BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig11019

Length=1642
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009614692.1|  PREDICTED: uncharacterized protein LOC104107561    573   0.0      Nicotiana tomentosiformis
ref|XP_009780705.1|  PREDICTED: uncharacterized protein LOC104229716    564   0.0      Nicotiana sylvestris
ref|XP_006363989.1|  PREDICTED: uncharacterized protein LOC102601007    563   0.0      Solanum tuberosum [potatoes]
ref|XP_004235367.1|  PREDICTED: uncharacterized protein LOC101248757    551   0.0      Solanum lycopersicum
ref|XP_011073153.1|  PREDICTED: uncharacterized protein LOC105158192    540   0.0      Sesamum indicum [beniseed]
ref|XP_010069444.1|  PREDICTED: uncharacterized protein LOC104456368    526   7e-180   Eucalyptus grandis [rose gum]
emb|CDO98647.1|  unnamed protein product                                524   5e-179   Coffea canephora [robusta coffee]
ref|XP_010091765.1|  hypothetical protein L484_019353                   520   2e-177   Morus notabilis
ref|XP_009360040.1|  PREDICTED: uncharacterized protein LOC103950...    514   3e-175   Pyrus x bretschneideri [bai li]
ref|XP_009360039.1|  PREDICTED: uncharacterized protein LOC103950...    514   5e-175   Pyrus x bretschneideri [bai li]
ref|XP_007036962.1|  Uncharacterized protein isoform 2                  511   3e-174   
ref|XP_009355996.1|  PREDICTED: uncharacterized protein LOC103946...    511   4e-174   Pyrus x bretschneideri [bai li]
ref|XP_009355995.1|  PREDICTED: uncharacterized protein LOC103946...    511   5e-174   Pyrus x bretschneideri [bai li]
gb|EYU21849.1|  hypothetical protein MIMGU_mgv1a007186mg                509   1e-173   Erythranthe guttata [common monkey flower]
ref|XP_008356699.1|  PREDICTED: uncharacterized protein LOC103420...    507   2e-172   
ref|XP_008356700.1|  PREDICTED: uncharacterized protein LOC103420...    507   2e-172   
ref|XP_006374246.1|  hypothetical protein POPTR_0015s05360g             506   3e-172   
ref|XP_011047792.1|  PREDICTED: uncharacterized protein LOC105142042    506   3e-172   Populus euphratica
ref|XP_006493269.1|  PREDICTED: uncharacterized protein LOC102611...    504   2e-171   Citrus sinensis [apfelsine]
ref|XP_010241168.1|  PREDICTED: uncharacterized protein LOC104585831    502   1e-170   Nelumbo nucifera [Indian lotus]
ref|XP_008393457.1|  PREDICTED: uncharacterized protein LOC103455...    502   2e-170   
ref|XP_006441318.1|  hypothetical protein CICLE_v10020337mg             501   4e-170   Citrus clementina [clementine]
ref|XP_008393456.1|  PREDICTED: uncharacterized protein LOC103455...    501   4e-170   
gb|KDO47166.1|  hypothetical protein CISIN_1g014467mg                   500   9e-170   Citrus sinensis [apfelsine]
emb|CBI35458.3|  unnamed protein product                                499   1e-169   Vitis vinifera
ref|XP_007036961.1|  Uncharacterized protein isoform 1                  499   2e-169   
ref|XP_002533448.1|  conserved hypothetical protein                     497   5e-169   
ref|XP_002267281.3|  PREDICTED: uncharacterized protein LOC100262899    497   3e-168   Vitis vinifera
ref|XP_002317709.1|  hypothetical protein POPTR_0012s03930g             494   5e-168   Populus trichocarpa [western balsam poplar]
ref|XP_006374243.1|  hypothetical protein POPTR_0015s05360g             495   6e-168   
ref|XP_008375019.1|  PREDICTED: uncharacterized protein LOC103438...    494   3e-167   
ref|XP_008240405.1|  PREDICTED: uncharacterized protein LOC103338912    494   3e-167   Prunus mume [ume]
ref|XP_008375017.1|  PREDICTED: uncharacterized protein LOC103438...    493   5e-167   
ref|XP_008466989.1|  PREDICTED: uncharacterized protein LOC103504355    493   7e-167   Cucumis melo [Oriental melon]
ref|XP_012081284.1|  PREDICTED: uncharacterized protein LOC105641...    492   2e-166   Jatropha curcas
ref|XP_007209930.1|  hypothetical protein PRUPE_ppa004570mg             494   4e-166   
ref|XP_012081283.1|  PREDICTED: uncharacterized protein LOC105641...    491   4e-166   Jatropha curcas
gb|KHG11329.1|  Alanine--tRNA ligase                                    488   3e-165   Gossypium arboreum [tree cotton]
ref|XP_004137518.1|  PREDICTED: uncharacterized protein LOC101203627    487   8e-165   Cucumis sativus [cucumbers]
ref|XP_006374245.1|  hypothetical protein POPTR_0015s05360g             484   1e-164   
ref|XP_011003767.1|  PREDICTED: uncharacterized protein LOC105110429    486   2e-164   Populus euphratica
ref|XP_010271178.1|  PREDICTED: uncharacterized protein LOC104607271    484   1e-163   Nelumbo nucifera [Indian lotus]
ref|XP_008798412.1|  PREDICTED: uncharacterized protein LOC103713309    483   4e-163   Phoenix dactylifera
gb|KGN64195.1|  hypothetical protein Csa_1G042990                       487   3e-162   Cucumis sativus [cucumbers]
ref|XP_002894114.1|  hypothetical protein ARALYDRAFT_473985             478   3e-161   
ref|XP_009414789.1|  PREDICTED: uncharacterized protein LOC103995...    478   3e-161   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010936872.1|  PREDICTED: uncharacterized protein LOC105056391    478   4e-161   Elaeis guineensis
ref|XP_009414790.1|  PREDICTED: uncharacterized protein LOC103995...    475   2e-160   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009408539.1|  PREDICTED: uncharacterized protein LOC103990...    475   4e-160   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB53076.1|  hypothetical protein B456_008G292100                    474   6e-160   Gossypium raimondii
ref|XP_009408547.1|  PREDICTED: uncharacterized protein LOC103990...    474   8e-160   
ref|XP_006306266.1|  hypothetical protein CARUB_v10012116mg             471   3e-158   Capsella rubella
ref|XP_006393405.1|  hypothetical protein EUTSA_v10011507mg             470   4e-158   Eutrema salsugineum [saltwater cress]
ref|XP_010461662.1|  PREDICTED: uncharacterized protein LOC104742...    470   4e-158   Camelina sativa [gold-of-pleasure]
emb|CDX95820.1|  BnaC05g35710D                                          470   5e-158   
gb|KJB30250.1|  hypothetical protein B456_005G134400                    469   8e-158   Gossypium raimondii
emb|CDX92162.1|  BnaA05g22450D                                          468   2e-157   
ref|XP_010465837.1|  PREDICTED: uncharacterized protein LOC104746127    468   3e-157   Camelina sativa [gold-of-pleasure]
ref|NP_175278.1|  uncharacterized protein                               468   3e-157   Arabidopsis thaliana [mouse-ear cress]
dbj|BAJ34170.1|  unnamed protein product                                467   5e-157   Eutrema halophilum
ref|XP_009145975.1|  PREDICTED: uncharacterized protein LOC103869650    467   7e-157   Brassica rapa
ref|XP_006406690.1|  hypothetical protein EUTSA_v10020677mg             468   8e-157   
gb|KFK39108.1|  hypothetical protein AALP_AA3G202000                    466   1e-156   Arabis alpina [alpine rockcress]
ref|XP_011464472.1|  PREDICTED: uncharacterized protein LOC101299...    466   1e-156   Fragaria vesca subsp. vesca
ref|XP_006297794.1|  hypothetical protein CARUB_v10013829mg             466   2e-156   Capsella rubella
gb|AFK42768.1|  unknown                                                 465   3e-156   Lotus japonicus
ref|XP_004299503.1|  PREDICTED: uncharacterized protein LOC101299...    463   1e-155   Fragaria vesca subsp. vesca
gb|EPS73872.1|  hypothetical protein M569_00881                         463   2e-155   Genlisea aurea
emb|CDX75937.1|  BnaC03g40200D                                          459   5e-154   
gb|KFK36092.1|  hypothetical protein AALP_AA4G076400                    459   6e-154   Arabis alpina [alpine rockcress]
ref|XP_010549033.1|  PREDICTED: uncharacterized protein LOC104820...    459   7e-154   Tarenaya hassleriana [spider flower]
ref|XP_010549034.1|  PREDICTED: uncharacterized protein LOC104820...    459   8e-154   Tarenaya hassleriana [spider flower]
ref|XP_010479269.1|  PREDICTED: uncharacterized protein LOC104758146    459   9e-154   Camelina sativa [gold-of-pleasure]
ref|XP_010500371.1|  PREDICTED: uncharacterized protein LOC104777762    458   2e-153   Camelina sativa [gold-of-pleasure]
ref|XP_010687245.1|  PREDICTED: uncharacterized protein LOC104901374    458   2e-153   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002885230.1|  predicted protein                                  457   6e-153   
gb|AAL32564.1|  Unknown protein                                         456   1e-152   Arabidopsis thaliana [mouse-ear cress]
dbj|BAF01343.1|  hypothetical protein                                   456   2e-152   Arabidopsis thaliana [mouse-ear cress]
ref|NP_566588.1|  uncharacterized protein                               456   2e-152   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001078173.1|  uncharacterized protein                            456   2e-152   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009135549.1|  PREDICTED: uncharacterized protein LOC103859727    454   4e-152   Brassica rapa
gb|AGV54799.1|  hypothetical protein                                    453   9e-152   Phaseolus vulgaris [French bean]
emb|CDX82345.1|  BnaA03g34760D                                          451   4e-151   
ref|XP_009145005.1|  PREDICTED: uncharacterized protein LOC103868678    451   5e-151   Brassica rapa
gb|KHN43658.1|  hypothetical protein glysoja_027724                     449   8e-151   Glycine soja [wild soybean]
ref|XP_003534126.1|  PREDICTED: uncharacterized protein LOC100802...    450   2e-150   Glycine max [soybeans]
ref|XP_004513343.1|  PREDICTED: uncharacterized protein LOC101494...    450   2e-150   
emb|CDY58279.1|  BnaCnng32840D                                          450   5e-150   Brassica napus [oilseed rape]
ref|XP_003528983.1|  PREDICTED: uncharacterized protein LOC100777...    448   8e-150   Glycine max [soybeans]
gb|ACU24516.1|  unknown                                                 448   8e-150   Glycine max [soybeans]
ref|XP_006849427.1|  PREDICTED: uncharacterized protein LOC18439191     449   1e-149   
ref|XP_007160560.1|  hypothetical protein PHAVU_002G331900g             445   2e-148   Phaseolus vulgaris [French bean]
ref|XP_010487675.1|  PREDICTED: uncharacterized protein LOC104765624    444   3e-148   Camelina sativa [gold-of-pleasure]
ref|XP_003525180.1|  PREDICTED: uncharacterized protein LOC100817...    442   2e-147   Glycine max [soybeans]
ref|XP_006580389.1|  PREDICTED: uncharacterized protein LOC100817...    442   3e-147   Glycine max [soybeans]
gb|KEH26747.1|  plant/T1N15-5 protein                                   442   3e-147   Medicago truncatula
ref|XP_004503251.1|  PREDICTED: uncharacterized protein LOC101489103    441   7e-147   Cicer arietinum [garbanzo]
ref|XP_010505920.1|  PREDICTED: uncharacterized protein LOC104782624    439   3e-146   Camelina sativa [gold-of-pleasure]
gb|EYU24493.1|  hypothetical protein MIMGU_mgv1a007418mg                438   9e-146   Erythranthe guttata [common monkey flower]
gb|AFK36208.1|  unknown                                                 436   1e-144   Medicago truncatula
ref|XP_003530975.1|  PREDICTED: uncharacterized protein LOC100793300    434   2e-144   Glycine max [soybeans]
gb|ACJ84884.1|  unknown                                                 435   2e-144   Medicago truncatula
gb|ACF87802.1|  unknown                                                 429   3e-142   Zea mays [maize]
gb|EAY91660.1|  hypothetical protein OsI_13299                          427   1e-141   Oryza sativa Indica Group [Indian rice]
ref|NP_001143815.1|  uncharacterized protein LOC100276591               427   3e-141   Zea mays [maize]
ref|XP_010939981.1|  PREDICTED: uncharacterized protein LOC105058679    426   6e-141   
ref|XP_004981973.1|  PREDICTED: uncharacterized protein LOC101781...    425   9e-141   Setaria italica
ref|NP_001051084.1|  Os03g0717900                                       426   3e-140   
ref|XP_004981974.1|  PREDICTED: uncharacterized protein LOC101781...    422   1e-139   Setaria italica
gb|ABF98565.1|  expressed protein                                       419   2e-139   Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ85118.1|  predicted protein                                      421   5e-139   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006650499.1|  PREDICTED: uncharacterized protein LOC102715191    413   3e-137   
ref|XP_007152648.1|  hypothetical protein PHAVU_004G147200g             414   1e-136   Phaseolus vulgaris [French bean]
ref|XP_002273280.1|  PREDICTED: uncharacterized protein LOC100245...    414   2e-136   Vitis vinifera
ref|NP_001169730.1|  hypothetical protein                               412   2e-135   Zea mays [maize]
ref|XP_003560595.1|  PREDICTED: uncharacterized protein LOC100829350    411   3e-135   Brachypodium distachyon [annual false brome]
ref|XP_010661178.1|  PREDICTED: uncharacterized protein LOC100245...    409   7e-135   
emb|CAN79123.1|  hypothetical protein VITISV_030635                     409   1e-134   Vitis vinifera
gb|EMT10781.1|  hypothetical protein F775_30852                         407   2e-132   
gb|ABR17692.1|  unknown                                                 403   1e-131   Picea sitchensis
gb|ADE77481.1|  unknown                                                 389   4e-126   Picea sitchensis
gb|KHG07714.1|  Ribosomal L11 methyltransferase                         381   1e-124   Gossypium arboreum [tree cotton]
emb|CAL07981.1|  hypothetical protein                                   378   2e-124   Platanus x hispanica [London plane tree]
ref|XP_007036963.1|  Uncharacterized protein isoform 3                  369   2e-119   
gb|AAK30572.1|AF346660_1  unknown                                       356   5e-116   Brassica napus [oilseed rape]
ref|XP_010919980.1|  PREDICTED: uncharacterized protein LOC105043949    360   2e-115   
ref|XP_011028101.1|  PREDICTED: uncharacterized protein LOC105128231    358   1e-114   Populus euphratica
ref|XP_002276652.1|  PREDICTED: uncharacterized protein LOC100260823    350   1e-111   Vitis vinifera
ref|XP_010261560.1|  PREDICTED: uncharacterized protein LOC104600354    350   1e-111   Nelumbo nucifera [Indian lotus]
ref|XP_006471483.1|  PREDICTED: uncharacterized protein LOC102623998    347   2e-110   Citrus sinensis [apfelsine]
ref|XP_012080770.1|  PREDICTED: uncharacterized protein LOC105640956    347   2e-110   Jatropha curcas
ref|XP_008800077.1|  PREDICTED: uncharacterized protein LOC103714...    347   3e-110   Phoenix dactylifera
ref|XP_011081424.1|  PREDICTED: uncharacterized protein LOC105164476    343   5e-109   Sesamum indicum [beniseed]
gb|KJB21160.1|  hypothetical protein B456_003G185600                    341   5e-108   Gossypium raimondii
ref|XP_009413223.1|  PREDICTED: uncharacterized protein LOC103994...    340   1e-107   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHG08376.1|  Beta-casein                                             339   3e-107   Gossypium arboreum [tree cotton]
ref|XP_008466019.1|  PREDICTED: uncharacterized protein LOC103503...    339   3e-107   Cucumis melo [Oriental melon]
ref|XP_007040722.1|  Uncharacterized protein TCM_016604                 336   3e-106   
ref|XP_008238169.1|  PREDICTED: uncharacterized protein LOC103336834    337   3e-106   Prunus mume [ume]
ref|XP_004136206.1|  PREDICTED: uncharacterized protein LOC101213...    336   3e-106   Cucumis sativus [cucumbers]
emb|CDP11681.1|  unnamed protein product                                336   4e-106   Coffea canephora [robusta coffee]
ref|XP_009373461.1|  PREDICTED: uncharacterized protein LOC103962488    335   8e-106   Pyrus x bretschneideri [bai li]
ref|XP_009413222.1|  PREDICTED: uncharacterized protein LOC103994...    334   2e-105   
ref|XP_004300191.1|  PREDICTED: uncharacterized protein LOC101292798    334   3e-105   Fragaria vesca subsp. vesca
ref|XP_006854071.1|  PREDICTED: uncharacterized protein LOC18443828     332   6e-105   Amborella trichopoda
ref|XP_008373529.1|  PREDICTED: uncharacterized protein LOC103436859    333   8e-105   
ref|XP_002518989.1|  conserved hypothetical protein                     332   1e-104   Ricinus communis
ref|XP_010055250.1|  PREDICTED: uncharacterized protein LOC104443499    330   7e-104   
gb|KCW71713.1|  hypothetical protein EUGRSUZ_E00224                     331   2e-103   Eucalyptus grandis [rose gum]
ref|XP_008800078.1|  PREDICTED: uncharacterized protein LOC103714...    328   3e-103   
ref|XP_009804854.1|  PREDICTED: uncharacterized protein LOC104250017    325   1e-101   Nicotiana sylvestris
ref|XP_006352932.1|  PREDICTED: uncharacterized protein LOC102595128    322   1e-100   Solanum tuberosum [potatoes]
ref|XP_004245960.1|  PREDICTED: uncharacterized protein LOC101262445    320   5e-100   
ref|XP_010677383.1|  PREDICTED: uncharacterized protein LOC104893042    318   4e-99    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009607216.1|  PREDICTED: uncharacterized protein LOC104101473    317   6e-99    Nicotiana tomentosiformis
emb|CBI33818.3|  unnamed protein product                                317   1e-98    Vitis vinifera
gb|EYU43718.1|  hypothetical protein MIMGU_mgv1a007450mg                313   2e-97    Erythranthe guttata [common monkey flower]
ref|XP_003534296.1|  PREDICTED: uncharacterized protein LOC100802337    313   3e-97    Glycine max [soybeans]
ref|XP_009145204.1|  PREDICTED: uncharacterized protein LOC103868901    311   2e-96    Brassica rapa
emb|CDY35549.1|  BnaA05g16370D                                          310   5e-96    Brassica napus [oilseed rape]
gb|EPS63452.1|  hypothetical protein M569_11331                         307   6e-96    Genlisea aurea
ref|XP_006415245.1|  hypothetical protein EUTSA_v10007794mg             308   2e-95    Eutrema salsugineum [saltwater cress]
ref|XP_004976664.1|  PREDICTED: uncharacterized protein LOC101761297    308   2e-95    Setaria italica
ref|XP_010540738.1|  PREDICTED: uncharacterized protein LOC104814412    308   4e-95    Tarenaya hassleriana [spider flower]
ref|XP_007158234.1|  hypothetical protein PHAVU_002G135300g             307   6e-95    Phaseolus vulgaris [French bean]
ref|XP_003612708.1|  hypothetical protein MTR_5g028020                  306   1e-94    Medicago truncatula
gb|EEC77902.1|  hypothetical protein OsI_17223                          306   2e-94    Oryza sativa Indica Group [Indian rice]
gb|KHN40428.1|  hypothetical protein glysoja_000926                     305   3e-94    Glycine soja [wild soybean]
gb|AFW59314.1|  hypothetical protein ZEAMMB73_007794                    305   5e-94    
ref|XP_002448446.1|  hypothetical protein SORBIDRAFT_06g027240          303   2e-93    Sorghum bicolor [broomcorn]
ref|NP_001053731.1|  Os04g0595100                                       303   3e-93    
ref|XP_004512464.1|  PREDICTED: uncharacterized protein LOC101507671    303   3e-93    Cicer arietinum [garbanzo]
emb|CDY29940.1|  BnaC05g28960D                                          302   5e-93    Brassica napus [oilseed rape]
ref|NP_001145533.1|  uncharacterized protein LOC100278968               301   1e-92    Zea mays [maize]
ref|NP_001242537.1|  uncharacterized protein LOC100810147               301   1e-92    
ref|XP_008800079.1|  PREDICTED: uncharacterized protein LOC103714...    300   2e-92    Phoenix dactylifera
ref|XP_006653725.1|  PREDICTED: uncharacterized protein LOC102702753    300   4e-92    Oryza brachyantha
ref|NP_001031154.1|  uncharacterized protein                            296   1e-91    Arabidopsis thaliana [mouse-ear cress]
gb|KFK44959.1|  hypothetical protein AALP_AA1G325800                    298   1e-91    Arabis alpina [alpine rockcress]
ref|XP_002890970.1|  hypothetical protein ARALYDRAFT_473397             298   1e-91    Arabidopsis lyrata subsp. lyrata
dbj|BAH56904.1|  AT1G48450                                              295   3e-91    Arabidopsis thaliana [mouse-ear cress]
ref|NP_001185170.1|  uncharacterized protein                            294   8e-91    Arabidopsis thaliana [mouse-ear cress]
gb|EMS68345.1|  hypothetical protein TRIUR3_07699                       295   3e-90    Triticum urartu
dbj|BAJ87444.1|  predicted protein                                      295   3e-90    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT04061.1|  hypothetical protein F775_32804                         292   3e-89    
ref|XP_006307539.1|  hypothetical protein CARUB_v10009166mg             292   1e-88    
ref|XP_010461033.1|  PREDICTED: uncharacterized protein LOC104741810    289   4e-88    Camelina sativa [gold-of-pleasure]
ref|NP_564389.1|  uncharacterized protein                               289   6e-88    Arabidopsis thaliana [mouse-ear cress]
emb|CBI40011.3|  unnamed protein product                                285   8e-88    Vitis vinifera
ref|XP_010499760.1|  PREDICTED: uncharacterized protein LOC104777247    288   1e-87    Camelina sativa [gold-of-pleasure]
ref|XP_010478637.1|  PREDICTED: uncharacterized protein LOC104757587    288   2e-87    Camelina sativa [gold-of-pleasure]
ref|XP_010240349.1|  PREDICTED: uncharacterized protein LOC104585415    286   4e-87    Brachypodium distachyon [annual false brome]
tpg|DAA51043.1|  TPA: hypothetical protein ZEAMMB73_539342              278   2e-86    
ref|XP_008466020.1|  PREDICTED: uncharacterized protein LOC103503...    276   6e-84    
ref|XP_011652634.1|  PREDICTED: uncharacterized protein LOC101213...    275   1e-83    Cucumis sativus [cucumbers]
emb|CAN68920.1|  hypothetical protein VITISV_039448                     272   7e-83    Vitis vinifera
ref|XP_002977160.1|  hypothetical protein SELMODRAFT_106276             268   7e-81    
ref|XP_007209264.1|  hypothetical protein PRUPE_ppa007392mg             268   1e-80    
ref|XP_002981973.1|  hypothetical protein SELMODRAFT_233832             267   2e-80    
gb|ABR16101.1|  unknown                                                 269   5e-80    Picea sitchensis
ref|XP_002982952.1|  hypothetical protein SELMODRAFT_234120             265   7e-80    
gb|AFK35334.1|  unknown                                                 261   7e-80    Lotus japonicus
ref|XP_002965311.1|  hypothetical protein SELMODRAFT_82738              263   7e-79    
ref|XP_002304357.2|  hypothetical protein POPTR_0003s09600g             251   2e-75    
ref|XP_004253444.1|  PREDICTED: uncharacterized protein LOC101265814    239   8e-71    Solanum lycopersicum
ref|XP_010461665.1|  PREDICTED: uncharacterized protein LOC104742360    231   5e-69    Camelina sativa [gold-of-pleasure]
gb|ACN34329.1|  unknown                                                 214   2e-61    Zea mays [maize]
ref|XP_010908554.1|  PREDICTED: uncharacterized protein LOC105034...    212   1e-58    Elaeis guineensis
ref|XP_010908555.1|  PREDICTED: uncharacterized protein LOC105034...    209   2e-58    
ref|XP_010247844.1|  PREDICTED: uncharacterized protein LOC104590798    211   4e-58    Nelumbo nucifera [Indian lotus]
ref|XP_007049654.1|  F21O3.2 protein                                    209   6e-58    
ref|XP_010274079.1|  PREDICTED: uncharacterized protein LOC104609452    209   2e-57    Nelumbo nucifera [Indian lotus]
ref|XP_010069618.1|  PREDICTED: uncharacterized protein LOC104456510    208   2e-57    Eucalyptus grandis [rose gum]
gb|KJB42555.1|  hypothetical protein B456_007G157400                    207   3e-57    Gossypium raimondii
ref|XP_006484801.1|  PREDICTED: uncharacterized protein LOC102613099    206   7e-57    Citrus sinensis [apfelsine]
ref|XP_006437252.1|  hypothetical protein CICLE_v10031774mg             206   8e-57    Citrus clementina [clementine]
ref|XP_011018702.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    201   1e-56    Populus euphratica
gb|KHG02769.1|  Phosphoserine aminotransferase                          206   1e-56    Gossypium arboreum [tree cotton]
gb|KDO46601.1|  hypothetical protein CISIN_1g015579mg                   205   2e-56    Citrus sinensis [apfelsine]
ref|XP_008776305.1|  PREDICTED: uncharacterized protein LOC103696450    205   5e-56    Phoenix dactylifera
ref|XP_006848511.1|  PREDICTED: uncharacterized protein LOC18438261     205   7e-56    Amborella trichopoda
ref|XP_002303068.2|  hypothetical protein POPTR_0002s24910g             202   4e-55    Populus trichocarpa [western balsam poplar]
ref|XP_002531072.1|  conserved hypothetical protein                     201   1e-54    Ricinus communis
ref|XP_012085283.1|  PREDICTED: uncharacterized protein LOC105644513    200   2e-54    Jatropha curcas
gb|KDO46600.1|  hypothetical protein CISIN_1g015579mg                   199   5e-54    Citrus sinensis [apfelsine]
ref|XP_011024597.1|  PREDICTED: uncharacterized protein LOC105125729    199   6e-54    Populus euphratica
ref|XP_004290164.1|  PREDICTED: uncharacterized protein LOC101305809    198   6e-54    Fragaria vesca subsp. vesca
ref|XP_003520988.1|  PREDICTED: uncharacterized protein LOC100793365    197   3e-53    Glycine max [soybeans]
ref|XP_010100787.1|  hypothetical protein L484_015816                   195   7e-53    Morus notabilis
gb|KDO46602.1|  hypothetical protein CISIN_1g015579mg                   192   1e-52    Citrus sinensis [apfelsine]
ref|XP_006367000.1|  PREDICTED: uncharacterized protein LOC102582294    195   1e-52    Solanum tuberosum [potatoes]
ref|XP_006599165.1|  PREDICTED: uncharacterized protein LOC100804253    194   2e-52    Glycine max [soybeans]
ref|XP_006437251.1|  hypothetical protein CICLE_v10031774mg             191   2e-52    
gb|KDO46604.1|  hypothetical protein CISIN_1g015579mg                   190   4e-52    Citrus sinensis [apfelsine]
ref|XP_002272171.1|  PREDICTED: uncharacterized protein LOC100251038    193   6e-52    Vitis vinifera
ref|XP_004247039.1|  PREDICTED: uncharacterized protein LOC101262953    191   2e-51    Solanum lycopersicum
ref|XP_007134152.1|  hypothetical protein PHAVU_010G023700g             190   1e-50    Phaseolus vulgaris [French bean]
gb|KDO57188.1|  hypothetical protein CISIN_1g036217mg                   183   2e-50    Citrus sinensis [apfelsine]
gb|KDO46603.1|  hypothetical protein CISIN_1g015579mg                   186   2e-50    Citrus sinensis [apfelsine]
ref|XP_011089045.1|  PREDICTED: uncharacterized protein LOC105170122    187   6e-50    Sesamum indicum [beniseed]
emb|CDP03929.1|  unnamed protein product                                187   7e-50    Coffea canephora [robusta coffee]
ref|XP_009587865.1|  PREDICTED: uncharacterized protein LOC104085515    187   9e-50    Nicotiana tomentosiformis
ref|XP_010685095.1|  PREDICTED: uncharacterized protein LOC104899578    187   9e-50    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004510240.1|  PREDICTED: uncharacterized protein LOC101489146    186   2e-49    Cicer arietinum [garbanzo]
ref|XP_009763079.1|  PREDICTED: uncharacterized protein LOC104215037    186   2e-49    Nicotiana sylvestris
gb|KHN40722.1|  hypothetical protein glysoja_049851                     185   3e-49    Glycine soja [wild soybean]
ref|XP_010547130.1|  PREDICTED: uncharacterized protein LOC104818981    184   5e-49    Tarenaya hassleriana [spider flower]
ref|NP_001143759.1|  uncharacterized protein LOC100276521               185   5e-49    Zea mays [maize]
gb|KFK38188.1|  hypothetical protein AALP_AA3G080700                    184   6e-49    Arabis alpina [alpine rockcress]
gb|AGT16908.1|  hypothetical protein SHCRBa_217_A17_F_90                184   9e-49    Saccharum hybrid cultivar R570
gb|ACF84114.1|  unknown                                                 183   3e-48    Zea mays [maize]
ref|XP_009349111.1|  PREDICTED: uncharacterized protein LOC103940675    182   3e-48    Pyrus x bretschneideri [bai li]
gb|AGT15907.1|  hypothetical protein SHCRBa_013_F04_R_50                182   5e-48    Saccharum hybrid cultivar R570
ref|XP_004979240.1|  PREDICTED: uncharacterized protein LOC101761319    182   9e-48    Setaria italica
gb|AGT16639.1|  Protein of unknown function DUF760                      182   9e-48    Saccharum hybrid cultivar R570
ref|XP_008382586.1|  PREDICTED: uncharacterized protein LOC103445364    181   1e-47    
ref|XP_008676966.1|  PREDICTED: uncharacterized protein LOC100276...    181   1e-47    Zea mays [maize]
ref|XP_007201792.1|  hypothetical protein PRUPE_ppa007244mg             181   1e-47    Prunus persica
ref|XP_008244677.1|  PREDICTED: uncharacterized protein LOC103342802    181   1e-47    Prunus mume [ume]
gb|AGT16547.1|  hypothetical protein SHCRBa_093_N12_F_10                181   1e-47    Saccharum hybrid cultivar R570
ref|XP_006602471.1|  PREDICTED: uncharacterized protein LOC100794...    179   4e-47    Glycine max [soybeans]
ref|XP_006407850.1|  hypothetical protein EUTSA_v10020977mg             179   4e-47    Eutrema salsugineum [saltwater cress]
ref|XP_003626951.1|  hypothetical protein MTR_8g012420                  179   6e-47    Medicago truncatula
ref|XP_009372204.1|  PREDICTED: uncharacterized protein LOC103961392    178   1e-46    Pyrus x bretschneideri [bai li]
ref|XP_008458049.1|  PREDICTED: uncharacterized protein LOC103497590    178   2e-46    Cucumis melo [Oriental melon]
gb|KHN10952.1|  hypothetical protein glysoja_026687                     177   2e-46    Glycine soja [wild soybean]
ref|NP_566302.1|  uncharacterized protein                               177   3e-46    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010552027.1|  PREDICTED: uncharacterized protein LOC104822482    177   4e-46    Tarenaya hassleriana [spider flower]
gb|KDO46606.1|  hypothetical protein CISIN_1g015579mg                   173   5e-46    Citrus sinensis [apfelsine]
ref|XP_003577586.1|  PREDICTED: uncharacterized protein LOC100826589    177   5e-46    Brachypodium distachyon [annual false brome]
ref|XP_009793974.1|  PREDICTED: uncharacterized protein LOC104240787    176   7e-46    Nicotiana sylvestris
ref|XP_002884641.1|  hypothetical protein ARALYDRAFT_896892             176   8e-46    Arabidopsis lyrata subsp. lyrata
ref|XP_007140787.1|  hypothetical protein PHAVU_008G142100g             176   8e-46    Phaseolus vulgaris [French bean]
ref|XP_006586216.1|  PREDICTED: uncharacterized protein LOC102662413    176   1e-45    Glycine max [soybeans]
ref|XP_004149773.1|  PREDICTED: uncharacterized protein LOC101209314    175   3e-45    Cucumis sativus [cucumbers]
ref|XP_009147087.1|  PREDICTED: uncharacterized protein LOC103870681    174   3e-45    Brassica rapa
emb|CEF99337.1|  Protein of unknown function DUF760                     176   4e-45    Ostreococcus tauri
emb|CDY28064.1|  BnaC05g44660D                                          174   5e-45    Brassica napus [oilseed rape]
ref|XP_008372537.1|  PREDICTED: uncharacterized protein LOC103435886    174   5e-45    
ref|XP_001420115.1|  predicted protein                                  175   7e-45    
emb|CAN66177.1|  hypothetical protein VITISV_005141                     164   9e-45    
ref|XP_009596731.1|  PREDICTED: uncharacterized protein LOC104092768    172   2e-44    
ref|XP_010464350.1|  PREDICTED: uncharacterized protein LOC104744916    171   3e-44    
ref|XP_010451051.1|  PREDICTED: uncharacterized protein LOC104733110    171   5e-44    
emb|CDY24630.1|  BnaA05g30290D                                          170   1e-43    
ref|XP_010486277.1|  PREDICTED: uncharacterized protein LOC104764444    169   2e-43    
ref|XP_006297949.1|  hypothetical protein CARUB_v10013990mg             169   3e-43    
gb|KHN21277.1|  hypothetical protein glysoja_038588                     166   6e-43    
ref|XP_006368347.1|  hypothetical protein POPTR_0001s01860g             163   6e-43    
dbj|BAK05587.1|  predicted protein                                      167   1e-42    
dbj|BAD94862.1|  hypothetical protein                                   156   6e-42    
ref|XP_006662927.1|  PREDICTED: uncharacterized protein LOC102711023    164   8e-42    
gb|AFK47814.1|  unknown                                                 155   1e-41    
ref|NP_199670.1|  uncharacterized protein                               164   1e-41    
ref|XP_006280743.1|  hypothetical protein CARUB_v10026712mg             163   1e-41    
ref|NP_001067848.2|  Os11g0456100                                       161   8e-41    
gb|ABA93505.2|  expressed protein                                       161   1e-40    
ref|XP_002863907.1|  hypothetical protein ARALYDRAFT_917767             160   2e-40    
ref|XP_002863048.1|  hypothetical protein ARALYDRAFT_920669             159   3e-40    
ref|XP_009151658.1|  PREDICTED: uncharacterized protein LOC103874970    159   4e-40    
ref|XP_006395162.1|  hypothetical protein EUTSA_v10004513mg             159   5e-40    
ref|XP_009124377.1|  PREDICTED: uncharacterized protein LOC103849349    159   8e-40    
emb|CDX85350.1|  BnaC07g26610D                                          155   8e-39    
ref|XP_007510107.1|  predicted protein                                  157   1e-38    
emb|CDY60823.1|  BnaAnng17260D                                          154   2e-38    
ref|XP_005649890.1|  DUF760-domain-containing protein                   155   3e-38    
emb|CDY34905.1|  BnaA01g32360D                                          153   6e-38    
ref|XP_002503881.1|  predicted protein                                  152   1e-36    
ref|XP_005849975.1|  hypothetical protein CHLNCDRAFT_141875             151   2e-35    
gb|KFK31332.1|  hypothetical protein AALP_AA6G098300                    145   3e-35    
gb|EMS63859.1|  hypothetical protein TRIUR3_07220                       139   5e-34    
gb|EYU39191.1|  hypothetical protein MIMGU_mgv1a013058mg                139   5e-34    
ref|XP_006432689.1|  hypothetical protein CICLE_v10003247mg             134   1e-33    
ref|XP_001691046.1|  predicted protein                                  139   1e-32    
gb|EMT02013.1|  hypothetical protein F775_06929                         135   1e-32    
ref|XP_004240629.1|  PREDICTED: uncharacterized protein LOC101262317    130   4e-30    
ref|XP_010271747.1|  PREDICTED: uncharacterized protein LOC104607751    120   2e-28    
gb|ABR26180.1|  unknown                                                 118   2e-28    
ref|XP_011399310.1|  WD repeat-containing protein 89-like protein       127   1e-27    
ref|XP_002948306.1|  hypothetical protein VOLCADRAFT_88515              124   1e-27    
ref|XP_003055064.1|  predicted protein                                  125   2e-27    
gb|KEH22562.1|  DUF760 family protein                                   120   1e-26    
ref|XP_004492297.1|  PREDICTED: uncharacterized protein LOC101488500    115   1e-24    
gb|ACU18333.1|  unknown                                                 111   2e-24    
ref|XP_008341108.1|  PREDICTED: LOW QUALITY PROTEIN: cell divisio...    113   6e-24    
emb|CDY19857.1|  BnaC09g31230D                                          105   3e-23    
ref|XP_004240628.1|  PREDICTED: uncharacterized protein LOC101262016    108   1e-22    
ref|XP_004500125.1|  PREDICTED: uncharacterized protein LOC101505...    103   2e-22    
ref|XP_003081567.1|  unnamed protein product                            100   1e-20    
gb|EPS72664.1|  hypothetical protein M569_02093                       99.8    6e-20    
gb|AEW07482.1|  hypothetical protein 0_2478_01                        94.7    1e-19    
ref|XP_006385682.1|  hypothetical protein POPTR_0003s09620g           84.3    2e-15    
dbj|BAD94536.1|  hypothetical protein                                 83.2    3e-15    
emb|CAN81624.1|  hypothetical protein VITISV_014254                   84.3    4e-15    
gb|KDO57187.1|  hypothetical protein CISIN_1g035864mg                 78.6    2e-13    
gb|KDO36404.1|  hypothetical protein CISIN_1g034247mg                 73.9    3e-12    
ref|XP_010088656.1|  hypothetical protein L484_007878                 75.9    6e-12    
gb|AAP45168.2|  hypothetical protein SBB1_14t00001                    71.6    4e-11    
gb|EYU24492.1|  hypothetical protein MIMGU_mgv1a012902mg              71.6    1e-10    
gb|KIY96176.1|  hypothetical protein MNEG_11787                       72.8    1e-10    
dbj|BAF63502.1|  hypothetical protein                                 69.7    1e-10    
gb|AFK33975.1|  unknown                                               70.1    2e-10    
gb|AAQ14307.1|  ABRH7                                                 69.3    5e-10    
ref|XP_002444902.1|  hypothetical protein SORBIDRAFT_07g001113        64.7    2e-09    
ref|XP_010445948.1|  PREDICTED: uncharacterized protein LOC104728696  68.2    2e-09    
gb|AFW59313.1|  hypothetical protein ZEAMMB73_007794                  62.0    8e-08    
emb|CDY40232.1|  BnaA09g35140D                                        56.6    9e-06    
gb|EYU39226.1|  hypothetical protein MIMGU_mgv1a0220162mg             53.9    3e-05    
gb|EYU39189.1|  hypothetical protein MIMGU_mgv1a022366mg              50.4    3e-04    
ref|WP_015145832.1|  hypothetical protein                             49.7    8e-04    



>ref|XP_009614692.1| PREDICTED: uncharacterized protein LOC104107561 [Nicotiana tomentosiformis]
Length=421

 Score =   573 bits (1478),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/429 (71%), Positives = 338/429 (79%), Gaps = 22/429 (5%)
 Frame = -2

Query  1497  MEMTTSLRSSITVGCGPVKSGRRFTTDAPGFVKFGSKALLSAPSIK-------VKLGNRR  1339
             ME  T+  S+ ++   P K+    +     FV+FGS+  +S   IK       VKL NR+
Sbjct  1     METATAFGSAFSICYRPTKA----SLGGSDFVRFGSQFRISPSGIKLYPSVSHVKLSNRK  56

Query  1338  VAFGSTKCNSIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLE  1159
              AFGS KC SIRASL  S SGGSA PIAPL+LESPIGQFL+QIL SHPHLV AAVDQQLE
Sbjct  57    AAFGSRKCTSIRASLSPSESGGSAAPIAPLQLESPIGQFLSQILTSHPHLVPAAVDQQLE  116

Query  1158  QLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDAD  979
             QLQT+R+ E+Q E    EPSA+GTDIVLYRRIAEVKAN+R+KALEEILYALVVQKFMDA+
Sbjct  117   QLQTERDSEQQKE----EPSATGTDIVLYRRIAEVKANDRKKALEEILYALVVQKFMDAN  172

Query  978   VPLVPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNANSSV-Q  802
             V LVPAI+ PS   SG IDT PS+D++  RLHS EA EMIQNHL+LILGNR   NS+V Q
Sbjct  173   VSLVPAISPPSSEPSGRIDTWPSQDDKFERLHSAEANEMIQNHLALILGNRLGDNSAVAQ  232

Query  801   INKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGG------Ds  640
             I+K RVGQVYAASVMYGYFLKRVDQRFQLEK MKVLPQG+D EDS I+QVGG      D 
Sbjct  233   ISKFRVGQVYAASVMYGYFLKRVDQRFQLEKTMKVLPQGVDDEDSSIRQVGGEEIRSGDR  292

Query  639   sdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAI  460
             SDTS   + SHPE+ SW  G  G+ GFG  +KPSRLR YVMSFDGETLQRYATIRSKEAI
Sbjct  293   SDTSFGVTQSHPELSSWSAGSAGTGGFGHGIKPSRLRNYVMSFDGETLQRYATIRSKEAI  352

Query  459   NIIEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSV  280
              IIEKHTEALFGRPEI ITPQGT+DSSKDEL+KISF  L RLVLEAVTFGSFLWDVES V
Sbjct  353   GIIEKHTEALFGRPEIVITPQGTVDSSKDELLKISFGGLSRLVLEAVTFGSFLWDVESYV  412

Query  279   DSRYHFVAH  253
             DSRYHFVA+
Sbjct  413   DSRYHFVAN  421



>ref|XP_009780705.1| PREDICTED: uncharacterized protein LOC104229716 [Nicotiana sylvestris]
 ref|XP_009780706.1| PREDICTED: uncharacterized protein LOC104229716 [Nicotiana sylvestris]
Length=421

 Score =   564 bits (1454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/429 (70%), Positives = 336/429 (78%), Gaps = 22/429 (5%)
 Frame = -2

Query  1497  MEMTTSLRSSITVGCGPVKSGRRFTTDAPGFVKFGSKALLSAPSIK-------VKLGNRR  1339
             ME  T+  SS ++   P K+    +     FV+FGS+   S   IK       VKL N++
Sbjct  1     METATAFGSSFSICYRPTKA----SLGGSDFVRFGSQFRNSPSGIKLYPSISHVKLSNKK  56

Query  1338  VAFGSTKCNSIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLE  1159
              AFGS KC SIRASL  S SG SA PIAPL+LESPIGQFL+QIL SHPHLV AAVDQQLE
Sbjct  57    AAFGSRKCTSIRASLSPSESGRSAAPIAPLQLESPIGQFLSQILTSHPHLVPAAVDQQLE  116

Query  1158  QLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDAD  979
             QLQT+R+ E+Q E    EPSA+GTDIVLYRRIAEVKAN+R+KALEEILYALVVQKFMDA+
Sbjct  117   QLQTERDSEQQKE----EPSATGTDIVLYRRIAEVKANDRKKALEEILYALVVQKFMDAN  172

Query  978   VPLVPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNANSSV-Q  802
             V LVPAI+ PS   SG +DT PS+D++   LHS EA EMIQNHL+LILG+R   NS+V Q
Sbjct  173   VSLVPAISPPSSEPSGRVDTWPSQDDKFEHLHSAEANEMIQNHLALILGSRLGDNSAVAQ  232

Query  801   INKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGG------Ds  640
             I+KLRVGQVYAASVMYGYFLKRVDQRFQLEK MKVLPQG+D ED   +QVGG      D 
Sbjct  233   ISKLRVGQVYAASVMYGYFLKRVDQRFQLEKTMKVLPQGVDDEDGSFRQVGGEEIRSGDR  292

Query  639   sdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAI  460
             SDTS R + SHPE+ SW  G  G+ GFG  +KPSRLR YVMSFDGETLQRYATIRSKEAI
Sbjct  293   SDTSSRVTQSHPELSSWSAGSAGTGGFGHGIKPSRLRNYVMSFDGETLQRYATIRSKEAI  352

Query  459   NIIEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSV  280
              IIEKHTEALFGRPEI ITPQGT+DSSKDEL+KISF  LRRLVLEAVTFGSFLWDVES V
Sbjct  353   GIIEKHTEALFGRPEIVITPQGTVDSSKDELLKISFGGLRRLVLEAVTFGSFLWDVESYV  412

Query  279   DSRYHFVAH  253
             DSRYHFVA+
Sbjct  413   DSRYHFVAN  421



>ref|XP_006363989.1| PREDICTED: uncharacterized protein LOC102601007 [Solanum tuberosum]
Length=421

 Score =   563 bits (1451),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/429 (69%), Positives = 335/429 (78%), Gaps = 22/429 (5%)
 Frame = -2

Query  1497  MEMTTSLRSSITVGCGPVKSGRRFTTDAPGFVKFGSKALLSAPSIK-------VKLGNRR  1339
             ME  T+ RS  ++   P K+    + D   FV+ GS+  +S   IK       VKL NR+
Sbjct  1     METATAFRSGFSICYKPTKA----SLDGSDFVRVGSQLRMSPSGIKLYPSISHVKLSNRK  56

Query  1338  VAFGSTKCNSIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLE  1159
             V+FGS K  +IRAS+  S SGGSA PIAPL+LESPIGQFL+QIL SHPHLV AAVDQQLE
Sbjct  57    VSFGSRKYTAIRASVSPSESGGSAAPIAPLQLESPIGQFLSQILTSHPHLVPAAVDQQLE  116

Query  1158  QLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDAD  979
              L+TDR+ E+Q E    EPS +GTDIVLYRRIAEVKANER+K LEEILYALVVQKFMDA+
Sbjct  117   LLKTDRDAEQQKE----EPSPAGTDIVLYRRIAEVKANERKKTLEEILYALVVQKFMDAN  172

Query  978   VPLVPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNANSSV-Q  802
             V LVPAI+  S   SG IDT PS+D++L  LHSPEA EMIQNHLSLILG+R   NS+V Q
Sbjct  173   VSLVPAISPSSSEPSGRIDTWPSQDDKLEHLHSPEANEMIQNHLSLILGSRLGDNSAVAQ  232

Query  801   INKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGD------s  640
             I+KLRVGQVYAAS+MYGYFL+RVDQRFQLEK+MKVLPQG+D EDS IQQV G+      S
Sbjct  233   ISKLRVGQVYAASIMYGYFLRRVDQRFQLEKSMKVLPQGVDDEDSSIQQVAGEDISGDRS  292

Query  639   sdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAI  460
               +   ++ +HPE+ SW  GG    GFG  +KPSRLR YVMSFDGETLQRYATIRS+EAI
Sbjct  293   DTSFRSTTQTHPELTSWSAGGASPGGFGQGIKPSRLRNYVMSFDGETLQRYATIRSREAI  352

Query  459   NIIEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSV  280
              +IEKHTEALFGRPEI ITPQGTIDSSKDELIKISF  LRRLVLEAVTFGSFLWDVES V
Sbjct  353   GMIEKHTEALFGRPEIVITPQGTIDSSKDELIKISFGGLRRLVLEAVTFGSFLWDVESYV  412

Query  279   DSRYHFVAH  253
             DSRYHFVA+
Sbjct  413   DSRYHFVAN  421



>ref|XP_004235367.1| PREDICTED: uncharacterized protein LOC101248757 [Solanum lycopersicum]
Length=421

 Score =   551 bits (1419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/432 (68%), Positives = 333/432 (77%), Gaps = 28/432 (6%)
 Frame = -2

Query  1497  MEMTTSLRSSITVGCGPVKSGRRFTTDAPG---FVKFGSKALLSAPSIK-------VKLG  1348
             ME  T+ RS  ++ C       R T  A G   FV+ GS+  +S   IK       VKL 
Sbjct  1     METATAFRSGFSI-CN------RATKAALGGSDFVRVGSQLRMSPSGIKLYPSISHVKLS  53

Query  1347  NRRVAFGSTKCNSIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQ  1168
             NR+VAFGS K  +IRAS+  S SGGSA PIAPL+LESPIGQFL QIL SHPHLVSAAVDQ
Sbjct  54    NRKVAFGSRKYTAIRASVSPSESGGSAAPIAPLQLESPIGQFLCQILTSHPHLVSAAVDQ  113

Query  1167  QLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFM  988
             QLE L+ DR+ E+Q E    EPS +GTDIVLYRRIAEVKANER+K LEEILYALVVQKFM
Sbjct  114   QLELLKIDRDAEQQKE----EPSIAGTDIVLYRRIAEVKANERKKTLEEILYALVVQKFM  169

Query  987   DADVPLVPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNANSS  808
             DA+V LVPAI+  S   SG IDT PS+D++L  LHS EA EMIQNHLSLILG+R   +S+
Sbjct  170   DANVSLVPAISPSSSEPSGRIDTWPSQDDKLEHLHSAEANEMIQNHLSLILGSRLGDDSA  229

Query  807   V-QINKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGD----  643
             V QI+KLRVGQVYAAS+MYGYFL+RVDQRFQLEK+MKVLP G+D EDS IQQV G+    
Sbjct  230   VAQISKLRVGQVYAASIMYGYFLRRVDQRFQLEKSMKVLPPGVDNEDSSIQQVAGEDISG  289

Query  642   --ssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSK  469
               S  +   ++ +HPE+ SW  GG+   GFG  +KPSRLR YVMSFDGETLQRYATIRS+
Sbjct  290   DRSDTSFRSTTQTHPELTSWSAGGVSPGGFGQGIKPSRLRNYVMSFDGETLQRYATIRSR  349

Query  468   EAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVE  289
             EAI +IEKHTEALFGRPEI ITPQGTIDSSKDELIKISF  LRRLVLEAVTFGSFLWDVE
Sbjct  350   EAIGMIEKHTEALFGRPEIVITPQGTIDSSKDELIKISFGGLRRLVLEAVTFGSFLWDVE  409

Query  288   SSVDSRYHFVAH  253
             S VDSRYHFVA+
Sbjct  410   SYVDSRYHFVAN  421



>ref|XP_011073153.1| PREDICTED: uncharacterized protein LOC105158192 [Sesamum indicum]
Length=421

 Score =   540 bits (1392),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/399 (71%), Positives = 328/399 (82%), Gaps = 21/399 (5%)
 Frame = -2

Query  1404  VKFGSKALLSA------PSIK-VKLGNRRVAFGSTKCNSIRASLPLSNSGGSAMPIAPLK  1246
             ++ GS++LLS       PSI  VKLGNR+V F + KC  IRAS+  S+SG +A PIAPL+
Sbjct  29    LRVGSRSLLSYSWIRQRPSISHVKLGNRKVDFVTRKCTGIRASMQPSDSGSAAAPIAPLQ  88

Query  1245  LESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRR  1066
             LESPIGQFL+QILVSHPHLV AAV+QQLEQLQTDR+ EK+ E    EP+ASGT++VLYRR
Sbjct  89    LESPIGQFLSQILVSHPHLVPAAVEQQLEQLQTDRDAEKEKE----EPAASGTELVLYRR  144

Query  1065  IAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPSKDEQLARL  886
             IAEVKANERRKALEEILYALVVQKFMDA+V L+P IT  S ++SG +D+ PS+D++L  L
Sbjct  145   IAEVKANERRKALEEILYALVVQKFMDANVSLIPTITPSSPDNSGRVDSWPSQDDKLESL  204

Query  885   HSPEAYEMIQNHLSLILGNR-SNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQLEK  709
             HSPEAYEMIQNHL+LILGNR  ++NS  QI+KLRVGQVYAASVMYGYFL+RVDQRFQLEK
Sbjct  205   HSPEAYEMIQNHLALILGNRLGDSNSVAQISKLRVGQVYAASVMYGYFLRRVDQRFQLEK  264

Query  708   NMKVLPQGLDKEDSGIQQV-------GGDssdtslrsspSHPEVVSWPDGGMGSRGFGTE  550
             +MKVLPQ +D E++ I+QV        GD S+ SLR+   HPEV SW   G    G    
Sbjct  265   SMKVLPQSIDNEENHIEQVIADDMRPSGDYSNESLRNPQPHPEVSSW--SGGLGAGGFGR  322

Query  549   MKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDE  370
             +KPSRLRTYVMSFDGETLQRYATIRSKEAI+IIEKHTEALFGRPEI ITP+GT+DSSKDE
Sbjct  323   IKPSRLRTYVMSFDGETLQRYATIRSKEAISIIEKHTEALFGRPEIVITPEGTVDSSKDE  382

Query  369   LIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFVAH  253
             LIKISF  LRRLVLEAVTFGSFLWDVES VDSRYHFVA+
Sbjct  383   LIKISFGGLRRLVLEAVTFGSFLWDVESYVDSRYHFVAN  421



>ref|XP_010069444.1| PREDICTED: uncharacterized protein LOC104456368 [Eucalyptus grandis]
 gb|KCW57801.1| hypothetical protein EUGRSUZ_H00558 [Eucalyptus grandis]
Length=423

 Score =   526 bits (1354),  Expect = 7e-180, Method: Compositional matrix adjust.
 Identities = 283/425 (67%), Positives = 331/425 (78%), Gaps = 26/425 (6%)
 Frame = -2

Query  1485  TSLRSSITVGCGPVKSGRR---FTTDAPGFVKFGSKALLSAPS------IKVKLGNRRVA  1333
             T+ RSS      P     R      D PGFV+FG  A L APS      ++ + G+RRVA
Sbjct  7     TAFRSSTVGALRPSPCASRSAVLAADGPGFVRFG--AGLPAPSKHYTSSLRSRAGHRRVA  64

Query  1332  FGSTKCNSIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQL  1153
              GS +C  +RAS    ++G SA PIAPLKLESPIGQFL++ILVSHPHLV AAV+QQLEQL
Sbjct  65    VGSRRC-MVRASASFESAGSSA-PIAPLKLESPIGQFLSEILVSHPHLVPAAVEQQLEQL  122

Query  1152  QTDRNLEKQNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVP  973
             QTDR+ E + E    EP+ASGT++VLYRRIAEVKANERRKALEEILYALVVQKFMDA+V 
Sbjct  123   QTDRDAETKKE----EPNASGTELVLYRRIAEVKANERRKALEEILYALVVQKFMDANVS  178

Query  972   LVPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNANSSV-QIN  796
             L+P+I + S+  SG +D  P ++E L +LHSPEAYEMIQNHL+LILGNR   N+SV QI+
Sbjct  179   LIPSINTSSE-PSGRVDGWPIQEEMLEQLHSPEAYEMIQNHLALILGNRMGDNNSVAQIS  237

Query  795   KLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKED-SGIQQVGG-----Dssd  634
             KLRVGQVYAASVMYGYFLKRVDQRFQLEK MK+LP   D ++ + +QQV G     D+ D
Sbjct  238   KLRVGQVYAASVMYGYFLKRVDQRFQLEKTMKILPSASDDDEVNNVQQVVGEDRKPDTGD  297

Query  633   tslrsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINI  454
              + ++  SHPEV SW  GG+   GFG+ +KPSRLRTYVMSFDGETLQRYATIRSKEA++I
Sbjct  298   DTFQTVQSHPEVSSW-SGGVSPGGFGSGIKPSRLRTYVMSFDGETLQRYATIRSKEAVSI  356

Query  453   IEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDS  274
             IEKHTEALFGRPEI ITP+GT+DSS+DE IKISF  L+RLVLEAVTFGSFLWDVES VDS
Sbjct  357   IEKHTEALFGRPEIVITPEGTVDSSRDEHIKISFGGLKRLVLEAVTFGSFLWDVESFVDS  416

Query  273   RYHFV  259
             RYHFV
Sbjct  417   RYHFV  421



>emb|CDO98647.1| unnamed protein product [Coffea canephora]
Length=424

 Score =   524 bits (1349),  Expect = 5e-179, Method: Compositional matrix adjust.
 Identities = 285/432 (66%), Positives = 331/432 (77%), Gaps = 25/432 (6%)
 Frame = -2

Query  1497  MEMTTSLRSSITVGCGPVKSGRRFTTDAPGFVKFGSKALLSAPSIK-------VKLGNRR  1339
             ME   + RSS+ +   P     R     P FV+FGS + ++  S+K       VKLG  R
Sbjct  1     METAATFRSSLGI---PSYYDVRSVVKGPDFVQFGSISRVTPASVKQHPLISHVKLGQSR  57

Query  1338  VAFGSTKCNSIRASLPLSNSGGS-AMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQL  1162
             V   S KC  IR+S+  S++ G    PIAPL+LESPIGQFL++ILVSHPHLV AAV+QQL
Sbjct  58    VTLKSRKCTRIRSSMSSSSNSGGSTAPIAPLQLESPIGQFLSEILVSHPHLVPAAVEQQL  117

Query  1161  EQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDA  982
             EQLQTDR+ E Q E    EP+ASGTD+VLYRRIAEVKANERRKALEEILYAL+VQKFMDA
Sbjct  118   EQLQTDRDAESQKE----EPAASGTDLVLYRRIAEVKANERRKALEEILYALIVQKFMDA  173

Query  981   DVPLVPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNANSSV-  805
              V L+P+I  PS + SG +D  PS +E+L RLHS EAYEMIQNHL+LILGNR   +SSV 
Sbjct  174   SVSLIPSI-GPSLDPSGQVDKWPSHEEKLERLHSHEAYEMIQNHLALILGNRVADSSSVA  232

Query  804   QINKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKED-SGIQQV-------G  649
             QI+KLRVGQVYAASVMYGYFLKRVDQRFQLEK+M++LP+G D    S  Q++       G
Sbjct  233   QISKLRVGQVYAASVMYGYFLKRVDQRFQLEKSMRILPRGSDDGVLSNTQEMVGQEDGPG  292

Query  648   GDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSK  469
              D +  + R++ SHPEV SW  GG+ + GFG  MK SRLRTYVMSFDGETLQRYATIRSK
Sbjct  293   TDVAANTFRTAQSHPEVSSWSAGGVSAGGFGHGMKSSRLRTYVMSFDGETLQRYATIRSK  352

Query  468   EAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVE  289
             EA++IIEKHTEALFGRPEI ITP+GT+DSSKDELIKISF  LRRLVLEAVTFGSFLWDVE
Sbjct  353   EAVSIIEKHTEALFGRPEIVITPEGTVDSSKDELIKISFGGLRRLVLEAVTFGSFLWDVE  412

Query  288   SSVDSRYHFVAH  253
             S VDSRYHFVA+
Sbjct  413   SHVDSRYHFVAN  424



>ref|XP_010091765.1| hypothetical protein L484_019353 [Morus notabilis]
 gb|EXB45128.1| hypothetical protein L484_019353 [Morus notabilis]
Length=431

 Score =   520 bits (1338),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 276/404 (68%), Positives = 328/404 (81%), Gaps = 16/404 (4%)
 Frame = -2

Query  1428  FTTDAPGFVKFGSKALLS---APSIKVKLGNRRVAFGSTKCNSIRASLPLSNSGGSAMPI  1258
              T++   F  FG+   LS     S + KLG++R++FGS +   +RAS   S+SG S  PI
Sbjct  28    LTSNRTSFPCFGTNFGLSMKHKTSSRSKLGHKRISFGSRRFLLVRAST-SSDSGSSDSPI  86

Query  1257  APLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQ-----NEKQNDEPSAS  1093
             APL+LESP+GQFL+QIL+SHPHLV AAV+QQLEQLQTDR+  +Q     + ++++EPSA+
Sbjct  87    APLQLESPVGQFLSQILMSHPHLVPAAVEQQLEQLQTDRDAAQQLQTDCDAEKSEEPSAT  146

Query  1092  GTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLP  913
             GTD+ LYRRIAEVKANERRKALEEILYALVVQKFMDA+V LVP+I + + + SG +D+ P
Sbjct  147   GTDLALYRRIAEVKANERRKALEEILYALVVQKFMDANVSLVPSIETSASDPSGCVDSWP  206

Query  912   SKDEQLARLHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFLKR  736
             S+DE+L +LHSPEAYEMIQNHL+LILGNR   ++SV QI+KLRVGQVYAASVMYGYFLKR
Sbjct  207   SQDEKLEQLHSPEAYEMIQNHLALILGNRLGDSTSVAQISKLRVGQVYAASVMYGYFLKR  266

Query  735   VDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssd-----tslrsspSHPEVVSWPDGGMG  571
             VDQRFQLEK MK+LP  LD +D+ +QQ  GD S       S +++PSHPEV SW  GG  
Sbjct  267   VDQRFQLEKTMKILPNTLDGDDTNVQQAVGDDSRPLGGGESFQAAPSHPEVSSWA-GGTS  325

Query  570   SRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGT  391
               GFG  MKPSRLRTYVMSFDGETLQRYATIRSKEA++IIEKHTEALFGRPEI ITPQGT
Sbjct  326   PGGFGHGMKPSRLRTYVMSFDGETLQRYATIRSKEAVSIIEKHTEALFGRPEIVITPQGT  385

Query  390   IDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  259
             +DSSKDELIKISF+ L+RLVLEAVTFGSFLWDVES VD+RYHFV
Sbjct  386   VDSSKDELIKISFAGLKRLVLEAVTFGSFLWDVESYVDARYHFV  429



>ref|XP_009360040.1| PREDICTED: uncharacterized protein LOC103950540 isoform X2 [Pyrus 
x bretschneideri]
Length=430

 Score =   514 bits (1324),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 273/405 (67%), Positives = 323/405 (80%), Gaps = 16/405 (4%)
 Frame = -2

Query  1428  FTTDAPGFVKFGSKA---LLSAPSI-KVKLGNRRVAFGSTKCNSIRASLPLS--NSGGSA  1267
              T + PGF++ G K    +    SI + K+G+RR+ FGS +   +RA    S  +S GSA
Sbjct  29    LTANGPGFLRLGPKTHSPIKHQFSICQPKVGHRRMGFGSRRGFVVRAVAASSSPDSAGSA  88

Query  1266  MPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGT  1087
              PIAPL+LESPIGQFL+QI++SHPHLV +AVDQQLEQLQTDR+ E++ E Q +EPSASGT
Sbjct  89    SPIAPLQLESPIGQFLSQIMISHPHLVPSAVDQQLEQLQTDRDAEQKKE-QKEEPSASGT  147

Query  1086  DIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPSK  907
             D+VLYRRIAEVKA ERRKALEEILYALVVQKFMDA+V LVPAI SP+ + SG +D+ P++
Sbjct  148   DLVLYRRIAEVKATERRKALEEILYALVVQKFMDANVSLVPAI-SPTSDPSGQVDSWPTQ  206

Query  906   DEQLARLHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFLKRVD  730
             DE+L +LHSPEAYEMIQNHLSLILGNR   +SS+ +I+KL++GQVYAASVMYGYFLKRVD
Sbjct  207   DEKLEQLHSPEAYEMIQNHLSLILGNRLGDSSSLAKISKLKIGQVYAASVMYGYFLKRVD  266

Query  729   QRFQLEKNMKVLPQGLDKEDSGIQQ-VG-----GDssdtslrsspSHPEVVSWPDGGMGS  568
             QRFQLEK MK+LP  +  +DS I + VG     G   +T      SHPEV S   GG+  
Sbjct  267   QRFQLEKTMKILPGAMGAKDSDIHKSVGEDMRPGSGGETLQAGVSSHPEVPSLA-GGISP  325

Query  567   RGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTI  388
              GFG  +K SRLRTYVMSFDGETL RYATIRS+EAI+IIEKHTEALFGRP+I ITPQGT+
Sbjct  326   GGFGNALKHSRLRTYVMSFDGETLHRYATIRSREAISIIEKHTEALFGRPDIVITPQGTV  385

Query  387   DSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFVAH  253
             DSSKD+LIKISF  LRRLVLE+VTFGSFLWDVES VDSRYHFVA+
Sbjct  386   DSSKDDLIKISFGGLRRLVLESVTFGSFLWDVESYVDSRYHFVAN  430



>ref|XP_009360039.1| PREDICTED: uncharacterized protein LOC103950540 isoform X1 [Pyrus 
x bretschneideri]
Length=431

 Score =   514 bits (1323),  Expect = 5e-175, Method: Compositional matrix adjust.
 Identities = 274/408 (67%), Positives = 324/408 (79%), Gaps = 21/408 (5%)
 Frame = -2

Query  1428  FTTDAPGFVKFGSKALLSAP------SI-KVKLGNRRVAFGSTKCNSIRASLPLS--NSG  1276
              T + PGF++ G K    +P      SI + K+G+RR+ FGS +   +RA    S  +S 
Sbjct  29    LTANGPGFLRLGPKT--HSPIKQHQFSICQPKVGHRRMGFGSRRGFVVRAVAASSSPDSA  86

Query  1275  GSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSA  1096
             GSA PIAPL+LESPIGQFL+QI++SHPHLV +AVDQQLEQLQTDR+ E++ E Q +EPSA
Sbjct  87    GSASPIAPLQLESPIGQFLSQIMISHPHLVPSAVDQQLEQLQTDRDAEQKKE-QKEEPSA  145

Query  1095  SGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTL  916
             SGTD+VLYRRIAEVKA ERRKALEEILYALVVQKFMDA+V LVPAI SP+ + SG +D+ 
Sbjct  146   SGTDLVLYRRIAEVKATERRKALEEILYALVVQKFMDANVSLVPAI-SPTSDPSGQVDSW  204

Query  915   PSKDEQLARLHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFLK  739
             P++DE+L +LHSPEAYEMIQNHLSLILGNR   +SS+ +I+KL++GQVYAASVMYGYFLK
Sbjct  205   PTQDEKLEQLHSPEAYEMIQNHLSLILGNRLGDSSSLAKISKLKIGQVYAASVMYGYFLK  264

Query  738   RVDQRFQLEKNMKVLPQGLDKEDSGIQQ-VG-----GDssdtslrsspSHPEVVSWPDGG  577
             RVDQRFQLEK MK+LP  +  +DS I + VG     G   +T      SHPEV S   GG
Sbjct  265   RVDQRFQLEKTMKILPGAMGAKDSDIHKSVGEDMRPGSGGETLQAGVSSHPEVPSLA-GG  323

Query  576   MGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQ  397
             +   GFG  +K SRLRTYVMSFDGETL RYATIRS+EAI+IIEKHTEALFGRP+I ITPQ
Sbjct  324   ISPGGFGNALKHSRLRTYVMSFDGETLHRYATIRSREAISIIEKHTEALFGRPDIVITPQ  383

Query  396   GTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFVAH  253
             GT+DSSKD+LIKISF  LRRLVLE+VTFGSFLWDVES VDSRYHFVA+
Sbjct  384   GTVDSSKDDLIKISFGGLRRLVLESVTFGSFLWDVESYVDSRYHFVAN  431



>ref|XP_007036962.1| Uncharacterized protein isoform 2 [Theobroma cacao]
 gb|EOY21463.1| Uncharacterized protein isoform 2 [Theobroma cacao]
Length=428

 Score =   511 bits (1317),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 270/403 (67%), Positives = 317/403 (79%), Gaps = 19/403 (5%)
 Frame = -2

Query  1428  FTTDAPGFVKFGSKALLS------APSIKVKLGNRRVAFGSTKCNSIRASLPLSNSGGSA  1267
              T + P F++F +K  L       +P    K  NRR+A GS +   +RAS    +S G  
Sbjct  30    LTANEPHFLRFAAKPRLPFSIKHYSPLSYSKPQNRRMALGSRRGMVVRASSS-PDSAGPT  88

Query  1266  MPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSAS-G  1090
              PIAPL++ESPIGQFL+QIL+SHPHLV AAV+QQLEQLQTDR+ E++ E    EPSAS G
Sbjct  89    APIAPLQMESPIGQFLSQILISHPHLVPAAVEQQLEQLQTDRDAEEKKE----EPSASAG  144

Query  1089  TDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPS  910
             TD+VLYRRIAEVKANER+KALEEILYALVVQKFMDA+V LVPA+T  S + SG +D  PS
Sbjct  145   TDLVLYRRIAEVKANERKKALEEILYALVVQKFMDANVSLVPAMTPSSTDPSGRVDMWPS  204

Query  909   KDEQLARLHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFLKRV  733
             ++++L  LHSPEAYEMIQNHL+LILGNR   ++SV QI+KLRVGQVYAASVMYGYFLKRV
Sbjct  205   EEDKLELLHSPEAYEMIQNHLALILGNRLGDSTSVAQISKLRVGQVYAASVMYGYFLKRV  264

Query  732   DQRFQLEKNMKVLPQGLDKEDSGIQQ-VGGDssdt----slrsspSHPEVVSWPDGGMGS  568
             DQRFQLEK MK+LP   + E+SG++Q VG D        S ++  SHPEV SW  GG+  
Sbjct  265   DQRFQLEKTMKILPNASNGEESGVEQSVGEDMGTAGLGDSYKAVSSHPEVSSW-SGGISP  323

Query  567   RGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTI  388
              GFG  +KP RLRTYVMSFDGETLQ++A IRSKEA++IIEKHTEALFGRPEI ITPQGT+
Sbjct  324   GGFGHGIKPCRLRTYVMSFDGETLQKFAAIRSKEAVSIIEKHTEALFGRPEIVITPQGTV  383

Query  387   DSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  259
             DSSKDELIKISF+ L+RLVLEAVTFGSFLWDVES VDSRYHFV
Sbjct  384   DSSKDELIKISFNGLKRLVLEAVTFGSFLWDVESYVDSRYHFV  426



>ref|XP_009355996.1| PREDICTED: uncharacterized protein LOC103946898 isoform X2 [Pyrus 
x bretschneideri]
Length=428

 Score =   511 bits (1316),  Expect = 4e-174, Method: Compositional matrix adjust.
 Identities = 274/407 (67%), Positives = 320/407 (79%), Gaps = 22/407 (5%)
 Frame = -2

Query  1428  FTTDAPGFVKFGSKALLSAPS------IKVKLGNRRVAFGSTKCNSIRASLPLSNSGGSA  1267
              T + PGF++ G KA   +PS       + K+G+RR+ +G+ +   +RA+   S+   + 
Sbjct  29    LTANGPGFLRLGPKA--HSPSKHQFSICQPKVGHRRMGYGTRRGLVVRAAAASSSPDSAG  86

Query  1266  M--PIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSAS  1093
                PIAPLKLESPIGQFL+QI++SHPHLV +AVDQQLEQL TDR+ E++ E    EPSAS
Sbjct  87    SDSPIAPLKLESPIGQFLSQIMISHPHLVPSAVDQQLEQLLTDRDAEEKKE----EPSAS  142

Query  1092  GTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLP  913
             GTDIVLYRRIAEVKA ERRKALEEILY LVVQKFMDA+V LVPAIT  + + SG +D+ P
Sbjct  143   GTDIVLYRRIAEVKATERRKALEEILYTLVVQKFMDANVSLVPAITPTASDPSGRVDSWP  202

Query  912   SKDEQLARLHSPEAYEMIQNHLSLILGNR-SNANSSVQINKLRVGQVYAASVMYGYFLKR  736
             S++E+L +LHSPEAYEMIQNHLSLILGNR  ++ S  QI+KLRVGQVYAASVMYGYFLKR
Sbjct  203   SQNEKLEQLHSPEAYEMIQNHLSLILGNRLGDSTSLAQISKLRVGQVYAASVMYGYFLKR  262

Query  735   VDQRFQLEKNMKVLPQGLDKEDSGIQ-QVG-----GDssdtslrsspSHPEVVSWPDGGM  574
             VDQRFQLEK MK+LP  +  EDS IQ  VG     G   DT    +PSHPEV SW  GG+
Sbjct  263   VDQRFQLEKTMKILPSAMGPEDSDIQTSVGQDVRPGGGEDTLQAGAPSHPEVSSWA-GGI  321

Query  573   GSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQG  394
              S GFG  +KPSRLRTYVMSFDGETL RYATIRS+EA++IIEKHTEALFGRP+I ITPQG
Sbjct  322   SSGGFGNAIKPSRLRTYVMSFDGETLHRYATIRSREAVSIIEKHTEALFGRPDIVITPQG  381

Query  393   TIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFVAH  253
             T+DSSKD+ IKISF  LRRLVLEAVTFGSFLWDVES VDSRYHFVA+
Sbjct  382   TVDSSKDDHIKISFGGLRRLVLEAVTFGSFLWDVESYVDSRYHFVAN  428



>ref|XP_009355995.1| PREDICTED: uncharacterized protein LOC103946898 isoform X1 [Pyrus 
x bretschneideri]
Length=429

 Score =   511 bits (1316),  Expect = 5e-174, Method: Compositional matrix adjust.
 Identities = 274/408 (67%), Positives = 320/408 (78%), Gaps = 23/408 (6%)
 Frame = -2

Query  1428  FTTDAPGFVKFGSKALLSAPS-------IKVKLGNRRVAFGSTKCNSIRASLPLSNSGGS  1270
              T + PGF++ G KA   +PS        + K+G+RR+ +G+ +   +RA+   S+   +
Sbjct  29    LTANGPGFLRLGPKA--HSPSKEHQFSICQPKVGHRRMGYGTRRGLVVRAAAASSSPDSA  86

Query  1269  AM--PIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSA  1096
                 PIAPLKLESPIGQFL+QI++SHPHLV +AVDQQLEQL TDR+ E++ E    EPSA
Sbjct  87    GSDSPIAPLKLESPIGQFLSQIMISHPHLVPSAVDQQLEQLLTDRDAEEKKE----EPSA  142

Query  1095  SGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTL  916
             SGTDIVLYRRIAEVKA ERRKALEEILY LVVQKFMDA+V LVPAIT  + + SG +D+ 
Sbjct  143   SGTDIVLYRRIAEVKATERRKALEEILYTLVVQKFMDANVSLVPAITPTASDPSGRVDSW  202

Query  915   PSKDEQLARLHSPEAYEMIQNHLSLILGNR-SNANSSVQINKLRVGQVYAASVMYGYFLK  739
             PS++E+L +LHSPEAYEMIQNHLSLILGNR  ++ S  QI+KLRVGQVYAASVMYGYFLK
Sbjct  203   PSQNEKLEQLHSPEAYEMIQNHLSLILGNRLGDSTSLAQISKLRVGQVYAASVMYGYFLK  262

Query  738   RVDQRFQLEKNMKVLPQGLDKEDSGIQ-QVG-----GDssdtslrsspSHPEVVSWPDGG  577
             RVDQRFQLEK MK+LP  +  EDS IQ  VG     G   DT    +PSHPEV SW  GG
Sbjct  263   RVDQRFQLEKTMKILPSAMGPEDSDIQTSVGQDVRPGGGEDTLQAGAPSHPEVSSWA-GG  321

Query  576   MGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQ  397
             + S GFG  +KPSRLRTYVMSFDGETL RYATIRS+EA++IIEKHTEALFGRP+I ITPQ
Sbjct  322   ISSGGFGNAIKPSRLRTYVMSFDGETLHRYATIRSREAVSIIEKHTEALFGRPDIVITPQ  381

Query  396   GTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFVAH  253
             GT+DSSKD+ IKISF  LRRLVLEAVTFGSFLWDVES VDSRYHFVA+
Sbjct  382   GTVDSSKDDHIKISFGGLRRLVLEAVTFGSFLWDVESYVDSRYHFVAN  429



>gb|EYU21849.1| hypothetical protein MIMGU_mgv1a007186mg [Erythranthe guttata]
Length=416

 Score =   509 bits (1312),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 270/394 (69%), Positives = 316/394 (80%), Gaps = 16/394 (4%)
 Frame = -2

Query  1404  VKFGSKALLSAPSIK-------VKLGNRRVAFGSTKCNSIRASLPLSNSGGSAMPIAPLK  1246
             ++  S+++LS   I+       +K G+R+V   S K  SIRAS    +SG S+ PIAPL+
Sbjct  29    LRLASRSVLSNAWIQQRQSISHMKFGSRKVEPLSKKRTSIRASKQSPDSGNSSAPIAPLQ  88

Query  1245  LESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRR  1066
             LESPIGQFL+QIL+SHPHLV AAV+QQLEQLQTDR+ E  NEK++   SASGT++VLYRR
Sbjct  89    LESPIGQFLSQILISHPHLVPAAVEQQLEQLQTDRDAE--NEKED--LSASGTELVLYRR  144

Query  1065  IAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPSKDEQLARL  886
             I EVKANERR+ALEEILYALVVQKFMD ++PLVP IT  S + SG +DT PS+DE+L RL
Sbjct  145   IQEVKANERREALEEILYALVVQKFMDVNIPLVPTITPSSPDKSGRVDTWPSQDEKLERL  204

Query  885   HSPEAYEMIQNHLSLILGNR-SNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQLEK  709
             HS EAYEMIQNHL+LILGNR +++NS  +I+KLRVGQVYAASVMYGYFLKR+DQRFQLEK
Sbjct  205   HSTEAYEMIQNHLALILGNRLADSNSLAEISKLRVGQVYAASVMYGYFLKRIDQRFQLEK  264

Query  708   NMKVLPQGLD-KEDSGIQQV-GGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPSR  535
              MKVLPQG    E   I+QV   D  D+   +  SHPE  ++   G+G   F   +KPSR
Sbjct  265   TMKVLPQGTTVNEYENIEQVIADDKKDSVRSAQNSHPEASTF-SSGIGGMSFAG-VKPSR  322

Query  534   LRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKIS  355
             LRTYVMSFDGETLQRYATIRSKEAI+IIEKHTEALFGRPEI+ITPQGT+DSSKDELIKIS
Sbjct  323   LRTYVMSFDGETLQRYATIRSKEAISIIEKHTEALFGRPEIAITPQGTVDSSKDELIKIS  382

Query  354   FSSLRRLVLEAVTFGSFLWDVESSVDSRYHFVAH  253
             F  L+RLVLEAVTFGSFLWDVES VDSRYHFVA+
Sbjct  383   FGGLKRLVLEAVTFGSFLWDVESFVDSRYHFVAN  416



>ref|XP_008356699.1| PREDICTED: uncharacterized protein LOC103420417 isoform X1 [Malus 
domestica]
Length=429

 Score =   507 bits (1305),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 272/408 (67%), Positives = 316/408 (77%), Gaps = 23/408 (6%)
 Frame = -2

Query  1428  FTTDAPGFVKFGSKALLSAPS-------IKVKLGNRRVAFGSTKCNSIRASLPLSNSGGS  1270
              T   PGF++ G KA   +PS        + K+G+RR+ +GS +   +RA+   S+   +
Sbjct  29    LTAHGPGFLRLGPKA--HSPSKQHQFSICQPKVGHRRMGYGSRRGLVVRAAAASSSPDSA  86

Query  1269  AM--PIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSA  1096
                 PIAPLKLESPIGQFL+QI++SHPHLV +AVDQQL+ L TDR+ E++ E    EPSA
Sbjct  87    GSDSPIAPLKLESPIGQFLSQIMISHPHLVPSAVDQQLDLLLTDRDAEEKKE----EPSA  142

Query  1095  SGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTL  916
             SGTDIVLYRRIAEVKA ERRKALEEILY LVVQKFMDA+V LVPAIT  +   SG +D+ 
Sbjct  143   SGTDIVLYRRIAEVKATERRKALEEILYTLVVQKFMDANVSLVPAITPTASYPSGQVDSW  202

Query  915   PSKDEQLARLHSPEAYEMIQNHLSLILGNR-SNANSSVQINKLRVGQVYAASVMYGYFLK  739
             PS++E+L +LHSPEAYEMIQNHLSLILGNR  ++ S  QI+KLRVGQVYAASVMYGYFLK
Sbjct  203   PSQNEKLEQLHSPEAYEMIQNHLSLILGNRLGDSTSLAQISKLRVGQVYAASVMYGYFLK  262

Query  738   RVDQRFQLEKNMKVLPQGLDKEDSGIQ-QVGGDs-----sdtslrsspSHPEVVSWPDGG  577
             RVDQRFQLEK MK+LP  +  EDS IQ  VG D       DT    + SHPEV SW  GG
Sbjct  263   RVDQRFQLEKTMKILPSAMGPEDSDIQTSVGQDMRPGGGEDTLQAGASSHPEVSSWA-GG  321

Query  576   MGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQ  397
             + S GFG  +KPSRLRTYVMSFDGETL RYATIRS+EA++IIEKHTEALFGRP+I ITPQ
Sbjct  322   ISSGGFGNAIKPSRLRTYVMSFDGETLHRYATIRSREAVSIIEKHTEALFGRPDIVITPQ  381

Query  396   GTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFVAH  253
             GT+DSSKD+ IKISF  LRRLVLEAVTFGSFLWDVES VDSRYHFVA+
Sbjct  382   GTVDSSKDDHIKISFGGLRRLVLEAVTFGSFLWDVESYVDSRYHFVAN  429



>ref|XP_008356700.1| PREDICTED: uncharacterized protein LOC103420417 isoform X2 [Malus 
domestica]
Length=428

 Score =   507 bits (1305),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 272/407 (67%), Positives = 316/407 (78%), Gaps = 22/407 (5%)
 Frame = -2

Query  1428  FTTDAPGFVKFGSKALLSAPS------IKVKLGNRRVAFGSTKCNSIRASLPLSNSGGSA  1267
              T   PGF++ G KA   +PS       + K+G+RR+ +GS +   +RA+   S+   + 
Sbjct  29    LTAHGPGFLRLGPKA--HSPSKHQFSICQPKVGHRRMGYGSRRGLVVRAAAASSSPDSAG  86

Query  1266  M--PIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSAS  1093
                PIAPLKLESPIGQFL+QI++SHPHLV +AVDQQL+ L TDR+ E++ E    EPSAS
Sbjct  87    SDSPIAPLKLESPIGQFLSQIMISHPHLVPSAVDQQLDLLLTDRDAEEKKE----EPSAS  142

Query  1092  GTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLP  913
             GTDIVLYRRIAEVKA ERRKALEEILY LVVQKFMDA+V LVPAIT  +   SG +D+ P
Sbjct  143   GTDIVLYRRIAEVKATERRKALEEILYTLVVQKFMDANVSLVPAITPTASYPSGQVDSWP  202

Query  912   SKDEQLARLHSPEAYEMIQNHLSLILGNR-SNANSSVQINKLRVGQVYAASVMYGYFLKR  736
             S++E+L +LHSPEAYEMIQNHLSLILGNR  ++ S  QI+KLRVGQVYAASVMYGYFLKR
Sbjct  203   SQNEKLEQLHSPEAYEMIQNHLSLILGNRLGDSTSLAQISKLRVGQVYAASVMYGYFLKR  262

Query  735   VDQRFQLEKNMKVLPQGLDKEDSGIQ-QVGGDs-----sdtslrsspSHPEVVSWPDGGM  574
             VDQRFQLEK MK+LP  +  EDS IQ  VG D       DT    + SHPEV SW  GG+
Sbjct  263   VDQRFQLEKTMKILPSAMGPEDSDIQTSVGQDMRPGGGEDTLQAGASSHPEVSSWA-GGI  321

Query  573   GSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQG  394
              S GFG  +KPSRLRTYVMSFDGETL RYATIRS+EA++IIEKHTEALFGRP+I ITPQG
Sbjct  322   SSGGFGNAIKPSRLRTYVMSFDGETLHRYATIRSREAVSIIEKHTEALFGRPDIVITPQG  381

Query  393   TIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFVAH  253
             T+DSSKD+ IKISF  LRRLVLEAVTFGSFLWDVES VDSRYHFVA+
Sbjct  382   TVDSSKDDHIKISFGGLRRLVLEAVTFGSFLWDVESYVDSRYHFVAN  428



>ref|XP_006374246.1| hypothetical protein POPTR_0015s05360g [Populus trichocarpa]
 ref|XP_006374247.1| hypothetical protein POPTR_0015s05360g [Populus trichocarpa]
 gb|ABK96147.1| unknown [Populus trichocarpa]
 gb|ERP52043.1| hypothetical protein POPTR_0015s05360g [Populus trichocarpa]
 gb|ERP52044.1| hypothetical protein POPTR_0015s05360g [Populus trichocarpa]
Length=417

 Score =   506 bits (1303),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 273/424 (64%), Positives = 323/424 (76%), Gaps = 20/424 (5%)
 Frame = -2

Query  1497  MEMTTSLRSSITVGCG-PVKSGRRF---TTDAPGFVKFGSKALLSAPSIKVKLGNRRVAF  1330
             ME  T+     ++G   P KS  R     T+   FV F  K   S      KLG+RRVA+
Sbjct  1     MEAATATVIGSSIGISTPAKSVARLGFLATNKQDFVHFPIKRHSSVS--YSKLGHRRVAY  58

Query  1329  GSTKCNSIRASLPLSNSGGSAM-PIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQL  1153
             GS +C ++RAS   S+    ++ PIAPL+LESPIGQFL+QILVSHPHLV AAV+QQLEQL
Sbjct  59    GSRRCMAVRASSSSSSDSSGSIVPIAPLQLESPIGQFLSQILVSHPHLVPAAVEQQLEQL  118

Query  1152  QTDRNLEKQNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVP  973
             QTDR+    +EKQ ++PSA+GTD+VLYRRIAE KAN+RRKALEEILYALVVQKFMDA+V 
Sbjct  119   QTDRD----SEKQKEDPSATGTDLVLYRRIAEAKANDRRKALEEILYALVVQKFMDANVS  174

Query  972   LVPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNANSSV-QIN  796
             L+P I   S  SSG +DT PS+DE+L +LHSPEAYEMIQNHL+LILGNR   +++V QI+
Sbjct  175   LIPTIGPSSAESSGQVDTWPSQDEKLEQLHSPEAYEMIQNHLTLILGNRVGDSTAVAQIS  234

Query  795   KLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQ-VGGDss----dt  631
             KLR+GQVYAASVMYGYFLKRVDQRFQLEK MK+LP G+D+ +S I + VG D        
Sbjct  235   KLRIGQVYAASVMYGYFLKRVDQRFQLEKTMKILPNGVDETESDIHKAVGQDVKPGGRGL  294

Query  630   slrsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINII  451
             S ++  SHPE +S   GG+   GFG  +K SRLR YVMSFD ETLQRYATIRSKEA++II
Sbjct  295   SYQALSSHPEAIS---GGISPGGFGHGLKASRLRNYVMSFDAETLQRYATIRSKEAVSII  351

Query  450   EKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSR  271
             EKHTEALFGRPEI ITPQGTID+SKDE++ IS   L+RL LEAVTFGSFLWDVES VDSR
Sbjct  352   EKHTEALFGRPEIVITPQGTIDTSKDEVVTISLGGLKRLALEAVTFGSFLWDVESYVDSR  411

Query  270   YHFV  259
             YHFV
Sbjct  412   YHFV  415



>ref|XP_011047792.1| PREDICTED: uncharacterized protein LOC105142042 [Populus euphratica]
Length=418

 Score =   506 bits (1303),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 276/424 (65%), Positives = 324/424 (76%), Gaps = 19/424 (4%)
 Frame = -2

Query  1497  MEMTTSLRSSITVGC-GPVKSGRRF---TTDAPGFVKFGSKALLSAPSIKVKLGNRRVAF  1330
             ME  T+     ++G  GP KS  R     T+   FV+F  K   S    K+   +RRVA+
Sbjct  1     MEAATATVIGSSIGISGPGKSVARLGFLATNKQDFVRFPIKRHSSVSYSKLG-SHRRVAY  59

Query  1329  GSTKCNSIRASLPLSNSGGSAM-PIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQL  1153
             GS +  ++RAS   S+    ++ PIAPL+LESPIGQFL+QILVSHPHLV AAV+QQLEQL
Sbjct  60    GSRRYMAVRASSSSSSDSSGSIVPIAPLQLESPIGQFLSQILVSHPHLVPAAVEQQLEQL  119

Query  1152  QTDRNLEKQNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVP  973
             QTDR+    +EKQ ++PSA+GTD+VLYRRIAEVKANERRKALEEILYALVVQKFMDA+V 
Sbjct  120   QTDRD----SEKQKEDPSATGTDLVLYRRIAEVKANERRKALEEILYALVVQKFMDANVS  175

Query  972   LVPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNANSSV-QIN  796
             L+P I   S  SSG +D+ PS+DE+L +LHSPEAYEMIQNHL+LILGNR   ++ V QI+
Sbjct  176   LIPTIAPSSTESSGQVDSWPSQDEKLEQLHSPEAYEMIQNHLTLILGNRVGDSTVVAQIS  235

Query  795   KLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQ-VGGDss----dt  631
             KLRVGQVYAASVMYGYFLKRVDQRFQLEK MK LP G+D+ +S I + VG D        
Sbjct  236   KLRVGQVYAASVMYGYFLKRVDQRFQLEKTMKTLPNGVDERESDIHKAVGQDVKPGGRGL  295

Query  630   slrsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINII  451
             S ++  SHPE +S   GG+   GFG  +K SRLR YVMSFDGETLQRYATIRSKEA++II
Sbjct  296   SYQALSSHPEAIS---GGISPGGFGNGLKASRLRNYVMSFDGETLQRYATIRSKEAVSII  352

Query  450   EKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSR  271
             EKHTEALFGRPEI ITPQGTID+SKDEL+KIS   L+RL LEAVTFGSFLWDVES VDSR
Sbjct  353   EKHTEALFGRPEIVITPQGTIDTSKDELVKISLGGLKRLALEAVTFGSFLWDVESYVDSR  412

Query  270   YHFV  259
             YHFV
Sbjct  413   YHFV  416



>ref|XP_006493269.1| PREDICTED: uncharacterized protein LOC102611948 isoform X1 [Citrus 
sinensis]
 ref|XP_006493270.1| PREDICTED: uncharacterized protein LOC102611948 isoform X2 [Citrus 
sinensis]
Length=418

 Score =   504 bits (1298),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 275/395 (70%), Positives = 315/395 (80%), Gaps = 15/395 (4%)
 Frame = -2

Query  1416  APGFVKFGSKALLSAPSIKV----KLGNRRVAFGSTKCNSIRASLPLSNSGGSAMPIAPL  1249
              P F++FG+K+LL           K  +RR  FGS +C  +RAS   S S GS  PIAPL
Sbjct  28    GPDFIRFGTKSLLPIKHYSSVSNPKPRHRRKGFGSRRCMVVRASS-SSESSGSMDPIAPL  86

Query  1248  KLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYR  1069
             +LESP+GQFL+QIL+SHPHLV AAV+QQLEQLQTDR+ EK  E    E SASGT++VLYR
Sbjct  87    QLESPVGQFLSQILISHPHLVPAAVEQQLEQLQTDRDAEKHKE----EASASGTELVLYR  142

Query  1068  RIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPSKDEQLAR  889
             RIAEVKANERRKALEEILYALVVQKFMDA+V L+P+IT  S +SSG +DT  S+DE L +
Sbjct  143   RIAEVKANERRKALEEILYALVVQKFMDANVSLIPSITPSSSDSSGRVDTWLSQDENLEQ  202

Query  888   LHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFLKRVDQRFQLE  712
             LHS EAYEMIQNHL+LILGNR   ++SV QI+KLRVGQVYAASVMYGYFLKRVDQRFQLE
Sbjct  203   LHSSEAYEMIQNHLALILGNRLGDSTSVAQISKLRVGQVYAASVMYGYFLKRVDQRFQLE  262

Query  711   KNMKVLPQGLDKEDSGIQQVGGDs----sdtslrsspSHPEVVSWPDGGMGSRGFGTEMK  544
             K+MK+LP   D E SGIQQV GD     ++ S  +  SHPEV S+  GG+   GFG  +K
Sbjct  263   KSMKILPDASDVEASGIQQVVGDVTPTGAEGSHEALSSHPEVSSF-SGGVSPGGFGHGIK  321

Query  543   PSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELI  364
              SRLRTYVMSFDGETLQRYATIRSKEA++IIEKHTEALFGRPEI +TPQGT+DSS DE I
Sbjct  322   ASRLRTYVMSFDGETLQRYATIRSKEAVSIIEKHTEALFGRPEIVVTPQGTVDSSNDEQI  381

Query  363   KISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  259
             KISF+ L+RLVLEAVTFGSFLWDVES VDSRYHFV
Sbjct  382   KISFAGLKRLVLEAVTFGSFLWDVESYVDSRYHFV  416



>ref|XP_010241168.1| PREDICTED: uncharacterized protein LOC104585831 [Nelumbo nucifera]
Length=424

 Score =   502 bits (1293),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 279/433 (64%), Positives = 315/433 (73%), Gaps = 27/433 (6%)
 Frame = -2

Query  1497  MEMTTSLRSSITVGCGP---VKSGRRFTTDAPGFVKFGSKALLSAPSIK-------VKLG  1348
             ME    LRSS  + C P   V      T  AP FV F SK  LS   IK        K G
Sbjct  1     MEAVAVLRSSSGI-CKPPNFVTESGFLTARAPDFVFFNSKLRLSNGWIKHSPSTYLSKQG  59

Query  1347  NRRVAFGSTKCNSIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQ  1168
                  F S K   ++AS    +S  SA PIAPLKLESP+GQFL QIL SHPHLV AAVDQ
Sbjct  60    QSSSVFKSRKRTIMKASAS-QDSTESASPIAPLKLESPVGQFLAQILRSHPHLVPAAVDQ  118

Query  1167  QLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFM  988
             QLEQLQTDR+ EKQ E    EPS+S TD+VLYRRIAEVKA ERRKALEEILYALVVQKFM
Sbjct  119   QLEQLQTDRDAEKQKE----EPSSSSTDLVLYRRIAEVKATERRKALEEILYALVVQKFM  174

Query  987   DADVPLVPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNANSS  808
             D +V L+P I S     SG +DT P++DE+L +LHS EAYEMIQNHL+LILGNR   + +
Sbjct  175   DGNVFLIPTILS--SKPSGRVDTWPNQDEKLEQLHSSEAYEMIQNHLALILGNRVGDSRT  232

Query  807   V-QINKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQV-------  652
             V QI+KLRVGQVYAASVMYGYFLKRVDQRFQLEK MK+LP   D++++ I+QV       
Sbjct  233   VAQISKLRVGQVYAASVMYGYFLKRVDQRFQLEKTMKILPYASDEQETDIEQVMAEQTPS  292

Query  651   GGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRS  472
             GG+  + S ++  +HPEV SW  G  G  GFG   K S+LRTYVMSFD E LQRYATIRS
Sbjct  293   GGEGIEASSQTEQTHPEVSSWL-GNFGPGGFGHGYKSSKLRTYVMSFDAEMLQRYATIRS  351

Query  471   KEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDV  292
             KEA++IIEKHTEALFGRPEI ITP GTIDSSKDELI+ISF  L+RLVLEAVTFGSFLWDV
Sbjct  352   KEAVSIIEKHTEALFGRPEIVITPHGTIDSSKDELIRISFGGLKRLVLEAVTFGSFLWDV  411

Query  291   ESSVDSRYHFVAH  253
             ES VDSRYHFVA+
Sbjct  412   ESYVDSRYHFVAN  424



>ref|XP_008393457.1| PREDICTED: uncharacterized protein LOC103455652 isoform X2 [Malus 
domestica]
Length=431

 Score =   502 bits (1293),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 266/405 (66%), Positives = 320/405 (79%), Gaps = 15/405 (4%)
 Frame = -2

Query  1428  FTTDAPGFVKFGSKA---LLSAPSI-KVKLGNRRVAFGSTKCNSIRASLPLSNSGGSAM-  1264
              T + PGF++ G K    +    SI + K+G+RR+ +GS +   +RA+   S+   +   
Sbjct  29    LTANGPGFLRLGPKTHSPIKHRFSICQPKVGHRRMGYGSRRGFVVRAAAASSSPDSAGSA  88

Query  1263  -PIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGT  1087
              PIAPL+LESPIGQFL+QI++SHPHLV +AVDQQLEQLQTDR+ E++ E Q +EPSASGT
Sbjct  89    SPIAPLQLESPIGQFLSQIMISHPHLVPSAVDQQLEQLQTDRDAEQKKE-QKEEPSASGT  147

Query  1086  DIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPSK  907
             D+VLYRRIAEVKA ERRKALEEILYALVVQKFMDA+V LVPAI+  + + SG +D+ PS+
Sbjct  148   DLVLYRRIAEVKATERRKALEEILYALVVQKFMDANVSLVPAISPTASDPSGQVDSWPSQ  207

Query  906   DEQLARLHSPEAYEMIQNHLSLILGNR-SNANSSVQINKLRVGQVYAASVMYGYFLKRVD  730
             DE+L +LHSPEAYEMI+NHLSLILGNR  ++ S  +I+KL+VGQVYAASVMYGYFLKRVD
Sbjct  208   DEKLEQLHSPEAYEMIRNHLSLILGNRLGDSTSLAKISKLKVGQVYAASVMYGYFLKRVD  267

Query  729   QRFQLEKNMKVLPQGLDKEDSGIQQ-VG-----GDssdtslrsspSHPEVVSWPDGGMGS  568
             QRFQLEK MK+LP  +  EDS I + VG     G   + S   + SHPEV S   GG+  
Sbjct  268   QRFQLEKTMKILPGAMGAEDSDIHKSVGEDVRPGSGGEASQAGASSHPEVXSLA-GGVSP  326

Query  567   RGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTI  388
              GFG  +K SRLRTYVMSFDGETL RYATIRS+EAI+IIEKHTEALFGRP+I ITPQGT+
Sbjct  327   GGFGNALKHSRLRTYVMSFDGETLHRYATIRSREAISIIEKHTEALFGRPDIVITPQGTV  386

Query  387   DSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFVAH  253
             DSSKD+LIKISF  LRRL+LE+VTFGSFLWDVES VDSRYHFVA+
Sbjct  387   DSSKDDLIKISFGGLRRLILESVTFGSFLWDVESYVDSRYHFVAN  431



>ref|XP_006441318.1| hypothetical protein CICLE_v10020337mg [Citrus clementina]
 ref|XP_006441319.1| hypothetical protein CICLE_v10020337mg [Citrus clementina]
 ref|XP_006441320.1| hypothetical protein CICLE_v10020337mg [Citrus clementina]
 gb|ESR54558.1| hypothetical protein CICLE_v10020337mg [Citrus clementina]
 gb|ESR54559.1| hypothetical protein CICLE_v10020337mg [Citrus clementina]
 gb|ESR54560.1| hypothetical protein CICLE_v10020337mg [Citrus clementina]
Length=417

 Score =   501 bits (1289),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 272/395 (69%), Positives = 315/395 (80%), Gaps = 16/395 (4%)
 Frame = -2

Query  1416  APGFVKFGSKALLSAPSIKV----KLGNRRVAFGSTKCNSIRASLPLSNSGGSAMPIAPL  1249
              P F++FG+K+LL           K  +RR  FGS +C  +RAS   S S  S  PIAPL
Sbjct  28    GPDFIRFGTKSLLPIKHYSSVSNPKPRHRRKGFGSRRCMVVRASS-SSESSRSMDPIAPL  86

Query  1248  KLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYR  1069
             +LESP+GQFL+QIL+SHPHLV AAV+QQLEQLQTDR+ EK     ++E SASGT++VLYR
Sbjct  87    QLESPVGQFLSQILISHPHLVPAAVEQQLEQLQTDRDAEK-----HEEASASGTELVLYR  141

Query  1068  RIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPSKDEQLAR  889
             RIAEVKANERRKALEEILYALVVQKFMDA+V L+P+IT  S +SSG +DT  S+DE L +
Sbjct  142   RIAEVKANERRKALEEILYALVVQKFMDANVSLIPSITPSSSDSSGRVDTWLSQDENLEQ  201

Query  888   LHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFLKRVDQRFQLE  712
             LHS EAYEMIQNHL+LILGNR   ++SV QI+KLRVGQVYAASVMYGYFLKRVDQRFQLE
Sbjct  202   LHSSEAYEMIQNHLALILGNRLGDSTSVAQISKLRVGQVYAASVMYGYFLKRVDQRFQLE  261

Query  711   KNMKVLPQGLDKEDSGIQQVGGDs----sdtslrsspSHPEVVSWPDGGMGSRGFGTEMK  544
             K+MK+LP   D E+SGIQQV GD     ++ S  +  SHPEV S+  GG+   GFG  +K
Sbjct  262   KSMKILPDASDVEESGIQQVVGDVTPTGAEGSHEALSSHPEVSSF-SGGVSPGGFGHGIK  320

Query  543   PSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELI  364
              SRLRTYVMSFDGETLQRYATIRSKEA++IIEKHTEALFGRPEI +TPQGT+DSS D  I
Sbjct  321   ASRLRTYVMSFDGETLQRYATIRSKEAVSIIEKHTEALFGRPEIVVTPQGTVDSSNDVQI  380

Query  363   KISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  259
             KISF+ L+RLVLEAVTFGSFLWDVES VDSRYHFV
Sbjct  381   KISFAGLKRLVLEAVTFGSFLWDVESYVDSRYHFV  415



>ref|XP_008393456.1| PREDICTED: uncharacterized protein LOC103455652 isoform X1 [Malus 
domestica]
Length=432

 Score =   501 bits (1290),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 264/406 (65%), Positives = 317/406 (78%), Gaps = 16/406 (4%)
 Frame = -2

Query  1428  FTTDAPGFVKFGSKALLSAPSIKV-----KLGNRRVAFGSTKCNSIRASLPLSNSGGSAM  1264
              T + PGF++ G K        +      K+G+RR+ +GS +   +RA+   S+   +  
Sbjct  29    LTANGPGFLRLGPKTHSPIKQHRFSICQPKVGHRRMGYGSRRGFVVRAAAASSSPDSAGS  88

Query  1263  --PIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASG  1090
               PIAPL+LESPIGQFL+QI++SHPHLV +AVDQQLEQLQTDR+ E++ E Q +EPSASG
Sbjct  89    ASPIAPLQLESPIGQFLSQIMISHPHLVPSAVDQQLEQLQTDRDAEQKKE-QKEEPSASG  147

Query  1089  TDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPS  910
             TD+VLYRRIAEVKA ERRKALEEILYALVVQKFMDA+V LVPAI+  + + SG +D+ PS
Sbjct  148   TDLVLYRRIAEVKATERRKALEEILYALVVQKFMDANVSLVPAISPTASDPSGQVDSWPS  207

Query  909   KDEQLARLHSPEAYEMIQNHLSLILGNR-SNANSSVQINKLRVGQVYAASVMYGYFLKRV  733
             +DE+L +LHSPEAYEMI+NHLSLILGNR  ++ S  +I+KL+VGQVYAASVMYGYFLKRV
Sbjct  208   QDEKLEQLHSPEAYEMIRNHLSLILGNRLGDSTSLAKISKLKVGQVYAASVMYGYFLKRV  267

Query  732   DQRFQLEKNMKVLPQGLDKEDSGIQQ-VG-----GDssdtslrsspSHPEVVSWPDGGMG  571
             DQRFQLEK MK+LP  +  EDS I + VG     G   + S   + SHPEV S   GG+ 
Sbjct  268   DQRFQLEKTMKILPGAMGAEDSDIHKSVGEDVRPGSGGEASQAGASSHPEVXSLA-GGVS  326

Query  570   SRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGT  391
               GFG  +K SRLRTYVMSFDGETL RYATIRS+EAI+IIEKHTEALFGRP+I ITPQGT
Sbjct  327   PGGFGNALKHSRLRTYVMSFDGETLHRYATIRSREAISIIEKHTEALFGRPDIVITPQGT  386

Query  390   IDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFVAH  253
             +DSSKD+LIKISF  LRRL+LE+VTFGSFLWDVES VDSRYHFVA+
Sbjct  387   VDSSKDDLIKISFGGLRRLILESVTFGSFLWDVESYVDSRYHFVAN  432



>gb|KDO47166.1| hypothetical protein CISIN_1g014467mg [Citrus sinensis]
Length=424

 Score =   500 bits (1287),  Expect = 9e-170, Method: Compositional matrix adjust.
 Identities = 273/395 (69%), Positives = 314/395 (79%), Gaps = 16/395 (4%)
 Frame = -2

Query  1416  APGFVKFGSKALLSAPSIKV----KLGNRRVAFGSTKCNSIRASLPLSNSGGSAMPIAPL  1249
              P F++FG+K+LL           K  +RR  FGS +C  +RAS   S S  S  PIAPL
Sbjct  35    GPDFIRFGTKSLLPIKHYSSVSNPKPRHRRKGFGSRRCMVVRASS-SSESSRSMDPIAPL  93

Query  1248  KLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYR  1069
             +LESP+GQFL+QIL+SHPHLV AAV+QQLEQLQTDR+ EK     ++E SASGT++VLYR
Sbjct  94    QLESPVGQFLSQILISHPHLVPAAVEQQLEQLQTDRDAEK-----HEEASASGTELVLYR  148

Query  1068  RIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPSKDEQLAR  889
             RIAEVKANERRKALEEILYALVVQKFMDA+V L+P+IT  S +SSG +DT  S+DE L +
Sbjct  149   RIAEVKANERRKALEEILYALVVQKFMDANVSLIPSITPSSSDSSGRVDTWLSQDENLEQ  208

Query  888   LHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFLKRVDQRFQLE  712
             LHS EAYEMIQNHL+LILGNR   ++SV QI+KLRVGQVYAASVMYGYFLKRVDQRFQLE
Sbjct  209   LHSSEAYEMIQNHLALILGNRLGDSTSVAQISKLRVGQVYAASVMYGYFLKRVDQRFQLE  268

Query  711   KNMKVLPQGLDKEDSGIQQVGGDssdt----slrsspSHPEVVSWPDGGMGSRGFGTEMK  544
             K+MK+LP   D E SGIQQV GD + T    S  +  SHPEV S+  GG+   GFG  +K
Sbjct  269   KSMKILPDASDVEASGIQQVVGDVTPTGAEGSHEALSSHPEVSSF-SGGVSPGGFGHGIK  327

Query  543   PSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELI  364
              SRLRTYVMSFDGETLQRYATIRSKEA++IIEKHTEALFGRPEI +TPQGT+DSS D  I
Sbjct  328   ASRLRTYVMSFDGETLQRYATIRSKEAVSIIEKHTEALFGRPEIVVTPQGTVDSSNDVQI  387

Query  363   KISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  259
             KISF+ L+RLVLEAVTFGSFLWDVES VDSRYHFV
Sbjct  388   KISFAGLKRLVLEAVTFGSFLWDVESYVDSRYHFV  422



>emb|CBI35458.3| unnamed protein product [Vitis vinifera]
Length=410

 Score =   499 bits (1285),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 269/391 (69%), Positives = 310/391 (79%), Gaps = 11/391 (3%)
 Frame = -2

Query  1428  FTTDAPGFVKFGSKALLSAPSIKVKLGNRRVAFGSTKCNSIRASLPLSNSGGSAMPIAPL  1249
             F  +    V+F ++    +  + +K G+R +AFG  KC  +RAS   ++S GSA PIAPL
Sbjct  28    FNVNRSNSVRFPTQFRFFSGWLNLKSGHRNMAFGCKKCTIVRASA-SADSSGSAAPIAPL  86

Query  1248  KLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYR  1069
             +LESPIGQFL+QIL+SHPHLV AAV+QQLEQLQTDR+ E+  E    E SASGT++VLYR
Sbjct  87    QLESPIGQFLSQILISHPHLVPAAVEQQLEQLQTDRDAEEHKE----ESSASGTELVLYR  142

Query  1068  RIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPSKDEQLAR  889
             RIAEVKANER+KALEEILYALVVQKFMDA+V L+P I+S S +SS  +DT PS+D +L +
Sbjct  143   RIAEVKANERKKALEEILYALVVQKFMDANVSLIPTISSSSSDSSDRVDTWPSQDGKLEQ  202

Query  888   LHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFLKRVDQRFQLE  712
             LHSPEAYEMIQNHL+LILGNR   ++SV QI+KLRVGQVYAASVMYGYFLKRVDQRFQLE
Sbjct  203   LHSPEAYEMIQNHLALILGNRLGDSTSVAQISKLRVGQVYAASVMYGYFLKRVDQRFQLE  262

Query  711   KNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPSRL  532
             K MK+LP  LD +   +Q+   DS  T       HPEV SW  GG    GFG  +KPSRL
Sbjct  263   KTMKILPHALDGDKGSVQEAFDDSVQTVKS----HPEVSSWA-GGFTPGGFGHGIKPSRL  317

Query  531   RTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKISF  352
             R YVMSFD ETLQRYATIRSKEA++IIEKHTEALFGRPEI ITPQGTIDSSKDELIKISF
Sbjct  318   RNYVMSFDAETLQRYATIRSKEAVSIIEKHTEALFGRPEIIITPQGTIDSSKDELIKISF  377

Query  351   SSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  259
               L+RLVLEAVTFGSFLWDVES VDSRYHFV
Sbjct  378   GGLKRLVLEAVTFGSFLWDVESFVDSRYHFV  408



>ref|XP_007036961.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY21462.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=438

 Score =   499 bits (1286),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 265/398 (67%), Positives = 312/398 (78%), Gaps = 19/398 (5%)
 Frame = -2

Query  1428  FTTDAPGFVKFGSKALLS------APSIKVKLGNRRVAFGSTKCNSIRASLPLSNSGGSA  1267
              T + P F++F +K  L       +P    K  NRR+A GS +   +RAS    +S G  
Sbjct  30    LTANEPHFLRFAAKPRLPFSIKHYSPLSYSKPQNRRMALGSRRGMVVRASSS-PDSAGPT  88

Query  1266  MPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSAS-G  1090
              PIAPL++ESPIGQFL+QIL+SHPHLV AAV+QQLEQLQTDR+ E++ E    EPSAS G
Sbjct  89    APIAPLQMESPIGQFLSQILISHPHLVPAAVEQQLEQLQTDRDAEEKKE----EPSASAG  144

Query  1089  TDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPS  910
             TD+VLYRRIAEVKANER+KALEEILYALVVQKFMDA+V LVPA+T  S + SG +D  PS
Sbjct  145   TDLVLYRRIAEVKANERKKALEEILYALVVQKFMDANVSLVPAMTPSSTDPSGRVDMWPS  204

Query  909   KDEQLARLHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFLKRV  733
             ++++L  LHSPEAYEMIQNHL+LILGNR   ++SV QI+KLRVGQVYAASVMYGYFLKRV
Sbjct  205   EEDKLELLHSPEAYEMIQNHLALILGNRLGDSTSVAQISKLRVGQVYAASVMYGYFLKRV  264

Query  732   DQRFQLEKNMKVLPQGLDKEDSGIQQ-VGGDssdt----slrsspSHPEVVSWPDGGMGS  568
             DQRFQLEK MK+LP   + E+SG++Q VG D        S ++  SHPEV SW  GG+  
Sbjct  265   DQRFQLEKTMKILPNASNGEESGVEQSVGEDMGTAGLGDSYKAVSSHPEVSSW-SGGISP  323

Query  567   RGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTI  388
              GFG  +KP RLRTYVMSFDGETLQ++A IRSKEA++IIEKHTEALFGRPEI ITPQGT+
Sbjct  324   GGFGHGIKPCRLRTYVMSFDGETLQKFAAIRSKEAVSIIEKHTEALFGRPEIVITPQGTV  383

Query  387   DSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDS  274
             DSSKDELIKISF+ L+RLVLEAVTFGSFLWDVES VDS
Sbjct  384   DSSKDELIKISFNGLKRLVLEAVTFGSFLWDVESYVDS  421



>ref|XP_002533448.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF28932.1| conserved hypothetical protein [Ricinus communis]
Length=392

 Score =   497 bits (1279),  Expect = 5e-169, Method: Compositional matrix adjust.
 Identities = 261/423 (62%), Positives = 312/423 (74%), Gaps = 40/423 (9%)
 Frame = -2

Query  1518  IRHCCCMMEMTTSLRSSITVGCGPVKSGRRFTTDAPGFVKFGSKALLSAPSIKVKLGNRR  1339
             +R+   M + +T++  S+ +             + PGF++F +    S+ S   K G RR
Sbjct  9     VRYPIGMYKPSTTVGRSVFLAA-----------NGPGFLRFSTTKHYSSVSYG-KQGYRR  56

Query  1338  VAFGSTKCNSIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLE  1159
              AFG+ +  ++RAS   S+  G    IAPL+LESPIGQFL+QIL++HPHLV AAV+QQLE
Sbjct  57    EAFGNRRYTAVRASSSSSDRAGPPAQIAPLQLESPIGQFLSQILINHPHLVPAAVEQQLE  116

Query  1158  QLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDAD  979
             QLQTDR+ +K  E    EPS SGTD+VLYRRIAEVKANERRKALEEILYALVVQKFMDA+
Sbjct  117   QLQTDRDADKHKE----EPSVSGTDLVLYRRIAEVKANERRKALEEILYALVVQKFMDAN  172

Query  978   VPLVPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNANSSV-Q  802
             V LVP+I   S   S  +D  P +DE+L RLHSPEAYEMIQNHL+LILGNR   +++V Q
Sbjct  173   VSLVPSIAPASAEPSDPVDMWPRQDEKLERLHSPEAYEMIQNHLALILGNRVGDSTTVAQ  232

Query  801   INKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslr  622
             I+KLRVGQVYAASVMYGYFLKRVDQRFQLEK+MK+LP  +D+ D+               
Sbjct  233   ISKLRVGQVYAASVMYGYFLKRVDQRFQLEKSMKILPSAVDEGDNN--------------  278

Query  621   sspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKH  442
                     V+W  G + + GFG  +K SRLR+YVMSFDGETLQRYATIRSKEA++IIEKH
Sbjct  279   --------VAW-SGDVSAGGFGHGIKASRLRSYVMSFDGETLQRYATIRSKEAVSIIEKH  329

Query  441   TEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHF  262
             TEALFGRPEI ITPQGT+DSSKDELIKISF  L+RLVLEAVTFGSFLWDVES VDSRYHF
Sbjct  330   TEALFGRPEIIITPQGTVDSSKDELIKISFGGLKRLVLEAVTFGSFLWDVESYVDSRYHF  389

Query  261   VAH  253
             V +
Sbjct  390   VTN  392



>ref|XP_002267281.3| PREDICTED: uncharacterized protein LOC100262899 [Vitis vinifera]
Length=443

 Score =   497 bits (1279),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 269/396 (68%), Positives = 313/396 (79%), Gaps = 12/396 (3%)
 Frame = -2

Query  1428  FTTDAPGFVKFGSKALLSAPSIKVKLGNRRVAFGSTKCNSIRASLPLSNSGGSAMPIAPL  1249
             F  +    V+F ++    +  + +K G+R +AFG  KC  +RAS   ++S GSA PIAPL
Sbjct  52    FNVNRSNSVRFPTQFRFFSGWLNLKSGHRNMAFGCKKCTIVRASA-SADSSGSAAPIAPL  110

Query  1248  KLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYR  1069
             +LESPIGQFL+QIL+SHPHLV AAV+QQLEQLQTDR+ E+  E    E SASGT++VLYR
Sbjct  111   QLESPIGQFLSQILISHPHLVPAAVEQQLEQLQTDRDAEEHKE----ESSASGTELVLYR  166

Query  1068  RIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPSKDEQLAR  889
             RIAEVKANER+KALEEILYALVVQKFMDA+V L+P I+S S +SS  +DT PS+D +L +
Sbjct  167   RIAEVKANERKKALEEILYALVVQKFMDANVSLIPTISSSSSDSSDRVDTWPSQDGKLEQ  226

Query  888   LHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFLKRVDQRFQLE  712
             LHSPEAYEMIQNHL+LILGNR   ++SV QI+KLRVGQVYAASVMYGYFLKRVDQRFQLE
Sbjct  227   LHSPEAYEMIQNHLALILGNRLGDSTSVAQISKLRVGQVYAASVMYGYFLKRVDQRFQLE  286

Query  711   KNMKVLPQGLDKEDSGIQQVGGDssd-----tslrsspSHPEVVSWPDGGMGSRGFGTEM  547
             K MK+LP  LD +   +Q+   D         S+++  SHPEV SW  GG    GFG  +
Sbjct  287   KTMKILPHALDGDKGSVQEALWDKMTPSGSDDSVQTVKSHPEVSSWA-GGFTPGGFGHGI  345

Query  546   KPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDEL  367
             KPSRLR YVMSFD ETLQRYATIRSKEA++IIEKHTEALFGRPEI ITPQGTIDSSKDEL
Sbjct  346   KPSRLRNYVMSFDAETLQRYATIRSKEAVSIIEKHTEALFGRPEIIITPQGTIDSSKDEL  405

Query  366   IKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  259
             IKISF  L+RLVLEAVTFGSFLWDVES VDSRYHFV
Sbjct  406   IKISFGGLKRLVLEAVTFGSFLWDVESFVDSRYHFV  441



>ref|XP_002317709.1| hypothetical protein POPTR_0012s03930g [Populus trichocarpa]
 ref|XP_006376704.1| hypothetical protein POPTR_0012s03930g [Populus trichocarpa]
 gb|ABK95039.1| unknown [Populus trichocarpa]
 gb|EEE95929.1| hypothetical protein POPTR_0012s03930g [Populus trichocarpa]
 gb|ERP54501.1| hypothetical protein POPTR_0012s03930g [Populus trichocarpa]
Length=401

 Score =   494 bits (1273),  Expect = 5e-168, Method: Compositional matrix adjust.
 Identities = 268/419 (64%), Positives = 314/419 (75%), Gaps = 26/419 (6%)
 Frame = -2

Query  1497  MEMTTSLRSSITVG-CGPVKSGRR---FTTDAPGFVKFGSKALLSAPSIKVKLGNRRVAF  1330
             ME  T+     ++G C P KS  R     T    FV+F  K   S      K G+RRVA+
Sbjct  1     MEAATATFIGSSIGICRPAKSVARSGFLATIGQDFVRFPHKHCSSVS--YSKPGHRRVAY  58

Query  1329  GSTKCNSIRASLPLSNSGGSAMP-IAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQL  1153
             GS +C  +RASL  S+    ++  IAPL+LESP+GQFL+QIL+SHPHLV AAV+QQLEQL
Sbjct  59    GSRRCMGVRASLSSSSDSSGSIASIAPLQLESPVGQFLSQILISHPHLVPAAVEQQLEQL  118

Query  1152  QTDRNLEKQNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVP  973
             QTDR+ EKQ E    EPSA+ TD+VLYR+IAEVKANERRKALEEILYALVVQKFMDA+V 
Sbjct  119   QTDRDAEKQKE----EPSATSTDLVLYRKIAEVKANERRKALEEILYALVVQKFMDANVS  174

Query  972   LVPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNANSSV-QIN  796
             L+  + S S + SG +DT PS+DE+L RLHSPEAY+MIQNHL+LILGNR   +++V QIN
Sbjct  175   LISTMASSSTDPSGGVDTRPSQDEKLERLHSPEAYDMIQNHLALILGNRMGDSTAVAQIN  234

Query  795   KLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrss  616
             KLR GQVYAASVMYGYFLKRVDQRFQLEK MK+LP  +D+ ++ I++V            
Sbjct  235   KLRAGQVYAASVMYGYFLKRVDQRFQLEKTMKILPNAVDEGETDIRKV-----------V  283

Query  615   pSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTE  436
              SHPE  S    G+   G G  +K SRLR YVMSFDGETLQRYATIRSKEA+++IEKHTE
Sbjct  284   SSHPEAFS---DGVSPGGLGHGLKASRLRNYVMSFDGETLQRYATIRSKEAVSLIEKHTE  340

Query  435   ALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  259
             ALFGRPEI I  QGTIDSSKDEL+KISF  L+RLVLEAVTFGSFLWDVES VDSRYHFV
Sbjct  341   ALFGRPEIVIALQGTIDSSKDELVKISFGGLKRLVLEAVTFGSFLWDVESYVDSRYHFV  399



>ref|XP_006374243.1| hypothetical protein POPTR_0015s05360g [Populus trichocarpa]
 ref|XP_006374244.1| hypothetical protein POPTR_0015s05360g [Populus trichocarpa]
 gb|ERP52040.1| hypothetical protein POPTR_0015s05360g [Populus trichocarpa]
 gb|ERP52041.1| hypothetical protein POPTR_0015s05360g [Populus trichocarpa]
Length=424

 Score =   495 bits (1275),  Expect = 6e-168, Method: Compositional matrix adjust.
 Identities = 268/419 (64%), Positives = 318/419 (76%), Gaps = 20/419 (5%)
 Frame = -2

Query  1497  MEMTTSLRSSITVGCG-PVKSGRRF---TTDAPGFVKFGSKALLSAPSIKVKLGNRRVAF  1330
             ME  T+     ++G   P KS  R     T+   FV F  K   S      KLG+RRVA+
Sbjct  1     MEAATATVIGSSIGISTPAKSVARLGFLATNKQDFVHFPIKRHSSVSY--SKLGHRRVAY  58

Query  1329  GSTKCNSIRASLPLSNSGGSAM-PIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQL  1153
             GS +C ++RAS   S+    ++ PIAPL+LESPIGQFL+QILVSHPHLV AAV+QQLEQL
Sbjct  59    GSRRCMAVRASSSSSSDSSGSIVPIAPLQLESPIGQFLSQILVSHPHLVPAAVEQQLEQL  118

Query  1152  QTDRNLEKQNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVP  973
             QTDR+    +EKQ ++PSA+GTD+VLYRRIAE KAN+RRKALEEILYALVVQKFMDA+V 
Sbjct  119   QTDRD----SEKQKEDPSATGTDLVLYRRIAEAKANDRRKALEEILYALVVQKFMDANVS  174

Query  972   LVPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNANSSV-QIN  796
             L+P I   S  SSG +DT PS+DE+L +LHSPEAYEMIQNHL+LILGNR   +++V QI+
Sbjct  175   LIPTIGPSSAESSGQVDTWPSQDEKLEQLHSPEAYEMIQNHLTLILGNRVGDSTAVAQIS  234

Query  795   KLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQ-VGGDss----dt  631
             KLR+GQVYAASVMYGYFLKRVDQRFQLEK MK+LP G+D+ +S I + VG D        
Sbjct  235   KLRIGQVYAASVMYGYFLKRVDQRFQLEKTMKILPNGVDETESDIHKAVGQDVKPGGRGL  294

Query  630   slrsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINII  451
             S ++  SHPE +S   GG+   GFG  +K SRLR YVMSFD ETLQRYATIRSKEA++II
Sbjct  295   SYQALSSHPEAIS---GGISPGGFGHGLKASRLRNYVMSFDAETLQRYATIRSKEAVSII  351

Query  450   EKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDS  274
             EKHTEALFGRPEI ITPQGTID+SKDE++ IS   L+RL LEAVTFGSFLWDVES VDS
Sbjct  352   EKHTEALFGRPEIVITPQGTIDTSKDEVVTISLGGLKRLALEAVTFGSFLWDVESYVDS  410



>ref|XP_008375019.1| PREDICTED: uncharacterized protein LOC103438262 isoform X2 [Malus 
domestica]
 ref|XP_008375020.1| PREDICTED: uncharacterized protein LOC103438262 isoform X2 [Malus 
domestica]
Length=428

 Score =   494 bits (1271),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 271/407 (67%), Positives = 315/407 (77%), Gaps = 22/407 (5%)
 Frame = -2

Query  1428  FTTDAPGFVKFGSKALLSAPS------IKVKLGNRRVAFGSTKCNSIRASLPLSNSGGSA  1267
              T   PGF++ G KA   +PS       + K+G+RR+ +G  +   +RA+   S+   + 
Sbjct  29    LTAHGPGFLRLGPKA--HSPSKHQFSICQPKVGHRRMGYGXRRGLVVRAAAASSSPDSAG  86

Query  1266  M--PIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSAS  1093
                PIAPLKLESPIGQFL+QI++SHPHLV +AVDQQL+ L TDR+ E++ E    EPSAS
Sbjct  87    SDSPIAPLKLESPIGQFLSQIMISHPHLVPSAVDQQLDLLLTDRDAEEKKE----EPSAS  142

Query  1092  GTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLP  913
             GTDIVLYRRIAEVKA ERRKALEEILY LVVQKFMDA+V LVPAIT  +   SG +D+ P
Sbjct  143   GTDIVLYRRIAEVKATERRKALEEILYTLVVQKFMDANVSLVPAITPTASYPSGQVDSWP  202

Query  912   SKDEQLARLHSPEAYEMIQNHLSLILGNR-SNANSSVQINKLRVGQVYAASVMYGYFLKR  736
             S++E+L +LHSPEAYEMIQNHLSLILGNR  ++ S  QI+KLRVGQVYAASVMYGYFLKR
Sbjct  203   SQNEKLEQLHSPEAYEMIQNHLSLILGNRLGDSTSLAQISKLRVGQVYAASVMYGYFLKR  262

Query  735   VDQRFQLEKNMKVLPQGLDKEDSGIQ-QVGGDs-----sdtslrsspSHPEVVSWPDGGM  574
             VDQRFQLEK MK+LP  +  EDS IQ  VG D       DT    + SHPEV SW  GG+
Sbjct  263   VDQRFQLEKTMKILPSAMGPEDSDIQTSVGQDMRPGGGEDTLQAGASSHPEVSSWA-GGI  321

Query  573   GSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQG  394
              S GFG  +KPSRLRTYVMSFDGETL RYATIRS+EA++IIEKHTEALFGRP+I ITPQG
Sbjct  322   SSGGFGNAIKPSRLRTYVMSFDGETLHRYATIRSREAVSIIEKHTEALFGRPDIVITPQG  381

Query  393   TIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFVAH  253
             T+DSSKD+ IKISF  LRRLVLEAVTFGSFLWDVES VDSRYHFVA+
Sbjct  382   TVDSSKDDHIKISFGGLRRLVLEAVTFGSFLWDVESYVDSRYHFVAN  428



>ref|XP_008240405.1| PREDICTED: uncharacterized protein LOC103338912 [Prunus mume]
Length=428

 Score =   494 bits (1271),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 269/400 (67%), Positives = 320/400 (80%), Gaps = 16/400 (4%)
 Frame = -2

Query  1428  FTTDAPGFVKFGSKALLSAPSIKVKLGNRRVAFGSTKCNSIRASL--PLSNSGGSAMPIA  1255
             F   +PGF  F  K   S    KV  G+RR+ FGS +C  +RA+   P  +S GS  PIA
Sbjct  37    FLRLSPGF-HFSIKHQFSISQPKV--GHRRMGFGSRRCLVVRAAAASPSPDSTGSTSPIA  93

Query  1254  PLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVL  1075
             PL+LESPIGQFL+QI++SHPHLV +AV+QQLEQLQTDR+ E++ E    EPSASGTD+VL
Sbjct  94    PLQLESPIGQFLSQIMISHPHLVPSAVEQQLEQLQTDRDTEQKQE----EPSASGTDLVL  149

Query  1074  YRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPSKDEQL  895
             YRRIAEVKA ERRKALEEILY LVVQKFMDA+V L+PA+T  + + SG +DT PS++++L
Sbjct  150   YRRIAEVKATERRKALEEILYTLVVQKFMDANVSLIPALTPSASDLSGRVDTWPSEEDKL  209

Query  894   ARLHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFLKRVDQRFQ  718
              +LHSPEAYEMIQNHL+LILGNR   ++S+ QI+KLRVGQVYAASVMYGYFLKRVDQRFQ
Sbjct  210   EQLHSPEAYEMIQNHLALILGNRLGDSASLAQISKLRVGQVYAASVMYGYFLKRVDQRFQ  269

Query  717   LEKNMKVLPQGLDKEDSGIQQ-VGGDs----sdtslrsspSHPEVVSWPDGGMGSRGFGT  553
             LEK +K+LP  L  EDS +Q+ VG D      + SL++  SHPEV S   GG+G+ GFG 
Sbjct  270   LEKTVKILPNALGAEDSNVQKSVGEDMRPGGEEESLQAGASHPEVTS-SAGGIGAGGFGN  328

Query  552   EMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKD  373
              +KPSRLRTYVMSFDGETL RYATIRS+EA++IIEKHTEALFGRP+I ITPQGT+DSSKD
Sbjct  329   GIKPSRLRTYVMSFDGETLHRYATIRSREAVSIIEKHTEALFGRPDIVITPQGTVDSSKD  388

Query  372   ELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFVAH  253
             + +KISF  LRRLVLEAVTFGSFLWDVES VDSRYHFV +
Sbjct  389   DHVKISFGGLRRLVLEAVTFGSFLWDVESYVDSRYHFVTN  428



>ref|XP_008375017.1| PREDICTED: uncharacterized protein LOC103438262 isoform X1 [Malus 
domestica]
 ref|XP_008375018.1| PREDICTED: uncharacterized protein LOC103438262 isoform X1 [Malus 
domestica]
Length=429

 Score =   493 bits (1269),  Expect = 5e-167, Method: Compositional matrix adjust.
 Identities = 271/408 (66%), Positives = 315/408 (77%), Gaps = 23/408 (6%)
 Frame = -2

Query  1428  FTTDAPGFVKFGSKALLSAPS-------IKVKLGNRRVAFGSTKCNSIRASLPLSNSGGS  1270
              T   PGF++ G KA   +PS        + K+G+RR+ +G  +   +RA+   S+   +
Sbjct  29    LTAHGPGFLRLGPKA--HSPSKQHQFSICQPKVGHRRMGYGXRRGLVVRAAAASSSPDSA  86

Query  1269  AM--PIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSA  1096
                 PIAPLKLESPIGQFL+QI++SHPHLV +AVDQQL+ L TDR+ E++ E    EPSA
Sbjct  87    GSDSPIAPLKLESPIGQFLSQIMISHPHLVPSAVDQQLDLLLTDRDAEEKKE----EPSA  142

Query  1095  SGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTL  916
             SGTDIVLYRRIAEVKA ERRKALEEILY LVVQKFMDA+V LVPAIT  +   SG +D+ 
Sbjct  143   SGTDIVLYRRIAEVKATERRKALEEILYTLVVQKFMDANVSLVPAITPTASYPSGQVDSW  202

Query  915   PSKDEQLARLHSPEAYEMIQNHLSLILGNR-SNANSSVQINKLRVGQVYAASVMYGYFLK  739
             PS++E+L +LHSPEAYEMIQNHLSLILGNR  ++ S  QI+KLRVGQVYAASVMYGYFLK
Sbjct  203   PSQNEKLEQLHSPEAYEMIQNHLSLILGNRLGDSTSLAQISKLRVGQVYAASVMYGYFLK  262

Query  738   RVDQRFQLEKNMKVLPQGLDKEDSGIQ-QVGGDs-----sdtslrsspSHPEVVSWPDGG  577
             RVDQRFQLEK MK+LP  +  EDS IQ  VG D       DT    + SHPEV SW  GG
Sbjct  263   RVDQRFQLEKTMKILPSAMGPEDSDIQTSVGQDMRPGGGEDTLQAGASSHPEVSSWA-GG  321

Query  576   MGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQ  397
             + S GFG  +KPSRLRTYVMSFDGETL RYATIRS+EA++IIEKHTEALFGRP+I ITPQ
Sbjct  322   ISSGGFGNAIKPSRLRTYVMSFDGETLHRYATIRSREAVSIIEKHTEALFGRPDIVITPQ  381

Query  396   GTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFVAH  253
             GT+DSSKD+ IKISF  LRRLVLEAVTFGSFLWDVES VDSRYHFVA+
Sbjct  382   GTVDSSKDDHIKISFGGLRRLVLEAVTFGSFLWDVESYVDSRYHFVAN  429



>ref|XP_008466989.1| PREDICTED: uncharacterized protein LOC103504355 [Cucumis melo]
Length=422

 Score =   493 bits (1268),  Expect = 7e-167, Method: Compositional matrix adjust.
 Identities = 262/397 (66%), Positives = 301/397 (76%), Gaps = 22/397 (6%)
 Frame = -2

Query  1410  GFVKFGSKALLSAPSIKV-------KLGNRRVAFGSTKCNSIRASLPLSNSGGSAMPIAP  1252
             GFV+F S   LS   I++       KL N+++  G  +   ++AS+  + S  S  PIAP
Sbjct  33    GFVRFPS---LSHVPIRLCPQVSYSKLWNKKLGTGIRRSTIVKASMD-AESSESGEPIAP  88

Query  1251  LKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLY  1072
             L+LESPIGQFLTQILVSHPHLV AAV+QQL+QLQ DR+ E      N+E S SGTD+VLY
Sbjct  89    LQLESPIGQFLTQILVSHPHLVPAAVEQQLDQLQNDRDAEG-----NNEASGSGTDLVLY  143

Query  1071  RRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPSKDEQLA  892
             RRIAEVKANER++ LEEILYALVVQKFMDA+VPL+PAIT  S + SG +DT  + DE L 
Sbjct  144   RRIAEVKANERKQVLEEILYALVVQKFMDANVPLIPAITPSSSDVSGRVDTWAANDESLE  203

Query  891   RLHSPEAYEMIQNHLSLILGNR-SNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQL  715
              LHSPEAYEMIQNHL+LILGNR  ++ S VQI+KLRVGQVYAASVMYGYFLKRVDQRFQL
Sbjct  204   HLHSPEAYEMIQNHLALILGNRVGDSTSVVQISKLRVGQVYAASVMYGYFLKRVDQRFQL  263

Query  714   EKNMKVLPQGLDKEDSGIQQVGGDssd----tslrsspSHPEVVSWPDGGMGS-RGFGTE  550
             EK MKVLP+  + EDS IQQ  G+        +      HPE+ SWPD    S  GF   
Sbjct  264   EKTMKVLPKASNSEDSIIQQAIGEDVRPYVGENSPPVSPHPEITSWPDRDENSIGGFSQG  323

Query  549   MKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDE  370
             +K SRLR YVM+FDGETLQRYATIRSKEA+ IIEKHTEALFGRPEI+ITPQGTID SKDE
Sbjct  324   LKASRLRNYVMAFDGETLQRYATIRSKEAVGIIEKHTEALFGRPEIAITPQGTIDPSKDE  383

Query  369   LIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  259
              +KISF  L+ LVLEAVTFGSFLWDVES VDSRYHFV
Sbjct  384   QLKISFGGLKGLVLEAVTFGSFLWDVESYVDSRYHFV  420



>ref|XP_012081284.1| PREDICTED: uncharacterized protein LOC105641369 isoform X2 [Jatropha 
curcas]
Length=430

 Score =   492 bits (1266),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 269/429 (63%), Positives = 320/429 (75%), Gaps = 32/429 (7%)
 Frame = -2

Query  1479  LRSSITVGCGPVKSGRR---FTTDAPGFVKFG-SKALLSAPSIKVKLG----NRRVAFGS  1324
             LRS+I + C P  S  R        P  ++F  S       S  V  G    N+RV FGS
Sbjct  10    LRSAIGI-CRPTSSVGRPLFLAASPPDSLRFSISYHFPVKHSYSVSYGKSGRNKRVGFGS  68

Query  1323  TKCNSIRASLPLSNSGGSAM-----PIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLE  1159
              +C  ++AS   S+S  S       PIAPL++ESPIGQFL+QIL+SHPHLV AAV+QQLE
Sbjct  69    RRCTVVKASSSSSSSPSSDSGGSLAPIAPLQMESPIGQFLSQILMSHPHLVPAAVEQQLE  128

Query  1158  QLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDAD  979
             QLQTDR+ +K+ E    EPS +GTD+VLYRRIAEVKANER+KALEEILYALVVQKFMDA+
Sbjct  129   QLQTDRDADKEKE----EPSVTGTDLVLYRRIAEVKANERKKALEEILYALVVQKFMDAN  184

Query  978   VPLVPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNANSSV-Q  802
             V L P I   S + S  +DT P +DE+L +LHSPEAYEMIQNHL+LILGN+   +++V Q
Sbjct  185   VSLTPTIAPSSADESDRVDTWPGQDEKLKQLHSPEAYEMIQNHLALILGNKIGDSTTVAQ  244

Query  801   INKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQV--------GG  646
             I+KLRVGQVYAASVMYGYFLKRVDQRFQLEK+MK+LP  +D+ED  +QQ         GG
Sbjct  245   ISKLRVGQVYAASVMYGYFLKRVDQRFQLEKSMKILPNVMDEEDDNLQQAAMQDMKSSGG  304

Query  645   DssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKE  466
             + +  ++ S   HPE +S   GG+   GFG  ++ SRLR+YVMSFDGETLQRYATIRSKE
Sbjct  305   EDAFEAMSS---HPEGLS--AGGISPGGFGHGVRASRLRSYVMSFDGETLQRYATIRSKE  359

Query  465   AINIIEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVES  286
             A++IIEKHTEALFGRPEI ITPQGT+DSSKDEL+KISF  L+RLVLEAVTFGSFLWDVES
Sbjct  360   AVSIIEKHTEALFGRPEIVITPQGTVDSSKDELMKISFGGLKRLVLEAVTFGSFLWDVES  419

Query  285   SVDSRYHFV  259
              VDSRYHFV
Sbjct  420   YVDSRYHFV  428



>ref|XP_007209930.1| hypothetical protein PRUPE_ppa004570mg [Prunus persica]
 gb|EMJ11129.1| hypothetical protein PRUPE_ppa004570mg [Prunus persica]
Length=502

 Score =   494 bits (1271),  Expect = 4e-166, Method: Compositional matrix adjust.
 Identities = 263/400 (66%), Positives = 313/400 (78%), Gaps = 16/400 (4%)
 Frame = -2

Query  1428  FTTDAPGFVKFGSKALLSAPSIKVKLGNRRVAFGSTKCNSIRASL--PLSNSGGSAMPIA  1255
             F   +PGF  F  K   S    KV  G+ R+ FGS +C  +RA+   P  +S GS  PIA
Sbjct  111   FLRLSPGF-HFSIKHQFSISQPKV--GHWRMGFGSRRCLVVRAAAASPSPDSTGSTSPIA  167

Query  1254  PLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVL  1075
             PL+LESPIGQFL+QI++SHPHLV +AV+QQLEQLQTDR+ E++ E    EPSASGTD+VL
Sbjct  168   PLQLESPIGQFLSQIMISHPHLVPSAVEQQLEQLQTDRDTEQKQE----EPSASGTDLVL  223

Query  1074  YRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPSKDEQL  895
             YRRIAEVKA ERRKALEEILY LVVQKFMDA+V L+PA+T  + + SG +DT PS++++L
Sbjct  224   YRRIAEVKATERRKALEEILYTLVVQKFMDANVSLIPALTPSASDLSGRVDTWPSEEDKL  283

Query  894   ARLHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFLKRVDQRFQ  718
              +LHSPEAYEMIQNHL+LILG+R   ++S+ QI+KLRVGQVYAASVMYGYFLKRVDQRFQ
Sbjct  284   EQLHSPEAYEMIQNHLALILGSRLGDSASLAQISKLRVGQVYAASVMYGYFLKRVDQRFQ  343

Query  717   LEKNMKVLPQGLDKEDSGIQQ-VGGDs----sdtslrsspSHPEVVSWPDGGMGSRGFGT  553
             LEK +K+LP  L  EDS +Q+ VG D      + SL++  SHPEV SW  G         
Sbjct  344   LEKTVKILPNALGAEDSNVQKSVGEDMRPGGEEESLQAGASHPEVTSWGGGISPGGFGNG  403

Query  552   EMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKD  373
              +KPSRLRTYVMSFDGETL RYATIRS+EA++IIEKHTEALFGRP+I ITPQGT+DSSKD
Sbjct  404   -IKPSRLRTYVMSFDGETLHRYATIRSREAVSIIEKHTEALFGRPDIVITPQGTVDSSKD  462

Query  372   ELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFVAH  253
             + +KISF  LRRLVLEAVTFGSFLWDVES VDSRYHFV +
Sbjct  463   DHVKISFGGLRRLVLEAVTFGSFLWDVESYVDSRYHFVTN  502



>ref|XP_012081283.1| PREDICTED: uncharacterized protein LOC105641369 isoform X1 [Jatropha 
curcas]
 gb|KDP30111.1| hypothetical protein JCGZ_18399 [Jatropha curcas]
Length=431

 Score =   491 bits (1264),  Expect = 4e-166, Method: Compositional matrix adjust.
 Identities = 255/377 (68%), Positives = 302/377 (80%), Gaps = 23/377 (6%)
 Frame = -2

Query  1347  NRRVAFGSTKCNSIRASLPLSNSGGSAM-----PIAPLKLESPIGQFLTQILVSHPHLVS  1183
             N+RV FGS +C  ++AS   S+S  S       PIAPL++ESPIGQFL+QIL+SHPHLV 
Sbjct  62    NKRVGFGSRRCTVVKASSSSSSSPSSDSGGSLAPIAPLQMESPIGQFLSQILMSHPHLVP  121

Query  1182  AAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEEILYALV  1003
             AAV+QQLEQLQTDR+ +K+ E    EPS +GTD+VLYRRIAEVKANER+KALEEILYALV
Sbjct  122   AAVEQQLEQLQTDRDADKEKE----EPSVTGTDLVLYRRIAEVKANERKKALEEILYALV  177

Query  1002  VQKFMDADVPLVPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRS  823
             VQKFMDA+V L P I   S + S  +DT P +DE+L +LHSPEAYEMIQNHL+LILGN+ 
Sbjct  178   VQKFMDANVSLTPTIAPSSADESDRVDTWPGQDEKLKQLHSPEAYEMIQNHLALILGNKI  237

Query  822   NANSSV-QINKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQV--  652
               +++V QI+KLRVGQVYAASVMYGYFLKRVDQRFQLEK+MK+LP  +D+ED  +QQ   
Sbjct  238   GDSTTVAQISKLRVGQVYAASVMYGYFLKRVDQRFQLEKSMKILPNVMDEEDDNLQQAAM  297

Query  651   ------GGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQR  490
                   GG+ +  ++ S   HPE +S   GG+   GFG  ++ SRLR+YVMSFDGETLQR
Sbjct  298   QDMKSSGGEDAFEAMSS---HPEGLSA--GGISPGGFGHGVRASRLRSYVMSFDGETLQR  352

Query  489   YATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFG  310
             YATIRSKEA++IIEKHTEALFGRPEI ITPQGT+DSSKDEL+KISF  L+RLVLEAVTFG
Sbjct  353   YATIRSKEAVSIIEKHTEALFGRPEIVITPQGTVDSSKDELMKISFGGLKRLVLEAVTFG  412

Query  309   SFLWDVESSVDSRYHFV  259
             SFLWDVES VDSRYHFV
Sbjct  413   SFLWDVESYVDSRYHFV  429



>gb|KHG11329.1| Alanine--tRNA ligase [Gossypium arboreum]
 gb|KHG12308.1| Alanine--tRNA ligase [Gossypium arboreum]
Length=428

 Score =   488 bits (1257),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 252/352 (72%), Positives = 295/352 (84%), Gaps = 15/352 (4%)
 Frame = -2

Query  1287  SNSGGSAMP---IAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEK  1117
             S+S  SA P   IAPL++ESPIGQFL+QIL+SHPHLV AAV+QQLEQLQ+DR+ +++ E 
Sbjct  81    SSSPDSAEPNAQIAPLRMESPIGQFLSQILISHPHLVPAAVEQQLEQLQSDRDTDEKKE-  139

Query  1116  QNDEPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNS  937
                EPSASGTD+VLYRRIAEVKANER++ALEEILYALVVQKFMDA++ LVPAITS S + 
Sbjct  140   ---EPSASGTDLVLYRRIAEVKANERKRALEEILYALVVQKFMDANISLVPAITS-SADP  195

Query  936   SGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASV  760
             SG +DT PS++++L +LHS EA+EMIQNHL+LILGNR   ++SV QI+KLRVGQVYAASV
Sbjct  196   SGRVDTWPSQEDKLEQLHSAEAHEMIQNHLALILGNRLGDSTSVAQISKLRVGQVYAASV  255

Query  759   MYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssd-----tslrsspSHPEVV  595
             MYGYFL+RVDQRFQLEK MKVLP   D + S I+Q  GD +       S +++ SH EV 
Sbjct  256   MYGYFLRRVDQRFQLEKTMKVLPSASDGDKSSIEQTVGDDTRPSGLGDSYQAASSHAEVS  315

Query  594   SWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPE  415
             SW  GG+   GFG+ +KPSRLRTYVMSFDGETLQRYA+IRSKEA+ IIEKHTEALFGRPE
Sbjct  316   SW-SGGISPGGFGSGIKPSRLRTYVMSFDGETLQRYASIRSKEAVGIIEKHTEALFGRPE  374

Query  414   ISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  259
             I+ITPQGT+DSS DELIKISF  L+RLVLEAVTFGSFLWDVES VDSRYHFV
Sbjct  375   IAITPQGTVDSSNDELIKISFGGLKRLVLEAVTFGSFLWDVESFVDSRYHFV  426



>ref|XP_004137518.1| PREDICTED: uncharacterized protein LOC101203627 [Cucumis sativus]
Length=422

 Score =   487 bits (1254),  Expect = 8e-165, Method: Compositional matrix adjust.
 Identities = 268/425 (63%), Positives = 308/425 (72%), Gaps = 23/425 (5%)
 Frame = -2

Query  1491  MTTSLRSSITVGCGPVKSGR-RFTTDAPGFVKFGSKALLSAPSIKV-------KLGNRRV  1336
             M T + S + V      SGR     +  GFV+F S   LS   I++       KL N+++
Sbjct  5     MATVIGSPVGVFARLNSSGRSEIFGNGLGFVRFPS---LSHVPIRLCPQVSYSKLWNKKL  61

Query  1335  AFGSTKCNSIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQ  1156
               G  +   ++AS+  + S  S  PIAPL+LESPIGQFLTQILVSHPHLV AAV+QQL+Q
Sbjct  62    GTGIRRSTIVKASMD-AESSESDEPIAPLQLESPIGQFLTQILVSHPHLVPAAVEQQLDQ  120

Query  1155  LQTDRNLEKQNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADV  976
             LQ DR+ E      N E S SGTD+VLYRRIAEVKANER++ LEEILYALVVQKFMDA+V
Sbjct  121   LQNDRDAEG-----NKEASGSGTDLVLYRRIAEVKANERKQVLEEILYALVVQKFMDANV  175

Query  975   PLVPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNR-SNANSSVQI  799
             PL+PAIT  S + SG +DT  + DE L  LHSPEAYEMIQNHLSLILGNR S++ S VQI
Sbjct  176   PLIPAITPSSSDVSGRVDTWAANDENLEHLHSPEAYEMIQNHLSLILGNRVSDSTSVVQI  235

Query  798   NKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssd----t  631
             +KLRVGQVYAASVMYGYFLKRVDQRFQLEK +KVLP+  + EDS IQQ  G+        
Sbjct  236   SKLRVGQVYAASVMYGYFLKRVDQRFQLEKTVKVLPKASNSEDSIIQQAIGEDVRPYVGE  295

Query  630   slrsspSHPEVVSWPDGGMGS-RGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINI  454
             +      HPE+ SWPD    S  G    +K SRLR YVM+FDGETLQRYATIRSKEA+ I
Sbjct  296   NSPPVSPHPEIASWPDHDENSFGGVSQSVKASRLRNYVMAFDGETLQRYATIRSKEAVGI  355

Query  453   IEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDS  274
             IEKHTEALFGR EI ITPQGTID SKDE +KISF  L+ LVLEAVTFGSFLWDVES VDS
Sbjct  356   IEKHTEALFGRAEIVITPQGTIDPSKDEQLKISFGGLKGLVLEAVTFGSFLWDVESYVDS  415

Query  273   RYHFV  259
             RYHFV
Sbjct  416   RYHFV  420



>ref|XP_006374245.1| hypothetical protein POPTR_0015s05360g [Populus trichocarpa]
 gb|ERP52042.1| hypothetical protein POPTR_0015s05360g [Populus trichocarpa]
Length=354

 Score =   484 bits (1247),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 245/342 (72%), Positives = 284/342 (83%), Gaps = 13/342 (4%)
 Frame = -2

Query  1266  MPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGT  1087
             +PIAPL+LESPIGQFL+QILVSHPHLV AAV+QQLEQLQTDR+    +EKQ ++PSA+GT
Sbjct  18    VPIAPLQLESPIGQFLSQILVSHPHLVPAAVEQQLEQLQTDRD----SEKQKEDPSATGT  73

Query  1086  DIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPSK  907
             D+VLYRRIAE KAN+RRKALEEILYALVVQKFMDA+V L+P I   S  SSG +DT PS+
Sbjct  74    DLVLYRRIAEAKANDRRKALEEILYALVVQKFMDANVSLIPTIGPSSAESSGQVDTWPSQ  133

Query  906   DEQLARLHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFLKRVD  730
             DE+L +LHSPEAYEMIQNHL+LILGNR   +++V QI+KLR+GQVYAASVMYGYFLKRVD
Sbjct  134   DEKLEQLHSPEAYEMIQNHLTLILGNRVGDSTAVAQISKLRIGQVYAASVMYGYFLKRVD  193

Query  729   QRFQLEKNMKVLPQGLDKEDSGIQQ-VGGDss----dtslrsspSHPEVVSWPDGGMGSR  565
             QRFQLEK MK+LP G+D+ +S I + VG D        S ++  SHPE +S   GG+   
Sbjct  194   QRFQLEKTMKILPNGVDETESDIHKAVGQDVKPGGRGLSYQALSSHPEAIS---GGISPG  250

Query  564   GFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTID  385
             GFG  +K SRLR YVMSFD ETLQRYATIRSKEA++IIEKHTEALFGRPEI ITPQGTID
Sbjct  251   GFGHGLKASRLRNYVMSFDAETLQRYATIRSKEAVSIIEKHTEALFGRPEIVITPQGTID  310

Query  384   SSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  259
             +SKDE++ IS   L+RL LEAVTFGSFLWDVES VDSRYHFV
Sbjct  311   TSKDEVVTISLGGLKRLALEAVTFGSFLWDVESYVDSRYHFV  352



>ref|XP_011003767.1| PREDICTED: uncharacterized protein LOC105110429 [Populus euphratica]
Length=401

 Score =   486 bits (1250),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 263/419 (63%), Positives = 312/419 (74%), Gaps = 26/419 (6%)
 Frame = -2

Query  1497  MEMTTSLRSSITVGCG-PVKSGRR---FTTDAPGFVKFGSKALLSAPSIKVKLGNRRVAF  1330
             ME  T+     ++G   P K   R      +   FV+F  K   S      K G+RRVA+
Sbjct  1     MEAATATFIGSSIGISRPAKYVARSGFLAANGQDFVRFPHKHYSSVS--YSKPGHRRVAY  58

Query  1329  GSTKCNSIRASLPLSNSGGSAMP-IAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQL  1153
             GS +C  +RASL  S+    ++  IAPL+LESP+GQFL+QIL+SHPHLV AAV+QQLEQL
Sbjct  59    GSRRCMGVRASLSSSSDSSGSIASIAPLQLESPVGQFLSQILISHPHLVPAAVEQQLEQL  118

Query  1152  QTDRNLEKQNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVP  973
             QTDR+ EKQ E    EPSA+ TD+VLYR+IAEVKANERRKALEEILYALVVQKFMDA++ 
Sbjct  119   QTDRDAEKQKE----EPSATSTDLVLYRKIAEVKANERRKALEEILYALVVQKFMDANIS  174

Query  972   LVPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNANSSV-QIN  796
             L+  I S S++ SG ++T PS+DE+L RLHSPEAY+MIQNHL+LILGNR   +++V QIN
Sbjct  175   LISTIASSSKDPSGGLNTRPSQDEKLERLHSPEAYDMIQNHLALILGNRMGDSTAVAQIN  234

Query  795   KLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrss  616
             KLR GQVYAASVMYGYFLKRVDQRFQLEK MK+LP  +D+ ++ I++V            
Sbjct  235   KLRAGQVYAASVMYGYFLKRVDQRFQLEKTMKILPNAVDEGETDIRKV-----------V  283

Query  615   pSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTE  436
              SHPE  S    G+   G G  +K SRLR YVMSFDGETLQRYATIRSKEA+++IEKHTE
Sbjct  284   SSHPEAFS---DGISPGGSGHGLKASRLRNYVMSFDGETLQRYATIRSKEAVSLIEKHTE  340

Query  435   ALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  259
             ALFGRPEI I  QGT DSSKDEL+KISF  L+RLVLEAVTFGSFLWDVES VDSRYHFV
Sbjct  341   ALFGRPEIVIALQGTTDSSKDELVKISFGGLKRLVLEAVTFGSFLWDVESYVDSRYHFV  399



>ref|XP_010271178.1| PREDICTED: uncharacterized protein LOC104607271 [Nelumbo nucifera]
Length=424

 Score =   484 bits (1247),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 274/433 (63%), Positives = 311/433 (72%), Gaps = 27/433 (6%)
 Frame = -2

Query  1497  MEMTTSLRSSITVGCGP---VKSGRRFTTDAPGFVKFGSKALLSAPSIK-------VKLG  1348
             ME    LRSS  +G  P    KSG   T  AP FV   SK   S   IK        K  
Sbjct  1     MEAVAVLRSSSGIGKHPDFVAKSGV-LTASAPHFVCLSSKLRFSNVWIKHSPSTYLSKQR  59

Query  1347  NRRVAFGSTKCNSIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQ  1168
               R    S K   +RAS    +S  SA PIAPL+LESP+GQFL QIL SHPHLV AAVDQ
Sbjct  60    QSRSVSRSRKSTIVRASAS-QDSTESAAPIAPLQLESPVGQFLAQILRSHPHLVPAAVDQ  118

Query  1167  QLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFM  988
              LEQLQT R+ EKQ E    EP++SGTD+VLYRRIAEVKANERRKALEEILYAL+VQKFM
Sbjct  119   HLEQLQTSRDAEKQKE----EPASSGTDLVLYRRIAEVKANERRKALEEILYALIVQKFM  174

Query  987   DADVPLVPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNANSS  808
             DA+V L+P I S   + SG +DT P ++++L +LHS EAYEMIQNHL+LILGNR   +S+
Sbjct  175   DANVSLIPTILS--SDPSGPVDTWPDQEKKLEQLHSTEAYEMIQNHLALILGNRVADSST  232

Query  807   V-QINKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGD----  643
             + QI+KLRVGQVYAASVMYGYFLKRVDQRFQLEK MK+LP   D+E    Q V G     
Sbjct  233   IAQISKLRVGQVYAASVMYGYFLKRVDQRFQLEKTMKILPYASDEESDTEQAVAGQMNPS  292

Query  642   ---ssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRS  472
                SS+ S  +  +HPEV S P G   S GFG  +K SRLRTYVMSFD +TLQRYATIRS
Sbjct  293   GNKSSEASSHAEQTHPEVSSSP-GNFSSGGFGYGVKSSRLRTYVMSFDADTLQRYATIRS  351

Query  471   KEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDV  292
             KE ++IIEKHTEALFGRPEI ITPQGT+DSSKDE I+ISF  L+RLVLEAVTFGSFLWDV
Sbjct  352   KEGVSIIEKHTEALFGRPEIVITPQGTVDSSKDEQIRISFGGLKRLVLEAVTFGSFLWDV  411

Query  291   ESSVDSRYHFVAH  253
             ES VD RYHFVA+
Sbjct  412   ESYVDLRYHFVAN  424



>ref|XP_008798412.1| PREDICTED: uncharacterized protein LOC103713309 [Phoenix dactylifera]
 ref|XP_008798421.1| PREDICTED: uncharacterized protein LOC103713309 [Phoenix dactylifera]
Length=418

 Score =   483 bits (1243),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 264/395 (67%), Positives = 300/395 (76%), Gaps = 15/395 (4%)
 Frame = -2

Query  1413  PGFVKF------GSKALLSAPSIKV-KLGNRRVAFGSTKCNSIRASLPLSNSGGSAMPIA  1255
             P FV F       S+ L    SI V KLG R   FG  + + IRASL   NS  S+ PIA
Sbjct  31    PDFVSFDPRSHFSSRWLKGCRSISVRKLGQR--GFGDRRNSGIRASLSSPNSSESSSPIA  88

Query  1254  PLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVL  1075
             PL+LESPIGQFL+QIL+SHPHLV AAVDQQL+QLQTDR  EK  E    EPS SGTD+VL
Sbjct  89    PLQLESPIGQFLSQILISHPHLVPAAVDQQLDQLQTDREAEKNKE----EPSPSGTDLVL  144

Query  1074  YRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPSKDEQL  895
             YRRIAEVKA ERR+ALEEILYALVVQKFM+ADV LVP + S S + S  +D  P ++E++
Sbjct  145   YRRIAEVKAKERRRALEEILYALVVQKFMEADVSLVPTL-SQSTDPSERVDQWPPEEEKI  203

Query  894   ARLHSPEAYEMIQNHLSLILGNR-SNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQ  718
              RLHSP+AYEMI+NHL+LILG R  ++NS   I+KLRVGQVYAASVMYGYFLKRVDQRFQ
Sbjct  204   ERLHSPDAYEMIKNHLALILGQRLGDSNSVAPISKLRVGQVYAASVMYGYFLKRVDQRFQ  263

Query  717   LEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPS  538
             LEK+MK LP G D+E+  I+Q   D S  S +   SHPE            GFG  +KP 
Sbjct  264   LEKSMKSLPWGTDEEEDAIKQAMPDESRPSAQIGNSHPEASLGSSPSFSQGGFGHNVKPC  323

Query  537   RLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKI  358
             RLR+YVMSFD ETLQRYAT+RSKEA +IIEKHTEALFGRPEI ITPQGTIDSSKDELIKI
Sbjct  324   RLRSYVMSFDSETLQRYATVRSKEAFSIIEKHTEALFGRPEIVITPQGTIDSSKDELIKI  383

Query  357   SFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFVAH  253
             SF+ LRRL+LEAVTFGSFLWDVES VDSRYHFV +
Sbjct  384   SFAGLRRLILEAVTFGSFLWDVESYVDSRYHFVTN  418



>gb|KGN64195.1| hypothetical protein Csa_1G042990 [Cucumis sativus]
Length=588

 Score =   487 bits (1253),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 268/426 (63%), Positives = 308/426 (72%), Gaps = 23/426 (5%)
 Frame = -2

Query  1491  MTTSLRSSITVGCGPVKSGR-RFTTDAPGFVKFGSKALLSAPSIKV-------KLGNRRV  1336
             M T + S + V      SGR     +  GFV+F S   LS   I++       KL N+++
Sbjct  171   MATVIGSPVGVFARLNSSGRSEIFGNGLGFVRFPS---LSHVPIRLCPQVSYSKLWNKKL  227

Query  1335  AFGSTKCNSIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQ  1156
               G  +   ++AS+  + S  S  PIAPL+LESPIGQFLTQILVSHPHLV AAV+QQL+Q
Sbjct  228   GTGIRRSTIVKASMD-AESSESDEPIAPLQLESPIGQFLTQILVSHPHLVPAAVEQQLDQ  286

Query  1155  LQTDRNLEKQNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADV  976
             LQ DR+ E      N E S SGTD+VLYRRIAEVKANER++ LEEILYALVVQKFMDA+V
Sbjct  287   LQNDRDAEG-----NKEASGSGTDLVLYRRIAEVKANERKQVLEEILYALVVQKFMDANV  341

Query  975   PLVPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNR-SNANSSVQI  799
             PL+PAIT  S + SG +DT  + DE L  LHSPEAYEMIQNHLSLILGNR S++ S VQI
Sbjct  342   PLIPAITPSSSDVSGRVDTWAANDENLEHLHSPEAYEMIQNHLSLILGNRVSDSTSVVQI  401

Query  798   NKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrs  619
             +KLRVGQVYAASVMYGYFLKRVDQRFQLEK +KVLP+  + EDS IQQ  G+     +  
Sbjct  402   SKLRVGQVYAASVMYGYFLKRVDQRFQLEKTVKVLPKASNSEDSIIQQAIGEDVRPYVGE  461

Query  618   ----spSHPEVVSWPDGGMGSRG-FGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINI  454
                    HPE+ SWPD    S G     +K SRLR YVM+FDGETLQRYATIRSKEA+ I
Sbjct  462   NSPPVSPHPEIASWPDHDENSFGGVSQSVKASRLRNYVMAFDGETLQRYATIRSKEAVGI  521

Query  453   IEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDS  274
             IEKHTEALFGR EI ITPQGTID SKDE +KISF  L+ LVLEAVTFGSFLWDVES VDS
Sbjct  522   IEKHTEALFGRAEIVITPQGTIDPSKDEQLKISFGGLKGLVLEAVTFGSFLWDVESYVDS  581

Query  273   RYHFVA  256
             RYHFV 
Sbjct  582   RYHFVV  587



>ref|XP_002894114.1| hypothetical protein ARALYDRAFT_473985 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70373.1| hypothetical protein ARALYDRAFT_473985 [Arabidopsis lyrata subsp. 
lyrata]
Length=426

 Score =   478 bits (1231),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 257/412 (62%), Positives = 315/412 (76%), Gaps = 24/412 (6%)
 Frame = -2

Query  1440  SGRR--FTTDAPGFVKFGSKALLSAPSIKVKLGNRRVAF------GSTKCNSIRASLPLS  1285
             SGR    T + PGF++FGS+       +KV+L N  + F      G+T   S R+ +  +
Sbjct  19    SGRSILLTPNCPGFMRFGSRPQFR---LKVRLQNSSLKFSRPLQSGTTCAKSRRSFVVKA  75

Query  1284  NSGGSAM--PIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQN  1111
             ++ G A    IAPL+L+SP+GQFL+QILVSHPHLV AAV+QQLEQLQ DR+ E+Q++   
Sbjct  76    SASGDASTDSIAPLQLKSPVGQFLSQILVSHPHLVPAAVEQQLEQLQIDRDSEEQSK---  132

Query  1110  DEPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSG  931
             D  S  GTDIVLYRRIAEVK  ERR+ALEEILYALVVQKFMDA+V LVP+ITS S + SG
Sbjct  133   DASSVPGTDIVLYRRIAEVKEKERRRALEEILYALVVQKFMDANVSLVPSITSSSADPSG  192

Query  930   SIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMY  754
              +DT P+ D +L RLHSPE YEMIQNHLS+IL NR++  ++V QI+KL VGQVYAASVMY
Sbjct  193   RVDTWPTLDGELERLHSPEVYEMIQNHLSIILKNRTDDLTAVAQISKLGVGQVYAASVMY  252

Query  753   GYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDs-------sdtslrsspSHPEVV  595
             GYFLKR+DQRFQLEK+M++LP G  + ++ I+Q G ++       ++ + ++  S+ EV 
Sbjct  253   GYFLKRIDQRFQLEKSMRILPGGSYEGETSIEQAGRETERSFYEEAEETYQAVSSNQEVG  312

Query  594   SWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPE  415
             S+  G   S GF ++MK SRL+TYVMSFDGETLQRYATIRS+EA+ IIEKHTEALFGRPE
Sbjct  313   SFVGGINASGGFSSDMKQSRLKTYVMSFDGETLQRYATIRSREAVGIIEKHTEALFGRPE  372

Query  414   ISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  259
             I ITPQGTIDSSKDE IKISF  L+RLVLEAVTFGSFLWDVES VDSRYHFV
Sbjct  373   IVITPQGTIDSSKDEHIKISFKGLKRLVLEAVTFGSFLWDVESHVDSRYHFV  424



>ref|XP_009414789.1| PREDICTED: uncharacterized protein LOC103995816 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=416

 Score =   478 bits (1230),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 257/384 (67%), Positives = 295/384 (77%), Gaps = 10/384 (3%)
 Frame = -2

Query  1401  KFGSKALLSAPSIKVKLGNRRVAFGSTKCNSIRASLPLSNSGGSAMPIAPLKLESPIGQF  1222
             ++ +  L S  SI +    RR+ FG+ +   +RAS   S+S  S++PIAPL+LESPIGQF
Sbjct  42    RYSTLWLKSDSSISLSKQGRRL-FGARRSIGVRAS---SSSSESSLPIAPLQLESPIGQF  97

Query  1221  LTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIAEVKANE  1042
             L+QILVSHPHL+ AAVDQQLEQLQTDR  EK  E    EP+ SGTDIVLYRRIAEVKANE
Sbjct  98    LSQILVSHPHLLPAAVDQQLEQLQTDREAEKNKE----EPAPSGTDIVLYRRIAEVKANE  153

Query  1041  RRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEM  862
             RR ALEEILYALV+QKF++ADV LVPAI S S + S  +D  P +DE+L RLHSPEAYEM
Sbjct  154   RRTALEEILYALVIQKFVEADVSLVPAI-SQSTDPSSRVDHWPPQDEKLERLHSPEAYEM  212

Query  861   IQNHLSLILGNR-SNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQG  685
             I+NHL+LILG R S++NS   I+KLR+GQVYAASVMYGYFLKRVDQRFQLEK+MK LP G
Sbjct  213   IKNHLALILGQRLSDSNSVAPISKLRIGQVYAASVMYGYFLKRVDQRFQLEKSMKTLPWG  272

Query  684   LDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDG  505
              DKE+  I+Q   D S     S  S+PE+ SW   G      G   K S LR+YVMSFD 
Sbjct  273   SDKEEIAIKQAMPDESRPFTESRISNPELPSWSSPGFNKGAVGNGAKSSLLRSYVMSFDS  332

Query  504   ETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLE  325
             +TLQRY TIRSKEA  IIEKHTEALFGRPEI ITPQGTIDSSKDELIKISF  LRRL+LE
Sbjct  333   DTLQRYVTIRSKEAFTIIEKHTEALFGRPEIVITPQGTIDSSKDELIKISFGGLRRLILE  392

Query  324   AVTFGSFLWDVESSVDSRYHFVAH  253
             A+TFGSFLWDVE  VDSRYHFV +
Sbjct  393   AITFGSFLWDVEGYVDSRYHFVTN  416



>ref|XP_010936872.1| PREDICTED: uncharacterized protein LOC105056391 [Elaeis guineensis]
Length=418

 Score =   478 bits (1229),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 259/395 (66%), Positives = 296/395 (75%), Gaps = 15/395 (4%)
 Frame = -2

Query  1413  PGFVKFGSKALLSAPSIK-------VKLGNRRVAFGSTKCNSIRASLPLSNSGGSAMPIA  1255
             P FV F  K+   +  +K        KLG R   F   +   IRASL   NS  S+ PIA
Sbjct  31    PDFVSFDPKSHFRSRWLKGCRPISVRKLGQR--GFSDRRNTGIRASLSSPNSSESSSPIA  88

Query  1254  PLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVL  1075
             PL+LESPIGQFL+QIL+SHPHLV AAVDQQLEQL TDR  EK  E    EPS SGTD+VL
Sbjct  89    PLRLESPIGQFLSQILISHPHLVPAAVDQQLEQLHTDREAEKSKE----EPSPSGTDLVL  144

Query  1074  YRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPSKDEQL  895
             YRRIAEVKA ERR+ALEEILYALVVQKFM+ADV L+PA+ S S + SG +D    ++E+L
Sbjct  145   YRRIAEVKAEERRRALEEILYALVVQKFMEADVSLIPAL-SQSTDPSGRVDRWAPEEEKL  203

Query  894   ARLHSPEAYEMIQNHLSLILGNR-SNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQ  718
              RLHSP+AYEMI++HL+LILG R  ++NS   I+KLRVGQVYAASVMYGYFLKRVDQRFQ
Sbjct  204   ERLHSPDAYEMIKSHLALILGQRLGDSNSVAPISKLRVGQVYAASVMYGYFLKRVDQRFQ  263

Query  717   LEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPS  538
             LEK+MK LP G D+E+  I+Q   D S  S +   SHPE             FG  +KP 
Sbjct  264   LEKSMKSLPWGTDEEEDAIKQAMPDESRPSAQIGNSHPEASLESSPSFSQGAFGHSIKPC  323

Query  537   RLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKI  358
             RLR+YVMSFD ETLQRYAT+RSKEA +IIEKHTEALFGRPEI ITPQGTIDSSKDELIKI
Sbjct  324   RLRSYVMSFDSETLQRYATVRSKEAFSIIEKHTEALFGRPEIVITPQGTIDSSKDELIKI  383

Query  357   SFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFVAH  253
             SF+ LRRL+LEAVTFGSFLWDVES VDSRYHFV +
Sbjct  384   SFAGLRRLILEAVTFGSFLWDVESYVDSRYHFVTN  418



>ref|XP_009414790.1| PREDICTED: uncharacterized protein LOC103995816 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=407

 Score =   475 bits (1223),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 266/419 (63%), Positives = 305/419 (73%), Gaps = 16/419 (4%)
 Frame = -2

Query  1497  MEMTTSLRSSITVGCGPVKSGRRFTTDAPGF---VKFGSKALLSAPSIKVKLGNRRVAFG  1327
             ME  + LRS   +   P  S R       G    + F  K   S  ++ +K G R   FG
Sbjct  1     MEAASGLRSPRCLRKAPGFSSRSCLLAIHGTNSSLSFDPKPRYS--TLWLKQGRR--LFG  56

Query  1326  STKCNSIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQT  1147
             + +   +RAS   S+S  S++PIAPL+LESPIGQFL+QILVSHPHL+ AAVDQQLEQLQT
Sbjct  57    ARRSIGVRAS---SSSSESSLPIAPLQLESPIGQFLSQILVSHPHLLPAAVDQQLEQLQT  113

Query  1146  DRNLEKQNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLV  967
             DR  EK  E    EP+ SGTDIVLYRRIAEVKANERR ALEEILYALV+QKF++ADV LV
Sbjct  114   DREAEKNKE----EPAPSGTDIVLYRRIAEVKANERRTALEEILYALVIQKFVEADVSLV  169

Query  966   PAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNR-SNANSSVQINKL  790
             PAI S S + S  +D  P +DE+L RLHSPEAYEMI+NHL+LILG R S++NS   I+KL
Sbjct  170   PAI-SQSTDPSSRVDHWPPQDEKLERLHSPEAYEMIKNHLALILGQRLSDSNSVAPISKL  228

Query  789   RVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspS  610
             R+GQVYAASVMYGYFLKRVDQRFQLEK+MK LP G DKE+  I+Q   D S     S  S
Sbjct  229   RIGQVYAASVMYGYFLKRVDQRFQLEKSMKTLPWGSDKEEIAIKQAMPDESRPFTESRIS  288

Query  609   HPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEAL  430
             +PE+ SW   G      G   K S LR+YVMSFD +TLQRY TIRSKEA  IIEKHTEAL
Sbjct  289   NPELPSWSSPGFNKGAVGNGAKSSLLRSYVMSFDSDTLQRYVTIRSKEAFTIIEKHTEAL  348

Query  429   FGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFVAH  253
             FGRPEI ITPQGTIDSSKDELIKISF  LRRL+LEA+TFGSFLWDVE  VDSRYHFV +
Sbjct  349   FGRPEIVITPQGTIDSSKDELIKISFGGLRRLILEAITFGSFLWDVEGYVDSRYHFVTN  407



>ref|XP_009408539.1| PREDICTED: uncharacterized protein LOC103990949 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=413

 Score =   475 bits (1222),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 270/440 (61%), Positives = 307/440 (70%), Gaps = 52/440 (12%)
 Frame = -2

Query  1497  MEMTTSLRSSITVGCGPVKSGRRFTTDAPGF--------------VKFGSKALLSAPSIK  1360
             ME  TSL+S             RF   APGF              + F  K  LS   +K
Sbjct  1     MEAATSLQSF------------RFLCKAPGFGPRSCVLAAHRSSFLFFDPKPHLSTRGLK  48

Query  1359  V----------KLGNRRVAFGSTKCNSIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQI  1210
             V          K G RR+  G+ +   +RAS    +S     PIAPL+LESPIGQFL+QI
Sbjct  49    VFDGYCPISLSKQGQRRI--GARRSTIVRASSSSPSSD----PIAPLQLESPIGQFLSQI  102

Query  1209  LVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIAEVKANERRKA  1030
             LVSHPHL+ AAVDQQLEQLQTDR   K  E    EP+ + TDIVLYRRIAEVKANERR+A
Sbjct  103   LVSHPHLLPAAVDQQLEQLQTDREAAKNKE----EPTPADTDIVLYRRIAEVKANERRRA  158

Query  1029  LEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNH  850
             LEEILYALVVQKF++ADV LVPAI   S + SG +D  P +DE+L RLHS EAYEMI+NH
Sbjct  159   LEEILYALVVQKFVEADVSLVPAICQ-SADPSGKVDQWPPEDEKLERLHSAEAYEMIKNH  217

Query  849   LSLILGNR-SNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKE  673
             L+LILG R S+ N    I+KLRVGQVYAASVMYGYFLKRVDQRFQLEK+MK LP G D E
Sbjct  218   LALILGQRTSDTNLVAPISKLRVGQVYAASVMYGYFLKRVDQRFQLEKSMKTLPWGSDVE  277

Query  672   DSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQ  493
             +S I+Q   D S  S++    HPEV SW     G  G    MKP RLR+YVMSFD +TLQ
Sbjct  278   ESAIKQAMIDESVPSVQPEIPHPEVSSWSSPSFGQGG----MKPCRLRSYVMSFDSDTLQ  333

Query  492   RYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTF  313
             R+ATIRSKEA +IIEKHTEALFGRPEI ITP+G IDSSKDELIKISF+ LRRL+LEAVTF
Sbjct  334   RHATIRSKEAFSIIEKHTEALFGRPEIVITPEGAIDSSKDELIKISFAGLRRLILEAVTF  393

Query  312   GSFLWDVESSVDSRYHFVAH  253
             GSFLWDVES VDSRYHFV +
Sbjct  394   GSFLWDVESYVDSRYHFVTN  413



>gb|KJB53076.1| hypothetical protein B456_008G292100 [Gossypium raimondii]
Length=411

 Score =   474 bits (1221),  Expect = 6e-160, Method: Compositional matrix adjust.
 Identities = 249/371 (67%), Positives = 292/371 (79%), Gaps = 24/371 (6%)
 Frame = -2

Query  1347  NRRVAFGSTKCNSIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQ  1168
             N+R+   S +   +RAS    ++  S   IAPL++ESP GQFL+QIL+SHPHLV AAV+Q
Sbjct  55    NKRMVLESRRGIVVRASSSPDSTDPSDP-IAPLRMESPTGQFLSQILISHPHLVPAAVEQ  113

Query  1167  QLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFM  988
             QL+QLQT+ + E++ E    E SASGTD+VLYRRIAEVKANER++ALEEILYALVVQKFM
Sbjct  114   QLKQLQTEWDTEQKKE----ELSASGTDLVLYRRIAEVKANERKRALEEILYALVVQKFM  169

Query  987   DADVPLVPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNANSS  808
             DADV LVPAIT  S+NSSG +DT PS++E+  +LHSPEAYEMIQ+HL+LILGNR N + S
Sbjct  170   DADVSLVPAITPSSKNSSGQVDTWPSQEEKFEQLHSPEAYEMIQSHLALILGNRLNDSKS  229

Query  807   V-QINKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQV-------  652
             V QI+KLRVGQVYAASVMYGYFLKRVD+RFQLEK MK+LP G D E S I++        
Sbjct  230   VAQISKLRVGQVYAASVMYGYFLKRVDERFQLEKTMKILPNGSDSEGSSIEKAVREDIRP  289

Query  651   GGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRS  472
              GD    S      H EV SW      S GFG  +KPSRLRTY+MSFDG+TLQR+ATIRS
Sbjct  290   AGDYLAVSS-----HLEVSSW------SGGFGNRIKPSRLRTYLMSFDGDTLQRFATIRS  338

Query  471   KEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDV  292
             KEA++IIEK TEALFGRPEI +TPQGT+DSSKDELIKISF  LR+LVLEA+TFGSFLWD 
Sbjct  339   KEAVSIIEKQTEALFGRPEIVLTPQGTVDSSKDELIKISFGGLRKLVLEAITFGSFLWDG  398

Query  291   ESSVDSRYHFV  259
             ES VDSRYHFV
Sbjct  399   ESFVDSRYHFV  409



>ref|XP_009408547.1| PREDICTED: uncharacterized protein LOC103990949 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=410

 Score =   474 bits (1220),  Expect = 8e-160, Method: Compositional matrix adjust.
 Identities = 269/437 (62%), Positives = 306/437 (70%), Gaps = 49/437 (11%)
 Frame = -2

Query  1497  MEMTTSLRSSITVGCGPVKSGRRFTTDAPGF--------------VKFGSKALLSAPSIK  1360
             ME  TSL+S             RF   APGF              + F  K  LS   +K
Sbjct  1     MEAATSLQSF------------RFLCKAPGFGPRSCVLAAHRSSFLFFDPKPHLSTRGLK  48

Query  1359  -------VKLGNRRVAFGSTKCNSIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVS  1201
                     K G RR+  G+ +   +RAS    +S     PIAPL+LESPIGQFL+QILVS
Sbjct  49    GYCPISLSKQGQRRI--GARRSTIVRASSSSPSSD----PIAPLQLESPIGQFLSQILVS  102

Query  1200  HPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEE  1021
             HPHL+ AAVDQQLEQLQTDR   K  E    EP+ + TDIVLYRRIAEVKANERR+ALEE
Sbjct  103   HPHLLPAAVDQQLEQLQTDREAAKNKE----EPTPADTDIVLYRRIAEVKANERRRALEE  158

Query  1020  ILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSL  841
             ILYALVVQKF++ADV LVPAI   S + SG +D  P +DE+L RLHS EAYEMI+NHL+L
Sbjct  159   ILYALVVQKFVEADVSLVPAICQ-SADPSGKVDQWPPEDEKLERLHSAEAYEMIKNHLAL  217

Query  840   ILGNR-SNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSG  664
             ILG R S+ N    I+KLRVGQVYAASVMYGYFLKRVDQRFQLEK+MK LP G D E+S 
Sbjct  218   ILGQRTSDTNLVAPISKLRVGQVYAASVMYGYFLKRVDQRFQLEKSMKTLPWGSDVEESA  277

Query  663   IQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYA  484
             I+Q   D S  S++    HPEV SW     G  G    MKP RLR+YVMSFD +TLQR+A
Sbjct  278   IKQAMIDESVPSVQPEIPHPEVSSWSSPSFGQGG----MKPCRLRSYVMSFDSDTLQRHA  333

Query  483   TIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSF  304
             TIRSKEA +IIEKHTEALFGRPEI ITP+G IDSSKDELIKISF+ LRRL+LEAVTFGSF
Sbjct  334   TIRSKEAFSIIEKHTEALFGRPEIVITPEGAIDSSKDELIKISFAGLRRLILEAVTFGSF  393

Query  303   LWDVESSVDSRYHFVAH  253
             LWDVES VDSRYHFV +
Sbjct  394   LWDVESYVDSRYHFVTN  410



>ref|XP_006306266.1| hypothetical protein CARUB_v10012116mg [Capsella rubella]
 gb|EOA39164.1| hypothetical protein CARUB_v10012116mg [Capsella rubella]
Length=421

 Score =   471 bits (1211),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 257/420 (61%), Positives = 315/420 (75%), Gaps = 22/420 (5%)
 Frame = -2

Query  1479  LRSSITVGCGPVKSGRRFTTDAPGFVKFGSKALLSAPSIKVKLGNRRVAFGSTKCNSIRA  1300
             ++SSI++   P KS    T + PGF++FGS      P  +++  + R     T   S R 
Sbjct  9     VQSSISLRQSPDKS-MFLTPNCPGFMRFGS-----GPQFRLRQKSSRPLQSRTSNVSSRR  62

Query  1299  SLPL---SNSGGSAM--PIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNL  1135
             S  +   ++SGG A    IAPL+L+SP+GQFL+QILVSHPHLV AAV+QQLEQLQ DR+ 
Sbjct  63    SFVVKASASSGGDASTDSIAPLQLKSPVGQFLSQILVSHPHLVPAAVEQQLEQLQIDRDA  122

Query  1134  EKQNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAIT  955
             E+Q +   D+ S  GTDIVLYRRIAE+K  ER++ALEEILYALVVQKFMDA+V LVP+IT
Sbjct  123   EEQIK---DDSSVPGTDIVLYRRIAEIKEKERKRALEEILYALVVQKFMDANVSLVPSIT  179

Query  954   SPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQ  778
             S S + SG +DT P+ D +L RLHSPE YEMIQNHLS+IL NR++  ++V QI+KL VGQ
Sbjct  180   SSSADPSGRVDTWPTLDGELERLHSPEVYEMIQNHLSIILKNRTDDLTAVAQISKLGVGQ  239

Query  777   VYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDs-------sdtslrs  619
             VYAASVMYGYFLKR+DQRFQLEK M++LP G    ++ I+Q G ++       ++ + ++
Sbjct  240   VYAASVMYGYFLKRIDQRFQLEKTMRILPGGSYDGETSIEQAGPETERSFYEEAEETYQA  299

Query  618   spSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHT  439
               S+ EV S+  G   S GF +E+  SRL+TYVMSFDGETLQRYATIRS+EA+ IIEKHT
Sbjct  300   VSSNQEVGSFVGGINASGGFSSEINQSRLKTYVMSFDGETLQRYATIRSREAVGIIEKHT  359

Query  438   EALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  259
             EALFGRPEI ITPQGTIDSSKDE IKISF  LRRLVLEAVTFGSFLWDVES VDSRYHFV
Sbjct  360   EALFGRPEILITPQGTIDSSKDEHIKISFKGLRRLVLEAVTFGSFLWDVESHVDSRYHFV  419



>ref|XP_006393405.1| hypothetical protein EUTSA_v10011507mg [Eutrema salsugineum]
 gb|ESQ30691.1| hypothetical protein EUTSA_v10011507mg [Eutrema salsugineum]
Length=426

 Score =   470 bits (1210),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 256/403 (64%), Positives = 307/403 (76%), Gaps = 19/403 (5%)
 Frame = -2

Query  1428  FTTDAPGFVKFGSKA---LLSAPSIKVK--LGNRRVAFGSTKCNSIRASLPLSNSGGSAM  1264
              T   PGF++FGS     L    S+KV   L +R  +  S +   ++AS   ++   S  
Sbjct  28    LTASCPGFMRFGSGPQFRLRHNSSLKVSRPLQSRTTSVKSRRSLVVKAS---ASGDASTD  84

Query  1263  PIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTD  1084
              IAPL+L+SP+GQFL+QILVSHPHLV AAV+QQLEQLQTDR  E+QN+   D  S  GTD
Sbjct  85    SIAPLELKSPVGQFLSQILVSHPHLVPAAVEQQLEQLQTDREAEEQNK---DASSVPGTD  141

Query  1083  IVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPSKD  904
             IVLYRRIAEVK  ERR+ALEEILYALVVQKFMDA+V LVP+I+S S++ SG +DT P++D
Sbjct  142   IVLYRRIAEVKEKERRRALEEILYALVVQKFMDANVSLVPSISSSSKDPSGRVDTWPAQD  201

Query  903   EQLARLHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFLKRVDQ  727
              +L RLHSPE YEMIQNHLS+IL NR    ++V QI+KL VGQVYAASVMYGYFLKR+DQ
Sbjct  202   GELERLHSPEVYEMIQNHLSIILKNRVGDLTTVAQISKLGVGQVYAASVMYGYFLKRIDQ  261

Query  726   RFQLEKNMKVLPQGLDKEDSGIQQVGGDs-------sdtslrsspSHPEVVSWPDGGMGS  568
             RFQLEK MK+LP G D+ ++ I+Q G ++       ++ + ++  S+ EV S+  G   S
Sbjct  262   RFQLEKTMKILPGGSDEGETSIEQAGRETERSFYEEAEETYQAVSSNREVGSFVGGINAS  321

Query  567   RGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTI  388
              GF +E K SRL+TYVMSFDGETLQRYATIRS+EA+ IIEKHTEALFGRPEI ITPQGTI
Sbjct  322   GGFSSETKQSRLKTYVMSFDGETLQRYATIRSREAVGIIEKHTEALFGRPEIVITPQGTI  381

Query  387   DSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  259
             DSSKDE IKISF  L+RLVLEAVTFGSFLWDVES VDSRYHFV
Sbjct  382   DSSKDEHIKISFKGLKRLVLEAVTFGSFLWDVESHVDSRYHFV  424



>ref|XP_010461662.1| PREDICTED: uncharacterized protein LOC104742359 isoform X1 [Camelina 
sativa]
 ref|XP_010461663.1| PREDICTED: uncharacterized protein LOC104742359 isoform X2 [Camelina 
sativa]
 ref|XP_010461664.1| PREDICTED: uncharacterized protein LOC104742359 isoform X3 [Camelina 
sativa]
Length=428

 Score =   470 bits (1210),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 251/404 (62%), Positives = 304/404 (75%), Gaps = 16/404 (4%)
 Frame = -2

Query  1428  FTTDAPGFVKFGSKA----LLSAPSIKVK--LGNRRVAFGSTKCNSIRASLPLSNSGGSA  1267
              T + PGF++F        L S  S+K    L +R     S +   ++AS   S    S 
Sbjct  25    LTPNCPGFMRFVGSGPQFRLRSNSSLKFSRPLQSRTSYVNSRRSFVVKASASASGGDAST  84

Query  1266  MPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGT  1087
               IAPL+L+SP+GQFL+QILVSHPHLV AAV+QQLEQLQ DR+ E+Q   ++D+ S  GT
Sbjct  85    DSIAPLQLKSPVGQFLSQILVSHPHLVPAAVEQQLEQLQIDRDAEEQ--IRDDDSSVPGT  142

Query  1086  DIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPSK  907
             DIVLYRRIAE+K  ER++ALEEILYALVVQKFMDA+V LVP+ITS S + SG +DT P+ 
Sbjct  143   DIVLYRRIAEIKEKERKRALEEILYALVVQKFMDANVSLVPSITSSSADPSGRVDTWPTL  202

Query  906   DEQLARLHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFLKRVD  730
             D +L RLHSPE YEMIQNHLS+IL NR++  ++V QI+KL VGQVYAASVMYGYFLKR+D
Sbjct  203   DGELERLHSPEVYEMIQNHLSIILKNRTDDLTAVAQISKLGVGQVYAASVMYGYFLKRID  262

Query  729   QRFQLEKNMKVLPQGLDKEDSGIQQVGGDs-------sdtslrsspSHPEVVSWPDGGMG  571
             QRFQLEK M++LP G  + ++ I+Q G ++       ++ + ++  S+ EV S+  G   
Sbjct  263   QRFQLEKTMRILPGGSYEGETSIEQAGRETERSFYEEAEETYQAVSSNQEVGSFVGGINA  322

Query  570   SRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGT  391
             S GF +EM  SRL+TYVMSFDGETLQRYATIRS+EA+ IIEKHTEALFGRPEI ITPQGT
Sbjct  323   SGGFSSEMNQSRLKTYVMSFDGETLQRYATIRSREAVGIIEKHTEALFGRPEILITPQGT  382

Query  390   IDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  259
             IDSSKDE IKISF  LRRLVLEAVTFGSFLWDVES VDSRYHFV
Sbjct  383   IDSSKDEHIKISFKGLRRLVLEAVTFGSFLWDVESHVDSRYHFV  426



>emb|CDX95820.1| BnaC05g35710D [Brassica napus]
Length=415

 Score =   470 bits (1209),  Expect = 5e-158, Method: Compositional matrix adjust.
 Identities = 236/336 (70%), Positives = 279/336 (83%), Gaps = 9/336 (3%)
 Frame = -2

Query  1263  PIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTD  1084
             PIAPL+LESP GQFL+QILV+HPHLV AAV+QQLEQLQTDR+ E QN+   D  SA GTD
Sbjct  86    PIAPLQLESPAGQFLSQILVTHPHLVPAAVEQQLEQLQTDRDSEGQNK---DASSAPGTD  142

Query  1083  IVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPSKD  904
             IVLYRRIAE+K NERR+ LEEILYALVVQKFM+A+V LVP+IT  S + SG +DT P+K 
Sbjct  143   IVLYRRIAELKENERRRTLEEILYALVVQKFMEANVSLVPSITPSSSDPSGRVDTWPTKV  202

Query  903   EQLARLHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFLKRVDQ  727
             E+L +LHS E YEMI NHL+LILG R    +S+ QI+KLRVGQVYAASVMYGYFLKRVDQ
Sbjct  203   EKLEKLHSSEMYEMIHNHLALILGPRMGDLASIAQISKLRVGQVYAASVMYGYFLKRVDQ  262

Query  726   RFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEM  547
             RFQLEK+MK+LP GLD   + ++Q      + + ++  SHPEV S+  GG+ ++GFG+E+
Sbjct  263   RFQLEKSMKILPGGLDDSKTSVEQ----PENVTFKAVSSHPEVGSFA-GGVSAKGFGSEI  317

Query  546   KPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDEL  367
             KPSRLRTYVMSFD ETLQRYATIRS+E + IIEKHTEALFG+PEI ITP+GT+DSSKDE 
Sbjct  318   KPSRLRTYVMSFDSETLQRYATIRSREGVGIIEKHTEALFGKPEIVITPEGTVDSSKDEQ  377

Query  366   IKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  259
             IKISF  ++RLVLEAVTFGSFLWDVES VD+RYHFV
Sbjct  378   IKISFGGMKRLVLEAVTFGSFLWDVESHVDARYHFV  413



>gb|KJB30250.1| hypothetical protein B456_005G134400 [Gossypium raimondii]
Length=422

 Score =   469 bits (1208),  Expect = 8e-158, Method: Compositional matrix adjust.
 Identities = 267/431 (62%), Positives = 328/431 (76%), Gaps = 29/431 (7%)
 Frame = -2

Query  1497  MEMTTSLRSSITV---GCGPVKSGRRFTTDAPGFVKFGSKALLSAPSIKVKLGNRRVAFG  1327
             ME  T + SS+++    C   +S      + P F +F +    S P   +KL +  V++ 
Sbjct  1     MEAATVVGSSMSLHRTSCSAARSAL-LVANGPLFPRFAANPRSSFP---IKLYSS-VSYS  55

Query  1326  STKCNSIRAS------LPLSNSGGSAMP---IAPLKLESPIGQFLTQILVSHPHLVSAAV  1174
              ++   +         +  S+S  SA P   IAPL++ESPIGQFL+QIL+SHPHLV AAV
Sbjct  56    KSRNRRMGLGGRRGMVVKASSSPDSAEPNAQIAPLRMESPIGQFLSQILISHPHLVPAAV  115

Query  1173  DQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQK  994
             +QQLEQLQTDR+ +++ E    EPSASGTD+VLYRRIAEVKANER++ALEEILYALVVQK
Sbjct  116   EQQLEQLQTDRDTDEKKE----EPSASGTDLVLYRRIAEVKANERKRALEEILYALVVQK  171

Query  993   FMDADVPLVPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNAN  814
             FMDA++ LVPAITS S + SG +DT PS++++L ++HS EA+EMIQNH++LILGNR   +
Sbjct  172   FMDANISLVPAITS-SADPSGRVDTWPSQEDKLEQIHSAEAHEMIQNHVALILGNRLGES  230

Query  813   SSV-QINKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDss  637
             +SV QI+KLRVGQVYAASVMYGYFL+RVDQRFQLE+ MKVLP   D + S I+Q  GD +
Sbjct  231   TSVAQISKLRVGQVYAASVMYGYFLRRVDQRFQLERTMKVLPSASDDDKSSIEQTVGDDT  290

Query  636   d-----tslrsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRS  472
                    S +++ SHPEV SW  GG+ S GFG+ +KPSRLRTYVMSFDGETLQRYA+IRS
Sbjct  291   RPSGLGDSYQAASSHPEVSSW-SGGISSGGFGSGIKPSRLRTYVMSFDGETLQRYASIRS  349

Query  471   KEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDV  292
             KEA+ IIEKHTEALFGRPEI+ITPQGT+DSS DELIKISF  L+RLVLEAVTFGSFLWDV
Sbjct  350   KEAVGIIEKHTEALFGRPEIAITPQGTVDSSNDELIKISFGGLKRLVLEAVTFGSFLWDV  409

Query  291   ESSVDSRYHFV  259
             ES VDSRYHFV
Sbjct  410   ESFVDSRYHFV  420



>emb|CDX92162.1| BnaA05g22450D [Brassica napus]
Length=415

 Score =   468 bits (1204),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 236/336 (70%), Positives = 279/336 (83%), Gaps = 9/336 (3%)
 Frame = -2

Query  1263  PIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTD  1084
             PIAPL+LESP GQFL+QILV+HPHLV AAV+QQLEQLQTDR+ E QN+   D  S  GTD
Sbjct  86    PIAPLQLESPAGQFLSQILVTHPHLVPAAVEQQLEQLQTDRDSEGQNK---DASSVPGTD  142

Query  1083  IVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPSKD  904
             IVLYRRIAE+K NERR+ LEEILYALVVQKFM+A+V LVP+IT  S + SG +DT P+K 
Sbjct  143   IVLYRRIAELKENERRRTLEEILYALVVQKFMEANVSLVPSITPSSSDPSGRVDTWPTKV  202

Query  903   EQLARLHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFLKRVDQ  727
             E+L +LHS E YEMI NHL+LILG R    +SV QI+KLRVGQVYAASVMYGYFLKRVDQ
Sbjct  203   EKLEKLHSSEMYEMIHNHLALILGPRMGDLASVAQISKLRVGQVYAASVMYGYFLKRVDQ  262

Query  726   RFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEM  547
             RFQLEK+MK+L  GLD+  + ++Q      + + ++  SHPEV S+  GG+ ++GFG+E+
Sbjct  263   RFQLEKSMKLLTGGLDESKTSVEQ----PENVTFKAVSSHPEVGSFA-GGVSAKGFGSEI  317

Query  546   KPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDEL  367
             KPSRLRTYVMSFD ETLQRYATIRS+EA+ IIEKHTEALFG+PEI ITP+GT+DSSKDE 
Sbjct  318   KPSRLRTYVMSFDSETLQRYATIRSREAVGIIEKHTEALFGKPEIVITPEGTVDSSKDEQ  377

Query  366   IKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  259
             IKISF  ++RLVLEAVTFGSFLWDVES VD+RYHFV
Sbjct  378   IKISFGGMKRLVLEAVTFGSFLWDVESHVDARYHFV  413



>ref|XP_010465837.1| PREDICTED: uncharacterized protein LOC104746127 [Camelina sativa]
Length=410

 Score =   468 bits (1203),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 251/401 (63%), Positives = 302/401 (75%), Gaps = 22/401 (5%)
 Frame = -2

Query  1440  SGRRF-TTDAPGFVKFGSKALL-----SAPSIKVKLGNRRVAFGSTKCNSIRASLPLSNS  1279
             SG  F T   PGF + GS+  L     +  S+      RR+        +  AS   ++S
Sbjct  23    SGSMFLTASGPGFTRSGSRLRLRFRQNALQSLTTTAKTRRIFV----VRASSASSGDASS  78

Query  1278  GGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPS  1099
             G +  PIAPL+LESP GQFL+QIL+SHPHLV AAV+QQLEQLQTDR+ E QN+   D  S
Sbjct  79    GSTPKPIAPLRLESPAGQFLSQILLSHPHLVPAAVEQQLEQLQTDRDSEGQNK---DASS  135

Query  1098  ASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDT  919
               GTDIVLYRRIAE+K NERR+ LEEILYALVVQKFM+A+V LVP++T PS + SG +DT
Sbjct  136   VPGTDIVLYRRIAELKENERRRTLEEILYALVVQKFMEANVSLVPSVT-PSSHPSGRVDT  194

Query  918   LPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFL  742
              P+K E+L +LHSPE YEMI NHL+LILG+R    +SV QI+KLRVGQVYAASVMYGYFL
Sbjct  195   WPTKVEKLEQLHSPEMYEMIHNHLALILGSRMGDLASVAQISKLRVGQVYAASVMYGYFL  254

Query  741   KRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRG  562
             KRVDQRFQLEK MK+LP GLD   + + Q           +  SHPEV ++  GG+ ++G
Sbjct  255   KRVDQRFQLEKTMKILPGGLDDSKTSVDQT------ERPSAVSSHPEVGAFA-GGVSAKG  307

Query  561   FGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDS  382
             FG+E+KPSRLR+YVMSFD ETLQRYATIRS+EA+ IIEKHTEALFG+PEI +TP+GT+DS
Sbjct  308   FGSEIKPSRLRSYVMSFDAETLQRYATIRSREAVRIIEKHTEALFGKPEIVLTPEGTVDS  367

Query  381   SKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  259
             SKDE I ISF  ++RLVLEAVTFGSFLWDVES VD+RYHFV
Sbjct  368   SKDEQINISFGGMKRLVLEAVTFGSFLWDVESHVDARYHFV  408



>ref|NP_175278.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAF79715.1|AC020889_23 T1N15.6 [Arabidopsis thaliana]
 gb|AAL57686.1| At1g48450/T1N15_5 [Arabidopsis thaliana]
 gb|AAN41342.1| unknown protein [Arabidopsis thaliana]
 gb|AEE32293.1| uncharacterized protein AT1G48450 [Arabidopsis thaliana]
Length=423

 Score =   468 bits (1204),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 250/405 (62%), Positives = 307/405 (76%), Gaps = 25/405 (6%)
 Frame = -2

Query  1425  TTDAPGFVKFGSKALLSAPSIKVKLGNRRVAF------GSTKCNSIRASLPLSNSGGSAM  1264
             T + PGF++  S      P  +++  N  + F      G+T   S R+ +  +++ G A 
Sbjct  26    TPNCPGFMRISS-----GPQFRLR-QNSSLKFSRPFQSGTTCVKSRRSFVVKASASGDAS  79

Query  1263  --PIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASG  1090
                IAPL+L+SP+GQFL+QILVSHPHLV AAV+QQLEQLQ DR+ E+Q++   D  S  G
Sbjct  80    TESIAPLQLKSPVGQFLSQILVSHPHLVPAAVEQQLEQLQIDRDAEEQSK---DASSVLG  136

Query  1089  TDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPS  910
             TDIVLYRRIAEVK  ERR+ALEEILYALVVQKFMDA+V LVP+ITS S + SG +DT P+
Sbjct  137   TDIVLYRRIAEVKEKERRRALEEILYALVVQKFMDANVTLVPSITSSSADPSGRVDTWPT  196

Query  909   KDEQLARLHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFLKRV  733
              D +L RLHSPE YEMIQNHLS+IL NR++  ++V QI+KL VGQVYAASVMYGYFLKR+
Sbjct  197   LDGELERLHSPEVYEMIQNHLSIILKNRTDDLTAVAQISKLGVGQVYAASVMYGYFLKRI  256

Query  732   DQRFQLEKNMKVLPQGLDKEDSGIQQVGGD-------ssdtslrsspSHPEVVSWPDGGM  574
             DQRFQLEK M++LP G D+ ++ I+Q G D        ++ + ++  S+ +V S+  G  
Sbjct  257   DQRFQLEKTMRILPGGSDEGETSIEQAGRDVERNFYEEAEETYQAVSSNQDVGSFVGGIN  316

Query  573   GSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQG  394
              S GF ++MK SRL+TYVMSFDGETLQRYATIRS+E++ IIEKHTEALFGRPEI ITPQG
Sbjct  317   ASGGFSSDMKQSRLKTYVMSFDGETLQRYATIRSRESVGIIEKHTEALFGRPEIVITPQG  376

Query  393   TIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  259
             TIDSSKDE IKISF  L+RLVLEAVTFGSFLWDVES VDSRYHFV
Sbjct  377   TIDSSKDEHIKISFKGLKRLVLEAVTFGSFLWDVESHVDSRYHFV  421



>dbj|BAJ34170.1| unnamed protein product [Thellungiella halophila]
Length=419

 Score =   467 bits (1202),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 258/408 (63%), Positives = 304/408 (75%), Gaps = 37/408 (9%)
 Frame = -2

Query  1428  FTTDAPGFVKFGSKALLSAPSIKVKLGNRRVAFG--------STKCNSIRASLPLSNSGG  1273
              T   PGF + GS          ++L  R+ AFG        ST+    R S  +  S  
Sbjct  29    LTASGPGFTRSGSG---------LQLRLRQNAFGRFSRPLQSSTRAAKTRKSFAIRASAS  79

Query  1272  SAM--------PIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEK  1117
             S          PIAPL+LESP GQFL+QILVSHPHLV AAV+QQLEQLQTDR+ E QN+ 
Sbjct  80    SDDASSGSSSKPIAPLQLESPAGQFLSQILVSHPHLVPAAVEQQLEQLQTDRDSEGQNK-  138

Query  1116  QNDEPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNS  937
               D  S+ GTDIVLYRRIAE+K NERR+ LEEILYALVVQKFM+A+V L+P+I SPS + 
Sbjct  139   --DATSSPGTDIVLYRRIAELKENERRRTLEEILYALVVQKFMEANVSLIPSI-SPS-DP  194

Query  936   SGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASV  760
             SG +DT P+K E+L RLHSPE YEMI NHL+LILG+R    SSV QI+KLRVGQVYAASV
Sbjct  195   SGRVDTWPTKVEKLERLHSPEMYEMIHNHLALILGSRMGDLSSVAQISKLRVGQVYAASV  254

Query  759   MYGYFLKRVDQRFQLEKNMKVLPQGL-DKEDSGIQQVGGDssdtslrsspSHPEVVSWPD  583
             MYGYFLKRVDQRFQLEK MK+LP G  D+  + ++Q      D + ++  SHPEV S+  
Sbjct  255   MYGYFLKRVDQRFQLEKTMKILPGGSSDESKTSVEQ----PEDMTYKAVSSHPEVGSFA-  309

Query  582   GGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISIT  403
             GG+ ++GFG+E+KPSRLRTYVMSFD ETLQRYATIRS+EA+ IIEKHTEALFG+PEI IT
Sbjct  310   GGVSAKGFGSEIKPSRLRTYVMSFDSETLQRYATIRSREAVGIIEKHTEALFGKPEIVIT  369

Query  402   PQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  259
             PQGT+DSSKDE IKISF  ++RLVLEAVTFGSFLWDVES VD+RY FV
Sbjct  370   PQGTVDSSKDEQIKISFGGMKRLVLEAVTFGSFLWDVESHVDARYQFV  417



>ref|XP_009145975.1| PREDICTED: uncharacterized protein LOC103869650 [Brassica rapa]
Length=415

 Score =   467 bits (1201),  Expect = 7e-157, Method: Compositional matrix adjust.
 Identities = 236/336 (70%), Positives = 278/336 (83%), Gaps = 9/336 (3%)
 Frame = -2

Query  1263  PIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTD  1084
             PIAPL+LESP GQFL+QILV+HPHLV AAV+QQLEQLQTDR+ E QN+   D  S  GTD
Sbjct  86    PIAPLQLESPAGQFLSQILVTHPHLVPAAVEQQLEQLQTDRDSEGQNK---DASSVPGTD  142

Query  1083  IVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPSKD  904
             IVLYRRIAE+K NERRK LEEILYALVVQKFM+A+V LVP+IT  S + SG +DT P+K 
Sbjct  143   IVLYRRIAELKENERRKTLEEILYALVVQKFMEANVSLVPSITPSSSDPSGRVDTWPTKV  202

Query  903   EQLARLHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFLKRVDQ  727
             E+L +LH  E YEMI NHL+LILG R    +SV QI+KLRVGQVYAASVMYGYFLKRVDQ
Sbjct  203   EKLEKLHPSEMYEMIHNHLALILGPRMGDLASVAQISKLRVGQVYAASVMYGYFLKRVDQ  262

Query  726   RFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEM  547
             RFQLEK+MK+L  GLD+  + ++Q      + + ++  SHPEV S+  GG+ ++GFG+E+
Sbjct  263   RFQLEKSMKLLSGGLDESKTSVEQ----PENVTFKAVSSHPEVGSFA-GGVSAKGFGSEI  317

Query  546   KPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDEL  367
             KPSRLRTYVMSFD ETLQRYATIRS+EA+ IIEKHTEALFG+PEI ITP+GT+DSSKDE 
Sbjct  318   KPSRLRTYVMSFDSETLQRYATIRSREAVGIIEKHTEALFGKPEIVITPEGTVDSSKDEQ  377

Query  366   IKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  259
             IKISF  ++RLVLEAVTFGSFLWDVES VD+RYHFV
Sbjct  378   IKISFGGMKRLVLEAVTFGSFLWDVESHVDARYHFV  413



>ref|XP_006406690.1| hypothetical protein EUTSA_v10020677mg [Eutrema salsugineum]
 gb|ESQ48143.1| hypothetical protein EUTSA_v10020677mg [Eutrema salsugineum]
Length=466

 Score =   468 bits (1205),  Expect = 8e-157, Method: Compositional matrix adjust.
 Identities = 258/408 (63%), Positives = 304/408 (75%), Gaps = 37/408 (9%)
 Frame = -2

Query  1428  FTTDAPGFVKFGSKALLSAPSIKVKLGNRRVAFG--------STKCNSIRASLPLSNSGG  1273
              T   PGF + GS          ++L  R+ AFG        ST+    R S  +  S  
Sbjct  76    LTASGPGFTRSGSG---------LQLRLRQNAFGRFSRPLQSSTRAAKTRKSFAIRASAS  126

Query  1272  SAM--------PIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEK  1117
             S          PIAPL+LESP GQFL+QILVSHPHLV AAV+QQLEQLQTDR+ E QN+ 
Sbjct  127   SDDASSGSSSKPIAPLQLESPAGQFLSQILVSHPHLVPAAVEQQLEQLQTDRDSEGQNK-  185

Query  1116  QNDEPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNS  937
               D  S+ GTDIVLYRRIAE+K NERR+ LEEILYALVVQKFM+A+V L+P+I SPS + 
Sbjct  186   --DATSSPGTDIVLYRRIAELKENERRRTLEEILYALVVQKFMEANVSLIPSI-SPS-DP  241

Query  936   SGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASV  760
             SG +DT P+K E+L RLHSPE YEMI NHL+LILG+R    SSV QI+KLRVGQVYAASV
Sbjct  242   SGRVDTWPTKVEKLERLHSPEMYEMIHNHLALILGSRMGDLSSVAQISKLRVGQVYAASV  301

Query  759   MYGYFLKRVDQRFQLEKNMKVLPQGL-DKEDSGIQQVGGDssdtslrsspSHPEVVSWPD  583
             MYGYFLKRVDQRFQLEK MK+LP G  D+  + ++Q      D + ++  SHPEV S+  
Sbjct  302   MYGYFLKRVDQRFQLEKTMKILPGGSSDESKTSVEQ----PEDMTYKAVSSHPEVGSFA-  356

Query  582   GGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISIT  403
             GG+ ++GFG+E+KPSRLRTYVMSFD ETLQRYATIRS+EA+ IIEKHTEALFG+PEI IT
Sbjct  357   GGVSAKGFGSEIKPSRLRTYVMSFDSETLQRYATIRSREAVGIIEKHTEALFGKPEIVIT  416

Query  402   PQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  259
             PQGT+DSSKDE IKISF  ++RLVLEAVTFGSFLWDVES VD+RY FV
Sbjct  417   PQGTVDSSKDEQIKISFGGMKRLVLEAVTFGSFLWDVESHVDARYQFV  464



>gb|KFK39108.1| hypothetical protein AALP_AA3G202000 [Arabis alpina]
Length=418

 Score =   466 bits (1200),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 252/404 (62%), Positives = 306/404 (76%), Gaps = 20/404 (5%)
 Frame = -2

Query  1440  SGRRF-TTDAPGFVKFGSKALLSAPSIKVKLGNRRVAFGSTKCNSIRASL--------PL  1288
             SG  F T   PGF +FGS+  L +        +R     +T   + R+ +          
Sbjct  23    SGSMFLTASGPGFTRFGSELQLRSKQNAFSRVSRPSQSLTTSAKTRRSFVVRAAASSDGD  82

Query  1287  SNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQND  1108
              +SG S+ PIAPL+L+SP GQFL+QILVSHPHLV AAV+QQLEQLQTDR+ E QN+  + 
Sbjct  83    GSSGSSSKPIAPLELQSPAGQFLSQILVSHPHLVPAAVEQQLEQLQTDRDSEGQNKDASS  142

Query  1107  EPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGS  928
             +P   GTDIVLYRRIAE+K NERR+ LEEILYALVVQKFM+ADV L+P+I SPS + SG 
Sbjct  143   KP---GTDIVLYRRIAELKENERRRTLEEILYALVVQKFMEADVSLIPSI-SPS-DPSGR  197

Query  927   IDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYG  751
             +DT P+K E+L RLHS E YEMI NHL+LILG+R    +SV +I+KLRVGQVYAASVMYG
Sbjct  198   VDTWPTKVEKLERLHSTEMYEMIHNHLALILGSRMGDLTSVAEISKLRVGQVYAASVMYG  257

Query  750   YFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMG  571
             YFLKRVDQRFQLEK MK+LP GLD   + ++Q      + + ++  SHPEV S+  GG+ 
Sbjct  258   YFLKRVDQRFQLEKTMKILPGGLDDSKTSVEQA----EEVTKKTVSSHPEVGSFA-GGVS  312

Query  570   SRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGT  391
              +GFG+E+KPSRLRTYVMSFDGETLQ+YATIRS+EA+ IIEKHTEALFG+PEI I+P GT
Sbjct  313   PKGFGSEIKPSRLRTYVMSFDGETLQKYATIRSREAVGIIEKHTEALFGKPEIVISPDGT  372

Query  390   IDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  259
             +DSSKDE IKISF  ++RLVLEAVTFGSFLWDVES VD+RY FV
Sbjct  373   VDSSKDEQIKISFGGMKRLVLEAVTFGSFLWDVESHVDARYQFV  416



>ref|XP_011464472.1| PREDICTED: uncharacterized protein LOC101299089 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=412

 Score =   466 bits (1199),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 267/414 (64%), Positives = 316/414 (76%), Gaps = 17/414 (4%)
 Frame = -2

Query  1488  TTSLRSSITVGCGPVKSGRRFTTDAPGFVKFGSKALLSAPSIKVKLGNRRVAFGSTKCNS  1309
               + R S +VG  P+  G       P F+  G     S  SIK +LG     FG  +C  
Sbjct  14    VAAFRPSNSVGRSPLLMG-------PKFLPLGPLGAKSHSSIKHQLG-----FGRRRCLV  61

Query  1308  IRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEK  1129
             +RA+   S+SGGS+ PIAPL+LESPIGQFL+Q+++SHPHLV  AV+QQLEQLQT R+ E+
Sbjct  62    VRAASSSSDSGGSSAPIAPLQLESPIGQFLSQMMISHPHLVPTAVEQQLEQLQTARDAEE  121

Query  1128  QNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSP  949
             + EK+    SASGTD+VLYRRIAEVKANER+KALEEILYALVVQKFMDA+V LVP+I   
Sbjct  122   KKEKEEA--SASGTDLVLYRRIAEVKANERKKALEEILYALVVQKFMDANVSLVPSIAPA  179

Query  948   SQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVY  772
             + + SG +D  PS+D++L RLHSPEAYEMIQNHLSLILGNR + ++S+ QI+KL+VGQVY
Sbjct  180   ASDPSGRVDAWPSQDDKLERLHSPEAYEMIQNHLSLILGNRLDDSTSLAQISKLKVGQVY  239

Query  771   AASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQ-VGGDssdtslrsspSHPEVV  595
             AASVMYGYFLKRVDQRFQLEK MK+LP  L  EDS I++ VG D     + +S SHPEV 
Sbjct  240   AASVMYGYFLKRVDQRFQLEKTMKILPGSLGGEDSDIEKAVGEDKRLGGVDNSASHPEVS  299

Query  594   SWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPE  415
             SW  G          +KPSRLRTYVMS DGETLQRYATIRS+EA++IIEKHTEALFGRP+
Sbjct  300   SWSGGLGSGGFGNL-IKPSRLRTYVMSVDGETLQRYATIRSREAVSIIEKHTEALFGRPD  358

Query  414   ISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFVAH  253
             I ITPQGT+DSS DE IKISF  L+RLVLEAVTFGSFLWDVES VDSRYHFV +
Sbjct  359   IVITPQGTVDSSNDEHIKISFGGLKRLVLEAVTFGSFLWDVESYVDSRYHFVTN  412



>ref|XP_006297794.1| hypothetical protein CARUB_v10013829mg [Capsella rubella]
 gb|EOA30692.1| hypothetical protein CARUB_v10013829mg [Capsella rubella]
Length=412

 Score =   466 bits (1198),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 233/336 (69%), Positives = 280/336 (83%), Gaps = 9/336 (3%)
 Frame = -2

Query  1263  PIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTD  1084
             PIAPL+LESP GQFL+QILV+HPHLV AAV+QQLEQLQTDR+ E QN+   D  S  GTD
Sbjct  83    PIAPLQLESPAGQFLSQILVTHPHLVPAAVEQQLEQLQTDRDSEGQNK---DASSVPGTD  139

Query  1083  IVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPSKD  904
             IVLYRRIAEVK NER++ LEEILYALVVQKFM+A+V LVP++T PS + SG +DT P+K 
Sbjct  140   IVLYRRIAEVKENERKRTLEEILYALVVQKFMEANVSLVPSVT-PSSDPSGRVDTWPTKV  198

Query  903   EQLARLHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFLKRVDQ  727
             E+L +LHSPE YEMI NHL+LILG+R    +SV +I+KLRVGQVYAASVMYGYFLKRVDQ
Sbjct  199   EKLEQLHSPEMYEMIHNHLALILGSRIGDLASVARISKLRVGQVYAASVMYGYFLKRVDQ  258

Query  726   RFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEM  547
             RFQLEK MK+LP GLD+ ++ + Q  G  +  ++ S   HPEV S+  GG+ ++GFG+E+
Sbjct  259   RFQLEKTMKILPGGLDESNASVDQTEGPKTYQAVSS---HPEVGSFA-GGVSAKGFGSEI  314

Query  546   KPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDEL  367
             KPSRLR+YVMSFD ETLQ+YATIRS+EA+ IIEKHTEALFG+PEI +TP+GT+DSSKDE 
Sbjct  315   KPSRLRSYVMSFDAETLQKYATIRSREAVKIIEKHTEALFGKPEIVLTPEGTVDSSKDEQ  374

Query  366   IKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  259
             I ISF  ++RLVLEAVTFGSFLWDVES VD+RY FV
Sbjct  375   INISFGGMKRLVLEAVTFGSFLWDVESHVDARYQFV  410



>gb|AFK42768.1| unknown [Lotus japonicus]
Length=412

 Score =   465 bits (1196),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 246/387 (64%), Positives = 295/387 (76%), Gaps = 12/387 (3%)
 Frame = -2

Query  1404  VKFGSKALLSAPSIKVKLGNRRVAFGSTKCNSIRASLPLSNSGGSAMPIAPLKLESPIGQ  1225
             ++F  K   ++ SI  K G+   + G T+  ++      S+S  SA  IAPL+LESPIGQ
Sbjct  31    IRFPRKLCTTSVSIP-KQGHMSFSVG-TRRRALVVRAAASDSDESANKIAPLQLESPIGQ  88

Query  1224  FLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIAEVKAN  1045
             FL+QIL++ PHLV AAVDQQL QLQTDR+ E    KQN +PS+S TD+VLYRRIAEVKAN
Sbjct  89    FLSQILINRPHLVPAAVDQQLLQLQTDRDSESDPNKQNQDPSSSSTDLVLYRRIAEVKAN  148

Query  1044  ERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYE  865
             ERRKALEEILYALVVQKFM A++ L+P+IT    + +G +D+ P+ DE+L +LHS EAYE
Sbjct  149   ERRKALEEILYALVVQKFMAANISLIPSITP---DPTGRVDSWPNDDEKLKQLHSYEAYE  205

Query  864   MIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQ  688
             MIQNHLSLILGNR+   +S+ QI+KLRVGQVYAASVMYGYFLKRVDQRFQLEK MKVLP 
Sbjct  206   MIQNHLSLILGNRAGDLTSIAQISKLRVGQVYAASVMYGYFLKRVDQRFQLEKTMKVLPN  265

Query  687   GLDKEDSGIQQVGGDssd----tslrsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYV  520
                 EDS + +   D +      +     SHPE+  W  G +   GFG+ +KP+RLR YV
Sbjct  266   A--AEDSSVHKPVKDDARPGNGENTSQVMSHPELSPWLGGDVSPGGFGSGIKPTRLRNYV  323

Query  519   MSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLR  340
             MSFDG+TLQRYATIRSKEA++IIEKHTEALFGRPE +ITP+G IDSSKDE IKISF  L+
Sbjct  324   MSFDGDTLQRYATIRSKEAVSIIEKHTEALFGRPEFAITPEGAIDSSKDENIKISFGGLK  383

Query  339   RLVLEAVTFGSFLWDVESSVDSRYHFV  259
             RLVLEAVTFGSFLWDVES V+S YHFV
Sbjct  384   RLVLEAVTFGSFLWDVESYVESSYHFV  410



>ref|XP_004299503.1| PREDICTED: uncharacterized protein LOC101299089 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=413

 Score =   463 bits (1192),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 265/414 (64%), Positives = 315/414 (76%), Gaps = 16/414 (4%)
 Frame = -2

Query  1488  TTSLRSSITVGCGPVKSGRRFTTDAPGFVKFGSKALLSAPSIKVKLGNRRVAFGSTKCNS  1309
               + R S +VG  P+  G       P F+  G     S  SIK      ++ FG  +C  
Sbjct  14    VAAFRPSNSVGRSPLLMG-------PKFLPLGPLGAKSHSSIK----QHQLGFGRRRCLV  62

Query  1308  IRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEK  1129
             +RA+   S+SGGS+ PIAPL+LESPIGQFL+Q+++SHPHLV  AV+QQLEQLQT R+ E+
Sbjct  63    VRAASSSSDSGGSSAPIAPLQLESPIGQFLSQMMISHPHLVPTAVEQQLEQLQTARDAEE  122

Query  1128  QNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSP  949
             + EK+    SASGTD+VLYRRIAEVKANER+KALEEILYALVVQKFMDA+V LVP+I   
Sbjct  123   KKEKEEA--SASGTDLVLYRRIAEVKANERKKALEEILYALVVQKFMDANVSLVPSIAPA  180

Query  948   SQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVY  772
             + + SG +D  PS+D++L RLHSPEAYEMIQNHLSLILGNR + ++S+ QI+KL+VGQVY
Sbjct  181   ASDPSGRVDAWPSQDDKLERLHSPEAYEMIQNHLSLILGNRLDDSTSLAQISKLKVGQVY  240

Query  771   AASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQ-VGGDssdtslrsspSHPEVV  595
             AASVMYGYFLKRVDQRFQLEK MK+LP  L  EDS I++ VG D     + +S SHPEV 
Sbjct  241   AASVMYGYFLKRVDQRFQLEKTMKILPGSLGGEDSDIEKAVGEDKRLGGVDNSASHPEVS  300

Query  594   SWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPE  415
             SW  G          +KPSRLRTYVMS DGETLQRYATIRS+EA++IIEKHTEALFGRP+
Sbjct  301   SWSGGLGSGGFGNL-IKPSRLRTYVMSVDGETLQRYATIRSREAVSIIEKHTEALFGRPD  359

Query  414   ISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFVAH  253
             I ITPQGT+DSS DE IKISF  L+RLVLEAVTFGSFLWDVES VDSRYHFV +
Sbjct  360   IVITPQGTVDSSNDEHIKISFGGLKRLVLEAVTFGSFLWDVESYVDSRYHFVTN  413



>gb|EPS73872.1| hypothetical protein M569_00881 [Genlisea aurea]
Length=411

 Score =   463 bits (1191),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 252/378 (67%), Positives = 296/378 (78%), Gaps = 29/378 (8%)
 Frame = -2

Query  1353  LGNRRVAFGSTKCNSI-RASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAA  1177
             LGNR+ +F S++   + RAS+  S+ G S  PIAPL+LESP+GQFL+ IL+SHPHLV AA
Sbjct  50    LGNRKPSFSSSRQRPVTRASIHPSDFGSSQAPIAPLQLESPVGQFLSNILMSHPHLVPAA  109

Query  1176  VDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQ  997
             V+QQLEQLQTDR    Q E+   EPSASGT++VLYRRIAEVKANERRK LEEILYALVVQ
Sbjct  110   VEQQLEQLQTDR----QAEQTKQEPSASGTELVLYRRIAEVKANERRKVLEEILYALVVQ  165

Query  996   KFMDADVPLVPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNR-SN  820
             KFM A+VPL  +IT PS +SS   +T PSKD +L ++HS EAYEMIQNHL+LI+GNR S+
Sbjct  166   KFMAANVPLTSSIT-PSPDSS---NTWPSKDNELKKIHSAEAYEMIQNHLALIIGNRMSD  221

Query  819   ANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGI-------  661
             +++  QI+KLRVGQVYAASVMYGYFLKRVDQRFQLEK MK+LPQG D + S         
Sbjct  222   SDAIAQISKLRVGQVYAASVMYGYFLKRVDQRFQLEKTMKILPQGGDTKASNSIGEEVIA  281

Query  660   --QQVGGDssdtslrsspSHPEVV-SWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQR  490
               ++ GGD S  + +    HPEV  SW   G     FG  +KPSRLRTYVMS DGET+QR
Sbjct  282   SERRPGGDESFINSQP---HPEVPPSWSSNG---SPFG--IKPSRLRTYVMSLDGETIQR  333

Query  489   YATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDE-LIKISFSSLRRLVLEAVTF  313
             YATIRSKEAI IIEKHTEALFGRPEI +TP+G++DSSKDE  I I F++L+RLVLEAVTF
Sbjct  334   YATIRSKEAIGIIEKHTEALFGRPEIVLTPEGSVDSSKDEAAITIRFAALKRLVLEAVTF  393

Query  312   GSFLWDVESSVDSRYHFV  259
             GSFLWDVES VDSRYHFV
Sbjct  394   GSFLWDVESFVDSRYHFV  411



>emb|CDX75937.1| BnaC03g40200D [Brassica napus]
Length=414

 Score =   459 bits (1182),  Expect = 5e-154, Method: Compositional matrix adjust.
 Identities = 244/401 (61%), Positives = 294/401 (73%), Gaps = 18/401 (4%)
 Frame = -2

Query  1440  SGRRFTTDAPGFVKFGSKALLSAPSIKVKLGNRRVAFGSTKCNSIRASLPLSNSGGSAM-  1264
             +G  F T + GF   GSK  +          ++ +   +T  +  R S  +  S  S   
Sbjct  23    AGSMFLTTSGGFTPSGSKLQVRLKQNAFTRFSKPLQTSTTTASKTRRSFVVKASAASDDA  82

Query  1263  ---PIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSAS  1093
                PIAPL+LESP GQFL+QILVSHPHLV AAV+QQLEQLQTDR+ + QN   +   S  
Sbjct  83    SSKPIAPLQLESPAGQFLSQILVSHPHLVPAAVEQQLEQLQTDRDSQGQN--TDSSSSVP  140

Query  1092  GTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLP  913
             GTDIVLYRRIAE+K NER + LEEILYALVVQKFM+A+V L+P+IT  S + SG +DT P
Sbjct  141   GTDIVLYRRIAELKENERHRTLEEILYALVVQKFMEANVSLIPSITPSSSDPSGRVDTWP  200

Query  912   SKDEQLARLHSPEAYEMIQNHLSLILGNR-SNANSSVQINKLRVGQVYAASVMYGYFLKR  736
             +K E+L +LHSPE YEMI NHL+LILG+R  +  S  QI+KLRVGQVYAASVMYGYFLKR
Sbjct  201   NKVEKLEQLHSPEMYEMIHNHLALILGSRIGDLTSVAQISKLRVGQVYAASVMYGYFLKR  260

Query  735   VDQRFQLEKNMKVLPQ--GLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRG  562
             VDQRFQLEK MK+LP   G D+  S ++Q            +  HPEV S+  GG+ ++G
Sbjct  261   VDQRFQLEKTMKLLPGSGGADESKSSVEQ--------PEDVTSIHPEVGSFA-GGVSAKG  311

Query  561   FGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDS  382
             FG+E+KPSRLRTYVMSFD ETLQRYATIRS+EA+ I+EKHTEALFG+PEI ITPQGT+DS
Sbjct  312   FGSEIKPSRLRTYVMSFDSETLQRYATIRSREAVGIVEKHTEALFGKPEIVITPQGTVDS  371

Query  381   SKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  259
             SK+E IKISF  ++RLVLEAVTFGSFLWDVES VD+RY FV
Sbjct  372   SKEEQIKISFGGMKRLVLEAVTFGSFLWDVESHVDARYQFV  412



>gb|KFK36092.1| hypothetical protein AALP_AA4G076400 [Arabis alpina]
Length=424

 Score =   459 bits (1182),  Expect = 6e-154, Method: Compositional matrix adjust.
 Identities = 250/397 (63%), Positives = 299/397 (75%), Gaps = 19/397 (5%)
 Frame = -2

Query  1413  PGFVKFGSKALLSAPSIKVK---LGNRRVAFGSTKCNSIRASLPLSNSGGSAMPIAPLKL  1243
             PGF++F SK     P  +++   L  R ++  S +   ++AS    +   S   IAPL+L
Sbjct  33    PGFMRFSSK-----PQFRLRHNSLQTRTISVKSRRSFVVKASAFDDDVSSSTDSIAPLQL  87

Query  1242  ESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRI  1063
             +SP+GQFL++ILVSHPHLV AAV+QQLEQLQ DR+LE+QN  ++   S  GTDIVLYRRI
Sbjct  88    KSPVGQFLSEILVSHPHLVPAAVEQQLEQLQIDRDLEEQN--KDSSSSVPGTDIVLYRRI  145

Query  1062  AEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPSKDEQLARLH  883
             AEVK  ERR+ALEEILYALVVQKFMDA+V LVP+I+S S +SSG +DT P+ D +L RLH
Sbjct  146   AEVKEKERRRALEEILYALVVQKFMDANVSLVPSISSSSADSSGRVDTWPTVDGELERLH  205

Query  882   SPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFLKRVDQRFQLEKN  706
             SPE YEMIQNHLS+IL NR    S+V QI+KL VGQVYAASVMYGYFLKR+DQRFQLEK 
Sbjct  206   SPEVYEMIQNHLSIILKNRVGDLSTVAQISKLGVGQVYAASVMYGYFLKRIDQRFQLEKT  265

Query  705   MKVLPQGLDKEDSGIQQVGGDssdtslrs--------spSHPEVVSWPDGGMGSRGFGTE  550
             MK+LP   D+ ++ I+Q G ++  +              S+ EV S+  G   S GF ++
Sbjct  266   MKILPGWSDEGETSIEQAGRETERSRSYEEAEETYEAVSSNQEVGSFVGGINASGGFSSD  325

Query  549   MKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDE  370
             MK SRL+TYVMSFDGETLQRYATIRS+EA+ IIEKHTEALFGRPEI ITPQGTIDSS DE
Sbjct  326   MKQSRLKTYVMSFDGETLQRYATIRSREAVGIIEKHTEALFGRPEIMITPQGTIDSSNDE  385

Query  369   LIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  259
              IKISF  L+RLVLEAVTFGSFLWDVES VDSRYHFV
Sbjct  386   HIKISFHGLKRLVLEAVTFGSFLWDVESHVDSRYHFV  422



>ref|XP_010549033.1| PREDICTED: uncharacterized protein LOC104820333 isoform X1 [Tarenaya 
hassleriana]
Length=413

 Score =   459 bits (1181),  Expect = 7e-154, Method: Compositional matrix adjust.
 Identities = 244/338 (72%), Positives = 280/338 (83%), Gaps = 8/338 (2%)
 Frame = -2

Query  1266  MPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGT  1087
             +PIAPL+LESP+GQFL+QILVSHPHLV AAV+QQLEQLQT R+     E+Q D PS  GT
Sbjct  80    VPIAPLQLESPVGQFLSQILVSHPHLVPAAVEQQLEQLQTVRD----AEEQKDSPSVPGT  135

Query  1086  DIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPSK  907
             DIVLYRRIAEVK +ERR+ALEEILY LVVQKFMDA+V LVP+I S S + SG +DT P++
Sbjct  136   DIVLYRRIAEVKESERRRALEEILYTLVVQKFMDANVSLVPSIKS-SSDPSGRVDTWPAQ  194

Query  906   DEQLARLHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFLKRVD  730
             +E+L RLHSPEAYEMIQNHL++ILGNR    SSV QI+KLRVGQVYAASVMYGYFLKRVD
Sbjct  195   EERLERLHSPEAYEMIQNHLTIILGNRLGDPSSVAQISKLRVGQVYAASVMYGYFLKRVD  254

Query  729   QRFQLEKNMKVLPQGLDKEDSGIQQVG-GDssdtslrsspSHPEVVSWPDGGMGSRGFGT  553
             QRFQLEK MK+LP G D+ +  I+Q   G    ++      HPEV S+  GG+   GFG+
Sbjct  255   QRFQLEKTMKILPGGSDEGEGSIEQSAPGTERISNGDGGTYHPEVGSF-AGGISGGGFGS  313

Query  552   EMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKD  373
              +KPSRLRTYVMSFDGETLQRYATIRS+EA+ IIEKHTEALFGRPEI ITP+GT+DSS+D
Sbjct  314   GLKPSRLRTYVMSFDGETLQRYATIRSREAVGIIEKHTEALFGRPEIMITPEGTVDSSRD  373

Query  372   ELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  259
             E IKISF  L+RLVLEAVTFGSFLWDVES VDSRYHFV
Sbjct  374   EHIKISFGGLKRLVLEAVTFGSFLWDVESYVDSRYHFV  411



>ref|XP_010549034.1| PREDICTED: uncharacterized protein LOC104820333 isoform X2 [Tarenaya 
hassleriana]
Length=412

 Score =   459 bits (1180),  Expect = 8e-154, Method: Compositional matrix adjust.
 Identities = 244/338 (72%), Positives = 280/338 (83%), Gaps = 8/338 (2%)
 Frame = -2

Query  1266  MPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGT  1087
             +PIAPL+LESP+GQFL+QILVSHPHLV AAV+QQLEQLQT R+     E+Q D PS  GT
Sbjct  79    VPIAPLQLESPVGQFLSQILVSHPHLVPAAVEQQLEQLQTVRD----AEEQKDSPSVPGT  134

Query  1086  DIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPSK  907
             DIVLYRRIAEVK +ERR+ALEEILY LVVQKFMDA+V LVP+I S S + SG +DT P++
Sbjct  135   DIVLYRRIAEVKESERRRALEEILYTLVVQKFMDANVSLVPSIKS-SSDPSGRVDTWPAQ  193

Query  906   DEQLARLHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFLKRVD  730
             +E+L RLHSPEAYEMIQNHL++ILGNR    SSV QI+KLRVGQVYAASVMYGYFLKRVD
Sbjct  194   EERLERLHSPEAYEMIQNHLTIILGNRLGDPSSVAQISKLRVGQVYAASVMYGYFLKRVD  253

Query  729   QRFQLEKNMKVLPQGLDKEDSGIQQVG-GDssdtslrsspSHPEVVSWPDGGMGSRGFGT  553
             QRFQLEK MK+LP G D+ +  I+Q   G    ++      HPEV S+  GG+   GFG+
Sbjct  254   QRFQLEKTMKILPGGSDEGEGSIEQSAPGTERISNGDGGTYHPEVGSF-AGGISGGGFGS  312

Query  552   EMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKD  373
              +KPSRLRTYVMSFDGETLQRYATIRS+EA+ IIEKHTEALFGRPEI ITP+GT+DSS+D
Sbjct  313   GLKPSRLRTYVMSFDGETLQRYATIRSREAVGIIEKHTEALFGRPEIMITPEGTVDSSRD  372

Query  372   ELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  259
             E IKISF  L+RLVLEAVTFGSFLWDVES VDSRYHFV
Sbjct  373   EHIKISFGGLKRLVLEAVTFGSFLWDVESYVDSRYHFV  410



>ref|XP_010479269.1| PREDICTED: uncharacterized protein LOC104758146 [Camelina sativa]
Length=429

 Score =   459 bits (1182),  Expect = 9e-154, Method: Compositional matrix adjust.
 Identities = 250/404 (62%), Positives = 301/404 (75%), Gaps = 15/404 (4%)
 Frame = -2

Query  1428  FTTDAPGFVKFGSKA----LLSAPSIKVK--LGNRRVAFGSTKCNSIRASLPLSNSGGSA  1267
              T + PGF++F        L S  S+K    L +R     S +   ++AS   S    S 
Sbjct  25    LTPNCPGFMRFVGSGPQFRLRSNSSLKFSRPLQSRTSYVNSRRSFVVKASASASGGESST  84

Query  1266  MPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGT  1087
               IAPL+L+SP+GQFL+QILVSHPHLV AAV+QQLEQLQ DR+ E+Q    +  P  +GT
Sbjct  85    DSIAPLQLKSPVGQFLSQILVSHPHLVPAAVEQQLEQLQIDRDAEEQIRDDSSVP-GTGT  143

Query  1086  DIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPSK  907
             DIVLYRRIAE+K  ER++ALEEILYALVVQKFMDA+V LVP+ITS S + SG +DT P+ 
Sbjct  144   DIVLYRRIAEIKEKERKRALEEILYALVVQKFMDANVSLVPSITSSSADPSGRVDTWPTL  203

Query  906   DEQLARLHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFLKRVD  730
             D +L RLHSPE YEMIQNHLS+IL NR++  + V QI+KL VGQVYAASVMYGYFLKR+D
Sbjct  204   DGELERLHSPEVYEMIQNHLSIILKNRTDDLTGVAQISKLGVGQVYAASVMYGYFLKRID  263

Query  729   QRFQLEKNMKVLPQGLDKEDSGIQQVGGDs-------sdtslrsspSHPEVVSWPDGGMG  571
             QRFQLEK M++LP G  + ++ I+Q G ++       ++ + ++  S+ EV S+  G   
Sbjct  264   QRFQLEKTMRILPGGSYEGETSIEQAGRETERSFYEEAEETYQAVSSNQEVGSFVGGINA  323

Query  570   SRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGT  391
             S GF +EM  SRL+TYVMSFDGETLQRYATIRS+EA+ IIEKHTEALFGRPEI ITPQGT
Sbjct  324   SGGFSSEMNQSRLKTYVMSFDGETLQRYATIRSREAVGIIEKHTEALFGRPEILITPQGT  383

Query  390   IDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  259
             IDSSKDE IKISF  LRRLVLEAVTFGSFLWDVES VDSRYHFV
Sbjct  384   IDSSKDEHIKISFKGLRRLVLEAVTFGSFLWDVESHVDSRYHFV  427



>ref|XP_010500371.1| PREDICTED: uncharacterized protein LOC104777762 [Camelina sativa]
Length=429

 Score =   458 bits (1179),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 235/342 (69%), Positives = 278/342 (81%), Gaps = 11/342 (3%)
 Frame = -2

Query  1260  IAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDI  1081
             IAPL+L+SP+GQFL+QILVSHPHLV AAV+QQLEQLQ DR+ E+Q     D+ S  GTDI
Sbjct  89    IAPLQLKSPVGQFLSQILVSHPHLVPAAVEQQLEQLQIDRDAEEQI---RDDSSVPGTDI  145

Query  1080  VLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPSKDE  901
             VLYRRIAE+K  ER++ALEEILYALVVQKFMDA+V LVP+ITS S + SG +DT P+ D 
Sbjct  146   VLYRRIAEIKEKERKRALEEILYALVVQKFMDANVSLVPSITSSSADPSGRVDTWPTLDG  205

Query  900   QLARLHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFLKRVDQR  724
             +L RLHSPE YEMIQNHLS+IL NR++  ++V QI+KL VGQVYAASVMYGYFLKR+DQR
Sbjct  206   ELERLHSPEVYEMIQNHLSIILKNRTDDLAAVAQISKLGVGQVYAASVMYGYFLKRIDQR  265

Query  723   FQLEKNMKVLPQGLDKEDSGIQQVGGDs-------sdtslrsspSHPEVVSWPDGGMGSR  565
             FQLEK M++LP G  + ++ I+Q G ++       ++ + ++  S+ EV S+  G   S 
Sbjct  266   FQLEKTMRILPGGSYEGETSIEQAGRETERSFYEEAEETYQAVSSNQEVGSFVGGINASG  325

Query  564   GFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTID  385
             GF +EM  SRL+TYVMSFDGETLQRYATIRS+EA+ IIEKHTEALFGRPEI ITPQGTID
Sbjct  326   GFSSEMNQSRLKTYVMSFDGETLQRYATIRSREAVGIIEKHTEALFGRPEILITPQGTID  385

Query  384   SSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  259
             SSKDE IKISF  LRRLVLEAVTFGSFLWDVES VDSRYHFV
Sbjct  386   SSKDEHIKISFKGLRRLVLEAVTFGSFLWDVESHVDSRYHFV  427



>ref|XP_010687245.1| PREDICTED: uncharacterized protein LOC104901374 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010687246.1| PREDICTED: uncharacterized protein LOC104901374 [Beta vulgaris 
subsp. vulgaris]
Length=420

 Score =   458 bits (1178),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 257/425 (60%), Positives = 314/425 (74%), Gaps = 19/425 (4%)
 Frame = -2

Query  1497  MEMTTSLRSSITVGCGPVKSGRRFTTDAPG---FVKFGSKALLSAPS--IKVKLGNRRVA  1333
             ME  T LRS +++   P K   R +   P    F++F +    S  +   +VKL    ++
Sbjct  1     MEAATVLRSPLSISI-PQKLASRPSVSVPNGSSFMRFTNNFRFSKSTSPCRVKLEGGSLS  59

Query  1332  FGSTKCNSIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQL  1153
               S K   +RAS   SNS  S  PIAPL+LESP+GQFL+QILVSHPHLV AAVDQQLEQL
Sbjct  60    SRSRKSLMVRASKS-SNSFDSTAPIAPLQLESPVGQFLSQILVSHPHLVPAAVDQQLEQL  118

Query  1152  QTDRNLEKQNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVP  973
             QT+     ++EKQ +EPSASGTD+VLYRRIAEVK NERRK LEEILY LVVQKFMDA++ 
Sbjct  119   QTN----CESEKQKEEPSASGTDLVLYRRIAEVKENERRKTLEEILYTLVVQKFMDANIS  174

Query  972   LVPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNANSSV-QIN  796
             L+P+I+  S N++  +D  PS DE+L  +HSPEAYEMIQNHL+LILGNRS  ++SV QI+
Sbjct  175   LIPSISPSSANATDRVDVWPSLDEKLVEVHSPEAYEMIQNHLALILGNRSGDSTSVAQIS  234

Query  795   KLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLD-KEDSGIQQVGG-----Dssd  634
             KLRVGQVYAASVM+GYFLKR+DQRFQLEK MK+LP+ +D +E+  + + GG     DS+ 
Sbjct  235   KLRVGQVYAASVMFGYFLKRIDQRFQLEKAMKILPEQMDARENELMIEDGGSMASEDSTS  294

Query  633   tslrsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINI  454
                  +  HPEV S+   G+   GF   +KPSRLR+YVM+FD ETL +YATIRSKEA+ I
Sbjct  295   YYQDHAQVHPEVSSFT-SGINDGGFDQGVKPSRLRSYVMAFDAETLAKYATIRSKEAVTI  353

Query  453   IEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDS  274
             IEKHTEALFG+P+I +T QGTID S+DE IKI FS LRRLVLEAVTFGSFLWDVES VDS
Sbjct  354   IEKHTEALFGKPDIVLTAQGTIDPSRDEHIKIGFSGLRRLVLEAVTFGSFLWDVESYVDS  413

Query  273   RYHFV  259
             R+H V
Sbjct  414   RHHLV  418



>ref|XP_002885230.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61489.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=426

 Score =   457 bits (1176),  Expect = 6e-153, Method: Compositional matrix adjust.
 Identities = 237/336 (71%), Positives = 281/336 (84%), Gaps = 9/336 (3%)
 Frame = -2

Query  1263  PIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTD  1084
             PIAPL+L+SP GQFL+QILVSHPHLV AAV+QQLEQLQTDR+ + QN+   D  S  GTD
Sbjct  97    PIAPLQLQSPAGQFLSQILVSHPHLVPAAVEQQLEQLQTDRDSDGQNK---DASSVPGTD  153

Query  1083  IVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPSKD  904
             IVLYRRIAEVK NERR+ LEEILYALVVQKFM+A+V LVP+++  S + SG +DT P+K 
Sbjct  154   IVLYRRIAEVKENERRRTLEEILYALVVQKFMEANVSLVPSVSP-SSDPSGRVDTWPTKV  212

Query  903   EQLARLHSPEAYEMIQNHLSLILGNR-SNANSSVQINKLRVGQVYAASVMYGYFLKRVDQ  727
             E+L RLHSPE YEMI NHL+LILG+R  + NS  QI+KLRVGQVYAASVMYGYFLKRVDQ
Sbjct  213   EKLERLHSPEMYEMIHNHLALILGSRMGDLNSVAQISKLRVGQVYAASVMYGYFLKRVDQ  272

Query  726   RFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEM  547
             RFQLEK MK+LP GLD+  + ++Q       T+ ++  SHPEV S+  GG+ ++GFG+E+
Sbjct  273   RFQLEKTMKILPGGLDESKTSVEQT---EEKTTYQAVSSHPEVGSFA-GGVSAKGFGSEI  328

Query  546   KPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDEL  367
             KPSRLR+YVMSFD ETLQRYATIRS+EA+ IIEKHTEALFG+PEI ITP+GT+DSSKDE 
Sbjct  329   KPSRLRSYVMSFDAETLQRYATIRSREAVGIIEKHTEALFGKPEIVITPEGTVDSSKDEQ  388

Query  366   IKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  259
             IKISF  ++RLVLEAVTFGSFLWDVES VD+RYHFV
Sbjct  389   IKISFGGMKRLVLEAVTFGSFLWDVESHVDARYHFV  424



>gb|AAL32564.1| Unknown protein [Arabidopsis thaliana]
 gb|AAM13275.1| unknown protein [Arabidopsis thaliana]
Length=421

 Score =   456 bits (1173),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 235/336 (70%), Positives = 280/336 (83%), Gaps = 8/336 (2%)
 Frame = -2

Query  1263  PIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTD  1084
             PIAPL+L+SP GQFL+QILVSHPHLV AAV+QQLEQLQTDR+ + QN+   D  S  GTD
Sbjct  91    PIAPLQLQSPAGQFLSQILVSHPHLVPAAVEQQLEQLQTDRDSQGQNK---DSASVPGTD  147

Query  1083  IVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPSKD  904
             IVLYRRIAE+K NERR+ LEEILYALVVQKFM+A+V LVP+++  S + SG +DT P+K 
Sbjct  148   IVLYRRIAELKENERRRTLEEILYALVVQKFMEANVSLVPSVSP-SSDPSGRVDTWPTKV  206

Query  903   EQLARLHSPEAYEMIQNHLSLILGNR-SNANSSVQINKLRVGQVYAASVMYGYFLKRVDQ  727
             E+L RLHSPE YEMI NHL+LILG+R  + NS  QI+KLRVGQVYAASVMYGYFLKRVDQ
Sbjct  207   EKLERLHSPEMYEMIHNHLALILGSRMGDLNSVAQISKLRVGQVYAASVMYGYFLKRVDQ  266

Query  726   RFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEM  547
             RFQLEK MK+LP G D+  + ++Q  G  + T   +  SHPEV ++  GG+ ++GFG+E+
Sbjct  267   RFQLEKTMKILPGGSDESKTSVEQAEG--TATYQAAVSSHPEVGAFA-GGVSAKGFGSEI  323

Query  546   KPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDEL  367
             KPSRLR+YVMSFD ETLQRYATIRS+EA+ IIEKHTEALFG+PEI ITP+GT+DSSKDE 
Sbjct  324   KPSRLRSYVMSFDAETLQRYATIRSREAVGIIEKHTEALFGKPEIVITPEGTVDSSKDEQ  383

Query  366   IKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  259
             IKISF  ++RLVLEAVTFGSFLWDVES VD+RYHFV
Sbjct  384   IKISFGGMKRLVLEAVTFGSFLWDVESHVDARYHFV  419



>dbj|BAF01343.1| hypothetical protein [Arabidopsis thaliana]
Length=421

 Score =   456 bits (1172),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 235/336 (70%), Positives = 280/336 (83%), Gaps = 8/336 (2%)
 Frame = -2

Query  1263  PIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTD  1084
             PIAPL+L+SP GQFL+QILVSHPHLV AAV+QQLEQLQTDR+ + QN+   D  S  GTD
Sbjct  91    PIAPLQLQSPAGQFLSQILVSHPHLVPAAVEQQLEQLQTDRDSQGQNK---DSASVPGTD  147

Query  1083  IVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPSKD  904
             IVLYRRIAE+K NERR+ LEEILYALVVQKFM+A+V LVP+++  S + SG +DT P+K 
Sbjct  148   IVLYRRIAELKENERRRTLEEILYALVVQKFMEANVSLVPSVSP-SSDPSGRVDTWPTKV  206

Query  903   EQLARLHSPEAYEMIQNHLSLILGNR-SNANSSVQINKLRVGQVYAASVMYGYFLKRVDQ  727
             E+L RLHSPE YEMI NHL+LILG+R  + NS  QI+KLRVGQVYAASVMYGYFLKRVDQ
Sbjct  207   EKLERLHSPEMYEMIHNHLALILGSRMGDLNSVAQISKLRVGQVYAASVMYGYFLKRVDQ  266

Query  726   RFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEM  547
             RFQLEK MK+LP G D+  + ++Q  G  + T   +  SHPEV ++  GG+ ++GFG+E+
Sbjct  267   RFQLEKTMKILPGGSDESKTSVEQAEG--TATYQAAVSSHPEVGAFA-GGVSAKGFGSEI  323

Query  546   KPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDEL  367
             KPSRLR+YVMSFD ETLQRYATIRS+EA+ IIEKHTEALFG+PEI ITP+GT+DSSKDE 
Sbjct  324   KPSRLRSYVMSFDAETLQRYATIRSREAVGIIEKHTEALFGKPEIVITPEGTVDSSKDEQ  383

Query  366   IKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  259
             IKISF  ++RLVLEAVTFGSFLWDVES VD+RYHFV
Sbjct  384   IKISFGGMKRLVLEAVTFGSFLWDVESHVDARYHFV  419



>ref|NP_566588.1| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAB02703.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAM20406.1| unknown protein [Arabidopsis thaliana]
 gb|AEE76008.1| uncharacterized protein AT3G17800 [Arabidopsis thaliana]
Length=421

 Score =   456 bits (1172),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 235/336 (70%), Positives = 280/336 (83%), Gaps = 8/336 (2%)
 Frame = -2

Query  1263  PIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTD  1084
             PIAPL+L+SP GQFL+QILVSHPHLV AAV+QQLEQLQTDR+ + QN+   D  S  GTD
Sbjct  91    PIAPLQLQSPAGQFLSQILVSHPHLVPAAVEQQLEQLQTDRDSQGQNK---DSASVPGTD  147

Query  1083  IVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPSKD  904
             IVLYRRIAE+K NERR+ LEEILYALVVQKFM+A+V LVP+++  S + SG +DT P+K 
Sbjct  148   IVLYRRIAELKENERRRTLEEILYALVVQKFMEANVSLVPSVSP-SSDPSGRVDTWPTKV  206

Query  903   EQLARLHSPEAYEMIQNHLSLILGNR-SNANSSVQINKLRVGQVYAASVMYGYFLKRVDQ  727
             E+L RLHSPE YEMI NHL+LILG+R  + NS  QI+KLRVGQVYAASVMYGYFLKRVDQ
Sbjct  207   EKLERLHSPEMYEMIHNHLALILGSRMGDLNSVAQISKLRVGQVYAASVMYGYFLKRVDQ  266

Query  726   RFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEM  547
             RFQLEK MK+LP G D+  + ++Q  G  + T   +  SHPEV ++  GG+ ++GFG+E+
Sbjct  267   RFQLEKTMKILPGGSDESKTSVEQAEG--TATYQAAVSSHPEVGAFA-GGVSAKGFGSEI  323

Query  546   KPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDEL  367
             KPSRLR+YVMSFD ETLQRYATIRS+EA+ IIEKHTEALFG+PEI ITP+GT+DSSKDE 
Sbjct  324   KPSRLRSYVMSFDAETLQRYATIRSREAVGIIEKHTEALFGKPEIVITPEGTVDSSKDEQ  383

Query  366   IKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  259
             IKISF  ++RLVLEAVTFGSFLWDVES VD+RYHFV
Sbjct  384   IKISFGGMKRLVLEAVTFGSFLWDVESHVDARYHFV  419



>ref|NP_001078173.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE76009.1| uncharacterized protein AT3G17800 [Arabidopsis thaliana]
Length=427

 Score =   456 bits (1172),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 235/336 (70%), Positives = 280/336 (83%), Gaps = 8/336 (2%)
 Frame = -2

Query  1263  PIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTD  1084
             PIAPL+L+SP GQFL+QILVSHPHLV AAV+QQLEQLQTDR+ + QN+   D  S  GTD
Sbjct  97    PIAPLQLQSPAGQFLSQILVSHPHLVPAAVEQQLEQLQTDRDSQGQNK---DSASVPGTD  153

Query  1083  IVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPSKD  904
             IVLYRRIAE+K NERR+ LEEILYALVVQKFM+A+V LVP+++  S + SG +DT P+K 
Sbjct  154   IVLYRRIAELKENERRRTLEEILYALVVQKFMEANVSLVPSVSP-SSDPSGRVDTWPTKV  212

Query  903   EQLARLHSPEAYEMIQNHLSLILGNR-SNANSSVQINKLRVGQVYAASVMYGYFLKRVDQ  727
             E+L RLHSPE YEMI NHL+LILG+R  + NS  QI+KLRVGQVYAASVMYGYFLKRVDQ
Sbjct  213   EKLERLHSPEMYEMIHNHLALILGSRMGDLNSVAQISKLRVGQVYAASVMYGYFLKRVDQ  272

Query  726   RFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEM  547
             RFQLEK MK+LP G D+  + ++Q  G  + T   +  SHPEV ++  GG+ ++GFG+E+
Sbjct  273   RFQLEKTMKILPGGSDESKTSVEQAEG--TATYQAAVSSHPEVGAFA-GGVSAKGFGSEI  329

Query  546   KPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDEL  367
             KPSRLR+YVMSFD ETLQRYATIRS+EA+ IIEKHTEALFG+PEI ITP+GT+DSSKDE 
Sbjct  330   KPSRLRSYVMSFDAETLQRYATIRSREAVGIIEKHTEALFGKPEIVITPEGTVDSSKDEQ  389

Query  366   IKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  259
             IKISF  ++RLVLEAVTFGSFLWDVES VD+RYHFV
Sbjct  390   IKISFGGMKRLVLEAVTFGSFLWDVESHVDARYHFV  425



>ref|XP_009135549.1| PREDICTED: uncharacterized protein LOC103859727 [Brassica rapa]
Length=408

 Score =   454 bits (1168),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 244/395 (62%), Positives = 287/395 (73%), Gaps = 21/395 (5%)
 Frame = -2

Query  1428  FTTDAPGFVKFGSKALLSAPSIKVKLGNRRVAFGSTKCNSIRASLPLSNSGGSAM----P  1261
              TT APGF   GSK  L          ++ +   ST  +  R S  +  S  S      P
Sbjct  28    LTTSAPGFTPSGSKLQLRLKQNPFTRFSKPLQ-SSTTASKTRRSFVVKASAASDDASSKP  86

Query  1260  IAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDI  1081
             IAPL+LESP GQFL+QILVSHPHLV AAV+QQLEQLQTDR+ + QN   +   S  GTDI
Sbjct  87    IAPLQLESPAGQFLSQILVSHPHLVPAAVEQQLEQLQTDRDSQGQN--TDSSSSLPGTDI  144

Query  1080  VLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPSKDE  901
             VLYRRIAE+K NERR+ LEEILYALVVQKFM+A+V L+P+IT  S + SG +DT P+K E
Sbjct  145   VLYRRIAELKENERRRTLEEILYALVVQKFMEANVSLIPSITPSSSDPSGRVDTWPTKVE  204

Query  900   QLARLHSPEAYEMIQNHLSLILGNR-SNANSSVQINKLRVGQVYAASVMYGYFLKRVDQR  724
             +L +LHSPE YEMI NHL+LILG+R  +  S  Q +KLRVGQVYAASV+YGYFLKRVDQR
Sbjct  205   KLEQLHSPEMYEMIHNHLALILGSRIGDLTSVAQTSKLRVGQVYAASVIYGYFLKRVDQR  264

Query  723   FQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMK  544
             FQLEK MK+LP     E+   + V              HPEV S+  GG+ ++GFG+E+K
Sbjct  265   FQLEKTMKLLPGSGGAEEKQPEDVSS------------HPEVGSFA-GGVSAKGFGSEIK  311

Query  543   PSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELI  364
             PSRLRTYVMSFD ETLQRYATIRS+EA+ IIEKHTEALFG+PEI ITPQG +DSS DE I
Sbjct  312   PSRLRTYVMSFDSETLQRYATIRSREAVGIIEKHTEALFGKPEIVITPQGIVDSSNDEQI  371

Query  363   KISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  259
             KISF  ++RLVLEAVTFGSFLWDVES VD+RY FV
Sbjct  372   KISFGGMKRLVLEAVTFGSFLWDVESHVDARYQFV  406



>gb|AGV54799.1| hypothetical protein [Phaseolus vulgaris]
Length=409

 Score =   453 bits (1166),  Expect = 9e-152, Method: Compositional matrix adjust.
 Identities = 245/388 (63%), Positives = 293/388 (76%), Gaps = 17/388 (4%)
 Frame = -2

Query  1404  VKFGSKALLSAPSIKVKLGNRRVAFGSTKCNSIRASLPLSNSGGSAMPIAPLKLESPIGQ  1225
             ++F +K  LS      K G+ R   G+ +   +RA+     S   +  IAPLKLESPIGQ
Sbjct  31    LRFSTK--LSTSVAISKHGHGRHCVGTRRGFVVRAASFTPESSEPSSKIAPLKLESPIGQ  88

Query  1224  FLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIAEVKAN  1045
             FL+QIL+SHPHLV AAV+QQLEQ QTD +     +KQ  EP ASGTD+VLYRRIAEVKA 
Sbjct  89    FLSQILISHPHLVPAAVEQQLEQFQTDLD----GDKQKREPPASGTDLVLYRRIAEVKAK  144

Query  1044  ERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYE  865
             ER+ ALEEILYALVVQKFMDAD+ L+P++T    N SG +D+ PS+D +L  LHSPEAYE
Sbjct  145   ERKTALEEILYALVVQKFMDADISLIPSLTP---NQSGRVDSWPSEDGKLEELHSPEAYE  201

Query  864   MIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQ  688
             MIQNHL+LILG+R   ++SV QI+K+RVGQVYAAS+MYGYFLKRV QR+QLEK MK+LP 
Sbjct  202   MIQNHLALILGSRLGDSTSVAQISKIRVGQVYAASIMYGYFLKRVVQRYQLEKTMKILPN  261

Query  687   GLDKEDSGIQQVGGDssd----tslrsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYV  520
                 E++ IQQ   D S      S     SHPE+ + P G + SRGFG   K SRLRTYV
Sbjct  262   V--AEENSIQQTVIDESRISGGMSPSHVMSHPEISNLPGGSISSRGFGYGSKVSRLRTYV  319

Query  519   MSFDGETLQRYATIRSKEAINIIEKHTEALFGRP-EISITPQGTIDSSKDELIKISFSSL  343
             MSFD +TLQRYAT+RSKE++++IEKHTEALFGRP EI +TP+G IDSSKDE IKISF SL
Sbjct  320   MSFDTDTLQRYATLRSKESLSLIEKHTEALFGRPDEIVVTPEGVIDSSKDESIKISFGSL  379

Query  342   RRLVLEAVTFGSFLWDVESSVDSRYHFV  259
             +RLVLEAVTFGSFLWDVES VD+RYHFV
Sbjct  380   KRLVLEAVTFGSFLWDVESYVDARYHFV  407



>emb|CDX82345.1| BnaA03g34760D [Brassica napus]
Length=406

 Score =   451 bits (1161),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 230/336 (68%), Positives = 268/336 (80%), Gaps = 17/336 (5%)
 Frame = -2

Query  1263  PIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTD  1084
             PIAPL+LESP GQFL+QILVSHPHLV AAV+QQLEQLQTDR+ + QN   +   S  GTD
Sbjct  85    PIAPLQLESPAGQFLSQILVSHPHLVPAAVEQQLEQLQTDRDSQGQN--TDTSSSLPGTD  142

Query  1083  IVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPSKD  904
             IVLYRRIAE+K NERR+ LEEILYALVVQKFM+A+V L+P+IT PS + SG +DT P+K 
Sbjct  143   IVLYRRIAELKENERRRTLEEILYALVVQKFMEANVSLIPSIT-PSSDPSGRVDTWPTKV  201

Query  903   EQLARLHSPEAYEMIQNHLSLILGNR-SNANSSVQINKLRVGQVYAASVMYGYFLKRVDQ  727
             E+L +LHSPE YEMI NHL+LILG+R  +  S  QI+KLRVGQVYAASV+YGYFLKRVDQ
Sbjct  202   EKLEQLHSPEMYEMIHNHLALILGSRIGDLTSVAQISKLRVGQVYAASVIYGYFLKRVDQ  261

Query  726   RFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEM  547
             RFQLEK MK+LP     E+   + V              HPEV S+  GG+ ++GFG+E+
Sbjct  262   RFQLEKTMKLLPGSGGAEEKQPEDVSS------------HPEVGSFA-GGVSAKGFGSEI  308

Query  546   KPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDEL  367
             KPSRLRTYVMSFD ETLQRYATIRS+EA+ IIEKHTEALFG+PEI ITPQG +DSS DE 
Sbjct  309   KPSRLRTYVMSFDSETLQRYATIRSREAVGIIEKHTEALFGKPEIVITPQGIVDSSNDEQ  368

Query  366   IKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  259
             IKISF  ++RLVLEAVTFGSFLWDVES VD+RY FV
Sbjct  369   IKISFGGMKRLVLEAVTFGSFLWDVESHVDARYQFV  404



>ref|XP_009145005.1| PREDICTED: uncharacterized protein LOC103868678 [Brassica rapa]
 emb|CDY23684.1| BnaA05g17450D [Brassica napus]
Length=407

 Score =   451 bits (1161),  Expect = 5e-151, Method: Compositional matrix adjust.
 Identities = 250/395 (63%), Positives = 296/395 (75%), Gaps = 16/395 (4%)
 Frame = -2

Query  1428  FTTDAPGFVKFGS-KALLSAPSIKVKLGNRRVAFGSTKCNSIRASLPLSNSGGSAMPIAP  1252
              T  +PGF++F S        S  +KL +R     +T   S R+ +  S++  S   IAP
Sbjct  22    LTASSPGFIRFSSGPQFRHRHSTCLKL-SRPSQSRTTSLKSRRSFVVKSSASDS---IAP  77

Query  1251  LKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLY  1072
             L+L+SP+GQFL+QILVSHPHLV AAV+QQLEQLQTDR  E+Q   ++   S  GTDIVLY
Sbjct  78    LELKSPVGQFLSQILVSHPHLVPAAVEQQLEQLQTDREAEEQ--IKDSSSSLPGTDIVLY  135

Query  1071  RRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPSKDEQLA  892
             RRIAEVK  ERRKALEEILYALVVQKFMDA+V LVP+ITS    SSG +DT P++D +L 
Sbjct  136   RRIAEVKEKERRKALEEILYALVVQKFMDANVSLVPSITS----SSGRVDTWPTQDGELE  191

Query  891   RLHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFLKRVDQRFQL  715
             +LHSPE YEMIQNHLS+IL NR    S+V QI+KL VGQVYAASVMYGYFLKR+DQRFQL
Sbjct  192   QLHSPEVYEMIQNHLSIILKNREGDLSTVAQISKLGVGQVYAASVMYGYFLKRIDQRFQL  251

Query  714   EKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPD--GGM-GSRGFGTEMK  544
             EK MK+LP G D+ ++ I+Q G ++  +    +    + VS     GG+  S G  +E K
Sbjct  252   EKTMKILPGGSDEGETSIEQAGRETERSFYEEAEETYQAVSSNQEVGGINASGGSSSETK  311

Query  543   PSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELI  364
              SRL+TYVMSFDGETLQRYATIRS+EA+ IIEKHTEALFGRPEI ITPQG IDSSKDE +
Sbjct  312   QSRLKTYVMSFDGETLQRYATIRSREAVGIIEKHTEALFGRPEIVITPQG-IDSSKDEHM  370

Query  363   KISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  259
             KISF  L+RLVLEAVTFGSFLWDVES VDSRYHFV
Sbjct  371   KISFKGLKRLVLEAVTFGSFLWDVESHVDSRYHFV  405



>gb|KHN43658.1| hypothetical protein glysoja_027724, partial [Glycine soja]
Length=370

 Score =   449 bits (1156),  Expect = 8e-151, Method: Compositional matrix adjust.
 Identities = 245/375 (65%), Positives = 284/375 (76%), Gaps = 22/375 (6%)
 Frame = -2

Query  1356  KLGNRRVAFGSTKCNSIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAA  1177
             K G+ R   GS +   +RA+     S   +  IAPLKLESPIGQFL+QIL+SHPHLV AA
Sbjct  7     KQGHARHRVGSKRGFVVRAASFTPESSEPSSKIAPLKLESPIGQFLSQILISHPHLVPAA  66

Query  1176  VDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQ  997
             V+QQLEQ QTD +     +KQ  EPSASGTD+VLYRRIAEVKA ERR ALEEILYALVVQ
Sbjct  67    VEQQLEQFQTDCD----GDKQKKEPSASGTDLVLYRRIAEVKAKERRTALEEILYALVVQ  122

Query  996   KFMDADVPLVPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNA  817
             KFMDA++ L+P++T    N SG +D+ PS+D +L  LHSPEAYEMIQNHL+LILGNR   
Sbjct  123   KFMDANISLIPSLTP---NHSGQVDSWPSEDGKLEELHSPEAYEMIQNHLALILGNRLGD  179

Query  816   NSSV-QINKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQV----  652
             ++SV QI+K+RVGQVYAAS+MYGYFLKRV QRFQLEK MK+LP G   E++ IQ      
Sbjct  180   STSVAQISKIRVGQVYAASIMYGYFLKRVVQRFQLEKTMKILPNG--AEENSIQHTVVDD  237

Query  651   ----GGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYA  484
                 GGD     +     HPEV + P GG+ S GFG   K SRLRTYVMSFD ETLQRYA
Sbjct  238   SRISGGDGRSHVMS----HPEVSTLPGGGISSGGFGYGSKVSRLRTYVMSFDSETLQRYA  293

Query  483   TIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSF  304
             TIRSKEA++IIEKHTEALFGRPEI +TP+G IDS  D+ IKISF  L+RLVLEA+TFGSF
Sbjct  294   TIRSKEALSIIEKHTEALFGRPEIVVTPEGVIDSLTDQSIKISFGGLKRLVLEAITFGSF  353

Query  303   LWDVESSVDSRYHFV  259
             LWDVES VDSRYHFV
Sbjct  354   LWDVESYVDSRYHFV  368



>ref|XP_003534126.1| PREDICTED: uncharacterized protein LOC100802697 isoformX1 [Glycine 
max]
 ref|XP_003534127.1| PREDICTED: uncharacterized protein LOC100802697 isoformX2 [Glycine 
max]
 ref|XP_006587458.1| PREDICTED: uncharacterized protein LOC100802697 isoform X3 [Glycine 
max]
Length=414

 Score =   450 bits (1158),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 252/404 (62%), Positives = 291/404 (72%), Gaps = 34/404 (8%)
 Frame = -2

Query  1443  KSGRRFTTDAPGFVKFGSKALLSAPSIKVKLGNRRVAFGSTKCNSIRASLPLSNSGGSAM  1264
             +S  RF+T     V F             K G+ R   GS +   +RA+     S     
Sbjct  34    RSNLRFSTKLSTSVSFS------------KQGHARHRVGSKRGFVVRAASFTPESSEPTS  81

Query  1263  PIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTD  1084
              IAPLKLESPIGQFL+QIL+SHPHLV AAV+QQLEQ QTD +     +KQ  EPSASGTD
Sbjct  82    KIAPLKLESPIGQFLSQILISHPHLVPAAVEQQLEQFQTDCD----GDKQKKEPSASGTD  137

Query  1083  IVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPSKD  904
             +VLYRRIAEVKA ERR ALEEILYALVVQKFMDA++ L+P++T    N SG +D+ PS+D
Sbjct  138   LVLYRRIAEVKAKERRTALEEILYALVVQKFMDANISLIPSLTP---NHSGQVDSWPSED  194

Query  903   EQLARLHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFLKRVDQ  727
              +L  LHSPEAYEMIQNHL+LILGNR   ++SV QI+K+RVGQVYAAS+MYGYFLK V Q
Sbjct  195   GKLEELHSPEAYEMIQNHLALILGNRLGDSTSVAQISKIRVGQVYAASIMYGYFLKWVVQ  254

Query  726   RFQLEKNMKVLPQGLDKEDSGIQQV--------GGDssdtslrsspSHPEVVSWPDGGMG  571
             RFQLEK MK+LP G   E++ IQ          GGD     +     HPEV + P GG+ 
Sbjct  255   RFQLEKTMKILPNG--AEENSIQHTVVDDSRISGGDGRSHVMS----HPEVSTLPGGGIS  308

Query  570   SRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGT  391
             S GFG   K SRLRTYVMSFD ETLQRYATIRSKEA++IIEKHTEALFGRPEI +TP+G 
Sbjct  309   SGGFGYGSKVSRLRTYVMSFDSETLQRYATIRSKEALSIIEKHTEALFGRPEIVVTPEGV  368

Query  390   IDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  259
             IDS  DE IKISFS L+RLVLEA+TFGSFLWDVES VDSRYHFV
Sbjct  369   IDSLTDESIKISFSGLKRLVLEAITFGSFLWDVESYVDSRYHFV  412



>ref|XP_004513343.1| PREDICTED: uncharacterized protein LOC101494659 isoform X1 [Cicer 
arietinum]
 ref|XP_004513344.1| PREDICTED: uncharacterized protein LOC101494659 isoform X2 [Cicer 
arietinum]
Length=418

 Score =   450 bits (1158),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 243/385 (63%), Positives = 293/385 (76%), Gaps = 15/385 (4%)
 Frame = -2

Query  1398  FGSKALLSAPSIKVKLGNRRVAFGSTKCNSIRASLPLSNSGGSAMPIAPLKLESPIGQFL  1219
             F  K   S PS K   G R+++ GS +   +RA+   + S GS+  IAPLKLESPIGQFL
Sbjct  42    FSCKLHASVPSSKQGHG-RKLSVGSKRVFVVRAASSSAESSGSSSNIAPLKLESPIGQFL  100

Query  1218  TQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIAEVKANER  1039
             +QILVSHPHL+SAAV++QLEQ QTDR+ ++Q EK    PSASGTD+VLYRRIAEVKA ER
Sbjct  101   SQILVSHPHLMSAAVERQLEQFQTDRDGDEQKEK----PSASGTDLVLYRRIAEVKAKER  156

Query  1038  RKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMI  859
             RKA+EEILY LVVQKFMDADV L+P++     + SG +D+ PS+D +L  LHSPEAYEMI
Sbjct  157   RKAIEEILYTLVVQKFMDADVSLIPSVRP---HPSGQVDSWPSEDGKLEELHSPEAYEMI  213

Query  858   QNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGL  682
             Q+HL+L+LGNR   ++SV QI+KLRVGQVYAASVMYGYFLKRV QRFQLEK MK+LP   
Sbjct  214   QSHLALLLGNRIGDSASVAQISKLRVGQVYAASVMYGYFLKRVVQRFQLEKTMKILPDA-  272

Query  681   DKEDSGIQQVGGDssdtsl----rsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMS  514
              +E+S I Q   D +  +          HPEV +W   G+ S  FG E   SRLR+Y+MS
Sbjct  273   -EEESTIGQTMEDETRIAGLEMPSQVTPHPEVPTWSGSGISSGAFGQETTVSRLRSYMMS  331

Query  513   FDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRL  334
             FD ETLQRYATIRSKE+++IIEKHT+ALFG PEI++T +  I+SSKDE+IKIS   L+RL
Sbjct  332   FDLETLQRYATIRSKESVSIIEKHTDALFGIPEIAVTAEEKINSSKDEIIKISIGGLKRL  391

Query  333   VLEAVTFGSFLWDVESSVDSRYHFV  259
             VLEAVTFGSFLWDVES VDSRYHFV
Sbjct  392   VLEAVTFGSFLWDVESYVDSRYHFV  416



>emb|CDY58279.1| BnaCnng32840D [Brassica napus]
Length=425

 Score =   450 bits (1157),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 234/342 (68%), Positives = 275/342 (80%), Gaps = 11/342 (3%)
 Frame = -2

Query  1260  IAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDI  1081
             IAPL+L+SP+GQFL+QILVSHPHLV AA++QQLEQLQTDR  E +   ++   S  GTDI
Sbjct  85    IAPLQLKSPVGQFLSQILVSHPHLVPAAIEQQLEQLQTDR--EAEEHIKDSFSSLPGTDI  142

Query  1080  VLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPSKDE  901
             VLYRRIAEVK  ERRKALEEILYALVVQKFMDA+V LVP+ITS S + SG +DT P++D 
Sbjct  143   VLYRRIAEVKEKERRKALEEILYALVVQKFMDANVSLVPSITSSSTDPSGRVDTWPTQDG  202

Query  900   QLARLHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFLKRVDQR  724
             +L +LHSPE YEMIQNHLS+IL NR    S+V QI+KL +GQVYAASVMYGYFLKR+DQR
Sbjct  203   ELEQLHSPEVYEMIQNHLSIILKNREGDLSTVAQISKLGIGQVYAASVMYGYFLKRIDQR  262

Query  723   FQLEKNMKVLPQGLDKEDSGIQQVGGDs-------sdtslrsspSHPEVVSWPDGGMGSR  565
             FQLEK MK+LP G D+ ++ I+Q G ++       ++ + ++  S+ EV S+  G   S 
Sbjct  263   FQLEKTMKILPGGSDEGETSIEQAGRETQRSFYEEAEETYQAVSSNQEVGSFVGGINASG  322

Query  564   GFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTID  385
             G  +E K SRL+TYVMSFDGETLQRYATIRS+EA+ IIEKHTEALFGRPEI ITPQG ID
Sbjct  323   GSSSETKQSRLKTYVMSFDGETLQRYATIRSREAVGIIEKHTEALFGRPEIVITPQG-ID  381

Query  384   SSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  259
             SSKDE IKISF  L+RLVLEAVTFGSFLWDVES VDSRYHFV
Sbjct  382   SSKDEHIKISFKGLKRLVLEAVTFGSFLWDVESHVDSRYHFV  423



>ref|XP_003528983.1| PREDICTED: uncharacterized protein LOC100777314 isoform X1 [Glycine 
max]
 ref|XP_006583474.1| PREDICTED: uncharacterized protein LOC100777314 isoform X2 [Glycine 
max]
 ref|XP_006583475.1| PREDICTED: uncharacterized protein LOC100777314 isoform X3 [Glycine 
max]
 ref|XP_006583476.1| PREDICTED: uncharacterized protein LOC100777314 isoform X4 [Glycine 
max]
 gb|KHN25098.1| hypothetical protein glysoja_027512 [Glycine soja]
Length=408

 Score =   448 bits (1153),  Expect = 8e-150, Method: Compositional matrix adjust.
 Identities = 248/387 (64%), Positives = 290/387 (75%), Gaps = 16/387 (4%)
 Frame = -2

Query  1404  VKFGSKALLSAPSIKVKLGNRRVAFGSTKCNSIRASLPLSNSGGSAMPIAPLKLESPIGQ  1225
             ++F +K  LS      K G+ R   G+ +   +RA+     S   +  IAPLKLESPIGQ
Sbjct  31    LRFSTK--LSTSVAISKHGHGRHCVGTRRGFVVRAASFTPESSEPSSKIAPLKLESPIGQ  88

Query  1224  FLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIAEVKAN  1045
             FL+QIL+SHPHLV AAV+QQLEQ QTD +     +KQ  EPSASGTD+VLYRRIAEVKA 
Sbjct  89    FLSQILISHPHLVPAAVEQQLEQFQTDLD----GDKQKKEPSASGTDLVLYRRIAEVKAK  144

Query  1044  ERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYE  865
             ER+ ALEEILYALVVQKFMDA + L+P++T    N SG +D+ PS+D +L  LHSPEAYE
Sbjct  145   ERKTALEEILYALVVQKFMDASISLIPSLTP---NHSGQVDSWPSEDGKLEELHSPEAYE  201

Query  864   MIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQ  688
             MIQNHL+LILGNR   ++SV QI+K+RVGQVYAAS+MYGYFLKRV QRFQLE+ MK+LP 
Sbjct  202   MIQNHLALILGNRLGDSTSVAQISKIRVGQVYAASIMYGYFLKRVVQRFQLERTMKILPN  261

Query  687   GLDKEDSGIQQVGGDssdts----lrsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYV  520
                 E++ IQQ   D S            SHPEV + P GG+ S GFG   K SRLRTYV
Sbjct  262   A--TEENSIQQTVVDDSRIRGGEGHSHVMSHPEVSTLPGGGISSGGFGYGSKVSRLRTYV  319

Query  519   MSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLR  340
             MSFD ETLQRYATIRSKEA++IIEKHTEALFGRPEI +TPQG IDSS D+ IKISF  L+
Sbjct  320   MSFDSETLQRYATIRSKEALSIIEKHTEALFGRPEIVVTPQGVIDSSTDDNIKISFGGLK  379

Query  339   RLVLEAVTFGSFLWDVESSVDSRYHFV  259
             RLVLEA+TFGSFLWDVES VDSRYHFV
Sbjct  380   RLVLEAITFGSFLWDVESYVDSRYHFV  406



>gb|ACU24516.1| unknown [Glycine max]
Length=408

 Score =   448 bits (1153),  Expect = 8e-150, Method: Compositional matrix adjust.
 Identities = 248/387 (64%), Positives = 290/387 (75%), Gaps = 16/387 (4%)
 Frame = -2

Query  1404  VKFGSKALLSAPSIKVKLGNRRVAFGSTKCNSIRASLPLSNSGGSAMPIAPLKLESPIGQ  1225
             ++F +K  LS      K G+ R   G+ +   +RA+     S   +  IAPLKLESPIGQ
Sbjct  31    LRFSTK--LSTSVAISKHGHGRHCVGTRRGFVVRAASFTPESSEPSSKIAPLKLESPIGQ  88

Query  1224  FLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIAEVKAN  1045
             FL+QIL+SHPHLV AAV+QQLEQ QTD +     +KQ  EPSASGTD+VLYRRIAEVKA 
Sbjct  89    FLSQILISHPHLVPAAVEQQLEQFQTDLD----GDKQKKEPSASGTDLVLYRRIAEVKAK  144

Query  1044  ERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYE  865
             ER+ ALEEILYALVVQKFMDA + L+P++T    N SG +D+ PS+D +L  LHSPEAYE
Sbjct  145   ERKTALEEILYALVVQKFMDASISLIPSLTP---NHSGQVDSWPSEDGKLEELHSPEAYE  201

Query  864   MIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQ  688
             MIQNHL+LILGNR   ++SV QI+K+RVGQVYAAS+MYGYFLKRV QRFQLE+ MK+LP 
Sbjct  202   MIQNHLALILGNRLGDSTSVAQISKIRVGQVYAASIMYGYFLKRVVQRFQLERTMKILPN  261

Query  687   GLDKEDSGIQQVGGDssdts----lrsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYV  520
                 E++ IQQ   D S            SHPEV + P GG+ S GFG   K SRLRTYV
Sbjct  262   A--TEENSIQQTVVDDSRIRGGEGHSHVMSHPEVSTLPGGGISSGGFGHGSKVSRLRTYV  319

Query  519   MSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLR  340
             MSFD ETLQRYATIRSKEA++IIEKHTEALFGRPEI +TPQG IDSS D+ IKISF  L+
Sbjct  320   MSFDSETLQRYATIRSKEALSIIEKHTEALFGRPEIVVTPQGVIDSSTDDNIKISFGGLK  379

Query  339   RLVLEAVTFGSFLWDVESSVDSRYHFV  259
             RLVLEA+TFGSFLWDVES VDSRYHFV
Sbjct  380   RLVLEAITFGSFLWDVESYVDSRYHFV  406



>ref|XP_006849427.1| PREDICTED: uncharacterized protein LOC18439191 [Amborella trichopoda]
 ref|XP_011625238.1| PREDICTED: uncharacterized protein LOC18439191 [Amborella trichopoda]
 ref|XP_011625240.1| PREDICTED: uncharacterized protein LOC18439191 [Amborella trichopoda]
 gb|ERN11008.1| hypothetical protein AMTR_s00024p00021530 [Amborella trichopoda]
Length=439

 Score =   449 bits (1156),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 241/406 (59%), Positives = 300/406 (74%), Gaps = 32/406 (8%)
 Frame = -2

Query  1398  FGSKALLSAPSIKV-KLGNRRVAFGSTKCNSIRASLPLSNSGGSAMPIAPLKLESPIGQF  1222
             F + +L  +PS+ + K  + R+A  S +    +AS+   +S G + PIAPL++ESPIGQF
Sbjct  42    FANSSLKYSPSVVLPKHVHTRMAQRSRRNMVAKASM---DSNGDSGPIAPLQMESPIGQF  98

Query  1221  LTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIAEVKANE  1042
             L+QIL +HPHL+ AAVDQQLEQLQTDR+ E + E    EPS SGTD+VLYRRIAEVKANE
Sbjct  99    LSQILKNHPHLLPAAVDQQLEQLQTDRDSESEKE----EPSPSGTDLVLYRRIAEVKANE  154

Query  1041  RRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEM  862
             RRKALEEI+YAL+VQKFMDA+V L+P+++S   N+S  +DT P++ E+L ++HSPEA +M
Sbjct  155   RRKALEEIIYALIVQKFMDAEVSLIPSVSSSPDNTS-KVDTWPNQVEKLEKMHSPEALQM  213

Query  861   IQNHLSLILGNR-SNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQG  685
             I+NHL+LILGNR S+ +S  QI+KLRVGQVYAASVMYGYFLKRVDQRFQLEK MKVLP G
Sbjct  214   IRNHLALILGNRLSDLSSVAQISKLRVGQVYAASVMYGYFLKRVDQRFQLEKAMKVLPFG  273

Query  684   LDKEDSGIQQVGGD---------ssdtslrsspSHPEVVSWPDGGMGSR-----------  565
             +D  +  ++QV  D          +     +  ++    +W +   GS            
Sbjct  274   VDSGNLSMEQVLADDSGPKDLNNQTKNLKPNDQAYSGNPTWYEASHGSEQDGVDMGVNFS  333

Query  564   --GFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGT  391
               GFG  +K  +LR+YVMSFD ETLQRYATIRSKE+++IIEKHTEALFGRPE+ ITPQGT
Sbjct  334   PGGFGYGLKSYKLRSYVMSFDAETLQRYATIRSKESVSIIEKHTEALFGRPELRITPQGT  393

Query  390   IDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFVAH  253
             +DSSKDE IKISF  L  LVLEAVTFGSFLWDVES VDSRYHFV +
Sbjct  394   VDSSKDENIKISFGGLTTLVLEAVTFGSFLWDVESYVDSRYHFVTN  439



>ref|XP_007160560.1| hypothetical protein PHAVU_002G331900g [Phaseolus vulgaris]
 gb|ESW32554.1| hypothetical protein PHAVU_002G331900g [Phaseolus vulgaris]
Length=405

 Score =   445 bits (1144),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 227/338 (67%), Positives = 270/338 (80%), Gaps = 13/338 (4%)
 Frame = -2

Query  1260  IAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDI  1081
             IAPL+LESP+GQFL+QILV+HPHLV AAVDQQLEQLQTDR+ ++Q E    EPSASGTD+
Sbjct  75    IAPLQLESPVGQFLSQILVNHPHLVPAAVDQQLEQLQTDRDADQQKE----EPSASGTDL  130

Query  1080  VLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPSKDE  901
             VLYRRIAEVKANERRKALEEILYALVVQKFMDA++ L P++T    + SG +D  PS+D 
Sbjct  131   VLYRRIAEVKANERRKALEEILYALVVQKFMDANISLTPSVTP---DISGKVDLWPSEDG  187

Query  900   QLARLHSPEAYEMIQNHLSLILGNR-SNANSSVQINKLRVGQVYAASVMYGYFLKRVDQR  724
             +L +LHS EAYEMI+NHLSLILGN+  +  S  +I+K RVGQVYAASVMYGYFLKRVDQR
Sbjct  188   KLEKLHSHEAYEMIENHLSLILGNKVGDLTSIAEISKFRVGQVYAASVMYGYFLKRVDQR  247

Query  723   FQLEKNMKVLPQGLDKEDSGIQQVGGDs---sdtslrsspSHPEVVSWPDGGMGSRGFGT  553
             FQLEK +KVL    ++E+S  Q    ++    +       SHPEV +WP G +   G G 
Sbjct  248   FQLEKTVKVLTNETEEENSFHQTTMDNARPGVEEDTSQGTSHPEVFNWPGGDVSPGGVGY  307

Query  552   EMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKD  373
              +K +RLR YVMSFDG+TLQRYATIRSKEA++IIEKHTEALFGRPEI +TP+G +  SKD
Sbjct  308   GVKATRLRNYVMSFDGDTLQRYATIRSKEAVSIIEKHTEALFGRPEIVVTPEGAV--SKD  365

Query  372   ELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  259
             E +KISF  L++LVLEAVTFGSFLWDVES VD+RYHFV
Sbjct  366   ENVKISFGGLQKLVLEAVTFGSFLWDVESYVDARYHFV  403



>ref|XP_010487675.1| PREDICTED: uncharacterized protein LOC104765624 [Camelina sativa]
Length=409

 Score =   444 bits (1143),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 231/336 (69%), Positives = 275/336 (82%), Gaps = 12/336 (4%)
 Frame = -2

Query  1263  PIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTD  1084
             PIAPL+LESP GQFL+QIL+SHPHLV AAV+QQLEQLQTDR+ E QN+   D  S  GTD
Sbjct  83    PIAPLQLESPAGQFLSQILLSHPHLVPAAVEQQLEQLQTDRDSEGQNK---DASSVPGTD  139

Query  1083  IVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPSKD  904
             IVLYRRIAE+K NERR+ LEEILYALVVQKFM+A+V LVP+++  S + SG +DT P+K 
Sbjct  140   IVLYRRIAELKENERRRTLEEILYALVVQKFMEANVSLVPSVSP-SSDPSGRVDTWPTKV  198

Query  903   EQLARLHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFLKRVDQ  727
             ++L +LHSPE YEMI NHL+LILG+R    +SV QI+KLRVGQVYAASVMYGYFLKRVDQ
Sbjct  199   DKLEQLHSPEMYEMIHNHLALILGSRMGDLASVAQISKLRVGQVYAASVMYGYFLKRVDQ  258

Query  726   RFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEM  547
             RFQLEK MK+LP GLD   + + Q           +  SHPEV ++  GG+ ++GFG+E+
Sbjct  259   RFQLEKTMKILPGGLDDSKTSVDQT------ERPSAVSSHPEVGAFA-GGVSAKGFGSEI  311

Query  546   KPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDEL  367
             KPSRLR+YVMSFD ETLQRYATIRS+EA+ IIEKHTEALFG+PEI +TP+GT+DSSKDE 
Sbjct  312   KPSRLRSYVMSFDAETLQRYATIRSREAVRIIEKHTEALFGKPEIVLTPEGTVDSSKDEQ  371

Query  366   IKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  259
             I ISF  ++RLVLEAVTFGSFLWDVES VD+RYHFV
Sbjct  372   INISFGGMKRLVLEAVTFGSFLWDVESHVDARYHFV  407



>ref|XP_003525180.1| PREDICTED: uncharacterized protein LOC100817892 isoform X1 [Glycine 
max]
 gb|KHN10526.1| hypothetical protein glysoja_040681 [Glycine soja]
Length=399

 Score =   442 bits (1136),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 227/339 (67%), Positives = 269/339 (79%), Gaps = 15/339 (4%)
 Frame = -2

Query  1260  IAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDI  1081
             IAPL+LESPIGQFL+QIL  HPHLV AAVDQQL QLQTDR+   QN++Q   P    TD+
Sbjct  69    IAPLQLESPIGQFLSQILKDHPHLVPAAVDQQLHQLQTDRDAHLQNQQQPSSP----TDL  124

Query  1080  VLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPSKDE  901
             VLYRRIAEVKANERRKALEEILYALVVQKFMDA++ L+P++T    + SG +D  P++D 
Sbjct  125   VLYRRIAEVKANERRKALEEILYALVVQKFMDANISLIPSVTP---DLSGKVDLWPNEDG  181

Query  900   QLARLHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFLKRVDQR  724
             +L +LHS EAYEMIQNHLSLILGN++   +SV +I+K RVGQVYAASVMYGYFLKRVDQR
Sbjct  182   KLEQLHSDEAYEMIQNHLSLILGNKAGDLTSVAEISKFRVGQVYAASVMYGYFLKRVDQR  241

Query  723   FQLEKNMKVLPQGLDKEDSGIQQVGGDss----dtslrsspSHPEVVSWPDGGMGSRGFG  556
             FQLEK MKVLP   ++E+ G+ +   D++    +       SHPEV +WP G +   GFG
Sbjct  242   FQLEKTMKVLPNATEEEN-GVHRNTMDNARPSIEQDTSQVMSHPEVSAWPGGDVSPGGFG  300

Query  555   TEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSK  376
               +K +RLR YVMSFDG+TLQRYA IRSKEA++IIEKHTEALFGRPEI +TP+G +  SK
Sbjct  301   YGIKATRLRNYVMSFDGDTLQRYAAIRSKEAVSIIEKHTEALFGRPEIVVTPEGAV--SK  358

Query  375   DELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  259
             DE IKISF  L++LVLEAVTFGSFLWDVES VDSRYHFV
Sbjct  359   DENIKISFGGLKKLVLEAVTFGSFLWDVESYVDSRYHFV  397



>ref|XP_006580389.1| PREDICTED: uncharacterized protein LOC100817892 isoform X2 [Glycine 
max]
Length=400

 Score =   442 bits (1136),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 227/339 (67%), Positives = 269/339 (79%), Gaps = 15/339 (4%)
 Frame = -2

Query  1260  IAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDI  1081
             IAPL+LESPIGQFL+QIL  HPHLV AAVDQQL QLQTDR+   QN++Q   P    TD+
Sbjct  70    IAPLQLESPIGQFLSQILKDHPHLVPAAVDQQLHQLQTDRDAHLQNQQQPSSP----TDL  125

Query  1080  VLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPSKDE  901
             VLYRRIAEVKANERRKALEEILYALVVQKFMDA++ L+P++T    + SG +D  P++D 
Sbjct  126   VLYRRIAEVKANERRKALEEILYALVVQKFMDANISLIPSVTP---DLSGKVDLWPNEDG  182

Query  900   QLARLHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFLKRVDQR  724
             +L +LHS EAYEMIQNHLSLILGN++   +SV +I+K RVGQVYAASVMYGYFLKRVDQR
Sbjct  183   KLEQLHSDEAYEMIQNHLSLILGNKAGDLTSVAEISKFRVGQVYAASVMYGYFLKRVDQR  242

Query  723   FQLEKNMKVLPQGLDKEDSGIQQVGGDss----dtslrsspSHPEVVSWPDGGMGSRGFG  556
             FQLEK MKVLP   ++E+ G+ +   D++    +       SHPEV +WP G +   GFG
Sbjct  243   FQLEKTMKVLPNATEEEN-GVHRNTMDNARPSIEQDTSQVMSHPEVSAWPGGDVSPGGFG  301

Query  555   TEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSK  376
               +K +RLR YVMSFDG+TLQRYA IRSKEA++IIEKHTEALFGRPEI +TP+G +  SK
Sbjct  302   YGIKATRLRNYVMSFDGDTLQRYAAIRSKEAVSIIEKHTEALFGRPEIVVTPEGAV--SK  359

Query  375   DELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  259
             DE IKISF  L++LVLEAVTFGSFLWDVES VDSRYHFV
Sbjct  360   DENIKISFGGLKKLVLEAVTFGSFLWDVESYVDSRYHFV  398



>gb|KEH26747.1| plant/T1N15-5 protein [Medicago truncatula]
Length=418

 Score =   442 bits (1137),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 230/339 (68%), Positives = 270/339 (80%), Gaps = 14/339 (4%)
 Frame = -2

Query  1260  IAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDI  1081
             IAPLKLESP+GQFL+QILVSHPHL+SAAV++QLEQ QTDR+  +Q EK    PSASGTD+
Sbjct  87    IAPLKLESPVGQFLSQILVSHPHLMSAAVERQLEQFQTDRDGYEQKEK----PSASGTDL  142

Query  1080  VLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPSKDE  901
             VLYRRIAEVKA ERRKA+EEI+Y LVVQKFMDA+V LVP+IT+   N SG +D+ PS+D 
Sbjct  143   VLYRRIAEVKAKERRKAIEEIVYTLVVQKFMDANVSLVPSITA---NPSGQVDSWPSEDG  199

Query  900   QLARLHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFLKRVDQR  724
             +L  LHSPEAYE+IQ+HL+L+LGNRS  + SV QI+KLRVGQVYAASVMYGYFLKRV QR
Sbjct  200   KLEDLHSPEAYELIQSHLALLLGNRSGDSKSVAQISKLRVGQVYAASVMYGYFLKRVVQR  259

Query  723   FQLEKNMKVLPQGLDKEDSGIQQVGGDssdtsl----rsspSHPEVVSWPDGGMGSRGFG  556
             FQLEK +K LP     E++ I Q   D +  +         SHPEV +W + G+ S    
Sbjct  260   FQLEKTIKNLPDA--AEENTISQTLEDETRNAGLEFPSQVMSHPEVPAWLESGISSGAND  317

Query  555   TEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSK  376
              E+  SRLR+Y+MSFD ETLQRYATIRSKEA++IIE HTEALFGRPEI ITP+G I+SSK
Sbjct  318   QEITVSRLRSYMMSFDIETLQRYATIRSKEAVSIIENHTEALFGRPEIVITPEGKINSSK  377

Query  375   DELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  259
             DE+IKI    L+RLVLEAVTFGSFLWDVES VDSRYHFV
Sbjct  378   DEIIKIRIGGLKRLVLEAVTFGSFLWDVESYVDSRYHFV  416



>ref|XP_004503251.1| PREDICTED: uncharacterized protein LOC101489103 [Cicer arietinum]
Length=401

 Score =   441 bits (1133),  Expect = 7e-147, Method: Compositional matrix adjust.
 Identities = 226/338 (67%), Positives = 271/338 (80%), Gaps = 11/338 (3%)
 Frame = -2

Query  1260  IAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDI  1081
             IAPL+L SPIGQFL+QIL +HPHL+ AAVDQQL QLQ+D + ++QN+   D PS + TD+
Sbjct  69    IAPLQLHSPIGQFLSQILTNHPHLLPAAVDQQLHQLQSDHDADQQNQ---DPPSTTATDL  125

Query  1080  VLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPSKDE  901
             VLYRRIAEVKANERRKALEEILY LVVQKFMDA++ L+P+IT    + SG +D+ P++  
Sbjct  126   VLYRRIAEVKANERRKALEEILYTLVVQKFMDANISLIPSITP---DPSGRVDSWPNEYG  182

Query  900   QLARLHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFLKRVDQR  724
             +L +LHS EAYEMIQNHL+LILGNR+   +SV QI+KLRVGQVYAASVMYGYFLKRVDQR
Sbjct  183   KLEQLHSTEAYEMIQNHLALILGNRAGDLTSVAQISKLRVGQVYAASVMYGYFLKRVDQR  242

Query  723   FQLEKNMKVLPQGLDKEDSGIQQVGGDs---sdtslrsspSHPEVVSWPDGGMGSRGFGT  553
             FQLEK++K+LP   + E S  Q +  D+   S+       SHPEV +W  G +   GFG+
Sbjct  243   FQLEKSIKILPNSAE-ESSVHQTIINDARPHSEVDTSQVKSHPEVSTWLGGDVSPGGFGS  301

Query  552   EMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKD  373
              +KP+RLR YVMSFDG+TLQRYATIRSKEA++IIEKHTEALFGRPE+ ITP+G ID SKD
Sbjct  302   GIKPTRLRNYVMSFDGDTLQRYATIRSKEAVSIIEKHTEALFGRPEMVITPEGAIDRSKD  361

Query  372   ELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  259
             E IKISF  L+RLVLEAVTFG FLWDVES V+SRY FV
Sbjct  362   ENIKISFGGLKRLVLEAVTFGCFLWDVESYVESRYQFV  399



>ref|XP_010505920.1| PREDICTED: uncharacterized protein LOC104782624 [Camelina sativa]
Length=409

 Score =   439 bits (1130),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 230/336 (68%), Positives = 274/336 (82%), Gaps = 12/336 (4%)
 Frame = -2

Query  1263  PIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTD  1084
             PIAPL+LESP GQFL+QIL+SHPHLV AAV+QQLEQLQTDR+ E QN+   D  S  GTD
Sbjct  83    PIAPLQLESPAGQFLSQILLSHPHLVPAAVEQQLEQLQTDRDSEGQNK---DASSVPGTD  139

Query  1083  IVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPSKD  904
             IVLYRRIAE+K NERR+ LEEILYALVVQKFM+A+V LVP+++  S   SG +DT P+K 
Sbjct  140   IVLYRRIAELKENERRRTLEEILYALVVQKFMEANVSLVPSVSP-SSGPSGRVDTWPTKV  198

Query  903   EQLARLHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFLKRVDQ  727
             ++L +LHSPE YEMI NHL+LILG+R    +SV QI+KLRVGQVYAASVMYGYFLKRVDQ
Sbjct  199   DKLEQLHSPEMYEMIHNHLALILGSRMGDLASVAQISKLRVGQVYAASVMYGYFLKRVDQ  258

Query  726   RFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEM  547
             RFQLEK MK+LP GLD   + + Q           +  SHPEV ++  GG+ ++GFG+E+
Sbjct  259   RFQLEKTMKILPGGLDDNKTSVDQT------ERPSAVSSHPEVGAFA-GGVSAKGFGSEI  311

Query  546   KPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDEL  367
             KPSRLR+YVMSFD ETLQRYATIRS+EA+ IIEKHTEALFG+P+I +TP+GT+DSSKDE 
Sbjct  312   KPSRLRSYVMSFDAETLQRYATIRSREAVRIIEKHTEALFGKPDIVLTPEGTVDSSKDEQ  371

Query  366   IKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  259
             I ISF  ++RLVLEAVTFGSFLWDVES VD+RYHFV
Sbjct  372   INISFGGMKRLVLEAVTFGSFLWDVESHVDARYHFV  407



>gb|EYU24493.1| hypothetical protein MIMGU_mgv1a007418mg [Erythranthe guttata]
Length=408

 Score =   438 bits (1126),  Expect = 9e-146, Method: Compositional matrix adjust.
 Identities = 252/397 (63%), Positives = 290/397 (73%), Gaps = 29/397 (7%)
 Frame = -2

Query  1413  PGFVKFGS-KALLSAPSIKVKL-------GNRRVAFGSTKCNSIRASL-PLSNSGGSAMP  1261
             P F++ GS K++LS    + +L       GN  V F +TK + I AS+   S+SGGS  P
Sbjct  31    PNFLRVGSPKSILSGAWPQQRLLISRKNGGNCGVDFMNTKKSWIGASMQKHSDSGGSIDP  90

Query  1260  IAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDI  1081
             IAPL+LESPIGQFL++I++SHPHLVSAAV+QQLEQLQTD +  K+      E SASGT++
Sbjct  91    IAPLELESPIGQFLSKIMISHPHLVSAAVEQQLEQLQTDLDAVKE------ESSASGTEL  144

Query  1080  VLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPSKDE  901
             VLYRRIAEVKANERRK LEEILYALVVQKFMDADV LVP IT    +S    DT   K+ 
Sbjct  145   VLYRRIAEVKANERRKTLEEILYALVVQKFMDADVALVPNITQ--LDSVRVDDTWHCKEA  202

Query  900   QLARLHSPEAYEMIQNHLSLILGNR-SNANSSVQINKLRVGQVYAASVMYGYFLKRVDQR  724
             +L  LHS EAY+MIQ HLSLILG R +++ S  QI+KLRVGQVYAASVMYGYFLKR+DQR
Sbjct  203   ELEGLHSTEAYQMIQKHLSLILGKRLADSKSVAQISKLRVGQVYAASVMYGYFLKRIDQR  262

Query  723   FQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMK  544
              QLEK MK+LPQ    E   I+ V   +++  +          S  DG   SR  G  + 
Sbjct  263   LQLEKMMKILPQ----EKMDIEHVTYSAAEKRVPMLNE-----SLEDGINLSRFDGINL-  312

Query  543   PSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELI  364
              SRLR YVM FDGETLQRYATIRSKEA N+IEKHTEALFGRPEI ITP GTIDSS DELI
Sbjct  313   -SRLRNYVMLFDGETLQRYATIRSKEAFNVIEKHTEALFGRPEIVITPDGTIDSSNDELI  371

Query  363   KISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFVAH  253
             KISF  LRRLVLEAVTFGSFLWD ES VDSRYHFVA+
Sbjct  372   KISFGGLRRLVLEAVTFGSFLWDSESYVDSRYHFVAN  408



>gb|AFK36208.1| unknown [Medicago truncatula]
Length=421

 Score =   436 bits (1120),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 226/339 (67%), Positives = 265/339 (78%), Gaps = 11/339 (3%)
 Frame = -2

Query  1260  IAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDI  1081
             IAPL+ +SPIGQFL+QIL++HPHLV AAVDQQL QLQ DR++    + Q+  P+ S TD+
Sbjct  87    IAPLQFQSPIGQFLSQILINHPHLVPAAVDQQLLQLQPDRDVAHHQQNQDPSPTTS-TDL  145

Query  1080  VLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPSKDE  901
             VLYRRIAEVKANERR ALEEILY LVVQKFMDA++ L+P+IT    ++SG +D+  ++D 
Sbjct  146   VLYRRIAEVKANERRTALEEILYTLVVQKFMDANISLIPSITP---DASGRVDSWSNEDG  202

Query  900   QLARLHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFLKRVDQR  724
             +L +LHS EAYEMIQNHL+LILGNR+   SSV QI+KLRVGQVYAASVMYGYFLKRVDQR
Sbjct  203   KLEQLHSNEAYEMIQNHLALILGNRAGELSSVAQISKLRVGQVYAASVMYGYFLKRVDQR  262

Query  723   FQLEKNMKVLPQGLDKEDSGIQQVGGDss----dtslrsspSHPEVVSWPDGGMGSRGFG  556
             FQLEK+MKVL    D  DS I Q   D +    +       SHPEV +WP G +   GFG
Sbjct  263   FQLEKSMKVLTSASD--DSSIHQTIVDDARPGSEVDTSQVTSHPEVSTWPGGDVSPGGFG  320

Query  555   TEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSK  376
               +KP+RLR YVMSFDG+TLQRYATIRSKEA++IIEKHTEALFGRP + IT +G ID S+
Sbjct  321   YGIKPTRLRNYVMSFDGDTLQRYATIRSKEAVSIIEKHTEALFGRPGMVITHEGGIDYSE  380

Query  375   DELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  259
             DE IKISF  L RLVLEAVTFG FLWDVES VDSRY FV
Sbjct  381   DETIKISFGGLMRLVLEAVTFGCFLWDVESYVDSRYRFV  419



>ref|XP_003530975.1| PREDICTED: uncharacterized protein LOC100793300 [Glycine max]
 gb|KHN00132.1| hypothetical protein glysoja_028660 [Glycine soja]
Length=404

 Score =   434 bits (1117),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 248/416 (60%), Positives = 298/416 (72%), Gaps = 24/416 (6%)
 Frame = -2

Query  1488  TTSLRSSITVGCGPVK--SGRRFTTDAPGFVKFGSKALLSAPSIKVKLGNRRVAFGSTKC  1315
              T+ RS + +   PV   +  RF +   GF +    + +  P  K K G RR        
Sbjct  5     VTAFRSPLIILRRPVNESASARFGSTF-GFSRKQRFSSVCIPKHKHKQGRRR-------G  56

Query  1314  NSIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNL  1135
               +RAS   S     A  IAPL+ ES IGQFL+QIL  HPHLV AAVDQQL+QLQTDR+ 
Sbjct  57    FVVRASASSSPESDDA-KIAPLQFESSIGQFLSQILKDHPHLVPAAVDQQLQQLQTDRDA  115

Query  1134  EKQNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAIT  955
              +QNE    +PSAS TD+VLYRRIAEVKANERRKALEEILYALVVQKFMDA++ L+P++T
Sbjct  116   HQQNE----QPSASTTDLVLYRRIAEVKANERRKALEEILYALVVQKFMDANISLIPSVT  171

Query  954   SPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQ  778
                 + SG +D  P++D +L  LHS EAYEMIQNHL+LILGNR+   +S+ +I+K RVGQ
Sbjct  172   P---DLSGKVDLWPNEDGKLELLHSHEAYEMIQNHLALILGNRAGDLTSIAEISKFRVGQ  228

Query  777   VYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDss---dtslrsspSH  607
             VYAASVMYGYFL+RVDQRFQLEK MKVLP   +KE+S  Q    ++    +       SH
Sbjct  229   VYAASVMYGYFLRRVDQRFQLEKTMKVLPNATEKENSAHQTTMDNARPSIEEDTSQVMSH  288

Query  606   PEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALF  427
             PEV +WP G +   GFG  +K +RLR YVMSFDG+TLQRYATIRSKEA++IIEKHTEALF
Sbjct  289   PEVSTWPGGDVRPGGFGYGVKATRLRNYVMSFDGDTLQRYATIRSKEAVSIIEKHTEALF  348

Query  426   GRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  259
             GRPEI +TP+G +  SKDE IKISF  L++LVLEAVTFGSFLWDVES VDSRYHFV
Sbjct  349   GRPEIVVTPEGAV--SKDENIKISFGGLKKLVLEAVTFGSFLWDVESYVDSRYHFV  402



>gb|ACJ84884.1| unknown [Medicago truncatula]
Length=421

 Score =   435 bits (1119),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 226/339 (67%), Positives = 265/339 (78%), Gaps = 11/339 (3%)
 Frame = -2

Query  1260  IAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDI  1081
             IAPL+ +SPIGQFL+QIL++HPHLV AAVDQQL QLQ DR++    + Q+  P+ S TD+
Sbjct  87    IAPLQFQSPIGQFLSQILINHPHLVPAAVDQQLLQLQPDRDVAHHQQNQDPSPTTS-TDL  145

Query  1080  VLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPSKDE  901
             VLYRRIAEVKANERR ALEEILY LVVQKFMDA++ L+P+IT    ++SG +D+  ++D 
Sbjct  146   VLYRRIAEVKANERRTALEEILYTLVVQKFMDANISLIPSITP---DASGRVDSWSNEDG  202

Query  900   QLARLHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFLKRVDQR  724
             +L +LHS EAYEMIQNHL+LILGNR+   SSV QI+KLRVGQVYAASVMYGYFLKRVDQR
Sbjct  203   KLEQLHSNEAYEMIQNHLALILGNRAGDLSSVAQISKLRVGQVYAASVMYGYFLKRVDQR  262

Query  723   FQLEKNMKVLPQGLDKEDSGIQQVGGDss----dtslrsspSHPEVVSWPDGGMGSRGFG  556
             FQLEK+MKVL    D  DS I Q   D +    +       SHPEV +WP G +   GFG
Sbjct  263   FQLEKSMKVLTSASD--DSSIHQTIVDDARPGSEVDTSQVTSHPEVSTWPGGDVSPGGFG  320

Query  555   TEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSK  376
               +KP+RLR YVMSFDG+TLQRYATIRSKEA++IIEKHTEALFGRP + IT +G ID S+
Sbjct  321   YGIKPTRLRNYVMSFDGDTLQRYATIRSKEAVSIIEKHTEALFGRPGMVITHEGGIDYSE  380

Query  375   DELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  259
             DE IKISF  L RLVLEAVTFG FLWDVES VDSRY FV
Sbjct  381   DETIKISFGGLMRLVLEAVTFGCFLWDVESYVDSRYRFV  419



>gb|ACF87802.1| unknown [Zea mays]
 tpg|DAA51042.1| TPA: hypothetical protein ZEAMMB73_539342 [Zea mays]
Length=423

 Score =   429 bits (1104),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 220/338 (65%), Positives = 264/338 (78%), Gaps = 5/338 (1%)
 Frame = -2

Query  1260  IAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQND---EPSASG  1090
             IAPL++ESP GQ L+QIL +HPHL+SAA +QQLEQLQTDR  +K+ +K++D   + + +G
Sbjct  85    IAPLRMESPAGQLLSQILHTHPHLLSAAAEQQLEQLQTDREADKEKDKESDAGDKLAPTG  144

Query  1089  TDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPS  910
              D+VLYRRIAEVK  ERR+ LEEILYALVVQKF++A V LVPA+ S S + SG +D    
Sbjct  145   GDLVLYRRIAEVKEKERRRTLEEILYALVVQKFVEAGVSLVPAL-SRSTDPSGRVDQWAE  203

Query  909   K-DEQLARLHSPEAYEMIQNHLSLILGNRSNANSSVQINKLRVGQVYAASVMYGYFLKRV  733
               +E+L RLHS EAYEMI+NHL+LILG R    +   I+KLRVGQVYAASVMYGYFLKRV
Sbjct  204   TVEEKLQRLHSHEAYEMIENHLTLILGQRQGDATIAAISKLRVGQVYAASVMYGYFLKRV  263

Query  732   DQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGT  553
             DQRFQLEK MK LP G ++EDS + QV       S ++S SHPE+ SW      + G   
Sbjct  264   DQRFQLEKTMKGLPWGSEEEDSALNQVMMTDLMPSAQTSSSHPEMGSWTAPAFSTGGPSQ  323

Query  552   EMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKD  373
              +KP RLR+YVMSFD +TLQRYAT+RSKEA  IIEKHTEALFG+PEI ITP+GT+DSSKD
Sbjct  324   SIKPCRLRSYVMSFDSDTLQRYATVRSKEAFGIIEKHTEALFGKPEIVITPEGTLDSSKD  383

Query  372   ELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  259
             E I+ISF+ LRRL+LEAVTFGSFLWDVES VDSRYHFV
Sbjct  384   EHIRISFAGLRRLILEAVTFGSFLWDVESFVDSRYHFV  421



>gb|EAY91660.1| hypothetical protein OsI_13299 [Oryza sativa Indica Group]
 gb|EAZ28380.1| hypothetical protein OsJ_12360 [Oryza sativa Japonica Group]
Length=413

 Score =   427 bits (1099),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 221/337 (66%), Positives = 264/337 (78%), Gaps = 5/337 (1%)
 Frame = -2

Query  1260  IAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDI  1081
             IAPL++ESP+GQFL+QIL +HPHL+ AA +QQLEQLQTDR+  K N    D+P+ S  DI
Sbjct  81    IAPLQMESPVGQFLSQILATHPHLLPAAAEQQLEQLQTDRDAAKDN--GGDKPAPSDGDI  138

Query  1080  VLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPSKDE  901
             VLYRRIAEVK  ER++ALEEILYALVVQKF++A V LVPA+ S S +SSG +D      E
Sbjct  139   VLYRRIAEVKEKERKRALEEILYALVVQKFVEAGVSLVPAL-SHSISSSGRVDQWAESVE  197

Query  900   -QLARLHSPEAYEMIQNHLSLILGNRSNANSSVQINKLRVGQVYAASVMYGYFLKRVDQR  724
              +L ++HS EAYEMI+NHL+LILG R    +   I+KLRVGQVYAASVMYGYFLKRVDQR
Sbjct  198   GKLEKMHSQEAYEMIENHLALILGQRQADATVAAISKLRVGQVYAASVMYGYFLKRVDQR  257

Query  723   FQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMK  544
             FQLEK+MK LP G ++ED  + QV    S  S ++S SHPE+ SW      + G    +K
Sbjct  258   FQLEKSMKTLPWGSEEEDK-LNQVMTTDSRPSPQTSTSHPEMASWTSPNFSAGGPSQSVK  316

Query  543   PSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELI  364
             P RLR+YVMSFD ETLQ YATIRSKEA  IIEKHTEALFG+PEI ITP+GT+DSSKDE +
Sbjct  317   PCRLRSYVMSFDSETLQSYATIRSKEAFGIIEKHTEALFGKPEIVITPEGTVDSSKDEHV  376

Query  363   KISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFVAH  253
             +ISF+ LRRL+LEAVTFGSFLWDVES VD+RYHFVA+
Sbjct  377   RISFAGLRRLILEAVTFGSFLWDVESFVDTRYHFVAN  413



>ref|NP_001143815.1| uncharacterized protein LOC100276591 [Zea mays]
 gb|ACG35630.1| hypothetical protein [Zea mays]
Length=424

 Score =   427 bits (1097),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 219/338 (65%), Positives = 263/338 (78%), Gaps = 5/338 (1%)
 Frame = -2

Query  1260  IAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQND---EPSASG  1090
             IAPL++ESP GQ L+QIL +HPHL+SAA +QQLEQLQTDR  +K+ +K++D   + + +G
Sbjct  86    IAPLRMESPAGQLLSQILHTHPHLLSAAAEQQLEQLQTDREADKEKDKESDAGDKLAPTG  145

Query  1089  TDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPS  910
              ++VLYRRIAEVK  ERR+ LEEILYALVVQKF++A V LVPA+ S S + SG +D    
Sbjct  146   GNLVLYRRIAEVKEKERRRTLEEILYALVVQKFVEAGVSLVPAL-SRSTDPSGRVDQWAE  204

Query  909   K-DEQLARLHSPEAYEMIQNHLSLILGNRSNANSSVQINKLRVGQVYAASVMYGYFLKRV  733
               +E L RLHS EAYEMI+NHL+LILG R    +   I+KLRVGQVYAASVMYGYFLKRV
Sbjct  205   TVEENLQRLHSHEAYEMIENHLTLILGQRQGDATIAAISKLRVGQVYAASVMYGYFLKRV  264

Query  732   DQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGT  553
             DQRFQLEK MK LP G ++EDS + QV       S ++S SHPE+ SW      + G   
Sbjct  265   DQRFQLEKTMKGLPWGSEEEDSALNQVMMTDLMPSAQTSSSHPEMGSWTAPAFSTGGPSQ  324

Query  552   EMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKD  373
              +KP RLR+YVMSFD +TLQRYAT+RSKEA  IIEKHTEALFG+PEI ITP+GT+DSSKD
Sbjct  325   SIKPCRLRSYVMSFDSDTLQRYATVRSKEAFGIIEKHTEALFGKPEIVITPEGTLDSSKD  384

Query  372   ELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  259
             E I+ISF+ LRRL+LEAVTFGSFLWDVES VDSRYHFV
Sbjct  385   EHIRISFAGLRRLILEAVTFGSFLWDVESFVDSRYHFV  422



>ref|XP_010939981.1| PREDICTED: uncharacterized protein LOC105058679 [Elaeis guineensis]
 ref|XP_010939982.1| PREDICTED: uncharacterized protein LOC105058679 [Elaeis guineensis]
 ref|XP_010939983.1| PREDICTED: uncharacterized protein LOC105058679 [Elaeis guineensis]
 ref|XP_010939984.1| PREDICTED: uncharacterized protein LOC105058679 [Elaeis guineensis]
Length=422

 Score =   426 bits (1096),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 233/398 (59%), Positives = 282/398 (71%), Gaps = 18/398 (5%)
 Frame = -2

Query  1413  PGFVKFGSKALLSAPSIK-------VKLGNRRVAFGSTKCNSIRASLPLSNSGGSAMPIA  1255
             PGFV F  K+L    S+K        KLG     F S +   I+AS    N   S+  IA
Sbjct  32    PGFVSFDPKSLFCTRSLKGCRSLSVSKLGQS--GFCSRRNTGIKASFSSPNPSESSSRIA  89

Query  1254  PLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVL  1075
             PL+LESPIGQFL+QIL+SHPHLV AAVDQQLEQLQTDR    + EK    PS SGTD+VL
Sbjct  90    PLQLESPIGQFLSQILISHPHLVPAAVDQQLEQLQTDR----EAEKNKKGPSPSGTDVVL  145

Query  1074  YRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTL-PSKDEQ  898
             YRRIAEVKA ERR+ALEEILYALVVQKF++AD+ LVP++   + N+SG +    PS++E+
Sbjct  146   YRRIAEVKAKERRRALEEILYALVVQKFIEADISLVPSLAQLT-NASGKVKQWRPSEEEK  204

Query  897   LARLHSPEAYEMIQNHLSLILGN-RSNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRF  721
             L  LHSPEAYE+I+NHL+LILG    ++NS   ++KLRV  VYAASV+YGYFLKRVDQRF
Sbjct  205   LEGLHSPEAYEVIKNHLALILGQGLGDSNSVASVSKLRVVLVYAASVIYGYFLKRVDQRF  264

Query  720   QLEKNMKVLPQGL--DKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEM  547
             QLEK+MK LP G   + E+  ++Q   D S    +   SHP             G G  +
Sbjct  265   QLEKSMKTLPWGSVEENEEDAVKQAMPDESRPLTQIGNSHPVASLGSSPSFNHGGVGHSV  324

Query  546   KPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDEL  367
             KP RLR+Y  +FD + LQRY  +RSKEA +IIEKHTEALFGRPEI I PQGTIDSSKDE+
Sbjct  325   KPCRLRSYFKAFDSQMLQRYVKVRSKEAFHIIEKHTEALFGRPEIVIAPQGTIDSSKDEI  384

Query  366   IKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFVAH  253
             +KISF+ LRRL+LEAVTFGSFLWD ES VD+RYHF+ +
Sbjct  385   VKISFAGLRRLILEAVTFGSFLWDTESYVDTRYHFMTN  422



>ref|XP_004981973.1| PREDICTED: uncharacterized protein LOC101781190 isoform X1 [Setaria 
italica]
Length=411

 Score =   425 bits (1093),  Expect = 9e-141, Method: Compositional matrix adjust.
 Identities = 232/374 (62%), Positives = 280/374 (75%), Gaps = 13/374 (3%)
 Frame = -2

Query  1344  RRVAFGSTKCNS--------IRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHL  1189
             R  AFGS + NS        +RAS   S S   +  IAPL++ESP GQ L+QIL +HPHL
Sbjct  37    RGFAFGSKQLNSRTKRRSSVVRASWSPSESLPPSSSIAPLRMESPAGQLLSQILHTHPHL  96

Query  1188  VSAAVDQQLEQLQTDRNLEKQNEKQN---DEPSASGTDIVLYRRIAEVKANERRKALEEI  1018
             + AA +QQL+QLQTDR  EK  +K++   ++P+ +  D+VLYRRIAEVK  ERR+ALEEI
Sbjct  97    LPAAAEQQLQQLQTDREAEKDKDKESGAGEKPAPASGDLVLYRRIAEVKEKERRRALEEI  156

Query  1017  LYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPSK-DEQLARLHSPEAYEMIQNHLSL  841
             LYALVVQKF++A V LVPA+ S S +SSG +D      +E+L RLHSPEAYEMI+NHL L
Sbjct  157   LYALVVQKFVEAGVSLVPAL-SHSIDSSGRVDQWAETVEERLQRLHSPEAYEMIENHLDL  215

Query  840   ILGNRSNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGI  661
             ILG R    +   I+KLRVGQVYAASVMYGYFLKRVDQRFQLEK+MK LP G ++ED  +
Sbjct  216   ILGQRQGDATIAAISKLRVGQVYAASVMYGYFLKRVDQRFQLEKSMKSLPWGSEEEDDAL  275

Query  660   QQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYAT  481
              QV    S  S ++S SHPE+ SW      + G    +KP RLR+YVMSFD +TLQRYAT
Sbjct  276   NQVMTTDSMPSTQASSSHPEMASWTSPNFSTGGPSQSIKPCRLRSYVMSFDSDTLQRYAT  335

Query  480   IRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFL  301
             +RSKEA  IIEKHTEALFG+PE+ ITP+GT+DSSKDE I+ISF+ LRRL+LEAVTFGSFL
Sbjct  336   VRSKEAFGIIEKHTEALFGKPEVVITPEGTVDSSKDEHIRISFAGLRRLILEAVTFGSFL  395

Query  300   WDVESSVDSRYHFV  259
             WDVES VDSRYHFV
Sbjct  396   WDVESFVDSRYHFV  409



>ref|NP_001051084.1| Os03g0717900 [Oryza sativa Japonica Group]
 gb|ABF98564.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF12998.1| Os03g0717900 [Oryza sativa Japonica Group]
 dbj|BAG94154.1| unnamed protein product [Oryza sativa Japonica Group]
Length=455

 Score =   426 bits (1094),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 221/337 (66%), Positives = 264/337 (78%), Gaps = 5/337 (1%)
 Frame = -2

Query  1260  IAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDI  1081
             IAPL++ESP+GQFL+QIL +HPHL+ AA +QQLEQLQTDR+  K N    D+P+ S  DI
Sbjct  123   IAPLQMESPVGQFLSQILATHPHLLPAAAEQQLEQLQTDRDAAKDN--GGDKPAPSDGDI  180

Query  1080  VLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPSKDE  901
             VLYRRIAEVK  ER++ALEEILYALVVQKF++A V LVPA+ S S +SSG +D      E
Sbjct  181   VLYRRIAEVKEKERKRALEEILYALVVQKFVEAGVSLVPAL-SHSISSSGRVDQWAESVE  239

Query  900   -QLARLHSPEAYEMIQNHLSLILGNRSNANSSVQINKLRVGQVYAASVMYGYFLKRVDQR  724
              +L ++HS EAYEMI+NHL+LILG R    +   I+KLRVGQVYAASVMYGYFLKRVDQR
Sbjct  240   GKLEKMHSQEAYEMIENHLALILGQRQADATVAAISKLRVGQVYAASVMYGYFLKRVDQR  299

Query  723   FQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMK  544
             FQLEK+MK LP G ++ED  + QV    S  S ++S SHPE+ SW      + G    +K
Sbjct  300   FQLEKSMKTLPWGSEEEDK-LNQVMTTDSRPSPQTSTSHPEMASWTSPNFSAGGPSQSVK  358

Query  543   PSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELI  364
             P RLR+YVMSFD ETLQ YATIRSKEA  IIEKHTEALFG+PEI ITP+GT+DSSKDE +
Sbjct  359   PCRLRSYVMSFDSETLQSYATIRSKEAFGIIEKHTEALFGKPEIVITPEGTVDSSKDEHV  418

Query  363   KISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFVAH  253
             +ISF+ LRRL+LEAVTFGSFLWDVES VD+RYHFVA+
Sbjct  419   RISFAGLRRLILEAVTFGSFLWDVESFVDTRYHFVAN  455



>ref|XP_004981974.1| PREDICTED: uncharacterized protein LOC101781190 isoform X2 [Setaria 
italica]
Length=410

 Score =   422 bits (1086),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 233/374 (62%), Positives = 280/374 (75%), Gaps = 14/374 (4%)
 Frame = -2

Query  1344  RRVAFGSTKCNS--------IRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHL  1189
             R  AFGS K NS        +RAS   S S   +  IAPL++ESP GQ L+QIL +HPHL
Sbjct  37    RGFAFGS-KLNSRTKRRSSVVRASWSPSESLPPSSSIAPLRMESPAGQLLSQILHTHPHL  95

Query  1188  VSAAVDQQLEQLQTDRNLEKQNEKQN---DEPSASGTDIVLYRRIAEVKANERRKALEEI  1018
             + AA +QQL+QLQTDR  EK  +K++   ++P+ +  D+VLYRRIAEVK  ERR+ALEEI
Sbjct  96    LPAAAEQQLQQLQTDREAEKDKDKESGAGEKPAPASGDLVLYRRIAEVKEKERRRALEEI  155

Query  1017  LYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPSK-DEQLARLHSPEAYEMIQNHLSL  841
             LYALVVQKF++A V LVPA+ S S +SSG +D      +E+L RLHSPEAYEMI+NHL L
Sbjct  156   LYALVVQKFVEAGVSLVPAL-SHSIDSSGRVDQWAETVEERLQRLHSPEAYEMIENHLDL  214

Query  840   ILGNRSNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGI  661
             ILG R    +   I+KLRVGQVYAASVMYGYFLKRVDQRFQLEK+MK LP G ++ED  +
Sbjct  215   ILGQRQGDATIAAISKLRVGQVYAASVMYGYFLKRVDQRFQLEKSMKSLPWGSEEEDDAL  274

Query  660   QQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYAT  481
              QV    S  S ++S SHPE+ SW      + G    +KP RLR+YVMSFD +TLQRYAT
Sbjct  275   NQVMTTDSMPSTQASSSHPEMASWTSPNFSTGGPSQSIKPCRLRSYVMSFDSDTLQRYAT  334

Query  480   IRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFL  301
             +RSKEA  IIEKHTEALFG+PE+ ITP+GT+DSSKDE I+ISF+ LRRL+LEAVTFGSFL
Sbjct  335   VRSKEAFGIIEKHTEALFGKPEVVITPEGTVDSSKDEHIRISFAGLRRLILEAVTFGSFL  394

Query  300   WDVESSVDSRYHFV  259
             WDVES VDSRYHFV
Sbjct  395   WDVESFVDSRYHFV  408



>gb|ABF98565.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAG87500.1| unnamed protein product [Oryza sativa Japonica Group]
Length=328

 Score =   419 bits (1076),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 217/332 (65%), Positives = 259/332 (78%), Gaps = 5/332 (2%)
 Frame = -2

Query  1245  LESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRR  1066
             +ESP+GQFL+QIL +HPHL+ AA +QQLEQLQTDR+  K N    D+P+ S  DIVLYRR
Sbjct  1     MESPVGQFLSQILATHPHLLPAAAEQQLEQLQTDRDAAKDN--GGDKPAPSDGDIVLYRR  58

Query  1065  IAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPSKDE-QLAR  889
             IAEVK  ER++ALEEILYALVVQKF++A V LVPA+ S S +SSG +D      E +L +
Sbjct  59    IAEVKEKERKRALEEILYALVVQKFVEAGVSLVPAL-SHSISSSGRVDQWAESVEGKLEK  117

Query  888   LHSPEAYEMIQNHLSLILGNRSNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQLEK  709
             +HS EAYEMI+NHL+LILG R    +   I+KLRVGQVYAASVMYGYFLKRVDQRFQLEK
Sbjct  118   MHSQEAYEMIENHLALILGQRQADATVAAISKLRVGQVYAASVMYGYFLKRVDQRFQLEK  177

Query  708   NMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPSRLR  529
             +MK LP G ++ED  + QV    S  S ++S SHPE+ SW      + G    +KP RLR
Sbjct  178   SMKTLPWGSEEEDK-LNQVMTTDSRPSPQTSTSHPEMASWTSPNFSAGGPSQSVKPCRLR  236

Query  528   TYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKISFS  349
             +YVMSFD ETLQ YATIRSKEA  IIEKHTEALFG+PEI ITP+GT+DSSKDE ++ISF+
Sbjct  237   SYVMSFDSETLQSYATIRSKEAFGIIEKHTEALFGKPEIVITPEGTVDSSKDEHVRISFA  296

Query  348   SLRRLVLEAVTFGSFLWDVESSVDSRYHFVAH  253
              LRRL+LEAVTFGSFLWDVES VD+RYHFVA+
Sbjct  297   GLRRLILEAVTFGSFLWDVESFVDTRYHFVAN  328



>dbj|BAJ85118.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=408

 Score =   421 bits (1081),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 218/337 (65%), Positives = 260/337 (77%), Gaps = 6/337 (2%)
 Frame = -2

Query  1260  IAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDI  1081
             IAPL++ESPIGQFL+QILV+HPHL+ AA +QQLEQLQT ++  ++ + Q   P A+G DI
Sbjct  77    IAPLQMESPIGQFLSQILVTHPHLLPAAAEQQLEQLQTVQDSAEKKDAQA--PPAAG-DI  133

Query  1080  VLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPSKDE  901
             VLYRRIAEVK  ER++ +EEILYALVVQKF++A V LVPA++     SSG +D      E
Sbjct  134   VLYRRIAEVKEKERKRTMEEILYALVVQKFVEAGVSLVPALSHSIDTSSGRVDQWAEHVE  193

Query  900   -QLARLHSPEAYEMIQNHLSLILGNRSNANSSVQINKLRVGQVYAASVMYGYFLKRVDQR  724
              +L RLHS EAYEMI+NHL+LILG R    +   I+KLRVGQVYAASVMYGYFLKRVD+R
Sbjct  194   GKLERLHSHEAYEMIENHLNLILGQRQADGTVAAISKLRVGQVYAASVMYGYFLKRVDKR  253

Query  723   FQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMK  544
             FQLEK+MK LP G   ED  + QV    S  S ++  SHPEV SW    + + G G  +K
Sbjct  254   FQLEKSMKSLPWG--SEDDTLNQVMTTDSRPSDQTYSSHPEVESWTSPDLSAGGLGQSVK  311

Query  543   PSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELI  364
             PSRLR+YVMSFD +TLQ YATIRSK A  IIEKHTEALFG+PEI ITP+GT+DSSKDE +
Sbjct  312   PSRLRSYVMSFDSDTLQTYATIRSKVAFGIIEKHTEALFGKPEIVITPEGTVDSSKDEYV  371

Query  363   KISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFVAH  253
             +ISFS LRRL+LEAVTFGSFLWDVES VDSRYHFV +
Sbjct  372   RISFSGLRRLILEAVTFGSFLWDVESYVDSRYHFVTN  408



>ref|XP_006650499.1| PREDICTED: uncharacterized protein LOC102715191 [Oryza brachyantha]
Length=327

 Score =   413 bits (1062),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 216/332 (65%), Positives = 255/332 (77%), Gaps = 6/332 (2%)
 Frame = -2

Query  1245  LESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRR  1066
             +ESP+GQFL+QIL +HPHL+ AA +QQLEQLQTDR+  K  E   D+P+ S  DIVLYRR
Sbjct  1     MESPVGQFLSQILATHPHLLPAAAEQQLEQLQTDRDAAK--EDGGDKPTPSDGDIVLYRR  58

Query  1065  IAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPSKDE-QLAR  889
             IAEVK  ER++ALEEILYALVVQKF++A V LVPA+ S S NSSG +D      E +L +
Sbjct  59    IAEVKEKERKRALEEILYALVVQKFVEAGVSLVPAL-SHSINSSGRVDQWAESVEGKLEK  117

Query  888   LHSPEAYEMIQNHLSLILGNRSNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQLEK  709
             LHS EAYEMI+NHL+LILG R    +   I+KLRVGQVYAASVMYGYFLKRVD+RFQLEK
Sbjct  118   LHSQEAYEMIENHLALILGQRQADATVAAISKLRVGQVYAASVMYGYFLKRVDKRFQLEK  177

Query  708   NMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPSRLR  529
             +MK LP G   E   + QV    S  S ++S SHPE+ SW      + G    +KP RLR
Sbjct  178   SMKTLPWG--SEGDMLNQVMTTDSRPSAQTSTSHPEMASWTSPNFSAGGPSQSVKPCRLR  235

Query  528   TYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKISFS  349
             +YVMSFD +TLQ YATIRSKEA  IIEKHTEALFG+PEI ITP+GT+DSSKDE ++ISF+
Sbjct  236   SYVMSFDSDTLQSYATIRSKEAFGIIEKHTEALFGKPEIVITPEGTVDSSKDEHVRISFA  295

Query  348   SLRRLVLEAVTFGSFLWDVESSVDSRYHFVAH  253
              LRRL+LEAVTFGSFLWDVES VDSRYHFV +
Sbjct  296   GLRRLILEAVTFGSFLWDVESFVDSRYHFVVN  327



>ref|XP_007152648.1| hypothetical protein PHAVU_004G147200g [Phaseolus vulgaris]
 gb|ESW24642.1| hypothetical protein PHAVU_004G147200g [Phaseolus vulgaris]
Length=403

 Score =   414 bits (1065),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 240/399 (60%), Positives = 286/399 (72%), Gaps = 27/399 (7%)
 Frame = -2

Query  1437  GRRFTTDAPGFVKFGSKALLSAPSIKVKLGNRRVAFGSTKCNSIRASLPLSNSGGSAMPI  1258
             GR      P  + F +K   S      K  + R + GS +   +RA+     S   +  +
Sbjct  24    GRPSAFAFPSNLAFSTKLSTSVSVSISKQCHGRHSVGSKRGFVVRATSSFPESSEPSSNV  83

Query  1257  APLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIV  1078
             APLKLESPIGQFL+QIL+SHPHLV AAV++QLEQ QTD  ++  N+K+  EP ASGTD+V
Sbjct  84    APLKLESPIGQFLSQILMSHPHLVPAAVERQLEQFQTD--IDGDNQKR--EPPASGTDLV  139

Query  1077  LYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPSKDEQ  898
             LYRRIAEVKA ER+ ALEEILYALVVQKFMDAD+ L+P++T    N SG           
Sbjct  140   LYRRIAEVKAKERKTALEEILYALVVQKFMDADISLIPSLTP---NQSGR----------  186

Query  897   LARLHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFLKRVDQRF  721
                LHSPEAYEMIQNHL+LILG+R   ++SV QI+K+RVGQVYAAS+MYGYFLKRV QR+
Sbjct  187   --ELHSPEAYEMIQNHLALILGSRLGDSTSVAQISKIRVGQVYAASIMYGYFLKRVVQRY  244

Query  720   QLEKNMKVLPQGLDKEDSGIQQV----GGDssdtslrsspSHPEVVSWPDGGMGSRGFGT  553
             QLEK MK+LP     E++ IQQ      G S   S     SHPE+ + P G + S GFG 
Sbjct  245   QLEKTMKILPNV--AEENSIQQTVIDESGISGGKSPSHVMSHPEISNLPGGSISSGGFGY  302

Query  552   EMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRP-EISITPQGTIDSSK  376
               K SRLRTYVMSFD +TLQRYAT+RSKE+++IIEKHTEALFGRP EI +TP+G IDSSK
Sbjct  303   GSKVSRLRTYVMSFDTDTLQRYATLRSKESLSIIEKHTEALFGRPDEIVVTPEGVIDSSK  362

Query  375   DELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  259
             DE IKISF SL+RLVLEAVTFGSFLWDVES VD+RYHFV
Sbjct  363   DESIKISFGSLKRLVLEAVTFGSFLWDVESYVDARYHFV  401



>ref|XP_002273280.1| PREDICTED: uncharacterized protein LOC100245443 isoform X1 [Vitis 
vinifera]
Length=411

 Score =   414 bits (1065),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 223/377 (59%), Positives = 275/377 (73%), Gaps = 19/377 (5%)
 Frame = -2

Query  1350  GNRRVAFGSTKCNSIRASLPLSN-SGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAV  1174
             G+R++A G  +   +RAS  + N S  SA PIAPL+LESPIG+FLT+IL+SHPHLV AAV
Sbjct  43    GHRKMASGWKEQTMVRASATVDNDSYESAAPIAPLRLESPIGRFLTEILISHPHLVPAAV  102

Query  1173  DQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQK  994
             ++QLEQ QTDR+ E   +    E SASG +++LYRRIA+VKANER+KALEEILY LVVQK
Sbjct  103   ERQLEQFQTDRDAEGHKQ----ESSASGIELLLYRRIAKVKANERKKALEEILYVLVVQK  158

Query  993   FMDADVPLVPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNAN  814
             F+ A+VPL+P ++  S  SSG +D  PS D  L  LHSPEA EMIQNHL+ ILGNR   +
Sbjct  159   FVGANVPLIPRMSPSSLGSSGRVDNWPSLDRDLGELHSPEATEMIQNHLAFILGNRFGDS  218

Query  813   SSV-QINKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLD------KEDSGIQQ  655
             +SV +++KLRVGQVYAASVMYGYFLKRVD+RFQLEK MK+LP  LD      +E  G+  
Sbjct  219   TSVAKMSKLRVGQVYAASVMYGYFLKRVDERFQLEKTMKILPYALDGDKGYVEEAMGMSP  278

Query  654   VGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIR  475
              G D    S++   S PE   W  GG+    FG   KPS L +YV   D ETL RY TIR
Sbjct  279   FGSD---DSVQGVESQPEASCWA-GGLTIGSFGHWKKPSSLGSYVKLIDAETLMRYTTIR  334

Query  474   SKEAINIIEKHTEALFGRPEISITPQ---GTIDSSKDELIKISFSSLRRLVLEAVTFGSF  304
             S EA++II+KHT+ALFGR +++I P     T+DSS+DELIK+SF  L+RLVLEA+TFGSF
Sbjct  335   SMEAVSIIQKHTQALFGRRDVAIIPNIPMWTLDSSEDELIKMSFGGLKRLVLEALTFGSF  394

Query  303   LWDVESSVDSRYHFVAH  253
             LWDVES VDSR HFV +
Sbjct  395   LWDVESFVDSRLHFVVN  411



>ref|NP_001169730.1| hypothetical protein [Zea mays]
 gb|ACN34695.1| unknown [Zea mays]
 gb|AFW67799.1| hypothetical protein ZEAMMB73_826524 [Zea mays]
Length=416

 Score =   412 bits (1058),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 219/341 (64%), Positives = 261/341 (77%), Gaps = 10/341 (3%)
 Frame = -2

Query  1260  IAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQND---EPSASG  1090
             +APL++ESP GQ L+QIL +HPHL+ AA +QQLE LQTDR  EK  +K++D   + + +G
Sbjct  77    MAPLRMESPAGQLLSQILHTHPHLLPAAAEQQLELLQTDREAEKNKDKESDAGDKLAPTG  136

Query  1089  TDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPS  910
              D+VLYRRIA+VK  ERR+ LEEILYALVV+KF++A V LVPA+ S S +SSG +D    
Sbjct  137   VDLVLYRRIAQVKEKERRRTLEEILYALVVEKFVEAGVSLVPAL-SRSIDSSGRVDQWAE  195

Query  909   KDE-QLARLHSPEAYEMIQNHLSLILGNRSNANSSVQINKLRVGQVYAASVMYGYFLKRV  733
               E +L RLHSPEAYEMI+NHL+LILG R +  +   I+KLRVGQVYAASVMYGYFLKRV
Sbjct  196   TVEGRLQRLHSPEAYEMIENHLALILGQRQSDATIAAISKLRVGQVYAASVMYGYFLKRV  255

Query  732   DQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSW---PDGGMGSRG  562
             DQRFQLEK MK LP G ++ED  + QV    S  S +SS SHPE+ SW   PD   G  G
Sbjct  256   DQRFQLEKTMKSLPWGSEEEDGALYQVMTTDSMPSAQSSSSHPEMGSWTAAPDFNAG--G  313

Query  561   FGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDS  382
                 +KP RLR+YVMSFD +TLQRYAT+RSKEA  IIEKHTEALFG+ EI +TP GT+ S
Sbjct  314   PSESIKPCRLRSYVMSFDPDTLQRYATVRSKEAFGIIEKHTEALFGKAEIVVTPGGTVGS  373

Query  381   SKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  259
             SKDE I+ISF+ LRRLVLEAVTFGSFLWDVES VDS YHFV
Sbjct  374   SKDEHIRISFAGLRRLVLEAVTFGSFLWDVESFVDSSYHFV  414



>ref|XP_003560595.1| PREDICTED: uncharacterized protein LOC100829350 [Brachypodium 
distachyon]
Length=413

 Score =   411 bits (1057),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 210/337 (62%), Positives = 255/337 (76%), Gaps = 4/337 (1%)
 Frame = -2

Query  1260  IAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDI  1081
             IAPL++ES +GQFL+QILV+HPHL+ AA +QQLEQLQT  +  K+    + +    G DI
Sbjct  80    IAPLQMESAVGQFLSQILVTHPHLLPAAAEQQLEQLQTVHDAAKKENGSDTQAPPPGGDI  139

Query  1080  VLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPSKDE  901
             VLYRRIA+VK  E+++ LEEILYA+VVQKF++A V LVPA+ S S ++SG +D      E
Sbjct  140   VLYRRIAQVKEKEKKRTLEEILYAMVVQKFVEAGVSLVPAL-SHSIDTSGRVDQWAEPTE  198

Query  900   -QLARLHSPEAYEMIQNHLSLILGNRSNANSSVQINKLRVGQVYAASVMYGYFLKRVDQR  724
              +L RLHS EAYEMI+NHL+LILG R    +   I+KLRVGQVYAASVMYGYFLKRVDQR
Sbjct  199   GKLERLHSHEAYEMIENHLNLILGQRQADATVAAISKLRVGQVYAASVMYGYFLKRVDQR  258

Query  723   FQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMK  544
             FQLEK+MK LP G   +D  + QV    S  S  +  SHPE+ SW    + + G G  +K
Sbjct  259   FQLEKSMKSLPWG--SQDDALNQVMMTDSRPSTEAYSSHPEMESWTSSDLSAGGLGQSIK  316

Query  543   PSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELI  364
             P RLR+YVMSFD +TLQ YATIRSK A  IIEKHTEALFG+PEI ITP+GT+DSSKDE +
Sbjct  317   PCRLRSYVMSFDSDTLQSYATIRSKVAFGIIEKHTEALFGKPEIVITPEGTVDSSKDEHV  376

Query  363   KISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFVAH  253
             +ISF+ LRRL+LEAVTFGSFLWDVES VDSRYHFV +
Sbjct  377   RISFAGLRRLILEAVTFGSFLWDVESYVDSRYHFVTN  413



>ref|XP_010661178.1| PREDICTED: uncharacterized protein LOC100245443 isoform X2 [Vitis 
vinifera]
Length=365

 Score =   409 bits (1050),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 221/373 (59%), Positives = 271/373 (73%), Gaps = 19/373 (5%)
 Frame = -2

Query  1338  VAFGSTKCNSIRASLPLSN-SGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQL  1162
             +A G  +   +RAS  + N S  SA PIAPL+LESPIG+FLT+IL+SHPHLV AAV++QL
Sbjct  1     MASGWKEQTMVRASATVDNDSYESAAPIAPLRLESPIGRFLTEILISHPHLVPAAVERQL  60

Query  1161  EQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDA  982
             EQ QTDR+ E   +    E SASG +++LYRRIA+VKANER+KALEEILY LVVQKF+ A
Sbjct  61    EQFQTDRDAEGHKQ----ESSASGIELLLYRRIAKVKANERKKALEEILYVLVVQKFVGA  116

Query  981   DVPLVPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNANSSV-  805
             +VPL+P ++  S  SSG +D  PS D  L  LHSPEA EMIQNHL+ ILGNR   ++SV 
Sbjct  117   NVPLIPRMSPSSLGSSGRVDNWPSLDRDLGELHSPEATEMIQNHLAFILGNRFGDSTSVA  176

Query  804   QINKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLD------KEDSGIQQVGGD  643
             +++KLRVGQVYAASVMYGYFLKRVD+RFQLEK MK+LP  LD      +E  G+   G D
Sbjct  177   KMSKLRVGQVYAASVMYGYFLKRVDERFQLEKTMKILPYALDGDKGYVEEAMGMSPFGSD  236

Query  642   ssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEA  463
                 S++   S PE   W  GG+    FG   KPS L +YV   D ETL RY TIRS EA
Sbjct  237   ---DSVQGVESQPEASCWA-GGLTIGSFGHWKKPSSLGSYVKLIDAETLMRYTTIRSMEA  292

Query  462   INIIEKHTEALFGRPEISITPQ---GTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDV  292
             ++II+KHT+ALFGR +++I P     T+DSS+DELIK+SF  L+RLVLEA+TFGSFLWDV
Sbjct  293   VSIIQKHTQALFGRRDVAIIPNIPMWTLDSSEDELIKMSFGGLKRLVLEALTFGSFLWDV  352

Query  291   ESSVDSRYHFVAH  253
             ES VDSR HFV +
Sbjct  353   ESFVDSRLHFVVN  365



>emb|CAN79123.1| hypothetical protein VITISV_030635 [Vitis vinifera]
Length=411

 Score =   409 bits (1052),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 221/377 (59%), Positives = 273/377 (72%), Gaps = 19/377 (5%)
 Frame = -2

Query  1350  GNRRVAFGSTKCNSIRASLPLSN-SGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAV  1174
             G+R++A G  +   +RA   + N S  SA  IAPL+LESPIG+FLT+IL+SHPHLV AAV
Sbjct  43    GHRKMASGWKEQTMVRAXATVDNDSYESAAXIAPLRLESPIGRFLTEILISHPHLVPAAV  102

Query  1173  DQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQK  994
             ++QLEQ QTDR+ E   +    E SASG +++LYRRIA+VKANER+KALEEILY LVVQK
Sbjct  103   ERQLEQFQTDRDAEGHKQ----ESSASGIELLLYRRIAKVKANERKKALEEILYVLVVQK  158

Query  993   FMDADVPLVPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNAN  814
             F+ A+VPL+P ++  S  SSG +D  PS D  L  LHSPEA EMIQNHL+ ILGNR   +
Sbjct  159   FVGANVPLIPRMSPSSLGSSGRVDNWPSLDRDLGELHSPEATEMIQNHLAFILGNRFGDS  218

Query  813   SSV-QINKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLD------KEDSGIQQ  655
             +SV +++KLRVGQVYAASVMYGYFLKRVD+RFQLEK MK+LP  LD      +E  G+  
Sbjct  219   TSVAKMSKLRVGQVYAASVMYGYFLKRVDERFQLEKTMKILPYALDGDKGYVEEAMGMSP  278

Query  654   VGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIR  475
              G D    S++   S PE   W  GG+    FG   KPS L +YV   D ETL RY TIR
Sbjct  279   FGSD---DSVQGVESQPEASCWA-GGLTIGSFGHWKKPSSLGSYVKLIDAETLMRYTTIR  334

Query  474   SKEAINIIEKHTEALFGRPEISITPQ---GTIDSSKDELIKISFSSLRRLVLEAVTFGSF  304
             S EA++II+KHT+ALFGR +++I P     T+DSS+DELIK+SF  L+RLVLEA+TFGSF
Sbjct  335   SMEAVSIIQKHTQALFGRRDVAIIPNIPMWTLDSSEDELIKMSFGGLKRLVLEALTFGSF  394

Query  303   LWDVESSVDSRYHFVAH  253
             LWDVES VDSR HFV +
Sbjct  395   LWDVESFVDSRLHFVVN  411



>gb|EMT10781.1| hypothetical protein F775_30852 [Aegilops tauschii]
Length=493

 Score =   407 bits (1045),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 213/330 (65%), Positives = 253/330 (77%), Gaps = 6/330 (2%)
 Frame = -2

Query  1260  IAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDI  1081
             IAPL++ESPIGQFL+QILV+HPHL+ AA +QQLEQLQT ++    ++K    P A+G DI
Sbjct  126   IAPLQMESPIGQFLSQILVTHPHLLPAAAEQQLEQLQTVQD--SADKKDAQAPPAAG-DI  182

Query  1080  VLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPSKDE  901
             VLYRRIAEVK  ER++ +EEILYALVVQKF++A V LVPA++     SSG +D      E
Sbjct  183   VLYRRIAEVKEKERKRTMEEILYALVVQKFVEAGVSLVPALSHSIDASSGRVDQWAEHVE  242

Query  900   -QLARLHSPEAYEMIQNHLSLILGNRSNANSSVQINKLRVGQVYAASVMYGYFLKRVDQR  724
              +L RLHS EAYEMI+NHL+LILG R    +   I+KLRVGQVYAASVMYGYFLKRVD+R
Sbjct  243   GKLERLHSHEAYEMIENHLNLILGQRQADGTVAAISKLRVGQVYAASVMYGYFLKRVDKR  302

Query  723   FQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMK  544
             FQLEK+MK LP G   ED  + QV    S  S ++  SHPEV SW    + + G G  +K
Sbjct  303   FQLEKSMKSLPWG--SEDDALNQVMTTDSRPSDQTYSSHPEVESWTSPDLSAGGLGQSVK  360

Query  543   PSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELI  364
             PSRLR+YVMSFD +TLQ YATIRSK A  IIEKHTEALFG+PEI ITP+GT+DSSKDE +
Sbjct  361   PSRLRSYVMSFDSDTLQTYATIRSKVAFGIIEKHTEALFGKPEIVITPEGTVDSSKDEYV  420

Query  363   KISFSSLRRLVLEAVTFGSFLWDVESSVDS  274
             +ISFS LRRL+LEAVTFGSFLWDVES VDS
Sbjct  421   RISFSGLRRLILEAVTFGSFLWDVESYVDS  450



>gb|ABR17692.1| unknown [Picea sitchensis]
 gb|ACN40252.1| unknown [Picea sitchensis]
Length=434

 Score =   403 bits (1035),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 223/401 (56%), Positives = 279/401 (70%), Gaps = 33/401 (8%)
 Frame = -2

Query  1410  GFVKFGSKALLSAPSIKVKLGNR-RVAFGSTKCNSIRASLPLSNSGGSAMPIAPLKLESP  1234
             G +KF    +   P  +     R R  FG      +RA+    N   S+ PIAPL+LESP
Sbjct  52    GSLKFSQSIITPGPQWRCTYSKRSRRNFG------VRAA---GNYDESSKPIAPLQLESP  102

Query  1233  IGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIAEV  1054
              GQFL+Q+L  HPHL+ AAV+QQLE+L  DR+       Q D PS++ T++VLYRRIAEV
Sbjct  103   TGQFLSQLLKDHPHLLPAAVEQQLERLVADRD----AAAQQDPPSSTSTELVLYRRIAEV  158

Query  1053  KANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPSKDEQLARLHSPE  874
             KA ERRKALEEI+YAL+VQKFMDA + L+P I+ P    +G IDT P +D +L  +HS E
Sbjct  159   KAAERRKALEEIMYALIVQKFMDARISLIPCISMPDP-VTGQIDTWPKQDHKLEGVHSSE  217

Query  873   AYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKV  697
             A+EMI+NHLSL+LGNR   +SS+ QI+KLRVGQVYAASVMYGYFL+RVDQRFQLEK+MK 
Sbjct  218   AFEMIKNHLSLVLGNRLLDSSSIAQISKLRVGQVYAASVMYGYFLRRVDQRFQLEKSMKT  277

Query  696   LPQGLDKEDSGIQQVGGDssdt-slrsspSHPEVVSWPDGGMGSRGFGTE----------  550
             LP GL++E    Q +G DS      ++  S P+V S     M S G  +E          
Sbjct  278   LPSGLNEESDAEQTLGSDSKTKGEFQTRYSSPQVAS---AAMPSIGTPSEPEFNPTVNGR  334

Query  549   --MKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSK  376
               +KP +LR YVMSF+ ETLQRYAT+RSKE ++IIEKH+EALFGRPE+ +   G++ ++ 
Sbjct  335   RGVKPCKLRAYVMSFEPETLQRYATMRSKEGVSIIEKHSEALFGRPEVQVV-GGSVAATN  393

Query  375   DELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFVAH  253
             DE+IKISFS L  LVLEAVTFGSFLWDVES VDSRYHFV +
Sbjct  394   DEIIKISFSGLTSLVLEAVTFGSFLWDVESYVDSRYHFVTN  434



>gb|ADE77481.1| unknown [Picea sitchensis]
Length=435

 Score =   389 bits (998),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 206/365 (56%), Positives = 255/365 (70%), Gaps = 48/365 (13%)
 Frame = -2

Query  1260  IAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDI  1081
             IAPL  ESPIGQFL+QIL +HPHL+ AA+DQQLE+L  DR+   Q+E    +PS S TD+
Sbjct  86    IAPLDFESPIGQFLSQILKNHPHLLPAAIDQQLERLAADRDAASQHE----QPSTSSTDL  141

Query  1080  VLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPSKDE  901
             VLYRRIAE+KA ERRKALEEI+Y L+VQKFMDA V L+P I+ P+  S G +DT P++D 
Sbjct  142   VLYRRIAELKAEERRKALEEIIYTLIVQKFMDAGVSLIPTISLPAAGS-GKVDTWPNQDT  200

Query  900   QLARLHSPEAYEMIQNHLSLILGNR---SNANSSVQINKLRVGQVYAASVMYGYFLKRVD  730
             +L  +HS EA EMI+ HLSL+LGNR   S++N+  +I+KLRVGQVYAASVMYGYFL+RVD
Sbjct  201   ELEAVHSIEAVEMIKEHLSLVLGNRNAGSDSNTVAEISKLRVGQVYAASVMYGYFLRRVD  260

Query  729   QRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEV--VSWPDGGMGSRG--  562
             + FQLEK+MK+LP   ++E    Q             + +HPE+  V+W D      G  
Sbjct  261   KHFQLEKSMKMLPFASNEEIDAEQ------------LNSTHPELEGVNWQDNSAVQGGAA  308

Query  561   -----------------------FG-TEMKPSRLRTYVMSFDGETLQRYATIRSKEAINI  454
                                    FG    KP +LR YVMSFD ETLQRYAT+RSKE +NI
Sbjct  309   IAAAVAAMAGAAGPAGQDFNPIVFGQIGAKPCKLRAYVMSFDPETLQRYATMRSKEGVNI  368

Query  453   IEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDS  274
             IE+H EALFGRPEI ITP G++  +KDE+++ISF+ L  +VLEAVTFGSFLWDVES VDS
Sbjct  369   IERHAEALFGRPEIHITPDGSMAVTKDEILRISFTGLTSMVLEAVTFGSFLWDVESHVDS  428

Query  273   RYHFV  259
             RYHFV
Sbjct  429   RYHFV  433



>gb|KHG07714.1| Ribosomal L11 methyltransferase [Gossypium arboreum]
Length=340

 Score =   381 bits (979),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 194/278 (70%), Positives = 223/278 (80%), Gaps = 19/278 (7%)
 Frame = -2

Query  1068  RIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPSKDEQLAR  889
             RIAEVKANER++ALEEILYALVV KFMDADV LVPAIT  S++SSG +DT PS++E+  +
Sbjct  72    RIAEVKANERKRALEEILYALVVLKFMDADVSLVPAITPSSKDSSGQVDTWPSQEEKFEQ  131

Query  888   LHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFLKRVDQRFQLE  712
             LHSPEAYEMIQ+HL+LILGNR N + SV QI+K+RVGQVYAASVMYGYFLKRVD+RFQLE
Sbjct  132   LHSPEAYEMIQSHLALILGNRLNDSKSVAQISKIRVGQVYAASVMYGYFLKRVDERFQLE  191

Query  711   KNMKVLPQGLDKEDSGIQQV-------GGDssdtslrsspSHPEVVSWPDGGMGSRGFGT  553
             K MK+LP G D E S I++         GD    S      H EV SW      S GFG 
Sbjct  192   KTMKILPNGSDSEGSSIEKAIREDIRPAGDYLVVSS-----HLEVSSW------SGGFGN  240

Query  552   EMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKD  373
              +KPSRLRTY+MSFDG+ LQR+ATIRSKEA++IIEK TEALFGRPEI +TPQGT+DSSKD
Sbjct  241   RIKPSRLRTYLMSFDGDILQRFATIRSKEAVSIIEKQTEALFGRPEIVLTPQGTVDSSKD  300

Query  372   ELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  259
             ELIKISF  L++LVLEA+TFGSFLWD ES VDSRYHFV
Sbjct  301   ELIKISFGGLKKLVLEAITFGSFLWDGESFVDSRYHFV  338



>emb|CAL07981.1| hypothetical protein [Platanus x acerifolia]
Length=273

 Score =   378 bits (971),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 194/274 (71%), Positives = 221/274 (81%), Gaps = 8/274 (3%)
 Frame = -2

Query  1071  RRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAIT-SPSQNSSGSIDTLPSKDEQL  895
             RRIAEVKANERRKALEEILYALVVQKFMDADV L+P I+ S + ++S  + T P ++E+L
Sbjct  1     RRIAEVKANERRKALEEILYALVVQKFMDADVSLMPTISPSSATDASTQVGTWPGQEEKL  60

Query  894   ARLHSPEAYEMIQNHLSLILGNR-SNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQ  718
              +LHSPEAYEMIQNHL+LILGNR +N+N+  QI+KLRVGQVYAASVMYGYFLKRVDQRFQ
Sbjct  61    KQLHSPEAYEMIQNHLALILGNRVANSNTVAQISKLRVGQVYAASVMYGYFLKRVDQRFQ  120

Query  717   LEKNMKVLPQGLDKEDSGIQQVGGDss-----dtslrsspSHPEVVSWPDGGMGSRGFGT  553
             LEK MK+LP   D+E S I+Q   +         S  +  +HPEV S P G     GFG 
Sbjct  121   LEKTMKILPFASDEEKSDIEQSVAEEMRPGGGKASAYAEQTHPEVSSQP-GNFSPGGFGH  179

Query  552   EMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKD  373
              +KPSRLRTYVM+FD ETLQ YATIRSKEA+ IIEKHTEALFGRPEI ITPQGTIDSSKD
Sbjct  180   GIKPSRLRTYVMAFDAETLQSYATIRSKEAVTIIEKHTEALFGRPEIVITPQGTIDSSKD  239

Query  372   ELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSR  271
             EL++ISF  L+RLVLEAVTFGSFLWDVES VDSR
Sbjct  240   ELVRISFGGLKRLVLEAVTFGSFLWDVESYVDSR  273



>ref|XP_007036963.1| Uncharacterized protein isoform 3, partial [Theobroma cacao]
 gb|EOY21464.1| Uncharacterized protein isoform 3, partial [Theobroma cacao]
Length=360

 Score =   369 bits (946),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 202/324 (62%), Positives = 242/324 (75%), Gaps = 19/324 (6%)
 Frame = -2

Query  1428  FTTDAPGFVKFGSKALLS------APSIKVKLGNRRVAFGSTKCNSIRASLPLSNSGGSA  1267
              T + P F++F +K  L       +P    K  NRR+A GS +   +RAS    +S G  
Sbjct  43    LTANEPHFLRFAAKPRLPFSIKHYSPLSYSKPQNRRMALGSRRGMVVRASSS-PDSAGPT  101

Query  1266  MPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSAS-G  1090
              PIAPL++ESPIGQFL+QIL+SHPHLV AAV+QQLEQLQTDR+ E++ E    EPSAS G
Sbjct  102   APIAPLQMESPIGQFLSQILISHPHLVPAAVEQQLEQLQTDRDAEEKKE----EPSASAG  157

Query  1089  TDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPS  910
             TD+VLYRRIAEVKANER+KALEEILYALVVQKFMDA+V LVPA+T  S + SG +D  PS
Sbjct  158   TDLVLYRRIAEVKANERKKALEEILYALVVQKFMDANVSLVPAMTPSSTDPSGRVDMWPS  217

Query  909   KDEQLARLHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFLKRV  733
             ++++L  LHSPEAYEMIQNHL+LILGNR   ++SV QI+KLRVGQVYAASVMYGYFLKRV
Sbjct  218   EEDKLELLHSPEAYEMIQNHLALILGNRLGDSTSVAQISKLRVGQVYAASVMYGYFLKRV  277

Query  732   DQRFQLEKNMKVLPQGLDKEDSGIQQ-VGGDssdt----slrsspSHPEVVSWPDGGMGS  568
             DQRFQLEK MK+LP   + E+SG++Q VG D        S ++  SHPEV SW  GG+  
Sbjct  278   DQRFQLEKTMKILPNASNGEESGVEQSVGEDMGTAGLGDSYKAVSSHPEVSSW-SGGISP  336

Query  567   RGFGTEMKPSRLRTYVMSFDGETL  496
              GFG  +KP RLRTYVMSFDGETL
Sbjct  337   GGFGHGIKPCRLRTYVMSFDGETL  360



>gb|AAK30572.1|AF346660_1 unknown [Brassica napus]
Length=256

 Score =   356 bits (913),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 179/258 (69%), Positives = 214/258 (83%), Gaps = 6/258 (2%)
 Frame = -2

Query  1029  LEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNH  850
             LEEILYALVVQKFM+A+V LVP+IT  S + SG +DT P+K E+L +LHS E YEMI NH
Sbjct  2     LEEILYALVVQKFMEANVSLVPSITPSSSDPSGRVDTWPTKVEKLEKLHSSEMYEMIHNH  61

Query  849   LSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKE  673
             L+LILG R    +SV QI+KLRVGQVYAASVMYGYFLKRVDQRFQLEK+MK+L  GLD+ 
Sbjct  62    LALILGPRMGDLASVAQISKLRVGQVYAASVMYGYFLKRVDQRFQLEKSMKLLTGGLDES  121

Query  672   DSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQ  493
              + ++Q      + + ++  SHPEV S+  GG+ ++GFG+E+KPSRLRTYVMSFD ETLQ
Sbjct  122   KTSVEQ----PENVTFKAVSSHPEVGSFA-GGVSAKGFGSEIKPSRLRTYVMSFDSETLQ  176

Query  492   RYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTF  313
             RYATIRS+EA+ IIEKHTEALFG+PEI ITP+GT+DSSKDE IKISF  ++RLVLEAVTF
Sbjct  177   RYATIRSREAVGIIEKHTEALFGKPEIVITPEGTVDSSKDEQIKISFGGMKRLVLEAVTF  236

Query  312   GSFLWDVESSVDSRYHFV  259
             GSFLWDVES VD+RYHFV
Sbjct  237   GSFLWDVESHVDARYHFV  254



>ref|XP_010919980.1| PREDICTED: uncharacterized protein LOC105043949 [Elaeis guineensis]
Length=404

 Score =   360 bits (923),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 189/348 (54%), Positives = 250/348 (72%), Gaps = 19/348 (5%)
 Frame = -2

Query  1290  LSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQN  1111
             L NSG + +PIAPL+ ESPIGQ L+QI+ +HPHL+ AA+DQQLE+LQ+DR+ EK+     
Sbjct  74    LENSGENQIPIAPLQFESPIGQLLSQIMQTHPHLLPAAIDQQLERLQSDRDAEKE-----  128

Query  1110  DEPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSG  931
              E   +  D++LYRRIAEVKA ER+KALEEI+Y L+VQKFMD D+ ++PAI SPS + + 
Sbjct  129   -ETPPATQDLLLYRRIAEVKAKERQKALEEIIYCLIVQKFMDNDISMIPAI-SPSSDPNS  186

Query  930   SIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNA--NSSVQINKLRVGQVYAASVM  757
              +   P+++ +L  +HSP+A EMIQ+HL+LILG R+    N+ VQI+KL++G++YAAS+M
Sbjct  187   EVHYWPNQEHKLEAIHSPDALEMIQSHLTLILGERAVGPLNAIVQISKLKLGKLYAASIM  246

Query  756   YGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGG  577
             YGYFLKRVDQRFQLE+ MK LP      D+  Q+V  D     L    S  ++ S     
Sbjct  247   YGYFLKRVDQRFQLERTMKTLPT-----DTRQQRVFDDLKPNPLWDLESMVQISS-----  296

Query  576   MGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQ  397
                   G + K  RLR+YVM  D E LQRYATIRSKE+I++IEK T+ALFGRP+I I   
Sbjct  297   DDDGSDGEDSKSYRLRSYVMYLDAEALQRYATIRSKESISLIEKQTQALFGRPDIRIAED  356

Query  396   GTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFVAH  253
             G++D+S DEL+ I+FS L  LVLEAV FGSFLW+ ES V+S+YHFV +
Sbjct  357   GSLDTSNDELVGITFSGLTMLVLEAVAFGSFLWEAESYVESKYHFVTN  404



>ref|XP_011028101.1| PREDICTED: uncharacterized protein LOC105128231 [Populus euphratica]
Length=413

 Score =   358 bits (919),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 191/389 (49%), Positives = 264/389 (68%), Gaps = 25/389 (6%)
 Frame = -2

Query  1398  FGSKALLSAPSIKVK----LGNRRVAFGSTKCN----SIRASLPLSNSGGSAMPIAPLKL  1243
             F S + LS PS   K     G  R+  G  K      ++RAS    +S G+ +P++PL+ 
Sbjct  37    FHSLSFLSPPSHLTKRCPSFGIPRLGAGMYKFRPRGLTVRAS---GDSAGNPVPVSPLEF  93

Query  1242  ESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRI  1063
             ESP+GQ L QIL +HPHL+ AA+DQQLE LQTDR+ +K       E +AS  D  LY+RI
Sbjct  94    ESPVGQLLAQILQTHPHLLPAAIDQQLENLQTDRDAQK-------EEAASSQDF-LYKRI  145

Query  1062  AEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPSKDEQLARLH  883
             AEVK  ERRKALEEI+Y+++V KF+D D+ ++P I SP+ + +G +D  P+++++L  +H
Sbjct  146   AEVKEKERRKALEEIIYSMIVHKFLDNDISMIPKI-SPTSDPTGRVDFWPNQEQKLEAVH  204

Query  882   SPEAYEMIQNHLSLILGNR--SNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQLEK  709
             SPEA+EMIQ+HLS++LG R      +++QI+K+++G++YAAS+MYGYFL+RVDQR+QLE+
Sbjct  205   SPEAFEMIQSHLSIVLGERLVGPLETTIQISKIKLGKLYAASLMYGYFLRRVDQRYQLER  264

Query  708   NMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPSRLR  529
              M  LP+G D++ +  +     +      S          PDG     G   E K  RLR
Sbjct  265   TMNTLPKGFDEDRARFEDPSPANRLWDPDSLIRILPNSGDPDGDFTDTG---EEKSYRLR  321

Query  528   TYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKISFS  349
             +YVM  D ETLQRYATIRSKEAI++IEK T+ALFGRP+I I   G+I+++ DE++ I+FS
Sbjct  322   SYVMYLDAETLQRYATIRSKEAISLIEKQTQALFGRPDIRIADDGSIETANDEVVSITFS  381

Query  348   SLRRLVLEAVTFGSFLWDVESSVDSRYHF  262
              L  LVLEAV FGSFLWD ES V+S+YHF
Sbjct  382   GLTMLVLEAVGFGSFLWDAESYVESKYHF  410



>ref|XP_002276652.1| PREDICTED: uncharacterized protein LOC100260823 [Vitis vinifera]
Length=403

 Score =   350 bits (899),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 188/387 (49%), Positives = 262/387 (68%), Gaps = 26/387 (7%)
 Frame = -2

Query  1398  FGSKALLSAPSIKV-KLGNRRVAFGSTKCN----SIRASLPLSNSGGSAMPIAPLKLESP  1234
             F +    S PS  + KLG      G  KC     ++RAS+   NS    +P+APL+LESP
Sbjct  34    FKNLLFRSCPSFCIPKLG-----VGLDKCRVRGLTVRASV---NSDDELVPVAPLQLESP  85

Query  1233  IGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIAEV  1054
             IGQ L QIL +HPHL+ AA+DQQLE LQTDR+       Q +E   S  D++LYRRIA V
Sbjct  86    IGQLLAQILQTHPHLLPAAIDQQLENLQTDRD------AQREETPPSSHDLLLYRRIAAV  139

Query  1053  KANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPSKDEQLARLHSPE  874
             +  ER+K LEEILY L+VQKF+D ++ ++P I++ S +  G +D  P+++++L  +HSPE
Sbjct  140   REKERQKVLEEILYCLIVQKFVDKNISMIPKISATS-DPVGRVDFWPNQEQKLESIHSPE  198

Query  873   AYEMIQNHLSLILGNR--SNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMK  700
             A+EMIQ+HLSL+LG R     ++ VQI+K+++G++YAAS+MYGYFLKRVD+R+QLE+ MK
Sbjct  199   AFEMIQSHLSLVLGERLVGPLDTIVQISKIKLGKLYAASIMYGYFLKRVDERYQLERTMK  258

Query  699   VLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYV  520
              LP+G ++     +  G  +      S    P       G + S   G+     RLR+YV
Sbjct  259   TLPEGFNENRLSFEDPGPANRLWDPDSLIRIPADDDDDGGMLDSVEGGS----YRLRSYV  314

Query  519   MSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLR  340
             M  D ETLQRYATIRSKEAI++IEK T+ALFG+P++ ++  G++D+S DE++ I+FS L 
Sbjct  315   MYLDAETLQRYATIRSKEAISLIEKQTQALFGKPDVRVSEDGSLDTSNDEVVSITFSGLT  374

Query  339   RLVLEAVTFGSFLWDVESSVDSRYHFV  259
              LVLEAV FGSFLWD E+ V+S+YHF+
Sbjct  375   MLVLEAVAFGSFLWDSETYVESKYHFL  401



>ref|XP_010261560.1| PREDICTED: uncharacterized protein LOC104600354 [Nelumbo nucifera]
Length=409

 Score =   350 bits (899),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 194/390 (50%), Positives = 260/390 (67%), Gaps = 33/390 (8%)
 Frame = -2

Query  1398  FGSKALLSA------PSIKVKLGNRRVAFGSTKCN----SIRASLPLSNSGGSAMPIAPL  1249
             + +K+LLS       PS  ++LG      G  KC     S+RAS    +S     PIAPL
Sbjct  33    YDTKSLLSGGILKRYPSCFLRLGA-----GLEKCRTRSLSVRAS---GHSNNDTTPIAPL  84

Query  1248  KLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNE--KQNDEPSASGTDIVL  1075
             + ESP+GQ L QI+ +HPHL+ AA+DQQLE LQTD+  + +     QND         +L
Sbjct  85    RFESPVGQLLVQIMQTHPHLLPAAIDQQLENLQTDQGAQGEESLPPQND---------LL  135

Query  1074  YRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPSKDEQL  895
             YRRIAEV+  ERRKALEEI+Y L+VQKFM+  + ++P I+ PS + +G +D  P+++++L
Sbjct  136   YRRIAEVQEKERRKALEEIIYCLIVQKFMENAISMIPPISVPSSDPTGRVDLWPNQEQKL  195

Query  894   ARLHSPEAYEMIQNHLSLILGNR--SNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRF  721
               +HSPEA+EMIQ+HLSL+LG+R     ++ VQI+KL++G++YAAS+MYGYFLKRVDQRF
Sbjct  196   ESVHSPEAFEMIQSHLSLVLGDRLVGPLDTIVQISKLKLGKLYAASIMYGYFLKRVDQRF  255

Query  720   QLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKP  541
             QLE+ MK LP G D ED  ++    ++      S           DG     G G E K 
Sbjct  256   QLERTMKTLPDGFD-EDQVLKDPAPENQLWDADSLIRISPDDGDSDGDGDILGSG-ETKS  313

Query  540   SRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIK  361
              RLR+YVM  D ETLQRYAT+R+KEAI++IEK T+ALFGRP+I I   G++D+S DE+I 
Sbjct  314   YRLRSYVMYLDAETLQRYATVRTKEAISLIEKQTQALFGRPDIRIAEDGSLDTSNDEMIG  373

Query  360   ISFSSLRRLVLEAVTFGSFLWDVESSVDSR  271
             ++FS L  LVLEAV FGSFLWD ES V+S+
Sbjct  374   LTFSGLTMLVLEAVAFGSFLWDAESYVESK  403



>ref|XP_006471483.1| PREDICTED: uncharacterized protein LOC102623998 [Citrus sinensis]
Length=408

 Score =   347 bits (891),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 186/384 (48%), Positives = 266/384 (69%), Gaps = 36/384 (9%)
 Frame = -2

Query  1374  APSIKV-KLGNRRVAFGSTKCN----SIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQI  1210
              PS  + KLGN     G  KC     ++RAS    +S  + +PIAPL+ ESP+GQ L QI
Sbjct  47    CPSFCIPKLGN-----GMDKCRMRDLTVRAS---GSSDRNVVPIAPLQFESPVGQLLAQI  98

Query  1209  LVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIAEVKANERRKA  1030
             L +HPHL+ AA+DQQLE +Q D+N+++++  Q+          +LY+RIAEVK  ER+KA
Sbjct  99    LQTHPHLLPAAIDQQLENIQIDKNVQREDTSQD----------LLYQRIAEVKEKERQKA  148

Query  1029  LEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNH  850
             +EEI+Y L+VQKF++ D+ ++P I   S +  G +D  P+++++L  +HSPEA+EMIQ+H
Sbjct  149   VEEIIYCLIVQKFVENDISMIPKIGETS-DPVGRVDFWPNQEQKLESVHSPEAFEMIQSH  207

Query  849   LSLILGNR--SNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDK  676
             LSL+LG R     ++ +QI+K+++G++YAAS+MYGYFL+RVDQRFQLE+ MK LP+G D+
Sbjct  208   LSLVLGERLVGPLDTIIQISKIKLGKLYAASIMYGYFLRRVDQRFQLERTMKTLPEGFDE  267

Query  675   EDSGIQQVGGDssdtslrsspSHPE-VVSWP---DGGMGSRGF-GTEMKPSRLRTYVMSF  511
             +     +V  +  + S  +    P+ ++  P   DG +G     G E K  RLR+YVM  
Sbjct  268   D-----KVRYEEREPSPMNRLWDPDSLIRIPPNDDGTVGESFMDGGEGKSYRLRSYVMYL  322

Query  510   DGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLV  331
             D ETLQRYATIRSKEAI++IEK T+ALFGRP++ +   G+ID+SKDE+I ++F  L  LV
Sbjct  323   DAETLQRYATIRSKEAISLIEKQTQALFGRPDVRVLEDGSIDTSKDEVISVTFLGLTMLV  382

Query  330   LEAVTFGSFLWDVESSVDSRYHFV  259
             LEAV FGSF+WD ES V+S+Y F+
Sbjct  383   LEAVAFGSFMWDSESYVESKYPFI  406



>ref|XP_012080770.1| PREDICTED: uncharacterized protein LOC105640956 [Jatropha curcas]
 gb|KDP30713.1| hypothetical protein JCGZ_15541 [Jatropha curcas]
Length=405

 Score =   347 bits (891),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 190/397 (48%), Positives = 264/397 (66%), Gaps = 50/397 (13%)
 Frame = -2

Query  1383  LLSAPSIKV------KLGNRRVAFGSTKCNSIRASLPLSNSGGSAMPIAPLKLESPIGQF  1222
             L SAPS +       KLGN    F   +   +RAS   SN    ++PI+PL+ ESP+GQ 
Sbjct  35    LSSAPSRRYPSFGMPKLGNGMTKF-RERGFIVRASGDPSNY---SVPISPLQFESPVGQL  90

Query  1221  LTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIAEVKANE  1042
             L QIL +HPHL+ AAVDQQLE LQTDR+      K+++ P +     +LY+RIAEV+  E
Sbjct  91    LAQILQTHPHLLPAAVDQQLENLQTDRD-----TKRDETPPSQD---LLYKRIAEVREKE  142

Query  1041  RRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEM  862
             RR ALEEI+Y+L+VQKF+D  + ++P I S S + +G +D  P+++++L  +HSPEA+EM
Sbjct  143   RRNALEEIIYSLIVQKFLDNGISMIPKI-SASSDPTGRVDFWPNQEQKLESVHSPEAFEM  201

Query  861   IQNHLSLILGNR--SNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQ  688
             IQ+HL+L+LG+R     ++ VQI+K+++G++YAAS+MYGYFL+RVDQRFQLE+ M  LP+
Sbjct  202   IQSHLTLVLGDRLVGPIDTIVQISKIKLGKLYAASIMYGYFLRRVDQRFQLERTMNTLPK  261

Query  687   GLDKEDSGIQQVGGDssdtslrsspSHPEVVSW------------PDGGMGSRGF--GTE  550
             G D+     +++  D            P  V+W             DG     GF   + 
Sbjct  262   GFDES----RRIYDD-----------DPSPVNWFWDSDSLIRIQPDDGDYSDEGFIDTSR  306

Query  549   MKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDE  370
              K +RLR+YVM  D ETLQRYATIRSKE +++IEK T+ALFGRP+I +   G+ID++ DE
Sbjct  307   EKSNRLRSYVMYLDAETLQRYATIRSKEVMSLIEKQTQALFGRPDIRVMEDGSIDTANDE  366

Query  369   LIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  259
             +I ++FS L  LVLEAV FGSFLWD ES V+S+YHF+
Sbjct  367   VISMTFSGLTMLVLEAVAFGSFLWDAESYVESKYHFL  403



>ref|XP_008800077.1| PREDICTED: uncharacterized protein LOC103714566 isoform X1 [Phoenix 
dactylifera]
Length=405

 Score =   347 bits (889),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 181/346 (52%), Positives = 246/346 (71%), Gaps = 19/346 (5%)
 Frame = -2

Query  1290  LSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQN  1111
             L NSG +  PIAPL+ ESP+GQ L+QI+ +HPHL+ AA+DQQLE+LQ+DR+ +K+     
Sbjct  75    LENSGENHTPIAPLQFESPVGQLLSQIMQTHPHLLPAAIDQQLEKLQSDRDAQKE-----  129

Query  1110  DEPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSG  931
              E   +  D+ LYRRIAEVKA ER+KALEEI+Y L+VQKFMD  + ++PAI SP+ + + 
Sbjct  130   -ETPPATQDLPLYRRIAEVKAKERQKALEEIIYCLIVQKFMDNGISMIPAI-SPTSDPNS  187

Query  930   SIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNR--SNANSSVQINKLRVGQVYAASVM  757
              +   P+++++L  +HSP+A +MIQ+HL+LILG R     N+ VQI++L++G++YAAS+M
Sbjct  188   QVHYWPNQEQKLEAIHSPDALDMIQSHLTLILGERVVGPLNTIVQISRLKLGKLYAASIM  247

Query  756   YGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGG  577
             YGYFLKRVDQRFQLE+ MK LP      D+  Q++  D     L    S  ++ S     
Sbjct  248   YGYFLKRVDQRFQLERTMKTLPT-----DTRQQRIFDDLKPNPLWDLESMVQISS-----  297

Query  576   MGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQ  397
                   G + K  RLR+YVM  D ETLQRYATIRSKE+I++IEK T+ALFGRP+I I   
Sbjct  298   DDDGSDGEDSKSYRLRSYVMYLDAETLQRYATIRSKESISLIEKQTQALFGRPDIRIAED  357

Query  396   GTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  259
             G++D+S DEL+ I+F+ L  LVLEAV FGS LW+ ES V+S+YHFV
Sbjct  358   GSLDTSNDELVGITFTGLTMLVLEAVAFGSILWEAESYVESKYHFV  403



>ref|XP_011081424.1| PREDICTED: uncharacterized protein LOC105164476 [Sesamum indicum]
Length=408

 Score =   343 bits (881),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 182/390 (47%), Positives = 268/390 (69%), Gaps = 27/390 (7%)
 Frame = -2

Query  1416  APGFVKFGSKALLSAPSIKVKLGNRRVAFGSTKCNSIRASLPLSNSGGSAMPIAPLKLES  1237
             +PGF K       S P+ K+++G  ++    T+   +RAS    NSGG  +P+APL+LES
Sbjct  40    SPGFSKN-----CSFPNPKLEIGPEKL---RTRGFMVRAS---GNSGGDLIPVAPLQLES  88

Query  1236  PIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIAE  1057
             P+GQ L QIL +HPHL+ A  +QQLE LQ+ R+     +K+   PS+   D++LY+RIAE
Sbjct  89    PVGQLLAQILQTHPHLLLATAEQQLENLQSQRD----GQKETTAPSSQ--DLLLYKRIAE  142

Query  1056  VKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPSKDEQLARLHSP  877
             VK  ERRK LEEI+Y L+VQ+F+   + ++P I++ S + +G +D  P++++QL  +HS 
Sbjct  143   VKEKERRKTLEEIIYCLIVQRFVANHISMIPKISTTS-DPTGRVDLWPNQEQQLESVHSA  201

Query  876   EAYEMIQNHLSLILGNR--SNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQLEKNM  703
             EA+EMI +HLSL+LG R     ++ +QI+K+++G++YAAS+MYGYFL+RVD+R+QLE++M
Sbjct  202   EAFEMILSHLSLVLGERVVGPLDTIIQISKIKLGKLYAASIMYGYFLRRVDERYQLERSM  261

Query  702   KVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGS--RGFGTEMKPSRLR  529
               LP+G      G ++V  +      +       +  +PD G G       +E K  +LR
Sbjct  262   NTLPEGF-----GEERVRFEEPTPEKQLWDPDSLIRIYPDEGDGGGIVDSSSEEKSYKLR  316

Query  528   TYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKISFS  349
             +YVM  D ETLQRYATIRSKEAI++IEK T+ALFG+P+I++T  G++D+S DEL+ ++FS
Sbjct  317   SYVMYLDAETLQRYATIRSKEAISLIEKQTQALFGQPDITVTQDGSLDASNDELVSLTFS  376

Query  348   SLRRLVLEAVTFGSFLWDVESSVDSRYHFV  259
              L  LVLEAVTFGSFLWD E+ V+S+Y F+
Sbjct  377   GLTMLVLEAVTFGSFLWDTENYVESKYPFI  406



>gb|KJB21160.1| hypothetical protein B456_003G185600 [Gossypium raimondii]
 gb|KJB21161.1| hypothetical protein B456_003G185600 [Gossypium raimondii]
Length=400

 Score =   341 bits (874),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 179/369 (49%), Positives = 249/369 (67%), Gaps = 20/369 (5%)
 Frame = -2

Query  1356  KLGNRRVAFGSTKCNSIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAA  1177
             KLG     +   +C ++RAS     SG +  PIAP++ ESP+GQ L QIL +HPHL+ AA
Sbjct  47    KLGMVPDKYRGGRCLTMRAS---GESGDNLSPIAPVEFESPVGQLLAQILRTHPHLLPAA  103

Query  1176  VDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQ  997
             VDQQL+ LQ+D+N + +   Q+ +        +LY+RIAEVK  ER+K LEEI+Y L+VQ
Sbjct  104   VDQQLDNLQSDKNDQTEETPQSQD--------LLYKRIAEVKEKERQKTLEEIIYCLIVQ  155

Query  996   KFMDADVPLVPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNR--S  823
             KF+D ++ ++P +T  S + +G +D  P+++++L  +HSPEA+EMIQ+HLSL+LG+R   
Sbjct  156   KFVDNEISMIPKVTETS-DPTGRVDFWPNQEQKLEFVHSPEAFEMIQSHLSLVLGDRMVG  214

Query  822   NANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVG-G  646
               ++ VQI+K+++G++YAAS+MYGYFL+RVDQRFQLE+ MK LP+   K  +  +    G
Sbjct  215   PLSTIVQISKIKLGKLYAASIMYGYFLRRVDQRFQLERTMKTLPEDFTKSQARFEDPNPG  274

Query  645   DssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKE  466
                          P          G      E K  RLR+YVM  D ETLQRYATIRSKE
Sbjct  275   KQLWDPDSLIRIPPHDDD-----DGGGYGDAEGKQYRLRSYVMYLDSETLQRYATIRSKE  329

Query  465   AINIIEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVES  286
             AI++IEK T+ALFGRP+I I   G++D+S DE++ ++FS L  LVLEAV FGSFLWD ES
Sbjct  330   AISLIEKQTQALFGRPDIRILDDGSLDTSNDEVVSLTFSGLTMLVLEAVAFGSFLWDAES  389

Query  285   SVDSRYHFV  259
              V+S+YHF+
Sbjct  390   YVESKYHFL  398



>ref|XP_009413223.1| PREDICTED: uncharacterized protein LOC103994576 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=402

 Score =   340 bits (871),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 181/383 (47%), Positives = 257/383 (67%), Gaps = 27/383 (7%)
 Frame = -2

Query  1398  FGSKALLSAPSIKVKLGNRRVAFGSTKCNSIRASLPLSNSGGSAMPIAPLKLESPIGQFL  1219
             F +K+ +  P I ++L N R     T+   +RA   L NS     PIAPL+ ESP GQ L
Sbjct  44    FSAKSSIGWPKIGIRLENHR-----TRILQVRA---LGNSSDGQTPIAPLQFESPTGQLL  95

Query  1218  TQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIAEVKANER  1039
             +QI+ +HPHL+ AA+DQQLE+LQ+D + E      N +   +  D+ LYRRIAEVK  ER
Sbjct  96    SQIMQTHPHLLPAAIDQQLERLQSDIDAE------NAKTPVASQDLPLYRRIAEVKEKER  149

Query  1038  RKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMI  859
              KALEEI+Y L+VQKFM+ ++ ++P +T+ S + +  +D+ P+++ +L  +HSP+A EMI
Sbjct  150   HKALEEIIYCLIVQKFMEKEIDMIPTVTT-STDPTYRVDSWPNQEHKLESMHSPDALEMI  208

Query  858   QNHLSLILGNRSNA--NSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQG  685
             Q+HL+LILG R     N+  QI+KL++G++YAAS+MYGYFLKRVD+R+QLE+ MK LP  
Sbjct  209   QSHLTLILGERVGGPLNTVAQISKLKLGKLYAASIMYGYFLKRVDERYQLERTMKTLP--  266

Query  684   LDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDG  505
                +  G Q++  +     L    S  ++ S           G E KP RLR+YVM  D 
Sbjct  267   --TKPRG-QRIFDELKPNPLWDLESMVQISS-----DDDDFDGDETKPYRLRSYVMYLDA  318

Query  504   ETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLE  325
             ETLQRYATIRSKE+I++IEK T+ALFGRP+I I   G++++  DE++ I+FS L  LVLE
Sbjct  319   ETLQRYATIRSKESISLIEKQTQALFGRPDIRIADDGSLETPNDEVVGITFSGLTMLVLE  378

Query  324   AVTFGSFLWDVESSVDSRYHFVA  256
             AV FG+FLW+ E  V+S++HF++
Sbjct  379   AVAFGTFLWEAEGYVESKFHFLS  401



>gb|KHG08376.1| Beta-casein [Gossypium arboreum]
Length=399

 Score =   339 bits (869),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 186/401 (46%), Positives = 258/401 (64%), Gaps = 22/401 (5%)
 Frame = -2

Query  1449  PVKSGRRFTTDAPGFVKFGSKALLSAPSIKV-KLGNRRVAFGSTKCNSIRASLPLSNSGG  1273
             P      F    P      S      PS+ + KLG     +   +C ++RA   L  SG 
Sbjct  15    PSAGALNFRHFHPNHFFLSSPFFKRCPSLCIPKLGMVPDKYRGGRCLTMRA---LGESGD  71

Query  1272  SAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSAS  1093
             +  PIAP++ ESP+GQ L QIL +HPHL+ AAVDQQL+ LQ+D+N + +   Q+ +    
Sbjct  72    NLSPIAPVEFESPVGQLLAQILRTHPHLLPAAVDQQLDNLQSDKNDQTEETLQSHD----  127

Query  1092  GTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLP  913
                 +LY+RIAEVK  ER+K LEEI+Y L+VQKF+D ++ ++P +T  S + +G +D  P
Sbjct  128   ----LLYKRIAEVKEKERQKTLEEIIYCLIVQKFVDNEISMIPKVTETS-DPTGRVDFWP  182

Query  912   SKDEQLARLHSPEAYEMIQNHLSLILGNR--SNANSSVQINKLRVGQVYAASVMYGYFLK  739
             ++ ++L  +HSPEA+EMIQ+HLSL+LG+R     ++ VQI+K+++G++YAAS+MYGYFL+
Sbjct  183   NQ-QKLEFVHSPEAFEMIQSHLSLVLGDRMVGPLSTIVQISKIKLGKLYAASIMYGYFLR  241

Query  738   RVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGF  559
             RVDQRFQLE+ MK LP+   K  +  +            S    P     P       G+
Sbjct  242   RVDQRFQLERTMKTLPEDFTKSQARFEDPNPGKQLWDPDSLIRIP-----PHDDDDGGGY  296

Query  558   -GTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDS  382
                E K  RLR+YVM  D ETLQRYATIRSKEAI++IEK T+ALFGRP+I I   G++D+
Sbjct  297   EDAEGKQYRLRSYVMYLDSETLQRYATIRSKEAISLIEKQTQALFGRPDIQILDDGSLDT  356

Query  381   SKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  259
             S DE++ ++FS L  LVLEAV FGSFLWD ES V+S+YHF+
Sbjct  357   SNDEVVSLTFSGLTMLVLEAVAFGSFLWDAESYVESKYHFL  397



>ref|XP_008466019.1| PREDICTED: uncharacterized protein LOC103503577 isoform X1 [Cucumis 
melo]
Length=405

 Score =   339 bits (869),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 181/356 (51%), Positives = 246/356 (69%), Gaps = 24/356 (7%)
 Frame = -2

Query  1311  SIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLE  1132
             SIRAS    +   +  P+APL+ ESP+GQ L QIL SHPHL+ A VDQQL+ LQT+R+  
Sbjct  67    SIRAS----DDSRNVYPVAPLQFESPVGQLLAQILQSHPHLLPATVDQQLDNLQTERD--  120

Query  1131  KQNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITS  952
                  Q +E  +S  D  LY+RIAEVK  ERRK LEEILY L+V KF++ D+ ++P IT 
Sbjct  121   ----SQTEEAPSSSQD-PLYKRIAEVKEKERRKTLEEILYCLIVGKFVENDISMIPKITE  175

Query  951   PSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNA--NSSVQINKLRVGQ  778
              S + +G +D  P+++++L  +HSPEA+EMIQ+HLSL+LG+R     +S V+++K+++G+
Sbjct  176   TS-DPTGRVDFWPNQEQKLESVHSPEAFEMIQSHLSLVLGDRVVGPFSSIVEMSKIKLGK  234

Query  777   VYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEV  598
             +YAAS+MYGYFLKRVDQRFQLE+ MK LP+   K+    + +  +            P+ 
Sbjct  235   LYAASIMYGYFLKRVDQRFQLERTMKTLPEAFTKDFD--EPIPANQLWDPDSLIRIAPD-  291

Query  597   VSWPDGGMG-SRGF--GTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALF  427
                 D G G SRG     + K  RLR+YVM  D ETLQRYAT+RSKEAI++IEK T+ALF
Sbjct  292   ----DEGFGDSRGLIDAGDGKSYRLRSYVMYLDSETLQRYATLRSKEAISLIEKQTQALF  347

Query  426   GRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  259
             G+P+I I   G+ID+  DE+I ++FS L  LVLEAV FGSFLWD ES V+S+Y+F+
Sbjct  348   GKPDIRIAADGSIDTLNDEVISLTFSGLTMLVLEAVAFGSFLWDAESYVESKYNFI  403



>ref|XP_007040722.1| Uncharacterized protein TCM_016604 [Theobroma cacao]
 gb|EOY25223.1| Uncharacterized protein TCM_016604 [Theobroma cacao]
Length=402

 Score =   336 bits (862),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 176/360 (49%), Positives = 248/360 (69%), Gaps = 29/360 (8%)
 Frame = -2

Query  1311  SIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLE  1132
             ++RAS     S  S  PIAP++ ESP+GQ L QIL +HPHL+ AA+DQQLE LQ+D    
Sbjct  61    TMRAS---GESDDSLSPIAPVQFESPVGQLLAQILRTHPHLLPAAIDQQLENLQSD----  113

Query  1131  KQNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITS  952
             K ++K+   PS      +LY+RIAEVK  ERR+ LEEI+Y L+VQKF+D ++ ++P I +
Sbjct  114   KDDQKEETTPSQD----LLYKRIAEVKEKERRRTLEEIIYCLIVQKFVDNEISMIPKIMA  169

Query  951   PSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNR--SNANSSVQINKLRVGQ  778
              S + +G +D  P+++++L  +HSPEA+EMIQ HLSL+LG+R     ++ V+I+K+++G+
Sbjct  170   TS-DPTGRVDFWPNQEQKLESVHSPEAFEMIQGHLSLVLGDRVVGPLSTIVEISKIKLGK  228

Query  777   VYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDS-------GIQQVGGDssdtslrs  619
             +YAAS+MYGYFL+RVDQRFQLE+ M+ LP+  +K+ +       G Q    DS      +
Sbjct  229   LYAASIMYGYFLRRVDQRFQLERTMRTLPEDFNKDQARFEDPNPGKQMWDPDSWIRIPPN  288

Query  618   spSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHT  439
               +  +   + D   G        K  RLR+YVM  D ETLQRYATIRS+EAI++IEK T
Sbjct  289   DDNDGDGGGYMDTLEG--------KSYRLRSYVMYLDSETLQRYATIRSREAISLIEKQT  340

Query  438   EALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  259
             +ALFGRP+I I   G++D+S DE++ I+F+ L  LVLEAV FGSFLWD ES V+S+YHF+
Sbjct  341   QALFGRPDIRILDDGSLDTSNDEVVSITFTGLTMLVLEAVAFGSFLWDAESYVESKYHFL  400



>ref|XP_008238169.1| PREDICTED: uncharacterized protein LOC103336834 [Prunus mume]
Length=405

 Score =   337 bits (863),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 189/380 (50%), Positives = 257/380 (68%), Gaps = 30/380 (8%)
 Frame = -2

Query  1377  SAPSIKV-KLGN---RRVAFGSTKCNSIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQI  1210
             S PS  + KLGN   +R A G      +RAS    +S  + +P+APL+ ESP GQ L QI
Sbjct  47    SCPSSCIPKLGNGLHKRRARGLI----VRAS---KDSSDNLVPVAPLQFESPAGQLLAQI  99

Query  1209  LVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIAEVKANERRKA  1030
             L +HPHL+SAA+DQQLE LQ DR+ +++      E SAS  D  LY+RIA++K  ERR A
Sbjct  100   LQNHPHLLSAAIDQQLENLQKDRDAQRK------ETSASSED-PLYKRIAQIKEKERRMA  152

Query  1029  LEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNH  850
             LEEI+Y L+VQKF++ D+ ++P I++ S + +G +D  P ++ +L  +HSPEA EMIQ+H
Sbjct  153   LEEIIYCLIVQKFIENDISMIPKISATS-DPTGRVDFWPMQENKLESVHSPEALEMIQSH  211

Query  849   LSLILGNR--SNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDK  676
             LSL+LG R     +S V+I+K+++G++YAAS+MYGYFLKRVDQRFQLE+ M  LP G   
Sbjct  212   LSLVLGERLVGPLSSIVEISKIKLGKLYAASIMYGYFLKRVDQRFQLERTMNTLPDGFTP  271

Query  675   EDSGIQQVGG-DssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGET  499
             + +   Q+   DS         S  +  S+ + G        + K  RLR+YVM  D ET
Sbjct  272   DAAPANQLWDPDSLIRIPPDGGSDGDGGSYMNNG--------DDKSYRLRSYVMYLDAET  323

Query  498   LQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAV  319
             LQRYATIRSKEAI++IE  T+ALFGRP++ IT  G+ID+S DE+I ++FS L  LVLEAV
Sbjct  324   LQRYATIRSKEAISLIENQTQALFGRPDVRITDDGSIDASNDEVIALTFSGLTMLVLEAV  383

Query  318   TFGSFLWDVESSVDSRYHFV  259
              FGSFLWD E+ ++S YHF+
Sbjct  384   AFGSFLWDAETYIESNYHFL  403



>ref|XP_004136206.1| PREDICTED: uncharacterized protein LOC101213975 isoform X1 [Cucumis 
sativus]
 gb|KGN60350.1| hypothetical protein Csa_3G895960 [Cucumis sativus]
Length=405

 Score =   336 bits (862),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 179/356 (50%), Positives = 246/356 (69%), Gaps = 24/356 (7%)
 Frame = -2

Query  1311  SIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLE  1132
             SIRAS    +   +  P+AP++ ESP+GQ L QIL SHPHL+ A VDQQL+ LQT+R+  
Sbjct  67    SIRAS----DDSRNVYPVAPVQFESPVGQLLAQILQSHPHLLPATVDQQLDNLQTERD--  120

Query  1131  KQNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITS  952
                  Q +E  +S  D  LY+RIAEVK  ERRK LEEILY L+V KF++ D+ ++P IT 
Sbjct  121   ----SQTEEAPSSSQD-PLYKRIAEVKDKERRKTLEEILYCLIVGKFVENDISMIPKITE  175

Query  951   PSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNA--NSSVQINKLRVGQ  778
              S + +G +D  P+++++L  +HSPEA+EMIQ+HLSL+LG+R     +S V+++K+++G+
Sbjct  176   TS-DPTGRVDFWPNQEQKLESVHSPEAFEMIQSHLSLVLGDRVVGPFSSIVEMSKIKLGK  234

Query  777   VYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEV  598
             +YAAS+MYGYFLKRVDQRFQLE+ MK LP+   K+    + +  +            P+ 
Sbjct  235   LYAASIMYGYFLKRVDQRFQLERTMKTLPEAFTKDFD--EPIPANQLWDPDSLIRIAPD-  291

Query  597   VSWPDGGMG-SRGF--GTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALF  427
                 D G G SRG     + K  RLR+YVM  D ETLQRYAT+RSKEAI++IEK T++LF
Sbjct  292   ----DEGFGDSRGLIDADDGKSYRLRSYVMYLDSETLQRYATLRSKEAISLIEKQTQSLF  347

Query  426   GRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  259
             G+P+I I   G+ID+  DE+I ++FS L  LVLEAV FGSFLWD ES V+S+Y+F+
Sbjct  348   GKPDIRIAADGSIDTLNDEVISLTFSGLTMLVLEAVAFGSFLWDAESYVESKYNFI  403



>emb|CDP11681.1| unnamed protein product [Coffea canephora]
Length=405

 Score =   336 bits (861),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 175/354 (49%), Positives = 245/354 (69%), Gaps = 19/354 (5%)
 Frame = -2

Query  1311  SIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLE  1132
             ++RAS   S   G  +PIAP++LESP+GQFL QIL +HPHL+ AA+DQQLE LQ++R+ E
Sbjct  64    AVRASESFS---GDLVPIAPVQLESPVGQFLAQILQNHPHLLPAAIDQQLENLQSERDAE  120

Query  1131  KQNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITS  952
                   N++   S  D++LY+RIAEVK  ERRKA+E+I+Y LVV KF+D  + ++P ITS
Sbjct  121   ------NEKNPPSSQDLLLYKRIAEVKDKERRKAVEDIIYCLVVHKFVDNKISMIPKITS  174

Query  951   PSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNR--SNANSSVQINKLRVGQ  778
              S + +G +D  P+++++L  +HSPEA+EMI +HLSL+LG R     ++ VQI+K+++G+
Sbjct  175   TS-DPAGRVDFWPNQEQKLESVHSPEAFEMILSHLSLVLGERVVGPLDTIVQISKIKLGK  233

Query  777   VYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQ-QVGGDssdtslrsspSHPE  601
             +YAAS+MYGYFL+RVD+R+QLE++M  LP+  +K     +    G             P+
Sbjct  234   LYAASIMYGYFLRRVDERYQLERSMNTLPEKPNKGQPFFRGPTPGKQLWAPESLIQIPPD  293

Query  600   VVSWPDGGMGS-RGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFG  424
                  D   G     G + K  RLR+YVM  D ETLQRYATIRSKEA+++IEK T+ALFG
Sbjct  294   -----DADDGEPMDLGGDGKSYRLRSYVMYLDAETLQRYATIRSKEAVSLIEKQTQALFG  348

Query  423   RPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHF  262
             RP+I I   G++D+S+DE+  ++FS L  LVLEAV FGSFLWD E   +S+YHF
Sbjct  349   RPDIRIAEDGSVDASRDEVTSLTFSGLTMLVLEAVAFGSFLWDAEGYAESKYHF  402



>ref|XP_009373461.1| PREDICTED: uncharacterized protein LOC103962488 [Pyrus x bretschneideri]
Length=403

 Score =   335 bits (859),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 184/395 (47%), Positives = 261/395 (66%), Gaps = 40/395 (10%)
 Frame = -2

Query  1422  TDAPGFVKFGSKALLSAPSIKV-KLGNRRVAFGSTKCNS----IRASLPLSNSGGSAMPI  1258
             TD+  F+   +    S PS  + KLGNR        C +    +RAS    +S  + +P+
Sbjct  40    TDSKSFL--SASIFRSCPSFCIPKLGNR-----PYNCRARGLVVRAS---KDSSDNLVPV  89

Query  1257  APLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIV  1078
             +PL+ ESP GQ L QIL +HPHL+ AA+DQQLE LQ D++ +++         A+ +  +
Sbjct  90    SPLQFESPPGQLLAQILQTHPHLLPAAIDQQLENLQIDKDAQRKE--------AASSANL  141

Query  1077  LYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPSKDEQ  898
             LY+RIAEVK  ERR ALEEI+Y L+V KF+D ++ ++P I+  S + +G +D  P+++++
Sbjct  142   LYKRIAEVKDKERRMALEEIIYCLIVHKFVDREISMIPKISETS-DPTGRVDFWPNQEKK  200

Query  897   LARLHSPEAYEMIQNHLSLILGNR--SNANSSVQINKLRVGQVYAASVMYGYFLKRVDQR  724
             L  +HSPEAYEMIQ+HLSL+LG R     +S V+I+K+++G++YAAS+MYGYFLKRVD+R
Sbjct  201   LESVHSPEAYEMIQSHLSLVLGERLVGPLSSMVEISKIKLGKLYAASIMYGYFLKRVDER  260

Query  723   FQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMK  544
             FQLE++M  LP+G   + +   Q+    S   +      PE         G+    ++ K
Sbjct  261   FQLERSMNTLPEGFTADPAPANQLWDPDSLIRIA-----PE---------GASDSDSDSK  306

Query  543   PSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELI  364
               RLR+YV   D ETLQRYATIRSKEAI++IE  T+ALFG+P+I I   G+ID+S DE+I
Sbjct  307   SYRLRSYVTYLDAETLQRYATIRSKEAISLIENQTQALFGKPDIRIAADGSIDTSNDEVI  366

Query  363   KISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  259
              ++FS L  L+LEAV FGSFLWD E+ V+SRYHFV
Sbjct  367   ALTFSGLTMLILEAVAFGSFLWDAETYVESRYHFV  401



>ref|XP_009413222.1| PREDICTED: uncharacterized protein LOC103994576 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=406

 Score =   334 bits (856),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 181/387 (47%), Positives = 257/387 (66%), Gaps = 31/387 (8%)
 Frame = -2

Query  1398  FGSKALLSAPSIKVKLGNRRVAFGSTKCNSIRASLPLSNSGGSAMPIAPLKLESPIGQFL  1219
             F +K+ +  P I ++L N R     T+   +RA   L NS     PIAPL+ ESP GQ L
Sbjct  44    FSAKSSIGWPKIGIRLENHR-----TRILQVRA---LGNSSDGQTPIAPLQFESPTGQLL  95

Query  1218  TQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYR----RIAEVK  1051
             +QI+ +HPHL+ AA+DQQLE+LQ+D + E      N +   +  D+ LYR    RIAEVK
Sbjct  96    SQIMQTHPHLLPAAIDQQLERLQSDIDAE------NAKTPVASQDLPLYRFTKERIAEVK  149

Query  1050  ANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPSKDEQLARLHSPEA  871
               ER KALEEI+Y L+VQKFM+ ++ ++P +T+ S + +  +D+ P+++ +L  +HSP+A
Sbjct  150   EKERHKALEEIIYCLIVQKFMEKEIDMIPTVTT-STDPTYRVDSWPNQEHKLESMHSPDA  208

Query  870   YEMIQNHLSLILGNRSNA--NSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKV  697
              EMIQ+HL+LILG R     N+  QI+KL++G++YAAS+MYGYFLKRVD+R+QLE+ MK 
Sbjct  209   LEMIQSHLTLILGERVGGPLNTVAQISKLKLGKLYAASIMYGYFLKRVDERYQLERTMKT  268

Query  696   LPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVM  517
             LP     +  G Q++  +     L    S  ++ S           G E KP RLR+YVM
Sbjct  269   LP----TKPRG-QRIFDELKPNPLWDLESMVQISS-----DDDDFDGDETKPYRLRSYVM  318

Query  516   SFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRR  337
               D ETLQRYATIRSKE+I++IEK T+ALFGRP+I I   G++++  DE++ I+FS L  
Sbjct  319   YLDAETLQRYATIRSKESISLIEKQTQALFGRPDIRIADDGSLETPNDEVVGITFSGLTM  378

Query  336   LVLEAVTFGSFLWDVESSVDSRYHFVA  256
             LVLEAV FG+FLW+ E  V+S++HF++
Sbjct  379   LVLEAVAFGTFLWEAEGYVESKFHFLS  405



>ref|XP_004300191.1| PREDICTED: uncharacterized protein LOC101292798 [Fragaria vesca 
subsp. vesca]
Length=405

 Score =   334 bits (856),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 179/371 (48%), Positives = 251/371 (68%), Gaps = 32/371 (9%)
 Frame = -2

Query  1341  RVAFGSTKCNS----IRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAV  1174
             +V  G  KC +    +RAS    +S  + +P+APL+ ESP GQ L QIL +HPHL+ AAV
Sbjct  55    KVGNGLYKCRARGLIVRAS---EDSSANLVPVAPLQFESPAGQLLGQILQTHPHLLPAAV  111

Query  1173  DQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQK  994
             DQQLE+LQT+R+ +++     + P++ G    LY+RIAEVK  ERR AL+EI+Y L+VQK
Sbjct  112   DQQLEKLQTERDAQEE-----ESPASKGP---LYKRIAEVKEKERRAALQEIIYCLIVQK  163

Query  993   FMDADVPLVPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNR----  826
             F++ ++ ++P I++ S + +G +D  P+++++L  +HS EA+EMIQ+HLSL+LG R    
Sbjct  164   FVENEISMIPKISATS-DPTGRVDFWPNQEQKLESVHSSEAFEMIQSHLSLVLGERLVGV  222

Query  825   SNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGG  646
                +S V+I+K+++G++YAAS+MYGYFLKRVDQRFQLE+ M +LP+          +V  
Sbjct  223   GPLSSLVEISKIKLGKLYAASIMYGYFLKRVDQRFQLERTMNILPK----------RVTQ  272

Query  645   DssdtslrsspSHPEVVSWPDGGMGSRGF--GTEMKPSRLRTYVMSFDGETLQRYATIRS  472
             D              +   P  G    GF    E K  RLR+YVM  D ETLQRYATIRS
Sbjct  273   DPDPAPANQLWDPDSLFRIPPDGGDEAGFIDKEESKSYRLRSYVMYLDAETLQRYATIRS  332

Query  471   KEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDV  292
             KEAI++IE  T+ALFG+P+I I   G+ID+S DE+I ++FS L  LVLEAV FGSFLWD 
Sbjct  333   KEAISLIESQTQALFGKPDIRIAGDGSIDTSNDEVISLTFSGLTMLVLEAVAFGSFLWDA  392

Query  291   ESSVDSRYHFV  259
             E+ V+S+Y+FV
Sbjct  393   ETDVESKYNFV  403



>ref|XP_006854071.1| PREDICTED: uncharacterized protein LOC18443828 [Amborella trichopoda]
 gb|ERN15538.1| hypothetical protein AMTR_s00048p00111750 [Amborella trichopoda]
Length=383

 Score =   332 bits (852),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 188/389 (48%), Positives = 252/389 (65%), Gaps = 50/389 (13%)
 Frame = -2

Query  1398  FGSKALLSAPSIK-----VKLGNRRVAFGSTKCNSIRASLPLSNSGGSAMPIAPLKLESP  1234
             F    L + PS++      KL N RV  G            ++ SG ++ PIAPL+ ESP
Sbjct  38    FSGGFLKNGPSVRGLKHGCKLANLRVRRG------------INASGETSTPIAPLQFESP  85

Query  1233  IGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIAEV  1054
             IGQFL QIL +HPHL+ AAVDQQLE+LQ+DR      E Q +E S S TD+ L RRIAEV
Sbjct  86    IGQFLAQILRTHPHLLPAAVDQQLERLQSDR------ESQKEEKSPSATDL-LSRRIAEV  138

Query  1053  KANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPSKDEQLARLHSPE  874
             K  ER++ALEEI+YAL+VQKFMD  V + P I +PS        + P+++ +L  +HS E
Sbjct  139   KDKERQRALEEIIYALIVQKFMDVGVSMFPNIPTPSY-------SWPNQESKLQTIHSNE  191

Query  873   AYEMIQNHLSLILGNR--SNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMK  700
             A+EMI+NHL+L+LG R  +     ++I+KLR+G++YAAS+MYGYFL+RVDQRFQLE++M 
Sbjct  192   AFEMIENHLALVLGGRWPNPTQPRIEISKLRIGKLYAASIMYGYFLRRVDQRFQLERSMG  251

Query  699   VLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYV  520
              L   ++ ED   Q   G+  D           +V+  D          + K   LR+YV
Sbjct  252   TLSLEVE-EDESDQVTEGEFFDAEF--------LVTESDS--------DDPKSYLLRSYV  294

Query  519   MSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLR  340
             M  + E+LQRYATIRSKEA+++IEK T+ALFGRP+I +   G++D+  DE+I +SF SL 
Sbjct  295   MHLNSESLQRYATIRSKEAVSVIEKQTQALFGRPDIRMAEDGSLDALNDEVIAVSFESLN  354

Query  339   RLVLEAVTFGSFLWDVESSVDSRYHFVAH  253
              LVLEAV FGSFLWDVE   DS+YHF+ +
Sbjct  355   ALVLEAVAFGSFLWDVEGYADSKYHFLTN  383



>ref|XP_008373529.1| PREDICTED: uncharacterized protein LOC103436859 [Malus domestica]
Length=403

 Score =   333 bits (853),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 184/391 (47%), Positives = 258/391 (66%), Gaps = 44/391 (11%)
 Frame = -2

Query  1392  SKALLSA------PSIKV-KLGNRRVAFGSTKCNS----IRASLPLSNSGGSAMPIAPLK  1246
             SK+ LSA      PS  + KLGN     G   C +    +RAS    +S  + +P+APL+
Sbjct  42    SKSFLSASFFRSCPSFCIPKLGN-----GLYNCRARGLVVRAS---KDSSDNLVPVAPLQ  93

Query  1245  LESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRR  1066
              ESP GQ L QIL +HPHL+ AA+DQQLE LQ D++ +++         A+ +  +LY+R
Sbjct  94    FESPAGQLLAQILZTHPHLLPAAIDQQLENLQIDKDAQRKE--------AASSANLLYKR  145

Query  1065  IAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPSKDEQLARL  886
             IA+VK  ERR ALEEI+Y L+V KF+D ++ ++P I+  S + +G +D  P+++++L  +
Sbjct  146   IAKVKDKERRMALEEIIYCLIVHKFVDREISMIPKISETS-DPTGRVDFWPNQEKKLESV  204

Query  885   HSPEAYEMIQNHLSLILGNR--SNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQLE  712
             HSPEAYEMIQ+HLSL+LG R     +S V+I+K+++G++YAAS+MYGYFLKRVD+RFQLE
Sbjct  205   HSPEAYEMIQSHLSLVLGERLVGPLSSMVEISKIKLGKLYAASIMYGYFLKRVDERFQLE  264

Query  711   KNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPSRL  532
             + M  LP+G   + +   Q+    S   +      PE         G+    ++ K  RL
Sbjct  265   RTMNTLPEGFTADPAPANQLWDPDSLIRIA-----PE---------GASDSDSDSKSYRL  310

Query  531   RTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKISF  352
             R+YV   D ETLQRYATIRSKEAI++IE  T+ALFG+P+I I   G+ID+  DE+I ++F
Sbjct  311   RSYVTYLDAETLQRYATIRSKEAISLIENQTQALFGKPDIRIAADGSIDAPNDEVIALTF  370

Query  351   SSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  259
             S L  L+LEAV FGSFLWD E+ V+SRYHFV
Sbjct  371   SGLTMLILEAVAFGSFLWDAETYVESRYHFV  401



>ref|XP_002518989.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF43522.1| conserved hypothetical protein [Ricinus communis]
Length=408

 Score =   332 bits (852),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 175/356 (49%), Positives = 247/356 (69%), Gaps = 25/356 (7%)
 Frame = -2

Query  1311  SIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLE  1132
             ++RAS    ++   ++P+ PLK ESP+GQ L QIL +HPHL+ +A+DQQLE LQ+DR+  
Sbjct  73    TLRAS---GDANNYSVPLPPLKFESPVGQLLAQILQTHPHLLPSAIDQQLENLQSDRD--  127

Query  1131  KQNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITS  952
                   + + S S  D+ LY+RIAEVK  ERRK LEEI+Y+L+VQKF+D D+ ++P +++
Sbjct  128   -----ASTDQSPSSQDL-LYKRIAEVKEKERRKTLEEIIYSLIVQKFLDNDILMIPKVSA  181

Query  951   PSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNR--SNANSSVQINKLRVGQ  778
              S + +G +D  P+++++L  +HSPEA+EMI +HL+L+LG R      + VQI+K+++G+
Sbjct  182   TS-DPTGRVDFWPNQEQKLESVHSPEAFEMILSHLTLVLGERVVGPLETIVQISKIKLGK  240

Query  777   VYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEV  598
             +YAAS+MYGYFL+RVD+RFQLE+ M  LP+  D+      +   D      R       +
Sbjct  241   LYAASIMYGYFLRRVDERFQLERTMNTLPKDYDE-----NRARYDEPSPMNRLWDPDSLI  295

Query  597   VSWPDGGMGSRGF--GTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFG  424
                PD G    GF    E K  RLR+YVM  D ETLQRYATIRSKEA+++IEK T+ALFG
Sbjct  296   RIQPDNG----GFMDTVEGKSYRLRSYVMYLDVETLQRYATIRSKEAMSLIEKQTQALFG  351

Query  423   RPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFVA  256
             RP+I I   G+ID++ DE+I I+FS L  LVLEAV FGSFLW+ ES V+S+YHF++
Sbjct  352   RPDIRIAEDGSIDTANDEVISITFSGLTMLVLEAVAFGSFLWEGESYVESKYHFIS  407



>ref|XP_010055250.1| PREDICTED: uncharacterized protein LOC104443499 [Eucalyptus grandis]
Length=408

 Score =   330 bits (847),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 176/353 (50%), Positives = 245/353 (69%), Gaps = 20/353 (6%)
 Frame = -2

Query  1308  IRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEK  1129
             IRAS    +S  + +P+APL  ESPIGQ L QIL +HPHL+ AA DQQLE LQ++R+ EK
Sbjct  71    IRAS---GDSSDNPVPVAPLTFESPIGQLLAQILQNHPHLLLAAADQQLENLQSERDAEK  127

Query  1128  QNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSP  949
             +       P+++    +LY+RIAEVK  ER K LEEI+Y L+VQ+F++ ++ ++P IT+ 
Sbjct  128   EKN-----PASAD---LLYQRIAEVKEKERHKTLEEIIYCLIVQRFVENNISMIPKITAT  179

Query  948   SQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNR--SNANSSVQINKLRVGQV  775
             S + +G +D  P+++E+L  +HSPEA+EMIQ+HLSL++G+R     +S +Q +K+++G++
Sbjct  180   S-DPTGRVDYWPNQEEKLESVHSPEAFEMIQSHLSLVVGDRVVGPLDSIIQSSKIKLGKL  238

Query  774   YAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVV  595
             YAAS+MYGYFL+RVD+RFQLE+ M  LP+G  +    ++     S      S    P   
Sbjct  239   YAASIMYGYFLRRVDERFQLERTMNTLPKGYTENRVRLEDSIPTSPFWDPDSLIRIP---  295

Query  594   SWPDGGMGSRGFGTEM-KPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRP  418
               PD G G     +E  K  RLR+YVM  D ETLQRYATIRSKEAI++IEK T+ALFGRP
Sbjct  296   --PDDGDGGSFLDSEEGKLYRLRSYVMYLDPETLQRYATIRSKEAISLIEKQTQALFGRP  353

Query  417   EISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  259
             +I +   G+ID+S DE+I +S S L  L+LEAV FGSFLWD E+ V+S+Y FV
Sbjct  354   DIRVAEDGSIDTSSDEVISLSVSGLTMLILEAVAFGSFLWDAENFVESKYQFV  406



>gb|KCW71713.1| hypothetical protein EUGRSUZ_E00224 [Eucalyptus grandis]
Length=465

 Score =   331 bits (848),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 176/353 (50%), Positives = 245/353 (69%), Gaps = 20/353 (6%)
 Frame = -2

Query  1308  IRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEK  1129
             IRAS    +S  + +P+APL  ESPIGQ L QIL +HPHL+ AA DQQLE LQ++R+ EK
Sbjct  128   IRAS---GDSSDNPVPVAPLTFESPIGQLLAQILQNHPHLLLAAADQQLENLQSERDAEK  184

Query  1128  QNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSP  949
             +       P+++    +LY+RIAEVK  ER K LEEI+Y L+VQ+F++ ++ ++P IT+ 
Sbjct  185   EKN-----PASAD---LLYQRIAEVKEKERHKTLEEIIYCLIVQRFVENNISMIPKITAT  236

Query  948   SQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNR--SNANSSVQINKLRVGQV  775
             S + +G +D  P+++E+L  +HSPEA+EMIQ+HLSL++G+R     +S +Q +K+++G++
Sbjct  237   S-DPTGRVDYWPNQEEKLESVHSPEAFEMIQSHLSLVVGDRVVGPLDSIIQSSKIKLGKL  295

Query  774   YAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVV  595
             YAAS+MYGYFL+RVD+RFQLE+ M  LP+G  +    ++     S      S    P   
Sbjct  296   YAASIMYGYFLRRVDERFQLERTMNTLPKGYTENRVRLEDSIPTSPFWDPDSLIRIP---  352

Query  594   SWPDGGMGSRGFGTEM-KPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRP  418
               PD G G     +E  K  RLR+YVM  D ETLQRYATIRSKEAI++IEK T+ALFGRP
Sbjct  353   --PDDGDGGSFLDSEEGKLYRLRSYVMYLDPETLQRYATIRSKEAISLIEKQTQALFGRP  410

Query  417   EISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  259
             +I +   G+ID+S DE+I +S S L  L+LEAV FGSFLWD E+ V+S+Y FV
Sbjct  411   DIRVAEDGSIDTSSDEVISLSVSGLTMLILEAVAFGSFLWDAENFVESKYQFV  463



>ref|XP_008800078.1| PREDICTED: uncharacterized protein LOC103714566 isoform X2 [Phoenix 
dactylifera]
Length=390

 Score =   328 bits (841),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 185/383 (48%), Positives = 254/383 (66%), Gaps = 33/383 (9%)
 Frame = -2

Query  1371  PSIKVKL-----GNRRVAFGSTKCNSIRASLPLSNSGGS-----AMPIAPLKLESPIGQF  1222
             P + +KL      + R  F S KC S   S+   N GG      A  +    LE+ +GQ 
Sbjct  27    PPVDLKLLPSLSSDSRAGF-SNKCYS---SVGWPNIGGQLEKYRARSLKVKALENSVGQL  82

Query  1221  LTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIAEVKANE  1042
             L+QI+ +HPHL+ AA+DQQLE+LQ+DR+ +K+      E   +  D+ LYRRIAEVKA E
Sbjct  83    LSQIMQTHPHLLPAAIDQQLEKLQSDRDAQKE------ETPPATQDLPLYRRIAEVKAKE  136

Query  1041  RRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEM  862
             R+KALEEI+Y L+VQKFMD  + ++PAI SP+ + +  +   P+++++L  +HSP+A +M
Sbjct  137   RQKALEEIIYCLIVQKFMDNGISMIPAI-SPTSDPNSQVHYWPNQEQKLEAIHSPDALDM  195

Query  861   IQNHLSLILGNR--SNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQ  688
             IQ+HL+LILG R     N+ VQI++L++G++YAAS+MYGYFLKRVDQRFQLE+ MK LP 
Sbjct  196   IQSHLTLILGERVVGPLNTIVQISRLKLGKLYAASIMYGYFLKRVDQRFQLERTMKTLP-  254

Query  687   GLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFD  508
                  D+  Q++  D     L    S  ++ S           G + K  RLR+YVM  D
Sbjct  255   ----TDTRQQRIFDDLKPNPLWDLESMVQISS-----DDDGSDGEDSKSYRLRSYVMYLD  305

Query  507   GETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVL  328
              ETLQRYATIRSKE+I++IEK T+ALFGRP+I I   G++D+S DEL+ I+F+ L  LVL
Sbjct  306   AETLQRYATIRSKESISLIEKQTQALFGRPDIRIAEDGSLDTSNDELVGITFTGLTMLVL  365

Query  327   EAVTFGSFLWDVESSVDSRYHFV  259
             EAV FGS LW+ ES V+S+YHFV
Sbjct  366   EAVAFGSILWEAESYVESKYHFV  388



>ref|XP_009804854.1| PREDICTED: uncharacterized protein LOC104250017 [Nicotiana sylvestris]
Length=405

 Score =   325 bits (832),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 171/371 (46%), Positives = 253/371 (68%), Gaps = 27/371 (7%)
 Frame = -2

Query  1341  RVAFGSTKCNS----IRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAV  1174
             R+  G  K  +    IRA+    +SGG  +P+AP++LES +GQFL QIL +HPHL+ AA+
Sbjct  50    RLGIGPEKAQNRNWMIRATAS-GSSGGDLVPVAPVQLESAVGQFLAQILQTHPHLLPAAI  108

Query  1173  DQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQK  994
             +QQLE LQ +R+     + + ++PS+     VL++RIAEV+  ERR+ALEEILY L+V K
Sbjct  109   EQQLENLQNERD----TQLKENQPSSKD---VLHKRIAEVREKERRRALEEILYCLIVHK  161

Query  993   FMDADVPLVPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNA-  817
             F+D ++ L+P I+  S   +GS+   P+++++L  +HS +A+EMI +H+S++LG R    
Sbjct  162   FVDNEISLIPKISETSV-PTGSVGFWPNQEQKLESIHSADAFEMIVSHISIVLGEREVGP  220

Query  816   -NSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDs  640
              +S VQI+K+++G++YAAS+MYGYFLKRVD+R+QLE++M   P+          Q+  + 
Sbjct  221   LDSIVQISKVKLGKLYAASIMYGYFLKRVDERYQLERSMSKPPKSF--------QISTNP  272

Query  639   sdtslrsspSHPE--VVSWPDGG--MGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRS  472
              + +       PE  +  +P+ G   G   F  E K  RLR+YVM  D ETLQRYAT+RS
Sbjct  273   DEPAAPRQLWDPESLIEIYPEDGDREGLADFDIEDKSQRLRSYVMYLDAETLQRYATLRS  332

Query  471   KEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDV  292
             KEAI++IEK T+ALFGRP+I ++  GT+D S DE++ +++S L  LVLEAV FGSFLW+ 
Sbjct  333   KEAISVIEKQTQALFGRPDIKVSDDGTLDVSNDEVLSVTYSGLTMLVLEAVAFGSFLWEA  392

Query  291   ESSVDSRYHFV  259
             ES V+S+YH +
Sbjct  393   ESYVESKYHII  403



>ref|XP_006352932.1| PREDICTED: uncharacterized protein LOC102595128 [Solanum tuberosum]
Length=402

 Score =   322 bits (825),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 164/363 (45%), Positives = 252/363 (69%), Gaps = 27/363 (7%)
 Frame = -2

Query  1323  TKCNSIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTD  1144
             T+  +IRA+    +SGG  +P+AP++LES +GQFL Q+L +HPHL+ AA++QQLE LQ +
Sbjct  57    TRSWTIRATAS-GSSGGDLVPVAPVQLESAVGQFLAQMLQTHPHLLPAAIEQQLENLQNE  115

Query  1143  RNLE-KQNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLV  967
             R+ + K+N+        S T  VL +RIAEV+  ERRK LEE+LY L+V KF+D D+ ++
Sbjct  116   RDAQLKENQ--------SSTKDVLQKRIAEVREKERRKILEEVLYCLIVHKFVDNDISMI  167

Query  966   PAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNA--NSSVQINK  793
             P I+  S + +G++   P+++++L  +HSP+A+EMI +H++++LG R+    +S VQ++K
Sbjct  168   PKISETS-DPTGNVGYWPNQEQKLESVHSPDAFEMIISHITIVLGERAVGPLDSIVQMSK  226

Query  792   LRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrssp  613
             +++G++YAAS+MYGYFLKRVD+R+QLE+++   P+          Q+  +  + +     
Sbjct  227   IKLGKLYAASIMYGYFLKRVDERYQLERSVSKPPESF--------QISTNPDEPAAPRQL  278

Query  612   SHPE--VVSWPDGGMGSRGFGT---EMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIE  448
               P+  +  +P+ G    GF     E KP RLR+YVM  D +TLQRYAT+RSKEA+ +IE
Sbjct  279   WDPDSLIEIYPEDG-DREGFAVSDIEGKPERLRSYVMYLDADTLQRYATLRSKEAVTVIE  337

Query  447   KHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRY  268
             K T+ALFGRP+I ++  GT+D S DE++ +++S L  LVLEAV FGSFLW+ ES V+S+Y
Sbjct  338   KQTQALFGRPDIKVSGDGTLDVSNDEVLSVTYSGLTMLVLEAVAFGSFLWETESYVESKY  397

Query  267   HFV  259
             H +
Sbjct  398   HII  400



>ref|XP_004245960.1| PREDICTED: uncharacterized protein LOC101262445 [Solanum lycopersicum]
Length=402

 Score =   320 bits (820),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 164/363 (45%), Positives = 251/363 (69%), Gaps = 27/363 (7%)
 Frame = -2

Query  1323  TKCNSIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTD  1144
             T+   IRA+    +SGG  +P+AP++LES +GQFL Q+L +HPHL+ AA++QQL+ LQ +
Sbjct  57    TRSWKIRATAS-GSSGGDLVPVAPVQLESAVGQFLAQMLQTHPHLLPAAIEQQLDNLQNE  115

Query  1143  RNLE-KQNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLV  967
             R+ + K+N+        S T  VL +RIAEVK  ERRK LEEILY L+V KF++ D+ ++
Sbjct  116   RDAQLKENQ--------SSTKDVLQKRIAEVKEKERRKILEEILYCLIVHKFVENDISMI  167

Query  966   PAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNA--NSSVQINK  793
             P I+  S + +G++   P+++++L  +HSP+A+EMI +H++++LG R+    +S VQ++K
Sbjct  168   PKISETS-DPTGNVGYWPNQEQKLESVHSPDAFEMIISHITIVLGERAVGPLDSIVQMSK  226

Query  792   LRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrssp  613
             +++G++YAAS+MYGYFLKRVD+R+QLE+++   P+          Q+  +  + +     
Sbjct  227   IKLGKLYAASIMYGYFLKRVDERYQLERSVSKPPESF--------QISTNPDEPAAPRQL  278

Query  612   SHPE--VVSWPDGGMGSRGFGT---EMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIE  448
               P+  +  +P+ G    GF     E KP RLR+YVM  D +TLQRYAT+RSKEA+ +IE
Sbjct  279   WDPDSLIEIYPEDG-DREGFAVSDIEGKPERLRSYVMYLDADTLQRYATLRSKEAVTVIE  337

Query  447   KHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRY  268
             K T+ALFGRP+I +T  GT+D S DE++ +++S L  LVLEAV+FGSFLW+ E  V+S+Y
Sbjct  338   KQTQALFGRPDIKVTGDGTLDVSNDEVLSVTYSGLTMLVLEAVSFGSFLWETEGYVESKY  397

Query  267   HFV  259
             H +
Sbjct  398   HII  400



>ref|XP_010677383.1| PREDICTED: uncharacterized protein LOC104893042 [Beta vulgaris 
subsp. vulgaris]
Length=415

 Score =   318 bits (816),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 175/366 (48%), Positives = 242/366 (66%), Gaps = 39/366 (11%)
 Frame = -2

Query  1308  IRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEK  1129
             +RAS    NSG +  PIAP++LESP G  LTQIL +HPHL+ AA+DQQLE LQ D++ +K
Sbjct  73    VRAS---DNSGENLTPIAPVQLESPAGLLLTQILQTHPHLLPAAIDQQLENLQNDKDAQK  129

Query  1128  QNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSP  949
             +      E  +S   + LYRRIAEV+  ERRKALEEI+Y  +VQ+F++  + ++P I S 
Sbjct  130   E------ETPSSSQGLPLYRRIAEVREKERRKALEEIIYCSIVQRFVERSILMIPEI-SQ  182

Query  948   SQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNR--SNANSSVQINKLRVGQV  775
             S + +G +D  P+++++L  +HS EA EMIQ+HLSL+LG R      S V+I+K+++G++
Sbjct  183   SPDITGRVDFWPNQEQKLESVHSTEAIEMIQSHLSLVLGERLVGPLQSLVEISKIKLGKL  242

Query  774   YAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVV  595
             YAAS+MYGYFL+RVDQR+QLE+ MK LP+   K  +  Q               S P+  
Sbjct  243   YAASIMYGYFLRRVDQRYQLERAMKTLPEDFGKSTTRFQD--------------SVPQSP  288

Query  594   SW-PDG---------GMGSRGFGTEM---KPSRLRTYVMSFDGETLQRYATIRSKEAINI  454
              W PD           M S G   ++   K  +LR+YVM  D +TLQRYAT+RSKEA+++
Sbjct  289   FWDPDSLIQIPADEEDMVSYGEPLDIGDGKSYKLRSYVMYLDTDTLQRYATLRSKEAMSL  348

Query  453   IEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDS  274
             IE+ T++LFGRP+I I   G +++  DE+I ISFS L  LVLEAV FGSFLWD E  V+S
Sbjct  349   IERQTQSLFGRPDIKIAESGVLETQNDEIISISFSGLTMLVLEAVAFGSFLWDSEDYVES  408

Query  273   RYHFVA  256
             +Y FV+
Sbjct  409   KYSFVS  414



>ref|XP_009607216.1| PREDICTED: uncharacterized protein LOC104101473 [Nicotiana tomentosiformis]
Length=405

 Score =   317 bits (813),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 174/406 (43%), Positives = 262/406 (65%), Gaps = 30/406 (7%)
 Frame = -2

Query  1452  GPVKSGRRFTTDAPGFVK--FGSKALLSAPSIKVKLGNRRVAFGSTKCNSIRASLPLSNS  1279
             G +K    F+     F+   F   +  S P + +  G        T+   IRA+    +S
Sbjct  20    GGLKQFHAFSEPTKSFLSHSFSKSSPFSVPRLGIGPGK-----AQTRNWMIRATSS-GSS  73

Query  1278  GGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPS  1099
             GG  +P+AP++LES +GQFL Q+L +HPHL+ AA++QQLE LQ +R+     + + ++PS
Sbjct  74    GGDLVPVAPVQLESAVGQFLAQMLQTHPHLLPAAIEQQLENLQNERD----TQLKENQPS  129

Query  1098  ASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDT  919
             +     VL++RIAEV+  ERRK LEEILY L V KF+D ++ L+P I+  S + +GS+  
Sbjct  130   SKD---VLHKRIAEVREKERRKVLEEILYCLSVHKFVDNEISLIPKISETS-DPTGSVGF  185

Query  918   LPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNA--NSSVQINKLRVGQVYAASVMYGYF  745
              P+++++L  +HS +A+EMI +H+S++LG R     +S VQI+K+++G++YAAS+MYGYF
Sbjct  186   WPNQEQKLESIHSADAFEMILSHISIVLGEREVGPLDSIVQISKVKLGKLYAASIMYGYF  245

Query  744   LKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPE--VVSWPDGG--  577
             LKRVD+R+QLE++M   P+          Q+  +  + +       PE  +  +P+ G  
Sbjct  246   LKRVDERYQLERSMSKPPESF--------QISTNPDEPAAPRQLWDPESLIEIYPEDGDR  297

Query  576   MGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQ  397
              G      E K  RLR+YVM  D ETLQRYAT+RSKEAI++IEK T+ALFG+P+I ++  
Sbjct  298   EGLADSDIEGKSQRLRSYVMYLDAETLQRYATLRSKEAISVIEKQTQALFGQPDIKVSDD  357

Query  396   GTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  259
             GT+D S DE++ +++S L  LVLEAV FGSFLW+ ES V+S+YH +
Sbjct  358   GTLDVSNDEVLSVTYSGLTMLVLEAVAFGSFLWEAESYVESKYHII  403



>emb|CBI33818.3| unnamed protein product [Vitis vinifera]
Length=423

 Score =   317 bits (813),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 174/366 (48%), Positives = 244/366 (67%), Gaps = 26/366 (7%)
 Frame = -2

Query  1398  FGSKALLSAPSIKV-KLGNRRVAFGSTKCN----SIRASLPLSNSGGSAMPIAPLKLESP  1234
             F +    S PS  + KLG      G  KC     ++RAS+   NS    +P+APL+LESP
Sbjct  34    FKNLLFRSCPSFCIPKLG-----VGLDKCRVRGLTVRASV---NSDDELVPVAPLQLESP  85

Query  1233  IGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIAEV  1054
             IGQ L QIL +HPHL+ AA+DQQLE LQTDR+       Q +E   S  D++LYRRIA V
Sbjct  86    IGQLLAQILQTHPHLLPAAIDQQLENLQTDRD------AQREETPPSSHDLLLYRRIAAV  139

Query  1053  KANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPSKDEQLARLHSPE  874
             +  ER+K LEEILY L+VQKF+D ++ ++P I++ S +  G +D  P+++++L  +HSPE
Sbjct  140   REKERQKVLEEILYCLIVQKFVDKNISMIPKISATS-DPVGRVDFWPNQEQKLESIHSPE  198

Query  873   AYEMIQNHLSLILGNR--SNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMK  700
             A+EMIQ+HLSL+LG R     ++ VQI+K+++G++YAAS+MYGYFLKRVD+R+QLE+ MK
Sbjct  199   AFEMIQSHLSLVLGERLVGPLDTIVQISKIKLGKLYAASIMYGYFLKRVDERYQLERTMK  258

Query  699   VLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYV  520
              LP+G ++     +  G  +      S    P       G + S   G+     RLR+YV
Sbjct  259   TLPEGFNENRLSFEDPGPANRLWDPDSLIRIPADDDDDGGMLDSVEGGS----YRLRSYV  314

Query  519   MSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLR  340
             M  D ETLQRYATIRSKEAI++IEK T+ALFG+P++ ++  G++D+S DE++ I+FS L 
Sbjct  315   MYLDAETLQRYATIRSKEAISLIEKQTQALFGKPDVRVSEDGSLDTSNDEVVSITFSGLT  374

Query  339   RLVLEA  322
              LVLEA
Sbjct  375   MLVLEA  380



>gb|EYU43718.1| hypothetical protein MIMGU_mgv1a007450mg [Erythranthe guttata]
Length=407

 Score =   313 bits (803),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 183/439 (42%), Positives = 271/439 (62%), Gaps = 60/439 (14%)
 Frame = -2

Query  1497  MEMTTSLRSSITVGCGPVKSGRRFTT--DA-----PGFVKFGSKALLSAPSIKVKLGNRR  1339
             M+++  L   +   C     G+ + +  DA     PGF K  S      P ++V L   R
Sbjct  1     MQISGVLPDVLACSCWSPPEGKPYCSFFDAKCFFFPGFSKNWSS---RNPKLEVGLDKLR  57

Query  1338  VAFGSTKCNSIRASLPLSNSGGSAMP--IAPLKLESPIGQFLTQILVSHPHLVSAAVDQQ  1165
                  T+  ++RAS    NS G  +     P+++ESP+GQ L QIL +HPHL+ A  +QQ
Sbjct  58    -----TRSFTVRAS---GNSDGDLVEENKNPVQMESPVGQLLAQILQTHPHLLLATAEQQ  109

Query  1164  LEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMD  985
             LE LQ++R      E ++D    S  D++LY+RI EVK  ERRK LEEILY L+VQ+F++
Sbjct  110   LENLQSER------EAKDD----SSKDLLLYKRIGEVKEKERRKILEEILYCLIVQRFVE  159

Query  984   ADVPLVPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNR--SNANS  811
              ++ L+P I + S + +  +D+ P+++E+L  +HS EA+EMI +HL+L+LG R     ++
Sbjct  160   NNISLIPKIMATS-DPAIRVDSWPNQEEKLESVHSAEAFEMILSHLALVLGERVVGPPDT  218

Query  810   SVQINKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdt  631
              +Q++K+++G++YAASVMYGYFL+RVD+R+QLE++M  LP+G  + +  ++         
Sbjct  219   IIQMSKIKLGKLYAASVMYGYFLRRVDERYQLERSMNTLPEGFGEFEDRVR---------  269

Query  630   slrsspSHPEVVSW-PDGGM-------GSRGFGT-------EMKPSRLRTYVMSFDGETL  496
                     P+   W PD  +       G  G  T       E K  +LR+YVM  D ETL
Sbjct  270   ---FEEPTPDKQQWDPDSLIRIYPNEDGEYGASTVEDSSTNEDKSYKLRSYVMYLDAETL  326

Query  495   QRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVT  316
             QRYATIRSKEAI++IEK T+ALFGRP+I +T  G++D+S DE++ ++FS L  LVLEAV 
Sbjct  327   QRYATIRSKEAISLIEKQTQALFGRPDIKVTEDGSLDASNDEIVSLTFSGLTMLVLEAVA  386

Query  315   FGSFLWDVESSVDSRYHFV  259
             FGSFLWD E+ V+S+Y F+
Sbjct  387   FGSFLWDNENFVESKYPFI  405



>ref|XP_003534296.1| PREDICTED: uncharacterized protein LOC100802337 [Glycine max]
Length=408

 Score =   313 bits (802),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 178/399 (45%), Positives = 254/399 (64%), Gaps = 35/399 (9%)
 Frame = -2

Query  1425  TTDAPGFVKFGSKALLSAPSIKVKLGNRRVAFGSTKCNSIRASLPLSNSGGSAMPIAPLK  1246
              +DA GFV  G   L S PS         +     +    RAS   ++S  + +P APL+
Sbjct  33    VSDAKGFVSGG--FLKSCPSSYNPKHYHELYNFRARGLVARAS---ADSRDNLVPFAPLQ  87

Query  1245  LESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRR  1066
             LESP+GQ L +I  +HPHL++A +DQQLE LQ  R+ +K+++   D          LY+R
Sbjct  88    LESPVGQLLEKISNTHPHLLTAVIDQQLENLQNVRDAQKESDPSQDS---------LYKR  138

Query  1065  IAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPSKDEQLARL  886
             IAEVK  E+R  LEEI+Y  +V KF++ ++ ++P I++ S + +G +D  P+++ +L  +
Sbjct  139   IAEVKDKEKRITLEEIIYCSIVHKFLENNISMIPKISATS-DPTGRVDLWPNQELKLEAV  197

Query  885   HSPEAYEMIQNHLSLILGNR--SNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQLE  712
             HSPEA EMIQ+HLSL+LG+R      + VQI+K+++G++YAAS+MYGYFLKRVD+RFQLE
Sbjct  198   HSPEALEMIQSHLSLVLGDRLVGPLQTVVQISKIKLGKLYAASIMYGYFLKRVDERFQLE  257

Query  711   KNMKVLPQGLDKEDS------GIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGF--G  556
             ++M +LP+   K  S      GI+    DS  T          V  + D G     +   
Sbjct  258   RSMGILPKDFGKAKSYDEPSPGIKLWDPDSLIT----------VQDYDDEGYNDSDYMDT  307

Query  555   TEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSK  376
              E K  RLR YVM  D ETLQR AT+RSKEAI++IEK T+ALFGRP+I ++  G+I++S 
Sbjct  308   DEDKSFRLRAYVMQLDAETLQRLATVRSKEAISLIEKQTQALFGRPDIRVSDDGSIETSN  367

Query  375   DELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  259
             DEL+ ++FS L  LVLEA+ FGSFLWD E+ V+S+Y F+
Sbjct  368   DELLSLTFSGLTMLVLEAIAFGSFLWDKENYVESKYPFL  406



>ref|XP_009145204.1| PREDICTED: uncharacterized protein LOC103868901 [Brassica rapa]
Length=401

 Score =   311 bits (796),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 166/339 (49%), Positives = 230/339 (68%), Gaps = 15/339 (4%)
 Frame = -2

Query  1263  PIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTD  1084
             PIAP++LESP+GQ L QIL +HPHL+   VDQQL++L T      +N+    EPS+S   
Sbjct  72    PIAPVELESPVGQLLDQILRTHPHLLPVTVDQQLDKLST------ENDNLKAEPSSSQD-  124

Query  1083  IVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPSKD  904
              +L +RI+EVK  E+RK L EI+Y LVV +F++ ++ ++P I  P+ + +G ID  P+++
Sbjct  125   -ILSKRISEVKDKEKRKTLAEIIYCLVVHRFVEKEITMIPQI-KPTSDPAGRIDLWPNQE  182

Query  903   EQLARLHSPEAYEMIQNHLSLILGNRSNA---NSSVQINKLRVGQVYAASVMYGYFLKRV  733
             E+L  +HS EA+EMIQ+HLS +LG+R+     +S VQI+K+++G++YAASVMYGYFL+R+
Sbjct  183   EKLEVIHSAEAFEMIQSHLSSVLGDRTAVGPLSSIVQISKIKLGKLYAASVMYGYFLRRI  242

Query  732   DQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdts-lrsspSHPEVVSWPDGGMGSRGFG  556
             DQR+QLE+ M  LP+  DK     ++                 PE    PD     R  G
Sbjct  243   DQRYQLERTMNTLPKRPDKTRERYEEPSPPYPLWDPDSLIRIQPEEYD-PDEYAIQRNEG  301

Query  555   TEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSK  376
              E     LR+YV   D +TLQRYATIRSKEA+++IEK T+ALFGRP+I I   G +D+S 
Sbjct  302   -ESSSYGLRSYVTYLDSDTLQRYATIRSKEAMSLIEKQTQALFGRPDIRILEDGKLDTSN  360

Query  375   DELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  259
             DE++ +SFS L  LVLEAVTFGSFLWD ES V+S+YHF+
Sbjct  361   DEVLSLSFSGLAMLVLEAVTFGSFLWDAESYVESKYHFL  399



>emb|CDY35549.1| BnaA05g16370D [Brassica napus]
Length=402

 Score =   310 bits (793),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 164/339 (48%), Positives = 228/339 (67%), Gaps = 14/339 (4%)
 Frame = -2

Query  1263  PIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTD  1084
             PIAP++LESP+GQ L QIL +HPHL+   VDQQL++L T      +N+    EPS+S   
Sbjct  72    PIAPVELESPVGQLLDQILRTHPHLLPVTVDQQLDKLST------ENDNLKAEPSSSQD-  124

Query  1083  IVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPSKD  904
              +L +RI+EVK  E+RK L EI+Y LVV +F++ ++ ++P I  P+ + +G ID  P+++
Sbjct  125   -ILSKRISEVKDKEKRKTLAEIIYCLVVHRFVEKEITMIPQI-KPTSDPAGRIDLWPNQE  182

Query  903   EQLARLHSPEAYEMIQNHLSLILGNRSNA---NSSVQINKLRVGQVYAASVMYGYFLKRV  733
             E+L  +HS EA+EMIQ+HLS +LG+R+     +S VQI+K+++G++YAASVMYGYFL+R+
Sbjct  183   EKLEVIHSAEAFEMIQSHLSSVLGDRTAVGPLSSIVQISKIKLGKLYAASVMYGYFLRRI  242

Query  732   DQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdts-lrsspSHPEVVSWPDGGMGSRGFG  556
             DQR+QLE+ M  LP+  DK     ++                 PE    PD     R   
Sbjct  243   DQRYQLERTMNTLPKRPDKTRERYEEPSPPYPLWDPDSLIRIQPEEYD-PDEYAIQRNEE  301

Query  555   TEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSK  376
                    LR+YV   D +TLQRYATIRSKEA+++IEK T+ALFGRP+I I   G +D+S 
Sbjct  302   ESSSSYGLRSYVTYLDSDTLQRYATIRSKEAMSLIEKQTQALFGRPDIRILEDGKLDTSN  361

Query  375   DELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  259
             DE++ +SFS L  LVLEAVTFGSFLWD ES V+S+YHF+
Sbjct  362   DEVLSLSFSGLAMLVLEAVTFGSFLWDAESYVESKYHFL  400



>gb|EPS63452.1| hypothetical protein M569_11331, partial [Genlisea aurea]
Length=342

 Score =   307 bits (787),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 159/363 (44%), Positives = 239/363 (66%), Gaps = 41/363 (11%)
 Frame = -2

Query  1305  RASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQ  1126
             R+++  ++S     PI+PL+LESP+GQ L+Q L +HPHL+ AAV+QQLE LQ  R+   +
Sbjct  5     RSTMVRASSTSGRDPISPLELESPVGQLLSQALQTHPHLLMAAVEQQLENLQRQRD---E  61

Query  1125  NEKQNDEPSASGT------DIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVP  964
              +K+   P +  T      D VLY+RIAE K  ERRKA+EEI+Y L+V +F+D ++ ++P
Sbjct  62    GKKEPSRPQSKNTASTPSSDDVLYKRIAEFKEKERRKAVEEIMYCLIVHRFVDNNISMIP  121

Query  963   AITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNR--------SNANSS  808
              I   S +    +D  P+++++L  +HSPEA+EM+ +HLSL+LG R        S   S 
Sbjct  122   KI---STSMDERVDLWPNQEQKLESVHSPEAFEMVLSHLSLVLGERMTTTTGGPSEDPSV  178

Query  807   VQINKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdts  628
             VQI+K+++G++YA+S+MYGYFL+RVD+R+QLE+++  LP  + ++      +        
Sbjct  179   VQISKIKLGKLYASSIMYGYFLRRVDERYQLERSVNTLPPPVGRQLWDPASL--------  230

Query  627   lrsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIE  448
                      +  +PDG       G+     +LR+YVM  D ETLQ+YAT+RSKEA+++IE
Sbjct  231   ---------IRIYPDGAAYPEDDGSH----KLRSYVMYLDAETLQKYATMRSKEALSLIE  277

Query  447   KHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRY  268
             K T+A+FG+PEIS+T +G++D++ DE   +SF  L  LVLEAV FGSFLWD E+ V+S+Y
Sbjct  278   KQTQAVFGKPEISVTEEGSLDAADDETFSVSFPDLTVLVLEAVAFGSFLWDAETFVESKY  337

Query  267   HFV  259
              FV
Sbjct  338   SFV  340



>ref|XP_006415245.1| hypothetical protein EUTSA_v10007794mg [Eutrema salsugineum]
 gb|ESQ33598.1| hypothetical protein EUTSA_v10007794mg [Eutrema salsugineum]
Length=405

 Score =   308 bits (790),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 169/361 (47%), Positives = 237/361 (66%), Gaps = 15/361 (4%)
 Frame = -2

Query  1329  GSTKCNSIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQ  1150
             G  +  ++RAS    +S  S  P+AP++LESP+GQ L QIL +HPHL+   VDQQLE+  
Sbjct  54    GRGRGVTVRASGGEEDSNESFAPLAPVELESPVGQLLEQILRTHPHLLPITVDQQLEKFA  113

Query  1149  TDRNLEKQNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPL  970
                    +NE    E S+S    +L +RI+EV+  ERRK L EI+Y LVVQ+F++  + +
Sbjct  114   A------ENESLKAESSSSQD--LLSKRISEVREKERRKTLAEIIYCLVVQRFVEKGISM  165

Query  969   VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNA---NSSVQI  799
             +P I  P+ + +G +D  P+++E+L  +HS EA+EMIQ+HLS +LG+R+     +S VQI
Sbjct  166   IPQI-KPTSDPAGRVDLWPNQEEKLEVIHSAEAFEMIQSHLSSVLGDRTAVGPLSSIVQI  224

Query  798   NKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdts-lr  622
             +K+++G++YAASVMYGYFL+R+DQR+QLE+ M  LP+  +K     ++            
Sbjct  225   SKIKLGKLYAASVMYGYFLRRIDQRYQLERTMNTLPKRPEKTRERYEEPSPPYPLWDPDS  284

Query  621   sspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKH  442
                  PE    PDG    R    E     LR+YV   D +TLQRYATIRSKEA+++IEK 
Sbjct  285   LIRIQPEEYD-PDGYAIERD-ENESSSYGLRSYVTYLDSDTLQRYATIRSKEAMSLIEKQ  342

Query  441   TEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHF  262
             T+ALFGRP+I I   G +D+S DE++ +SFS L  LVLEAVTFGSFLWD ES V+S+YHF
Sbjct  343   TQALFGRPDIRILEDGKLDTSNDEVLSLSFSGLAMLVLEAVTFGSFLWDAESYVESKYHF  402

Query  261   V  259
             +
Sbjct  403   L  403



>ref|XP_004976664.1| PREDICTED: uncharacterized protein LOC101761297 [Setaria italica]
Length=402

 Score =   308 bits (789),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 166/357 (46%), Positives = 237/357 (66%), Gaps = 21/357 (6%)
 Frame = -2

Query  1323  TKCNSIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTD  1144
             T+   I+A    + SG     +APL+ ESP GQ L QIL SHPHL+ A VDQQLE LQ++
Sbjct  63    TRTFKIKAK---AESGDGYTRLAPLRFESPSGQLLVQILQSHPHLLPATVDQQLENLQSE  119

Query  1143  RNLEKQNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVP  964
             ++ +K+      E S    D+ LY+RIAEVK  ER+  LEEI+Y  ++ KFMD D+ + P
Sbjct  120   KDAQKE------EASKVPQDL-LYKRIAEVKEKERQNTLEEIIYCWIIYKFMDNDISMTP  172

Query  963   AITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNA--NSSVQINKL  790
             A+ +P       I +LP+++++L  +HSP+A+EMIQNHL+LI+G +  A  ++ V+I+ L
Sbjct  173   AL-APGGGPVRDISSLPNQEDKLQSIHSPDAFEMIQNHLNLIMGEKIAAPLDTVVEISNL  231

Query  789   RVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspS  610
              +G++YAAS+MYGYFLKRVD+RFQLEK MK LP       +  QQ+  ++   +      
Sbjct  232   NLGKLYAASIMYGYFLKRVDERFQLEKTMKTLPP------NPKQQIVFENLKPNPFWDME  285

Query  609   HPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEAL  430
                 ++ PDG   S     E  P++LR+YV   D +TLQRYATIRSKEA+++IEK T++L
Sbjct  286   SLVQIT-PDGEEISLD-DEESNPNKLRSYVSQLDADTLQRYATIRSKEAVSLIEKQTQSL  343

Query  429   FGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  259
             FGRP+I +   G++++   ++I I+F  L  LVLEAV FGSFLW+ ES V+S+YHFV
Sbjct  344   FGRPDIKVLDDGSVNARDGQMITITFIELNHLVLEAVAFGSFLWEAESYVESKYHFV  400



>ref|XP_010540738.1| PREDICTED: uncharacterized protein LOC104814412 [Tarenaya hassleriana]
Length=407

 Score =   308 bits (788),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 176/379 (46%), Positives = 243/379 (64%), Gaps = 23/379 (6%)
 Frame = -2

Query  1380  LSAPSIKVKLGNRRVAFGSTKCNSIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVS  1201
               AP +     N     G  +  ++RAS     S  ++  IAPL+LESP+GQ L QIL +
Sbjct  45    FCAPKLGAAFDN-----GRGRGVTVRAS---GESNENSDLIAPLELESPVGQLLVQILRT  96

Query  1200  HPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEE  1021
             HPHL+   VDQQLE L  ++       + N+ PS+      LY+RIAEVK  ERRK LEE
Sbjct  97    HPHLLPITVDQQLENLANEKE-----ARGNELPSSQDP---LYKRIAEVKEKERRKTLEE  148

Query  1020  ILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSL  841
             ILY LVVQ+F + ++ ++P I   S + +G +D  P+++++L  +HS EA+EMIQ+HL+L
Sbjct  149   ILYCLVVQRFAENEISMIPQIKQTS-DPAGRVDFWPNQEQKLEAVHSAEAFEMIQSHLTL  207

Query  840   ILGNR--SNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLP-QGLDKED  670
             +LG+R     NS VQI+K+++G++YAASVMYGYFL+RVDQR+QLE+ M  LP +  +K  
Sbjct  208   VLGDRMVGPLNSIVQISKIKLGKLYAASVMYGYFLRRVDQRYQLERKMNTLPSKRQEKTR  267

Query  669   SGIQQVGGDs-sdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPS-RLRTYVMSFDGETL  496
                ++                 PE    PD     R    E + S RLR+YVM  D ETL
Sbjct  268   ERYEEPSPPYPLWDPDSLIRIQPEDYD-PDEYAMDREAEEEGESSYRLRSYVMYLDPETL  326

Query  495   QRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVT  316
             QRYATIRSKEA+++IE+ T+ALFGRP+I I   G +++S DE++ ++FS L  LVLEAV 
Sbjct  327   QRYATIRSKEAMSLIERQTQALFGRPDIRILEDGKLNTSNDEVLSLTFSGLAMLVLEAVA  386

Query  315   FGSFLWDVESSVDSRYHFV  259
             FGSFLWD ES V+S+YHF+
Sbjct  387   FGSFLWDAESYVESKYHFL  405



>ref|XP_007158234.1| hypothetical protein PHAVU_002G135300g [Phaseolus vulgaris]
 gb|ESW30228.1| hypothetical protein PHAVU_002G135300g [Phaseolus vulgaris]
Length=408

 Score =   307 bits (787),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 177/398 (44%), Positives = 256/398 (64%), Gaps = 33/398 (8%)
 Frame = -2

Query  1425  TTDAPGFVKFGSKALLSAPS-IKVKLGNRRVAFGSTKCNSIRASLPLSNSGGSAMPIAPL  1249
              +DA GF+  G   L S PS    KL N    F + + +  RAS   +NS  + +P APL
Sbjct  33    VSDAKGFLSGG--FLKSCPSSYNPKLYNEFYNFRA-RGSVARAS---ANSRDNPVPFAPL  86

Query  1248  KLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYR  1069
             + ESP+GQ L QI  +HPHL+ AA+DQQLE LQT R+ +K+        S++  +  L +
Sbjct  87    QFESPVGQLLEQISNTHPHLLPAAIDQQLENLQTARDAQKE--------SSTSPNNSLNK  138

Query  1068  RIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPSKDEQLAR  889
             RIAEVK  E+R  LEEI+Y  +V KF++ ++ ++P +++ S + +G +D  P+++ +L  
Sbjct  139   RIAEVKEKEKRMILEEIMYCSIVHKFLENNILMIPKLSATS-DPTGRVDLWPNQELKLEA  197

Query  888   LHSPEAYEMIQNHLSLILGNR--SNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQL  715
             +HSPEA+EMIQ+HLSL+LG+R      + VQI+K+++G++YAAS+MYGYFLKRVD+RFQL
Sbjct  198   VHSPEAFEMIQSHLSLVLGDRLVGPLQAIVQISKIKLGKLYAASIMYGYFLKRVDERFQL  257

Query  714   EKNMKVLPQGLDKEDS------GIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGT  553
             E+++  LP+ L K  S      GI+    DS                + D         T
Sbjct  258   ERSVGTLPKDLGKTKSFEEPSPGIKLWDPDSLIIVQDYDDDSYSDSDYMD---------T  308

Query  552   EMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKD  373
             E K  RLR YVM  D ++LQR AT+RSKEAI++IEK T+ALFGRP+I ++  G+I++S D
Sbjct  309   EGKSFRLRAYVMQLDPDSLQRLATVRSKEAISLIEKQTQALFGRPDIRVSNDGSIETSND  368

Query  372   ELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  259
             EL+ ++FS +  L+LEAV FGSFLWD E  V+S+Y F+
Sbjct  369   ELLSLTFSGMTMLILEAVAFGSFLWDKEKYVESKYPFL  406



>ref|XP_003612708.1| hypothetical protein MTR_5g028020 [Medicago truncatula]
 gb|AES95666.1| plant/F3C3-6 protein [Medicago truncatula]
Length=410

 Score =   306 bits (785),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 171/394 (43%), Positives = 255/394 (65%), Gaps = 23/394 (6%)
 Frame = -2

Query  1407  FVKFGSKALLSA-------PSIKVKLGNRRVAFGSTKCNSIRASLPLSNSGGSAMPIAPL  1249
             F  F +K +LS        PS   K  N   +F   +   +RAS   ++S  + +P  PL
Sbjct  29    FHSFDAKNVLSTGFLKSCPPSYNAKHYNEPYSFRG-RGLVVRAS---TDSSDNFVPSPPL  84

Query  1248  KLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYR  1069
             + ESP+GQ L QIL +HPHL  A +DQQLE+LQT+R+        N E S++  +  LY+
Sbjct  85    QFESPVGQLLEQILQTHPHLFLATIDQQLEKLQTERD-------ANKEESSTSYEDSLYK  137

Query  1068  RIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPSKDEQLAR  889
             RIAE+K  E+R  LEEI+Y L+V KF +  + ++P I++ S + +  +D+ P+++ +L  
Sbjct  138   RIAEIKEKEKRTTLEEIMYCLIVNKFKENKISMIPKISATS-DPNEQVDSWPNQEFKLEA  196

Query  888   LHSPEAYEMIQNHLSLILGNRSNA--NSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQL  715
             +HS EA+EMIQ+HLSL+LG R+     + +QI+K+++G++YAAS+MYGYFLKRVD+RFQL
Sbjct  197   VHSSEAFEMIQSHLSLVLGERAVGPLQTIIQISKIKLGKLYAASIMYGYFLKRVDERFQL  256

Query  714   EKNMKVLPQGLDKEDSGIQQVGG-DssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPS  538
             E+++  LPQ L KE+    +    +    S      +P+   + +    + G G E K S
Sbjct  257   ERSVGTLPQDLGKENISFDEPSPPNKLWDSDSLIRIYPDDEGYYEMDDMNTGDG-EGKSS  315

Query  537   RLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKI  358
              LR YV   D E LQR AT+RSKEAI++IEK T+ALFGRP+I ++  G+I+++ DE++ +
Sbjct  316   GLRAYVTQLDTEALQRLATVRSKEAISLIEKQTQALFGRPDIRLSGDGSIETTNDEVLSL  375

Query  357   SFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFVA  256
             +FS L  LVLE+V FGSFLWD E+ V+S+Y F+A
Sbjct  376   TFSGLTMLVLESVAFGSFLWDEENYVESKYPFLA  409



>gb|EEC77902.1| hypothetical protein OsI_17223 [Oryza sativa Indica Group]
Length=420

 Score =   306 bits (785),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 175/419 (42%), Positives = 249/419 (59%), Gaps = 31/419 (7%)
 Frame = -2

Query  1509  CCCMMEMTTSLRSSITVGCGPVKSGRRFTTDAPGFVKFGSKALLSAPSIKVKLGNRRVAF  1330
             CCC+       R S ++G      G  F+     F  F  K+ L   S K          
Sbjct  29    CCCLR------RPSASLGPATPPQGASFSIRDMVFRLF-DKSFLYTSSPKSGF-----LI  76

Query  1329  GSTKCNSIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQ  1150
              S +  S++    + +SG     +APL  E+P GQ L QIL SHPHL+ A VDQQLE LQ
Sbjct  77    NSCRARSLKVKAKM-DSGDGLTRLAPLMFETPSGQLLVQILQSHPHLLPATVDQQLENLQ  135

Query  1149  TDRNLEKQNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPL  970
             ++++       Q  E S    D+ LY+RIAEVK  ER+  LEEI+Y  ++ KFM+ D+ +
Sbjct  136   SEKD------AQEKEASKVPQDL-LYKRIAEVKEKERQNTLEEIIYCWIIYKFMENDISM  188

Query  969   VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNA--NSSVQIN  796
              PA+ +P       I +LP+++++L  +HSP+A EMIQNHL+LI+G +  A  ++ V+I+
Sbjct  189   TPAL-APLGGPVRDISSLPNQEDRLQSIHSPDALEMIQNHLNLIMGEKVAAPLDTVVEIS  247

Query  795   KLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrss  616
              L +G++YAAS+MYGYFLKRVD+RFQLEKNMK LP    K+   ++ +  +         
Sbjct  248   NLNLGKLYAASIMYGYFLKRVDERFQLEKNMKTLPPN-PKQQIVLENLKPNPFWDMESLV  306

Query  615   pSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTE  436
                P+       G        E  P++LR+YV   D +TLQRYATIRSKEA+++IEK T+
Sbjct  307   QITPD-------GEEIDLDDEESNPNKLRSYVSRLDADTLQRYATIRSKEAVSLIEKQTQ  359

Query  435   ALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  259
             ALFGRP+I +   G++++   ++I I+F  L  LVLEA  FGSFLW+ ES V+S+YHFV
Sbjct  360   ALFGRPDIKVLDDGSVNAKDGQMITITFIELTHLVLEAAAFGSFLWEAESHVESKYHFV  418



>gb|KHN40428.1| hypothetical protein glysoja_000926 [Glycine soja]
Length=406

 Score =   305 bits (782),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 178/393 (45%), Positives = 249/393 (63%), Gaps = 26/393 (7%)
 Frame = -2

Query  1425  TTDAPGFVKFGSKALLSAPS-IKVKLGNRRVAFGSTKCNSIRASLPLSNSGGSAMPIAPL  1249
              +DA GF+  G   L S PS    K  N    F +    +  ++ P  N     +P APL
Sbjct  33    VSDAKGFLSGG--FLKSCPSSYNPKHYNELYNFRARGLVARASADPRDN----LVPFAPL  86

Query  1248  KLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYR  1069
             + ESP+GQ L QI  +HPHL+ AA+DQQLE LQT R+   QNE      S+  +   LY+
Sbjct  87    QFESPVGQLLEQISNTHPHLLPAAIDQQLENLQTARD--AQNE------SSDSSLDSLYK  138

Query  1068  RIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPSKDEQLAR  889
             RIAEVK  E+R  LEEILY  +V KF++ ++ ++P I++ S + +G +D  P+++ +L  
Sbjct  139   RIAEVKEKEKRTTLEEILYCSIVHKFLENNISMIPKISATS-DPTGRVDLWPNQELKLEG  197

Query  888   LHSPEAYEMIQNHLSLILGNR--SNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQL  715
             +HSPEA+EMIQ+HLSL+LG+R      + VQI+K+++G++YAAS+MYGYFLKR+D+RFQL
Sbjct  198   VHSPEAFEMIQSHLSLVLGDRLVGPLQTVVQISKIKLGKLYAASIMYGYFLKRIDERFQL  257

Query  714   EKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGT-EMKPS  538
             E++M  LP+   K  S  +   G            H       D    S    T E +  
Sbjct  258   ERSMGTLPKDFGKAKSFDEPSPGIKLWDPDSLIIVH-------DYDNDSDHMDTDEGRSF  310

Query  537   RLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKI  358
             RLR YVM  D ETLQR AT+RSKEAI++IEK T+ALFGRP+I ++  G+I++S DEL+ +
Sbjct  311   RLRAYVMQLDAETLQRLATVRSKEAISLIEKQTQALFGRPDIRVSEDGSIETSNDELLSL  370

Query  357   SFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  259
             +FS L  LVLEA+ FGSFLWD E+ V+S+Y F+
Sbjct  371   TFSGLTMLVLEALAFGSFLWDKENYVESKYPFL  403



>gb|AFW59314.1| hypothetical protein ZEAMMB73_007794 [Zea mays]
Length=400

 Score =   305 bits (780),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 181/412 (44%), Positives = 254/412 (62%), Gaps = 40/412 (10%)
 Frame = -2

Query  1473  SSITVGCGP-----VKSGRRFTTDAPGFVKFGSKALLSAPSIKVKLGNRRVAFGSTKCNS  1309
             SS T  CG      V S R F    P  ++  SKA         ++ N R     T+   
Sbjct  20    SSTTSSCGARPRAAVGSVRLFCKGFPCSIR--SKA-------GFQIHNYR-----TRMFK  65

Query  1308  IRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEK  1129
             I+A    + SG     +APL+ ESP GQ L QIL SHPHL+ A VDQQLE LQ++++   
Sbjct  66    IKAK---AESGDGYTRLAPLRFESPSGQLLIQILQSHPHLIPATVDQQLENLQSEKS---  119

Query  1128  QNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSP  949
                 Q++E S    D+ LY+RIAEVK  ER+ ALEEI+Y  V  +FM+ D+ + PA+ SP
Sbjct  120   ---AQSEEASKVPQDL-LYKRIAEVKEKERQNALEEIIYCWVTYRFMENDIYMTPAL-SP  174

Query  948   SQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNR--SNANSSVQINKLRVGQV  775
                    I  LP+++++L  +HS +A+EMIQNHL+LI+G +  S  ++ V+I+ L +G++
Sbjct  175   GGGPVRDISALPNQEDKLRNIHSADAFEMIQNHLNLIMGEKIASPPDTVVEISNLNLGKL  234

Query  774   YAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVV  595
             YAAS+MYGYFLKRVD+RFQLEK MK LP   +      QQ+  ++   +          +
Sbjct  235   YAASIMYGYFLKRVDERFQLEKTMKTLPPKPN------QQIVFENLQPNPFWDMESLVQI  288

Query  594   SWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPE  415
             + PDG   S     +  P++LR+YV   D +TLQRYATIRSKEA+++IEK T+ALFGRP+
Sbjct  289   T-PDGEEISLD-DEKSNPNKLRSYVSQLDADTLQRYATIRSKEAVSLIEKQTQALFGRPD  346

Query  414   ISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  259
             I +   G++++    +I I+F+ L  LVLEAV FGSFLW+ ES V+S+YHFV
Sbjct  347   IKVLDDGSVNAKDGRMITITFTELNHLVLEAVAFGSFLWEAESYVESKYHFV  398



>ref|XP_002448446.1| hypothetical protein SORBIDRAFT_06g027240 [Sorghum bicolor]
 gb|EES12774.1| hypothetical protein SORBIDRAFT_06g027240 [Sorghum bicolor]
Length=402

 Score =   303 bits (776),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 159/338 (47%), Positives = 224/338 (66%), Gaps = 22/338 (7%)
 Frame = -2

Query  1260  IAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDI  1081
             +APL+ ESP GQ L QIL SHPHL+ A VDQQLE LQ+++        Q++E S    D+
Sbjct  81    LAPLRFESPSGQLLVQILQSHPHLIPATVDQQLENLQSEKT------AQSEEASKVPQDL  134

Query  1080  VLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPSKDE  901
              LY+RIAEVK  ER+ ALEEI+Y  ++ +FMD D+ +  A+ SP       I  LP++++
Sbjct  135   -LYKRIAEVKEKERQNALEEIIYCWIIYRFMDNDISMTSAL-SPGGGPVRDISALPNQED  192

Query  900   QLARLHSPEAYEMIQNHLSLILGNRSNA--NSSVQINKLRVGQVYAASVMYGYFLKRVDQ  727
             +L  +HS +A+EMIQNHL+LI+G +  A  ++ V+I+ L +G++YAAS+MYGYFLKRVD+
Sbjct  193   KLQSIHSADAFEMIQNHLNLIMGEKIAAPPDTVVEISNLNLGKLYAASIMYGYFLKRVDE  252

Query  726   RFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHP--EVVSWPDGGMGSRGFGT  553
             RFQLEK MK LP    K+    + +  +            P  E +S  D G        
Sbjct  253   RFQLEKTMKTLPPN-PKQQIVFENLQPNPFWDMESLVQITPDGEEISLDDEGSN------  305

Query  552   EMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKD  373
                P++L++YV   D +TLQRYATIRSKEA+++IEK T+ALFGRP+I +   G++++   
Sbjct  306   ---PNKLKSYVSKLDADTLQRYATIRSKEAVSLIEKQTQALFGRPDIKVLDDGSVNAKDG  362

Query  372   ELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  259
              ++ I+F+ L  LVLEAVTFGSFLW+ ES V+S+YHFV
Sbjct  363   RMVTITFTELNHLVLEAVTFGSFLWEAESYVESKYHFV  400



>ref|NP_001053731.1| Os04g0595100 [Oryza sativa Japonica Group]
 emb|CAE03929.1| OSJNba0093F12.3 [Oryza sativa Japonica Group]
 emb|CAD41566.3| OSJNBa0006A01.21 [Oryza sativa Japonica Group]
 dbj|BAF15645.1| Os04g0595100 [Oryza sativa Japonica Group]
 gb|EAZ31841.1| hypothetical protein OsJ_16003 [Oryza sativa Japonica Group]
 dbj|BAG90593.1| unnamed protein product [Oryza sativa Japonica Group]
Length=405

 Score =   303 bits (775),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 159/344 (46%), Positives = 224/344 (65%), Gaps = 18/344 (5%)
 Frame = -2

Query  1284  NSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDE  1105
             +SG     +APL  E+P GQ L QIL SHPHL+ A VDQQLE LQ++++       Q  E
Sbjct  76    DSGDGLTRLAPLMFETPSGQLLVQILQSHPHLLPATVDQQLENLQSEKD------AQEKE  129

Query  1104  PSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSI  925
              S    D+ LY+RIAEVK  ER+  LEEI+Y  ++ KFM+ D+ + PA+ +P       I
Sbjct  130   ASKVPQDL-LYKRIAEVKEKERQNTLEEIIYCWIIYKFMENDISMTPAL-APLGGPVRDI  187

Query  924   DTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNA--NSSVQINKLRVGQVYAASVMYG  751
              +LP+++++L  +HSP+A EMIQNHL+LI+G +  A  ++ V+I+ L +G++YAAS+MYG
Sbjct  188   SSLPNQEDRLQSIHSPDALEMIQNHLNLIMGEKVAAPLDTVVEISNLNLGKLYAASIMYG  247

Query  750   YFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMG  571
             YFLKRVD+RFQLEKNMK LP    K+   ++ +  +            P+       G  
Sbjct  248   YFLKRVDERFQLEKNMKTLPPN-PKQQIVLENLKPNPFWDMESLVQITPD-------GEE  299

Query  570   SRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGT  391
                   E  P++LR+YV   D +TLQRYATIRSKEA+++IEK T+ALFGRP+I +   G+
Sbjct  300   IDLDDEESNPNKLRSYVSRLDADTLQRYATIRSKEAVSLIEKQTQALFGRPDIKVLDDGS  359

Query  390   IDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  259
             +++   ++I I+F  L  LVLEA  FGSFLW+ ES V+S+YHFV
Sbjct  360   VNAKDGQMITITFIELTHLVLEAAAFGSFLWEAESHVESKYHFV  403



>ref|XP_004512464.1| PREDICTED: uncharacterized protein LOC101507671 [Cicer arietinum]
Length=410

 Score =   303 bits (776),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 164/356 (46%), Positives = 235/356 (66%), Gaps = 21/356 (6%)
 Frame = -2

Query  1308  IRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEK  1129
             +RAS   ++S  +++P  PL+ E+P+GQ L QIL +HPHLVSA +DQQLE+L T+R+  K
Sbjct  70    VRAS---TDSSDNSVPSPPLQFETPVGQLLEQILQTHPHLVSATIDQQLEKLLTERDAHK  126

Query  1128  QNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSP  949
                    E S++  +  LY+RIAE+K  E+R  LEEI+Y  +V KF +  + ++P I + 
Sbjct  127   -------EESSASYENSLYKRIAEIKEKEKRTTLEEIMYCSIVNKFKENKISMIPKIAAT  179

Query  948   SQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNR--SNANSSVQINKLRVGQV  775
             S + +  +D  P+++ +L  +HS EA+EMIQ+HLSL+LG R      + VQI+K+++G++
Sbjct  180   S-DPNDRVDLWPNQELKLEAVHSSEAFEMIQSHLSLVLGERVVGPLQTIVQISKIKLGKL  238

Query  774   YAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVV  595
             YAAS+MYGYFLKRVD RFQLE+   +LPQ   KE+     +  D      +   S   + 
Sbjct  239   YAASIMYGYFLKRVDDRFQLERRTGILPQDFGKEN-----ISFDEPSPPNKLWDSDSLIR  293

Query  594   SWPD--GGMGSRGFGT-EMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFG  424
              +PD  G        T E +  RLRTYVM  D ETLQR AT+RSKEAI++IEK T+ALFG
Sbjct  294   IYPDEEGYYEMDNMATGEGRSFRLRTYVMQLDAETLQRLATVRSKEAISLIEKQTQALFG  353

Query  423   RPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFVA  256
             RP+I ++  G+I++S DE++ ++FS L  LVLEAV FGSFLW  E+ VD +Y F+ 
Sbjct  354   RPDIRVSKDGSIETSNDEVLSLTFSGLTMLVLEAVAFGSFLWVQENYVDIKYPFLV  409



>emb|CDY29940.1| BnaC05g28960D [Brassica napus]
Length=401

 Score =   302 bits (773),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 163/344 (47%), Positives = 231/344 (67%), Gaps = 25/344 (7%)
 Frame = -2

Query  1263  PIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTD  1084
             PIAP++LESP+GQ L QIL +HPHL+   VDQQL++L T        E +N +  +S + 
Sbjct  72    PIAPVELESPVGQLLDQILRTHPHLLPVTVDQQLDKLST--------ENENLKAESSSSQ  123

Query  1083  IVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPSKD  904
               L +RI+EVK  E+RK L EI+Y LVV +F++ ++ ++P I  P+ + +G ID  P+++
Sbjct  124   DSLSKRISEVKDKEKRKTLAEIIYCLVVHRFVEKEISMIPQI-KPTSDPAGRIDLWPNQE  182

Query  903   EQLARLHSPEAYEMIQNHLSLILGNRSNA---NSSVQINKLRVGQVYAASVMYGYFLKRV  733
             E+L  +HS EA+EMIQ+HLS +LG+R+     +S VQI+K+++G++YAASVMYGYFL+R+
Sbjct  183   EKLEVIHSAEAFEMIQSHLSSVLGDRTAVGPLSSIVQISKIKLGKLYAASVMYGYFLRRI  242

Query  732   DQRFQLEKNMKVLPQGLDK------EDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMG  571
             DQR+QLE+ M  LP+  DK      E S    +    S   ++     P+  +       
Sbjct  243   DQRYQLERTMNTLPKRPDKTRERYEEPSPPYPLWDPDSLIRIQPEEYDPDEYAIQRNEDE  302

Query  570   SRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGT  391
             S  +G       LR+YV   D +TLQRYATIRSKEA+++IEK T+ALFGRP+I I   G 
Sbjct  303   SSSYG-------LRSYVTYLDSDTLQRYATIRSKEAMSLIEKQTQALFGRPDIRILEDGK  355

Query  390   IDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  259
             +D+S DE++ +SFS L  LVLEAVTFGSFLWD ES V+S+YHF+
Sbjct  356   LDTSNDEVLSLSFSGLATLVLEAVTFGSFLWDAESYVESKYHFL  399



>ref|NP_001145533.1| uncharacterized protein LOC100278968 [Zea mays]
 gb|ACG48280.1| hypothetical protein [Zea mays]
Length=400

 Score =   301 bits (771),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 180/412 (44%), Positives = 253/412 (61%), Gaps = 40/412 (10%)
 Frame = -2

Query  1473  SSITVGCGP-----VKSGRRFTTDAPGFVKFGSKALLSAPSIKVKLGNRRVAFGSTKCNS  1309
             SS T  CG      V S R F    P  ++  SKA         ++ N R     T+   
Sbjct  20    SSTTSSCGARPRAAVGSVRLFCKGFPCSIR--SKA-------GFQIHNYR-----TRMFK  65

Query  1308  IRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEK  1129
             I+A    + SG     +APL+ ESP GQ L QIL SHPHL+ A VDQQL  LQ++++   
Sbjct  66    IKAK---AESGDGYTRLAPLRFESPSGQLLIQILQSHPHLIPATVDQQLGNLQSEKS---  119

Query  1128  QNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSP  949
                 Q++E S    D+ LY+RIAEVK  ER+ ALEEI+Y  V  +FM+ D+ + PA+ SP
Sbjct  120   ---AQSEEASKVPQDL-LYKRIAEVKEKERQNALEEIIYCWVTYRFMENDIYMTPAL-SP  174

Query  948   SQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNR--SNANSSVQINKLRVGQV  775
                    I  LP+++++L  +HS +A+EMIQNHL+LI+G +  S  ++ V+I+ L +G++
Sbjct  175   GGGPVRDISALPNQEDKLRNIHSADAFEMIQNHLNLIMGEKIASPPDTVVEISNLNLGKL  234

Query  774   YAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVV  595
             YAAS+MYGYFLKRVD+RFQLEK MK LP   +      QQ+  ++   +          +
Sbjct  235   YAASIMYGYFLKRVDERFQLEKTMKTLPPKPN------QQIVFENLQPNPFWDMESLVQI  288

Query  594   SWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPE  415
             + PDG   S     +  P++LR+YV   D +TLQRYATIRSKEA+++IEK T+ALFGRP+
Sbjct  289   T-PDGEEISLD-DEKSNPNKLRSYVSQLDADTLQRYATIRSKEAVSLIEKQTQALFGRPD  346

Query  414   ISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  259
             I +   G++++    +I I+F+ L  LVLEAV FGSFLW+ ES V+S+YHFV
Sbjct  347   IKVLDDGSVNAKDGRMITITFTELNHLVLEAVAFGSFLWEAESYVESKYHFV  398



>ref|NP_001242537.1| uncharacterized protein LOC100810147 [Glycine max]
 gb|ACU21518.1| unknown [Glycine max]
Length=406

 Score =   301 bits (771),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 177/393 (45%), Positives = 247/393 (63%), Gaps = 26/393 (7%)
 Frame = -2

Query  1425  TTDAPGFVKFGSKALLSAPS-IKVKLGNRRVAFGSTKCNSIRASLPLSNSGGSAMPIAPL  1249
              +DA GF+  G   L S PS    K  N    F +    +  ++ P  N     +P APL
Sbjct  33    VSDAKGFLSGG--FLKSCPSSYNPKHYNELYNFRARGLVARASADPRDN----LVPFAPL  86

Query  1248  KLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYR  1069
             + ESP+GQ L QI  +HPHL+ AA+DQQLE LQT R+   QNE      S+  +   LY+
Sbjct  87    QFESPVGQLLEQISNTHPHLLPAAIDQQLENLQTARD--AQNE------SSDSSLDSLYK  138

Query  1068  RIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPSKDEQLAR  889
             RIAEVK  E+R  LEEILY  +V KF++ ++ ++P I++ S + +G +D  P+++ +L  
Sbjct  139   RIAEVKEKEKRTTLEEILYCSIVHKFLENNISMIPKISATS-DPTGRVDLWPNQELKLEG  197

Query  888   LHSPEAYEMIQNHLSLILGNR--SNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQL  715
             +HSPEA+EMIQ+HLSL+LG+R      + VQI+K+++G++YAAS+MYGYFLKR+D+RFQL
Sbjct  198   VHSPEAFEMIQSHLSLVLGDRLVGPLQTVVQISKIKLGKLYAASIMYGYFLKRIDERFQL  257

Query  714   EKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGT-EMKPS  538
             E++M  LP+   K  S  +   G            H       D    S    T E +  
Sbjct  258   ERSMGTLPKDFGKAKSFDEPSPGIKLWDPDSLIIVH-------DYDNDSDHMDTDEGRSF  310

Query  537   RLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKI  358
             RLR YVM  D ETLQR AT+RSKEAI++IEK T+AL GRP+I ++  G+I++S DEL+ +
Sbjct  311   RLRAYVMQLDAETLQRLATVRSKEAISLIEKQTQALVGRPDIRVSEDGSIETSNDELLSL  370

Query  357   SFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  259
             +FS L  LVLEA+ FGSFLWD E+ V+S Y F+
Sbjct  371   TFSGLTMLVLEALAFGSFLWDKENYVESEYPFL  403



>ref|XP_008800079.1| PREDICTED: uncharacterized protein LOC103714566 isoform X3 [Phoenix 
dactylifera]
Length=372

 Score =   300 bits (767),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 160/313 (51%), Positives = 220/313 (70%), Gaps = 19/313 (6%)
 Frame = -2

Query  1191  LVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEEILY  1012
             L ++A+DQQLE+LQ+DR+ +K+      E   +  D+ LYRRIAEVKA ER+KALEEI+Y
Sbjct  75    LENSAIDQQLEKLQSDRDAQKE------ETPPATQDLPLYRRIAEVKAKERQKALEEIIY  128

Query  1011  ALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILG  832
              L+VQKFMD  + ++PAI SP+ + +  +   P+++++L  +HSP+A +MIQ+HL+LILG
Sbjct  129   CLIVQKFMDNGISMIPAI-SPTSDPNSQVHYWPNQEQKLEAIHSPDALDMIQSHLTLILG  187

Query  831   NR--SNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQ  658
              R     N+ VQI++L++G++YAAS+MYGYFLKRVDQRFQLE+ MK LP      D+  Q
Sbjct  188   ERVVGPLNTIVQISRLKLGKLYAASIMYGYFLKRVDQRFQLERTMKTLPT-----DTRQQ  242

Query  657   QVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATI  478
             ++  D     L    S  ++ S           G + K  RLR+YVM  D ETLQRYATI
Sbjct  243   RIFDDLKPNPLWDLESMVQISS-----DDDGSDGEDSKSYRLRSYVMYLDAETLQRYATI  297

Query  477   RSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLW  298
             RSKE+I++IEK T+ALFGRP+I I   G++D+S DEL+ I+F+ L  LVLEAV FGS LW
Sbjct  298   RSKESISLIEKQTQALFGRPDIRIAEDGSLDTSNDELVGITFTGLTMLVLEAVAFGSILW  357

Query  297   DVESSVDSRYHFV  259
             + ES V+S+YHFV
Sbjct  358   EAESYVESKYHFV  370



>ref|XP_006653725.1| PREDICTED: uncharacterized protein LOC102702753 [Oryza brachyantha]
Length=399

 Score =   300 bits (767),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 160/344 (47%), Positives = 225/344 (65%), Gaps = 18/344 (5%)
 Frame = -2

Query  1284  NSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDE  1105
             +SG     +APL  ESP GQ L QIL SHPHL+ A VD QLE LQ++++       Q  E
Sbjct  70    DSGDGRTRLAPLIFESPSGQLLVQILQSHPHLLPATVDHQLENLQSEKD------AQEKE  123

Query  1104  PSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSI  925
                   D+ LY+RIAEVK  ER+  LEEI+Y  ++ KFMD D+ + PA+ SP       I
Sbjct  124   ALKVPQDL-LYKRIAEVKEKERQNTLEEIIYCWIIYKFMDNDIAMTPAL-SPLGGPVRDI  181

Query  924   DTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNA--NSSVQINKLRVGQVYAASVMYG  751
              +LP+++++L  +HSP+A EMIQNHL+LI+G +  A  ++ V+I+ L +G++YAAS+MYG
Sbjct  182   SSLPNQEDKLQSIHSPDALEMIQNHLNLIMGEKVAAPLDTVVEISNLNLGKLYAASIMYG  241

Query  750   YFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMG  571
             YFLKRVD+RFQLEKNMK LP       +  QQ+  ++   +          ++ PDG   
Sbjct  242   YFLKRVDERFQLEKNMKTLPP------NPKQQIVFENLKPNPFWDMESLVQIT-PDGEEI  294

Query  570   SRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGT  391
                   E  P++LR+YV   D +TLQRYATIRSKE++++IEK T+ALFGRP+I +   G+
Sbjct  295   DLD-DEESNPNKLRSYVSRLDADTLQRYATIRSKESVSLIEKQTQALFGRPDIKVLDDGS  353

Query  390   IDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  259
             +++   ++I I+F  L  LVLEA  FGSFLW+ ES ++S+YHFV
Sbjct  354   VNAKDGQMITITFIELTHLVLEAAAFGSFLWEAESHIESKYHFV  397



>ref|NP_001031154.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE32294.1| uncharacterized protein AT1G48450 [Arabidopsis thaliana]
Length=342

 Score =   296 bits (759),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 167/310 (54%), Positives = 219/310 (71%), Gaps = 25/310 (8%)
 Frame = -2

Query  1425  TTDAPGFVKFGSKALLSAPSIKVKLGNRRVAF------GSTKCNSIRASLPLSNSGGSAM  1264
             T + PGF++  S      P  +++  N  + F      G+T   S R+ +  +++ G A 
Sbjct  26    TPNCPGFMRISS-----GPQFRLR-QNSSLKFSRPFQSGTTCVKSRRSFVVKASASGDAS  79

Query  1263  --PIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASG  1090
                IAPL+L+SP+GQFL+QILVSHPHLV AAV+QQLEQLQ DR+ E+Q++   D  S  G
Sbjct  80    TESIAPLQLKSPVGQFLSQILVSHPHLVPAAVEQQLEQLQIDRDAEEQSK---DASSVLG  136

Query  1089  TDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPS  910
             TDIVLYRRIAEVK  ERR+ALEEILYALVVQKFMDA+V LVP+ITS S + SG +DT P+
Sbjct  137   TDIVLYRRIAEVKEKERRRALEEILYALVVQKFMDANVTLVPSITSSSADPSGRVDTWPT  196

Query  909   KDEQLARLHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFLKRV  733
              D +L RLHSPE YEMIQNHLS+IL NR++  ++V QI+KL VGQVYAASVMYGYFLKR+
Sbjct  197   LDGELERLHSPEVYEMIQNHLSIILKNRTDDLTAVAQISKLGVGQVYAASVMYGYFLKRI  256

Query  732   DQRFQLEKNMKVLPQGLDKEDSGIQQVGGD-------ssdtslrsspSHPEVVSWPDGGM  574
             DQRFQLEK M++LP G D+ ++ I+Q G D        ++ + ++  S+ +V S+  G  
Sbjct  257   DQRFQLEKTMRILPGGSDEGETSIEQAGRDVERNFYEEAEETYQAVSSNQDVGSFVGGIN  316

Query  573   GSRGFGTEMK  544
              S GF ++MK
Sbjct  317   ASGGFSSDMK  326



>gb|KFK44959.1| hypothetical protein AALP_AA1G325800 [Arabis alpina]
Length=405

 Score =   298 bits (764),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 160/338 (47%), Positives = 224/338 (66%), Gaps = 15/338 (4%)
 Frame = -2

Query  1260  IAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDI  1081
             +AP+ LESP+GQ L QIL +HPHL+   VD+QLE+L +      +NE    E   S T  
Sbjct  77    LAPVDLESPVGQLLMQILRTHPHLLPVTVDEQLEKLAS------ENESLKAE--LSSTQD  128

Query  1080  VLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPSKDE  901
             VL +RI+EV+  ERRK L EI+Y LVV +F++  + ++P I  P+ + +G +D  P+++E
Sbjct  129   VLSKRISEVRDKERRKTLAEIIYCLVVHRFVEKGISMIPQI-KPTSDPAGRVDLWPNQEE  187

Query  900   QLARLHSPEAYEMIQNHLSLILGNRSNA---NSSVQINKLRVGQVYAASVMYGYFLKRVD  730
             +L  +HS EA+EMIQ+HLS +LG+R+     +S VQI+K+++G++YAASVMYGYFL+R+D
Sbjct  188   KLEVIHSAEAFEMIQSHLSSVLGDRTAVGPLSSIVQISKIKLGKLYAASVMYGYFLRRID  247

Query  729   QRFQLEKNMKVLPQGLDKEDSGIQQVGGDs-sdtslrsspSHPEVVSWPDGGMGSRGFGT  553
              R+QLE+ MK LP+  +K     ++                 PE    PD     R    
Sbjct  248   SRYQLERTMKTLPKRSEKTRERFEEPSPPYPLWDPDSLIRIQPEEYD-PDEYAIQRN-ED  305

Query  552   EMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKD  373
             E   S LR YVM  D +TLQRYATIRSKEA+++IEK T+ALFGRP+I I   G +D+S D
Sbjct  306   ESSSSGLRAYVMQLDSDTLQRYATIRSKEAMSLIEKQTQALFGRPDIRILEDGKLDTSND  365

Query  372   ELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  259
             E++ +S S L  LVLEAV+FGSFLWD E+ V+S+YHF+
Sbjct  366   EILSLSVSGLAMLVLEAVSFGSFLWDAETYVESKYHFL  403



>ref|XP_002890970.1| hypothetical protein ARALYDRAFT_473397 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67229.1| hypothetical protein ARALYDRAFT_473397 [Arabidopsis lyrata subsp. 
lyrata]
Length=406

 Score =   298 bits (764),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 166/371 (45%), Positives = 236/371 (64%), Gaps = 17/371 (5%)
 Frame = -2

Query  1356  KLGNRRV-AFGSTKCNSIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSA  1180
             KLG+  +   G  +  ++RAS    +S G+  P+AP++LESP+GQ L QIL +HPHL+  
Sbjct  46    KLGSSSINENGRGRIVTVRASGE-EDSNGNFAPLAPVELESPVGQLLEQILRTHPHLLPV  104

Query  1179  AVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEEILYALVV  1000
              VD+QLE+   +    K +        +S T  +L +RI+EV+  ERRK L EI+Y LVV
Sbjct  105   TVDEQLEKFAAENETLKAD--------SSATQDILQKRISEVRDKERRKTLAEIIYCLVV  156

Query  999   QKFMDADVPLVPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSN  820
             Q+F++  + ++P I  P+ + +G ID  P+++E+L  +HS +A+EMIQ+HLS +LG+R+ 
Sbjct  157   QRFVEKGISMIPQI-KPTSDPAGRIDLWPNQEEKLEVIHSADAFEMIQSHLSSVLGDRTA  215

Query  819   A---NSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVG  649
                 +S VQI K+++G++YAAS MYGYFL+RVDQR+QLE+ M  LP+  +K     ++  
Sbjct  216   VGPLSSIVQIGKIKLGKLYAASAMYGYFLRRVDQRYQLERTMNTLPKRPEKTRERFEEPS  275

Query  648   GDs-sdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRS  472
                            PE    PD     R    E     LR+YV   D +TLQRYATIRS
Sbjct  276   PPYPLWDPDSLIRIQPEEYD-PDEYAIQRN-EDESSSYGLRSYVTYLDSDTLQRYATIRS  333

Query  471   KEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDV  292
             KEA+ +IEK T+ALFGRP+I I   G +D+S DE++ +S S L  LVLEAV FGSFLWD 
Sbjct  334   KEAMTLIEKQTQALFGRPDIRILEDGKLDTSNDEVLSLSVSGLAMLVLEAVAFGSFLWDS  393

Query  291   ESSVDSRYHFV  259
             ES V+S+YHF+
Sbjct  394   ESYVESKYHFL  404



>dbj|BAH56904.1| AT1G48450 [Arabidopsis thaliana]
Length=321

 Score =   295 bits (754),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 158/270 (59%), Positives = 200/270 (74%), Gaps = 18/270 (7%)
 Frame = -2

Query  1425  TTDAPGFVKFGSKALLSAPSIKVKLGNRRVAF------GSTKCNSIRASLPLSNSGGSAM  1264
             T + PGF++  S      P  +++  N  + F      G+T   S R+ +  +++ G A 
Sbjct  26    TPNCPGFMRISS-----GPQFRLR-QNSSLKFSRPFQSGTTCVKSRRSFVVKASASGDAS  79

Query  1263  --PIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASG  1090
                IAPL+L+SP+GQFL+QILVSHPHLV AAV+QQLEQLQ DR+ E+Q++   D  S  G
Sbjct  80    TESIAPLQLKSPVGQFLSQILVSHPHLVPAAVEQQLEQLQIDRDAEEQSK---DASSVLG  136

Query  1089  TDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPS  910
             TDIVLYRRIAEVK  ERR+ALEEILYALVVQKFMDA+V LVP+ITS S + SG +DT P+
Sbjct  137   TDIVLYRRIAEVKEKERRRALEEILYALVVQKFMDANVTLVPSITSSSADPSGRVDTWPT  196

Query  909   KDEQLARLHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFLKRV  733
              D +L RLHSPE YEMIQNHLS+IL NR++  ++V QI+KL VGQVYAASVMYGYFLKR+
Sbjct  197   LDGELERLHSPEVYEMIQNHLSIILKNRTDDLTAVAQISKLGVGQVYAASVMYGYFLKRI  256

Query  732   DQRFQLEKNMKVLPQGLDKEDSGIQQVGGD  643
             DQRFQLEK M++LP G D+ ++ I+Q G D
Sbjct  257   DQRFQLEKTMRILPGGSDEGETSIEQAGRD  286



>ref|NP_001185170.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE32295.1| uncharacterized protein AT1G48450 [Arabidopsis thaliana]
Length=333

 Score =   294 bits (752),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 158/270 (59%), Positives = 200/270 (74%), Gaps = 18/270 (7%)
 Frame = -2

Query  1425  TTDAPGFVKFGSKALLSAPSIKVKLGNRRVAF------GSTKCNSIRASLPLSNSGGSAM  1264
             T + PGF++  S      P  +++  N  + F      G+T   S R+ +  +++ G A 
Sbjct  26    TPNCPGFMRISS-----GPQFRLR-QNSSLKFSRPFQSGTTCVKSRRSFVVKASASGDAS  79

Query  1263  --PIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASG  1090
                IAPL+L+SP+GQFL+QILVSHPHLV AAV+QQLEQLQ DR+ E+Q++   D  S  G
Sbjct  80    TESIAPLQLKSPVGQFLSQILVSHPHLVPAAVEQQLEQLQIDRDAEEQSK---DASSVLG  136

Query  1089  TDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPS  910
             TDIVLYRRIAEVK  ERR+ALEEILYALVVQKFMDA+V LVP+ITS S + SG +DT P+
Sbjct  137   TDIVLYRRIAEVKEKERRRALEEILYALVVQKFMDANVTLVPSITSSSADPSGRVDTWPT  196

Query  909   KDEQLARLHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFLKRV  733
              D +L RLHSPE YEMIQNHLS+IL NR++  ++V QI+KL VGQVYAASVMYGYFLKR+
Sbjct  197   LDGELERLHSPEVYEMIQNHLSIILKNRTDDLTAVAQISKLGVGQVYAASVMYGYFLKRI  256

Query  732   DQRFQLEKNMKVLPQGLDKEDSGIQQVGGD  643
             DQRFQLEK M++LP G D+ ++ I+Q G D
Sbjct  257   DQRFQLEKTMRILPGGSDEGETSIEQAGRD  286



>gb|EMS68345.1| hypothetical protein TRIUR3_07699 [Triticum urartu]
Length=391

 Score =   295 bits (754),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 152/344 (44%), Positives = 224/344 (65%), Gaps = 16/344 (5%)
 Frame = -2

Query  1284  NSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDE  1105
             +SG     +AP+K E+P GQ L Q+L S PHL+   VDQQLE L  ++  +K       E
Sbjct  60    DSGDGETQLAPVKFETPSGQLLAQMLQSQPHLIPVTVDQQLENLTAEKIAQK-------E  112

Query  1104  PSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSI  925
              +A   + +LY+RIAEVK  ER+  LEEI+Y  ++ KFM+ D+ + PA++S S    G +
Sbjct  113   KAAKVPEDLLYKRIAEVKEKERQNTLEEIIYCWILFKFMENDIQMTPALSS-SGGPVGDV  171

Query  924   DTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNA--NSSVQINKLRVGQVYAASVMYG  751
              +LP+++ +L  +HS +A EMIQNHL+LI+G ++ A  ++ V+I+ L +G++YAAS+MYG
Sbjct  172   SSLPNQEYKLQNIHSQDALEMIQNHLNLIMGEQAAAPLDTVVEISNLNLGKLYAASIMYG  231

Query  750   YFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMG  571
             YFLKRVD+RFQLEK MK LP  L+      +++  +              V   PDG M 
Sbjct  232   YFLKRVDERFQLEKTMKTLPPSLN------EKLFTERDIKPNPFMDMESLVRMTPDGEMV  285

Query  570   SRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGT  391
                   E  P++LR+YV   D +TLQRYATIRSKE++++IEK T+ALFGRP+I +   G+
Sbjct  286   DVEEDEETNPNKLRSYVSRLDADTLQRYATIRSKESVSLIEKQTQALFGRPDIKVLDDGS  345

Query  390   IDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  259
             +++   + + ++F+ L  LVLEA  FG+FLW+ ES V+S+YHFV
Sbjct  346   VNAKDGKTVTLTFTELTHLVLEAAGFGAFLWEAESHVESKYHFV  389



>dbj|BAJ87444.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=392

 Score =   295 bits (754),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 154/343 (45%), Positives = 222/343 (65%), Gaps = 16/343 (5%)
 Frame = -2

Query  1281  SGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEP  1102
             SG     +AP+K E+P GQ L QIL S PHL+   VDQQLE L  ++  +K       E 
Sbjct  62    SGDGEAQLAPVKFETPSGQLLAQILQSQPHLIPVTVDQQLENLTAEKIAQK-------EK  114

Query  1101  SASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSID  922
             +A   + +LY+RIAEVK  ER+  LEEI+Y  ++ KFM+ D+ + PA+ SPS      I 
Sbjct  115   AAKVPEDLLYKRIAEVKEKERQNTLEEIIYCWILFKFMENDISMTPAL-SPSGGPVRDIS  173

Query  921   TLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNA--NSSVQINKLRVGQVYAASVMYGY  748
             +LP+++ +L  +HS +A EMIQNHL+LI+G ++ A  ++ V+I+ L +G++YAAS+MYGY
Sbjct  174   SLPNQEYKLQSIHSQDALEMIQNHLNLIMGEQAAAPLDTVVEISNLNLGKLYAASIMYGY  233

Query  747   FLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGS  568
             FLKRVD+RFQLEK MK LP  L+      +++  +              V   PDG M  
Sbjct  234   FLKRVDERFQLEKTMKTLPPSLN------EKLFTERDIKPNPFMDMESLVRMTPDGEMVD  287

Query  567   RGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTI  388
                  E  P++LR+YV   D +TLQRYATIRSKE++++IEK T+ALFGRP+I +   G++
Sbjct  288   VEEDEETNPNKLRSYVSRLDADTLQRYATIRSKESVSLIEKQTQALFGRPDIKVLDDGSV  347

Query  387   DSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  259
             ++   + + ++F+ L  LVLEA  FG+FLW+ ES V+S+YHFV
Sbjct  348   NAKDGKTVTLTFTELTHLVLEAAGFGAFLWEAESHVESKYHFV  390



>gb|EMT04061.1| hypothetical protein F775_32804 [Aegilops tauschii]
Length=392

 Score =   292 bits (747),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 152/344 (44%), Positives = 223/344 (65%), Gaps = 16/344 (5%)
 Frame = -2

Query  1284  NSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDE  1105
             +SG     +AP+K E+P GQ L QIL S PHL+   VDQQLE L  ++  +K       E
Sbjct  61    DSGDGETQLAPVKFETPSGQLLAQILQSQPHLIPVTVDQQLENLTAEKIAQK-------E  113

Query  1104  PSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSI  925
              +A   + +LY+RIAEVK  ER+  LEEI+Y  ++ KFM+ D+ + PA++S S      +
Sbjct  114   KAAKVPEDLLYKRIAEVKEKERQNTLEEIIYCWILFKFMENDIQMTPALSS-SGGPVRDV  172

Query  924   DTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNA--NSSVQINKLRVGQVYAASVMYG  751
              +LP+++ +L  +HS +A EMIQNHL+LI+G ++ A  ++ V+I+ L +G++YAAS+MYG
Sbjct  173   SSLPNQEYKLQSIHSQDALEMIQNHLNLIMGEQAAAPLDTVVEISNLNLGKLYAASIMYG  232

Query  750   YFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMG  571
             YFLKRVD+RFQLEK MK LP  L+      +++  +              V   PDG M 
Sbjct  233   YFLKRVDERFQLEKTMKTLPPSLN------EKLFTERDIKPNPFMDMESLVRMTPDGEMV  286

Query  570   SRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGT  391
                   E  P++LR+YV   D +TLQRYATIRSKE++++IEK T+ALFGRP+I +   G+
Sbjct  287   DVEEDEETNPNKLRSYVSRLDADTLQRYATIRSKESVSLIEKQTQALFGRPDIKVLDDGS  346

Query  390   IDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  259
             +++   + + ++F+ L  LVLEA  FG+FLW+ ES V+S+YHFV
Sbjct  347   VNAKDGKTVTLTFTELTHLVLEAAGFGAFLWEAESHVESKYHFV  390



>ref|XP_006307539.1| hypothetical protein CARUB_v10009166mg, partial [Capsella rubella]
 gb|EOA40437.1| hypothetical protein CARUB_v10009166mg, partial [Capsella rubella]
Length=440

 Score =   292 bits (747),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 158/372 (42%), Positives = 231/372 (62%), Gaps = 38/372 (10%)
 Frame = -2

Query  1329  GSTKCNSIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQ  1150
             G  +C ++RA     ++  +  P+AP++LESP+GQ L QIL +HPHL+   VD+QLE+  
Sbjct  90    GRGRCVTVRALGDEDSNNENFAPLAPVELESPVGQLLEQILRTHPHLLPVTVDEQLEKFA  149

Query  1149  TDRNLEKQNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPL  970
                      E +  +   S +  VL +RI+EV+  ERRK L EI+Y LVV +F++  + +
Sbjct  150   A--------ESEALKAETSSSQDVLSKRISEVRDKERRKTLAEIIYCLVVHRFVEKGISM  201

Query  969   VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNA---NSSVQI  799
             +P I  P+ + +G ID  P+++E+L  +HS +A+EMIQ+HLS +LG+R+     +S VQI
Sbjct  202   IPQI-KPTSDPAGRIDLWPNQEEKLEVIHSADAFEMIQSHLSSVLGDRTAVGPLSSIVQI  260

Query  798   NKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrs  619
             +K+++G++YAAS MYGYFL+RVDQR+QLE+ M  LP+  +K     ++            
Sbjct  261   SKIKLGKLYAASAMYGYFLRRVDQRYQLERTMNTLPKRPEKTRERYEEPS----------  310

Query  618   spSHPEVVSW-PDGGM-------GSRGFGTEMKPSR----LRTYVMSFDGETLQRYATIR  475
                 P    W PD  +        S  +  +         LR+YV   D +TLQRYATIR
Sbjct  311   ----PPYPLWDPDSLIRIQPEEYDSDEYAIQRNEDESSYGLRSYVTYLDSDTLQRYATIR  366

Query  474   SKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWD  295
             SKEA+ +IEK T+ALFGRP+I I   G +D+S DE++ +S S L  LVLEAV FGSFLWD
Sbjct  367   SKEAMTLIEKQTQALFGRPDIRILEDGKLDTSNDEVLSLSVSGLAMLVLEAVAFGSFLWD  426

Query  294   VESSVDSRYHFV  259
              E+ V+S+YHF+
Sbjct  427   SETYVESKYHFL  438



>ref|XP_010461033.1| PREDICTED: uncharacterized protein LOC104741810 [Camelina sativa]
Length=406

 Score =   289 bits (740),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 159/346 (46%), Positives = 222/346 (64%), Gaps = 15/346 (4%)
 Frame = -2

Query  1284  NSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDE  1105
             +S  +  P+AP++LESP+GQ L QIL +HPHL    VD+QLE+        K        
Sbjct  70    DSNENFAPLAPVELESPVGQLLDQILRTHPHLFPVTVDEQLEKFAAGNETLKSV------  123

Query  1104  PSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSI  925
              S+S  DI L +RI+EV+  +RRK L EI+Y LVVQ+F++  + ++P I  P+ + +G I
Sbjct  124   -SSSSQDI-LSKRISEVRDKDRRKTLAEIIYCLVVQRFVEKGISMIPQI-KPTSDPAGRI  180

Query  924   DTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNA---NSSVQINKLRVGQVYAASVMY  754
             D  P+++E+L  +HS +A+EMIQ+HLS +LG+R+     +S VQI+K+++G++YAAS MY
Sbjct  181   DLWPNQEEKLEVIHSADAFEMIQSHLSSVLGDRTAVGPLSSIVQISKIKLGKLYAASAMY  240

Query  753   GYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDs-sdtslrsspSHPEVVSWPDGG  577
             GYFL+RVDQR+QLE+ M  LP+  +K     ++                 PE    PD  
Sbjct  241   GYFLRRVDQRYQLERTMNTLPKRPEKTRERFEEPSPPYPLWDPNSLIRIQPEEYD-PDEY  299

Query  576   MGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQ  397
                R    E     LR+YV   D +TLQRYATIRSKEA+ +IEK T+ALFGRP+I I   
Sbjct  300   AIQRN-EDESSSYGLRSYVTYLDSDTLQRYATIRSKEAMTLIEKQTQALFGRPDIRILED  358

Query  396   GTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  259
             G +D+S DE++ +S S L  LVLEAV FGSFLWD ES V+S+YHF+
Sbjct  359   GKLDTSNDEVLSLSVSGLAMLVLEAVAFGSFLWDSESYVESKYHFL  404



>ref|NP_564389.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAG23441.1|AC084165_7 unknown protein [Arabidopsis thaliana]
 gb|AAK59781.1| At1g32160/F3C3_6 [Arabidopsis thaliana]
 gb|AAM65447.1| unknown [Arabidopsis thaliana]
 gb|AAO11596.1| At1g32160/F3C3_6 [Arabidopsis thaliana]
 gb|AEE31442.1| uncharacterized protein AT1G32160 [Arabidopsis thaliana]
Length=406

 Score =   289 bits (739),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 160/361 (44%), Positives = 228/361 (63%), Gaps = 16/361 (4%)
 Frame = -2

Query  1329  GSTKCNSIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQ  1150
             G  +  ++RAS    +S  +  P+AP++LESP+GQ L QIL +HPHL+   VD+QLE+  
Sbjct  56    GRGRSVTVRASGD-EDSNENFAPLAPVELESPVGQLLEQILRTHPHLLPVTVDEQLEKFA  114

Query  1149  TDRNLEKQNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPL  970
                      E ++ +  +S T  +L +RI+EV+  ERRK L EI+Y LVV +F++  + +
Sbjct  115   A--------ESESRKADSSSTQDILQKRISEVRDKERRKTLAEIIYCLVVHRFVEKGISM  166

Query  969   VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNA---NSSVQI  799
             +P I  P+ + +G ID  P+++E+L  +HS +A+EMIQ+HLS +LG+       +S VQI
Sbjct  167   IPRI-KPTSDPAGRIDLWPNQEEKLEVIHSADAFEMIQSHLSSVLGDGPAVGPLSSIVQI  225

Query  798   NKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDs-sdtslr  622
              K+++G++YAAS MYGYFL+RVDQR+QLE+ M  LP+  +K     ++            
Sbjct  226   GKIKLGKLYAASAMYGYFLRRVDQRYQLERTMNTLPKRPEKTRERFEEPSPPYPLWDPDS  285

Query  621   sspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKH  442
                  PE    PD     R    E     LR+YV   D +TLQRYATIRSKEA+ +IEK 
Sbjct  286   LIRIQPEEYD-PDEYAIQRN-EDESSSYGLRSYVTYLDSDTLQRYATIRSKEAMTLIEKQ  343

Query  441   TEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHF  262
             T+ALFGRP+I I   G +D+S DE++ +S S L  LVLEAV FGSFLWD ES V+S+YHF
Sbjct  344   TQALFGRPDIRILEDGKLDTSNDEVLSLSVSGLAMLVLEAVAFGSFLWDSESYVESKYHF  403

Query  261   V  259
             +
Sbjct  404   L  404



>emb|CBI40011.3| unnamed protein product [Vitis vinifera]
Length=289

 Score =   285 bits (728),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 145/237 (61%), Positives = 182/237 (77%), Gaps = 6/237 (3%)
 Frame = -2

Query  1350  GNRRVAFGSTKCNSIRASLPLSN-SGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAV  1174
             G+R++A G  +   +RAS  + N S  SA PIAPL+LESPIG+FLT+IL+SHPHLV AAV
Sbjct  43    GHRKMASGWKEQTMVRASATVDNDSYESAAPIAPLRLESPIGRFLTEILISHPHLVPAAV  102

Query  1173  DQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQK  994
             ++QLEQ QTDR+ E   +    E SASG +++LYRRIA+VKANER+KALEEILY LVVQK
Sbjct  103   ERQLEQFQTDRDAEGHKQ----ESSASGIELLLYRRIAKVKANERKKALEEILYVLVVQK  158

Query  993   FMDADVPLVPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNAN  814
             F+ A+VPL+P ++  S  SSG +D  PS D  L  LHSPEA EMIQNHL+ ILGNR   +
Sbjct  159   FVGANVPLIPRMSPSSLGSSGRVDNWPSLDRDLGELHSPEATEMIQNHLAFILGNRFGDS  218

Query  813   SSV-QINKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGG  646
             +SV +++KLRVGQVYAASVMYGYFLKRVD+RFQLEK MK+LP  LD +   +++  G
Sbjct  219   TSVAKMSKLRVGQVYAASVMYGYFLKRVDERFQLEKTMKILPYALDGDKGYVEEAMG  275



>ref|XP_010499760.1| PREDICTED: uncharacterized protein LOC104777247 [Camelina sativa]
Length=410

 Score =   288 bits (737),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 156/339 (46%), Positives = 219/339 (65%), Gaps = 15/339 (4%)
 Frame = -2

Query  1263  PIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTD  1084
             P+AP++LES +GQ L QIL +HPHL    VD+QLE+   +    K +        AS + 
Sbjct  81    PLAPVELESHVGQLLEQILRTHPHLFPVTVDEQLEKFAAENETLKAD--------ASSSQ  132

Query  1083  IVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPSKD  904
              +L +RI+EV+  +RRK L EI+Y LVVQ+F++  + ++P I  P+ + +G ID  P+++
Sbjct  133   DILSKRISEVRDKDRRKTLAEIIYCLVVQRFVEKGISMIPQI-KPTSDPAGRIDLWPNQE  191

Query  903   EQLARLHSPEAYEMIQNHLSLILGNR---SNANSSVQINKLRVGQVYAASVMYGYFLKRV  733
             E+L  +HS +A+EMIQ+HLS +LG+R   S  +S VQI+K+++G++YAAS MYGYFL+RV
Sbjct  192   EKLEVIHSADAFEMIQSHLSSVLGDRTAVSPLSSIVQISKIKLGKLYAASAMYGYFLRRV  251

Query  732   DQRFQLEKNMKVLPQGLDKEDSGIQQVGGDs-sdtslrsspSHPEVVSWPDGGMGSRGFG  556
             DQR+QLE+ M  LP+  +K     ++                 PE    PD     R   
Sbjct  252   DQRYQLERTMNTLPKRPEKTRERFEEPSPPYPLWDPNSLIRIQPEEYD-PDEYAIQRN-E  309

Query  555   TEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSK  376
              E     LR+YV   D +TLQRYATIRSKEA+ +IEK T+ALFGRP+I I   G +D+S 
Sbjct  310   DESSSYGLRSYVTYLDSDTLQRYATIRSKEAMTLIEKQTQALFGRPDIRILEDGKLDTSN  369

Query  375   DELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  259
             DE++ +S S L  LVLEAV FGSFLWD ES V+S+YHF+
Sbjct  370   DEVMSLSVSGLAMLVLEAVAFGSFLWDSESYVESKYHFL  408



>ref|XP_010478637.1| PREDICTED: uncharacterized protein LOC104757587 [Camelina sativa]
Length=407

 Score =   288 bits (736),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 157/346 (45%), Positives = 224/346 (65%), Gaps = 14/346 (4%)
 Frame = -2

Query  1284  NSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDE  1105
             +S  +  P+AP++LESP+GQ L QIL +HPHL    VD+QLE+         +NE    +
Sbjct  70    DSNENFAPLAPVELESPVGQLLEQILRTHPHLFPVTVDEQLEKFAA------ENETLKAD  123

Query  1104  PSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSI  925
              S+S  D VL +RI+EV+  +RRK L EI+Y LVVQ+F++  + ++P I  P+ + +G I
Sbjct  124   SSSSSQD-VLSKRISEVRDKDRRKTLAEIIYCLVVQRFVEKGISMIPQI-KPTSDPAGRI  181

Query  924   DTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNA---NSSVQINKLRVGQVYAASVMY  754
             D  P+++E+L  +HS +A+EMIQ+HLS +LG+R+     +S VQI+K+++G++YAAS MY
Sbjct  182   DLWPNQEEKLEIIHSADAFEMIQSHLSSVLGDRTAVGPLSSIVQISKIKLGKLYAASAMY  241

Query  753   GYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDs-sdtslrsspSHPEVVSWPDGG  577
             GYFL+RVDQR+QLE+ M  LP+  +K     ++                 PE   +    
Sbjct  242   GYFLRRVDQRYQLERTMNTLPKRPEKTRERFEEPSPPYPLWDPNSLIRIQPE--EYDSDE  299

Query  576   MGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQ  397
                +    E     LR+YV   D +TLQRYATIRSKEA+ +IEK T+ALFGRP+I I   
Sbjct  300   YAIQRNEDESSSYGLRSYVTYLDSDTLQRYATIRSKEAMTLIEKQTQALFGRPDIRILED  359

Query  396   GTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  259
             G +D+S DE++ +S S L  LVLEAV FGSFLWD ES V+S+YHF+
Sbjct  360   GKLDTSNDEVLSLSVSGLAMLVLEAVAFGSFLWDSESYVESKYHFL  405



>ref|XP_010240349.1| PREDICTED: uncharacterized protein LOC104585415 [Brachypodium 
distachyon]
Length=391

 Score =   286 bits (732),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 154/347 (44%), Positives = 227/347 (65%), Gaps = 24/347 (7%)
 Frame = -2

Query  1284  NSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDE  1105
             +SG     +APLK E+P GQ L QIL SHPHL+   VDQQLE LQ++++       QN+E
Sbjct  62    DSGDGETQLAPLKFETPSGQLLVQILQSHPHLIPVTVDQQLENLQSEKD------AQNEE  115

Query  1104  PSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITS---PSQNSS  934
              +    D+ LY+RIAEVK  ER+  LEEI+Y  ++ KF++ D+ + P+++S   P ++ S
Sbjct  116   AAKVPQDL-LYKRIAEVKEKERQTTLEEIIYCWILFKFVENDISMTPSLSSSSGPVRDIS  174

Query  933   GSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNA--NSSVQINKLRVGQVYAASV  760
                  LP+++ +L  +HS +A EMIQNHL+LI+G ++ A  ++ V+I+ L +G++YAAS+
Sbjct  175   -----LPNQEYKLQSIHSQDALEMIQNHLNLIMGEQAAAPLDTVVEISNLNLGKLYAASI  229

Query  759   MYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDG  580
             MYGYFLKRVD+RFQLEK MK LP       S  +Q+  +              V   PDG
Sbjct  230   MYGYFLKRVDERFQLEKTMKTLPP------SPKEQIVMERDLKPNPFWDMESLVQISPDG  283

Query  579   GMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITP  400
                      E  P++LR+YV   D +TLQ+YATIRSKE++++IEK T+ALFGRP+I +  
Sbjct  284   EEVDLD-DEESNPNKLRSYVSRLDADTLQKYATIRSKESVSLIEKQTQALFGRPDIKVLD  342

Query  399   QGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  259
              G++++   +++ I+F+ L  LVLEA  FG+FLW+ ES ++S+YHFV
Sbjct  343   DGSVNAKDGKIVTITFTELTNLVLEAAGFGAFLWEAESHIESKYHFV  389



>tpg|DAA51043.1| TPA: hypothetical protein ZEAMMB73_539342 [Zea mays]
Length=204

 Score =   278 bits (710),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 138/202 (68%), Positives = 159/202 (79%), Gaps = 0/202 (0%)
 Frame = -2

Query  864  MIQNHLSLILGNRSNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQG  685
            MI+NHL+LILG R    +   I+KLRVGQVYAASVMYGYFLKRVDQRFQLEK MK LP G
Sbjct  1    MIENHLTLILGQRQGDATIAAISKLRVGQVYAASVMYGYFLKRVDQRFQLEKTMKGLPWG  60

Query  684  LDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDG  505
             ++EDS + QV       S ++S SHPE+ SW      + G    +KP RLR+YVMSFD 
Sbjct  61   SEEEDSALNQVMMTDLMPSAQTSSSHPEMGSWTAPAFSTGGPSQSIKPCRLRSYVMSFDS  120

Query  504  ETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLE  325
            +TLQRYAT+RSKEA  IIEKHTEALFG+PEI ITP+GT+DSSKDE I+ISF+ LRRL+LE
Sbjct  121  DTLQRYATVRSKEAFGIIEKHTEALFGKPEIVITPEGTLDSSKDEHIRISFAGLRRLILE  180

Query  324  AVTFGSFLWDVESSVDSRYHFV  259
            AVTFGSFLWDVES VDSRYHFV
Sbjct  181  AVTFGSFLWDVESFVDSRYHFV  202



>ref|XP_008466020.1| PREDICTED: uncharacterized protein LOC103503577 isoform X2 [Cucumis 
melo]
Length=335

 Score =   276 bits (706),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 142/276 (51%), Positives = 196/276 (71%), Gaps = 13/276 (5%)
 Frame = -2

Query  1071  RRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPSKDEQLA  892
             +RIAEVK  ERRK LEEILY L+V KF++ D+ ++P IT  S + +G +D  P+++++L 
Sbjct  66    KRIAEVKEKERRKTLEEILYCLIVGKFVENDISMIPKITETS-DPTGRVDFWPNQEQKLE  124

Query  891   RLHSPEAYEMIQNHLSLILGNRSNA--NSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQ  718
              +HSPEA+EMIQ+HLSL+LG+R     +S V+++K+++G++YAAS+MYGYFLKRVDQRFQ
Sbjct  125   SVHSPEAFEMIQSHLSLVLGDRVVGPFSSIVEMSKIKLGKLYAASIMYGYFLKRVDQRFQ  184

Query  717   LEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMG-SRGF--GTEM  547
             LE+ MK LP+   K+    + +  +            P+     D G G SRG     + 
Sbjct  185   LERTMKTLPEAFTKDFD--EPIPANQLWDPDSLIRIAPD-----DEGFGDSRGLIDAGDG  237

Query  546   KPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDEL  367
             K  RLR+YVM  D ETLQRYAT+RSKEAI++IEK T+ALFG+P+I I   G+ID+  DE+
Sbjct  238   KSYRLRSYVMYLDSETLQRYATLRSKEAISLIEKQTQALFGKPDIRIAADGSIDTLNDEV  297

Query  366   IKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  259
             I ++FS L  LVLEAV FGSFLWD ES V+S+Y+F+
Sbjct  298   ISLTFSGLTMLVLEAVAFGSFLWDAESYVESKYNFI  333



>ref|XP_011652634.1| PREDICTED: uncharacterized protein LOC101213975 isoform X2 [Cucumis 
sativus]
Length=335

 Score =   275 bits (704),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 141/276 (51%), Positives = 196/276 (71%), Gaps = 13/276 (5%)
 Frame = -2

Query  1071  RRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPSKDEQLA  892
             +RIAEVK  ERRK LEEILY L+V KF++ D+ ++P IT  S + +G +D  P+++++L 
Sbjct  66    KRIAEVKDKERRKTLEEILYCLIVGKFVENDISMIPKITETS-DPTGRVDFWPNQEQKLE  124

Query  891   RLHSPEAYEMIQNHLSLILGNRSNA--NSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQ  718
              +HSPEA+EMIQ+HLSL+LG+R     +S V+++K+++G++YAAS+MYGYFLKRVDQRFQ
Sbjct  125   SVHSPEAFEMIQSHLSLVLGDRVVGPFSSIVEMSKIKLGKLYAASIMYGYFLKRVDQRFQ  184

Query  717   LEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMG-SRGF--GTEM  547
             LE+ MK LP+   K+    + +  +            P+     D G G SRG     + 
Sbjct  185   LERTMKTLPEAFTKDFD--EPIPANQLWDPDSLIRIAPD-----DEGFGDSRGLIDADDG  237

Query  546   KPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDEL  367
             K  RLR+YVM  D ETLQRYAT+RSKEAI++IEK T++LFG+P+I I   G+ID+  DE+
Sbjct  238   KSYRLRSYVMYLDSETLQRYATLRSKEAISLIEKQTQSLFGKPDIRIAADGSIDTLNDEV  297

Query  366   IKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  259
             I ++FS L  LVLEAV FGSFLWD ES V+S+Y+F+
Sbjct  298   ISLTFSGLTMLVLEAVAFGSFLWDAESYVESKYNFI  333



>emb|CAN68920.1| hypothetical protein VITISV_039448 [Vitis vinifera]
Length=299

 Score =   272 bits (696),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 138/284 (49%), Positives = 198/284 (70%), Gaps = 7/284 (2%)
 Frame = -2

Query  1104  PSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSI  925
             P    T +   RRIA V+  ER+K LEEILY L+VQKF+D ++ ++P I++ S +  G +
Sbjct  19    PLMLHTRLTRVRRIAAVREKERQKVLEEILYCLIVQKFVDKNISMIPKISATS-DPVGRV  77

Query  924   DTLPSKDEQLARLHSPEAYEMIQNHLSLILGNR--SNANSSVQINKLRVGQVYAASVMYG  751
             D  P+++++L  +HSPEA+EMIQ+HLSL+LG R     ++ VQI+K+++G++YAAS+MYG
Sbjct  78    DFWPNQEQKLESIHSPEAFEMIQSHLSLVLGERLVGPLDTIVQISKIKLGKLYAASIMYG  137

Query  750   YFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMG  571
             YFLKRVD+R+QLE+ MK LP+G ++     +  G  +      S    P       G + 
Sbjct  138   YFLKRVDERYQLERTMKTLPEGFNENRLSFEDPGPANRLWDPDSLIRIPADDDDDGGMLD  197

Query  570   SRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGT  391
             S   G+     RLR+YVM  D ETLQRYATIRSKEAI++IEK T+ALFG+P++ ++  G+
Sbjct  198   SVEGGS----YRLRSYVMYLDAETLQRYATIRSKEAISLIEKQTQALFGKPDVRVSEDGS  253

Query  390   IDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  259
             +D+S DE++ I+FS L  LVLEAV FGSFLWD E+ V+S+YHF+
Sbjct  254   LDTSNDEVVSITFSGLTMLVLEAVAFGSFLWDSETYVESKYHFL  297



>ref|XP_002977160.1| hypothetical protein SELMODRAFT_106276 [Selaginella moellendorffii]
 gb|EFJ21769.1| hypothetical protein SELMODRAFT_106276 [Selaginella moellendorffii]
Length=333

 Score =   268 bits (685),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 144/341 (42%), Positives = 220/341 (65%), Gaps = 17/341 (5%)
 Frame = -2

Query  1260  IAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDI  1081
             + P + ESPIGQFL  +L SHPHL   A +Q ++QL  D+N   +        ++SG+++
Sbjct  2     VGPWEPESPIGQFLVSLLQSHPHLFLEAAEQHIQQLAADKNAAAEKST-----NSSGSEL  56

Query  1080  VLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDT-LPSKD  904
             VLY+RIAEVK  ER+KA+ E++Y+LVVQKF+D+ + LVP I  PS  ++  +DT   S  
Sbjct  57    VLYKRIAEVKEQERQKAVVEVIYSLVVQKFLDSRLALVPKI--PSLPANQKVDTNWQSVQ  114

Query  903   EQLARLHSPEAYEMIQNHLSLILGNRS----NANSSVQINKLRVGQVYAASVMYGYFLKR  736
               +  +HS E  E++++HL +ILG  S       + VQ +K+++G +YAA+V++GYFL+R
Sbjct  115   GDMESIHSAEVLEVVRDHLGMILGRPSPHYQEPYTLVQASKMKIGHLYAATVVFGYFLRR  174

Query  735   VDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFG  556
             +DQR+QL+ +MK   + L  +    ++ G  +++ +           S   GG+G  G  
Sbjct  175   LDQRYQLDLSMK---KALSSDKHEDEEQGKLAAEANAAVQAMQAAKSSTTRGGLGGSGVF  231

Query  555   TEM--KPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDS  382
              ++  KPS+L++YVMS D E+LQR+AT+R KE+++++E+ T+ALFG+PE  I P G++  
Sbjct  232   PQLGWKPSKLKSYVMSLDPESLQRFATLRCKESLDVVERQTQALFGKPEAEIAPDGSVVL  291

Query  381   SKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  259
                +   IS S LRRLV EAV FGSFLWD E+ VDS Y+ V
Sbjct  292   LAGDSFTISLSGLRRLVTEAVVFGSFLWDAEAHVDSHYNLV  332



>ref|XP_007209264.1| hypothetical protein PRUPE_ppa007392mg [Prunus persica]
 gb|EMJ10463.1| hypothetical protein PRUPE_ppa007392mg [Prunus persica]
Length=369

 Score =   268 bits (686),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 164/381 (43%), Positives = 227/381 (60%), Gaps = 68/381 (18%)
 Frame = -2

Query  1377  SAPSIKV-KLGNRRVAFGSTKCNS----IRASLPLSNSGGSAMPIAPLKLESPIGQFLTQ  1213
             S PS  + KLGN     G  KC +    +RAS    +S  + +P+APL+ ESP GQ L Q
Sbjct  47    SCPSSCIPKLGN-----GLYKCRARGLIVRAS---KDSSDNLVPVAPLQFESPAGQLLAQ  98

Query  1212  ILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIAEVKANERRK  1033
             IL +HPHL+SAA+DQQLE LQ DR+  ++      E SAS  D  LY+RIA+VK  ERR 
Sbjct  99    ILQNHPHLLSAAIDQQLENLQKDRDARRE------ETSASSAD-PLYKRIAQVKEKERRM  151

Query  1032  ALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQN  853
             ALEEI+Y L+VQKF++ D+ ++P I++ S + +G +D  P ++++L  +HSPEA EMIQ+
Sbjct  152   ALEEIIYCLIVQKFIENDISMIPKISATS-DPTGRVDFWPMQEKKLESVHSPEALEMIQS  210

Query  852   HLSLILGNR--SNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLD  679
             HLSL+LG R     ++ V+I+K+++G++YAAS+MYGYFLKRVDQRFQLE+ M  LP G  
Sbjct  211   HLSLVLGERLVGPLSAIVEISKIKLGKLYAASIMYGYFLKRVDQRFQLERTMNTLPDGFT  270

Query  678   KEDSGIQQVGG-DssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGE  502
              + +   Q+   DS         S  +  S+ + G        + K  RLR+YVM     
Sbjct  271   PDAAPANQLWDPDSLIRIPPDGGSDSDGGSYMNNG--------DDKSYRLRSYVM-----  317

Query  501   TLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEA  322
                                            IT  G+ID+S DE+I ++FS L  LVLEA
Sbjct  318   -------------------------------ITEDGSIDASNDEVIALTFSGLTMLVLEA  346

Query  321   VTFGSFLWDVESSVDSRYHFV  259
             V FGSFLWD E+ ++S YHF+
Sbjct  347   VAFGSFLWDAETYIESNYHFL  367



>ref|XP_002981973.1| hypothetical protein SELMODRAFT_233832 [Selaginella moellendorffii]
 gb|EFJ17066.1| hypothetical protein SELMODRAFT_233832 [Selaginella moellendorffii]
Length=324

 Score =   267 bits (682),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 144/339 (42%), Positives = 211/339 (62%), Gaps = 40/339 (12%)
 Frame = -2

Query  1215  QILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIAEVKANERR  1036
             Q L  +PHL  AA +QQLE L  +R          ++P+ +G D +LY+RIA++K+ ERR
Sbjct  2     QTLKGNPHLFHAAAEQQLELLDLERR------SALEQPNPAGNDHILYKRIAQLKSEERR  55

Query  1035  KALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQ  856
             +A++E++Y LVV+KF+ A + +VP I++      GS  + P +++ L  +HSPEA+EMI+
Sbjct  56    RAVQEVIYVLVVEKFLKAGIKMVPKISALVNREGGSACSWPIQEKDLESVHSPEAFEMIK  115

Query  855   NHLSLILG-----NRSNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLP  691
              H+ ++LG     +R   ++  QI+KLRVGQ+YA SVMYGYFLKRVD+R+QLEK MK+L 
Sbjct  116   EHMEMVLGGHATLSRVEPHTVAQISKLRVGQIYATSVMYGYFLKRVDERYQLEKKMKILT  175

Query  690   Q-------------GLDKEDSG--IQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFG  556
             +              ++K +S   IQ  G  S    + SS   P  V+            
Sbjct  176   RVAESGRGFTTQFLSIEKRESSEMIQAAGAASELDLVSSSSRSPSQVA------------  223

Query  555   TEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSK  376
               +K + LR YV  FD ETL RYAT+R+ E +++IE+H EALFGRP++ +   G++  ++
Sbjct  224   --LKNNDLRAYVAKFDHETLSRYATMRTHETVDLIERHAEALFGRPDLRVAADGSVGLAR  281

Query  375   DELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  259
             D+ I+I F+SLR LV+EA  FGS+LWDVES VD  Y  V
Sbjct  282   DDAIQIKFASLRALVMEAAAFGSYLWDVESYVDIHYRVV  320



>gb|ABR16101.1| unknown [Picea sitchensis]
Length=420

 Score =   269 bits (687),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 160/408 (39%), Positives = 236/408 (58%), Gaps = 26/408 (6%)
 Frame = -2

Query  1455  CGPVK---SGRRFTTDAPGFVKF-GSKALLSAPSIKVKLGNRRVAFGSTKCNSIRASLPL  1288
             CG +    S  RF  D      F GS+ L      K K           K + I  +   
Sbjct  22    CGRLSRSCSASRFYKDKRVCTDFQGSRDLYGKAVFKSK--------NWHKISGIHIARAE  73

Query  1287  SNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQND  1108
              + G  +   APL+L+S  GQ L+ IL + PHL   A  +QLE+L  DR+    +     
Sbjct  74    YHEGYVSSQFAPLELKSSAGQLLSDILQNQPHLFHVAAAKQLEELAADRD----DAITRQ  129

Query  1107  EPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGS  928
             E S+S    VL+R+IAE+KA+E + A  E++Y L+VQKF++ +VP+VP + S  +N  G 
Sbjct  130   ELSSSDAYSVLHRKIAELKAHECQTAAGEVIYMLIVQKFVELNVPMVPRLVSCMEN--GK  187

Query  927   IDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNAN-----SSVQINKLRVGQVYAAS  763
             +DT   K+E+L  +HSPE  EMI+ H+S ILG R   N     +  +I++L +G+VYAA+
Sbjct  188   VDTWLPKNEELESIHSPEMLEMIREHISRILGRRGKLNIVDNRTITEIDRLTLGRVYAAT  247

Query  762   VMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQV--GGDssdtslrsspSHPEVVSW  589
             +MYGYFL+R +QR+QLE N++ +   L   D   + +   G+S   +     S  ++ + 
Sbjct  248   IMYGYFLRRAEQRYQLEMNLETIYSYLSDADDVKKYLLHLGESKFFTRTKCLSGKDLDAI  307

Query  588   PDGGMGSRGF-GTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEI  412
             P     +     T  +P +LR Y+MSFD E+LQR A +R+KE++N++EKH EALFGRP I
Sbjct  308   PVADPSTSSLVETRTRPRQLRDYIMSFDAESLQRCAMMRTKESVNMVEKHAEALFGRPVI  367

Query  411   SITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRY  268
              I   GT   + D+ +++++SSL+RL+LEAV FGS LWDVE  V S Y
Sbjct  368   HIAADGTTTFAHDDALRLTYSSLKRLLLEAVAFGSLLWDVEGYVGSIY  415



>ref|XP_002982952.1| hypothetical protein SELMODRAFT_234120 [Selaginella moellendorffii]
 gb|EFJ16197.1| hypothetical protein SELMODRAFT_234120 [Selaginella moellendorffii]
Length=324

 Score =   265 bits (678),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 143/339 (42%), Positives = 210/339 (62%), Gaps = 40/339 (12%)
 Frame = -2

Query  1215  QILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIAEVKANERR  1036
             Q L  +PHL  AA +QQLE L  +R          ++P+ +G D +LY+RIA++K+ ERR
Sbjct  2     QTLKGNPHLFHAAAEQQLELLDLERR------SALEQPNPAGNDHILYKRIAQLKSEERR  55

Query  1035  KALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQ  856
             +A++E++Y LVV+KF+ A + +VP I++      GS  + P +++ L  +HSPEA+EMI+
Sbjct  56    RAVQEVIYVLVVEKFLKAGIKMVPKISALVNREGGSACSWPIQEKDLESVHSPEAFEMIK  115

Query  855   NHLSLILG-----NRSNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLP  691
              H+ ++LG     +R   ++  QI+KLRVGQ+YA SVMYGYFLKRVD+R+QLEK MK+L 
Sbjct  116   EHMEMVLGGHATLSRVEPHTVAQISKLRVGQIYATSVMYGYFLKRVDERYQLEKKMKILT  175

Query  690   Q-------------GLDKEDSG--IQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFG  556
             +              ++K +S   IQ     S    + SS   P  V+            
Sbjct  176   RVAESGRGFTTQFLSIEKRESSEMIQAAAAASELDLVSSSSRSPSQVA------------  223

Query  555   TEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSK  376
               +K + LR YV  FD ETL RYAT+R+ E +++IE+H EALFGRP++ +   G++  ++
Sbjct  224   --LKNNDLRAYVAKFDHETLSRYATMRTHETVDLIERHAEALFGRPDLRVAADGSVGLAR  281

Query  375   DELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  259
             D+ I+I F+SLR LV+EA  FGS+LWDVES VD  Y  V
Sbjct  282   DDAIQIKFASLRALVMEAAAFGSYLWDVESYVDIHYRVV  320



>gb|AFK35334.1| unknown [Lotus japonicus]
Length=207

 Score =   261 bits (667),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 131/205 (64%), Positives = 156/205 (76%), Gaps = 3/205 (1%)
 Frame = -2

Query  864  MIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQ  688
            MI+NHL L+LG+R   +++V QI+K+R GQVYAASVMYGYFLKRV QRFQLEK +K+LP 
Sbjct  1    MIENHLGLLLGSRQGDSTAVAQISKIRAGQVYAASVMYGYFLKRVVQRFQLEKAIKILPN  60

Query  687  GLDKEDSGIQQVGGDssdtsl--rsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMS  514
              ++ +S    V             +  HPEV +WP  G+ S  FG     SRL TY+MS
Sbjct  61   AAEENNSHRTIVDDTRVSIEEFPSQAMPHPEVSAWPGSGISSGAFGQGTTVSRLHTYMMS  120

Query  513  FDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRL  334
            FDGETLQRYATIRSKE+++IIEKHTEALFGRP+  ITP+G I+SSKDE+IKISF  L+RL
Sbjct  121  FDGETLQRYATIRSKESVSIIEKHTEALFGRPDAVITPEGKINSSKDEIIKISFGGLKRL  180

Query  333  VLEAVTFGSFLWDVESSVDSRYHFV  259
            VLEAVTFGSFLWDVES VDSRYHFV
Sbjct  181  VLEAVTFGSFLWDVESYVDSRYHFV  205



>ref|XP_002965311.1| hypothetical protein SELMODRAFT_82738 [Selaginella moellendorffii]
 gb|EFJ34149.1| hypothetical protein SELMODRAFT_82738 [Selaginella moellendorffii]
Length=333

 Score =   263 bits (671),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 142/341 (42%), Positives = 219/341 (64%), Gaps = 17/341 (5%)
 Frame = -2

Query  1260  IAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDI  1081
             + P + ESPIGQFL  +L SHPHL   A +Q ++QL  D+N   +        ++S +++
Sbjct  2     VGPWEPESPIGQFLVSLLQSHPHLFLEAAEQHIQQLAADKNAAAEKST-----NSSDSEL  56

Query  1080  VLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDT-LPSKD  904
             VLY+RIAEVK  ER+KA+ E++Y+LVVQKF+D+ + LVP I  PS  ++  +D+   S  
Sbjct  57    VLYKRIAEVKEQERQKAVVEVIYSLVVQKFLDSRLALVPKI--PSLPANQKVDSNWQSVL  114

Query  903   EQLARLHSPEAYEMIQNHLSLILGNRS----NANSSVQINKLRVGQVYAASVMYGYFLKR  736
               +  +HS E  E++++HL +ILG  S       + VQ +K+++G +YAA+V++GYFL+R
Sbjct  115   GDMESIHSAEVLEVVRDHLGMILGRPSPHYQEPYTLVQASKMKIGHLYAATVVFGYFLRR  174

Query  735   VDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFG  556
             +DQR+QL+ +MK   + L  +    ++ G  +++ +           S   GG+G  G  
Sbjct  175   LDQRYQLDLSMK---KALSSDKHEDEEQGKLAAEANAAVQAMQAAKSSTTRGGLGGSGVF  231

Query  555   TEM--KPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDS  382
              ++  KPS+L++YVMS D E+LQR+AT+R KE+++++E+ T+ALFG+PE  I P G++  
Sbjct  232   PQLGWKPSKLKSYVMSLDPESLQRFATLRCKESLDVVERQTQALFGKPEAEIAPDGSVVL  291

Query  381   SKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  259
                +   IS S LRRLV EAV FGSFLWD E+ VDS Y+ V
Sbjct  292   LAGDSFTISLSGLRRLVTEAVVFGSFLWDAEAHVDSHYNLV  332



>ref|XP_002304357.2| hypothetical protein POPTR_0003s09600g [Populus trichocarpa]
 gb|EEE79336.2| hypothetical protein POPTR_0003s09600g [Populus trichocarpa]
Length=250

 Score =   251 bits (640),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 125/252 (50%), Positives = 178/252 (71%), Gaps = 8/252 (3%)
 Frame = -2

Query  1008  LVVQKFMDADVPLVPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGN  829
             ++V KF+D D+ ++P I SP+ + +G +D  P+++++L  +HSPEA+EMIQ+HLS++LG 
Sbjct  1     MIVHKFLDNDISMIPKI-SPTSDPTGRVDFWPNQEQKLESVHSPEAFEMIQSHLSIVLGE  59

Query  828   R--SNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQ  655
             R      ++VQI+K+++G++YAAS+MYGYFL+RVDQR+QLE+ M  LP+G D++ +  + 
Sbjct  60    RLVGPLETTVQISKIKLGKLYAASLMYGYFLRRVDQRYQLERAMNTLPKGFDEDRARFED  119

Query  654   VG-GDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATI  478
                 +            P+    PDG     G   E K  RLR+YVM  D ETLQRYATI
Sbjct  120   PSPANRLWDPDSLIRILPDSGE-PDGDFTDTG---EEKSYRLRSYVMYLDAETLQRYATI  175

Query  477   RSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLW  298
             RSKEAI++IEK T+ALFGRP+I I   G+I+++ DE++ I+FS L  LVLEAV FGSFLW
Sbjct  176   RSKEAISLIEKQTQALFGRPDIRIAGDGSIETANDEVVSITFSGLTMLVLEAVGFGSFLW  235

Query  297   DVESSVDSRYHF  262
             D ES V+S+YHF
Sbjct  236   DAESYVESKYHF  247



>ref|XP_004253444.1| PREDICTED: uncharacterized protein LOC101265814, partial [Solanum 
lycopersicum]
Length=273

 Score =   239 bits (611),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 129/274 (47%), Positives = 178/274 (65%), Gaps = 7/274 (3%)
 Frame = -2

Query  1068  RIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPSKDEQLAR  889
             RI+EV+  ERRK L EI+Y LVV +F++  + ++P I  P+ + +G ID  P+++E+L  
Sbjct  1     RISEVRDKERRKTLAEIIYCLVVHRFVEKGISMIPRI-KPTSDPAGRIDLWPNQEEKLEV  59

Query  888   LHSPEAYEMIQNHLSLILGNRSNA---NSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQ  718
             +HS +A+EMIQ+HLS +LG+       +S VQI K+++G++YAAS MYGYFL+RVDQR+Q
Sbjct  60    IHSADAFEMIQSHLSSVLGDGPAVGPLSSIVQIGKIKLGKLYAASAMYGYFLRRVDQRYQ  119

Query  717   LEKNMKVLPQGLDKEDSGIQQVGGDs-sdtslrsspSHPEVVSWPDGGMGSRGFGTEMKP  541
             LE+ M  LP+  +K     ++                 PE    PD     R    E   
Sbjct  120   LERTMNTLPKRPEKTRERFEEPSPPYPLWDPDSLIRIQPEEYD-PDEYAIQRN-EDESSS  177

Query  540   SRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIK  361
               LR+YV   D +TLQRYATIRSKEA+ +IEK T+ALFGRP+I I   G +D+S DE++ 
Sbjct  178   YGLRSYVTYLDSDTLQRYATIRSKEAMTLIEKQTQALFGRPDIRILEDGKLDTSNDEVLS  237

Query  360   ISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  259
             +S S L  LVLEAV FGSFLWD ES V+S+YHF+
Sbjct  238   LSLSGLAMLVLEAVAFGSFLWDSESYVESKYHFL  271



>ref|XP_010461665.1| PREDICTED: uncharacterized protein LOC104742360 [Camelina sativa]
Length=176

 Score =   231 bits (590),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 118/174 (68%), Positives = 138/174 (79%), Gaps = 7/174 (4%)
 Frame = -2

Query  759  MYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDs-------sdtslrsspSHPE  601
            MYGYFLKR+DQRFQLEK M++LP G  + ++ I+Q G ++       ++ + ++  S+ E
Sbjct  1    MYGYFLKRIDQRFQLEKTMRILPGGSYEGETSIEQAGRETERSFYEEAEETYQAVSSNQE  60

Query  600  VVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGR  421
            V S+  G   S GF +EM  SRL+TYVMSFDGETLQRYATIRS+EA+ IIEKHTEALFGR
Sbjct  61   VGSFVGGINASGGFSSEMNQSRLKTYVMSFDGETLQRYATIRSREAVGIIEKHTEALFGR  120

Query  420  PEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  259
            PEI ITPQGTIDSSKDE IKISF  LRRLVLEAVTFGSFLWDVES VDSRYHFV
Sbjct  121  PEILITPQGTIDSSKDEHIKISFKGLRRLVLEAVTFGSFLWDVESHVDSRYHFV  174



>gb|ACN34329.1| unknown [Zea mays]
Length=239

 Score =   214 bits (544),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 113/246 (46%), Positives = 165/246 (67%), Gaps = 11/246 (4%)
 Frame = -2

Query  990  MDADVPLVPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNR--SNA  817
            M+ D+ + PA+ SP       I  LP+++++L  +HS +A+EMIQNHL+LI+G +  S  
Sbjct  1    MENDIYMTPAL-SPGGGPVRDISALPNQEDKLRNIHSADAFEMIQNHLNLIMGEKIASPP  59

Query  816  NSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDss  637
            ++ V+I+ L +G++YAAS+MYGYFLKRVD+RFQLEK MK LP   +      QQ+  ++ 
Sbjct  60   DTVVEISNLNLGKLYAASIMYGYFLKRVDERFQLEKTMKTLPPKPN------QQIVFENL  113

Query  636  dtslrsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAIN  457
              +          ++ PDG   S     +  P++LR+YV   D +TLQRYATIRSKEA++
Sbjct  114  QPNPFWDMESLVQIT-PDGEEISLD-DEKSNPNKLRSYVSQLDADTLQRYATIRSKEAVS  171

Query  456  IIEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVD  277
            +IEK T+ALFGRP+I +   G++++    +I I+F+ L  LVLEAV FGSFLW+ ES V+
Sbjct  172  LIEKQTQALFGRPDIKVLDDGSVNAKDGRMITITFTELNHLVLEAVAFGSFLWEAESYVE  231

Query  276  SRYHFV  259
            S+YHFV
Sbjct  232  SKYHFV  237



>ref|XP_010908554.1| PREDICTED: uncharacterized protein LOC105034920 isoform X1 [Elaeis 
guineensis]
Length=408

 Score =   212 bits (539),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 132/345 (38%), Positives = 190/345 (55%), Gaps = 30/345 (9%)
 Frame = -2

Query  1281  SGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRN--LEKQNEKQND  1108
             SG  +MP+ P+   SP G+FL  IL + PH+  AA ++QLE+L  DRN    +       
Sbjct  82    SGSVSMPLEPV---SPEGRFLCGILKNQPHIFPAAAERQLEELANDRNGAFIRWAHSMGS  138

Query  1107  EPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGS  928
             E S       L+R+IAE+K  E R A+EE++Y L+V KF +  VP+VP ++   + +   
Sbjct  139   EES------YLHRKIAEMKDCECRIAVEEVMYMLIVAKFYEIKVPMVPNLSKCIKYAR--  190

Query  927   IDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNAN-----SSVQINKLRVGQVYAAS  763
             +D   S+D +L  +H PE  EM++ HLS IL  R   N     S + I ++++G++YAAS
Sbjct  191   LDMSSSQDAELESIHDPEILEMVREHLSNILKWRGKVNLIENSSMIHIKRVQLGRIYAAS  250

Query  762   VMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPD  583
             +MYGYF+K V  R QLE     L      ED  + Q+         +         S+  
Sbjct  251   IMYGYFIKSVSLRHQLE-----LSLARTDEDLPLGQLMNSELFKKEQEENLVALGCSFDM  305

Query  582   GGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISIT  403
                    +    +  +LR+Y+M FD ETLQ  A +RS+EA+N+IEKH+ ALF   E S  
Sbjct  306   ASSLHPSYDRRRRVEKLRSYMMGFDSETLQICAKLRSQEAVNLIEKHSYALFEDREKST-  364

Query  402   PQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRY  268
                    + D  I +++S+ +RLVLEAV FGSFLWDVE  VDS Y
Sbjct  365   ------QTNDGNIIVTYSAFKRLVLEAVAFGSFLWDVERYVDSIY  403



>ref|XP_010908555.1| PREDICTED: uncharacterized protein LOC105034920 isoform X2 [Elaeis 
guineensis]
Length=351

 Score =   209 bits (533),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 132/345 (38%), Positives = 189/345 (55%), Gaps = 30/345 (9%)
 Frame = -2

Query  1281  SGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRN--LEKQNEKQND  1108
             SG  +MP+ P+   SP G+FL  IL + PH+  AA ++QLE+L  DRN    +       
Sbjct  25    SGSVSMPLEPV---SPEGRFLCGILKNQPHIFPAAAERQLEELANDRNGAFIRWAHSMGS  81

Query  1107  EPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGS  928
             E S       L+R+IAE+K  E R A+EE++Y L+V KF +  VP+VP ++   +     
Sbjct  82    EES------YLHRKIAEMKDCECRIAVEEVMYMLIVAKFYEIKVPMVPNLSKCIK--YAR  133

Query  927   IDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNAN-----SSVQINKLRVGQVYAAS  763
             +D   S+D +L  +H PE  EM++ HLS IL  R   N     S + I ++++G++YAAS
Sbjct  134   LDMSSSQDAELESIHDPEILEMVREHLSNILKWRGKVNLIENSSMIHIKRVQLGRIYAAS  193

Query  762   VMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPD  583
             +MYGYF+K V  R QLE     L      ED  + Q+         +         S+  
Sbjct  194   IMYGYFIKSVSLRHQLE-----LSLARTDEDLPLGQLMNSELFKKEQEENLVALGCSFDM  248

Query  582   GGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISIT  403
                    +    +  +LR+Y+M FD ETLQ  A +RS+EA+N+IEKH+ ALF   E S  
Sbjct  249   ASSLHPSYDRRRRVEKLRSYMMGFDSETLQICAKLRSQEAVNLIEKHSYALFEDREKST-  307

Query  402   PQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRY  268
                    + D  I +++S+ +RLVLEAV FGSFLWDVE  VDS Y
Sbjct  308   ------QTNDGNIIVTYSAFKRLVLEAVAFGSFLWDVERYVDSIY  346



>ref|XP_010247844.1| PREDICTED: uncharacterized protein LOC104590798 [Nelumbo nucifera]
Length=415

 Score =   211 bits (536),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 135/342 (39%), Positives = 201/342 (59%), Gaps = 35/342 (10%)
 Frame = -2

Query  1254  PLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRN--LEKQNEKQNDEPSASGTDI  1081
             PL+L S  G+FL+ IL +  HL + AV +QL++L  DR+  + + N       S   ++ 
Sbjct  91    PLELTSSAGKFLSDILQNQRHLFNVAVKEQLDELAFDRDGAVGRMN------LSVGSSES  144

Query  1080  VLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPSKDE  901
              L+RRIAE+K    + A+E+++Y LVV +F   +VP+VP ++   +N  G +   PSKD+
Sbjct  145   CLHRRIAELKECVCQIAIEDVMYMLVVHQFSKVEVPMVPRLSRCVRN--GKLAVWPSKDK  202

Query  900   QLARLHSPEAYEMIQNHLSLILGNRSNAN-----SSVQINKLRVGQVYAASVMYGYFLKR  736
             +   +HS E  EM++ H+  I+G R   N     ++ QI+KL++G+VYAAS++YGYFLK 
Sbjct  203   EFEAIHSDELLEMVREHVRTIIGWRGRFNMTDNWTTTQIHKLQLGRVYAASILYGYFLKS  262

Query  735   VDQRFQLEKNMKV----LP--QGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGM  574
                R +LE ++ +    LP  +G+    + +Q  G +      RS     E +S     +
Sbjct  263   AYLRHRLELSLSLTHLDLPIGRGIRIPVTELQLHGSEDHVLFGRS----AETIS---TSL  315

Query  573   GSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQG  394
               R      +   L++YVM FD ETLQR A ++S+EA+N+IEKH+ ALFG          
Sbjct  316   YQRLGRHVDRHENLKSYVMKFDPETLQRCARLKSREAVNLIEKHSWALFG-------DGN  368

Query  393   TIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRY  268
             T    KDE+I ++FSSL+RLVLEAV FGSFLWD E  VDS Y
Sbjct  369   TSSLEKDEVIVVTFSSLKRLVLEAVAFGSFLWDAERFVDSVY  410



>ref|XP_007049654.1| F21O3.2 protein [Theobroma cacao]
 gb|EOX93811.1| F21O3.2 protein [Theobroma cacao]
Length=403

 Score =   209 bits (533),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 136/388 (35%), Positives = 206/388 (53%), Gaps = 60/388 (15%)
 Frame = -2

Query  1359  VKLGNRRVAFGSTKCNSIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSA  1180
             ++ G     F   K  S++AS   S+   S++  APL+  S  G+FL+ +L +       
Sbjct  47    LRTGFTSTPFNDRKVPSVKASAGPSHCDFSSLN-APLEPRSAPGKFLSSVLQNQRQFFHF  105

Query  1179  AVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEEILYALVV  1000
             A   +L+QL  DR+            S++  +  L+RRIA++K +  + A+E+++Y L+ 
Sbjct  106   AAADELKQLAGDRDAAVARMFL----SSASDEACLHRRIAQLKEHYCQAAVEDVMYMLIF  161

Query  999   QKFMDADVPLVPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSN  820
              KF +  VPLVP ++    N  G ++  PSKD +L  +HS E  EM++ H+S ++G R+N
Sbjct  162   YKFSEIRVPLVPKLSRCIYN--GRLEIWPSKDWELESIHSIEVLEMVREHVSTVIGLRAN  219

Query  819   AN-----SSVQINKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQ  655
             ++     ++ +I +L++G+VYAAS++YGYFLK    R+ LEK + +  Q    + + +Q 
Sbjct  220   SSVTDNWATTEIQRLQLGRVYAASILYGYFLKSASSRYHLEKCLALAHQDRLSQRNSLQ-  278

Query  654   VGGDssdtslrsspSHPEVVSWPD---GGMGSRGFG----------------TEMKPSRL  532
                                  +PD    G  S  FG                 E     L
Sbjct  279   ---------------------FPDLLPCGFKSLVFGHVRDMQSVSLGQGPGRQEKNLEEL  317

Query  531   RTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKISF  352
             R YVM FD ETLQR A ++SKEA+N+IEKH+ ALFG  +  +   G       E+I  SF
Sbjct  318   RCYVMGFDPETLQRCAKVKSKEAVNLIEKHSCALFGDEKTGVLETG-------EVILTSF  370

Query  351   SSLRRLVLEAVTFGSFLWDVESSVDSRY  268
             SSL+RLVLEAV FGSFLWD+E  VD+ Y
Sbjct  371   SSLKRLVLEAVAFGSFLWDIEEYVDTVY  398



>ref|XP_010274079.1| PREDICTED: uncharacterized protein LOC104609452 [Nelumbo nucifera]
Length=414

 Score =   209 bits (531),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 129/340 (38%), Positives = 199/340 (59%), Gaps = 31/340 (9%)
 Frame = -2

Query  1254  PLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVL  1075
             P +  S  G+FL+ +L +  HL + AV + L++L   R+          + S   ++  L
Sbjct  90    PFEPCSSAGKFLSGVLQNQRHLFNVAVAETLDELAAGRD----GATARRDLSIGSSESCL  145

Query  1074  YRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPSKDEQL  895
             +RRIAE+K  E + A+E+++Y LVV KF + +VP++P ++   +N  G ++  PSKD+ L
Sbjct  146   HRRIAELKEFECQIAVEDVMYMLVVHKFSEINVPMIPRLSRCVRN--GKLEVWPSKDQDL  203

Query  894   ARLHSPEAYEMIQNHLSLILGNRSNAN-----SSVQINKLRVGQVYAASVMYGYFLKRVD  730
               +HS E  EM++ H+  I+G R  +      S+ QI+KL++G+VYAASVMYGYFLK   
Sbjct  204   EAIHSLEVVEMVKEHVGTIIGWRGKSRLTDNWSTTQIHKLQLGRVYAASVMYGYFLKSAS  263

Query  729   QRFQLEKNMKV------LPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGS  568
              + +LE ++ +      L  G+    + +Q  G ++     RS+ +    +     G G 
Sbjct  264   LKHRLELSLALTHQDLPLGHGIRIPVTELQLHGLENLVVLGRSTETRSTSLC---QGTGR  320

Query  567   RGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTI  388
             R  G +    +LR+YVM FD ETLQR A ++S+EA N+IEKH+ ALFG          T 
Sbjct  321   RVDGHK----KLRSYVMGFDSETLQRCAKLKSQEAANLIEKHSWALFG-------DGNTS  369

Query  387   DSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRY  268
                 D+++ ++FSSL+RLVLEA+ FGSFLWDVE+ VD  Y
Sbjct  370   SLENDKVLVVTFSSLKRLVLEAIAFGSFLWDVETYVDRVY  409



>ref|XP_010069618.1| PREDICTED: uncharacterized protein LOC104456510 [Eucalyptus grandis]
 gb|KCW58026.1| hypothetical protein EUGRSUZ_H00754 [Eucalyptus grandis]
Length=389

 Score =   208 bits (529),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 128/350 (37%), Positives = 194/350 (55%), Gaps = 54/350 (15%)
 Frame = -2

Query  1254  PLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVL  1075
             PL  +S  G++LT++L +   L  AAV ++L+QL  DR+            SA   +  L
Sbjct  68    PLVPKSAAGRYLTRVLQNQRQLFHAAVAEELKQLADDRDAAVSRVLL----SAGSDEACL  123

Query  1074  YRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPSKDEQL  895
             +RRIAE+K  +R+ A+++++Y L++ KF +  V LVP ++    N  G ++  P+KD +L
Sbjct  124   HRRIAEIKERDRQVAIKDVMYMLILYKFSEIRVHLVPKLSRCIYN--GRLEIWPAKDWEL  181

Query  894   ARLHSPEAYEMIQNHLSLILGNRSNAN-----SSVQINKLRVGQVYAASVMYGYFLKRVD  730
               +H  +  EMI+ H++ ++G R +++     ++  I +L++GQ+YAASV+YGYFLK   
Sbjct  182   ESIHGIDVLEMIKEHVAAVIGLRVDSSVTDNWATTHIQRLQLGQLYAASVLYGYFLKSAS  241

Query  729   QRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDG----------  580
              R  LE ++ + PQG                      +  HP  + WP G          
Sbjct  242   LRHHLECSLALSPQG----------------HRVFHRNSLHPPKI-WPHGWNNLVCGRVS  284

Query  579   ------GMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRP  418
                   G  S   G   K   LR YVM FD ETLQR A +RS+EA+++IEKH+ ALFG  
Sbjct  285   NDKLSLGQASIQDGNHGK---LRCYVMGFDPETLQRCAKVRSREAMDLIEKHSCALFGDG  341

Query  417   EISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRY  268
             ++ +        + D++I  SFSSL+RLVLEA+ FGSFLWDVE  VD+ Y
Sbjct  342   KMGLI-------TSDDVILTSFSSLKRLVLEAIAFGSFLWDVEEHVDTVY  384



>gb|KJB42555.1| hypothetical protein B456_007G157400 [Gossypium raimondii]
Length=398

 Score =   207 bits (528),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 134/369 (36%), Positives = 205/369 (56%), Gaps = 22/369 (6%)
 Frame = -2

Query  1359  VKLGNRRVAFGSTKCNSIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSA  1180
             ++ G     F   K  S++AS   S+   S++  APL+ +S  G+FL+ +L +       
Sbjct  42    LRTGFTSTPFNGRKAPSVKASAGASHCDFSSLN-APLEPKSAPGKFLSGVLQNQRQFFHF  100

Query  1179  AVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEEILYALVV  1000
             A   +L++L  DR+            S    +  L+RRIA++K  E + A+E+++Y L+ 
Sbjct  101   AAADELKRLSDDRDAAVARMFV----SLDSDEACLHRRIAQLKEQECQAAVEDVMYMLIF  156

Query  999   QKFMDADVPLVPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSN  820
              KF D  VPLVP ++    N    ++  PSKD +L  +HS E  E++++H+S ++G R++
Sbjct  157   YKFSDLRVPLVPKLSRCMYNCR--LEIWPSKDWELESIHSIEVLEVVRDHISAVIGLRAD  214

Query  819   AN-----SSVQINKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQ  655
             ++     ++ +I +L +G++YAAS++YGYFLK    R QLE+ + ++ Q      + +Q 
Sbjct  215   SSVTDNWATTEIQQLHLGRLYAASILYGYFLKSASSRHQLERCLTLVHQKRLNHRNSLQF  274

Query  654   VGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIR  475
             +                +V S P G    R    E     LR YVM FD ETLQR A  R
Sbjct  275   LDLLPCGIKSLVLGRFSDVQSVPLGQGPGR---QEKDLEELRCYVMGFDPETLQRCAKPR  331

Query  474   SKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWD  295
             SKEA ++IE+H+ ALFG  +  I PQ       DE+I+ SFSSL+RLVLEAV FGSFLWD
Sbjct  332   SKEAAHLIERHSCALFGDEQTGI-PQ------TDEVIRTSFSSLKRLVLEAVAFGSFLWD  384

Query  294   VESSVDSRY  268
             +E  VD+ Y
Sbjct  385   IEEYVDTVY  393



>ref|XP_006484801.1| PREDICTED: uncharacterized protein LOC102613099 [Citrus sinensis]
Length=390

 Score =   206 bits (525),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 127/339 (37%), Positives = 194/339 (57%), Gaps = 29/339 (9%)
 Frame = -2

Query  1254  PLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDI-V  1078
             PL+  SP G+FL+++L +     + AV  +L+ L  DR+             +SG+D   
Sbjct  66    PLEPNSPAGKFLSRVLQNQRQYFNLAVSDELKLLANDRDAAVARMSL-----SSGSDEGP  120

Query  1077  LYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPSKDEQ  898
             L+RRIA++K +E + A+E+++Y L++ KF +  V LVP ++    N  G ++  PSKD +
Sbjct  121   LHRRIAQLKEHECQTAVEDVMYMLILYKFSEIRVQLVPKLSRCIYN--GRLEIWPSKDWE  178

Query  897   LARLHSPEAYEMIQNHLSLILGNRSNAN-----SSVQINKLRVGQVYAASVMYGYFLKRV  733
             L  +H  E  EMI+ H+S ++G R+N +     ++ +I +LR+G+VY AS++YGYFLK  
Sbjct  179   LESIHEFEVLEMIREHISTVIGLRANCSVTDSWATTEIQRLRLGRVYVASILYGYFLKSA  238

Query  732   DQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDG----GMGSR  565
               R+ LE+ +    Q L        Q        +        +VV   +      +G  
Sbjct  239   SLRYYLEECLASAHQDLHLTHRNSLQF-----PEAWSYGLKQNQVVGCVNNMQSISLGRG  293

Query  564   GFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTID  385
               G E+K  +L+ YVM FD ETLQR A +RS+EA+N++EKH+ ALFG  +      G +D
Sbjct  294   TNGHELKQEKLKCYVMGFDPETLQRCAKLRSREAVNLVEKHSCALFGDGQT-----GLLD  348

Query  384   SSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRY  268
             +  DE+I  SFSSL+RLVLEA+ FGSFLWD E   D+ Y
Sbjct  349   T--DEVILTSFSSLKRLVLEAIAFGSFLWDAEEYADAVY  385



>ref|XP_006437252.1| hypothetical protein CICLE_v10031774mg [Citrus clementina]
 gb|ESR50492.1| hypothetical protein CICLE_v10031774mg [Citrus clementina]
Length=390

 Score =   206 bits (525),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 127/339 (37%), Positives = 194/339 (57%), Gaps = 29/339 (9%)
 Frame = -2

Query  1254  PLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDI-V  1078
             PL+  SP G+FL+++L +     + AV  +L+ L  DR+             +SG+D   
Sbjct  66    PLEPNSPAGKFLSRVLQNQRQYFNLAVSDELKLLANDRDAAVARMSL-----SSGSDEGP  120

Query  1077  LYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPSKDEQ  898
             L+RRIA++K +E + A+E+++Y L++ KF +  V LVP ++    N  G ++  PSKD +
Sbjct  121   LHRRIAQLKEHECQTAVEDVMYMLILYKFSEIRVQLVPKLSRCIYN--GRLEIWPSKDWE  178

Query  897   LARLHSPEAYEMIQNHLSLILGNRSNAN-----SSVQINKLRVGQVYAASVMYGYFLKRV  733
             L  +H  E  EMI+ H+S ++G R+N +     ++ +I +LR+G+VY AS++YGYFLK  
Sbjct  179   LESIHEFEVLEMIREHISTVIGLRANCSVTDSWATTEIQRLRLGRVYVASILYGYFLKSA  238

Query  732   DQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDG----GMGSR  565
               R+ LE+ +    Q L        Q        +        +VV   +      +G  
Sbjct  239   SLRYYLEECLASAHQDLHLTHRNSLQF-----PEAWSYGLKQNQVVGCVNNTQSISLGRG  293

Query  564   GFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTID  385
               G E+K  +L+ YVM FD ETLQR A +RS+EA+N++EKH+ ALFG  +      G +D
Sbjct  294   TNGHELKQEKLKCYVMGFDPETLQRCAKLRSREAVNLVEKHSCALFGDGQT-----GLLD  348

Query  384   SSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRY  268
             +  DE+I  SFSSL+RLVLEA+ FGSFLWD E   D+ Y
Sbjct  349   T--DEVILTSFSSLKRLVLEAIAFGSFLWDAEEYADAVY  385



>ref|XP_011018702.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC105121674 
[Populus euphratica]
Length=255

 Score =   201 bits (512),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 110/263 (42%), Positives = 168/263 (64%), Gaps = 18/263 (7%)
 Frame = -2

Query  1032  ALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQN  853
             A +EI+Y+++VQK +D  + ++P I  P+ + +G +   P+++++L         EMIQ+
Sbjct  4     AAKEIIYSMIVQKILDVVISMIPXIL-PTSDPTGRVGFWPNQEQKL---------EMIQS  53

Query  852   HLSLILGNR--SNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLD  679
             HLS++LG R      + V+I+K+++ +++AAS++YGYFL+RVDQR+QLE+ M  LP+G D
Sbjct  54    HLSIVLGVRLVCPLETIVEISKVKLXKLFAASILYGYFLRRVDQRYQLERTMNTLPKGFD  113

Query  678   KEDSGIQQVG-GDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGE  502
             K+ +  + +                P     PDGG    G   E K  RLR+YVM+   E
Sbjct  114   KDRAWFEDLSPAKPLWGPESLIRIVPGDSGCPDGGSXDTG---EEKSYRLRSYVMNLYVE  170

Query  501   TLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEA  322
             TL+RYAT+RSKEAI++ EK  +AL GRP+I I   G+I+++ DE++ I+FS L   VLEA
Sbjct  171   TLERYATLRSKEAISLNEKQAKALSGRPDIRIAENGSIETANDEVVSITFSGLAMPVLEA  230

Query  321   V--TFGSFLWDVESSVDSRYHFV  259
             V   FGSF WD ES V+S+YH +
Sbjct  231   VAFAFGSFPWDAESDVESKYHVL  253



>gb|KHG02769.1| Phosphoserine aminotransferase [Gossypium arboreum]
Length=403

 Score =   206 bits (524),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 133/369 (36%), Positives = 204/369 (55%), Gaps = 22/369 (6%)
 Frame = -2

Query  1359  VKLGNRRVAFGSTKCNSIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSA  1180
             ++ G     F   K  S++AS   S+   S++  APL+  S  G+FL+ +L +       
Sbjct  47    LRTGFTSTPFNGRKAPSVKASAGASHCDFSSLN-APLEPRSAPGKFLSGVLQNQRQFFHF  105

Query  1179  AVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEEILYALVV  1000
             A   +L++L  DR+            S    +  L+RRIA++K  E + A+E+++Y L+ 
Sbjct  106   AAADELKRLSDDRDAAVSRMFV----SLDSDEACLHRRIAQLKEQECQAAVEDVMYMLIF  161

Query  999   QKFMDADVPLVPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSN  820
              KF D  VPLVP ++    N    ++  PSKD +L  +HS E  E++++H+S ++G R++
Sbjct  162   YKFSDLRVPLVPKLSRCMYNCR--LEIWPSKDWELESIHSIEVLEVVRDHISAVIGLRAD  219

Query  819   AN-----SSVQINKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQ  655
             ++     ++ +I +L +G++YAAS++YGYFLK    R QLE+ + ++ Q      + +Q 
Sbjct  220   SSVTDNWATTEIQQLHLGRLYAASILYGYFLKSASSRHQLERCLTLVHQKRLNHRNSLQF  279

Query  654   VGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIR  475
             +                +V S P G    R    E     LR YVM FD ETLQR A  R
Sbjct  280   LDLLPCGIKSLVLGRFSDVQSVPLGQGPGR---QEKDLEELRCYVMGFDPETLQRCAKPR  336

Query  474   SKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWD  295
             SKEA ++IE+H+ ALFG  +  I P+       DE+I+ SFSSL+RLVLEAV FGSFLWD
Sbjct  337   SKEAAHLIERHSCALFGDEQTGI-PE------TDEVIRTSFSSLKRLVLEAVAFGSFLWD  389

Query  294   VESSVDSRY  268
             +E  VD+ Y
Sbjct  390   IEEYVDTVY  398



>gb|KDO46601.1| hypothetical protein CISIN_1g015579mg [Citrus sinensis]
Length=390

 Score =   205 bits (522),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 127/339 (37%), Positives = 193/339 (57%), Gaps = 29/339 (9%)
 Frame = -2

Query  1254  PLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDI-V  1078
             PL+  SP G+FL+++L +     + AV  +L+ L  DR+             +SG+D   
Sbjct  66    PLEPNSPAGKFLSRVLQNQRQYFNLAVSDELKLLANDRDAAVARMSL-----SSGSDEGP  120

Query  1077  LYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPSKDEQ  898
             L+RRIA++K +E + A+E+++Y L++ KF +  V LVP ++    N  G ++  PSKD +
Sbjct  121   LHRRIAQLKEHECQTAVEDVMYMLILYKFSEIRVQLVPKLSRCIYN--GRLEIWPSKDWE  178

Query  897   LARLHSPEAYEMIQNHLSLILGNRSNAN-----SSVQINKLRVGQVYAASVMYGYFLKRV  733
             L  +H  E  EMI+ H+S ++G R+N +     ++ +I +LR+G+VY AS++YGYFLK  
Sbjct  179   LESIHEFEVLEMIREHISTVIGLRANCSVTDSWATTEIQRLRLGRVYVASILYGYFLKSA  238

Query  732   DQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDG----GMGSR  565
               R+ LE+ +    Q L        Q        +        +VV   +      +G  
Sbjct  239   SLRYYLEECLASAHQDLHLTHRNSLQF-----PEAWSYGLKQNQVVGCVNNTQSISLGRG  293

Query  564   GFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTID  385
               G E+K   L+ YVM FD ETLQR A +RS+EA+N++EKH+ ALFG  +      G +D
Sbjct  294   TNGHELKQENLKCYVMGFDPETLQRCAKLRSREAVNLVEKHSCALFGDGQT-----GLLD  348

Query  384   SSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRY  268
             +  DE+I  SFSSL+RLVLEA+ FGSFLWD E   D+ Y
Sbjct  349   T--DEVILTSFSSLKRLVLEAIAFGSFLWDAEEYADAVY  385



>ref|XP_008776305.1| PREDICTED: uncharacterized protein LOC103696450 [Phoenix dactylifera]
Length=408

 Score =   205 bits (521),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 130/345 (38%), Positives = 185/345 (54%), Gaps = 30/345 (9%)
 Frame = -2

Query  1281  SGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRN--LEKQNEKQND  1108
             SG  +MP+ P+   SP G+FL  IL + PH+   A  +QLE+L  DRN    +       
Sbjct  82    SGSVSMPLEPV---SPEGRFLCGILKNQPHIFPVAAARQLEELANDRNGAFVRWAHSMGS  138

Query  1107  EPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGS  928
             E S       L+R+IAE+K  E R A+EE++Y L+V KF +  VP+VP ++   +     
Sbjct  139   EES------YLHRKIAEMKDCECRIAVEEVMYMLIVAKFYEIKVPMVPNLSECIK--YAR  190

Query  927   IDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNAN-----SSVQINKLRVGQVYAAS  763
             +D   SKD +L  +H  E  EM++ HLS IL  +   N     S + I ++++G++YAAS
Sbjct  191   LDMSSSKDAELESIHDSEILEMVREHLSNILKWKGKINLMENSSMIHIKRVQLGRIYAAS  250

Query  762   VMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPD  583
             +MYGYF+K V  R QLE     L      ED  + Q+         +         S+  
Sbjct  251   IMYGYFIKSVSLRHQLE-----LSLARTDEDLPLGQLMNSELFKKEQEENLVALGCSFDM  305

Query  582   GGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISIT  403
                    +    +  +LR+Y+M FD ETLQ  A +RS+EAIN+IEKH+ ALF   + S  
Sbjct  306   ASSLHPSYDRRRRVEKLRSYMMGFDSETLQICAKLRSREAINLIEKHSYALFEDRQKSTQ  365

Query  402   PQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRY  268
                      D  I +++S+ +RLVLEAV FGSFLWDVE  VDS Y
Sbjct  366   KN-------DGNIIVTYSAFKRLVLEAVAFGSFLWDVEKYVDSIY  403



>ref|XP_006848511.1| PREDICTED: uncharacterized protein LOC18438261 [Amborella trichopoda]
 gb|ERN10092.1| hypothetical protein AMTR_s00013p00260550 [Amborella trichopoda]
Length=424

 Score =   205 bits (521),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 141/408 (35%), Positives = 223/408 (55%), Gaps = 52/408 (13%)
 Frame = -2

Query  1434  RRFTTDAPGFVKFGSKALLSAPSIKVKLGNRRV----AFGSTKCNSIRASLPLSNSGGSA  1267
             R F  +  G VKF +       + K K G  R+    + GS KC++ +            
Sbjct  44    RSFEANFRGSVKFNNVGPFGVDT-KNKNGKARLGPVASAGSGKCHTRKV-----------  91

Query  1266  MPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRN--LEKQNEKQNDEPSAS  1093
                +P++ +S  G+ L+ IL  H HL + AV +Q+E+L  DR   + +Q     +E S  
Sbjct  92    --FSPMEPQSEEGKLLSHILQYHRHLFNGAVSEQIEKLSADRAGAIARQELCVGNEES--  147

Query  1092  GTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLP  913
                 +L+RR+AE++  E + A+EE++Y L+V KF + +VP+VP ++   +N  G  DT  
Sbjct  148   ----LLHRRVAELREKECQVAIEEVMYMLIVHKFSEINVPMVPRLSKCIKN--GKADTWS  201

Query  912   SKDEQLARLHSPEAYEMIQNHLSLILGNRSNA----NSSVQ--INKLRVGQVYAASVMYG  751
               D +L  +H  EA  M+++HL+ ILG RS++    NS V   I +L++G++YA+SVMYG
Sbjct  202   CHDSELEAIHDWEARIMVKDHLNKILGRRSDSSYTLNSCVMTLIGRLQLGKLYASSVMYG  261

Query  750   YFLKRVDQRFQLEKNMKV-----LPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWP  586
             YFL+   +R+ LEK++ V     L QG+   DSG   +  ++           P  V+  
Sbjct  262   YFLESACRRYHLEKSLHVRSDHPLFQGITLPDSGCWHLTPETLI---------PLGVTEE  312

Query  585   DGGMGSRGFGTEM--KPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEI  412
                     + ++   +   L+ Y+  F+ ET QR A +RSKEA+N++EKH+ ALF   E 
Sbjct  313   QETCCGDTYSSKTIDELDSLKRYITGFNAETFQRCAALRSKEAVNLVEKHSWALF--GEC  370

Query  411   SITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRY  268
                 +  +   +DE++ IS SSL+RLVLEAV FG FL++VE+ VD  Y
Sbjct  371   EEEGEEGMGEEQDEVLLISISSLKRLVLEAVAFGLFLYNVEAYVDPIY  418



>ref|XP_002303068.2| hypothetical protein POPTR_0002s24910g [Populus trichocarpa]
 gb|EEE82341.2| hypothetical protein POPTR_0002s24910g [Populus trichocarpa]
Length=407

 Score =   202 bits (514),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 131/351 (37%), Positives = 197/351 (56%), Gaps = 53/351 (15%)
 Frame = -2

Query  1254  PLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTD-IV  1078
             PL+L S  G+FL+ +  +   L   AV  +L+ L  DR+        +    +SG+D   
Sbjct  83    PLELRSAAGKFLSGVFQNQKQLFHVAVADELKLLADDRD-----SALSRMVRSSGSDEAS  137

Query  1077  LYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPSKDEQ  898
             L+RRIAE+K +E + A+E+++Y LV+ KF +  VPLVP ++    N  G ++  PSKD +
Sbjct  138   LHRRIAELKEHECQVAVEDVMYMLVLYKFSEIRVPLVPKLSRCIYN--GRLEIRPSKDWE  195

Query  897   LARLHSPEAYEMIQNHLSLILGNRSNAN-----SSVQINKLRVGQVYAASVMYGYFLKRV  733
             L  +HS E  EM++ H+S ++G ++N++     ++ ++ + R+G+VYAAS++YGYFLK  
Sbjct  196   LESIHSFEVLEMVREHVSTVIGLKANSSVADSWATTEVQRCRLGRVYAASILYGYFLKSA  255

Query  732   DQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGT  553
               R  LE  + VLP     +D  +            RS+   PE  S P  G+ +  FG 
Sbjct  256   SLRHHLEWCL-VLPH----QDIHLGH----------RSTLQFPE--SLPSYGLTNLVFGH  298

Query  552   ----------------EMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGR  421
                             + +  +L+ Y+M FD ETLQR A ++SKEA+N+IEKH+ ALFG 
Sbjct  299   ISNKQSTSQGTRLNRPKSEHEKLKCYMMGFDSETLQRCAKLKSKEAVNLIEKHSCALFGD  358

Query  420   PEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRY  268
              +  +          DE+I  SFSSL+RLVLEAV FG FLWD E  V+S Y
Sbjct  359   EKTGVLEN-------DEVILTSFSSLKRLVLEAVAFGCFLWDTEEDVNSVY  402



>ref|XP_002531072.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF31286.1| conserved hypothetical protein [Ricinus communis]
Length=408

 Score =   201 bits (511),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 125/337 (37%), Positives = 190/337 (56%), Gaps = 26/337 (8%)
 Frame = -2

Query  1254  PLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQN---EKQNDEPSASGTD  1084
             PL+  S  G+FL+ +  +   L   AV  +L+ L   R+          ++DE S     
Sbjct  85    PLEPSSAAGKFLSSVFQNQRQLFHVAVADELKLLADARDDAVSRMFLSSRSDEAS-----  139

Query  1083  IVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPSKD  904
               L+RRIA++K +E + A+E+++Y L+  KF +  VPLVP ++    N  G ++  PSKD
Sbjct  140   --LHRRIAQLKEHECQIAVEDVMYMLIFSKFSEIRVPLVPKLSRCIYN--GRLEIGPSKD  195

Query  903   EQLARLHSPEAYEMIQNHLSLILGNRSNAN-----SSVQINKLRVGQVYAASVMYGYFLK  739
              +L  +HS E  EMI+ H+  ++G R+N++     ++ +I +L++G+VYAASV+YGYFLK
Sbjct  196   WELESIHSFEVLEMIKEHVCTVIGLRANSSVTDSWATTEIQRLQLGRVYAASVLYGYFLK  255

Query  738   RVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGF  559
                 R  LE+ + V    +      ++Q     S            + +   G  G    
Sbjct  256   SASLRHYLEQCIAVSHHNVHLSCRTVRQYPESISHGLTNIVFR--RISNMQSGSAGQGSI  313

Query  558   GTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSS  379
               + +  +LR YVM FD ETLQR A ++SKEA+N+IEKH+ ALFG         G++++ 
Sbjct  314   KQDWQRGKLRCYVMGFDAETLQRCAKLKSKEAMNLIEKHSSALFGNDNT-----GSLEN-  367

Query  378   KDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRY  268
              DE+I  SFSSL+RLVLEAV FGSFLWD E  V+S +
Sbjct  368   -DEVILTSFSSLKRLVLEAVAFGSFLWDTEEYVNSIF  403



>ref|XP_012085283.1| PREDICTED: uncharacterized protein LOC105644513 [Jatropha curcas]
 gb|KDP45280.1| hypothetical protein JCGZ_15145 [Jatropha curcas]
Length=400

 Score =   200 bits (509),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 138/389 (35%), Positives = 206/389 (53%), Gaps = 43/389 (11%)
 Frame = -2

Query  1374  APSIKVKLGNRRVAFGSTKCN--------------SIRASLPLSNSGGSAMPIAPLKLES  1237
             +P + VK  +RR+   ST  N              S       SNS     P+ P    S
Sbjct  30    SPRLTVKFADRRLISTSTCLNWKVRPAVVVVARAGSSHCEPSSSNSFSLNTPLEP---RS  86

Query  1236  PIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTD-IVLYRRIA  1060
               G+FL+ +  +   L   AV ++L+ L  DR+        +    +SG+D   L+RRIA
Sbjct  87    AAGKFLSSVFQNQRQLFHVAVAEELKLLADDRD-----GAVSRMLLSSGSDEASLHRRIA  141

Query  1059  EVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPSKDEQLARLHS  880
             ++K  E + A+E+++Y L+  KF +  VPLVP ++    N  G ++  PSKD +L  +HS
Sbjct  142   QLKEQECQIAVEDVMYMLIFSKFSEIRVPLVPKLSRCIYN--GRLEIGPSKDWELESIHS  199

Query  879   PEAYEMIQNHLSLILGNRSNAN-----SSVQINKLRVGQVYAASVMYGYFLKRVDQRFQL  715
              E  EMI+ H+S ++G R+N++     ++ +I +L++G++Y AS++YGYFLK    R  L
Sbjct  200   FEVLEMIREHVSTVIGLRANSSVTDTWATTEIQRLQLGRLYVASILYGYFLKSASLRHYL  259

Query  714   EKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPSR  535
             E  + V    +        Q+   S          H  V S      G +    + K   
Sbjct  260   ELCLAVPHHDVHLSRRTSLQLPESSPYRISNLVFGHQSVSS------GQKSRKQDQKRGN  313

Query  534   LRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKIS  355
             LR YVM FD ETLQR A ++SKEA+N+IEKH+ ALFG  +      G +++  DE+I  S
Sbjct  314   LRCYVMGFDAETLQRCAKLKSKEAVNLIEKHSCALFGDDK-----AGLLEN--DEVILTS  366

Query  354   FSSLRRLVLEAVTFGSFLWDVESSVDSRY  268
             FSSL+RL+LEAV FGSFLWD E  V+S +
Sbjct  367   FSSLKRLILEAVAFGSFLWDTEEYVNSVF  395



>gb|KDO46600.1| hypothetical protein CISIN_1g015579mg [Citrus sinensis]
Length=404

 Score =   199 bits (506),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 126/349 (36%), Positives = 193/349 (55%), Gaps = 35/349 (10%)
 Frame = -2

Query  1254  PLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLE----KQNEKQNDEP-----  1102
             PL+  SP G+FL+++L +     + AV  +L+ L  DR+        +   ++ P     
Sbjct  66    PLEPNSPAGKFLSRVLQNQRQYFNLAVSDELKLLANDRDAAVARMSLSSGSDEGPLHRVV  125

Query  1101  --SASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGS  928
               SA G D   +  IA++K +E + A+E+++Y L++ KF +  V LVP ++    N  G 
Sbjct  126   SGSAHGADSC-FCWIAQLKEHECQTAVEDVMYMLILYKFSEIRVQLVPKLSRCIYN--GR  182

Query  927   IDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNAN-----SSVQINKLRVGQVYAAS  763
             ++  PSKD +L  +H  E  EMI+ H+S ++G R+N +     ++ +I +LR+G+VY AS
Sbjct  183   LEIWPSKDWELESIHEFEVLEMIREHISTVIGLRANCSVTDSWATTEIQRLRLGRVYVAS  242

Query  762   VMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPD  583
             ++YGYFLK    R+ LE+ +    Q L        Q        +        +VV   +
Sbjct  243   ILYGYFLKSASLRYYLEECLASAHQDLHLTHRNSLQF-----PEAWSYGLKQNQVVGCVN  297

Query  582   G----GMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPE  415
                   +G    G E+K   L+ YVM FD ETLQR A +RS+EA+N++EKH+ ALFG  +
Sbjct  298   NTQSISLGRGTNGHELKQENLKCYVMGFDPETLQRCAKLRSREAVNLVEKHSCALFGDGQ  357

Query  414   ISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRY  268
                   G +D+  DE+I  SFSSL+RLVLEA+ FGSFLWD E   D+ Y
Sbjct  358   T-----GLLDT--DEVILTSFSSLKRLVLEAIAFGSFLWDAEEYADAVY  399



>ref|XP_011024597.1| PREDICTED: uncharacterized protein LOC105125729 [Populus euphratica]
Length=404

 Score =   199 bits (506),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 130/351 (37%), Positives = 197/351 (56%), Gaps = 53/351 (15%)
 Frame = -2

Query  1254  PLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTD-IV  1078
             PL+L S  G+FL+ +  +   L   AV  +L+ L  DR+        +    +SG+D   
Sbjct  80    PLELRSAAGKFLSGVFQNQKQLFHVAVTDELKLLADDRD-----SALSRMVRSSGSDEAS  134

Query  1077  LYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPSKDEQ  898
             L+RRIAE+K +E + A+E+++Y LV+ KF +  VPLVP ++    N    ++  PSKD +
Sbjct  135   LHRRIAELKEHECQVAVEDVMYMLVLYKFSEIRVPLVPKLSRCIYN--ARLEIRPSKDWE  192

Query  897   LARLHSPEAYEMIQNHLSLILGNRSNAN-----SSVQINKLRVGQVYAASVMYGYFLKRV  733
             L  +HS E  EM++ H+S ++G ++N++     ++ ++ + R+G+VYAAS++YGYFLK  
Sbjct  193   LESIHSFEVLEMVREHVSTVIGLKANSSVADSWATTEVQRCRLGRVYAASILYGYFLKSA  252

Query  732   DQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFG-  556
               R  LE  + VLP     +D  +            R++   PE  S P  G+ +  FG 
Sbjct  253   SLRHHLEWCL-VLPH----QDIHLGH----------RTTLQFPE--SLPSYGLTNLVFGH  295

Query  555   --------TEMKPSR-------LRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGR  421
                      E + +R       L+ Y+M FD ETL+R A ++SKEA+N+IEKH+ ALFG 
Sbjct  296   ISNKQSTSQETRLNRPKSEHEKLKCYLMGFDSETLKRCAKLKSKEAVNLIEKHSCALFGD  355

Query  420   PEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRY  268
              +  +          DE+I  SFSSL+RLVLEAV FG FLWD E  V+S Y
Sbjct  356   EKTGVLEN-------DEVILTSFSSLKRLVLEAVAFGCFLWDTEEYVNSVY  399



>ref|XP_004290164.1| PREDICTED: uncharacterized protein LOC101305809 [Fragaria vesca 
subsp. vesca]
Length=379

 Score =   198 bits (504),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 132/387 (34%), Positives = 210/387 (54%), Gaps = 37/387 (10%)
 Frame = -2

Query  1383  LLSAPSIKVKLGNRRVAFGSTKCNSIRASLPLSNSGGSAMPIAPLKLESPI------GQF  1222
             LL  PS    L  R     S K  ++   L +    G++       L SP+      G+ 
Sbjct  10    LLPLPSPISTLKPRSTVNFSPKYQALTRRLTVVAGAGASSHCEFSSLNSPLDPRTRSGKD  69

Query  1221  LTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIAEVKANE  1042
             L+ +L +HP L   AV Q+L+QL  +R    Q+ +     SA   +  L+RRIA++K  +
Sbjct  70    LSSVLQNHPQLFHLAVAQELKQLADER----QDARCRMNLSAQSHEACLHRRIAQLKEQQ  125

Query  1041  RRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEM  862
              + A+E+++Y L+  KF +  VPLVP ++    N    ++ LP+KD +L  ++S E  EM
Sbjct  126   CQIAVEDVMYLLIFYKFSEVKVPLVPKLSKCIYN--DRLEILPAKDWELESIYSLEVLEM  183

Query  861   IQNHLSLILGNRSNANSS-----VQINKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKV  697
             I+ H++ ++G R+N++ +      +I +  +G+VY AS++YGYFLK V  R +LE+++ +
Sbjct  184   IREHVTTVIGLRANSSVTDNWAMTKITRQTLGRVYVASILYGYFLKSVSLRHRLERSLFL  243

Query  696   LPQGLDKE-DSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGT---EMKPSRLR  529
               Q L     + +Q++      +          ++    G + S   G+   E    +L+
Sbjct  244   ESQDLHLSCRTSLQEMSPHGIKS----------LIFGHVGKIQSECVGSNRLEKTHGKLK  293

Query  528   TYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKISFS  349
              YVM FD ETLQR A +RS+E++++I+ H  ALFG      +P+       DE+I  SFS
Sbjct  294   CYVMGFDPETLQRCAKLRSEESVDLIKNHCCALFGDDAEMGSPE------IDEVISTSFS  347

Query  348   SLRRLVLEAVTFGSFLWDVESSVDSRY  268
             SL+RLVLEAV FGSFLWD E  +DS Y
Sbjct  348   SLKRLVLEAVAFGSFLWDTEECIDSVY  374



>ref|XP_003520988.1| PREDICTED: uncharacterized protein LOC100793365 [Glycine max]
Length=393

 Score =   197 bits (500),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 127/388 (33%), Positives = 206/388 (53%), Gaps = 42/388 (11%)
 Frame = -2

Query  1383  LLSAPSIKVKLGNRRVAFGSTKCNSIRASLPLSNSGGSAMPI------APLKLESPIGQF  1222
               + P +    G  RVA  S+ C       P   +   A P       +PL+  S +G+F
Sbjct  27    FFTRPDLGGGGGGVRVASSSSSCLLFHRRRPFIRASAGASPCEFSSLNSPLEPRSMVGKF  86

Query  1221  LTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIAEVKANE  1042
             L  +L +HP +   AV ++L+ L  DR+             ++  + +L+RRIA VK N+
Sbjct  87    LIGVLQNHPQMFHLAVGEELKLLAEDRDAAHARMVLG----SASDEALLHRRIALVKENQ  142

Query  1041  RRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEM  862
              + A+E+++Y L+  KF +  VP+VP ++S   N  G ++ LPSKD +L  +HS E  +M
Sbjct  143   CQIAVEDVIYLLIFYKFSEIRVPMVPKLSSCLYN--GRLEILPSKDWELESIHSLEVLDM  200

Query  861   IQNHLSLILGNRSNAN-----SSVQINKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKV  697
             I+ H++ + G R+ ++     ++  + +  + +VY AS++YGYFLK V  R+ LE+N+ +
Sbjct  201   IREHITTVTGLRAKSSVTECWATTHVRQFLLARVYVASILYGYFLKSVSLRYHLERNLSL  260

Query  696   LPQGLD--KEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGT---EMKPSRL  532
                 L    + S +   G               + +      M S G G    E +   L
Sbjct  261   ANHDLHLGHKTSLMCSYG-------------FKDAIFGHLSNMSSLGQGLIRPEEELEDL  307

Query  531   RTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKISF  352
             + YVMSF   +LQR A +RSKEA+N++  ++ ALF   E      G++++  D++I  SF
Sbjct  308   KCYVMSFHPGSLQRCARLRSKEAVNLVGSYSCALFNNEE-----SGSVEN--DDVILTSF  360

Query  351   SSLRRLVLEAVTFGSFLWDVESSVDSRY  268
             SSL+RLVLEAV FGSFLW++E  +D+ Y
Sbjct  361   SSLKRLVLEAVAFGSFLWEIEDYIDNVY  388



>ref|XP_010100787.1| hypothetical protein L484_015816 [Morus notabilis]
 gb|EXB84485.1| hypothetical protein L484_015816 [Morus notabilis]
Length=363

 Score =   195 bits (495),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 124/337 (37%), Positives = 191/337 (57%), Gaps = 43/337 (13%)
 Frame = -2

Query  1236  PIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQND-EPSASGTDIVLYRRIA  1060
             P G+ L  +L++HP L   +V  +L+ L  DR+  +    ++D  P A      L+RRIA
Sbjct  51    PAGKALIGVLLNHPQLFHLSVADELKHLADDRDAARNRMIRSDGSPEA-----CLHRRIA  105

Query  1059  EVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPSKDEQLARLHS  880
             ++K NE + A+E+I+Y L+  KF +  VPLVP ++    N  G ++  P KD +L  ++S
Sbjct  106   QLKENECQVAVEDIMYLLIFYKFSEIKVPLVPRLSGCVYN--GRLEIWPPKDWELESIYS  163

Query  879   PEAYEMIQNHLSLILGNRSNANSS-----VQINKLRVGQVYAASVMYGYFLKRVDQRFQL  715
              E  E+++ H++ ++G R+N++ +       I K  + ++Y AS++YGYFLK    R QL
Sbjct  164   FEVLEIVREHIAAVIGLRANSSITDHWAITTIAKSALSRIYIASILYGYFLKSALLRLQL  223

Query  714   EKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGS--------RGF  559
             E+ +      LD +D  ++Q          R++  H  + +   G +GS           
Sbjct  224   EQCV-----ALDSQDLPLRQ----------RTTVQHHGIKNLLFGRIGSIQSESQSLDPS  268

Query  558   GTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSS  379
               E KP  L+ YVM FD ETLQR A ++SKEA ++IE H+ ALFG  +      G++D  
Sbjct  269   SQEKKPENLKCYVMGFDPETLQRCAKLKSKEATSLIENHSSALFGDEK-----TGSLDD-  322

Query  378   KDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRY  268
              DE+I  SFSSL+RLVLEAV FGSFLW+ E  V++ Y
Sbjct  323   -DEVILTSFSSLKRLVLEAVAFGSFLWETEECVNTVY  358



>gb|KDO46602.1| hypothetical protein CISIN_1g015579mg [Citrus sinensis]
Length=281

 Score =   192 bits (488),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 112/291 (38%), Positives = 164/291 (56%), Gaps = 47/291 (16%)
 Frame = -2

Query  1077  LYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPSKDEQ  898
             L+RRIA++K +E + A+E+++Y L++ KF +  V LVP ++    N  G ++  PSKD +
Sbjct  12    LHRRIAQLKEHECQTAVEDVMYMLILYKFSEIRVQLVPKLSRCIYN--GRLEIWPSKDWE  69

Query  897   LARLHSPEAYEMIQNHLSLILGNRSNAN-----SSVQINKLRVGQVYAASVMYGYFLKRV  733
             L  +H  E  EMI+ H+S ++G R+N +     ++ +I +LR+G+VY AS++YGYFLK  
Sbjct  70    LESIHEFEVLEMIREHISTVIGLRANCSVTDSWATTEIQRLRLGRVYVASILYGYFLKSA  129

Query  732   DQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDG---------  580
               R+ LE+ +    Q L        Q                PE  +W  G         
Sbjct  130   SLRYYLEECLASAHQDLHLTHRNSLQF---------------PE--AWSYGLKQNQVVGC  172

Query  579   -------GMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGR  421
                     +G    G E+K   L+ YVM FD ETLQR A +RS+EA+N++EKH+ ALFG 
Sbjct  173   VNNTQSISLGRGTNGHELKQENLKCYVMGFDPETLQRCAKLRSREAVNLVEKHSCALFGD  232

Query  420   PEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRY  268
              +      G +D+  DE+I  SFSSL+RLVLEA+ FGSFLWD E   D+ Y
Sbjct  233   GQT-----GLLDT--DEVILTSFSSLKRLVLEAIAFGSFLWDAEEYADAVY  276



>ref|XP_006367000.1| PREDICTED: uncharacterized protein LOC102582294 [Solanum tuberosum]
Length=390

 Score =   195 bits (495),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 133/369 (36%), Positives = 196/369 (53%), Gaps = 50/369 (14%)
 Frame = -2

Query  1305  RASLPLSNSGGSAMPI------APLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTD  1144
             R SL +  SG S+         APL+  +P G+ L+ +L++       AV +QLE+L  +
Sbjct  44    RRSLFVVASGSSSSKCEFSGLNAPLEPATPAGRLLSTVLLNDRKYFHVAVQKQLEKLAYE  103

Query  1143  RNLEKQNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVP  964
             R+  +   + N   S    +  L+RRIAEVK  E + ++E+I+Y L+  KF    V L+P
Sbjct  104   RD--EAVARMN--LSLGSDEAFLHRRIAEVKELECQASVEDIMYMLISYKFSGIRVHLIP  159

Query  963   AITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNAN-----SSVQI  799
              ++    N  G ++  P KD +L  +HS E  EM++ HL+ +LG +  +N     +  ++
Sbjct  160   RLSKCMYN--GRLEIWPCKDWELESIHSCEVLEMVREHLTTVLGWKEKSNVADNWTPTEV  217

Query  798   NKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKED------SGIQQVGGDss  637
              K ++ QVYAASV+YGYFLK    R  LEK +  +   LD         S I+ +G    
Sbjct  218   QKFKLCQVYAASVLYGYFLKSASLRHHLEKKLDHINPYLDIASYNQLLLSEIRSLGS---  274

Query  636   dtslrsspSHPEVVSW-PDGGMGSRGFGT-----EMKPSRLRTYVMSFDGETLQRYATIR  475
                        E+V +   GG  S   G      E K  +L+ YVMSFD ETLQ +A  +
Sbjct  275   -----------EIVPFGCIGGTRSTSVGQIPLLREKKQDKLKYYVMSFDPETLQMWAKPK  323

Query  474   SKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWD  295
             SKEA+N+IEKH+ ALFG  +  +        + DE+I  S +SL+R+VLEA+ FGSFLWD
Sbjct  324   SKEALNLIEKHSYALFGDKKTGLV-------ASDEVILTSLASLKRIVLEAIAFGSFLWD  376

Query  294   VESSVDSRY  268
              E  V   Y
Sbjct  377   AEEYVRIVY  385



>ref|XP_006599165.1| PREDICTED: uncharacterized protein LOC100804253 [Glycine max]
Length=388

 Score =   194 bits (494),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 124/357 (35%), Positives = 201/357 (56%), Gaps = 37/357 (10%)
 Frame = -2

Query  1308  IRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEK  1129
             IRAS   S    S++  +PL+  S +G+FL+ +L +HP +   AV ++L+ L  DR+   
Sbjct  54    IRASAGASPCEFSSLN-SPLEPRSMVGKFLSAVLQNHPQMFHVAVGEELKLLAEDRDAAH  112

Query  1128  QNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSP  949
                       ++  + +L+RRIA+VK N+ + A+E+++Y L+  KF +  VP+VP ++S 
Sbjct  113   ARMVLG----SASDEALLHRRIAQVKENQCQIAVEDVMYLLIFYKFSEIRVPMVPKLSSC  168

Query  948   SQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNAN-----SSVQINKLRV  784
               N  G ++ LPSKD +L  +HS E  +MI+ H++ + G R+ ++     ++ Q+ +  +
Sbjct  169   LYN--GRLEILPSKDWELESIHSSEVLDMIREHITTVTGLRAKSSVTECWATTQVRQFLL  226

Query  783   GQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLD--KEDSGIQQVGGDssdtslrsspS  610
              +VY AS++YGYFLK V  R+ LE+N+ +    L      S +   G             
Sbjct  227   ARVYVASILYGYFLKSVSLRYHLERNLSLANHDLHLGHRTSVMFSYG-------------  273

Query  609   HPEVVSWPDGGMGSRGFGT---EMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHT  439
               + +      M S G G    E +   L+ YVMSF   +LQR A +RSKEA+N++  ++
Sbjct  274   FKDAIFGHLSNMPSLGQGLIRPEEEIEDLKCYVMSFHPGSLQRCARLRSKEAVNLVGSYS  333

Query  438   EALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRY  268
              ALF   E      G++++  D++I  SFSSL+RLVLEAV FGSFLW+ E  +D+ Y
Sbjct  334   CALFNNKE-----SGSVEN--DDVILTSFSSLKRLVLEAVAFGSFLWETEDYIDNVY  383



>ref|XP_006437251.1| hypothetical protein CICLE_v10031774mg [Citrus clementina]
 gb|ESR50491.1| hypothetical protein CICLE_v10031774mg [Citrus clementina]
Length=281

 Score =   191 bits (485),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 111/289 (38%), Positives = 163/289 (56%), Gaps = 47/289 (16%)
 Frame = -2

Query  1071  RRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPSKDEQLA  892
             RRIA++K +E + A+E+++Y L++ KF +  V LVP ++    N  G ++  PSKD +L 
Sbjct  14    RRIAQLKEHECQTAVEDVMYMLILYKFSEIRVQLVPKLSRCIYN--GRLEIWPSKDWELE  71

Query  891   RLHSPEAYEMIQNHLSLILGNRSNAN-----SSVQINKLRVGQVYAASVMYGYFLKRVDQ  727
              +H  E  EMI+ H+S ++G R+N +     ++ +I +LR+G+VY AS++YGYFLK    
Sbjct  72    SIHEFEVLEMIREHISTVIGLRANCSVTDSWATTEIQRLRLGRVYVASILYGYFLKSASL  131

Query  726   RFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDG-----------  580
             R+ LE+ +    Q L        Q                PE  +W  G           
Sbjct  132   RYYLEECLASAHQDLHLTHRNSLQF---------------PE--AWSYGLKQNQVVGCVN  174

Query  579   -----GMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPE  415
                   +G    G E+K  +L+ YVM FD ETLQR A +RS+EA+N++EKH+ ALFG  +
Sbjct  175   NTQSISLGRGTNGHELKQEKLKCYVMGFDPETLQRCAKLRSREAVNLVEKHSCALFGDGQ  234

Query  414   ISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRY  268
                   G +D+  DE+I  SFSSL+RLVLEA+ FGSFLWD E   D+ Y
Sbjct  235   -----TGLLDT--DEVILTSFSSLKRLVLEAIAFGSFLWDAEEYADAVY  276



>gb|KDO46604.1| hypothetical protein CISIN_1g015579mg [Citrus sinensis]
 gb|KDO46605.1| hypothetical protein CISIN_1g015579mg [Citrus sinensis]
Length=281

 Score =   190 bits (483),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 111/289 (38%), Positives = 162/289 (56%), Gaps = 47/289 (16%)
 Frame = -2

Query  1071  RRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPSKDEQLA  892
             RRIA++K +E + A+E+++Y L++ KF +  V LVP ++    N  G ++  PSKD +L 
Sbjct  14    RRIAQLKEHECQTAVEDVMYMLILYKFSEIRVQLVPKLSRCIYN--GRLEIWPSKDWELE  71

Query  891   RLHSPEAYEMIQNHLSLILGNRSNAN-----SSVQINKLRVGQVYAASVMYGYFLKRVDQ  727
              +H  E  EMI+ H+S ++G R+N +     ++ +I +LR+G+VY AS++YGYFLK    
Sbjct  72    SIHEFEVLEMIREHISTVIGLRANCSVTDSWATTEIQRLRLGRVYVASILYGYFLKSASL  131

Query  726   RFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDG-----------  580
             R+ LE+ +    Q L        Q                PE  +W  G           
Sbjct  132   RYYLEECLASAHQDLHLTHRNSLQF---------------PE--AWSYGLKQNQVVGCVN  174

Query  579   -----GMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPE  415
                   +G    G E+K   L+ YVM FD ETLQR A +RS+EA+N++EKH+ ALFG  +
Sbjct  175   NTQSISLGRGTNGHELKQENLKCYVMGFDPETLQRCAKLRSREAVNLVEKHSCALFGDGQ  234

Query  414   ISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRY  268
                   G +D+  DE+I  SFSSL+RLVLEA+ FGSFLWD E   D+ Y
Sbjct  235   -----TGLLDT--DEVILTSFSSLKRLVLEAIAFGSFLWDAEEYADAVY  276



>ref|XP_002272171.1| PREDICTED: uncharacterized protein LOC100251038 [Vitis vinifera]
Length=380

 Score =   193 bits (490),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 127/339 (37%), Positives = 191/339 (56%), Gaps = 27/339 (8%)
 Frame = -2

Query  1254  PLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRN--LEKQNEKQNDEPSASGTDI  1081
             PL+  S  G+FL+ +L +   L   AV +QL  L  DR+  L + N       S+S ++ 
Sbjct  58    PLEPRSLPGKFLSGVLQNQRQLFHVAVAEQLRDLADDRDAALARMNLSYG---SSSSSES  114

Query  1080  VLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPSKDE  901
              L+RRIAE+K  E + A+E+++Y L+  KF +  V LVP ++    N  G ++  P++D 
Sbjct  115   CLHRRIAELKERECQIAVEDVMYLLIFYKFSEIRVHLVPRLSRCIYN--GRLEIWPARDW  172

Query  900   QLARLHSPEAYEMIQNHLSLILGNRSNAN-----SSVQINKLRVGQVYAASVMYGYFLKR  736
              L  +H+ E  EMI+ HL+ +LG +  +N     ++ QI + ++GQ+YAAS++YGYFLK 
Sbjct  173   ALECIHNFEVLEMIKEHLTTVLGWKPKSNVTENWATTQIRRFQLGQIYAASILYGYFLKS  232

Query  735   VDQRFQLEKNMKVLPQGLDKED-SGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGF  559
                R  LE ++      L   + SG    G       L+     P   S P     +   
Sbjct  233   ASLRHHLEMSLVHSHHDLPSSNVSGFWSYG-------LKDLFLGPNCSSQPTSLGEASSR  285

Query  558   GTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSS  379
               E +  +LR YVM FD +TLQR A ++SKEA+N++EKH+ ALFG  +      G +++ 
Sbjct  286   QEEKEEKKLRCYVMGFDPDTLQRCAKLKSKEAVNLVEKHSCALFGDEKT-----GLLET-  339

Query  378   KDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHF  262
              D++I  SFSS++RLVLEAV FGSFLWD E  V S Y+ 
Sbjct  340   -DDVISTSFSSMKRLVLEAVAFGSFLWDTEEYVGSVYNL  377



>ref|XP_004247039.1| PREDICTED: uncharacterized protein LOC101262953 [Solanum lycopersicum]
Length=390

 Score =   191 bits (486),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 127/350 (36%), Positives = 188/350 (54%), Gaps = 50/350 (14%)
 Frame = -2

Query  1257  APLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTD-I  1081
             APL+  +P G+ L+ +L++       AV +QLE+L  +R+     E       + GTD  
Sbjct  66    APLEPATPTGRLLSTLLLNDRKYFHVAVQKQLEKLANERD-----EAVARMNLSLGTDEA  120

Query  1080  VLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPSKDE  901
              L+RRIAEVK  E + ++E+I+Y L+  KF    V L+P ++    N  G ++  P KD 
Sbjct  121   FLHRRIAEVKELECQTSVEDIMYMLISYKFSGIRVHLIPRLSKCMYN--GRLEIWPCKDW  178

Query  900   QLARLHSPEAYEMIQNHLSLILGNRSNANSS-----VQINKLRVGQVYAASVMYGYFLKR  736
             +L  +HS E  EM++ HL+ +LG +  +N +      ++ K ++ QVY ASV+YGYFLK 
Sbjct  179   ELESIHSCEVLEMVREHLTSVLGWKEKSNVADNWTPTEVQKFKLCQVYVASVLYGYFLKS  238

Query  735   VDQRFQLEKNMKVLPQGLDKED------SGIQQVGGDssdtslrsspSHPEVVSWPDGGM  574
                R  LEK +  +   LD         S IQ +G               E+V  P G +
Sbjct  239   ASLRHHLEKKLDHINPYLDLASYKQLLLSTIQSLGS--------------EIV--PFGCI  282

Query  573   G-SRGFGT-------EMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRP  418
             G +R           E K  +L+ YVM+FD E LQ  A  +SKEA+N+IEKH+ ALFG  
Sbjct  283   GGTRSTSVSQIPLLREKKQDKLKYYVMNFDPEMLQMCAKPKSKEALNLIEKHSYALFG--  340

Query  417   EISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRY  268
                   + T+  + D++I  S +SL+R+VLEA+ FGSFLWD E  V + Y
Sbjct  341   -----DKNTVLVASDDVILTSLASLKRIVLEAIAFGSFLWDAEEYVRTVY  385



>ref|XP_007134152.1| hypothetical protein PHAVU_010G023700g [Phaseolus vulgaris]
 gb|ESW06146.1| hypothetical protein PHAVU_010G023700g [Phaseolus vulgaris]
Length=392

 Score =   190 bits (482),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 123/356 (35%), Positives = 195/356 (55%), Gaps = 38/356 (11%)
 Frame = -2

Query  1293  PLSNSGGSAMPI------APLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLE  1132
             P   S   A P       +PL+  S +G+FL+ +L +HP +   AV ++L+ L  DR+  
Sbjct  56    PFIRSSAGASPCEFSSLNSPLEPRSMVGKFLSGVLQNHPQMFHVAVGEELKLLAEDRD--  113

Query  1131  KQNEKQNDEPSASGTD-IVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAIT  955
                         S TD  +L+RRIA++K N+ + A+E+++Y L+  KF +  VPLVP ++
Sbjct  114   ---AAHARMVLGSVTDEALLHRRIAQLKENQCQIAVEDVMYLLIFYKFSEIRVPLVPKLS  170

Query  954   SPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNAN-----SSVQINKL  790
             S   N  G ++ LPSKD +L  +HS E  +MI+ H++ + G ++ ++     ++ Q+ + 
Sbjct  171   SCLYN--GRLEILPSKDWELESIHSLEVLDMIREHITTVTGLKAKSSVTESWATTQVRQF  228

Query  789   RVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQG--LDKEDSGIQQVGGDssdtslrss  616
              + +VY AS++YGYFLK V  R+ LE+N+ +      L    S +   G           
Sbjct  229   LLARVYVASILYGYFLKSVSLRYHLERNLSLADHDIHLGHRTSLMCSYG--------LKD  280

Query  615   pSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTE  436
                  + + P  G G      E +   L+ YVMSF   +LQR A +RSKEA+N++  ++ 
Sbjct  281   AIFGHLSNMPSLGQGL--IRPEEEVEDLKCYVMSFHPGSLQRCARLRSKEAVNLVGSYSC  338

Query  435   ALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRY  268
             ALF   E      G+ ++  D++I  SFSSL+RLVLEAV FGSFLW+ E  +D+ Y
Sbjct  339   ALFNNKE-----SGSFEN--DDVILTSFSSLKRLVLEAVAFGSFLWETEDYIDNVY  387



>gb|KDO57188.1| hypothetical protein CISIN_1g036217mg [Citrus sinensis]
Length=196

 Score =   183 bits (465),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 106/240 (44%), Positives = 147/240 (61%), Gaps = 48/240 (20%)
 Frame = -2

Query  972  LVPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNR--SNANSSVQI  799
            ++P I   S +  G +D  P+++++L  +HSPEA+EMIQ+HLSL+LG R     ++ +QI
Sbjct  1    MIPKIRETS-DPVGRVDFWPNQEQKLESVHSPEAFEMIQSHLSLVLGERLVGPLDTIIQI  59

Query  798  NKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrs  619
            +K+++G++YAAS+MY       D   ++  N           D G   VG          
Sbjct  60   SKIKLGKLYAASIMY-------DSLIRIPPN-----------DDG--TVGE---------  90

Query  618  spSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHT  439
                    S+ DGG G        K  RLR+YVM  D ETLQRYATIRSKEAI++IEK T
Sbjct  91   --------SFMDGGEG--------KSYRLRSYVMYLDAETLQRYATIRSKEAISLIEKQT  134

Query  438  EALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  259
            +ALFGRP+I +   G+ID+SKDE+I ++F  L  LVLEAV FGSF+WD ES V+S+Y F+
Sbjct  135  QALFGRPDIRVLEDGSIDTSKDEVISVTFLGLTMLVLEAVAFGSFMWDSESYVESKYPFI  194



>gb|KDO46603.1| hypothetical protein CISIN_1g015579mg [Citrus sinensis]
Length=276

 Score =   186 bits (471),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 110/292 (38%), Positives = 162/292 (55%), Gaps = 47/292 (16%)
 Frame = -2

Query  1080  VLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPSKDE  901
             V   +IA++K +E + A+E+++Y L++ KF +  V LVP ++    N  G ++  PSKD 
Sbjct  6     VFVGKIAQLKEHECQTAVEDVMYMLILYKFSEIRVQLVPKLSRCIYN--GRLEIWPSKDW  63

Query  900   QLARLHSPEAYEMIQNHLSLILGNRSNAN-----SSVQINKLRVGQVYAASVMYGYFLKR  736
             +L  +H  E  EMI+ H+S ++G R+N +     ++ +I +LR+G+VY AS++YGYFLK 
Sbjct  64    ELESIHEFEVLEMIREHISTVIGLRANCSVTDSWATTEIQRLRLGRVYVASILYGYFLKS  123

Query  735   VDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDG--------  580
                R+ LE+ +    Q L        Q                PE  +W  G        
Sbjct  124   ASLRYYLEECLASAHQDLHLTHRNSLQF---------------PE--AWSYGLKQNQVVG  166

Query  579   --------GMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFG  424
                      +G    G E+K   L+ YVM FD ETLQR A +RS+EA+N++EKH+ ALFG
Sbjct  167   CVNNTQSISLGRGTNGHELKQENLKCYVMGFDPETLQRCAKLRSREAVNLVEKHSCALFG  226

Query  423   RPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRY  268
               +      G +D+  DE+I  SFSSL+RLVLEA+ FGSFLWD E   D+ Y
Sbjct  227   DGQ-----TGLLDT--DEVILTSFSSLKRLVLEAIAFGSFLWDAEEYADAVY  271



>ref|XP_011089045.1| PREDICTED: uncharacterized protein LOC105170122 [Sesamum indicum]
Length=378

 Score =   187 bits (475),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 115/338 (34%), Positives = 184/338 (54%), Gaps = 26/338 (8%)
 Frame = -2

Query  1257  APLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIV  1078
             APL+  +  G+FL+ +L+        A  ++LE+L  +R+          + S    +  
Sbjct  54    APLEPRTTAGKFLSGVLLDDRDNFRVAARKELERLANERD----EAAARLQLSLGSDEAC  109

Query  1077  LYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPSKDEQ  898
             L+RRIAE K +E R A+EE++Y L+  KF +  V L+P ++    N  G ++  PSKD +
Sbjct  110   LHRRIAEFKEHECRDAVEEVMYMLIFHKFNEMRVHLIPRLSEGVYN--GRLEIWPSKDWE  167

Query  897   LARLHSPEAYEMIQNHLSLILGNRSNAN-----SSVQINKLRVGQVYAASVMYGYFLKRV  733
             L  +HS E  +M++ HL  ++G RS +N     ++ +I +L++ ++YAAS++YGYFLK  
Sbjct  168   LESIHSFEVLQMVREHLRAVVGWRSISNVTASWATTEIQRLKLCKLYAASILYGYFLKSA  227

Query  732   DQRFQLEKNMKVLPQGLDKEDSGI---QQVGGDssdtslrsspSHPEVVSWPDGGMGSRG  562
               R  LE+ +      L     GI    Q+      +      +   V S     +G   
Sbjct  228   SLRHHLERVLD-----LSNSHFGIGARNQLSAPEMFSVGSDYITSGRVGSAKSSSVGRVS  282

Query  561   FGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDS  382
             +    K    R YVM FD ET+Q  A  +SKEA+N+IE+H+ ALFG  E      G +++
Sbjct  283   YSLGSKQENFRFYVMGFDAETIQMCAKPKSKEAVNLIERHSSALFGDEE-----TGLVET  337

Query  381   SKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRY  268
               +++I  SF+SL+R +LEAV FGSFLW+ E+ V++ Y
Sbjct  338   --NDVITTSFASLKRFLLEAVAFGSFLWEAENCVNAVY  373



>emb|CDP03929.1| unnamed protein product [Coffea canephora]
Length=400

 Score =   187 bits (476),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 137/389 (35%), Positives = 199/389 (51%), Gaps = 67/389 (17%)
 Frame = -2

Query  1344  RRVAFGS-TKCNSIRASLPLSNSG---------GSAMPIAPLKLESPIGQFLTQILVSHP  1195
             RR+ FG  T+    R  L L+ SG         G   P+ P    +P G+ L  +L++ P
Sbjct  40    RRINFGGRTRSPYRRGFLVLAASGTGSECGEYRGLYTPVQP---TTPAGRLLGTVLLNDP  96

Query  1194  HLVSAAVDQQLEQLQTDRN--LEKQNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEE  1021
                   V +QLEQL  DR   L + N       S++  +  L+RRIAE+K +E + A+E+
Sbjct  97    DYFPQVVQKQLEQLAVDRYEALLRMN------LSSASHEACLHRRIAELKEHECQAAIED  150

Query  1020  ILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSL  841
              +Y ++  KF +  V LVP ++    N  G ++  PSKD +L  +HS E  EMI+ HL+ 
Sbjct  151   AMYVVICSKFYEIRVHLVPQLSKCMYN--GRLEIQPSKDWELESIHSFEVLEMIREHLTT  208

Query  840   ILGNRSNANSS-----VQINKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDK  676
              +G R+N++ +      QI++L++ QVY ASV+YGYFLK    R  LEKN+  +      
Sbjct  209   FVGWRANSSVTDKWAVTQISRLQLCQVYTASVLYGYFLKAASLRHTLEKNLLHM-----N  263

Query  675   EDSGIQQVGGDssdtslrsspSHPEVVSWPDG---GMGSRGFGTEM------------KP  541
              D G+  VG              P    W  G    M  R   T              K 
Sbjct  264   FDLGL-NVGSH-----------FPVADMWALGSKAAMFGRVLSTRSTSVSEVSSNQANKG  311

Query  540   SRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIK  361
              +LR YVM FD E+LQ  A  +SKEA N+IE+ + ALFG  E      G +++  +E+I 
Sbjct  312   DKLRCYVMGFDPESLQMCAKPKSKEAANLIERQSFALFGDEET-----GLLET--NEVIS  364

Query  360   ISFSSLRRLVLEAVTFGSFLWDVESSVDS  274
              SF+SL+R VLEA+ FGS+LWD E  + +
Sbjct  365   TSFASLKRYVLEAIAFGSYLWDAEEYIST  393



>ref|XP_009587865.1| PREDICTED: uncharacterized protein LOC104085515 [Nicotiana tomentosiformis]
Length=387

 Score =   187 bits (475),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 121/345 (35%), Positives = 182/345 (53%), Gaps = 36/345 (10%)
 Frame = -2

Query  1257  APLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIV  1078
             APL+  +P G+ L+ +L++  +    AV +QLE L  DR+            S    +  
Sbjct  63    APLEPTTPTGRLLSTVLLNDRNNFHVAVQKQLEHLAYDRD----QALARMYLSFGSDEAF  118

Query  1077  LYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPSKDEQ  898
             L+RRIAEVK  E + ++E+I+Y L+  KF    V LVP ++    N  G ++  P +D +
Sbjct  119   LHRRIAEVKELECQASVEDIMYILISYKFSGIRVHLVPKLSKCMYN--GRLEIWPCRDWE  176

Query  897   LARLHSPEAYEMIQNHLSLILGNRSNANSS-----VQINKLRVGQVYAASVMYGYFLKRV  733
             L  +HS E  EM++ HL+++LG +  +N +      ++ KL++ +VYAASV++GYFLK  
Sbjct  177   LESIHSCEVLEMVREHLTIVLGWKEKSNVTDNWAPTKVQKLQLCRVYAASVLFGYFLKSA  236

Query  732   DQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGM-GSRGFG  556
               R  LE+ +  + + L         + G S            E V  P G + G+R   
Sbjct  237   SLRHHLEQKVDHINRDLG--------IAGSSQLLLSELRSLGSETV--PFGRISGTRSTS  286

Query  555   T-------EMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQ  397
                     E K  +L+ YVMSFD ETLQ  A  +SKEA+N+IEKH  ALFG  +  +   
Sbjct  287   VGRIPLVREKKQEKLKYYVMSFDAETLQMCAKPKSKEALNLIEKHIYALFGDEKTGLIAS  346

Query  396   GTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHF  262
             G +       I  S +SL+R+VLEA+ FGSFLWD E  + + Y  
Sbjct  347   GGV-------ISTSLASLKRIVLEAIAFGSFLWDAEEYIRTVYQL  384



>ref|XP_010685095.1| PREDICTED: uncharacterized protein LOC104899578 [Beta vulgaris 
subsp. vulgaris]
Length=372

 Score =   187 bits (474),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 113/343 (33%), Positives = 185/343 (54%), Gaps = 43/343 (13%)
 Frame = -2

Query  1254  PLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVL  1075
             PLKL+SP+G+ L+ +L + PH    AV  +L ++  DR+          + S   ++  L
Sbjct  53    PLKLKSPVGRSLSSVLQNEPHCFYDAVSVELNRIAEDRD----AAFARFDLSLGSSEASL  108

Query  1074  YRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPSKDEQL  895
             +RRIA++K  E + A+E++LY +++  F +  VPL P+++    N  G ++ LPSKD +L
Sbjct  109   HRRIAKLKEEECQVAVEDVLYMIILYNFSEFKVPLAPSLSKCLYN--GRLEILPSKDWEL  166

Query  894   ARLHSPEAYEMIQNHLSLILGNRSNAN-----SSVQINKLRVGQVYAASVMYGYFLKRVD  730
               +HS E  EM++ HLS++LG +  ++     S+ ++ +  + QVY AS++YGYFLK   
Sbjct  167   ESIHSLEVLEMVREHLSIVLGWKVGSSVTVNWSTTKVRRHHLSQVYQASILYGYFLKSAS  226

Query  729   QRFQLEKNMKVLPQGL---------DKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGG  577
              R++LE+++    Q +         + +  G + V              H  + +     
Sbjct  227   LRYRLEQSLPPTHQQISFGSWSPPPEFQSCGFENV-------------FHGNMFNPRSRT  273

Query  576   MGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQ  397
             +        MK + LR YV  FD +T++  A ++S+EA  +IEKH  ALFG         
Sbjct  274   LSQVSRRPRMKEANLRCYVTGFDVQTMEECAKLKSEEAAELIEKHCLALFGNS-------  326

Query  396   GTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRY  268
                ++  +++I  S SSL+RLVLEAV FG FLWD E  V+S Y
Sbjct  327   ---NAENNDMILTSLSSLKRLVLEAVAFGCFLWDAEQCVNSTY  366



>ref|XP_004510240.1| PREDICTED: uncharacterized protein LOC101489146 [Cicer arietinum]
Length=383

 Score =   186 bits (473),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 129/411 (31%), Positives = 207/411 (50%), Gaps = 61/411 (15%)
 Frame = -2

Query  1434  RRFTTDAPGFVKFGSKALLSAPSIKVKLGNRRVAFGSTKCNSIRASLPLSNSGGSAMPIA  1255
             R   T  P    F +  ++S+  +  +    RVA        I+AS   S+   S++  +
Sbjct  7     RHHFTIKPQIGGFFTTPIISSSCLNFRCSGNRVALKRV----IKASGGASHCEFSSLN-S  61

Query  1254  PLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVL  1075
             PL+  S +G+FL+ +  +H  L   AV ++L+ L  DR    Q        +++    +L
Sbjct  62    PLEPRSLVGKFLSGVFQNHRQLFHVAVQEELKLLSDDR----QAALSRMLLASNSDQALL  117

Query  1074  YRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPSKDEQL  895
             +RRIA++K N+   A+E+I+  L+  KF +  VPLVP ++S   N  G ++ LPSKD +L
Sbjct  118   HRRIAQIKENQCEVAVEDIMSLLIFYKFSEIRVPLVPKLSSCLYN--GRLEILPSKDWEL  175

Query  894   ARLHSPEAYEMIQNHLSLILGNR-----SNANSSVQINKLRVGQVYAASVMYGYFLKRVD  730
               +H  E  +MI+ H++ + G +     ++  ++ ++ K  + +VY AS++YGYFLK V 
Sbjct  176   ESIHCLEVLDMIREHVTTVTGLKAKPSVTDTWATTKVRKFLLARVYVASILYGYFLKSVS  235

Query  729   QRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPD---GGMGSRGF  559
              R+ LE+N+ +    +         +G             H   +S+ D    G     F
Sbjct  236   LRYHLERNLSLANHDV--------HLG-------------HRTSLSFKDMCPYGFKDAIF  274

Query  558   G--------------TEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGR  421
             G               E +   L+ YVMSF   +LQR A +RSKEA+N++  ++ ALF  
Sbjct  275   GHLSNIQSIGQGLIRQEEEIEDLKCYVMSFHPGSLQRCAKLRSKEAVNLVRSYSCALFNN  334

Query  420   PEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRY  268
                    QG+     D++I  SFSSL+RLVLEAV FGSFLW+ E  +D  Y
Sbjct  335   -------QGSDSVENDDIILTSFSSLKRLVLEAVAFGSFLWETEDYIDDLY  378



>ref|XP_009763079.1| PREDICTED: uncharacterized protein LOC104215037 [Nicotiana sylvestris]
Length=392

 Score =   186 bits (473),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 136/398 (34%), Positives = 200/398 (50%), Gaps = 45/398 (11%)
 Frame = -2

Query  1398  FGSKALLSAPSIKVKLGNRRVAFGSTKCNSIRASLPLSNSGGSAMPI------APLKLES  1237
             F  K  L + S +    N    F S+   S R SL +  SG S+         APL   +
Sbjct  18    FTVKTTLLSSSTRFTFKNS--PFTSSSVGS-RRSLFVVASGNSSSKCEFSGLNAPLVPTT  74

Query  1236  PIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRN--LEKQNEKQNDEPSASGTDIVLYRRI  1063
             P G+ L+ +L++  +     V +QLEQL  DR+  L + N       S    +  L+RRI
Sbjct  75    PTGRLLSTVLLNDRNNFHVVVQKQLEQLAYDRDEALARIN------LSFGSDEAFLHRRI  128

Query  1062  AEVKANERRKALEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPSKDEQLARLH  883
             AEVK  E + ++E+I+Y L+  KF    V LVP ++    N    ++  P +D +L  +H
Sbjct  129   AEVKELECQASVEDIMYILISYKFSGMRVHLVPKLSKCMYNDR--LEIWPCRDWELESIH  186

Query  882   SPEAYEMIQNHLSLILGNRSNANSS-----VQINKLRVGQVYAASVMYGYFLKRVDQRFQ  718
             S E  EM++ HL+ +LG +  +N +      ++ KL++ +VYAASV++GYFLK    R  
Sbjct  187   SCEVLEMVREHLTTVLGWKEKSNVTDNWAPTKVRKLQLCRVYAASVLFGYFLKSASLRHH  246

Query  717   LEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPD-GGMGSRGFGT----  553
             LE+ +  + + L         + G S            E V +    G  S   G     
Sbjct  247   LEQKVDHINRDLG--------IAGSSQLLLSELRSLGSETVPFSHISGTRSTSVGRIPLV  298

Query  552   -EMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSK  376
              E K  +L+ YVMSFD ETLQ  A  +SKEA+N+IEKH  ALFG  +  +   G      
Sbjct  299   REKKQEKLKYYVMSFDAETLQMCAKPKSKEALNLIEKHIYALFGDEKTGLIASG------  352

Query  375   DELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHF  262
              E+I  S +SL+R+VLEA+ FGSFLWD E  + + Y  
Sbjct  353   -EVISTSLASLKRIVLEAIAFGSFLWDAEEYIRTVYQL  389



>gb|KHN40722.1| hypothetical protein glysoja_049851 [Glycine soja]
Length=381

 Score =   185 bits (470),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 120/354 (34%), Positives = 196/354 (55%), Gaps = 38/354 (11%)
 Frame = -2

Query  1308  IRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLEK  1129
             IRAS   S    S++  +PL+  S +G+FL+ +L +HP +   AV +  +       L  
Sbjct  54    IRASAGASPCEFSSLN-SPLEPRSMVGKFLSAVLQNHPQMFHVAVAEDRDAAHARMVL--  110

Query  1128  QNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAITSP  949
                       ++  + +L+RRIA+VK N+ + A+E+++Y L+  KF +  VP+VP ++S 
Sbjct  111   ---------GSASDEALLHRRIAQVKENQCQIAVEDVMYLLIFYKFSEIRVPMVPKLSSC  161

Query  948   SQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNAN-----SSVQINKLRV  784
               N  G ++ LPSKD +L  +HS E  +MI+ H++ + G R+ ++     ++ Q+ +  +
Sbjct  162   LYN--GRLEILPSKDWELESIHSSEVLDMIREHITTVTGLRAKSSVTECWATTQVRQFLL  219

Query  783   GQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLD--KEDSGIQQVGGDssdtslrsspS  610
              +VY AS++YGYFLK V  R+ LE+N+ +    L      S +   G   +         
Sbjct  220   ARVYVASILYGYFLKSVSLRYHLERNLSLANHDLHLGHRTSVMFSYGFKDAIFG------  273

Query  609   HPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEAL  430
                + + P  G G      E +   L+ YVMSF   +LQR A +RSKEA+N++  ++ AL
Sbjct  274   --HLSNMPSLGQGL--IRPEEEIEDLKCYVMSFHPGSLQRCARLRSKEAVNLVGSYSCAL  329

Query  429   FGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRY  268
             F   E      G++++  D++I  SFSSL+RLVLEAV FGSFLW+ E  +D+ Y
Sbjct  330   FNNKE-----SGSVEN--DDVILTSFSSLKRLVLEAVAFGSFLWETEDYIDNVY  376



>ref|XP_010547130.1| PREDICTED: uncharacterized protein LOC104818981 [Tarenaya hassleriana]
Length=370

 Score =   184 bits (468),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 146/423 (35%), Positives = 218/423 (52%), Gaps = 85/423 (20%)
 Frame = -2

Query  1491  MTTSLRSSITVGCGPVKSGRRFTTDAPGFVKFGSKALLSAPSIKVKLGNRRVAFGSTKCN  1312
             M T L   I++   P+   RR   D+ GF   G  AL   PS +++        G+++C+
Sbjct  1     MDTRLSHQISL---PLLPTRR---DSKGF---GVCAL---PSRRLRSAAVVATAGASRCD  48

Query  1311  SIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQQLEQLQTDRNLE  1132
                         GS++  APL+  S  G+FL+ +L +   L   A   +L+QL  DR   
Sbjct  49    P-----------GSSLN-APLEPRSAQGRFLSSVLQNKRQLFHFAAADELKQLADDRE--  94

Query  1131  KQNEKQNDEPSASGTD-IVLYRRIAEVKANERRKALEEILYALVVQKFMDADVPLVPAIT  955
                   + +  +SG+D   L+RRIA++K +  + A+++I+Y L+  KF +  VPLVP ++
Sbjct  95    ---SAVSRKLLSSGSDEACLHRRIAQLKEHYSQIAVQDIMYMLIFYKFSEIRVPLVPKLS  151

Query  954   SPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNAN-----SSVQINKL  790
                 N  G ++  PSKD +L  +HS +A E+I+ H+S ++G R N++     ++ QI KL
Sbjct  152   RCIYN--GRLEIWPSKDWELESIHSIDALELIKEHVSAVIGLRVNSSVTDNWATTQIQKL  209

Query  789   RVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspS  610
              +G+VY AS++YGYFLK    R QLE ++          D  I Q               
Sbjct  210   HLGRVYTASILYGYFLKSATLRHQLECSLS---------DLQINQ--------------Q  246

Query  609   HPEVVSWPDGGMGSRGFGT---------EMKPSRLRTYVMSFDGETLQRYATIRSKEAIN  457
              P  + +P G +    F T         E+K   LR Y+  F+ ETLQR A  RS+EA N
Sbjct  247   RP--IQFPKGPVFGCSFPTSTPQAFENRELK--HLRHYISGFNPETLQRCAKPRSEEARN  302

Query  456   IIEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVD  277
             +IEK + ALFG+ +             DE++  SFSSL+RLVLEAV FG+FLWD E  VD
Sbjct  303   LIEKQSIALFGQEK------------GDEVVVTSFSSLKRLVLEAVAFGTFLWDTEEYVD  350

Query  276   SRY  268
               Y
Sbjct  351   GVY  353



>ref|NP_001143759.1| uncharacterized protein LOC100276521 [Zea mays]
 gb|ACG35058.1| hypothetical protein [Zea mays]
Length=390

 Score =   185 bits (470),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 135/384 (35%), Positives = 204/384 (53%), Gaps = 62/384 (16%)
 Frame = -2

Query  1335  AFGSTKC----------NSIRASLPLSNSGGSAMPI--------APLKLESPIGQFLTQI  1210
             AFG   C           SI A+  L ++  SA P         APL+ ++  G FL  +
Sbjct  30    AFGYYTCWQLQGNILNWRSISATKKLWSTVASAKPDDSKFESVDAPLEPQTCEGSFLCGL  89

Query  1209  LVSHPHLVSAAVDQQLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIAEVKANERRKA  1030
             L + PH+  AA ++QL++L   R    +   +  E S    +  L+RRIAE+K +E ++A
Sbjct  90    LKNLPHIFLAAAEKQLQELSYQR----EESLKRWEHSIGSKEDCLHRRIAELKEHECQRA  145

Query  1029  LEEILYALVVQKFMDADVPLVPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNH  850
             +E+I+Y L+V KF   +VP+VP ++    N    +   P ++  L  +H PE  E+I+ H
Sbjct  146   IEDIMYMLIVYKFFKIEVPMVPNLSKLISNR--RLQLWPPRETDLESIHGPEVLELIREH  203

Query  849   LSLIL------GNRSNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMK----  700
             L+ I+      G + N  S+++I +L+  ++Y+AS+MYGYFLK V  R +LE  +     
Sbjct  204   LTSIIRWVHRNGPKIN-RSTLRIKRLQFVRIYSASIMYGYFLKSVSIRHRLELTLTRSEG  262

Query  699   VLP-QGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTY  523
             V P Q L+ + +  Q+  G    +S  SS   P  V               + P  LR Y
Sbjct  263   VPPIQFLNAQLTNKQEQEGAIGGSSEASSSLRPSSV---------------VNPHDLRGY  307

Query  522   VMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSK--DELIKISFS  349
             +M FD +TLQ  A +RS EA N+IE+H+ ALFG         G ++ S+  DE + +  S
Sbjct  308   IMGFDPKTLQLCAKLRSSEASNLIERHSWALFG---------GDMELSQENDEAVILDPS  358

Query  348   SLRRLVLEAVTFGSFLWDVESSVD  277
             SL+RL+LEA+ FGSFLWDVE  VD
Sbjct  359   SLKRLLLEAIAFGSFLWDVEDYVD  382



>gb|KFK38188.1| hypothetical protein AALP_AA3G080700 [Arabis alpina]
Length=374

 Score =   184 bits (468),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 130/375 (35%), Positives = 189/375 (50%), Gaps = 70/375 (19%)
 Frame = -2

Query  1350  GNRRVAFGSTKCNSIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVD  1171
               R++ F S     + A+ P     GS++  APL+  S  G+FL  +L++   L   A  
Sbjct  40    ARRKIRFSSIVV--VAAAGPSRCEPGSSLN-APLEPRSAQGRFLRSVLLNKRQLFHFAAA  96

Query  1170  QQLEQLQTDRNLEKQNEKQNDEPSASGTD-IVLYRRIAEVKANERRKALEEILYALVVQK  994
              +L+QL  DR              +SG+D   L+RRIA++K    + A+++I+Y L+  K
Sbjct  97    DELKQLSDDREAALARM-----CLSSGSDEASLHRRIAQLKERYCKTAVQDIMYMLIFYK  151

Query  993   FMDADVPLVPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNAN  814
             + +  VPLVP ++    N  G ++  P+KD +L  +HS EA E+I+ H+S ++G R N+ 
Sbjct  152   YSEIRVPLVPKLSRCIYN--GRLEIWPTKDWELESIHSCEALELIKEHVSAVIGLRVNSC  209

Query  813   -----SSVQINKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVG  649
                  ++ +I KL +G VYAAS++YGYFLK    R QLE                +  + 
Sbjct  210   VTDNWATTEIQKLHLGNVYAASILYGYFLKSASLRHQLE--------------CSLSDIH  255

Query  648   GDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPS--------RLRTYVMSFDGETLQ  493
             G                     G + S  FG     S        +LR Y+ +FD ETLQ
Sbjct  256   G--------------------SGYLKSSVFGCSFTTSNAQISTKQQLRHYISAFDPETLQ  295

Query  492   RYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTF  313
             R A  R++EA+N+IEK + ALFG  +             DE I  SFSSL+RLVLEAV F
Sbjct  296   RCAKPRTEEAMNLIEKQSLALFGTED------------HDETIVTSFSSLKRLVLEAVAF  343

Query  312   GSFLWDVESSVDSRY  268
             G+FLWD E  VD  Y
Sbjct  344   GTFLWDTELYVDGAY  358



>gb|AGT16908.1| hypothetical protein SHCRBa_217_A17_F_90 [Saccharum hybrid cultivar 
R570]
Length=391

 Score =   184 bits (468),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 136/378 (36%), Positives = 204/378 (54%), Gaps = 54/378 (14%)
 Frame = -2

Query  1347  NRRVAFGSTKCNSIRASLPLSNSGGSAMPIAPLKLESPIGQFLTQILVSHPHLVSAAVDQ  1168
             N R  F + K  S  AS    +S   ++  APL+ ++  G FL  +L + PH+  AA  +
Sbjct  45    NWRSIFAAKKLWSTVASAKPDDSKFESVD-APLEPQTWEGSFLCGLLKNLPHIFLAAAAK  103

Query  1167  QLEQLQTDRNLEKQNEKQNDEPSASGTDIVLYRRIAEVKANERRKALEEILYALVVQKFM  988
             QL++L   R    ++     E S    +  L+RRIAE+K  E + A+E+I+Y L+V KF 
Sbjct  104   QLQELSYQR----EDTLNRWEHSIGSKEDCLHRRIAELKEQECQTAIEDIMYMLIVYKFF  159

Query  987   DADVPLVPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLIL------GNR  826
               +VP+VP ++    N    +   P ++  L  +H PE  E+I+ HL+ I+      G +
Sbjct  160   KIEVPMVPNLSKLISNR--RLQLWPPRETDLESIHGPEVLELIREHLTSIIRWVHRNGPK  217

Query  825   SNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQLEKNM---KVLP---QGLDKEDSG  664
              N  S+++I +L+ G++Y+AS+MYGYFLK V  R +LE  +   + LP   Q L+ + + 
Sbjct  218   IN-RSTLRIKRLQFGRIYSASIMYGYFLKSVSIRHRLELTLIHSEELPLPIQFLNAQFTN  276

Query  663   IQQ----VGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETL  496
              Q+    +GG              EV S       SR   + + P  LR Y+M FD +TL
Sbjct  277   KQEQEEAIGGSR------------EVSS------SSRP-NSVVNPHDLRGYMMGFDPKTL  317

Query  495   QRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSK--DELIKISFSSLRRLVLEA  322
             Q  A +RS EA N+IE+H+ ALFG         G ++ S+  DE I +  SSL+RL+LEA
Sbjct  318   QLCAKLRSFEASNLIERHSWALFG---------GNMELSQENDEAIILDPSSLKRLLLEA  368

Query  321   VTFGSFLWDVESSVDSRY  268
             + FGSFLWDVE  VD  Y
Sbjct  369   IAFGSFLWDVEDYVDEIY  386



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5203578534112