyptus grandis]
Length=235

 Score =   206 bits (523),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 101/219 (46%), Positives = 154/219 (70%), Gaps = 3/219 (1%)
 Frame = -3

Query  817  VGSLLCCHGSPNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIR  641
            +G ++    +P K    ++KLE K++E ++R A     ++S N++ILKFP   +  ++ +
Sbjct  1    MGGVIGKGDAPKKAWVPETKLEAKMVEAMQRRASGGSKMKSFNSIILKFPKIDKSFRKCK  60

Query  640  TVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  461
            ++FEQFDEDSN  ID+EEL+ C  KL+    +EEI++LF +CD++D+  IKFNEFIVLLC
Sbjct  61   SIFEQFDEDSNHVIDKEELRHCFNKLEISFSDEEINDLFEACDINDDMGIKFNEFIVLLC  120

Query  460  LIYLLMDAPSSG-STSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPL  284
            L++LL D P++  + SK+G P +E+TF T+V+AF+FLDKN DG + K ++V A N+    
Sbjct  121  LVHLLKDDPTAQLAKSKMGMPDLETTFETLVDAFVFLDKNKDGHVSKSEMVDAINETASG  180

Query  283  EKSPSHVTRTRFKEMDWDR-SGKISFRKFLFAFLDWVGI  170
            E+S   +   RF+EMDWDR +G ++F++FLFAF  WVGI
Sbjct  181  ERSSGQIAMKRFEEMDWDRKNGMVNFKEFLFAFTRWVGI  219



>ref|XP_007205832.1| hypothetical protein PRUPE_ppa010999mg [Prunus persica]
 gb|EMJ07031.1| hypothetical protein PRUPE_ppa010999mg [Prunus persica]
Length=227

 Score =   205 bits (522),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 101/218 (46%), Positives = 154/218 (71%), Gaps = 2/218 (1%)
 Frame = -3

Query  817  VGSLLCCHGSPNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIR  641
            +G+++    SP ++S  ++KLE K++E +KR A     ++S ++LILKF    E L++ +
Sbjct  1    MGAVVGKGDSPRQFSIHETKLEAKMVEAMKRRAVKGSVMKSFDSLILKFRKIDESLRKCK  60

Query  640  TVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  461
             +FEQFDEDSNGAID+EE+KKC  KL+    +EEI +LF +CD++++  IKFNEFIVL+C
Sbjct  61   AIFEQFDEDSNGAIDQEEMKKCFYKLEVSFTDEEISDLFEACDINEDMGIKFNEFIVLIC  120

Query  460  LIYLLMDAPSSGSTS-KIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPL  284
            L+YLL D  +   T   +  P +E+TF T+V+AF+FLDKN DG + K ++V+A N+    
Sbjct  121  LVYLLKDDSNDVHTKLHMEMPDLEATFETLVDAFVFLDKNKDGYVSKSEMVQAINETTTG  180

Query  283  EKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGI  170
            E+S   +   RF+EMDWD++G ++F++FLFAF  W+GI
Sbjct  181  ERSSGRIAMKRFEEMDWDKNGMVNFKEFLFAFTRWIGI  218



>ref|XP_008384627.1| PREDICTED: probable calcium-binding protein CML21 [Malus domestica]
 ref|XP_008384628.1| PREDICTED: probable calcium-binding protein CML21 [Malus domestica]
Length=227

 Score =   205 bits (522),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 100/218 (46%), Positives = 152/218 (70%), Gaps = 2/218 (1%)
 Frame = -3

Query  817  VGSLLCCHGSPNKYSRLDSKLETKVLEVKRNAPATLSI-RSINALILKFPHFREGLKEIR  641
            +G+++    +  ++S  ++KLE K++E  +   A  SI +S N LILKFP   E  +  +
Sbjct  1    MGAVVGKSENARRFSIHETKLEAKMVEAMQRRAAKGSIMKSFNNLILKFPKIDESFRNCK  60

Query  640  TVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  461
             +FEQFDEDSNG ID+EE+KKC  KL+    +EEID+LF +CD++++  IKFNEFIVL+C
Sbjct  61   AIFEQFDEDSNGMIDQEEMKKCFYKLEVSFTDEEIDDLFEACDINEDMGIKFNEFIVLIC  120

Query  460  LIYLLMDAPSSGSTS-KIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPL  284
            L++LL D   +  T  ++G P +E+TF T+V+AF+FLDKN DG + K ++V+A N+    
Sbjct  121  LVHLLKDDNKAVHTKLQLGLPEMEATFETLVDAFVFLDKNKDGYVSKSEMVEAINETTTG  180

Query  283  EKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGI  170
            E+S   +   RF+EMDWD++G ++F++FLFAF  W+GI
Sbjct  181  ERSSGRIAMKRFEEMDWDKNGMVNFKEFLFAFTRWIGI  218



>ref|XP_004294881.1| PREDICTED: probable calcium-binding protein CML21 [Fragaria vesca 
subsp. vesca]
 ref|XP_011461556.1| PREDICTED: probable calcium-binding protein CML21 [Fragaria vesca 
subsp. vesca]
 ref|XP_011461557.1| PREDICTED: probable calcium-binding protein CML21 [Fragaria vesca 
subsp. vesca]
 ref|XP_011461558.1| PREDICTED: probable calcium-binding protein CML21 [Fragaria vesca 
subsp. vesca]
 ref|XP_011461559.1| PREDICTED: probable calcium-binding protein CML21 [Fragaria vesca 
subsp. vesca]
 ref|XP_011461561.1| PREDICTED: probable calcium-binding protein CML21 [Fragaria vesca 
subsp. vesca]
 ref|XP_011461562.1| PREDICTED: probable calcium-binding protein CML21 [Fragaria vesca 
subsp. vesca]
 ref|XP_011461563.1| PREDICTED: probable calcium-binding protein CML21 [Fragaria vesca 
subsp. vesca]
 ref|XP_011461564.1| PREDICTED: probable calcium-binding protein CML21 [Fragaria vesca 
subsp. vesca]
 ref|XP_011461565.1| PREDICTED: probable calcium-binding protein CML21 [Fragaria vesca 
subsp. vesca]
 ref|XP_011461566.1| PREDICTED: probable calcium-binding protein CML21 [Fragaria vesca 
subsp. vesca]
 ref|XP_011461567.1| PREDICTED: probable calcium-binding protein CML21 [Fragaria vesca 
subsp. vesca]
 ref|XP_011461568.1| PREDICTED: probable calcium-binding protein CML21 [Fragaria vesca 
subsp. vesca]
Length=228

 Score =   205 bits (521),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 98/218 (45%), Positives = 152/218 (70%), Gaps = 2/218 (1%)
 Frame = -3

Query  817  VGSLLCCHGSPNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIR  641
            +G+++    SP   S  ++KLE K++E ++R A     ++S N++ILKFP   E L+  +
Sbjct  1    MGAVVGKAESPRSLSISETKLEAKMVEAMQRRAAKGSVMKSFNSIILKFPKIDESLRNCK  60

Query  640  TVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  461
             +F+QFDEDSNGAID +ELK+   KL+    +EEID+LF +CD++++  I FNEFIVL+C
Sbjct  61   DIFQQFDEDSNGAIDHDELKRAFSKLEVSFTDEEIDDLFAACDINEDMGINFNEFIVLIC  120

Query  460  LIYLLMDAPSSGSTS-KIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPL  284
            +++LL D  ++G     +G P +E+TF T+V+AF+FLDKN DG + K ++V+A N+    
Sbjct  121  VVFLLKDDQNAGEKKVDMGMPKLEATFETLVDAFVFLDKNKDGYVSKSEMVQAINETTTG  180

Query  283  EKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGI  170
            E+S   +   RF+EMDWDR+G ++F++FLFAF  W+GI
Sbjct  181  ERSSGRIAMKRFEEMDWDRNGMVNFKEFLFAFTRWIGI  218



>ref|XP_010676135.1| PREDICTED: probable calcium-binding protein CML21 [Beta vulgaris 
subsp. vulgaris]
Length=230

 Score =   205 bits (521),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 97/218 (44%), Positives = 147/218 (67%), Gaps = 2/218 (1%)
 Frame = -3

Query  817  VGSLLCCHGSPNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIR  641
            +G  L    SP +    ++KLE K++E ++  A     ++S N +ILKFP   +  ++ +
Sbjct  2    MGGALGVPESPKRGYLPETKLEAKMVEAMQERASKGTVMKSFNTIILKFPKIDQSFRKCK  61

Query  640  TVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  461
             +FE+FDED N  ID  ELK C +KL+    EEE+D+ F++CD+++N  +KFNEFIVLLC
Sbjct  62   AIFEEFDEDKNEVIDHNELKHCFRKLEISFTEEEVDDFFKACDINENMGMKFNEFIVLLC  121

Query  460  LIYLLM-DAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPL  284
            L+YLL  D P +G  S++G P +E+TF T+V+AF FLDKN DG + K ++++A N+    
Sbjct  122  LVYLLQEDQPKTGVKSRMGLPNLEATFETLVDAFAFLDKNKDGYVSKTEMIQAINETTSG  181

Query  283  EKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGI  170
            E+S   +   RF+EMDWD++G ++F++FLFAF  WVGI
Sbjct  182  ERSSGRIAMKRFEEMDWDKNGMVNFKEFLFAFTRWVGI  219



>ref|XP_004965909.1| PREDICTED: probable calcium-binding protein CML21-like isoform 
X1 [Setaria italica]
 ref|XP_004965910.1| PREDICTED: probable calcium-binding protein CML21-like isoform 
X2 [Setaria italica]
Length=224

 Score =   204 bits (520),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 97/213 (46%), Positives = 149/213 (70%), Gaps = 1/213 (0%)
 Frame = -3

Query  787  PNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDEDS  611
              K S   SKLE K+++ +++ A    S++S + +++KFP   E  ++ +T+FEQFDEDS
Sbjct  10   TQKRSFHGSKLEAKMVDAMQQRASHGTSLKSFDGIVMKFPRIDESFRKCKTIFEQFDEDS  69

Query  610  NGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMDAPS  431
            NG ID+EELK C QKL+    EEEI +LF +CD++++  +KFNEFIV LCL+YLL +   
Sbjct  70   NGEIDKEELKHCFQKLEISFTEEEISDLFEACDINEDMGMKFNEFIVFLCLVYLLNEPAV  129

Query  430  SGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPLEKSPSHVTRTR  251
            S +  K+G   +E+TF T+V+AF+FLDKN DG + K ++++A  +    E+S   +   R
Sbjct  130  SEAKIKMGLGNLEATFETLVDAFVFLDKNKDGYVSKDEMIQAITETTTGERSSGRIAMKR  189

Query  250  FKEMDWDRSGKISFRKFLFAFLDWVGIDGDDED  152
            F+EMDWD++G ++F++FLFAF  WVGID +++D
Sbjct  190  FEEMDWDKNGMVTFKEFLFAFTRWVGIDENEDD  222



>ref|XP_006647028.1| PREDICTED: probable calcium-binding protein CML21-like isoform 
X1 [Oryza brachyantha]
 ref|XP_006647029.1| PREDICTED: probable calcium-binding protein CML21-like isoform 
X2 [Oryza brachyantha]
Length=227

 Score =   204 bits (520),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 100/217 (46%), Positives = 151/217 (70%), Gaps = 2/217 (1%)
 Frame = -3

Query  817  VGSLLCCHGSPNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIR  641
            +G ++    SP ++S   SKLE K++E +++ A    S++S N++I+KFP   E L+  R
Sbjct  1    MGGVIGRGDSP-RHSSPASKLEKKMVEAMQQRAQQGTSVKSFNSVIMKFPKIDESLRNCR  59

Query  640  TVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  461
            T+F+QFDEDSNG ID+EELK C QKL     +EEI +LF++CD+ ++  +KFNEFIV LC
Sbjct  60   TIFQQFDEDSNGEIDQEELKHCFQKLGIAFTDEEIKDLFQACDIYEHMGMKFNEFIVFLC  119

Query  460  LIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPLE  281
            L+YLL D   S +  ++G   +E TF T+V++F+FLDKN DG + K ++++A N+    E
Sbjct  120  LVYLLNDPLVSEARKRMGLGNLEPTFETLVDSFVFLDKNKDGYVSKNEMIQAINETIGGE  179

Query  280  KSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGI  170
            +S   +   RF+EMDWD++G ++F++FLFAF  WVGI
Sbjct  180  RSSGRIGMKRFEEMDWDKNGTVTFKEFLFAFTRWVGI  216



>ref|XP_004516273.1| PREDICTED: probable calcium-binding protein CML22-like [Cicer 
arietinum]
Length=216

 Score =   204 bits (518),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 97/220 (44%), Positives = 151/220 (69%), Gaps = 4/220 (2%)
 Frame = -3

Query  817  VGSLLCCHGSPNKYSRLDSKLETKVLEVKRNAPATLSIRSINALILKFPHFREGLKEIRT  638
            +G+++CC    ++   L+ KLE K+ E++RN      ++SI+++++ FP F+E LK +R 
Sbjct  1    MGAIICCISKSSEKKSLERKLEKKIAEIRRNKFGQSKLKSIDSIVMLFPMFKERLKTLRG  60

Query  637  VFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCL  458
            +FEQ+DEDSNG+I+  EL+  L+ LQ H+ E+EI+ +F  CD+D ++ I+FNEFIVLLCL
Sbjct  61   MFEQYDEDSNGSIEPHELEIFLEHLQLHLQEQEIESIFHYCDIDGSKGIQFNEFIVLLCL  120

Query  457  IYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPLEK  278
            I++L +  SS ++ K     +   F+TIVE FLF DKNGDGKL KKD+V+  N+  P   
Sbjct  121  IHILTEPLSSDNSPKAKLAQLGEVFDTIVEIFLFFDKNGDGKLDKKDMVRTMNETHPRFS  180

Query  277  SPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDD  158
                +T     EMDWD++G+++  +FLF F++W+GID D+
Sbjct  181  GYFFIT----GEMDWDKNGQVTLIEFLFGFINWIGIDVDE  216



>ref|XP_011097697.1| PREDICTED: probable calcium-binding protein CML21 [Sesamum indicum]
 ref|XP_011097698.1| PREDICTED: probable calcium-binding protein CML21 [Sesamum indicum]
 ref|XP_011097699.1| PREDICTED: probable calcium-binding protein CML21 [Sesamum indicum]
Length=229

 Score =   204 bits (518),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 100/209 (48%), Positives = 151/209 (72%), Gaps = 5/209 (2%)
 Frame = -3

Query  766  DSKLETKVLEV--KRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDR  593
            ++KLE K++E   KR A  + S++S N++ILKFP   E  ++ +T FE+FDED NG+I+ 
Sbjct  17   ETKLEAKIIEAVRKREAQGS-SMKSFNSIILKFPKIDESFRKCKTTFEEFDEDGNGSIEP  75

Query  592  EELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMDAPSSGS-TS  416
            +ELK C +KL+    +EEID+LF +CD++++ +IKFNEFIVLLCL+YLL + P++    S
Sbjct  76   QELKHCFRKLEIKFTDEEIDDLFEACDINEDMRIKFNEFIVLLCLVYLLKEYPTAEQDKS  135

Query  415  KIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPLEKSPSHVTRTRFKEMD  236
            + G P +E+TF T+V+ F+FLDKN DG + + ++V A N+    E+S   +   RF+EMD
Sbjct  136  QRGMPNLEATFETLVDTFVFLDKNRDGYVSRNEMVHAINETTTGERSSGRIAMKRFEEMD  195

Query  235  WDRSGKISFRKFLFAFLDWVGI-DGDDED  152
            WD++G ++F++FLFAF  WVGI D DDE+
Sbjct  196  WDKNGMVNFKEFLFAFTHWVGIEDMDDEE  224



>ref|NP_001132390.1| uncharacterized protein LOC100193836 [Zea mays]
 gb|ACF81210.1| unknown [Zea mays]
 gb|ACG46514.1| calcium ion binding protein [Zea mays]
 gb|AFW87516.1| calcium ion binding protein [Zea mays]
Length=226

 Score =   204 bits (518),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 100/217 (46%), Positives = 154/217 (71%), Gaps = 2/217 (1%)
 Frame = -3

Query  817  VGSLLCCHGSPNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIR  641
            +G++L  H + +K S   SKLE K+++ +++ A    S++S +++I+KFP   E  ++ +
Sbjct  1    MGAVLGRHDT-HKRSSHGSKLEVKMVDAMQQRASHGTSLKSFDSIIMKFPKIDESFRKCK  59

Query  640  TVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  461
            T+FEQFDEDSNG ID+EELK C QKL+    EEEI +LF +CD++++  +KFNEFIV LC
Sbjct  60   TIFEQFDEDSNGEIDKEELKHCFQKLEISFTEEEICDLFEACDINEDMGMKFNEFIVFLC  119

Query  460  LIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPLE  281
            L+YLL +A    +  K+G   +E+TF T+V+AF+FLDKN DG + K ++++A N+    E
Sbjct  120  LVYLLNEAAVLEAKIKMGLGNLEATFETLVDAFVFLDKNKDGYVSKDEMIQAINETTTGE  179

Query  280  KSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGI  170
            +S   +   RF+EMDWD++G ++F++FLFAF  WVGI
Sbjct  180  RSSGPIAMKRFEEMDWDKNGMVTFKEFLFAFTRWVGI  216



>ref|XP_009379121.1| PREDICTED: probable calcium-binding protein CML21 [Pyrus x bretschneideri]
 ref|XP_009379122.1| PREDICTED: probable calcium-binding protein CML21 [Pyrus x bretschneideri]
Length=227

 Score =   203 bits (517),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 100/218 (46%), Positives = 152/218 (70%), Gaps = 2/218 (1%)
 Frame = -3

Query  817  VGSLLCCHGSPNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIR  641
            +G ++    S  K+S  ++KLE K++E ++R A     ++S N+LILKFP   E L+  +
Sbjct  1    MGGVVGKSESSRKFSIHETKLEAKMVEAMQRRAAKGSVMKSFNSLILKFPKIDESLRNCK  60

Query  640  TVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  461
             +FEQFDEDSNG ID+EE+KKC  KL+    +EEI +LF +CD++++  IKFNEFIVL+C
Sbjct  61   AIFEQFDEDSNGMIDQEEMKKCFSKLEVSFTDEEIIDLFEACDINEDMGIKFNEFIVLIC  120

Query  460  LIYLLMDAPSSGSTS-KIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPL  284
            L++LL D   +  T  ++G   +E+TF T+V+AF+FLDKN DG + K ++V+A N+    
Sbjct  121  LVHLLKDDNKAVHTKLQLGMLELEATFETLVDAFVFLDKNKDGYVSKSEMVEAINETTTG  180

Query  283  EKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGI  170
            E+S   +   RF+EMDWD++G ++F++FLFAF  W+GI
Sbjct  181  ERSSGRIAMKRFEEMDWDKNGMVNFKEFLFAFTRWIGI  218



>gb|EEC72684.1| hypothetical protein OsI_06250 [Oryza sativa Indica Group]
Length=228

 Score =   203 bits (516),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 96/210 (46%), Positives = 145/210 (69%), Gaps = 1/210 (0%)
 Frame = -3

Query  796  HGSPNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFD  620
             G   +++   SKLE K++E +++ A    S++S N++I+KFP   E L+  R +F+QFD
Sbjct  7    RGDSPRHTSPASKLERKMVEAMQQRAQKGTSVKSFNSVIMKFPKIDESLRNCRIIFQQFD  66

Query  619  EDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMD  440
            EDSNG ID++ELK C QKL     +EEI +LF++CD+ +N  +KFNEFIV LCL+YLL D
Sbjct  67   EDSNGEIDQQELKHCFQKLDISFTDEEIKDLFQACDIYENMGMKFNEFIVFLCLVYLLND  126

Query  439  APSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPLEKSPSHVT  260
               S +  ++G   +E TF T+V++F+FLDKN DG + K ++++A N+    E+S   + 
Sbjct  127  PLVSEARKRMGLGSLEPTFETLVDSFVFLDKNKDGYVSKNEMIQAINETIGGERSSGRIG  186

Query  259  RTRFKEMDWDRSGKISFRKFLFAFLDWVGI  170
              RF+EMDWD++G ++F++FLFAF  WVGI
Sbjct  187  MKRFEEMDWDKNGTVTFKEFLFAFTRWVGI  216



>ref|NP_001046205.1| Os02g0198200 [Oryza sativa Japonica Group]
 dbj|BAD25460.1| calcium-binding EF hand-like protein [Oryza sativa Japonica Group]
 dbj|BAF08119.1| Os02g0198200 [Oryza sativa Japonica Group]
 dbj|BAG86728.1| unnamed protein product [Oryza sativa Japonica Group]
Length=228

 Score =   202 bits (515),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 96/213 (45%), Positives = 146/213 (69%), Gaps = 1/213 (0%)
 Frame = -3

Query  805  LCCHGSPNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIRTVFE  629
            +   G   +++   SKLE K++E +++ A    S++S N++I+KFP   E L+  R +F+
Sbjct  4    IVGRGDSPRHTSPASKLERKMVEAMQQRAQKGTSVKSFNSVIMKFPKIDESLRNCRIIFQ  63

Query  628  QFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYL  449
            QFDEDSNG ID++ELK C QKL     +EEI +LF++CD+ +N  +KFNEFIV LCL+YL
Sbjct  64   QFDEDSNGEIDQQELKHCFQKLDISFTDEEIKDLFQACDIYENMGMKFNEFIVFLCLVYL  123

Query  448  LMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPLEKSPS  269
            L D   S +  ++G   +E TF T+V++F+FLDKN DG + K ++++A N+    E+S  
Sbjct  124  LNDPLVSEARKRMGLGSLEPTFETLVDSFVFLDKNKDGYVSKNEMIQAINETIGGERSSG  183

Query  268  HVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGI  170
             +   RF+EMDWD++G ++F++FLFAF  WVGI
Sbjct  184  RIGMKRFEEMDWDKNGTVTFKEFLFAFTRWVGI  216



>gb|EMT21140.1| Putative calcium-binding protein CML21 [Aegilops tauschii]
Length=226

 Score =   202 bits (515),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 98/209 (47%), Positives = 143/209 (68%), Gaps = 1/209 (0%)
 Frame = -3

Query  793  GSPNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDE  617
            G   +YS   +KLE K+++ +++ A    S+RS N++I+KFP   E L+  R +F+QFDE
Sbjct  8    GDTPRYSSAATKLEQKMVDAMQQRAQQGTSLRSFNSVIMKFPKIDESLRNCRIIFQQFDE  67

Query  616  DSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMDA  437
            DSNG ID+ ELK C QKL     +EEI +LF +CD+ ++  +KFNEFIV LCL+YLL D 
Sbjct  68   DSNGEIDQLELKHCFQKLDISFTDEEIKDLFEACDIYEHMGMKFNEFIVFLCLVYLLNDP  127

Query  436  PSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPLEKSPSHVTR  257
              S +  ++G   +E TF T+V+AF+FLDKN DG + K +V++A N+    E+S   +  
Sbjct  128  AVSEARKRMGLGNLEPTFETLVDAFVFLDKNKDGYVSKNEVIEAINETSAGERSSGRIGV  187

Query  256  TRFKEMDWDRSGKISFRKFLFAFLDWVGI  170
             RF+EMDWD++G ++F++FLFAF  WVGI
Sbjct  188  KRFEEMDWDKNGTVTFKEFLFAFTRWVGI  216



>ref|XP_010327214.1| PREDICTED: probable calcium-binding protein CML21 [Solanum lycopersicum]
Length=230

 Score =   202 bits (515),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 102/220 (46%), Positives = 154/220 (70%), Gaps = 4/220 (2%)
 Frame = -3

Query  817  VGSLLCCHGSPN--KYSRLDSKLETKVLEVK-RNAPATLSIRSINALILKFPHFREGLKE  647
            +G +L  + SP+  K S  ++KLE K+ E   R      SIRS ++L+LKFP   E L++
Sbjct  1    MGGVLGKNESPSSPKASVPETKLEAKITEAMLRRETEGSSIRSFDSLVLKFPKIDENLRK  60

Query  646  IRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVL  467
             + +F++FDEDSNGAID +ELK    KL+ +  +EEI +LF +CD++++  I+F+EFIVL
Sbjct  61   CKVIFQEFDEDSNGAIDPQELKHAFNKLEINFTDEEISDLFEACDINEDMGIEFSEFIVL  120

Query  466  LCLIYLLMDAPSS-GSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAF  290
            LCL+YLL D PS+  + S++G P +E TF T+V+AF+FLDKN DG + + ++V+A N+  
Sbjct  121  LCLVYLLKDDPSALHAKSRMGLPNLEVTFETLVDAFVFLDKNKDGYVSRNEMVQAINETI  180

Query  289  PLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGI  170
              E+S   +   RF+EMDWD++G ++F++FLFAF  WVGI
Sbjct  181  SGERSSGRIAMRRFEEMDWDKNGMVNFKEFLFAFTHWVGI  220



>ref|XP_011095629.1| PREDICTED: probable calcium-binding protein CML21 [Sesamum indicum]
 ref|XP_011095630.1| PREDICTED: probable calcium-binding protein CML21 [Sesamum indicum]
 ref|XP_011095632.1| PREDICTED: probable calcium-binding protein CML21 [Sesamum indicum]
 ref|XP_011095633.1| PREDICTED: probable calcium-binding protein CML21 [Sesamum indicum]
 ref|XP_011095634.1| PREDICTED: probable calcium-binding protein CML21 [Sesamum indicum]
 ref|XP_011095635.1| PREDICTED: probable calcium-binding protein CML21 [Sesamum indicum]
 ref|XP_011095636.1| PREDICTED: probable calcium-binding protein CML21 [Sesamum indicum]
Length=229

 Score =   202 bits (515),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 99/225 (44%), Positives = 156/225 (69%), Gaps = 3/225 (1%)
 Frame = -3

Query  817  VGSLLCCHGSPNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIR  641
            +G ++  + SP K +  ++KLE ++ E ++R      +I+S N++ILKFP     L++ +
Sbjct  1    MGGVIGKNESP-KAAVSETKLEARINEAIRRREVEGSTIKSFNSIILKFPKIDRSLRKCK  59

Query  640  TVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  461
              FE FDED NGAIDREELK C  KL+    +EE+++LF +CD++++  +KFNEFIVLLC
Sbjct  60   ATFEDFDEDGNGAIDREELKHCFHKLEISFTDEEVNDLFEACDINEDMGMKFNEFIVLLC  119

Query  460  LIYLLMDAPSS-GSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPL  284
            L+YLL + P++  + S++G   +E+TF T+V+AF+FLDKN DG + K ++V A N+    
Sbjct  120  LVYLLKEDPAAEHAKSRMGMLNLEATFETLVDAFVFLDKNKDGYVSKNEMVDAINETTSG  179

Query  283  EKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDEDH  149
            E+S   +   RF+EMDWD++G ++F++F+FAF  WVGI+  D+D 
Sbjct  180  ERSSGRIAMKRFEEMDWDKNGMVNFKEFVFAFTRWVGIEEGDDDE  224



>ref|NP_001148425.1| calcium ion binding protein [Zea mays]
 gb|ACG31429.1| calcium ion binding protein [Zea mays]
Length=225

 Score =   202 bits (514),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 96/210 (46%), Positives = 146/210 (70%), Gaps = 1/210 (0%)
 Frame = -3

Query  793  GSPNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDE  617
            G   +++   SKLE K++E +++ A    S++S+N++I+KFP   E L++ RT+F+QFDE
Sbjct  7    GDSPRHTSSASKLEKKMVEAMQQRALKGTSVKSLNSVIMKFPKIDESLRKCRTIFQQFDE  66

Query  616  DSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMDA  437
            DSNG ID+ ELK C Q L     ++EI +LF++CD+ +N  +KFNEFIV LCL+YLL D 
Sbjct  67   DSNGEIDQLELKHCFQNLGIESTDQEIKDLFQACDIYENMGMKFNEFIVFLCLVYLLDDP  126

Query  436  PSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPLEKSPSHVTR  257
              S    ++G   +E TF T+VE+F+FLDKN DG + K ++++A N+    E+S   +  
Sbjct  127  AVSEVRKRMGLGSLEPTFETLVESFVFLDKNKDGYVSKSEMIQAINETIGGERSSGRIGM  186

Query  256  TRFKEMDWDRSGKISFRKFLFAFLDWVGID  167
             RF+EMDWD++G ++F++FLFAF  WVGI+
Sbjct  187  KRFEEMDWDKNGTVTFKEFLFAFTHWVGIN  216



>ref|XP_008358900.1| PREDICTED: LOW QUALITY PROTEIN: probable calcium-binding protein 
CML21 [Malus domestica]
Length=227

 Score =   202 bits (514),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 99/218 (45%), Positives = 151/218 (69%), Gaps = 2/218 (1%)
 Frame = -3

Query  817  VGSLLCCHGSPNKYSRLDSKLETKVLEVKRNAPATLSI-RSINALILKFPHFREGLKEIR  641
            +G+++    +  ++S  ++KLE K++E  +   A  SI +S N LILKFP   E  +  +
Sbjct  1    MGAVVGKSENARRFSIHETKLEAKMVEAMQRRAAKGSIMKSFNNLILKFPKIDESFRNCK  60

Query  640  TVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  461
             +FEQFDEDSNG ID+EE+KKC  KL+    +EEID+LF +CD++++  IKFNEFIVL+C
Sbjct  61   AIFEQFDEDSNGMIDQEEMKKCFYKLEVSFTDEEIDDLFEACDINEDMGIKFNEFIVLIC  120

Query  460  LIYLLMDAPSSGSTS-KIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPL  284
            L++LL D   +  T  ++G P +E+TF T+V+AF+FLDKN DG + K ++V+A N+    
Sbjct  121  LVHLLKDDNKAVHTKLQLGLPEMEATFETLVDAFVFLDKNKDGYVSKSEMVEAINETTTG  180

Query  283  EKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGI  170
            E+S   +   RF+EMDW ++G ++F++FLFAF  W+GI
Sbjct  181  ERSSGRIAMKRFEEMDWXKNGMVNFKEFLFAFTRWIGI  218



>ref|XP_002451725.1| hypothetical protein SORBIDRAFT_04g006670 [Sorghum bicolor]
 gb|EES04701.1| hypothetical protein SORBIDRAFT_04g006670 [Sorghum bicolor]
Length=228

 Score =   202 bits (515),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 99/209 (47%), Positives = 144/209 (69%), Gaps = 1/209 (0%)
 Frame = -3

Query  793  GSPNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDE  617
            G   ++S   SKLE K++E +K+ A    S++S N++I+KFP   E L+  RT+F+QFDE
Sbjct  7    GDSPRHSSPASKLEKKMVEAMKQRALKGTSMKSFNSVIMKFPKIDENLRNCRTIFQQFDE  66

Query  616  DSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMDA  437
            DSNG ID+ ELK C QKL     +EEI  LF++CD+ ++  +KFNEFIV LCL+YLL D 
Sbjct  67   DSNGEIDQLELKHCFQKLGIESTDEEIKALFQACDIYEHMGMKFNEFIVFLCLVYLLNDP  126

Query  436  PSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPLEKSPSHVTR  257
              S +  ++G   +E TF T+VE+F+FLDKN DG + K ++++A N+    E+S   +  
Sbjct  127  AVSEARKRMGLGNLEPTFETLVESFVFLDKNKDGYVSKSEMIQAINETIGGERSSGRIGV  186

Query  256  TRFKEMDWDRSGKISFRKFLFAFLDWVGI  170
             RF+EMDWD++G ++F++FLFAF  WVGI
Sbjct  187  KRFEEMDWDKNGTVTFKEFLFAFTRWVGI  215



>ref|XP_006352556.1| PREDICTED: probable calcium-binding protein CML21-like [Solanum 
tuberosum]
Length=237

 Score =   202 bits (514),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 102/220 (46%), Positives = 154/220 (70%), Gaps = 4/220 (2%)
 Frame = -3

Query  817  VGSLLCCHGSPN--KYSRLDSKLETKVLEVK-RNAPATLSIRSINALILKFPHFREGLKE  647
            +G +L  + SP+  K S  ++KLE K+ E   R      SIRS ++L+LKFP   E L++
Sbjct  1    MGGVLGKNESPSSPKASVPETKLEAKITEAMLRRETEGSSIRSFDSLVLKFPKIDENLRK  60

Query  646  IRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVL  467
             + +F++FDEDSNGAID +ELK    KL+ +  +EEI +LF +CD++++  I+F+EFIVL
Sbjct  61   CKVIFQEFDEDSNGAIDPQELKHAFNKLEINFTDEEISDLFEACDINEDMGIEFSEFIVL  120

Query  466  LCLIYLLMDAPSS-GSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAF  290
            LCL+YLL D PS+  + S++G P +E TF T+V+AF+FLDKN DG + + ++V+A N+  
Sbjct  121  LCLVYLLKDDPSALHAKSRMGLPNLEVTFETLVDAFVFLDKNKDGYVSRNEMVQAINETI  180

Query  289  PLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGI  170
              E+S   +   RF+EMDWD++G ++F++FLFAF  WVGI
Sbjct  181  SGERSSGRIAMRRFEEMDWDKNGMVNFKEFLFAFTHWVGI  220



>gb|EEC78513.1| hypothetical protein OsI_18448 [Oryza sativa Indica Group]
 gb|EEE62320.1| hypothetical protein OsJ_17109 [Oryza sativa Japonica Group]
Length=231

 Score =   202 bits (514),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 93/216 (43%), Positives = 144/216 (67%), Gaps = 2/216 (1%)
 Frame = -3

Query  781  KYSRLDSKLETKVLEV--KRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDEDSN  608
            KY R++  L+ KV E   +R      + RS+N++ +  P F+EGL+ IR VF+Q+DEDSN
Sbjct  13   KYRRVEKDLDKKVAEALKERTKSKKKTFRSVNSITMGLPRFKEGLRNIRDVFDQYDEDSN  72

Query  607  GAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMDAPSS  428
            G ID EEL+ CL KLQ  + EEEID + R CD+D+ + I+F EF+V LCL+YLL  +  +
Sbjct  73   GTIDNEELRNCLNKLQVQMSEEEIDNIHRYCDIDNRKGIQFPEFVVFLCLMYLLFGSDVT  132

Query  427  GSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPLEKSPSHVTRTRF  248
               S+  S  +   F+ +++AFLF DK+G+GK+ +KDV +  N+A   E++PSH+T   F
Sbjct  133  YRVSEFESARLNYVFDELIDAFLFFDKDGNGKMKRKDVTQRMNEATHQERTPSHITSQLF  192

Query  247  KEMDWDRSGKISFRKFLFAFLDWVGIDGDDEDHMAE  140
            KEMD +R+G ++ ++FL + + W G++ DD++   E
Sbjct  193  KEMDLNRNGHVNLKEFLLSIIRWAGVETDDDEARNE  228



>gb|AFW66169.1| calcium ion binding protein [Zea mays]
Length=225

 Score =   202 bits (513),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 96/210 (46%), Positives = 146/210 (70%), Gaps = 1/210 (0%)
 Frame = -3

Query  793  GSPNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDE  617
            G   +++   SKLE K++E +++ A    S++S+N++I+KFP   E L++ RT+F+QFDE
Sbjct  7    GDSPRHTSPASKLEKKMVEAMQQRALKGTSVKSLNSVIMKFPKIDESLRKCRTIFQQFDE  66

Query  616  DSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMDA  437
            DSNG ID+ ELK C Q L     ++EI +LF++CD+ +N  +KFNEFIV LCL+YLL D 
Sbjct  67   DSNGEIDQLELKHCFQNLGIESTDQEIKDLFQACDIYENMGMKFNEFIVFLCLVYLLDDP  126

Query  436  PSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPLEKSPSHVTR  257
              S    ++G   +E TF T+VE+F+FLDKN DG + K ++++A N+    E+S   +  
Sbjct  127  AVSEVRKRMGLGSLEPTFETLVESFVFLDKNKDGYVSKSEMIQAINETIGGERSSGRIGM  186

Query  256  TRFKEMDWDRSGKISFRKFLFAFLDWVGID  167
             RF+EMDWD++G ++F++FLFAF  WVGI+
Sbjct  187  KRFEEMDWDKNGTVTFKEFLFAFTHWVGIN  216



>ref|XP_010233984.1| PREDICTED: probable calcium-binding protein CML21 isoform X2 
[Brachypodium distachyon]
Length=226

 Score =   202 bits (513),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 98/210 (47%), Positives = 145/210 (69%), Gaps = 7/210 (3%)
 Frame = -3

Query  796  HGSPNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFD  620
            HGSP       SKLE K++E +++ A    +++S N++I+KFP   E L++ R +F+QFD
Sbjct  13   HGSPA------SKLEQKMVEAMQQRAQQGTTMKSFNSVIMKFPKIDESLRKCRIIFQQFD  66

Query  619  EDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMD  440
            EDSNG ID+EELK C QKL     +EEI +LF +CD+ ++  +KFNEFIV LCL+YLL D
Sbjct  67   EDSNGEIDQEELKHCFQKLDISFTDEEIKDLFEACDIYEHMGMKFNEFIVFLCLVYLLND  126

Query  439  APSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPLEKSPSHVT  260
               S +  ++G   +E TF T+V++F+FLDKN DG + K +V++A N+    E+S   + 
Sbjct  127  PAVSEARKRMGLGNLEPTFETLVDSFVFLDKNKDGYVSKNEVIEAINETTAGERSSGRIG  186

Query  259  RTRFKEMDWDRSGKISFRKFLFAFLDWVGI  170
              RF+EMDWD++G ++F++FLFAF  WVG+
Sbjct  187  VKRFEEMDWDKNGTVTFKEFLFAFTRWVGL  216



>ref|XP_004149571.1| PREDICTED: probable calcium-binding protein CML21 [Cucumis sativus]
 gb|KGN56046.1| hypothetical protein Csa_3G061000 [Cucumis sativus]
Length=229

 Score =   201 bits (512),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 100/201 (50%), Positives = 141/201 (70%), Gaps = 2/201 (1%)
 Frame = -3

Query  766  DSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDRE  590
            ++KLE K++E +K+ A     IRS + +ILKFP   + L+  +T+F+QFDED NG IDR 
Sbjct  17   ETKLEAKMVETMKQRATKGSIIRSFDCIILKFPKIDDSLRNCKTIFQQFDEDLNGIIDRR  76

Query  589  ELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMDAPSSG-STSK  413
            ELKKC   L+  + EEEID+LF +CD+     +KFNEFIVLLCL+YLL D P++  S S+
Sbjct  77   ELKKCFDGLEILLTEEEIDDLFDACDISTAMGMKFNEFIVLLCLVYLLKDDPNAVFSKSQ  136

Query  412  IGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPLEKSPSHVTRTRFKEMDW  233
             G P +E TF ++V+AF+FLDKN DG + K ++V A N+    E+S   +   RF+EMDW
Sbjct  137  FGMPKLEQTFESLVDAFVFLDKNKDGYVSKSEMVSAINETTSGERSSGRIAMRRFEEMDW  196

Query  232  DRSGKISFRKFLFAFLDWVGI  170
            D++G ++F++FLFAF  WVGI
Sbjct  197  DKNGMVNFKEFLFAFTRWVGI  217



>ref|XP_003571276.1| PREDICTED: probable calcium-binding protein CML21 isoform X1 
[Brachypodium distachyon]
Length=265

 Score =   202 bits (513),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 98/210 (47%), Positives = 145/210 (69%), Gaps = 7/210 (3%)
 Frame = -3

Query  796  HGSPNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFD  620
            HGSP       SKLE K++E +++ A    +++S N++I+KFP   E L++ R +F+QFD
Sbjct  52   HGSPA------SKLEQKMVEAMQQRAQQGTTMKSFNSVIMKFPKIDESLRKCRIIFQQFD  105

Query  619  EDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMD  440
            EDSNG ID+EELK C QKL     +EEI +LF +CD+ ++  +KFNEFIV LCL+YLL D
Sbjct  106  EDSNGEIDQEELKHCFQKLDISFTDEEIKDLFEACDIYEHMGMKFNEFIVFLCLVYLLND  165

Query  439  APSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPLEKSPSHVT  260
               S +  ++G   +E TF T+V++F+FLDKN DG + K +V++A N+    E+S   + 
Sbjct  166  PAVSEARKRMGLGNLEPTFETLVDSFVFLDKNKDGYVSKNEVIEAINETTAGERSSGRIG  225

Query  259  RTRFKEMDWDRSGKISFRKFLFAFLDWVGI  170
              RF+EMDWD++G ++F++FLFAF  WVG+
Sbjct  226  VKRFEEMDWDKNGTVTFKEFLFAFTRWVGL  255



>gb|EYU33744.1| hypothetical protein MIMGU_mgv1a013136mg [Erythranthe guttata]
Length=229

 Score =   201 bits (510),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 95/205 (46%), Positives = 147/205 (72%), Gaps = 2/205 (1%)
 Frame = -3

Query  781  KYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDEDSNG  605
            K S  ++KLE+K++E V+R      S++S N++ILKFP   E  ++ +T F+++DED NG
Sbjct  12   KSSLQETKLESKIIEAVQRRELKGSSMKSFNSIILKFPKIDESFRKCKTTFDEYDEDKNG  71

Query  604  AIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMDAPS-S  428
             ID +ELK C +KL+    EEEI++LF++CD++++  +KFNEFIVL+CL+YLL + PS  
Sbjct  72   TIDLQELKHCFRKLEISFTEEEINDLFQACDINEDMTMKFNEFIVLICLVYLLKEDPSDK  131

Query  427  GSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPLEKSPSHVTRTRF  248
             + S++G P +++TF T+V+ F+FLDKN DG + K ++V A N+    E+S   +   RF
Sbjct  132  DAKSQMGMPNLKATFETLVDTFVFLDKNKDGYVSKSEMVDAINETTSGERSSGRIAMKRF  191

Query  247  KEMDWDRSGKISFRKFLFAFLDWVG  173
            +EMDWDR+G ++F++FLFAF  WVG
Sbjct  192  EEMDWDRNGMVNFKEFLFAFTHWVG  216



>ref|XP_004951561.1| PREDICTED: probable calcium-binding protein CML21-like [Setaria 
italica]
Length=226

 Score =   200 bits (508),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 96/209 (46%), Positives = 144/209 (69%), Gaps = 1/209 (0%)
 Frame = -3

Query  793  GSPNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDE  617
            G   + S   +KLE K++E +++ A    S++S N++I+KFP   E L+  RT+F+QFDE
Sbjct  7    GDSPRNSSPATKLERKMVEAMQQRALKGTSVKSFNSVIMKFPKIDESLRNCRTIFQQFDE  66

Query  616  DSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMDA  437
            DSNG ID++ELK C QKL     ++EI +LF +CD+ ++  +KFNEFIV LCL+YLL D 
Sbjct  67   DSNGEIDQQELKHCFQKLGIESTDDEIKDLFEACDIYEHMGMKFNEFIVFLCLVYLLNDP  126

Query  436  PSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPLEKSPSHVTR  257
              S +  ++G   +E TF T+VE+F+FLDKN DG + K ++++A N+    E+S   +  
Sbjct  127  AVSEARKRMGLGSLEPTFETLVESFVFLDKNKDGYVSKNEMIQAINETTAGERSSGRIGV  186

Query  256  TRFKEMDWDRSGKISFRKFLFAFLDWVGI  170
             RF+EMDWD++G ++F++FLFAF  WVGI
Sbjct  187  KRFEEMDWDKNGTVTFKEFLFAFTRWVGI  215



>ref|XP_006654041.1| PREDICTED: probable calcium-binding protein CML22-like [Oryza 
brachyantha]
Length=229

 Score =   199 bits (505),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 89/214 (42%), Positives = 142/214 (66%), Gaps = 2/214 (1%)
 Frame = -3

Query  790  SPNKYSRLDSKLETKVLEV--KRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDE  617
            +P KY R+   L+ KV E   +R      + RS+N++ +  P F+EGL  IR VF+Q+DE
Sbjct  10   APIKYRRIQKDLDKKVAEALKERTKAKKKTFRSVNSITMGLPRFKEGLNNIRDVFDQYDE  69

Query  616  DSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMDA  437
            DSNG ID +EL+ CL +L   + EEE+D + R CD+D+ + I+F EF V LCL+YLL  +
Sbjct  70   DSNGTIDNDELRNCLNELHVQLSEEEVDNIHRYCDIDNRKGIQFQEFAVFLCLMYLLFGS  129

Query  436  PSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPLEKSPSHVTR  257
              +   S+  S  +   F+ +++A+LF DK+G+GK+++KDV +  N+A   E++PSH+T 
Sbjct  130  DVTRRISEFESARLNYVFDELIDAYLFFDKDGNGKMNRKDVTERMNEATHQERTPSHITT  189

Query  256  TRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDE  155
              FKEMD +R+G ++ ++FLF+ + W G++ D+E
Sbjct  190  QLFKEMDLNRNGNVNLKEFLFSIIRWAGVESDEE  223



>ref|XP_009608207.1| PREDICTED: probable calcium-binding protein CML21 [Nicotiana 
tomentosiformis]
 ref|XP_009608208.1| PREDICTED: probable calcium-binding protein CML21 [Nicotiana 
tomentosiformis]
Length=227

 Score =   199 bits (505),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 97/218 (44%), Positives = 155/218 (71%), Gaps = 3/218 (1%)
 Frame = -3

Query  817  VGSLLCCHGSPNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIR  641
            +G +L  + SP + S  ++KLE K+ E ++R      SI+S ++++LKFP   E L++ +
Sbjct  1    MGGVLGKNESP-RASVPETKLEAKITEAMQRRETEGSSIKSFDSIVLKFPKIDENLRKCK  59

Query  640  TVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  461
             +F++FDEDSNGAID +ELK    KL+ +  +EEI +LF +CD++++  I+F+EFIVLLC
Sbjct  60   VIFQEFDEDSNGAIDPQELKHAFGKLEINFTDEEISDLFEACDINEDMGIEFSEFIVLLC  119

Query  460  LIYLLMDAPSS-GSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPL  284
            L+YLL D P++  + S++G P +E TF T+V+AF+FLDKN DG + + ++++A N+    
Sbjct  120  LVYLLKDDPTALHAKSRMGLPNLEVTFETLVDAFVFLDKNKDGHVSRNEMIQAINETTSG  179

Query  283  EKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGI  170
            E+S   +   RF+EMDWD++G ++F++FLFAF  WVGI
Sbjct  180  ERSSGRIAMRRFEEMDWDKNGMVNFKEFLFAFTHWVGI  217



>gb|ABK22178.1| unknown [Picea sitchensis]
 gb|ACN39992.1| unknown [Picea sitchensis]
Length=224

 Score =   198 bits (504),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 95/207 (46%), Positives = 148/207 (71%), Gaps = 2/207 (1%)
 Frame = -3

Query  763  SKLETKVLEVKRNAPAT--LSIRSINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDRE  590
            SKLE K++E  R    +   +++S N++I+KFP   E  + +R VF++FD+DS+G ID E
Sbjct  18   SKLELKMVEAMRKKATSGGSTLKSFNSIIMKFPKIDESFENVRDVFQKFDKDSSGTIDLE  77

Query  589  ELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMDAPSSGSTSKI  410
            ELK+C ++LQ    +EEI EL + CD+D+++ I+F EFIVLLCL+Y+L +     S S+I
Sbjct  78   ELKECFRELQVSFTDEEITELHQICDMDESKGIEFKEFIVLLCLVYILWEPTDPNSKSRI  137

Query  409  GSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPLEKSPSHVTRTRFKEMDWD  230
            G P +E+TF++I++AF F DK+GDG + KK++++A N A P  ++   +   RF+EMD+D
Sbjct  138  GLPHLEATFDSIIDAFRFFDKDGDGYVSKKEILQALNQASPGGRAADQIGIKRFEEMDFD  197

Query  229  RSGKISFRKFLFAFLDWVGIDGDDEDH  149
            ++G ISF++FLFAF  WVG++ DD+D 
Sbjct  198  KNGMISFKEFLFAFTHWVGVEVDDDDE  224



>ref|NP_001131792.1| calcium ion binding protein [Zea mays]
 gb|ACF80358.1| unknown [Zea mays]
 gb|ACG38606.1| calcium ion binding protein [Zea mays]
 gb|AFW70731.1| calcium ion binding protein [Zea mays]
Length=227

 Score =   198 bits (504),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 95/209 (45%), Positives = 144/209 (69%), Gaps = 1/209 (0%)
 Frame = -3

Query  793  GSPNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDE  617
            G   ++S   SKLE K+++ +++ A    S++S N++I+KFP   E L+  RT+F++FDE
Sbjct  7    GDSPRHSSPASKLEKKMVDAMQQRALKGTSVKSFNSVIMKFPKIDESLRNCRTIFQEFDE  66

Query  616  DSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMDA  437
            DSNG ID+ ELK+C Q L     +EEI +LF +CD+ ++  +KFNEFIV LCL+YLL D 
Sbjct  67   DSNGEIDQLELKRCFQNLGIESTDEEIKDLFEACDIYEHMGMKFNEFIVFLCLVYLLNDP  126

Query  436  PSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPLEKSPSHVTR  257
              S +  ++G   +E TF T+VE+F+FLDKN DG + K ++++A N+    E+S   +  
Sbjct  127  AVSEARKRMGLGNLEPTFETLVESFVFLDKNKDGYVSKSEMIQAINETIGGERSSGRIGM  186

Query  256  TRFKEMDWDRSGKISFRKFLFAFLDWVGI  170
             RF+EMDWD++G ++F++FLFAF  WVGI
Sbjct  187  RRFEEMDWDKNGTVTFKEFLFAFTRWVGI  215



>dbj|BAK07400.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=226

 Score =   196 bits (499),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 95/209 (45%), Positives = 142/209 (68%), Gaps = 1/209 (0%)
 Frame = -3

Query  793  GSPNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDE  617
            G   +YS   +KLE K+++ +++ A    S++S N++I+KFP   E L+  R +F+QFDE
Sbjct  8    GDTPRYSSAATKLEQKMVDAMQQRAQQGTSLKSFNSVIMKFPKIDENLRNCRIIFQQFDE  67

Query  616  DSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMDA  437
            DSNG ID+ EL+ C QKL     +EEI +LF +CD+ ++  +KFNEFIV LCL+YLL D 
Sbjct  68   DSNGEIDQLELEHCFQKLDISFTDEEIKDLFEACDIYEHMGMKFNEFIVFLCLVYLLNDP  127

Query  436  PSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPLEKSPSHVTR  257
              S +  ++G   +E TF T+V+AF+FLDKN D  + K +V++A N+    E+S   +  
Sbjct  128  AVSEARKRMGLGNLEPTFETLVDAFVFLDKNKDEYVSKNEVIEAINETSAGERSSGRIGV  187

Query  256  TRFKEMDWDRSGKISFRKFLFAFLDWVGI  170
             RF+EMDWD++G ++F++FLFAF  WVGI
Sbjct  188  KRFEEMDWDKNGTVTFKEFLFAFTRWVGI  216



>ref|XP_009776689.1| PREDICTED: probable calcium-binding protein CML21 [Nicotiana 
sylvestris]
 ref|XP_009776690.1| PREDICTED: probable calcium-binding protein CML21 [Nicotiana 
sylvestris]
Length=227

 Score =   196 bits (497),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 96/218 (44%), Positives = 154/218 (71%), Gaps = 3/218 (1%)
 Frame = -3

Query  817  VGSLLCCHGSPNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIR  641
            +G +L  + SP + S  ++KLE K+ E ++R      SI+S ++++LKFP   E L++ +
Sbjct  1    MGGVLGKNESP-RASVPETKLEAKITEAMQRRETEGSSIKSFDSIVLKFPKIDENLRKCK  59

Query  640  TVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  461
             +F++FDEDSNGAID +ELK    KL+ +  +EEI +LF +CD++++  I+F+EFIVLLC
Sbjct  60   VIFQEFDEDSNGAIDPQELKHAFGKLEINFTDEEISDLFEACDINEDMGIEFSEFIVLLC  119

Query  460  LIYLLMDAPSS-GSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPL  284
            L+YLL D P++  + S++G P +E  F T+V+AF+FLDKN DG + + ++++A N+    
Sbjct  120  LVYLLKDDPTALHAKSRMGLPNLEVAFETLVDAFVFLDKNKDGYVSRNEMIQAINETTSG  179

Query  283  EKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGI  170
            E+S   +   RF+EMDWD++G ++F++FLFAF  WVGI
Sbjct  180  ERSSGRIGMRRFEEMDWDKNGMVNFKEFLFAFTHWVGI  217



>ref|XP_010231716.1| PREDICTED: probable calcium-binding protein CML21 isoform X2 
[Brachypodium distachyon]
 ref|XP_010231717.1| PREDICTED: probable calcium-binding protein CML21 isoform X2 
[Brachypodium distachyon]
 ref|XP_010231718.1| PREDICTED: probable calcium-binding protein CML21 isoform X2 
[Brachypodium distachyon]
Length=230

 Score =   194 bits (494),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 88/223 (39%), Positives = 147/223 (66%), Gaps = 2/223 (1%)
 Frame = -3

Query  817  VGSLLCCHGSPNKYSRLDSKLETKVLEV--KRNAPATLSIRSINALILKFPHFREGLKEI  644
            +G       +P K  R++  L+ KV+E   +R      + +S+N++ ++ P F++GL++I
Sbjct  1    MGGAASRLATPIKQRRVEKDLDNKVVEALRERARARKKTFKSVNSITMRLPRFKDGLRDI  60

Query  643  RTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLL  464
            R VF+ +D DSNG ID EEL+ C+ KLQ  + E+E+D++ R CDV+  + I+F EF+VLL
Sbjct  61   RDVFDHYDVDSNGTIDNEELRSCMSKLQVQMSEKEVDDVHRYCDVNSRKGIQFQEFVVLL  120

Query  463  CLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPL  284
            CL+YLL     +   S+  S  +   F+ +++AFLF +K+GDGK+ +KDV +  N+A   
Sbjct  121  CLMYLLFGPGVTRQVSEFESAKLNYVFDELIDAFLFFNKDGDGKMRRKDVTQRMNEASHQ  180

Query  283  EKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDE  155
            E++PSH+T   FKEMD +++G ++ ++FLF+ + W GI+ +DE
Sbjct  181  ERTPSHITTQLFKEMDLNKNGSVNLKEFLFSMIRWAGIETEDE  223



>ref|XP_006474771.1| PREDICTED: probable calcium-binding protein CML21-like [Citrus 
sinensis]
Length=229

 Score =   194 bits (493),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 93/198 (47%), Positives = 143/198 (72%), Gaps = 4/198 (2%)
 Frame = -3

Query  766  DSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDRE  590
            ++KLE K++E ++R A    +++S N++ILKFP   + L+  + +FE+FDEDSNG ID E
Sbjct  18   ETKLEAKMVEAMQRRAAEGTALKSFNSIILKFPKIDDSLRNCKAIFEKFDEDSNGTIDHE  77

Query  589  ELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMDAPSS-GSTSK  413
            ELKKC  KL+    EEEI++LF +CD++ +  +KFNEFIVLLCL+YLL D P++  + S+
Sbjct  78   ELKKCFHKLEIKFTEEEINDLFEACDINKDMGMKFNEFIVLLCLVYLLKDDPTALRAKSR  137

Query  412  IGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPLEKSPSHVTRTRFKEMDW  233
            +G P +E+TF T+V+AF+FLDKN DG + + ++ +A  ++   E S   +   RF+EMDW
Sbjct  138  MGMPKLEATFETLVDAFVFLDKNKDGYVSRSEMTQAVTESG--EGSTGRIAIKRFEEMDW  195

Query  232  DRSGKISFRKFLFAFLDW  179
            D++G ++F++FLFAF  W
Sbjct  196  DKNGMVNFKEFLFAFTRW  213



>ref|XP_006452756.1| hypothetical protein CICLE_v10009385mg [Citrus clementina]
 gb|ESR65996.1| hypothetical protein CICLE_v10009385mg [Citrus clementina]
 gb|KDO73986.1| hypothetical protein CISIN_1g026998mg [Citrus sinensis]
Length=229

 Score =   194 bits (493),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 93/198 (47%), Positives = 143/198 (72%), Gaps = 4/198 (2%)
 Frame = -3

Query  766  DSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDRE  590
            ++KLE K++E ++R A    +++S N++ILKFP   + L+  + +FE+FDEDSNG ID E
Sbjct  18   ETKLEAKMVEAMQRRAAEGTALKSFNSIILKFPKIDDSLRNCKAIFEKFDEDSNGTIDHE  77

Query  589  ELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMDAPSS-GSTSK  413
            ELKKC  KL+    EEEI++LF +CD++ +  +KFNEFIVLLCL+YLL D P++  + S+
Sbjct  78   ELKKCFHKLEIKFTEEEINDLFEACDINKDMGMKFNEFIVLLCLVYLLKDDPTALRAKSR  137

Query  412  IGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPLEKSPSHVTRTRFKEMDW  233
            +G P +E+TF T+V+AF+FLDKN DG + + ++ +A  ++   E S   +   RF+EMDW
Sbjct  138  MGMPKLEATFETLVDAFVFLDKNKDGYVSRSEMTQAVTESG--EGSTGRIAIKRFEEMDW  195

Query  232  DRSGKISFRKFLFAFLDW  179
            D++G ++F++FLFAF  W
Sbjct  196  DKNGMVNFKEFLFAFTRW  213



>ref|XP_003568950.2| PREDICTED: probable calcium-binding protein CML21 isoform X1 
[Brachypodium distachyon]
Length=244

 Score =   194 bits (494),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 88/223 (39%), Positives = 147/223 (66%), Gaps = 2/223 (1%)
 Frame = -3

Query  817  VGSLLCCHGSPNKYSRLDSKLETKVLEV--KRNAPATLSIRSINALILKFPHFREGLKEI  644
            +G       +P K  R++  L+ KV+E   +R      + +S+N++ ++ P F++GL++I
Sbjct  15   MGGAASRLATPIKQRRVEKDLDNKVVEALRERARARKKTFKSVNSITMRLPRFKDGLRDI  74

Query  643  RTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLL  464
            R VF+ +D DSNG ID EEL+ C+ KLQ  + E+E+D++ R CDV+  + I+F EF+VLL
Sbjct  75   RDVFDHYDVDSNGTIDNEELRSCMSKLQVQMSEKEVDDVHRYCDVNSRKGIQFQEFVVLL  134

Query  463  CLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPL  284
            CL+YLL     +   S+  S  +   F+ +++AFLF +K+GDGK+ +KDV +  N+A   
Sbjct  135  CLMYLLFGPGVTRQVSEFESAKLNYVFDELIDAFLFFNKDGDGKMRRKDVTQRMNEASHQ  194

Query  283  EKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDE  155
            E++PSH+T   FKEMD +++G ++ ++FLF+ + W GI+ +DE
Sbjct  195  ERTPSHITTQLFKEMDLNKNGSVNLKEFLFSMIRWAGIETEDE  237



>ref|XP_010545296.1| PREDICTED: LOW QUALITY PROTEIN: probable calcium-binding protein 
CML21 [Tarenaya hassleriana]
Length=230

 Score =   194 bits (493),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 97/205 (47%), Positives = 142/205 (69%), Gaps = 8/205 (4%)
 Frame = -3

Query  766  DSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDRE  590
            ++KLE K+ E ++R A    S++S N+++LKFP   +GL+  R++F QFDEDSNG ID E
Sbjct  17   ETKLEAKISEAMQRRASRGTSMKSFNSIVLKFPKIDDGLRNCRSIFHQFDEDSNGWIDHE  76

Query  589  ELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMDAPSS-----G  425
            ELKK  +KL+  + EEEI +LF  CD++D+  I F EFIVLLCL+YLL D PS+      
Sbjct  77   ELKKSFEKLEISMTEEEIRDLFEGCDINDDMGITFKEFIVLLCLVYLLKDDPSTVIDSFS  136

Query  424  STSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPLEKSPSHVTRTRFK  245
              S    P +E+TF T+V+ F+FLD+N DG + ++++V A +++   E+S   +   RF+
Sbjct  137  YASXPSLPKLEATFETLVDTFVFLDENKDGYVSREEMVHAIDESG--ERSSGRIAMKRFE  194

Query  244  EMDWDRSGKISFRKFLFAFLDWVGI  170
            EMDWDR+G ++F++FLFAF  WVGI
Sbjct  195  EMDWDRNGMVNFKEFLFAFTQWVGI  219



>ref|XP_002869609.1| calcium ion binding protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45868.1| calcium ion binding protein [Arabidopsis lyrata subsp. lyrata]
Length=229

 Score =   194 bits (493),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 91/201 (45%), Positives = 146/201 (73%), Gaps = 4/201 (2%)
 Frame = -3

Query  766  DSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDRE  590
            ++KLE K++E V+R A    +++S N+++LKFP   +GL+  + +F++FDEDSNG+ID  
Sbjct  18   ETKLEAKIIEAVQRRASRGTTMKSFNSIVLKFPKIDDGLRNCKAIFQEFDEDSNGSIDHT  77

Query  589  ELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMDAPSS-GSTSK  413
            ELK C++KL+    EEEI++LF++CD++++  I F EFIVLLCL+YLL D  S+      
Sbjct  78   ELKNCIKKLEISFDEEEINDLFKACDINEDMGITFTEFIVLLCLVYLLKDDSSTLQKKWT  137

Query  412  IGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPLEKSPSHVTRTRFKEMDW  233
            +G P +E TF T+V+ F+FLD+N DG + ++++V+A +++   E+S   +   RF+EMDW
Sbjct  138  MGMPKLEPTFETLVDTFVFLDENKDGYVSREEMVRAIDESG--ERSSGRIAMKRFEEMDW  195

Query  232  DRSGKISFRKFLFAFLDWVGI  170
            D++G ++F++FLFAF  WVGI
Sbjct  196  DKNGMVNFKEFLFAFTQWVGI  216



>ref|NP_194377.2| putative calcium-binding protein CML21 [Arabidopsis thaliana]
 sp|Q52K82.1|CML21_ARATH RecName: Full=Probable calcium-binding protein CML21; AltName: 
Full=Calmodulin-like protein 21 [Arabidopsis thaliana]
 gb|AAY17423.1| At4g26470 [Arabidopsis thaliana]
 gb|AEE85204.1| putative calcium-binding protein CML21 [Arabidopsis thaliana]
Length=231

 Score =   194 bits (493),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 91/201 (45%), Positives = 146/201 (73%), Gaps = 4/201 (2%)
 Frame = -3

Query  766  DSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDRE  590
            ++KLE K++E V+R A    +++S N+++LKFP   +GL+  + +F++FDEDSNG+ID  
Sbjct  18   ETKLEAKIIEAVQRRASRGTTMKSFNSIVLKFPKIDDGLRNCKAIFQEFDEDSNGSIDHT  77

Query  589  ELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMDAPSS-GSTSK  413
            ELK C++KL+    EEEI++LF++CD++++  I F EFIVLLCL+YLL D  S+      
Sbjct  78   ELKNCIRKLEISFDEEEINDLFKACDINEDMGITFTEFIVLLCLVYLLKDDSSTLQKKWT  137

Query  412  IGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPLEKSPSHVTRTRFKEMDW  233
            +G P +E TF T+V+ F+FLD+N DG + ++++V+A +++   E+S   +   RF+EMDW
Sbjct  138  MGMPKLEPTFETLVDTFVFLDENKDGYVSREEMVRAIDESG--ERSSGRIAMKRFEEMDW  195

Query  232  DRSGKISFRKFLFAFLDWVGI  170
            D++G ++F++FLFAF  WVGI
Sbjct  196  DKNGMVNFKEFLFAFTQWVGI  216



>ref|XP_006285834.1| hypothetical protein CARUB_v10007314mg [Capsella rubella]
 gb|EOA18732.1| hypothetical protein CARUB_v10007314mg [Capsella rubella]
Length=233

 Score =   193 bits (491),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 94/218 (43%), Positives = 152/218 (70%), Gaps = 4/218 (2%)
 Frame = -3

Query  817  VGSLLCCHGSPNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIR  641
            +G+ +    S  K    ++KLE K++E V+R A    +++S N+++LKFP   EGL+  +
Sbjct  1    MGAAVTKSESLQKEWVPETKLEAKIIEAVQRRATRGTAMKSFNSIVLKFPKIDEGLRNCK  60

Query  640  TVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  461
             +F++FDEDSNG+ID  ELK C++KL+    E+EI++LF++CD++++  I F EFIVLLC
Sbjct  61   AIFQEFDEDSNGSIDHTELKNCIRKLEISFEEDEINDLFKACDINEDMGITFTEFIVLLC  120

Query  460  LIYLLMDAPSS-GSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPL  284
            L+YLL D  S+      +G P +E TF T+V+ F+FLD+N DG + ++++V+A +++   
Sbjct  121  LVYLLKDDSSTLQKKWTMGMPKLEPTFETLVDTFVFLDENKDGYVCREEMVRAIDESG--  178

Query  283  EKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGI  170
            E+S   +   RF+EMDWD++G ++F++FLFAF  WVGI
Sbjct  179  ERSSGRIAMKRFEEMDWDKNGMVNFKEFLFAFTQWVGI  216



>ref|XP_009142368.1| PREDICTED: probable calcium-binding protein CML21 [Brassica rapa]
 emb|CDY66743.1| BnaAnng22830D [Brassica napus]
Length=225

 Score =   193 bits (490),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 91/201 (45%), Positives = 145/201 (72%), Gaps = 4/201 (2%)
 Frame = -3

Query  766  DSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDRE  590
            ++KLE K++E V+R A    +++S N+++LKFP   EGL+  + +F++FDEDSNG+ID  
Sbjct  12   ETKLEAKIIEAVQRRASRGTTMKSFNSIVLKFPKIDEGLRNCKAIFQEFDEDSNGSIDHT  71

Query  589  ELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMDAPSSGSTS-K  413
            ELK C +KL+    E+EI++LF +CD++++  I F EFIVLLCL+YLL D  S+     +
Sbjct  72   ELKNCFRKLEISFEEDEINDLFEACDINEDMGITFTEFIVLLCLVYLLKDDSSTLQKKWR  131

Query  412  IGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPLEKSPSHVTRTRFKEMDW  233
            +G P +E TF T+V+ F+FLD+N DG + ++++V+A +++   E+S   +   RF+EMDW
Sbjct  132  LGMPKLEPTFETLVDTFVFLDENKDGLVSREEMVRAIDESG--ERSSGRIAMKRFEEMDW  189

Query  232  DRSGKISFRKFLFAFLDWVGI  170
            D++G ++F++FLFAF  WVGI
Sbjct  190  DKNGMVNFKEFLFAFTQWVGI  210



>ref|XP_006413177.1| hypothetical protein EUTSA_v10026168mg [Eutrema salsugineum]
 gb|ESQ54630.1| hypothetical protein EUTSA_v10026168mg [Eutrema salsugineum]
Length=226

 Score =   192 bits (489),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 91/201 (45%), Positives = 144/201 (72%), Gaps = 4/201 (2%)
 Frame = -3

Query  766  DSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDRE  590
            ++KLE K++E V+R A    + +S N+++LKFP   +GL+  + +F++FDEDSNG+ID  
Sbjct  18   ETKLEAKIIEAVRRRASRGTTTKSFNSIVLKFPKIDDGLRNCKAIFQEFDEDSNGSIDHT  77

Query  589  ELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMDAPSS-GSTSK  413
            ELK C +KL+    EEEI++LF +CD++++  I F EFIVLLCL+YLL D  S+     +
Sbjct  78   ELKNCFRKLEISFDEEEINDLFEACDINEDMGITFTEFIVLLCLVYLLKDDSSTLQKKWR  137

Query  412  IGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPLEKSPSHVTRTRFKEMDW  233
            +G P +E TF T+V+ F+FLD+N DG + ++++V+A +++   E+S   +   RF+EMDW
Sbjct  138  LGMPKLEPTFETLVDTFVFLDENKDGYVSREEMVRAIDESG--ERSSGRIAMKRFEEMDW  195

Query  232  DRSGKISFRKFLFAFLDWVGI  170
            D++G ++F++FLFAF  WVGI
Sbjct  196  DKNGMVNFKEFLFAFTQWVGI  216



>ref|XP_004960294.1| PREDICTED: probable calcium-binding protein CML22-like [Setaria 
italica]
Length=262

 Score =   192 bits (488),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 91/235 (39%), Positives = 151/235 (64%), Gaps = 9/235 (4%)
 Frame = -3

Query  853  RPCLSLKLVSDKVGSLLCCHGSPNKYSRLDSKLETKVLEV--KRNAPATLSIRSINALIL  680
            RP  ++ +V+      +C    P K  R++  L+ KV     +R      + RS+N++ +
Sbjct  28   RPVAAMGIVAS-----MCME--PIKRRRVEKDLDDKVAAALRERARSRQRTFRSVNSITM  80

Query  679  KFPHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDN  500
            + P F++GL++I+ VF+Q+DE+S+G ID EEL++CL KLQ  + +EE D++ R CD+D  
Sbjct  81   RLPRFKDGLRDIKDVFDQYDENSDGTIDNEELRRCLGKLQVQMSDEEADDVHRYCDIDRR  140

Query  499  EKIKFNEFIVLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKK  320
              I+F EF+VLLCL+YLL     +   S+  S  +   F+ +++AFLF DK+GDGK+ +K
Sbjct  141  NGIQFQEFVVLLCLMYLLFGPDVTRRVSEFESAKLNYVFDELIDAFLFFDKDGDGKMKRK  200

Query  319  DVVKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDE  155
            DV +  N+    E++PSH+T   FKEMD DR+GK++ ++FL++ + W G + +D+
Sbjct  201  DVTQRMNEESHQERTPSHITAQLFKEMDIDRNGKVNLKEFLYSIIRWAGHETEDD  255



>ref|XP_002447440.1| hypothetical protein SORBIDRAFT_06g001080 [Sorghum bicolor]
 gb|EES11768.1| hypothetical protein SORBIDRAFT_06g001080 [Sorghum bicolor]
Length=230

 Score =   190 bits (482),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 88/223 (39%), Positives = 144/223 (65%), Gaps = 2/223 (1%)
 Frame = -3

Query  817  VGSLLCCHGSPNKYSRLDSKLETKVLEV--KRNAPATLSIRSINALILKFPHFREGLKEI  644
            +G +      P K  R++  L+ KV +   +R      + RS+N++ ++ P F+EGL++I
Sbjct  1    MGMVTSICMEPIKRRRVEKDLDDKVADALQERTRSRQRTFRSVNSITMRLPRFKEGLRDI  60

Query  643  RTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLL  464
            + +F+Q+DEDSNG ID EEL+  L KLQ  + ++EID L   CD+D    I+F EF+VLL
Sbjct  61   KEIFDQYDEDSNGTIDNEELQSFLSKLQVKMSQQEIDNLHSYCDIDSRNGIQFQEFVVLL  120

Query  463  CLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPL  284
            CL+YLL     +   S+  S  +   F+ +++AF+F DK+GDGK+ K+DV    N+A   
Sbjct  121  CLMYLLFGPDVTRRVSEFESVKLNYVFDELIDAFIFFDKDGDGKMKKRDVTHRMNEASHQ  180

Query  283  EKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDE  155
            E++PSH+T   FKEMD +R+GK++ ++FL++ + W G++ +D+
Sbjct  181  ERTPSHITAQLFKEMDLNRNGKVNLKEFLYSMIRWAGLETEDD  223



>ref|XP_010448264.1| PREDICTED: probable calcium-binding protein CML21 [Camelina sativa]
 ref|XP_010448265.1| PREDICTED: probable calcium-binding protein CML21 [Camelina sativa]
Length=232

 Score =   190 bits (482),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 93/218 (43%), Positives = 149/218 (68%), Gaps = 4/218 (2%)
 Frame = -3

Query  817  VGSLLCCHGSPNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIR  641
            +G ++    S  K    ++KLE K++E V+R A    +++S N+++LKFP    GL+  +
Sbjct  1    MGGVVTKSESLEKEWVPETKLEAKIIEAVQRRATKGTTMKSFNSIVLKFPKIDVGLRNCK  60

Query  640  TVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  461
             +F++FDEDSNG+ID  ELK C++KL+    E+EI++LF++CD++++  I F EFIVLLC
Sbjct  61   AIFQEFDEDSNGSIDHTELKNCIRKLEISFEEDEINDLFKACDINEDMGITFTEFIVLLC  120

Query  460  LIYLLMDAPSS-GSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPL  284
            L+YLL D  S+      +G P +E TF T+V+ F+FLD N DG + + ++V+A +++   
Sbjct  121  LVYLLKDDSSTLQKKWTMGMPKLEPTFETLVDTFVFLDDNKDGYVSRDEMVRAIDESG--  178

Query  283  EKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGI  170
            E+S   +   RF+EMDWD++G ++F++FLFAF  WVGI
Sbjct  179  ERSSGRIAMKRFEEMDWDKNGMVNFKEFLFAFTQWVGI  216



>gb|KJB63079.1| hypothetical protein B456_009G454500 [Gossypium raimondii]
Length=220

 Score =   189 bits (481),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 107/219 (49%), Positives = 158/219 (72%), Gaps = 6/219 (3%)
 Frame = -3

Query  793  GSPNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDE  617
            G   K    ++KLE K++E ++  A    +I+S N++ILKFP     L++ + +FEQFDE
Sbjct  3    GVVGKSESPETKLEAKMVEAMQHRASKGTTIKSFNSIILKFPKIDHTLRKCKAIFEQFDE  62

Query  616  DSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMD-  440
            DSNGAID EELKKCL KLQ    EEEI++LF++CD++++  IKFNEF+VLLCL+YLL D 
Sbjct  63   DSNGAIDHEELKKCLHKLQVCFTEEEIEDLFKACDMNEDMGIKFNEFVVLLCLVYLLKDN  122

Query  439  APSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPLEKSPSHVT  260
            A    + S++G P +E+TF T+V+AF+ LDKN DG + K ++V+A N++   E+S   + 
Sbjct  123  ATEFEAKSRMGVPNLEATFETLVDAFVLLDKNKDGYVSKTEMVQAINES--GERSSGPIA  180

Query  259  RTRFKEMDWDRSGKISFRKFLFAFLDWVGID--GDDEDH  149
              RF+EMDWD++G +SF++FLFAF  W+GI+  GD+++H
Sbjct  181  TKRFEEMDWDKNGSVSFKEFLFAFTTWIGIEEVGDNDEH  219



>ref|XP_010433497.1| PREDICTED: probable calcium-binding protein CML21 [Camelina sativa]
Length=231

 Score =   190 bits (482),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 93/218 (43%), Positives = 149/218 (68%), Gaps = 4/218 (2%)
 Frame = -3

Query  817  VGSLLCCHGSPNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIR  641
            +G ++    S  K    ++KLE K++E V+R A    +++S N+++LKFP    GL+  +
Sbjct  1    MGGVVTKSESLEKEWVPETKLEAKIIEAVQRRATRGTTMKSFNSIVLKFPKIDVGLRNCK  60

Query  640  TVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  461
             +F++FDEDSNG+ID  ELK C++KL+    E+EI++LF++CD++++  I F EFIVLLC
Sbjct  61   AIFQEFDEDSNGSIDHTELKNCIRKLEISFEEDEINDLFKACDINEDMGITFTEFIVLLC  120

Query  460  LIYLLMDAPSS-GSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPL  284
            L+YLL D  S+      +G P +E TF T+V+ F+FLD N DG + + ++V+A +++   
Sbjct  121  LVYLLKDDSSTLQKKWTMGMPKLEPTFETLVDTFVFLDDNKDGYVSRDEMVRAIDESG--  178

Query  283  EKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGI  170
            E+S   +   RF+EMDWD++G ++F++FLFAF  WVGI
Sbjct  179  ERSSGRIAMKRFEEMDWDKNGMVNFKEFLFAFTQWVGI  216



>ref|XP_010438747.1| PREDICTED: probable calcium-binding protein CML21 [Camelina sativa]
 ref|XP_010438748.1| PREDICTED: probable calcium-binding protein CML21 [Camelina sativa]
Length=233

 Score =   189 bits (481),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/201 (45%), Positives = 143/201 (71%), Gaps = 4/201 (2%)
 Frame = -3

Query  766  DSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDRE  590
            ++KLE K++E V+R A    +++S N+++LKFP    GL+  + +F++FDEDSNG+ID  
Sbjct  18   ETKLEAKIIEAVQRRATRGTTMKSFNSIVLKFPKIDVGLRNCKAIFQEFDEDSNGSIDHT  77

Query  589  ELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMDAPSS-GSTSK  413
            ELK C++KL+    E+EI++LF++CD++++  I F EFIVLLCL+YLL D  S+      
Sbjct  78   ELKNCIRKLEISFEEDEINDLFKACDINEDMGITFTEFIVLLCLVYLLKDDSSTLQKKWT  137

Query  412  IGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPLEKSPSHVTRTRFKEMDW  233
            +G P +E TF T+V+ F+FLD N DG + + ++V+A +++   E+S   +   RF+EMDW
Sbjct  138  MGMPKLEPTFETLVDTFVFLDDNKDGYVSRDEMVRAIDESG--ERSSGRIAMKRFEEMDW  195

Query  232  DRSGKISFRKFLFAFLDWVGI  170
            D++G ++F++FLFAF  WVGI
Sbjct  196  DKNGMVNFKEFLFAFTQWVGI  216



>gb|KEH22471.1| calcium-binding EF-hand protein [Medicago truncatula]
Length=219

 Score =   186 bits (473),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 87/203 (43%), Positives = 140/203 (69%), Gaps = 0/203 (0%)
 Frame = -3

Query  832  LVSDKVGSLLCCHGSPNKYSRLDSKLETKVLEVKRNAPATLSIRSINALILKFPHFREGL  653
             +++K+G+++CC     +   L+ KLE K+ E++RN      ++SI+++++ FP F+E L
Sbjct  14   FLANKMGAVICCISEQGEKKSLERKLEKKIAEIRRNKFGQTKLKSIDSIVMLFPMFKERL  73

Query  652  KEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFI  473
            K +R +FEQ+DEDSN +I+  EL+  L+ LQ H+ E EI+  F+ CD+D ++ I+FNEFI
Sbjct  74   KTLRGMFEQYDEDSNESIEPHELQTFLEDLQLHLPENEIENFFQYCDIDGSKGIQFNEFI  133

Query  472  VLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDA  293
            VLLCLI++L +  SS ++ K     +   F+ I+E FLF D+NGDGKL+KKD+V+  N+ 
Sbjct  134  VLLCLIHILTEPLSSDNSPKEELAQLGQVFDKIIEIFLFFDQNGDGKLNKKDMVRTMNET  193

Query  292  FPLEKSPSHVTRTRFKEMDWDRS  224
             P E+SP+HVT+ RF  + ++ S
Sbjct  194  NPRERSPAHVTKNRFSIVHFNSS  216



>ref|NP_001148758.1| calcium ion binding protein [Zea mays]
 gb|ACG32796.1| calcium ion binding protein [Zea mays]
Length=230

 Score =   184 bits (467),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 82/224 (37%), Positives = 144/224 (64%), Gaps = 2/224 (1%)
 Frame = -3

Query  817  VGSLLCCHGSPNKYSRLDSKLETKVLEV--KRNAPATLSIRSINALILKFPHFREGLKEI  644
            +G +      P K  R++  L+ KV +   +R      + RS+N++ ++ P F+EGL+++
Sbjct  1    MGMVASMCTEPIKRHRVERDLDGKVADALRERTRSRQRTFRSVNSITMRLPRFKEGLRDV  60

Query  643  RTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLL  464
            + +F+Q+DEDS+G ID EEL+    +++ H+ EEE+  L R CD+D  + ++F EF+VLL
Sbjct  61   KNIFDQYDEDSDGTIDSEELQSFGSRVRVHMSEEEMSNLHRYCDIDSRKGVQFQEFVVLL  120

Query  463  CLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPL  284
            CL YLL     +   S+  S  +   F+ +++A++F DK+GDG L ++DV +  N+A   
Sbjct  121  CLAYLLFGPDVTRRVSEFESGKLNYVFDELIDAYIFFDKDGDGMLRRRDVTRRMNEASHQ  180

Query  283  EKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDED  152
            E++PSH+T   FKEMD +R+GK++ ++FL++ + W G+  +D+D
Sbjct  181  ERTPSHITAQLFKEMDLNRNGKVNLKEFLYSMIRWAGLGTEDDD  224



>ref|XP_010691276.1| PREDICTED: probable calcium-binding protein CML22 isoform X5 
[Beta vulgaris subsp. vulgaris]
Length=226

 Score =   184 bits (467),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 102/246 (41%), Positives = 142/246 (58%), Gaps = 48/246 (20%)
 Frame = -3

Query  865  VGLSRPCLSLKLVSDKVGSLL----CCHGSPNKYSRLDSKLETKVLEVKRNAPAT----L  710
             G SR C +LK +  KVGS+L    C   + NKY RLD+KLE K++E+KR A  +     
Sbjct  10   TGRSRSCPALKSICYKVGSMLWGCNCASSTTNKYRRLDAKLERKMIELKRQASTSGHTNK  69

Query  709  SIRSINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDE  530
              RSIN++I+KFP  +E +K++R VFE +D                              
Sbjct  70   KFRSINSVIMKFPQLKEQVKKLRGVFEHYDR-----------------------------  100

Query  529  LFRSCDVDDNEKIKFNEFIVLLCLIYLLMDAPS-SGSTSKIGSPVVESTFNTIVEAFLFL  353
                     N +I+F EFIVLLCLIYL+    S + + S+  SP  E+TF+ IV+ F+++
Sbjct  101  ---------NGRIQFREFIVLLCLIYLITKPSSPTDAVSRTESPNWEATFDIIVQVFIYM  151

Query  352  DKNGDGKLHKKDVVKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVG  173
            DKNGDGKL KKD+V A  +  P E+SPSHV +TRF EMD D+ G ++FR++LF    W+G
Sbjct  152  DKNGDGKLSKKDMVAALTEP-PWERSPSHVMKTRFMEMDKDKDGNVTFREYLFGLTSWLG  210

Query  172  IDGDDE  155
            ID D +
Sbjct  211  IDSDSD  216



>gb|KDO73987.1| hypothetical protein CISIN_1g026998mg [Citrus sinensis]
Length=221

 Score =   184 bits (466),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 90/197 (46%), Positives = 137/197 (70%), Gaps = 10/197 (5%)
 Frame = -3

Query  766  DSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDRE  590
            ++KLE K++E ++R A    +++S N++ILKFP   + L+  + +FE+FDEDSNG ID E
Sbjct  18   ETKLEAKMVEAMQRRAAEGTALKSFNSIILKFPKIDDSLRNCKAIFEKFDEDSNGTIDHE  77

Query  589  ELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMDAPSSGSTSKI  410
            ELKKC  KL+    EEEI++LF +CD++ +  +KFNEFIVLLCL+YLL D P++      
Sbjct  78   ELKKCFHKLEIKFTEEEINDLFEACDINKDMGMKFNEFIVLLCLVYLLKDDPTA------  131

Query  409  GSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPLEKSPSHVTRTRFKEMDWD  230
                +E+TF T+V+AF+FLDKN DG + + ++ +A  ++   E S   +   RF+EMDWD
Sbjct  132  -LRALEATFETLVDAFVFLDKNKDGYVSRSEMTQAVTESG--EGSTGRIAIKRFEEMDWD  188

Query  229  RSGKISFRKFLFAFLDW  179
            ++G ++F++FLFAF  W
Sbjct  189  KNGMVNFKEFLFAFTRW  205



>gb|KCW70421.1| hypothetical protein EUGRSUZ_F03649 [Eucalyptus grandis]
Length=223

 Score =   183 bits (465),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 89/199 (45%), Positives = 138/199 (69%), Gaps = 2/199 (1%)
 Frame = -3

Query  817  VGSLLCCHGSPNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIR  641
            +G ++    +P K    ++KLE K++E ++R A     ++S N++ILKFP   +  ++ +
Sbjct  1    MGGVIGKGDAPKKAWVPETKLEAKMVEAMQRRASGGSKMKSFNSIILKFPKIDKSFRKCK  60

Query  640  TVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  461
            ++FEQFDEDSN  ID+EEL+ C  KL+    +EEI++LF +CD++D+  IKFNEFIVLLC
Sbjct  61   SIFEQFDEDSNHVIDKEELRHCFNKLEISFSDEEINDLFEACDINDDMGIKFNEFIVLLC  120

Query  460  LIYLLMDAPSSG-STSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPL  284
            L++LL D P++  + SK+G P +E+TF T+V+AF+FLDKN DG + K ++V A N+    
Sbjct  121  LVHLLKDDPTAQLAKSKMGMPDLETTFETLVDAFVFLDKNKDGHVSKSEMVDAINETASG  180

Query  283  EKSPSHVTRTRFKEMDWDR  227
            E+S   +   RF+EMDWD+
Sbjct  181  ERSSGQIAMKRFEEMDWDK  199



>gb|KEH22472.1| calcium-binding EF-hand protein [Medicago truncatula]
Length=201

 Score =   182 bits (463),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 86/198 (43%), Positives = 136/198 (69%), Gaps = 0/198 (0%)
 Frame = -3

Query  817  VGSLLCCHGSPNKYSRLDSKLETKVLEVKRNAPATLSIRSINALILKFPHFREGLKEIRT  638
            +G+++CC     +   L+ KLE K+ E++RN      ++SI+++++ FP F+E LK +R 
Sbjct  1    MGAVICCISEQGEKKSLERKLEKKIAEIRRNKFGQTKLKSIDSIVMLFPMFKERLKTLRG  60

Query  637  VFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCL  458
            +FEQ+DEDSN +I+  EL+  L+ LQ H+ E EI+  F+ CD+D ++ I+FNEFIVLLCL
Sbjct  61   MFEQYDEDSNESIEPHELQTFLEDLQLHLPENEIENFFQYCDIDGSKGIQFNEFIVLLCL  120

Query  457  IYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPLEK  278
            I++L +  SS ++ K     +   F+ I+E FLF D+NGDGKL+KKD+V+  N+  P E+
Sbjct  121  IHILTEPLSSDNSPKEELAQLGQVFDKIIEIFLFFDQNGDGKLNKKDMVRTMNETNPRER  180

Query  277  SPSHVTRTRFKEMDWDRS  224
            SP+HVT+ RF  + ++ S
Sbjct  181  SPAHVTKNRFSIVHFNSS  198



>gb|EMS52340.1| putative calcium-binding protein CML22 [Triticum urartu]
Length=321

 Score =   186 bits (471),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 87/230 (38%), Positives = 150/230 (65%), Gaps = 2/230 (1%)
 Frame = -3

Query  835  KLVSDKVGSLLCCHGSPNKYSRLDSKLETKVLEV--KRNAPATLSIRSINALILKFPHFR  662
            K  ++++G       +P K+ R++ +L+ KV E   +R      + RS+N++ ++ P F+
Sbjct  85   KRKNEEMGGAASRLAAPIKHRRVERELDNKVAEALRERAKARKKTFRSVNSITMRLPRFK  144

Query  661  EGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFN  482
            +GLK+IR VF  +D DSNG ID EEL+ CL KL+  + E+E D++ R CDVD  + I+F 
Sbjct  145  DGLKDIRDVFALYDTDSNGTIDNEELRSCLSKLEVRMSEKEADDVHRYCDVDSRKGIQFQ  204

Query  481  EFIVLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAF  302
            EF+VL+CL+YLL     +   S+  S  +   F+ +++AFLF +++GDGK+ +KDV +  
Sbjct  205  EFVVLICLMYLLFGPNVTRRVSEFESDKLNYIFDELIDAFLFFNRDGDGKVTRKDVTQRM  264

Query  301  NDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDED  152
            N+    E++P+H+T   FKEMD +++GK++ ++FLF+ + W G++ ++ D
Sbjct  265  NEESDRERTPTHITTQLFKEMDLNKNGKVNLKEFLFSMIRWAGLEPEEGD  314



>ref|XP_010421964.1| PREDICTED: probable calcium-binding protein CML22, partial [Camelina 
sativa]
Length=175

 Score =   181 bits (458),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 94/175 (54%), Positives = 126/175 (72%), Gaps = 6/175 (3%)
 Frame = -3

Query  808  LLCCHGSPN--KYSRLDSKLETKVLEVKRNAPATLSIRSINALILKFPHFREGLKEIRTV  635
            + CC  S N  KY+ LD+KL  K++E +R  P   S++S++++I+KFP  REGL+ IR V
Sbjct  2    ICCCVKSENNKKYAELDAKLARKMVESRRIYPGHKSLKSMDSIIMKFPKLREGLRNIRNV  61

Query  634  FEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLI  455
            FE +D DSNG ID EELKKCL++LQ  + +EE+  L+  CDVD ++ I+FNEFIVLLCLI
Sbjct  62   FESYDNDSNGTIDIEELKKCLEELQLSLSDEEVKGLYGWCDVDGSKGIQFNEFIVLLCLI  121

Query  454  YLLMDAPSSGSTS---KIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFN  299
            YLL   PSS S +   ++G  +VES F+ IVE FLFLDK+G GKL+K DV+K  N
Sbjct  122  YLL-SKPSSESNAESREMGPKLVESIFDPIVEVFLFLDKDGKGKLNKADVIKTLN  175



>emb|CAA18223.1| putative protein [Arabidopsis thaliana]
 emb|CAB79502.1| putative protein [Arabidopsis thaliana]
Length=248

 Score =   182 bits (463),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 91/218 (42%), Positives = 146/218 (67%), Gaps = 21/218 (10%)
 Frame = -3

Query  766  DSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDRE  590
            ++KLE K++E V+R A    +++S N+++LKFP   +GL+  + +F++FDEDSNG+ID  
Sbjct  18   ETKLEAKIIEAVQRRASRGTTMKSFNSIVLKFPKIDDGLRNCKAIFQEFDEDSNGSIDHT  77

Query  589  ELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMDAPSS-GSTSK  413
            ELK C++KL+    EEEI++LF++CD++++  I F EFIVLLCL+YLL D  S+      
Sbjct  78   ELKNCIRKLEISFDEEEINDLFKACDINEDMGITFTEFIVLLCLVYLLKDDSSTLQKKWT  137

Query  412  IGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPLEKSPSHVTRTRF-----  248
            +G P +E TF T+V+ F+FLD+N DG + ++++V+A +++   E+S   +   RF     
Sbjct  138  MGMPKLEPTFETLVDTFVFLDENKDGYVSREEMVRAIDESG--ERSSGRIAMKRFAFFFT  195

Query  247  ------------KEMDWDRSGKISFRKFLFAFLDWVGI  170
                        +EMDWD++G ++F++FLFAF  WVGI
Sbjct  196  EPRILILIPVSAEEMDWDKNGMVNFKEFLFAFTQWVGI  233



>tpg|DAA38718.1| TPA: calcium ion binding protein [Zea mays]
Length=230

 Score =   182 bits (461),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 84/227 (37%), Positives = 143/227 (63%), Gaps = 6/227 (3%)
 Frame = -3

Query  817  VGSLLCCHGSPNKYSRLDSKLETKVLEV--KRNAPATLSIRSINALILKFPHFREGLKEI  644
            +G +      P K  R++  L+ KV +   +R      + RS+N++ ++ P F+EGL+++
Sbjct  1    MGMVASMCTEPIKRHRVERDLDGKVADALRERTRSRQRTFRSVNSITMRLPRFKEGLRDV  60

Query  643  RTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLL  464
            + +F+Q+DEDS+G ID EEL+    +++ H+ EEE+  L R CD+D  + ++F EF+VLL
Sbjct  61   KNIFDQYDEDSDGTIDSEELQSFGSRVRVHMSEEEMSNLHRYCDIDSRKGVQFQEFVVLL  120

Query  463  CLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPL  284
            CL YLL     +   S+  S  +   F+ +++A++F DK+GDG L ++DV    N+A   
Sbjct  121  CLAYLLFGPDVTRRVSEFESGKLNYVFDELIDAYIFFDKDGDGMLRRRDVTHRMNEASHQ  180

Query  283  EKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGI----DGDDE  155
            E++PSH+T   FKEMD +R+GK++ ++FL++ + W G+    DG DE
Sbjct  181  ERTPSHITAQLFKEMDLNRNGKVNLKEFLYSMIRWAGLGTEDDGSDE  227



>ref|XP_004509620.1| PREDICTED: probable calcium-binding protein CML21-like isoform 
X1 [Cicer arietinum]
Length=233

 Score =   181 bits (460),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 91/191 (48%), Positives = 132/191 (69%), Gaps = 2/191 (1%)
 Frame = -3

Query  790  SPNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDED  614
            SP K    ++KLE K++E ++R      S++S N +ILKFP   E  ++ R +FEQFDED
Sbjct  10   SPKKSWTPETKLEAKMVEAMQRRECHGCSVKSFNTIILKFPKIDESFRKCRAIFEQFDED  69

Query  613  SNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMDAP  434
            SNGAID+EELKKC  KL+    EEEI++LF +CD++D+  +KFNEFIVLLCL+YLL D P
Sbjct  70   SNGAIDQEELKKCFSKLEISFSEEEINDLFEACDINDDLGMKFNEFIVLLCLVYLLKDDP  129

Query  433  SS-GSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPLEKSPSHVTR  257
            ++  + S+IG P +E+TF T+V+ F+FLDKN DG + K ++V+A N+    E+S   +  
Sbjct  130  AALHAKSRIGMPNLEATFETLVDTFVFLDKNKDGYVSKSEMVQAINETTSGERSSGRIAM  189

Query  256  TRFKEMDWDRS  224
             RF ++   R+
Sbjct  190  KRFGQLSLLRT  200



>ref|XP_001784911.1| predicted protein [Physcomitrella patens]
 gb|EDQ50300.1| predicted protein [Physcomitrella patens]
Length=229

 Score =   180 bits (457),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 85/206 (41%), Positives = 136/206 (66%), Gaps = 2/206 (1%)
 Frame = -3

Query  763  SKLETKVLEV--KRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDRE  590
            +K+E ++++   +R     +++++ N  ILKFP      + +R VF + D++ +G++D E
Sbjct  14   TKIERRMVQAMAERAQKVNVTLKTFNTFILKFPKIDASFEAVREVFNKADKNGDGSLDME  73

Query  589  ELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMDAPSSGSTSKI  410
            ELK+CLQ+LQ    ++EI+E     D+D +  I+F EFIV+L LIYLL     +G  S I
Sbjct  74   ELKQCLQELQVEYSDQEIEEFHHESDMDASHGIQFKEFIVVLALIYLLGRPTHTGVESAI  133

Query  409  GSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPLEKSPSHVTRTRFKEMDWD  230
            G P +E+TF+ I EAF+F D+N DG + KK+++ A N+A P  +    +   RF+EMDWD
Sbjct  134  GLPDLEATFDEIAEAFVFFDRNKDGYVSKKEMIWAINEASPSGRHGHRIGVQRFEEMDWD  193

Query  229  RSGKISFRKFLFAFLDWVGIDGDDED  152
            + G I+F++FLFAF DWVG++ D+E+
Sbjct  194  KDGMITFKEFLFAFTDWVGLENDEEE  219



>ref|XP_001775820.1| predicted protein [Physcomitrella patens]
 gb|EDQ59359.1| predicted protein [Physcomitrella patens]
Length=229

 Score =   180 bits (456),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 85/206 (41%), Positives = 135/206 (66%), Gaps = 2/206 (1%)
 Frame = -3

Query  763  SKLETKVLEV--KRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDRE  590
            +K+E ++++   +R   A + +++ N  ILKFP      + +R VF + D++ +G++D +
Sbjct  14   TKIERRMIQAMAERAQIANVVLKTFNTFILKFPKIDASFEAVREVFNKADKNGDGSLDMD  73

Query  589  ELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMDAPSSGSTSKI  410
            ELK+CLQ+LQ    ++EI+E     D+D    I+F EFIV+L LIYLL     +G  S I
Sbjct  74   ELKQCLQELQVEYSDQEIEEFHHESDMDSTHGIQFKEFIVVLALIYLLGRPTHTGVKSAI  133

Query  409  GSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPLEKSPSHVTRTRFKEMDWD  230
            G P +E+TF+ I EAF+F D+N DG + KK+++ A N+A P  +    +   RF+EMDWD
Sbjct  134  GLPDLEATFDEIAEAFVFFDRNKDGYVSKKEMIWAINEASPSGRHGHRIGVQRFEEMDWD  193

Query  229  RSGKISFRKFLFAFLDWVGIDGDDED  152
            + G I+F++FLFAF DWVG++ D+E+
Sbjct  194  KDGMITFKEFLFAFTDWVGLENDEEE  219



>emb|CDX92818.1| BnaC07g40760D [Brassica napus]
Length=228

 Score =   177 bits (449),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 90/201 (45%), Positives = 143/201 (71%), Gaps = 4/201 (2%)
 Frame = -3

Query  766  DSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDRE  590
            ++KLE K+ E ++R      +++S N++ILKFP   EGL+  + +F++FDEDSNG+ID  
Sbjct  16   ETKLEAKIKEAMQRRESKGTTMKSFNSIILKFPKIDEGLRNCKAIFQEFDEDSNGSIDHS  75

Query  589  ELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMDAPSS-GSTSK  413
            ELK C +KL+    EEEI++LF++CD++++  I F EFIVLLCL+YLL D  S+     +
Sbjct  76   ELKNCFRKLEILFEEEEINDLFQACDINEDMGITFTEFIVLLCLVYLLKDDSSTLQKKWR  135

Query  412  IGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPLEKSPSHVTRTRFKEMDW  233
            +G P +E TF T+V+ F+FLD+N DG + ++++ +A +++   E+S   +   RF+EMDW
Sbjct  136  LGMPKLEPTFETLVDTFVFLDENKDGHVSREEMFRAIDES--GERSSGRIAMKRFEEMDW  193

Query  232  DRSGKISFRKFLFAFLDWVGI  170
            D++G ++F++FLFAF  WVGI
Sbjct  194  DKNGMVNFKEFLFAFTQWVGI  214



>ref|XP_009137599.1| PREDICTED: probable calcium-binding protein CML21 [Brassica rapa]
Length=228

 Score =   176 bits (446),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 90/201 (45%), Positives = 144/201 (72%), Gaps = 4/201 (2%)
 Frame = -3

Query  766  DSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDRE  590
            ++KLE K+ E ++R      +++S N++ILKFP   EGL+  + +F++FDEDSNG+ID  
Sbjct  16   ETKLEAKIKEAMQRRESKGTTMKSFNSIILKFPKIDEGLRNCKAIFQEFDEDSNGSIDHS  75

Query  589  ELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMDAPSS-GSTSK  413
            ELK C +KL+    EEEI++LF++CD++++ +I F EFIVLLCL+YLL D  S+     +
Sbjct  76   ELKNCFRKLEILFEEEEINDLFQACDINEDMEIAFTEFIVLLCLVYLLKDDSSTLQKKWR  135

Query  412  IGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPLEKSPSHVTRTRFKEMDW  233
            +G P +E TF T+V+ F+FLD+N DG + ++++ +A +++   E+S   +   RF+EMDW
Sbjct  136  LGMPKLEPTFETLVDTFVFLDENKDGHVSREEMFRAIDESG--ERSSGRIALKRFEEMDW  193

Query  232  DRSGKISFRKFLFAFLDWVGI  170
            D++G ++F++FLFAF  WVGI
Sbjct  194  DKNGMVNFKEFLFAFTLWVGI  214



>emb|CDY42732.1| BnaA03g48070D [Brassica napus]
Length=228

 Score =   176 bits (445),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 90/201 (45%), Positives = 143/201 (71%), Gaps = 4/201 (2%)
 Frame = -3

Query  766  DSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDRE  590
            ++KLE K+ E ++R      +++S N++ILKFP   EGL+  + +F++FDEDSNG+ID  
Sbjct  16   ETKLEAKIKEAMQRRESKGTTMKSFNSIILKFPKIDEGLRNCKAIFQEFDEDSNGSIDHS  75

Query  589  ELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMDAPSS-GSTSK  413
            ELK C +KL+    EEEI++LF++CD++++ +I F EFIVLLCL+YLL D  S+     +
Sbjct  76   ELKNCFRKLEILFEEEEINDLFQACDINEDMEIAFTEFIVLLCLVYLLKDDSSTLQKKWR  135

Query  412  IGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPLEKSPSHVTRTRFKEMDW  233
            +G P +E TF T+V+ F+FLD+N DG + ++++ +A +++   E+S   +   RF+EMDW
Sbjct  136  LGMPKLEPTFETLVDTFVFLDENKDGHVSREEMFRAIDESG--ERSSGRIAMKRFEEMDW  193

Query  232  DRSGKISFRKFLFAFLDWVGI  170
            D +G ++F++FLFAF  WVGI
Sbjct  194  DNNGMVNFKEFLFAFTLWVGI  214



>emb|CDX94327.1| BnaC01g18570D [Brassica napus]
Length=225

 Score =   169 bits (427),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 90/201 (45%), Positives = 145/201 (72%), Gaps = 4/201 (2%)
 Frame = -3

Query  766  DSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDRE  590
            ++KLE K++E V+R A    +++S N+++LKFP   EGL+  + +F++FDEDSNG+ID  
Sbjct  12   ETKLEAKIIEAVQRRASRGTTMKSFNSIVLKFPKIDEGLRNCKAIFQEFDEDSNGSIDHT  71

Query  589  ELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMDAPSS-GSTSK  413
            ELK C +KL+    E+EI++LF +CD++++  I F EF+VLLCL+YLL D  S+     +
Sbjct  72   ELKNCFRKLEISFEEDEINDLFEACDINEDMGITFTEFVVLLCLVYLLKDDSSTLQKKWR  131

Query  412  IGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPLEKSPSHVTRTRFKEMDW  233
            +G P +E TF T+V+ F+FLD+N DG + ++++V+A +++   E+S   +   RF+EMDW
Sbjct  132  LGMPKLEPTFETLVDTFVFLDENKDGLVSREEMVRAIDES--GERSSGRIAMKRFEEMDW  189

Query  232  DRSGKISFRKFLFAFLDWVGI  170
            D++G ++F++FLFAF  WVGI
Sbjct  190  DKNGMVNFKEFLFAFTQWVGI  210



>ref|XP_002990940.1| hypothetical protein SELMODRAFT_132549 [Selaginella moellendorffii]
 gb|EFJ07984.1| hypothetical protein SELMODRAFT_132549 [Selaginella moellendorffii]
Length=226

 Score =   165 bits (417),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 82/201 (41%), Positives = 130/201 (65%), Gaps = 4/201 (2%)
 Frame = -3

Query  763  SKLETKVLEV--KRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDRE  590
            SK+E +++E   KR        +S N++++KFP   +  +++R VF++FD+D +G ID E
Sbjct  15   SKIERRMVEAMRKRAKAGPSPFKSFNSILMKFPKIDKSFEQVRGVFKKFDKDDSGTIDLE  74

Query  589  ELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMDAPSSGSTSKI  410
            ELK C ++LQ    + E+       D+D ++ + F EFI++L L+YLL +  +    S+I
Sbjct  75   ELKTCFRELQVEFTDTEVKAFHEESDMDKSKGVDFKEFIIVLALVYLLGETGAK-PKSRI  133

Query  409  GSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPLEKSPSH-VTRTRFKEMDW  233
            G   +ESTF TIV+ F F DK+GDG + +K+++ A N+A P + S    +   RF+EMDW
Sbjct  134  GLAELESTFETIVDTFRFFDKDGDGYVSRKEMITAINEASPGQSSSGESIGVKRFEEMDW  193

Query  232  DRSGKISFRKFLFAFLDWVGI  170
            D++G I+F++FLFAF DWVGI
Sbjct  194  DKNGMITFKEFLFAFTDWVGI  214



>ref|XP_008667961.1| PREDICTED: calcium ion binding protein isoform X1 [Zea mays]
Length=260

 Score =   165 bits (418),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 82/247 (33%), Positives = 140/247 (57%), Gaps = 36/247 (15%)
 Frame = -3

Query  787  PNKYSRLDSKLETKVLEV--KRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDED  614
            P K  R++  L+ KV +   +R      + RS+N++ ++ P F+EGL++++ +F+Q+DED
Sbjct  11   PIKRHRVERDLDGKVADALRERTRSRQRTFRSVNSITMRLPRFKEGLRDVKNIFDQYDED  70

Query  613  SNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMDAP  434
            S+G ID EEL+    +++ H+ EEE+  L R CD+D  + ++F EF+VLLCL YLL    
Sbjct  71   SDGTIDSEELQSFGSRVRVHMSEEEMSNLHRYCDIDSRKGVQFQEFVVLLCLAYLLFGPD  130

Query  433  SSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPLEKSPSHVTRT  254
             +   S+  S  +   F+ +++A++F DK+GDG L ++DV    N+A   E++PSH+T  
Sbjct  131  VTRRVSEFESGKLNYVFDELIDAYIFFDKDGDGMLRRRDVTHRMNEASHQERTPSHITAQ  190

Query  253  RF------------------------------KEMDWDRSGKISFRKFLFAFLDWVGI--  170
             F                              +EMD +R+GK++ ++FL++ + W G+  
Sbjct  191  LFSTRSSCLLLFSPVAVLSKLMCVCVSVSVSAEEMDLNRNGKVNLKEFLYSMIRWAGLGT  250

Query  169  --DGDDE  155
              DG DE
Sbjct  251  EDDGSDE  257



>gb|ERN01821.1| hypothetical protein AMTR_s00089p00059230 [Amborella trichopoda]
Length=225

 Score =   163 bits (412),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 87/225 (39%), Positives = 135/225 (60%), Gaps = 8/225 (4%)
 Frame = -3

Query  817  VGSLLCCHGSPNKYSRLDSKLETKVLEVKR---NAPATLSIRSINALILKFPHFREGLKE  647
            +G +     SP    R  SKL   V E  +   +A      RSI+ +++KFP   EGLKE
Sbjct  1    MGGIWGRLSSPLSQMRASSKLHMMVGEAMKRRVSAGGGSPFRSIDGMLMKFPKLIEGLKE  60

Query  646  IRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVL  467
            +  +F+QFD+DSNG I+ EEL++    LQ    ++ +  L+ +C++D ++ I F + ++L
Sbjct  61   LHIIFDQFDKDSNGTINWEELRQIFSYLQLKFSDQTLANLYDACEMDGHKGINFAKLVLL  120

Query  466  LCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFP  287
            L   +LL D P       +  P +E TFNT+++AF+FLDKNGDG +++K++V+A  +A  
Sbjct  121  LGWFHLLEDHPYESHAGDL--PHIEGTFNTLIDAFVFLDKNGDGYINRKEMVQAIKEAPS  178

Query  286  LEKSP---SHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGD  161
             EKS      +   RFKEMD D++G ISF++FL AF  W+ I+ D
Sbjct  179  KEKSSKDTKDIAMNRFKEMDCDKNGHISFKEFLLAFTRWIEINDD  223



>ref|XP_002982786.1| hypothetical protein SELMODRAFT_422194 [Selaginella moellendorffii]
 gb|EFJ16031.1| hypothetical protein SELMODRAFT_422194 [Selaginella moellendorffii]
Length=243

 Score =   159 bits (403),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 84/217 (39%), Positives = 132/217 (61%), Gaps = 19/217 (9%)
 Frame = -3

Query  763  SKLETKVLEV--KRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDRE  590
            SK+E +++E   KR        +S N++++KFP   +  +++R VF++FD+D +G ID E
Sbjct  15   SKIERRMVEAMRKRAKAGPSPFKSFNSILMKFPKIDKSFEQVRGVFKKFDKDDSGTIDLE  74

Query  589  ELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMDAPS-------  431
            ELK C ++LQ    + E+       D+D ++ + F EFI++L L+YLL +  +       
Sbjct  75   ELKTCFRELQVEFTDTEVKAFHEESDMDKSKGVDFKEFIIVLALVYLLGETGAKPVKQKE  134

Query  430  ----SGST-----SKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPLEK  278
                 GS      S+IG   +ESTF TIV+ F F DK+GDG + +K+++ A N+A P + 
Sbjct  135  EDKGKGSQLKNLKSRIGLAELESTFETIVDTFRFFDKDGDGYVSRKEMITAINEASPGQS  194

Query  277  SPSH-VTRTRFKEMDWDRSGKISFRKFLFAFLDWVGI  170
            S    +   RF+EMDWD++G I+F++FLFAF DWVGI
Sbjct  195  SSGESIGVKRFEEMDWDKNGMITFKEFLFAFTDWVGI  231



>ref|XP_002990719.1| hypothetical protein SELMODRAFT_429138 [Selaginella moellendorffii]
 gb|EFJ08168.1| hypothetical protein SELMODRAFT_429138 [Selaginella moellendorffii]
Length=233

 Score =   155 bits (393),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 84/212 (40%), Positives = 128/212 (60%), Gaps = 25/212 (12%)
 Frame = -3

Query  733  KRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQF---------DEDSNGAIDREELK  581
            +R A A  S++S +A+++KF        ++R VF++F         D+   G ID E+LK
Sbjct  28   QRAAAAKSSVKSFDAILMKFSKIDMAFDQVRDVFKRFASAGWILVADKHKRGTIDLEQLK  87

Query  580  KCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMDAPSSGSTSKIGSP  401
             C ++L+    EEE+   +   DVD N +I F EFIV+L L YLL +  +S   S+IG P
Sbjct  88   ACFRELKVEFTEEEVQMFYEEGDVDHNRRISFKEFIVVLALAYLLGEPLNSDGKSRIGLP  147

Query  400  VVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPLEKSPSHVTRT--------RFK  245
             +E +F TI +AF+F DKNGDG + K++++++ +++       SH T T        RF+
Sbjct  148  DLEWSFETIEDAFVFFDKNGDGYVTKEEMIESIHES-------SHATNTQQDSIGVERFE  200

Query  244  EMDWDRSGKISFRKFLFAFLDWVGIDGDDEDH  149
            EMDWDR G+++F++FL AF  WVGI+ DDED 
Sbjct  201  EMDWDRDGRVTFKEFLLAFTGWVGIE-DDEDQ  231



>ref|NP_001078450.1| putative calcium-binding protein CML21 [Arabidopsis thaliana]
 dbj|BAE99871.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE85205.1| putative calcium-binding protein CML21 [Arabidopsis thaliana]
Length=211

 Score =   154 bits (390),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 75/175 (43%), Positives = 123/175 (70%), Gaps = 4/175 (2%)
 Frame = -3

Query  766  DSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDRE  590
            ++KLE K++E V+R A    +++S N+++LKFP   +GL+  + +F++FDEDSNG+ID  
Sbjct  18   ETKLEAKIIEAVQRRASRGTTMKSFNSIVLKFPKIDDGLRNCKAIFQEFDEDSNGSIDHT  77

Query  589  ELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMDAPSS-GSTSK  413
            ELK C++KL+    EEEI++LF++CD++++  I F EFIVLLCL+YLL D  S+      
Sbjct  78   ELKNCIRKLEISFDEEEINDLFKACDINEDMGITFTEFIVLLCLVYLLKDDSSTLQKKWT  137

Query  412  IGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPLEKSPSHVTRTRF  248
            +G P +E TF T+V+ F+FLD+N DG + ++++V+A +++   E+S   +   RF
Sbjct  138  MGMPKLEPTFETLVDTFVFLDENKDGYVSREEMVRAIDESG--ERSSGRIAMKRF  190



>ref|XP_002986712.1| hypothetical protein SELMODRAFT_425580 [Selaginella moellendorffii]
 gb|EFJ12275.1| hypothetical protein SELMODRAFT_425580 [Selaginella moellendorffii]
Length=233

 Score =   154 bits (390),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 84/212 (40%), Positives = 128/212 (60%), Gaps = 25/212 (12%)
 Frame = -3

Query  733  KRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQF---------DEDSNGAIDREELK  581
            +R A A  S++S +A+++KF        ++R VF++F         D+   G ID E+LK
Sbjct  28   QRAAAAKSSVKSFDAILMKFSKIDMAFDQVRDVFKRFASVGWILVADKHKRGTIDLEQLK  87

Query  580  KCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMDAPSSGSTSKIGSP  401
             C ++L+    EEE+   +   DVD N +I F EFIV+L L YLL +  +S   S+IG P
Sbjct  88   ACFRELKVEFTEEEVQIFYEEGDVDHNRRISFKEFIVVLALAYLLGEPLNSDGKSRIGLP  147

Query  400  VVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPLEKSPSHVTRT--------RFK  245
             +E +F TI +AF+F DKNGDG + K++++++ +++       SH T T        RF+
Sbjct  148  DLEWSFETIEDAFVFFDKNGDGYVTKEEMIESIHES-------SHATNTQQDSIGVERFE  200

Query  244  EMDWDRSGKISFRKFLFAFLDWVGIDGDDEDH  149
            EMDWDR G+++F++FL AF  WVGI+ DDED 
Sbjct  201  EMDWDRDGRVTFKEFLLAFTGWVGIE-DDEDQ  231



>gb|EMS67685.1| putative calcium-binding protein CML21 [Triticum urartu]
Length=313

 Score =   155 bits (391),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 97/296 (33%), Positives = 143/296 (48%), Gaps = 88/296 (30%)
 Frame = -3

Query  793  GSPNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDE  617
            G   +YS   +KLE K+++ +++ A    S++S N++I+KFP   E L+  R +F+QF E
Sbjct  8    GDTPRYSSAATKLEQKMVDAMQQRAQQGTSVKSFNSVIMKFPKIDENLRNCRIIFQQFGE  67

Query  616  -------DSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCL  458
                   DSNG ID+ ELK C QKL     +EEI +LF +CD+ ++  +KFNEFIV LCL
Sbjct  68   HYPPVYEDSNGEIDQLELKHCFQKLDISFTDEEIKDLFEACDIYEHMGMKFNEFIVFLCL  127

Query  457  IYLLMDAPSSGSTS----------------------------------------KIGSPV  398
            +YLL D   S + S                                        ++G   
Sbjct  128  VYLLNDPAVSEAVSFILPNIKYTYFQIPAITWCFTAAATPWSRNRMQSAFDQRKRMGLGN  187

Query  397  VESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPLEKSPSHVTRTRF----------  248
            +E TF T+V+AF+FLDKN DG + K +V++A N+    E+S   +   RF          
Sbjct  188  LEPTFETLVDAFVFLDKNKDGYVSKNEVIEAINETSAGERSSGRIGVKRFEILFKFGNCI  247

Query  247  ------------------------------KEMDWDRSGKISFRKFLFAFLDWVGI  170
                                          +EMDWD++G ++F++FLFAF  WVGI
Sbjct  248  GGLVLSAYYSPHYESFLIYVDPDVYSLVVPEEMDWDKNGTVTFKEFLFAFTRWVGI  303



>gb|AFK48479.1| unknown [Medicago truncatula]
Length=129

 Score =   148 bits (373),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 96/124 (77%), Gaps = 0/124 (0%)
 Frame = -3

Query  529  LFRSCDVDDNEKIKFNEFIVLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLD  350
             F+ CD+D ++ I+FNEFIVLLCLI++L +  SS ++ K     +   F+ I+E FLF D
Sbjct  6    FFQYCDIDGSKGIQFNEFIVLLCLIHILTEPLSSDNSPKEELAQLGQVFDKIIEIFLFFD  65

Query  349  KNGDGKLHKKDVVKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGI  170
            +NGDGKL+KKD+V+  N+  P E+SP+HVT+ RF+EMDWD++G+++FR+FLF F++WVGI
Sbjct  66   QNGDGKLNKKDMVRTMNETNPRERSPAHVTKNRFREMDWDKNGQVTFREFLFGFINWVGI  125

Query  169  DGDD  158
            D D+
Sbjct  126  DVDE  129



>ref|XP_002323775.2| hypothetical protein POPTR_0017s08200g [Populus trichocarpa]
 gb|EEF03908.2| hypothetical protein POPTR_0017s08200g [Populus trichocarpa]
Length=136

 Score =   143 bits (360),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 81/180 (45%), Positives = 108/180 (60%), Gaps = 47/180 (26%)
 Frame = -3

Query  697  INALILKFPHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRS  518
            +N LI+ FP F E LK IR VFEQ+DED NG+ID EELKKCLQKL   + +EE+++LF S
Sbjct  1    MNILIMWFPQFNEELKHIRGVFEQYDEDVNGSIDLEELKKCLQKLTLTL-KEEVEDLFHS  59

Query  517  CDVDDNEKIKFNEFIVLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGD  338
            CD+D++    F E I LL              TSK+GSP +++TF+TIVEAFLFL+KN  
Sbjct  60   CDIDNSTSSMFLEVINLL--------------TSKMGSPELQATFDTIVEAFLFLNKN--  103

Query  337  GKLHKKDVVKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDD  158
                                          +EMDWDR+GK+SFR+FL + ++W+ ID D+
Sbjct  104  ------------------------------EEMDWDRNGKVSFREFLSSLINWIRIDADE  133



>ref|XP_011621825.1| PREDICTED: probable calcium-binding protein CML21 [Amborella 
trichopoda]
Length=202

 Score =   125 bits (314),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 63/157 (40%), Positives = 100/157 (64%), Gaps = 5/157 (3%)
 Frame = -3

Query  622  DEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLM  443
            D+DSNG I+ EEL++    LQ    ++ +  L+ +C++D ++ I F + ++LL   +LL 
Sbjct  46   DKDSNGTINWEELRQIFSYLQLKFSDQTLANLYDACEMDGHKGINFAKLVLLLGWFHLLE  105

Query  442  DAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPLEKSP---  272
            D P       +  P +E TFNT+++AF+FLDKNGDG +++K++V+A  +A   EKS    
Sbjct  106  DHPYESHAGDL--PHIEGTFNTLIDAFVFLDKNGDGYINRKEMVQAIKEAPSKEKSSKDT  163

Query  271  SHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGD  161
              +   RFKEMD D++G ISF++FL AF  W+ I+ D
Sbjct  164  KDIAMNRFKEMDCDKNGHISFKEFLLAFTRWIEINDD  200



>ref|XP_002862334.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH38592.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=142

 Score =   121 bits (304),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 55/114 (48%), Positives = 86/114 (75%), Gaps = 1/114 (1%)
 Frame = -3

Query  766  DSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDRE  590
            ++KLE K++E V+R A    +++S N+++LKFP   +GL+  + +F++FDEDSNG+ID  
Sbjct  18   ETKLEAKIIEAVQRRASRGTTMKSFNSIVLKFPKIDDGLRNCKAIFQEFDEDSNGSIDHT  77

Query  589  ELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMDAPSS  428
            ELK C++KL+    EEEI++LF++CD++++  I F EFIVLLCL+YLL D  S+
Sbjct  78   ELKNCIKKLEISFDEEEINDLFKACDINEDMGITFTEFIVLLCLVYLLKDDSST  131



>gb|AFW87515.1| hypothetical protein ZEAMMB73_336887 [Zea mays]
Length=165

 Score =   120 bits (302),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 66/156 (42%), Positives = 103/156 (66%), Gaps = 4/156 (3%)
 Frame = -3

Query  817  VGSLLCCHGSPNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIR  641
            +G++L  H + +K S   SKLE K+++ +++ A    S++S +++I+KFP   E  ++ +
Sbjct  1    MGAVLGRHDT-HKRSSHGSKLEVKMVDAMQQRASHGTSLKSFDSIIMKFPKIDESFRKCK  59

Query  640  TVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  461
            T+FEQFDEDSNG ID+EELK C QKL+    EEEI +LF +CD++++  +KFNEFIV LC
Sbjct  60   TIFEQFDEDSNGEIDKEELKHCFQKLEISFTEEEICDLFEACDINEDMGMKFNEFIVFLC  119

Query  460  LIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFL  353
            L+YLL +A    + S I    + S  N ++   + L
Sbjct  120  LVYLLNEAAVLEAVSFISH--INSHSNILIALLVLL  153



>gb|ACR34117.1| unknown [Zea mays]
 gb|AFW87514.1| hypothetical protein ZEAMMB73_336887 [Zea mays]
Length=163

 Score =   111 bits (278),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 64/156 (41%), Positives = 101/156 (65%), Gaps = 6/156 (4%)
 Frame = -3

Query  817  VGSLLCCHGSPNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIR  641
            +G++L  H + +K S   SKLE K+++ +++ A    S++S +++I+KFP   E  ++ +
Sbjct  1    MGAVLGRHDT-HKRSSHGSKLEVKMVDAMQQRASHGTSLKSFDSIIMKFPKIDESFRKCK  59

Query  640  TVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  461
            T+FEQFD  SNG ID+EELK C QKL+    EEEI +LF +CD++++  +KFNEFIV LC
Sbjct  60   TIFEQFD--SNGEIDKEELKHCFQKLEISFTEEEICDLFEACDINEDMGMKFNEFIVFLC  117

Query  460  LIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFL  353
            L+YLL +A    + S I    + S  N ++   + L
Sbjct  118  LVYLLNEAAVLEAVSFISH--INSHSNILIALLVLL  151



>gb|KJB63080.1| hypothetical protein B456_009G454500 [Gossypium raimondii]
Length=128

 Score =   107 bits (266),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 76/107 (71%), Gaps = 1/107 (1%)
 Frame = -3

Query  793  GSPNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDE  617
            G   K    ++KLE K++E ++  A    +I+S N++ILKFP     L++ + +FEQFDE
Sbjct  3    GVVGKSESPETKLEAKMVEAMQHRASKGTTIKSFNSIILKFPKIDHTLRKCKAIFEQFDE  62

Query  616  DSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEF  476
            DSNGAID EELKKCL KLQ    EEEI++LF++CD++++  IKFNEF
Sbjct  63   DSNGAIDHEELKKCLHKLQVCFTEEEIEDLFKACDMNEDMGIKFNEF  109



>gb|KJB63081.1| hypothetical protein B456_009G454500 [Gossypium raimondii]
Length=165

 Score =   107 bits (266),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 76/107 (71%), Gaps = 1/107 (1%)
 Frame = -3

Query  793  GSPNKYSRLDSKLETKVLE-VKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDE  617
            G   K    ++KLE K++E ++  A    +I+S N++ILKFP     L++ + +FEQFDE
Sbjct  3    GVVGKSESPETKLEAKMVEAMQHRASKGTTIKSFNSIILKFPKIDHTLRKCKAIFEQFDE  62

Query  616  DSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEF  476
            DSNGAID EELKKCL KLQ    EEEI++LF++CD++++  IKFNEF
Sbjct  63   DSNGAIDHEELKKCLHKLQVCFTEEEIEDLFKACDMNEDMGIKFNEF  109



>ref|XP_003062470.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH53289.1| predicted protein [Micromonas pusilla CCMP1545]
Length=204

 Score =   108 bits (269),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 59/190 (31%), Positives = 106/190 (56%), Gaps = 18/190 (9%)
 Frame = -3

Query  682  LKFPHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQK---LQFHVGEEEIDELFRSCD  512
            +KFP      + +R +F++ D+D+NG I++ E    +++    +  V  E I+ ++   D
Sbjct  1    MKFPSMLSSFEALRGIFDRVDKDANGFIEKHEFVTAVEEGFSRKVTVEREMIERIYDEAD  60

Query  511  VDDNEKIKFNEFIVLLCLIYLLM---------DAPSSGSTSKIGSPVVESTFNTIVEAFL  359
            +  + ++ + EF++++ L+YL+          D   SGS  +    +V +    ++EAFL
Sbjct  61   LKHDGRVNYKEFVLMIVLLYLVSWETDLSVGKDTAVSGSAGE--DTLVHNAVQKVLEAFL  118

Query  358  FLDKNGDGKLHKKDVVK---AFNDAFPLEKSP-SHVTRTRFKEMDWDRSGKISFRKFLFA  191
            F D NGDG + K +V+K   A   A   +K+    +T  RF+E+DWD+SG++ F++FLFA
Sbjct  119  FFDANGDGYIRKDEVLKKLEAHEGAHAKQKTEHGGLTAARFRELDWDKSGRVDFKQFLFA  178

Query  190  FLDWVGIDGD  161
               W G+D D
Sbjct  179  VEGWCGMDDD  188



>emb|CDY70736.1| BnaCnng69600D, partial [Brassica napus]
Length=85

 Score = 97.1 bits (240),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/73 (62%), Positives = 56/73 (77%), Gaps = 1/73 (1%)
 Frame = -3

Query  370  EAFLFLDKNGDGKLHKKDVVKAFNDA-FPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLF  194
            E FLFLDK+G GKL+K DV+K  N+  +PLE SP HVT  RF+EMDW R GK+ FR+FLF
Sbjct  1    EVFLFLDKDGKGKLNKADVIKRLNNEDYPLEISPKHVTNMRFEEMDWGRKGKVGFREFLF  60

Query  193  AFLDWVGIDGDDE  155
            AF+ WVG+D  D+
Sbjct  61   AFMSWVGLDDADD  73



>ref|XP_008619093.1| hypothetical protein SDRG_14719 [Saprolegnia diclina VS20]
 gb|EQC27519.1| hypothetical protein SDRG_14719 [Saprolegnia diclina VS20]
Length=287

 Score =   101 bits (251),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 71/254 (28%), Positives = 120/254 (47%), Gaps = 48/254 (19%)
 Frame = -3

Query  775  SRLDSKLETKVLEVK--RNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDEDSNGA  602
            S LDSKL   + E+K  ++            ++LK P  +E    +R  F +FD+   G 
Sbjct  31   STLDSKLMEALRELKARKDHDGGDKHDPFTKILLKGPALKEAFDSVRVTFREFDKQQKGF  90

Query  601  IDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMDAPSSGS  422
            I  ++++  L +L  +  + EIDE F   D+ +N ++ F EF+V L + ++L   P+  +
Sbjct  91   IVFDDMESALNRLGGNFTKAEIDEAFSEADMAENGQLSFKEFLVCLAMGFVLHRIPALET  150

Query  421  T-----SKIGSPV----------------VESTFNTIVEAFLFLDKNGDGKLHKKDVVKA  305
            T     S   +P+                +   F   V+ FL+ D +GDG + K+++++ 
Sbjct  151  TETPQLSIFYAPLAGKAEPKTLLFGEGNKLRQAFQLAVDVFLWFDMDGDGLIEKEEMLRR  210

Query  304  FNDAFPLEKSPSH-----------------------VTRTRFKEMDWDRSGKISFRKFLF  194
              ++   E SP+                        +++ RF EMDWD  G I+F++FL 
Sbjct  211  LTESMH-EHSPTKKMSKVRKLGSTTKSSGTCPANAFISQKRFNEMDWDHDGSITFKEFLM  269

Query  193  AFLDWVGIDGDDED  152
            AF  WVG+D DDED
Sbjct  270  AFESWVGVD-DDED  282



>ref|XP_010468449.1| PREDICTED: probable calcium-binding protein CML22 [Camelina sativa]
Length=182

 Score = 98.2 bits (243),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 77/241 (32%), Positives = 109/241 (45%), Gaps = 79/241 (33%)
 Frame = -3

Query  808  LLCC---HGSPNKYSRLDSKLETKVLEVKRNAPATLSIRSINALILKFPHFREGLKEIRT  638
            ++CC     +  KY+ LD KL  K++E +R  P                           
Sbjct  1    MICCCVKSDTNKKYAELDGKLARKMVESRRIYPG--------------------------  34

Query  637  VFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFR-SCDVDDNEKIKFNEFIVLLC  461
                 + D NG ID EELKKCL++LQ  + +EE+  L+   CDVD ++ I+FNEF+  L 
Sbjct  35   ---HKNNDKNGTIDIEELKKCLEELQLSLSDEEVKGLYGIWCDVDGSKGIQFNEFMFKL-  90

Query  460  LIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDA-FPL  284
                                         +E FLFLDK G GK++K DV+K  N+  +PL
Sbjct  91   -----------------------------IEVFLFLDKEGKGKVNKADVIKTLNNEDYPL  121

Query  283  EKSPSHVTRTRFKEMDWDRSGKISFR------------KFLF--AFLDWVGIDGDDEDHM  146
            E+S SHVT  RF E D      I F             K++   AF+ WVG+D  D+ +M
Sbjct  122  ERSLSHVTNMRF-EFDLLIGDSICFHELQKKWIGEEKEKWVLESAFMSWVGLDDADDYYM  180

Query  145  A  143
            +
Sbjct  181  S  181



>ref|XP_009840757.1| hypothetical protein H257_14590 [Aphanomyces astaci]
 gb|ETV69742.1| hypothetical protein H257_14590 [Aphanomyces astaci]
Length=356

 Score = 93.2 bits (230),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 65/269 (24%), Positives = 125/269 (46%), Gaps = 67/269 (25%)
 Frame = -3

Query  787  PNKYSRLDSKLETKVLEVKRNAPATLSIRSINA------------LILKFPHFREGLKEI  644
            PN + ++ S L+ K++    NA   L +R  N             ++LK P  ++    +
Sbjct  71   PNPH-KVSSSLDLKLI----NALKELKVRKENGVGGHDKHDPFTKILLKGPSLKQAFDSV  125

Query  643  RTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLL  464
            R+ F+ FD+   G+I   ++++ L +L  +  ++EI++ F   D+ ++ ++ F EF+V L
Sbjct  126  RSTFDAFDKLKQGSISFNDMEEALNRLGGNFTKDEINDAFTEADMSESGRLTFKEFLVCL  185

Query  463  CLIYLLMDAPSSGSTSKIGSPV---------------------------VESTFNTIVEA  365
             + ++L   P+    S+ G P                            +   F+  V+ 
Sbjct  186  AIGFVLHRIPALDDRSEGGQPRLSIFYAPLKGSGKDGQPKALLFGDGNKLRQAFHLAVDV  245

Query  364  FLFLDKNGDGKLHKKDVVKAFNDAF----PLEKS-----------------PSH--VTRT  254
            FL+ D +GDG + K +++   +++     P +K+                 P++  +T+ 
Sbjct  246  FLWFDMDGDGLIEKNEMLSRLHESMHEHSPTKKTSKQRSLAKGDVEAMINCPANTFITQR  305

Query  253  RFKEMDWDRSGKISFRKFLFAFLDWVGID  167
            RF EMDWD  G I+F++FL AF  WVG++
Sbjct  306  RFNEMDWDHDGSITFKEFLMAFESWVGVN  334



>ref|XP_008878820.1| hypothetical protein H310_13196 [Aphanomyces invadans]
 gb|ETV92513.1| hypothetical protein H310_13196 [Aphanomyces invadans]
Length=345

 Score = 92.8 bits (229),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 67/268 (25%), Positives = 119/268 (44%), Gaps = 58/268 (22%)
 Frame = -3

Query  787  PNKY---SRLDSKL--ETKVLEVKRNAPATLSIR--SINALILKFPHFREGLKEIRTVFE  629
            PN +   S LD KL    K L V+R   A    +      ++LK P  ++    +R+ F+
Sbjct  74   PNPHHVSSSLDQKLINAFKELRVRRENDAHSHDKHDPFTKILLKGPSLKQAFDSVRSTFD  133

Query  628  QFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYL  449
             FD    G+I   ++++ L +L  +  ++E+ + F   D+ ++ ++ F EF+V L + ++
Sbjct  134  AFDTHKQGSISFGDMEEALNRLGGNFTKDEVYDAFNEADMTESGRLTFKEFLVCLAIGFV  193

Query  448  LMDAPSSGSTSKIGSPVV---------------------------ESTFNTIVEAFLFLD  350
            L   P+       G P +                              F+  V+ FL+ D
Sbjct  194  LHRIPALDDREPDGQPQLSIFYAPLNSSIKDGEPKSLLFGDGNKLRQAFHLAVDVFLWFD  253

Query  349  KNGDGKLHKKDVVKAFNDAFPLEKSP-----------------------SHVTRTRFKEM  239
             +GDG + + +++   +++   E SP                       S +T+ RF EM
Sbjct  254  IDGDGLIERNEMLSRLHESM-HEHSPTKKTSKQRSFLKASDATVTCPANSFITQRRFNEM  312

Query  238  DWDRSGKISFRKFLFAFLDWVGIDGDDE  155
            DWD  G I+F++FL AF  WVG+D +D+
Sbjct  313  DWDHDGSITFKEFLMAFESWVGVDDEDD  340



>gb|KDO27543.1| hypothetical protein SPRG_06811 [Saprolegnia parasitica CBS 223.65]
Length=287

 Score = 91.3 bits (225),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 65/245 (27%), Positives = 112/245 (46%), Gaps = 47/245 (19%)
 Frame = -3

Query  775  SRLDSKLETKVLEVK--RNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDEDSNGA  602
            S LDSKL   + E+K  ++            ++LK P  +E    +R  F +FD+   G 
Sbjct  31   STLDSKLMDALRELKARKDHDGGDKHDPFTKILLKGPALKEAFDSVRVTFREFDKQQKGF  90

Query  601  IDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMDAPSSGS  422
            I  ++++  L +L  +  + EIDE F   D+ +N ++ F EF+V L + ++L   P+  +
Sbjct  91   IVFDDMESALNRLGGNFTKAEIDEAFSEADMAENGQLSFKEFLVCLAMGFVLHRIPALET  150

Query  421  T-----SKIGSPVVEST----------------FNTIVEAFLFLDKNGDGKLHKKDVVKA  305
            T     S   +P+   T                F   V+ FL+ D +GDG + K+++++ 
Sbjct  151  TETPQLSIFYAPLAGKTEPKTLLFGEGNKLRQAFQLAVDVFLWFDMDGDGLIEKEEMLRR  210

Query  304  FNDAFPLEKSPSH-----------------------VTRTRFKEMDWDRSGKISFRKFLF  194
              ++   E SP+                        +++ RF EMDWD  G I+F++FL 
Sbjct  211  LTESMH-EHSPTKKMSKARKLGSTTKSGSTCPANAFISQKRFNEMDWDHDGSITFKEFLM  269

Query  193  AFLDW  179
            AF  W
Sbjct  270  AFESW  274



>gb|EAZ22107.1| hypothetical protein OsJ_05766 [Oryza sativa Japonica Group]
Length=93

 Score = 87.0 bits (214),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 58/81 (72%), Gaps = 0/81 (0%)
 Frame = -3

Query  412  IGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPLEKSPSHVTRTRFKEMDW  233
            +G   +E TF T+V++F+FLDKN DG + K ++++A N+    E+S   +   RF+EMDW
Sbjct  1    MGLGSLEPTFETLVDSFVFLDKNKDGYVSKNEMIQAINETIGGERSSGRIGMKRFEEMDW  60

Query  232  DRSGKISFRKFLFAFLDWVGI  170
            D++G ++F++FLFAF  WVGI
Sbjct  61   DKNGTVTFKEFLFAFTRWVGI  81



>emb|CBN76140.1| calcium ion binding [Ectocarpus siliculosus]
Length=378

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 56/201 (28%), Positives = 101/201 (50%), Gaps = 20/201 (10%)
 Frame = -3

Query  700  SINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFR  521
            S   ++LK    R  + +IR VF++ D D +G ID  E+   ++ L+ ++ E+EI  LF+
Sbjct  44   SFTRVLLKLGTVRTFMNDIRRVFQERDTDQSGRIDMCEMSTAMKDLKVNLSEDEIKALFK  103

Query  520  SCDVDDNEKIKFNEFIVLLCLIYL------LMDAPSSGSTSKIGS-------------PV  398
              D  +++++   +F+V+L + Y+      LM+ P++                       
Sbjct  104  MADFYEDKQLTMKQFLVVLAMGYVLDAIPDLMENPATAEAEAAARAAGRRMSNFYNKEQT  163

Query  397  VESTFNTIVEAFLFLDKNGDGKLHKKDV-VKAFNDAFPLEKSPSHVTRTRFKEMDWDRSG  221
            V +       A+L  DK   G + ++ V +    +    E S S +++ R+ EMDWD +G
Sbjct  164  VRNALELFTYAYLLFDKECKGVISREQVMIVVAENGQKDEGSMSILSQERWDEMDWDSNG  223

Query  220  KISFRKFLFAFLDWVGIDGDD  158
             ISF +F++AF  WV +DG+D
Sbjct  224  DISFGEFVYAFTKWVDVDGED  244



>ref|XP_006299579.1| hypothetical protein CARUB_v10015753mg [Capsella rubella]
 gb|EOA32477.1| hypothetical protein CARUB_v10015753mg [Capsella rubella]
Length=157

 Score = 85.9 bits (211),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 74/135 (55%), Gaps = 25/135 (19%)
 Frame = -3

Query  802  CCHGSPN--KYSRLDSKLETKVLEVKRNAPATLSIRSINALILKFPHFREGLKEIRTVFE  629
            CC  S    KY+ LD+KL  K++E +R  P   S++S++++I+KFP  REGL+ IR+VFE
Sbjct  4    CCVNSEKNKKYAELDAKLARKMVESRRIYPGHRSLKSMDSIIMKFPKLREGLRNIRSVFE  63

Query  628  QF--------------------DEDSNGAIDREELKKCLQKLQFHVGEEEIDELF---RS  518
             +                    D D NG ID EELKKCL++L+  + +EE+  L+     
Sbjct  64   SYAFIKIPLVFLFNILVLRIFSDNDKNGTIDIEELKKCLEELKLSLSDEEVKGLYGCAEE  123

Query  517  CDVDDNEKIKFNEFI  473
             D     K+ F EF+
Sbjct  124  MDWGRKGKVGFREFL  138


 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -3

Query  247  KEMDWDRSGKISFRKFLFAFLDWVGIDGDDEDHMA  143
            +EMDW R GK+ FR+FLFAF+ WVG+D  D+ + +
Sbjct  122  EEMDWGRKGKVGFREFLFAFMSWVGLDDADDYYTS  156



>gb|ETI45580.1| hypothetical protein F443_09884 [Phytophthora parasitica P1569]
 gb|ETM45391.1| hypothetical protein L914_09550 [Phytophthora parasitica]
Length=325

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 67/275 (24%), Positives = 117/275 (43%), Gaps = 53/275 (19%)
 Frame = -3

Query  835  KLVSDKVGSLLCCHGSPNKYSRLDSKLETKVLE--VKRNAPATLSIRSINALILKFPHFR  662
            KL++  + S+     +P   + LD K+   + E   +R             ++LK P   
Sbjct  49   KLLTSNIASIRPVEQTPRVPTPLDQKITNAIKERWQERAQQEKEKENQFTRILLKLPQAA  108

Query  661  EGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFN  482
                  R+ F  FD++  G I+  +L +  ++L  +   EEI ++F   D+ ++ K+ FN
Sbjct  109  VAFNSARSTFNAFDKEGKGYIEFSDLSRVFEQLGANFSSEEIGQVFEESDMMEDGKLNFN  168

Query  481  EFIVLLCLIYLLMDAPSSGST-----SKIGSPVVES------------------------  389
            EF+V L + ++L   PS  S      S   +P+  +                        
Sbjct  169  EFLVCLAIGFVLHKIPSLESEQEQQLSIFYAPMSRTSSNSSRTSSAVSSQSILFGDGNNL  228

Query  388  --TFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPLEKSPSHVTRT-------------  254
               F   V+AFL+ D +G+G +++ ++V    ++  L  SP+    T             
Sbjct  229  RLAFQLAVDAFLWFDVDGNGVINRDEMVTKLENSIVLH-SPTKKMSTGDRNRGSSDYSSN  287

Query  253  ------RFKEMDWDRSGKISFRKFLFAFLDWVGID  167
                  RF EMDW+  G I F++FL AF  WVG++
Sbjct  288  RAIWEQRFMEMDWNGDGTIHFKEFLMAFESWVGLE  322



>gb|ETK85532.1| hypothetical protein L915_09682 [Phytophthora parasitica]
 gb|ETL38971.1| hypothetical protein L916_09586 [Phytophthora parasitica]
 gb|ETL92092.1| hypothetical protein L917_09511 [Phytophthora parasitica]
 gb|ETO74224.1| hypothetical protein F444_09978 [Phytophthora parasitica P1976]
 gb|ETP15388.1| hypothetical protein F441_09834 [Phytophthora parasitica CJ01A1]
 gb|ETP43453.1| hypothetical protein F442_09789 [Phytophthora parasitica P10297]
Length=325

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 67/275 (24%), Positives = 117/275 (43%), Gaps = 53/275 (19%)
 Frame = -3

Query  835  KLVSDKVGSLLCCHGSPNKYSRLDSKLETKVLE--VKRNAPATLSIRSINALILKFPHFR  662
            KL++  + S+     +P   + LD K+   + E   +R             ++LK P   
Sbjct  49   KLLTSNIASIRPVEQTPRVPTPLDQKITNAIKERWQERAQQEKEKENQFTRILLKLPQAA  108

Query  661  EGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFN  482
                  R+ F  FD++  G I+  +L +  ++L  +   EEI ++F   D+ ++ K+ FN
Sbjct  109  VAFNSARSTFNAFDKEGKGYIEFSDLSRVFEQLGANFSSEEIGQVFEESDMMEDGKLNFN  168

Query  481  EFIVLLCLIYLLMDAPSSGST-----SKIGSPVVES------------------------  389
            EF+V L + ++L   PS  S      S   +P+  +                        
Sbjct  169  EFLVCLAIGFVLHKIPSLESEQEQQLSIFYAPMSRTSSNSSRTSSAVSSQSILFGDGNNL  228

Query  388  --TFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPLEKSPSHVTRT-------------  254
               F   V+AFL+ D +G+G +++ ++V    ++  L  SP+    T             
Sbjct  229  RLAFQLAVDAFLWFDVDGNGVINRDEMVTKLENSIVLH-SPTKKMSTGDRNRGSSDDSSN  287

Query  253  ------RFKEMDWDRSGKISFRKFLFAFLDWVGID  167
                  RF EMDW+  G I F++FL AF  WVG++
Sbjct  288  RAIWEQRFMEMDWNGDGTIHFKEFLMAFESWVGLE  322



>ref|XP_008892917.1| hypothetical protein PPTG_01392 [Phytophthora parasitica INRA-310]
 gb|ETN21086.1| hypothetical protein PPTG_01392 [Phytophthora parasitica INRA-310]
Length=325

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 65/274 (24%), Positives = 115/274 (42%), Gaps = 51/274 (19%)
 Frame = -3

Query  835  KLVSDKVGSLLCCHGSPNKYSRLDSKLETKVLE--VKRNAPATLSIRSINALILKFPHFR  662
            KL++  + S+     +P   + LD K+   + E   +R             ++LK P   
Sbjct  49   KLLTSNIASIRPVEQTPRVPTPLDQKITNAIKERWQERAQQEKEKENQFTRILLKLPQAA  108

Query  661  EGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFN  482
                  R+ F  FD++  G I+  +L +  ++L  +   EEI ++F   D+ ++ K+ FN
Sbjct  109  VAFNSARSTFNAFDKEGKGYIEFSDLSRVFEQLGANFSSEEIGQVFEESDMMEDGKLNFN  168

Query  481  EFIVLLCLIYLLMDAPSSGST-----SKIGSPVVES------------------------  389
            EF+V L + ++L   PS  S      S   +P+                           
Sbjct  169  EFLVCLAIGFVLHKIPSLESEQEQQLSIFYAPMSRISSNSSRTSSAVSSQSILFGDGNNL  228

Query  388  --TFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPL------------------EKSPS  269
               F   V+AFL+ D +G+G +++ ++V    ++  L                  + S  
Sbjct  229  RLAFQLAVDAFLWFDVDGNGVINRDEMVTKLENSIVLHSPTKKMFTGDRNRGSSDDSSNR  288

Query  268  HVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGID  167
             +   RF EMDW+  G I F++FL AF  WVG++
Sbjct  289  AIWEQRFMEMDWNGDGTIHFKEFLMAFESWVGLE  322



>ref|XP_008909760.1| hypothetical protein PPTG_14587 [Phytophthora parasitica INRA-310]
 gb|ETI40385.1| hypothetical protein F443_14192 [Phytophthora parasitica P1569]
 gb|ETK80489.1| hypothetical protein L915_13831 [Phytophthora parasitica]
 gb|ETL33914.1| hypothetical protein L916_13728 [Phytophthora parasitica]
 gb|ETM40377.1| hypothetical protein L914_13640 [Phytophthora parasitica]
 gb|ETN04823.1| hypothetical protein PPTG_14587 [Phytophthora parasitica INRA-310]
 gb|ETO69095.1| hypothetical protein F444_14211 [Phytophthora parasitica P1976]
 gb|ETP10206.1| hypothetical protein F441_14088 [Phytophthora parasitica CJ01A1]
 gb|ETP38305.1| hypothetical protein F442_14032 [Phytophthora parasitica P10297]
Length=292

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 62/290 (21%), Positives = 117/290 (40%), Gaps = 55/290 (19%)
 Frame = -3

Query  862  GLSRPCLSLKLVSDKVGSLLCCHGSPNKYSRL----DSKLETKVLEVKRNAPATLSIRSI  695
            G+S+P ++  L S +  S+    G+ +   +     D + E+       +A    ++R +
Sbjct  4    GVSKPAVTRSLRSAR-ASITSPRGASSHVDKARPASDGRRESTKQPTSIDARIIATLRQL  62

Query  694  N----------------ALILKFPHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKL  563
            N                 ++L+F   R+    +R+++ QF       +D E LK  L  +
Sbjct  63   NLTRRADPKKGRAMHFERIVLQFALVRDAFTTLRSIYRQFANAEKDGLDFEGLKAALNAM  122

Query  562  QFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYL----------------------  449
              H+ E ++ E+F   D+  +  +  NEF+V L + +L                      
Sbjct  123  GAHIKETDVSEIFYESDMVRDNSLSQNEFVVSLAIAHLLGLITNFDSIKDSVVHAPEDVT  182

Query  448  LMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPLEKSPS  269
            L+  P   +     S ++    + +V A+L  D +  G +   +V++          SP 
Sbjct  183  LVTPPDEPAEQGNASKLIAKALDLMVTAYLLFDNDASGTIQTSEVLEQMRQNPTGPNSPR  242

Query  268  HVTRT------------RFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDE  155
             + R             R KE+D+D+ G I+F++F+  F  W G D DDE
Sbjct  243  RLERMESSFSSKAIRDERIKELDFDQDGTITFQEFVLTFQRWAGSDDDDE  292



>gb|ETL87187.1| hypothetical protein L917_13535 [Phytophthora parasitica]
Length=292

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 62/290 (21%), Positives = 117/290 (40%), Gaps = 55/290 (19%)
 Frame = -3

Query  862  GLSRPCLSLKLVSDKVGSLLCCHGSPNKYSRL----DSKLETKVLEVKRNAPATLSIRSI  695
            G+S+P ++  L S +  S+    G+ +   +     D + E+       +A    ++R +
Sbjct  4    GVSKPAVTRSLRSAR-ASITSPRGASSHVDKARPASDGRRESTKQPTSIDARIIATLRQL  62

Query  694  N----------------ALILKFPHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKL  563
            N                 ++L+F   R+    +R+++ QF       +D E LK  L  +
Sbjct  63   NLTRRADPKKGRAMHFERIVLQFTLVRDAFTTLRSIYRQFANAEKDGLDFEGLKAALNAM  122

Query  562  QFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYL----------------------  449
              H+ E ++ E+F   D+  +  +  NEF+V L + +L                      
Sbjct  123  GAHIKETDVSEIFYESDMVRDNSLSQNEFVVSLAIAHLLGLITNFDSIKDSVVHAPEDVT  182

Query  448  LMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPLEKSPS  269
            L+  P   +     S ++    + +V A+L  D +  G +   +V++          SP 
Sbjct  183  LVTPPDEPAEQGNASKLIAKALDLMVTAYLLFDNDASGTIQTSEVLEQMRQNPTGPNSPR  242

Query  268  HVTRT------------RFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDE  155
             + R             R KE+D+D+ G I+F++F+  F  W G D DDE
Sbjct  243  RLERMESSFSSKAIRDERIKELDFDQDGTITFQEFVLTFQRWAGSDDDDE  292



>ref|XP_002907045.1| conserved hypothetical protein [Phytophthora infestans T30-4]
 gb|EEY63609.1| conserved hypothetical protein [Phytophthora infestans T30-4]
Length=296

 Score = 83.6 bits (205),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 60/296 (20%), Positives = 119/296 (40%), Gaps = 39/296 (13%)
 Frame = -3

Query  925  MGSSIYHC*VNPRLKTMKGSVGLSRPCLSLKLVSDKVGSLLCCHGSPNKYSRLDSKLETK  746
            MG  +    +   L++ + S+   R  +S  + +    +      S  + + +D+++   
Sbjct  1    MGGGVSKPAITRSLRSARASISSVRTAISHPVDNKARPASEGRRESTKQPTSIDARIIAT  60

Query  745  VLEV---KRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDREELKKC  575
            + ++   +R  P          ++L+F   R+    +R+++ QF       +D E LK  
Sbjct  61   LRQLNLTRRADPKKGRAMHFERIVLQFALVRDAFTTLRSIYRQFANAEKDGLDFEGLKAA  120

Query  574  LQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLL-------------MDAP  434
            L  +  H+ E ++ E+F   D+  +  +  NEF+V L + +LL             + AP
Sbjct  121  LNAMGAHIKESDVSEIFYESDMVRDNSLSQNEFVVSLAIAHLLGLITNFDSIKASVVQAP  180

Query  433  -----------SSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFP  287
                                S ++    + ++ A+L  D +  G +   +V+        
Sbjct  181  EDVTLITPPDEPPAEQGNNASKLIAKALDLMISAYLLFDNDASGTIQTSEVLDQMRQNPT  240

Query  286  LEKSPSHVTRT------------RFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDE  155
               SP  + R             R KE+D+D+ G I+F++F+  F  W G D DDE
Sbjct  241  GPNSPRRLERMESSFSSKAIRDERIKELDFDQDGTITFQEFVLTFQRWAGSDDDDE  296



>ref|XP_007224348.1| hypothetical protein PRUPE_ppa020720mg [Prunus persica]
 gb|EMJ25547.1| hypothetical protein PRUPE_ppa020720mg [Prunus persica]
Length=160

 Score = 81.3 bits (199),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 49/60 (82%), Gaps = 0/60 (0%)
 Frame = -3

Query  619  EDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMD  440
            EDSNGAID+EE+KKC  KL+    +EEI +LF +CD++++  IKFNEFIVL+CL+YLL D
Sbjct  21   EDSNGAIDQEEMKKCFYKLEVCFTDEEISDLFEACDINEDMGIKFNEFIVLICLVYLLKD  80



>ref|XP_009526471.1| hypothetical protein PHYSODRAFT_502537, partial [Phytophthora 
sojae]
 gb|EGZ17413.1| hypothetical protein PHYSODRAFT_502537, partial [Phytophthora 
sojae]
Length=236

 Score = 82.4 bits (202),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 54/202 (27%), Positives = 91/202 (45%), Gaps = 39/202 (19%)
 Frame = -3

Query  646  IRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVL  467
            +R+ F  +D ++ G I+  +L +  ++L  +   EEI  +F+  D+  + K+ F EF+V 
Sbjct  24   VRSTFRVYDRENKGYIEFADLSRVFEQLGANFSSEEISMVFQESDMMKDGKLNFKEFLVC  83

Query  466  LCLIYLLMDAPS-SGSTSKIGSPVVEST--------------------FNTIVEAFLFLD  350
            L + ++L   PS  G    I    + ST                    F   V+AFL+ D
Sbjct  84   LAIGFVLHKIPSLEGERLSIFYAPINSTPASAPTQFILFGEGNKLRLAFQLAVDAFLWFD  143

Query  349  KNGDGKLHKKDVVKAFNDAFPL------------------EKSPSHVTRTRFKEMDWDRS  224
             +GDG +++ ++      +  L                  + S   +   RF EMDW+  
Sbjct  144  VDGDGVINRSEMSTKLQHSMALHSPTKKMTADDMNKDTSDDSSNQAIWEQRFMEMDWNGD  203

Query  223  GKISFRKFLFAFLDWVGIDGDD  158
            G I F++FL AF  WVG++ DD
Sbjct  204  GTIQFKEFLMAFESWVGLEDDD  225



>emb|CCI44687.1| unnamed protein product [Albugo candida]
Length=272

 Score = 83.2 bits (204),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 58/213 (27%), Positives = 101/213 (47%), Gaps = 26/213 (12%)
 Frame = -3

Query  742  LEVKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKL  563
            L++KR+    L++  I   ILKF   R     +R ++++F ED    +    LK  L+ L
Sbjct  64   LKLKRDNSHALNLERI---ILKFGVARAAFDSLREIYDEFAEDD--GLTYVGLKLALKAL  118

Query  562  QFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLL----------------MDAPS  431
               + ++++ E+F   DV  +  +  NEF+V L + +LL                 D+  
Sbjct  119  GTTILDQDLQEIFFESDVVRDNSLSMNEFVVSLAIGHLLGLLQTSESRKASSSSKRDSEC  178

Query  430  SGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPLEKSPSHVTRT-  254
            S S       VV   F+ ++ A+L  D +G G +   +V+K  N      ++ +H  R+ 
Sbjct  179  SPSLGVNELDVVVKMFDLLISAYLLFDADGSGMIDSNEVLKVINPKTTSGRAGNHTERSG  238

Query  253  ----RFKEMDWDRSGKISFRKFLFAFLDWVGID  167
                R KE+D +  G I+F++F+  F  WVG+D
Sbjct  239  IGEARIKELDVNEDGTITFQEFVLTFQGWVGVD  271



>ref|XP_009526469.1| hypothetical protein PHYSODRAFT_264348 [Phytophthora sojae]
 gb|EGZ17411.1| hypothetical protein PHYSODRAFT_264348 [Phytophthora sojae]
Length=346

 Score = 84.0 bits (206),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 65/281 (23%), Positives = 113/281 (40%), Gaps = 66/281 (23%)
 Frame = -3

Query  823  DKVGSLLCCHGSPNKYSRLDSKLETKVLEVKRNAPATLSIRSINALILKFPHFREGLKEI  644
            +KV +   C  + +       +L        +++P  L       ++LKFP   +    +
Sbjct  40   EKVSTHASCGPTESSIETTKEQLHRHPTHTHKDSP--LDRNPFTRILLKFPQAAKAFNGV  97

Query  643  RTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLL  464
            R+ F+ FD++ +G I  ++L    ++L     E+EI+++F   D+ +N K+ F E +V L
Sbjct  98   RSTFKTFDKEGHGYIVSDDLPAIYKELGVSFSEDEINQVFEESDMKENGKLTFKELLVSL  157

Query  463  CLIYLLMDAPS-------------SGS-TSKIGSPV------------------------  398
             + +LL   PS             SGS    I   V                        
Sbjct  158  AIGFLLHRIPSLEKNRLSVFYTSRSGSINGSISGSVGRNNNIGGNSVGGSSTSSTAMAMN  217

Query  397  -----VESTFNTIVEAFLFLDKNGDGKLHKKDV--------------------VKAFNDA  293
                 + S +   ++AFL+ D  G G +++ D+                       + D+
Sbjct  218  GDDVELRSAYQLAIDAFLWFDTEGSGYINRNDMSVQLEASMARHSPTKKLKRRSGGYKDS  277

Query  292  FPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGI  170
                K+ S +   RF EMDW+ +G I F +FL AF  WVG+
Sbjct  278  GEDSKNWS-IWERRFAEMDWNHNGMIHFNEFLMAFESWVGV  317



>ref|XP_002896992.1| conserved hypothetical protein [Phytophthora infestans T30-4]
 gb|EEY66473.1| conserved hypothetical protein [Phytophthora infestans T30-4]
Length=237

 Score = 80.1 bits (196),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 57/234 (24%), Positives = 105/234 (45%), Gaps = 52/234 (22%)
 Frame = -3

Query  712  LSIRSINALILKFPHFREGLKE---IRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEE  542
            +++R  NA+  ++    +  KE   +R+ F  FD++  G I+  +L +  ++L      E
Sbjct  1    MAVRITNAIKERWQERSQHEKEKENVRSTFNAFDKERKGYIEFADLSRVFEQLGAKFSIE  60

Query  541  EIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMDAPS-----SGSTSKIGSPVVES----  389
            EI ++F   D+ ++ K+ FNEF+V L + ++L   PS         S   +P+  +    
Sbjct  61   EIGQVFEESDMMEDGKLTFNEFLVCLAIGFVLHKIPSLEGEQEQPLSIFYAPMSRTSSNS  120

Query  388  ----------------------TFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPL---  284
                                   F   V+AFL+ D +G+G++++ ++V    ++  L   
Sbjct  121  SRSSSGGSGQSILFGDGNKLRLAFQLAVDAFLWFDVDGNGEINRDEMVTKLQNSMTLHSP  180

Query  283  ---------------EKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGID  167
                           + S   +   RF EMDW+  G I F++FL AF  WVG++
Sbjct  181  TKKMSTGERSRGTSDDSSNRAIWEQRFMEMDWNGDGTIHFKEFLMAFESWVGLE  234



>emb|CCA15835.1| conserved hypothetical protein [Albugo laibachii Nc14]
Length=276

 Score = 80.5 bits (197),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 59/224 (26%), Positives = 111/224 (50%), Gaps = 24/224 (11%)
 Frame = -3

Query  775  SRLDSKLETKVLEVKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDEDSNGAID  596
            +R+++++   +  +K N   T ++ ++  +ILKF   R     +R ++++F E+ NG + 
Sbjct  55   TRINARIIDTLRSLKTNKENTQTL-NLERIILKFGVARAAFDSLREIYDEFAEE-NG-LT  111

Query  595  REELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLL-----MDAPS  431
               LK  L+ L   + ++++ E+F   DV  +  +  NEF+V L + +LL      ++  
Sbjct  112  YVGLKSALEALGTTILDQDLQEIFFESDVVRDNSLSMNEFVVSLAIGHLLGLLQTFESKQ  171

Query  430  SGSTSKIGSP-----------VVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFN----D  296
              STSK  +            VV   F+ ++ A+L  D +G G +   +V+K  N     
Sbjct  172  VSSTSKRDTETSTSLGDNERDVVVKMFDLLISAYLLFDADGSGIIDSSEVLKVMNPNTNS  231

Query  295  AFPLEKSP-SHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGID  167
                + S  S +   R KE+D +  G I+F++F+  F  WVG+D
Sbjct  232  GLACKHSEKSGIGEARIKELDINEDGTITFQEFVLTFQGWVGVD  275



>ref|XP_009519854.1| hypothetical protein PHYSODRAFT_325675 [Phytophthora sojae]
 gb|EGZ24566.1| hypothetical protein PHYSODRAFT_325675 [Phytophthora sojae]
Length=294

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 53/217 (24%), Positives = 93/217 (43%), Gaps = 43/217 (20%)
 Frame = -3

Query  688  LILKFPHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDV  509
            ++L+F   R+    IR++++QF +     +D E LK  L  +   + E ++ ELF   D+
Sbjct  82   IVLQFALVRDAFTTIRSIYKQFADAEKDGLDFEGLKSALSAMGAQIKESDMSELFYESDM  141

Query  508  DDNEKIKFNEFIVLLCLIYL-------------LMDAPS--------------SGSTSKI  410
              +  +  NEF+V L + +L             L+ AP                G+ SK+
Sbjct  142  VRDNSLSQNEFVVSLAIAHLLGLITNFDSIKNSLVHAPEDVTLITPPEEQPADQGNASKL  201

Query  409  GSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPLEKSPSHVTRT--------  254
                +    + +V A+L  D +  G +   +V++          SP  + R         
Sbjct  202  ----IAKALDLMVTAYLLFDNDASGTIQTSEVLEQMRQNTTGANSPRRLERVSSGLSSKA  257

Query  253  ----RFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDE  155
                R KE+D+D+ G I+F++F+  F  W   D DDE
Sbjct  258  IQDERIKELDFDQDGTITFQEFVLTFQRWAVSDDDDE  294



>ref|XP_002507740.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO68998.1| predicted protein [Micromonas sp. RCC299]
Length=275

 Score = 76.6 bits (187),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 52/224 (23%), Positives = 91/224 (41%), Gaps = 18/224 (8%)
 Frame = -3

Query  787  PNKYSRLDSKLETKVLEVKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDEDSN  608
            P     LD ++  ++     N P     RS +A++  F       + +R VF++ D DS+
Sbjct  10   PRPMGYLDRRIREQLRSYVANEPELKRTRSFHAVVSTFDSMLRSFRGVRAVFDRMDADSS  69

Query  607  GAIDREELKKCLQKLQFH-----------VGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  461
              ID +E     ++L+             V  + +  L+   D + +  I F EF+ LL 
Sbjct  70   DTIDFDEFLIACEQLRVRKRWRILGSDDGVTADTLRALYLHADSNGDGTIDFREFVCLLA  129

Query  460  LIYLLMD--APSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFND---  296
            L+YL+ D  AP+          V  S     + A+L  D  GDG + +  V    +    
Sbjct  130  LLYLMSDPAAPAMDDLHYDTQRVAHSAMTKALGAWLVFDPKGDGFIRRSQVTNVLDSLRL  189

Query  295  --AFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGI  170
                P ++      R R + + WD    ++ + FL A  +W  +
Sbjct  190  RTVHPQDRDMFRSLRKRLRGLPWDIYDTVTLQAFLMAVQEWTDL  233



>ref|XP_005850665.1| hypothetical protein CHLNCDRAFT_140699 [Chlorella variabilis]
 gb|EFN58563.1| hypothetical protein CHLNCDRAFT_140699 [Chlorella variabilis]
Length=276

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 59/252 (23%), Positives = 113/252 (45%), Gaps = 20/252 (8%)
 Frame = -3

Query  862  GLSRPCLSLKLVSDKVG---SLLCCHGSPNKYSR--LDSKLETKVLEVKRNAPATLSIRS  698
            GLSR    +  +S +VG     +    +    SR  L+ +L   ++     A  +     
Sbjct  29   GLSRLSSGVSRLSARVGLRRQYVAASKAEAANSRHALEQRLAEIIMAKAAAADPSAPKVK  88

Query  697  INALILKFPHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRS  518
             N L+L+F    EG    + VF +      G +  E+L+     L +H+ E  +  +F  
Sbjct  89   FNRLLLRFGTLHEGFAASKRVFRELVGVEGGELSLEQLRPACASLGYHLDEATLHSIFAG  148

Query  517  CDVDDNEKIKFNEFIVLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGD  338
             D+D +  +  +EF+  + +++ L   P      ++  P + +T+ T  EAF+    + D
Sbjct  149  ADMDGSRTLNVHEFLATMAIVHSLR-GPED---EELVDPQILATWRTAEEAFMSFASSRD  204

Query  337  GKLHKKDVVKAFNDAFPLEKSPS----------HVTRTRFKEMDWDRSGKISFRKFLFAF  188
            G + K ++    +++   +   S           + + RF+E+D + SG++SF +FLF  
Sbjct  205  GFIEKDELTGLMHESATDQVRHSANGSGGDPIRSIAQQRFEELDLNGSGRVSFLEFLFCL  264

Query  187  LDWVGIDGDDED  152
              WV  D ++ED
Sbjct  265  EGWV-EDAEEED  275



>ref|XP_006823620.1| PREDICTED: calmodulin-like [Saccoglossus kowalevskii]
Length=184

 Score = 72.4 bits (176),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 46/150 (31%), Positives = 77/150 (51%), Gaps = 14/150 (9%)
 Frame = -3

Query  646  IRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVL  467
            +   F++ D+D +G +  +E+KK L+ L   V +E+ID+ F S D +D+ KI +NEF   
Sbjct  40   VMEAFKEIDKDDSGYVTVDEVKKVLKDLGEEVSDEDIDKFFESADKNDDGKISYNEFYA-  98

Query  466  LCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFP  287
               +    +A   G  S+          + ++EAF  LD +G+G L K +V KA  DA  
Sbjct  99   -AWVKATEEAKKEGELSQ----------DEMLEAFKALDADGNGSLTKDEVKKALQDASS  147

Query  286  LEKSPSHVTRTRFKEMDWDRSGKISFRKFL  197
                      +  KE D D+ GK+ +++F+
Sbjct  148  Y--YSDEQVDSMIKEADEDKDGKVDYKEFV  175



>ref|XP_008863480.1| hypothetical protein H310_01913 [Aphanomyces invadans]
 gb|ETW07387.1| hypothetical protein H310_01913 [Aphanomyces invadans]
Length=300

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 50/199 (25%), Positives = 91/199 (46%), Gaps = 21/199 (11%)
 Frame = -3

Query  688  LILKFPHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDV  509
            + ++F +       IR ++ +  +     +  +     L      +    I ++F   D+
Sbjct  102  VAMQFGNVEMAFMCIREIYSKHTDPVRKTMQMDNFCGALSAFGVTIDRPAIQDIFNESDL  161

Query  508  DDNEKIKFNEFIVLLCLIYLLMDAP--SSGSTSK--------------IGSPVVESTFNT  377
              +  + FNEF V L + YLL   P  S+ ST++                +  V   F+T
Sbjct  162  IRDNSLNFNEFAVSLAICYLLNVVPGLSACSTTQGDDHLDDANVELDASDAKRVAKAFDT  221

Query  376  IVEAFLFLDKNGDGKLHKKDVVKAFNDA-FPLEKSPSHVTR----TRFKEMDWDRSGKIS  212
            +V A+L  D++  G +   ++ +  N       KS +H T+     R+KE+DW++ G I+
Sbjct  222  VVNAYLMFDEDASGIIKWDEMKEILNKPENGKAKSTTHKTKFFNVERWKELDWNKDGSIN  281

Query  211  FRKFLFAFLDWVGIDGDDE  155
            F++F  AF  WVG+D DD+
Sbjct  282  FQEFFLAFQKWVGVDDDDQ  300



>ref|XP_009040569.1| hypothetical protein AURANDRAFT_66979 [Aureococcus anophagefferens]
 gb|EGB04654.1| hypothetical protein AURANDRAFT_66979 [Aureococcus anophagefferens]
Length=339

 Score = 71.2 bits (173),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 58/240 (24%), Positives = 101/240 (42%), Gaps = 55/240 (23%)
 Frame = -3

Query  748  KVLEVKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQ  569
            ++L+ KR+  A     + + +++K        K I  V++  D D NG++D +EL+K + 
Sbjct  25   QMLKAKRDELAHAPPVTFSKILMKASSMNATYKRINAVYDSLDTDKNGSLDLKELQKMID  84

Query  568  KLQF--HVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMDAPS------------  431
            +L+    V  E++  +F  CD+D +  I   EFIV L L+YLL   P+            
Sbjct  85   ELEIGHEVSSEDLRSVFELCDIDHDGTISLKEFIVTLSLLYLLRAVPTLVSVRSEGKDVA  144

Query  430  -------SGSTSK--IGSP-----------VVEST---------------------FNTI  374
                   S  T    +GSP           + +ST                      + +
Sbjct  145  GLIKPTCSARTQGPDMGSPERATKQVDHLKLDQSTPRSESANQDAFLGRSNDIRYLVHWV  204

Query  373  VEAFLFLDKNGDGKLHKKDVVKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLF  194
            V A+L  D +  G + K +V +        + S   +   R++E+DWD +G + F +F F
Sbjct  205  VAAYLLFDTDCTGSISKDNVKQMQTQREIGDGSDVFLNEDRWQELDWDHNGVVDFEEFGF  264



>ref|XP_008620055.1| hypothetical protein SDRG_15654 [Saprolegnia diclina VS20]
 gb|EQC26476.1| hypothetical protein SDRG_15654 [Saprolegnia diclina VS20]
Length=281

 Score = 69.3 bits (168),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 49/199 (25%), Positives = 89/199 (45%), Gaps = 24/199 (12%)
 Frame = -3

Query  688  LILKFPHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDV  509
            + L+F +       IR ++E+  +     +D       L        E  + ++F   D+
Sbjct  84   VALQFGNVEIAFMSIREMYERHCDAKAMTLDN--FCSALTSFGVTTDENAVKDIFNESDI  141

Query  508  DDNEKIKFNEFIVLLCLIYLLMDAP----SSGSTSKIGSP-------------VVESTFN  380
              +  + FNEF V L + YLL   P    + G   +  +P              +   F 
Sbjct  142  IRDNALNFNEFAVSLAICYLLDIIPNLFHARGGGDEDDAPGADYKEIERDDALKISKAFE  201

Query  379  TIVEAFLFLDKNGDGKLHKKDVVKAFN--DAFPLEKSPSHV---TRTRFKEMDWDRSGKI  215
            T+V A+L  D++  G +   ++ +  N  ++  L+ + +H       R+KE+DW++ G I
Sbjct  202  TVVNAYLMFDQDASGIIKWGEMKEILNKPESSKLKSNAAHAKFFNVERWKELDWNKDGSI  261

Query  214  SFRKFLFAFLDWVGIDGDD  158
            +F++F  AF  WVGID D+
Sbjct  262  NFQEFFLAFQKWVGIDEDE  280



>emb|CCK71480.1| hypothetical protein KNAG_0H00640 [Kazachstania naganishii CBS 
8797]
Length=148

 Score = 66.6 bits (161),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 47/154 (31%), Positives = 73/154 (47%), Gaps = 20/154 (13%)
 Frame = -3

Query  661  EGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFN  482
            E ++E R  F+ FD+D +G+I   EL   ++ L     E+E+ +L    D D N +I F+
Sbjct  8    EQIQEFRDAFDLFDKDKSGSISASELTTVMKSLGLTPSEDEVRDLMNEIDQDGNNEIDFD  67

Query  481  EFIVLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAF  302
            EF+ L+      MD+                    ++EAF   DKNGDG + K ++ +  
Sbjct  68   EFLSLMARQANAMDSE-----------------QELIEAFKVFDKNGDGHISKSELKQVL  110

Query  301  NDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKF  200
            N     E+       T FKE+  D SG+IS  +F
Sbjct  111  NSIG--EQLTEEELDTMFKEV-SDGSGEISIEQF  141



>ref|XP_002287177.1| predicted protein [Thalassiosira pseudonana CCMP1335]
 gb|EED94620.1| predicted protein [Thalassiosira pseudonana CCMP1335]
Length=466

 Score = 68.6 bits (166),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 53/195 (27%), Positives = 97/195 (50%), Gaps = 23/195 (12%)
 Frame = -3

Query  688  LILKFPHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEE------EIDEL  527
            +I++FP   +    IR++    D + NG I+  EL   L ++  +VG E      +++ +
Sbjct  278  IIMRFPKIHKVFDRIRSIHAHHDNNKNGRIELSELTPALNEI-MNVGVEHGIDADQVENM  336

Query  526  FRSCDVDDNEKIK----FNEFIVLLCLIYLLMDAPSSGSTSKIGSPVVE------STFNT  377
            F   D++ +E I+      EFIV   + ++L +A      S +G  + E      +    
Sbjct  337  FMLSDLE-HEGIEAGLDVKEFIVFCAVGFVLAEAAKK---STMGGDISENDKEYRAAMMD  392

Query  376  IVEAFLFLDKNGDGKLHKKDVVKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFL  197
            IV A+L  D+ G G     ++    +++   + + S +T  R+ E+D D SG++ F +F+
Sbjct  393  IVAAYLTFDRQGKGYFTADEMHMTVSES-KGKDAASLLTPDRWSELDHDHSGRVDFEEFV  451

Query  196  FAFLDWVGIDGDDED  152
            +AF  WV   GDD+D
Sbjct  452  YAFSSWVNA-GDDDD  465


 Score = 63.9 bits (154),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 53/218 (24%), Positives = 94/218 (43%), Gaps = 27/218 (12%)
 Frame = -3

Query  724  APATLSIRSINA----LILKFPHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQF  557
            A A L+++   A    +I++FP      + +R++  + D +++G +D+EEL K + +L  
Sbjct  21   AKADLAVKHQKANFVRIIMRFPQIHSVFQRLRSIHSRCDVNNDGHVDQEELVKVMTELFG  80

Query  556  HVGEEEIDELFRSCDV-------------DDNEK------IKFNEFIVLLCLIYLLM---  443
                 E  +  R   V             DDNE       +   EFIV+  + ++L    
Sbjct  81   EGMRGEGRDPVRPSVVARTLSLSAVNDTNDDNEGGEKKGGLDVKEFIVMCAIGFILAEED  140

Query  442  -DAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPLEKSPSH  266
             D  + G     G          +V A+L  D+ G G    ++       +   + + S 
Sbjct  141  KDVSTFGGMLASGDDEYRRVMTDVVTAYLSFDREGKGYFTAEEFNGFMTASKRADAARSL  200

Query  265  VTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDED  152
             T  R+KE+D +  G + F +F++AF  WV   G DE+
Sbjct  201  FTEDRWKELDVNGDGTVQFEEFVYAFSQWVDDGGSDEE  238



>ref|XP_009825682.1| hypothetical protein H257_03354 [Aphanomyces astaci]
 gb|ETV83990.1| hypothetical protein H257_03354 [Aphanomyces astaci]
Length=280

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 46/203 (23%), Positives = 86/203 (42%), Gaps = 25/203 (12%)
 Frame = -3

Query  688  LILKFPHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDV  509
            + ++F +       IR ++ +  + +   +  +   + L      +    I ++F   D+
Sbjct  78   VAMQFGNVEMAFMCIRDIYTKHIDPTRKTMQMDNFCRALSAFGVTIDRPAIQDIFNESDL  137

Query  508  DDNEKIKFNEFIVLLCLIYLLMDAPS-SGSTSKIGSPV-------------------VES  389
              +  + FNEF V L + YLL   P  S + S    P+                   V  
Sbjct  138  IRDNSLNFNEFAVSLAICYLLDVVPGLSAANSSPADPLADEPLEDPGVELDATDAKRVAK  197

Query  388  TFNTIVEAFLFLDKNGDGKLHKKDVVKAFN-----DAFPLEKSPSHVTRTRFKEMDWDRS  224
             F+T+V A+L  D++  G +   ++ +  N      A             R+KE+DW++ 
Sbjct  198  AFDTVVNAYLMFDEDASGIIKWDEMKEILNKPEDGKAKTTTHKTKFFNIERWKELDWNKD  257

Query  223  GKISFRKFLFAFLDWVGIDGDDE  155
            G I+F++F  AF  WVG+D D++
Sbjct  258  GSINFQEFFLAFQKWVGVDEDEQ  280



>gb|KJB17909.1| hypothetical protein B456_003G023300 [Gossypium raimondii]
Length=169

 Score = 64.3 bits (155),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 43/153 (28%), Positives = 77/153 (50%), Gaps = 21/153 (14%)
 Frame = -3

Query  652  KEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFI  473
            +EI+  FE FD D +G ID +EL   ++ L F + EE+I+++    D D +  I F+EF+
Sbjct  27   QEIKEAFELFDTDGSGTIDAKELNVAMRALGFEMTEEQIEQMIADVDKDGSGAIDFDEFV  86

Query  472  VLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFND-  296
             ++              T+KIG      T   + +AF  +D++ +GK+  +D+ +  N+ 
Sbjct  87   YMM--------------TAKIGER---DTKEELTKAFQIIDQDNNGKISAQDIERIANEL  129

Query  295  AFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFL  197
               L K      +   +E D D  G++S  +F+
Sbjct  130  GVNLTKKE---IQDMIEEADKDNDGEVSMDEFM  159



>gb|KJB17910.1| hypothetical protein B456_003G023300 [Gossypium raimondii]
Length=170

 Score = 64.3 bits (155),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 43/153 (28%), Positives = 77/153 (50%), Gaps = 21/153 (14%)
 Frame = -3

Query  652  KEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFI  473
            +EI+  FE FD D +G ID +EL   ++ L F + EE+I+++    D D +  I F+EF+
Sbjct  28   QEIKEAFELFDTDGSGTIDAKELNVAMRALGFEMTEEQIEQMIADVDKDGSGAIDFDEFV  87

Query  472  VLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFND-  296
             ++              T+KIG      T   + +AF  +D++ +GK+  +D+ +  N+ 
Sbjct  88   YMM--------------TAKIGER---DTKEELTKAFQIIDQDNNGKISAQDIERIANEL  130

Query  295  AFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFL  197
               L K      +   +E D D  G++S  +F+
Sbjct  131  GVNLTKKE---IQDMIEEADKDNDGEVSMDEFM  160



>emb|CBY17793.1| unnamed protein product [Oikopleura dioica]
 emb|CBY22473.1| unnamed protein product [Oikopleura dioica]
Length=151

 Score = 63.9 bits (154),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 48/163 (29%), Positives = 79/163 (48%), Gaps = 24/163 (15%)
 Frame = -3

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P   E L E R  F+ FD+D NG I+ +ELK  L  L     +EE++EL +  D+D +  
Sbjct  4    PLTHERLLEYREAFQLFDKDGNGTIEIDELKIVLSSLGQPATQEELEELMKLADIDGDGT  63

Query  493  IKFNEFIVLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDV  314
            I  +EFI ++     + DA  + ++ +           T+ E F   D +G GK+   ++
Sbjct  64   IDLDEFIEMMR----VQDAMETENSHE----------ETLRETFQLFDTDGSGKISSSEL  109

Query  313  VKAFNDAFPLEKSPSHVTRTR----FKEMDWDRSGKISFRKFL  197
             +       +EK   H+T ++     KE D D  G+I F +F+
Sbjct  110  KQV------MEKLGDHLTDSQIQAMIKEADADGDGEIDFEEFV  146



>ref|XP_005099702.1| PREDICTED: uncharacterized protein LOC101861733 [Aplysia californica]
Length=493

 Score = 66.6 bits (161),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 47/191 (25%), Positives = 89/191 (47%), Gaps = 13/191 (7%)
 Frame = -3

Query  766  DSKLETKVLEVKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDREE  587
            +++L+  + EV  +   T+       ++ +     +  +EIR  F  FD+D NG I   E
Sbjct  10   EAELQDMINEVDADGNGTIDFPEFLTMMSRKTTDADSEEEIREAFRVFDKDGNGFISAAE  69

Query  586  LKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMDAPSSGSTSKIG  407
            L+  +  L   + +EE++E+ R  D D + ++ ++EF+ ++       D P++       
Sbjct  70   LRHVMSNLGEKLTDEEVEEMIREADSDGDGQVNYDEFVQMMS--QKTDDIPTA-------  120

Query  406  SPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPLEKSPSHVT-RTRFKEMDWD  230
              + E       EAF   DK+GDG +  K++         L ++P+    +    E+D D
Sbjct  121  DQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMR---SLGQNPTEAELQDMINEVDAD  177

Query  229  RSGKISFRKFL  197
             +G I F +FL
Sbjct  178  GNGTIDFPEFL  188


 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/101 (26%), Positives = 54/101 (53%), Gaps = 0/101 (0%)
 Frame = -3

Query  766  DSKLETKVLEVKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDREE  587
            +++L+  + EV  +   T+       ++ +     +  +EIR  F  FD+D NG I   E
Sbjct  390  EAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAE  449

Query  586  LKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLL  464
            L+  +  L   + +EE+DE+ R  D+D + ++ ++EF+ ++
Sbjct  450  LRHVMTNLGEKLTDEEVDEMIREADLDGDGQVNYDEFVKMM  490



>gb|ELU06160.1| hypothetical protein CAPTEDRAFT_227531 [Capitella teleta]
Length=145

 Score = 63.5 bits (153),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 42/157 (27%), Positives = 74/157 (47%), Gaps = 21/157 (13%)
 Frame = -3

Query  664  REGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKF  485
            R+ ++E+R  FE FD+D +G+I  EEL   +  L+    E EI ++ +  D+D   ++ F
Sbjct  3    RQQVEELREAFELFDKDGDGSITSEELLTVMTSLRQQATEAEIKDMIQQVDIDGKGQVSF  62

Query  484  NEFI-VLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVK  308
             +F+ +++CL                     +S  + +  AF   D++GDG +   D+ +
Sbjct  63   EDFVELMMCL------------------RTQQSVNDEMRSAFQIFDQDGDGFIDAMDIGR  104

Query  307  AFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFL  197
               D    EK  +        E D D  GKI+F +F+
Sbjct  105  TMADLG--EKLTAGDVEQMIHEADADGDGKINFEQFI  139



>gb|EPB82214.1| calmodulin [Mucor circinelloides f. circinelloides 1006PhL]
Length=150

 Score = 63.5 bits (153),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 42/153 (27%), Positives = 74/153 (48%), Gaps = 18/153 (12%)
 Frame = -3

Query  655  LKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEF  476
            + E R  F  FD++ +GAID EEL + ++ L     +EE+ ++    D D+N +I FNEF
Sbjct  10   ISEYRESFALFDKNGDGAIDVEELGQVMRSLNQEPTDEELKDMINDVDSDNNGRIDFNEF  69

Query  475  IVLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFND  296
            + ++  +                    + T N ++EAF   DK+ DG + + ++     +
Sbjct  70   LTIMSRM----------------KGADDETENDLLEAFKVFDKDQDGSITQDELRSVMTN  113

Query  295  AFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFL  197
                +K  S       KE D D  GKI++++F+
Sbjct  114  LG--QKLTSQELDEMIKEADTDGDGKINYKEFV  144



>ref|XP_001691376.1| flagellar associated protein [Chlamydomonas reinhardtii]
 gb|EDP05109.1| flagellar associated protein [Chlamydomonas reinhardtii]
Length=339

 Score = 65.5 bits (158),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 51/217 (24%), Positives = 93/217 (43%), Gaps = 15/217 (7%)
 Frame = -3

Query  769  LDSKLETKVLEVKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDRE  590
            L+ KL   ++  KR     +   S N L+L+ P    G K+IR                 
Sbjct  20   LERKLINAIITTKRRKSFKVKKSSFNNLMLQMPKLTAGFKKIREAHSAVTGGKATVPWST  79

Query  589  ELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMDAPSSGSTSK-  413
              + C   L        + EL    +V     +   + I++  ++YLL      GST + 
Sbjct  80   FCQSCATALGLDGSSASLKELLDIPEVGPEVPVTHGDIIIMFTVLYLL-----DGSTKRR  134

Query  412  -IGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDA---FPLEKSPSHVTRTRFK  245
             I +P V S    + ++F+F D + DG + +K++  A       F  + S S   R  F 
Sbjct  135  TIVAPEVRSCLELMEKSFMFFDSSADGCIERKELAVALKSGTRVFGRKASKSLADRL-FD  193

Query  244  EMDWDRSGKISFRKFLFAF----LDWVGIDGDDEDHM  146
            ++DW + G+I+F ++L       ++  G +G+++D +
Sbjct  194  QLDWSKDGQITFCEYLIGMERIIIETAGDEGEEDDDL  230



>ref|XP_010923302.1| PREDICTED: calcium-dependent protein kinase 10-like [Elaeis guineensis]
Length=539

 Score = 66.2 bits (160),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 46/164 (28%), Positives = 79/164 (48%), Gaps = 23/164 (14%)
 Frame = -3

Query  661  EGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFN  482
            E ++ IR +F+  D D+NG +  EELK  LQK+   + E E+  L  + DVD N  + + 
Sbjct  367  EEVEVIREMFKLMDTDNNGKVTFEELKAGLQKVGSQLAEPEMKMLMDAADVDGNGVLDYG  426

Query  481  EFIVLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAF  302
            EF+ ++  +  L                  S    +  AF+F DK+G G +   ++ +A 
Sbjct  427  EFVAVIIHLQRL------------------SNDGHLRRAFVFFDKDGSGYIELDELREAL  468

Query  301  NDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLF---AFLDW  179
             D     ++ + V     +E+D D+ G+IS+ +F+    A  DW
Sbjct  469  TDDS--GQTDTEVVYDILREVDTDKDGRISYEEFVAMMKAGTDW  510



>ref|XP_011397401.1| Palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, chloroplastic 
[Auxenochlorella protothecoides]
 gb|KFM24513.1| Palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, chloroplastic 
[Auxenochlorella protothecoides]
Length=585

 Score = 65.9 bits (159),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 55/218 (25%), Positives = 99/218 (45%), Gaps = 21/218 (10%)
 Frame = -3

Query  775  SRLDSKLETKVLEVKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDEDSNGAID  596
            +RL   ++ K  + +R  P  L+   +       P   +GL     VF   D    G I 
Sbjct  32   ARLSDTIKEKWAQGERGTPMKLNKLLLKL-----PSLHDGLSRAAKVFRSLDVPPTGEIS  86

Query  595  REELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMDAPSSGSTS  416
             ++L+   +KL + V ++ ++  F S D+D +  I  +EF+V+L +++LL          
Sbjct  87   LDQLRAGARKLGYAVDDDVLESAFVSADLDRSSTINVDEFVVILAILHLLK---GPRDEE  143

Query  415  KIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPLEKSP--SHVTRT----  254
             + +  +++ F    +AFL  D +  G + + ++  A  +   LE  P   H + T    
Sbjct  144  DVDAATLKA-FELATQAFLSFDSSRHGFISRDELESALLEPH-LENMPHSPHASATNTIV  201

Query  253  -----RFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDE  155
                 RF E+D D +G+I+F  FL     WV   G++E
Sbjct  202  PLVQQRFLELDRDGNGRITFPDFLACITHWVDEAGEEE  239



>dbj|GAN06811.1| calmodulin [Mucor ambiguus]
Length=149

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 43/153 (28%), Positives = 76/153 (50%), Gaps = 19/153 (12%)
 Frame = -3

Query  655  LKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEF  476
            + E R  F  FD++ +GAID EEL + ++ L      EE+ ++    D D+N +I FNEF
Sbjct  10   ISEYRESFALFDKNGDGAIDAEELGQVMRSLNQDPTNEELKDMINDVDSDNNGRIDFNEF  69

Query  475  IVLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFND  296
            + ++  +         G+         + T N ++EAF   DK+ DG + + ++    ++
Sbjct  70   LTIMSRM--------KGN---------DETENDLLEAFKVFDKDQDGSITQDELRSVMSN  112

Query  295  AFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFL  197
                +K  S       KE D D  GKI++++F+
Sbjct  113  LG--QKLTSQELDEMIKEADTDGDGKINYKEFV  143



>gb|ERG82025.1| calcyphosin-like protein [Ascaris suum]
Length=248

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 41/141 (29%), Positives = 69/141 (49%), Gaps = 6/141 (4%)
 Frame = -3

Query  658  GLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNE  479
            G+K +   F   D++ N  +D +E +K L      + EEE++  F++ D +++  I F+E
Sbjct  60   GIKSLGRSFRIMDDNENRTLDMDEFRKGLHDFGVTIDEEEVEAAFKTLDKNNSGTIDFDE  119

Query  478  FIVLL--CLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKA  305
            F+V L  C +Y    A S     K   P+ +S    I  AF  LDK GDG +   D+   
Sbjct  120  FLVALRNCSVYGFFIATSKNRIVKFQPPMSQSRLAVIDLAFKKLDKTGDGVITVDDMKGI  179

Query  304  FNDAFPLEKSPSHVTRTRFKE  242
            +N     E+ P  ++  + +E
Sbjct  180  YN----AERHPQFISGEKTRE  196



>ref|XP_010269961.1| PREDICTED: caltractin-like [Nelumbo nucifera]
Length=168

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 44/152 (29%), Positives = 78/152 (51%), Gaps = 19/152 (13%)
 Frame = -3

Query  652  KEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFI  473
            +EI+  FE FD D +G ID +EL   ++ L F + EE+I+++    D D +  I F+EF+
Sbjct  26   QEIKEAFELFDTDGSGTIDAKELNVAMRALGFEMTEEQIEQMIADVDKDGSGAIDFDEFV  85

Query  472  VLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDA  293
             ++              T+KIG      T   +++AF  +D++ +GK+ + D +K     
Sbjct  86   HMM--------------TAKIGER---DTKEELMKAFHIIDQDKNGKISEAD-IKHIAKE  127

Query  292  FPLEKSPSHVTRTRFKEMDWDRSGKISFRKFL  197
              L  S   + R   +E D DR G+++  +F+
Sbjct  128  LNLNFSDKEI-RDMVEEADRDRDGEVNSEEFI  158



>ref|XP_011402686.1| PREDICTED: LOW QUALITY PROTEIN: calmodulin-like protein 12 [Amphimedon 
queenslandica]
Length=449

 Score = 65.5 bits (158),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 41/152 (27%), Positives = 74/152 (49%), Gaps = 15/152 (10%)
 Frame = -3

Query  649  EIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIV  470
            EI+  F  FD+D NG I  EEL++ +  L  ++ +EE+D++ R  D+D + ++ + EF+ 
Sbjct  215  EIKEAFRVFDKDGNGFISSEELRQVMTNLGENLTDEEVDDMIREADLDGDGQVNYEEFVK  274

Query  469  LLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAF  290
            ++           +     +   + E       EAF   DK+GDG +  K++        
Sbjct  275  MM-----------TNKVQGVSEKLSEEQVAEFKEAFSLFDKDGDGTITTKELGVVMR---  320

Query  289  PLEKSPSHVT-RTRFKEMDWDRSGKISFRKFL  197
             L ++P+    +    E+D D +G I F +FL
Sbjct  321  SLGQNPTEAELQDMINEVDIDGNGTIDFPEFL  352


 Score = 53.5 bits (127),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/102 (26%), Positives = 55/102 (54%), Gaps = 0/102 (0%)
 Frame = -3

Query  766  DSKLETKVLEVKRNAPATLSIRSINALILKFPHFREGLKEIRTVFEQFDEDSNGAIDREE  587
            +++L+  + EV  +   T+       ++ +     +  +EI+  F  FD+D NG I  EE
Sbjct  328  EAELQDMINEVDIDGNGTIDFPEFLTMMARKSKGGDSEEEIKEAFRVFDKDGNGFISSEE  387

Query  586  LKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLC  461
            L++ +  L   + +EEIDE+ R  D+D + ++ + EF+ ++ 
Sbjct  388  LRQVMVNLGEDLSKEEIDEMIREADIDGDGQVNYEEFVKMMS  429


 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 47/214 (22%), Positives = 90/214 (42%), Gaps = 43/214 (20%)
 Frame = -3

Query  832  LVSDKVGSLLCCHGSPNKYSRLDSKLETKVLEVKRNAPATLSIRSINALILKFPHFREGL  653
            + + ++G+++   G     +  +++L+  + EV  +   T+       ++ +     +  
Sbjct  29   ITTKELGTVMRSLGQ----NPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSE  84

Query  652  KEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFN-EF  476
            +EIR  F  FD+D NG I   EL+  +  L   + +EE+DE+ R  D+D + ++ ++ EF
Sbjct  85   EEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYDAEF  144

Query  475  IVLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFND  296
                                               EAF   DK+GDG +  K++      
Sbjct  145  ----------------------------------KEAFSLFDKDGDGAITTKELGTVMR-  169

Query  295  AFPLEKSPSHVT-RTRFKEMDWDRSGKISFRKFL  197
               L + P+    +    E+D D +G I F +FL
Sbjct  170  --SLGQKPTEAELKDILNEIDIDGNGTIDFPEFL  201



>ref|XP_004288038.2| PREDICTED: caltractin [Fragaria vesca subsp. vesca]
Length=203

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 53/191 (28%), Positives = 88/191 (46%), Gaps = 38/191 (20%)
 Frame = -3

Query  721  PATLSIRSINALILKFPHFRE--------GL-----KEIRTVFEQFDEDSNGAIDREELK  581
            P + S R   A + + P  +E        GL     +EI+  FE FD D +G ID +EL 
Sbjct  25   PLSYSTRFQMATLYRGPSRKEKPRAGRHHGLNQQKRQEIKEAFELFDTDGSGTIDAKELN  84

Query  580  KCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMDAPSSGSTSKIGSP  401
              ++ L F + EE+I+++    D D +  I F+EF  ++              T+KIG  
Sbjct  85   VAMRALGFEMTEEQINQMIADVDKDGSGAIDFDEFAHMM--------------TAKIGE-  129

Query  400  VVESTFNTIVEAFLFLDKNGDGKLHKKD---VVKAFNDAFPLEKSPSHVTRTRFKEMDWD  230
                T   +++AF  LD++ +GK+   D   + K   + F   +    V     +E D D
Sbjct  130  --RDTKEELMKAFHILDQDNNGKISTADIKKIAKELGETFTDREIQEMV-----EEADRD  182

Query  229  RSGKISFRKFL  197
            R G++S  +F+
Sbjct  183  RDGEVSADEFI  193



>gb|ABR16212.1| unknown [Picea sitchensis]
Length=183

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 42/153 (27%), Positives = 75/153 (49%), Gaps = 8/153 (5%)
 Frame = -3

Query  658  GLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNE  479
            G  E+R VF  FD++ +G I ++E+++   KL+  +GEEE+    R+ DV+ +  + F+E
Sbjct  28   GRDELRRVFAIFDKNGDGLISKQEMRESFDKLRLCIGEEELASTIRTVDVNGDGYVDFDE  87

Query  478  FIVLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFN  299
            F+ L    Y  M    SG   + G    E     + EAF   D+NGDG +  +++     
Sbjct  88   FVTL----YESM----SGKRGEGGDAKAEHEDADLAEAFGVFDENGDGLITVEELQSVLK  139

Query  298  DAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKF  200
                 E       +   +++D D  G +++ +F
Sbjct  140  SLCFEEGRTIGDCKKMIQKVDKDGDGMVNYMEF  172



>gb|EKC42677.1| Calmodulin [Crassostrea gigas]
Length=526

 Score = 65.1 bits (157),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 50/197 (25%), Positives = 96/197 (49%), Gaps = 5/197 (3%)
 Frame = -3

Query  781  KYSRLDSKLETKVLEVKRNAPATLSIRSINALIL-KFPHFREGLKEIRTVFEQFDEDSNG  605
            K +  D  +E  + E+ +N    +        +  KF    E  +E+R  F+ FD+D +G
Sbjct  56   KQNPTDKDVEDMIAELDKNGNKKIEYDEFEKFMADKFKSPDEAEEEMRNAFKIFDKDGSG  115

Query  604  AIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEF--IVLLCLIYLLMDAPS  431
             ID +EL+  ++ L   + +EE+DE+ ++ D D + K+ ++E   I +     L ++   
Sbjct  116  KIDAKELRHAMKSLGETMTDEEVDEMIKAADQDSDGKVDYSESQKISVPYNGILPINIKQ  175

Query  430  SGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPLEKSPSHVTRTR  251
                S I S + E       EAF   DK+G G ++ ++++     AF  + + + V    
Sbjct  176  VPQYSPIPSKLPEEIKQEFREAFELFDKDGSGYINSRELLTVMR-AFKQDPTKAEVQHL-  233

Query  250  FKEMDWDRSGKISFRKF  200
             +E+D + +GKI + +F
Sbjct  234  MQELDTNGNGKIEYEEF  250



>sp|P41210.1|CATR_ATRNU RecName: Full=Caltractin; AltName: Full=Centrin [Atriplex nummularia]
 prf||1906390A caltractin-like protein
Length=167

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 43/155 (28%), Positives = 78/155 (50%), Gaps = 25/155 (16%)
 Frame = -3

Query  652  KEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFI  473
            +EI+  FE FD D +G ID +EL   ++ L F + EE+I+++    D D +  I F+EF 
Sbjct  25   QEIKEAFELFDTDGSGTIDAKELNVAMRALGFEMTEEQINQMIADVDKDGSGAIDFDEFC  84

Query  472  VLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKD---VVKAF  302
             ++              T+KIG      T   +++AF  +D++ +GK+  +D   + K  
Sbjct  85   HMM--------------TAKIGE---RDTKEELMKAFRIIDQDNNGKISPEDIQRIAKEL  127

Query  301  NDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFL  197
             + F ++     +     +E D DR G+++  +FL
Sbjct  128  GENFTVKDIQDMI-----EEADRDRDGEVNVEEFL  157



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2377925492388