BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig11016

Length=1822
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009589224.1|  PREDICTED: probably inactive leucine-rich re...    770   0.0      
emb|CDP14623.1|  unnamed protein product                                769   0.0      Coffea canephora [robusta coffee]
ref|XP_009589223.1|  PREDICTED: probably inactive leucine-rich re...    769   0.0      Nicotiana tomentosiformis
ref|XP_011073820.1|  PREDICTED: probably inactive leucine-rich re...    768   0.0      Sesamum indicum [beniseed]
ref|XP_009765958.1|  PREDICTED: probably inactive leucine-rich re...    766   0.0      Nicotiana sylvestris
ref|XP_004247993.1|  PREDICTED: probably inactive leucine-rich re...    751   0.0      Solanum lycopersicum
ref|XP_006364689.1|  PREDICTED: probably inactive leucine-rich re...    745   0.0      Solanum tuberosum [potatoes]
gb|EYU32740.1|  hypothetical protein MIMGU_mgv1a000860mg                743   0.0      Erythranthe guttata [common monkey flower]
ref|XP_003621730.1|  Probably inactive leucine-rich repeat recept...    734   0.0      Medicago truncatula
ref|XP_007034091.1|  Leucine-rich receptor-like protein kinase fa...    732   0.0      
ref|XP_004296675.1|  PREDICTED: probably inactive leucine-rich re...    729   0.0      Fragaria vesca subsp. vesca
ref|XP_002321093.1|  leucine-rich repeat transmembrane protein ki...    729   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_011000023.1|  PREDICTED: probably inactive leucine-rich re...    725   0.0      Populus euphratica
gb|KHN13843.1|  Probably inactive leucine-rich repeat receptor-li...    723   0.0      Glycine soja [wild soybean]
ref|XP_003552656.1|  PREDICTED: probably inactive leucine-rich re...    722   0.0      Glycine max [soybeans]
gb|KHN27185.1|  Probably inactive leucine-rich repeat receptor-li...    722   0.0      Glycine soja [wild soybean]
ref|XP_003518672.1|  PREDICTED: probably inactive leucine-rich re...    721   0.0      Glycine max [soybeans]
ref|XP_002518223.1|  receptor protein kinase, putative                  721   0.0      Ricinus communis
ref|XP_007139297.1|  hypothetical protein PHAVU_008G017400g             718   0.0      Phaseolus vulgaris [French bean]
ref|XP_010268319.1|  PREDICTED: probably inactive leucine-rich re...    714   0.0      Nelumbo nucifera [Indian lotus]
ref|XP_002265846.1|  PREDICTED: probably inactive leucine-rich re...    710   0.0      Vitis vinifera
ref|XP_009371148.1|  PREDICTED: probably inactive leucine-rich re...    707   0.0      Pyrus x bretschneideri [bai li]
ref|XP_002302895.2|  leucine-rich repeat transmembrane protein ki...    706   0.0      
ref|XP_011042759.1|  PREDICTED: probably inactive leucine-rich re...    701   0.0      Populus euphratica
ref|XP_008337525.1|  PREDICTED: probably inactive leucine-rich re...    698   0.0      Malus domestica [apple tree]
ref|XP_007225370.1|  hypothetical protein PRUPE_ppa000838mg             697   0.0      
ref|XP_010023583.1|  PREDICTED: probably inactive leucine-rich re...    696   0.0      Eucalyptus grandis [rose gum]
gb|KHG00472.1|  hypothetical protein F383_20103                         692   0.0      Gossypium arboreum [tree cotton]
gb|KJB37929.1|  hypothetical protein B456_006G227000                    691   0.0      Gossypium raimondii
ref|XP_004492049.1|  PREDICTED: probably inactive leucine-rich re...    690   0.0      Cicer arietinum [garbanzo]
ref|XP_008244427.1|  PREDICTED: probably inactive leucine-rich re...    689   0.0      Prunus mume [ume]
ref|XP_012072583.1|  PREDICTED: probably inactive leucine-rich re...    687   0.0      Jatropha curcas
ref|XP_010107246.1|  Probably inactive leucine-rich repeat recept...    681   0.0      
gb|KDO44075.1|  hypothetical protein CISIN_1g0027171mg                  670   0.0      Citrus sinensis [apfelsine]
ref|XP_006494521.1|  PREDICTED: probably inactive leucine-rich re...    676   0.0      Citrus sinensis [apfelsine]
gb|KDO44074.1|  hypothetical protein CISIN_1g0027171mg                  671   0.0      Citrus sinensis [apfelsine]
ref|XP_006421080.1|  hypothetical protein CICLE_v10004238mg             671   0.0      Citrus clementina [clementine]
ref|XP_010528265.1|  PREDICTED: probably inactive leucine-rich re...    664   0.0      Tarenaya hassleriana [spider flower]
ref|XP_010929848.1|  PREDICTED: probably inactive leucine-rich re...    662   0.0      Elaeis guineensis
ref|XP_009403616.1|  PREDICTED: probably inactive leucine-rich re...    651   0.0      Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008776998.1|  PREDICTED: LOW QUALITY PROTEIN: probably ina...    650   0.0      
ref|XP_004152295.1|  PREDICTED: probably inactive leucine-rich re...    647   0.0      Cucumis sativus [cucumbers]
ref|XP_009406353.1|  PREDICTED: probably inactive leucine-rich re...    647   0.0      Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010555906.1|  PREDICTED: probably inactive leucine-rich re...    644   0.0      Tarenaya hassleriana [spider flower]
ref|XP_010673272.1|  PREDICTED: probably inactive leucine-rich re...    644   0.0      Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008453972.1|  PREDICTED: probably inactive leucine-rich re...    644   0.0      Cucumis melo [Oriental melon]
ref|XP_010555905.1|  PREDICTED: probably inactive leucine-rich re...    643   0.0      Tarenaya hassleriana [spider flower]
emb|CDX85183.1|  BnaC07g24940D                                          636   0.0      
ref|NP_189443.2|  probably inactive leucine-rich repeat receptor-...    639   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_006290541.1|  hypothetical protein CARUB_v10016623mg             637   0.0      Capsella rubella
ref|XP_010502811.1|  PREDICTED: probably inactive leucine-rich re...    637   0.0      Camelina sativa [gold-of-pleasure]
ref|XP_010514517.1|  PREDICTED: probably inactive leucine-rich re...    635   0.0      Camelina sativa [gold-of-pleasure]
ref|XP_010425587.1|  PREDICTED: probably inactive leucine-rich re...    635   0.0      Camelina sativa [gold-of-pleasure]
ref|XP_002875419.1|  hypothetical protein ARALYDRAFT_484589             635   0.0      
ref|XP_009415955.1|  PREDICTED: probably inactive leucine-rich re...    633   0.0      Musa acuminata subsp. malaccensis [pisang utan]
gb|KFK33718.1|  hypothetical protein AALP_AA5G051000                    632   0.0      Arabis alpina [alpine rockcress]
gb|EPS70115.1|  hypothetical protein M569_04636                         630   0.0      Genlisea aurea
ref|XP_009151898.1|  PREDICTED: probably inactive leucine-rich re...    631   0.0      Brassica rapa
emb|CDY20032.1|  BnaA09g02190D                                          622   0.0      Brassica napus [oilseed rape]
ref|XP_009111587.1|  PREDICTED: probably inactive leucine-rich re...    621   0.0      Brassica rapa
ref|XP_006395381.1|  hypothetical protein EUTSA_v10003580mg             619   0.0      Eutrema salsugineum [saltwater cress]
emb|CDY00141.1|  BnaC09g01600D                                          613   0.0      
ref|NP_001045445.1|  Os01g0957100                                       605   0.0      
dbj|BAB92869.1|  putative receptor-like protein kinase                  605   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|EAY77289.1|  hypothetical protein OsI_05265                          605   0.0      Oryza sativa Indica Group [Indian rice]
ref|XP_006646695.1|  PREDICTED: probably inactive leucine-rich re...    593   0.0      Oryza brachyantha
ref|XP_004971314.1|  PREDICTED: probably inactive leucine-rich re...    569   0.0      Setaria italica
ref|XP_002459131.1|  hypothetical protein SORBIDRAFT_03g046350          545   8e-178   
ref|XP_006840189.1|  PREDICTED: probably inactive leucine-rich re...    532   7e-174   
dbj|BAJ85468.1|  predicted protein                                      531   8e-173   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008655312.1|  PREDICTED: uncharacterized protein LOC100384...    528   2e-171   Zea mays [maize]
gb|ACN33819.1|  unknown                                                 528   2e-171   Zea mays [maize]
ref|XP_008672259.1|  PREDICTED: uncharacterized protein LOC100216...    526   9e-170   
emb|CAN70282.1|  hypothetical protein VITISV_023081                     488   7e-166   Vitis vinifera
ref|XP_003567498.1|  PREDICTED: probably inactive leucine-rich re...    493   6e-158   Brachypodium distachyon [annual false brome]
gb|AES77940.2|  tyrosine kinase family protein                          469   1e-153   Medicago truncatula
ref|XP_003621722.1|  Receptor-like kinase                               471   2e-152   
ref|XP_003621710.1|  Receptor-like protein kinase                       472   8e-150   
emb|CBI39439.3|  unnamed protein product                                461   9e-149   Vitis vinifera
ref|XP_001769840.1|  predicted protein                                  441   3e-139   
ref|XP_001771841.1|  predicted protein                                  437   2e-137   
ref|XP_004502826.1|  PREDICTED: probably inactive leucine-rich re...    436   3e-137   Cicer arietinum [garbanzo]
dbj|BAF79960.1|  receptor-like kinase                                   434   2e-136   Marchantia polymorpha
ref|XP_011084816.1|  PREDICTED: probably inactive leucine-rich re...    433   7e-136   Sesamum indicum [beniseed]
ref|XP_009406870.1|  PREDICTED: probably inactive leucine-rich re...    430   6e-135   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011001391.1|  PREDICTED: probably inactive leucine-rich re...    430   7e-135   Populus euphratica
ref|XP_009416322.1|  PREDICTED: probably inactive leucine-rich re...    427   1e-134   
ref|XP_002325929.2|  leucine-rich repeat transmembrane protein ki...    429   1e-134   
gb|KEH35536.1|  leucine-rich receptor-like kinase family protein        429   2e-134   Medicago truncatula
ref|XP_009416321.1|  PREDICTED: probably inactive leucine-rich re...    428   4e-134   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010253073.1|  PREDICTED: probably inactive leucine-rich re...    426   2e-133   Nelumbo nucifera [Indian lotus]
ref|XP_007136420.1|  hypothetical protein PHAVU_009G043600g             424   7e-133   Phaseolus vulgaris [French bean]
ref|XP_009757206.1|  PREDICTED: probably inactive leucine-rich re...    422   9e-133   Nicotiana sylvestris
ref|XP_002467905.1|  hypothetical protein SORBIDRAFT_01g036160          424   1e-132   Sorghum bicolor [broomcorn]
ref|XP_012091138.1|  PREDICTED: probably inactive leucine-rich re...    424   1e-132   Jatropha curcas
gb|EPS70735.1|  hypothetical protein M569_04020                         423   2e-132   Genlisea aurea
ref|XP_004984462.1|  PREDICTED: probably inactive leucine-rich re...    423   4e-132   Setaria italica
ref|XP_008456780.1|  PREDICTED: probably inactive leucine-rich re...    421   2e-131   Cucumis melo [Oriental melon]
ref|XP_007011288.1|  Leucine-rich repeat protein kinase family pr...    421   2e-131   
ref|XP_011076585.1|  PREDICTED: LOW QUALITY PROTEIN: probably ina...    421   4e-131   Sesamum indicum [beniseed]
ref|XP_003522510.2|  PREDICTED: probably inactive leucine-rich re...    420   5e-131   Glycine max [soybeans]
ref|XP_004138394.1|  PREDICTED: probably inactive leucine-rich re...    419   7e-131   Cucumis sativus [cucumbers]
ref|XP_002520879.1|  ATP binding protein, putative                      419   8e-131   Ricinus communis
ref|NP_001239730.1|  probably inactive leucine-rich repeat recept...    419   1e-130   Glycine max [soybeans]
ref|XP_011095143.1|  PREDICTED: probably inactive leucine-rich re...    419   1e-130   Sesamum indicum [beniseed]
ref|XP_009623562.1|  PREDICTED: probably inactive leucine-rich re...    417   2e-130   Nicotiana tomentosiformis
ref|XP_008233886.1|  PREDICTED: LOW QUALITY PROTEIN: probably ina...    418   3e-130   Prunus mume [ume]
ref|XP_010253067.1|  PREDICTED: probably inactive leucine-rich re...    417   4e-130   Nelumbo nucifera [Indian lotus]
ref|XP_009363794.1|  PREDICTED: probably inactive leucine-rich re...    417   6e-130   Pyrus x bretschneideri [bai li]
ref|XP_006650049.1|  PREDICTED: probably inactive leucine-rich re...    417   9e-130   Oryza brachyantha
ref|XP_002319878.2|  leucine-rich repeat transmembrane protein ki...    416   1e-129   Populus trichocarpa [western balsam poplar]
ref|XP_007220278.1|  hypothetical protein PRUPE_ppa000889mg             416   2e-129   
ref|XP_010683484.1|  PREDICTED: probably inactive leucine-rich re...    414   7e-129   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008369373.1|  PREDICTED: probably inactive leucine-rich re...    414   8e-129   
dbj|BAK06250.1|  predicted protein                                      414   1e-128   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006842493.1|  PREDICTED: probably inactive leucine-rich re...    413   3e-128   Amborella trichopoda
ref|XP_010938277.1|  PREDICTED: probably inactive leucine-rich re...    406   4e-128   
ref|XP_004240861.1|  PREDICTED: probably inactive leucine-rich re...    410   4e-128   Solanum lycopersicum
gb|EYU42026.1|  hypothetical protein MIMGU_mgv1a000905mg                412   4e-128   Erythranthe guttata [common monkey flower]
gb|KHG03607.1|  hypothetical protein F383_26757                         412   5e-128   Gossypium arboreum [tree cotton]
ref|XP_006358746.1|  PREDICTED: probably inactive leucine-rich re...    410   6e-128   Solanum tuberosum [potatoes]
ref|XP_008244834.1|  PREDICTED: probably inactive leucine-rich re...    412   6e-128   Prunus mume [ume]
gb|KJB67929.1|  hypothetical protein B456_010G218400                    412   8e-128   Gossypium raimondii
ref|XP_007207150.1|  hypothetical protein PRUPE_ppa000904mg             411   9e-128   Prunus persica
gb|KJB73018.1|  hypothetical protein B456_011G209800                    411   1e-127   Gossypium raimondii
gb|KHG09451.1|  hypothetical protein F383_09289                         411   1e-127   Gossypium arboreum [tree cotton]
gb|EMT18823.1|  Putative LRR receptor-like serine/threonine-prote...    411   2e-127   
gb|EEC75203.1|  hypothetical protein OsI_11455                          410   3e-127   Oryza sativa Indica Group [Indian rice]
ref|XP_011010875.1|  PREDICTED: probably inactive leucine-rich re...    410   3e-127   Populus euphratica
gb|EAZ26832.1|  hypothetical protein OsJ_10748                          410   4e-127   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001050035.1|  Os03g0335500                                       410   4e-127   
ref|XP_002275275.1|  PREDICTED: probably inactive leucine-rich re...    410   4e-127   Vitis vinifera
gb|EEE55595.1|  hypothetical protein OsJ_03900                          400   5e-127   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008370260.1|  PREDICTED: probably inactive leucine-rich re...    409   8e-127   
gb|EYU35201.1|  hypothetical protein MIMGU_mgv1a000839mg                409   1e-126   Erythranthe guttata [common monkey flower]
ref|XP_009789234.1|  PREDICTED: probably inactive leucine-rich re...    409   1e-126   Nicotiana sylvestris
ref|XP_008788529.1|  PREDICTED: probably inactive leucine-rich re...    408   1e-126   Phoenix dactylifera
ref|XP_006644919.1|  PREDICTED: probably inactive leucine-rich re...    405   2e-126   Oryza brachyantha
ref|XP_010067617.1|  PREDICTED: probably inactive leucine-rich re...    408   2e-126   Eucalyptus grandis [rose gum]
ref|XP_003557968.1|  PREDICTED: probably inactive leucine-rich re...    407   3e-126   Brachypodium distachyon [annual false brome]
ref|XP_009349085.1|  PREDICTED: probably inactive leucine-rich re...    407   3e-126   Pyrus x bretschneideri [bai li]
ref|XP_008681357.1|  PREDICTED: uncharacterized protein LOC100304...    407   4e-126   
ref|XP_009614707.1|  PREDICTED: probably inactive leucine-rich re...    407   5e-126   Nicotiana tomentosiformis
ref|XP_009362809.1|  PREDICTED: probably inactive leucine-rich re...    406   6e-126   Pyrus x bretschneideri [bai li]
ref|XP_004308984.1|  PREDICTED: probably inactive leucine-rich re...    406   1e-125   Fragaria vesca subsp. vesca
ref|XP_010103654.1|  Probably inactive leucine-rich repeat recept...    406   1e-125   Morus notabilis
ref|XP_010922754.1|  PREDICTED: probably inactive leucine-rich re...    406   1e-125   Elaeis guineensis
ref|NP_001044651.1|  Os01g0821900                                       400   1e-125   
ref|XP_010931370.1|  PREDICTED: probably inactive leucine-rich re...    405   2e-125   Elaeis guineensis
ref|XP_009793754.1|  PREDICTED: probably inactive leucine-rich re...    405   3e-125   Nicotiana sylvestris
ref|XP_002990711.1|  hypothetical protein SELMODRAFT_132189             403   3e-125   
ref|XP_006486161.1|  PREDICTED: probably inactive leucine-rich re...    405   3e-125   Citrus sinensis [apfelsine]
ref|XP_007134722.1|  hypothetical protein PHAVU_010G070400g             399   4e-125   Phaseolus vulgaris [French bean]
ref|XP_011010876.1|  PREDICTED: probably inactive leucine-rich re...    404   4e-125   Populus euphratica
ref|XP_006435929.1|  hypothetical protein CICLE_v10030625mg             404   6e-125   
ref|XP_004305081.1|  PREDICTED: probably inactive leucine-rich re...    403   1e-124   Fragaria vesca subsp. vesca
ref|XP_008792235.1|  PREDICTED: LOW QUALITY PROTEIN: probably ina...    403   1e-124   
ref|XP_006429586.1|  hypothetical protein CICLE_v10010994mg             403   1e-124   
ref|XP_009372024.1|  PREDICTED: probably inactive leucine-rich re...    403   1e-124   Pyrus x bretschneideri [bai li]
ref|XP_010092789.1|  Probably inactive leucine-rich repeat recept...    402   2e-124   Morus notabilis
ref|XP_006481196.1|  PREDICTED: probably inactive leucine-rich re...    403   2e-124   Citrus sinensis [apfelsine]
gb|KDO64103.1|  hypothetical protein CISIN_1g002094mg                   402   2e-124   Citrus sinensis [apfelsine]
gb|EAY76307.1|  hypothetical protein OsI_04242                          402   3e-124   Oryza sativa Indica Group [Indian rice]
ref|XP_006341303.1|  PREDICTED: probably inactive leucine-rich re...    402   3e-124   Solanum tuberosum [potatoes]
ref|XP_010043193.1|  PREDICTED: probably inactive leucine-rich re...    401   5e-124   Eucalyptus grandis [rose gum]
emb|CDX72142.1|  BnaC08g27320D                                          400   6e-124   
ref|XP_004246289.1|  PREDICTED: probably inactive leucine-rich re...    401   7e-124   Solanum lycopersicum
dbj|BAB85306.1|  putative receptor-like protein kinase                  400   1e-123   Oryza sativa Japonica Group [Japonica rice]
gb|EMT15869.1|  Putative LRR receptor-like serine/threonine-prote...    398   1e-123   
ref|XP_010670069.1|  PREDICTED: probably inactive leucine-rich re...    400   1e-123   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010427454.1|  PREDICTED: probably inactive leucine-rich re...    400   2e-123   
gb|KHN40633.1|  Probably inactive leucine-rich repeat receptor-li...    390   2e-123   Glycine soja [wild soybean]
ref|XP_007134721.1|  hypothetical protein PHAVU_010G070400g             400   3e-123   Phaseolus vulgaris [French bean]
ref|XP_009116341.1|  PREDICTED: probably inactive leucine-rich re...    399   5e-123   Brassica rapa
ref|XP_002878081.1|  hypothetical protein ARALYDRAFT_907079             399   5e-123   Arabidopsis lyrata subsp. lyrata
ref|XP_002267737.3|  PREDICTED: probably inactive leucine-rich re...    399   6e-123   Vitis vinifera
ref|XP_006655414.1|  PREDICTED: probably inactive leucine-rich re...    394   6e-123   Oryza brachyantha
ref|XP_010525412.1|  PREDICTED: probably inactive leucine-rich re...    398   8e-123   Tarenaya hassleriana [spider flower]
ref|XP_006290556.1|  hypothetical protein CARUB_v10016642mg             398   9e-123   Capsella rubella
ref|XP_010424007.1|  PREDICTED: probably inactive leucine-rich re...    397   1e-122   
gb|AAL49790.1|  unknown protein                                         398   1e-122   Arabidopsis thaliana [mouse-ear cress]
ref|NP_191196.1|  leucine-rich repeat protein kinase-like protein       397   1e-122   Arabidopsis thaliana [mouse-ear cress]
emb|CDY27220.1|  BnaA09g35820D                                          397   2e-122   Brassica napus [oilseed rape]
ref|NP_001142419.1|  uncharacterized protein LOC100274594               384   2e-122   
ref|XP_004241084.1|  PREDICTED: probably inactive leucine-rich re...    397   2e-122   Solanum lycopersicum
ref|XP_007033525.1|  Leucine-rich receptor-like protein kinase fa...    397   3e-122   
ref|XP_009402208.1|  PREDICTED: probably inactive leucine-rich re...    397   4e-122   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010504542.1|  PREDICTED: probably inactive leucine-rich re...    396   5e-122   Camelina sativa [gold-of-pleasure]
ref|XP_003623626.1|  Receptor-like protein kinase                       395   6e-122   
ref|XP_010424006.1|  PREDICTED: probably inactive leucine-rich re...    395   8e-122   
gb|AES79844.2|  LRR receptor-like kinase family protein                 395   9e-122   Medicago truncatula
ref|XP_006357297.1|  PREDICTED: probably inactive leucine-rich re...    395   1e-121   Solanum tuberosum [potatoes]
ref|XP_004970391.1|  PREDICTED: probably inactive leucine-rich re...    393   4e-121   Setaria italica
ref|XP_006290555.1|  hypothetical protein CARUB_v10016642mg             393   4e-121   
ref|XP_010451924.1|  PREDICTED: probably inactive leucine-rich re...    393   5e-121   
ref|XP_002309183.1|  hypothetical protein POPTR_0006s10910g             394   5e-121   
gb|KDP21865.1|  hypothetical protein JCGZ_00652                         384   7e-121   Jatropha curcas
ref|XP_002528692.1|  Brassinosteroid LRR receptor kinase precurso...    393   9e-121   Ricinus communis
ref|XP_010490496.1|  PREDICTED: probably inactive leucine-rich re...    392   1e-120   
ref|XP_010412798.1|  PREDICTED: probably inactive leucine-rich re...    397   2e-120   
ref|XP_008456960.1|  PREDICTED: probably inactive leucine-rich re...    390   6e-120   Cucumis melo [Oriental melon]
tpg|DAA57062.1|  TPA: putative leucine-rich repeat receptor-like ...    390   7e-120   
ref|XP_003533657.2|  PREDICTED: probably inactive leucine-rich re...    390   8e-120   Glycine max [soybeans]
ref|XP_004146470.1|  PREDICTED: probably inactive leucine-rich re...    389   1e-119   Cucumis sativus [cucumbers]
ref|XP_006402993.1|  hypothetical protein EUTSA_v10005773mg             389   2e-119   Eutrema salsugineum [saltwater cress]
ref|XP_002870895.1|  hypothetical protein ARALYDRAFT_486880             389   2e-119   
gb|EEE64100.1|  hypothetical protein OsJ_18931                          387   3e-119   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002323672.2|  hypothetical protein POPTR_0016s14410g             389   3e-119   Populus trichocarpa [western balsam poplar]
ref|NP_001055847.2|  Os05g0478300                                       387   7e-119   
emb|CDY04822.1|  BnaAnng00040D                                          386   1e-118   
ref|XP_011019006.1|  PREDICTED: probably inactive leucine-rich re...    387   1e-118   Populus euphratica
ref|XP_002458686.1|  hypothetical protein SORBIDRAFT_03g038240          387   1e-118   Sorghum bicolor [broomcorn]
ref|XP_006279331.1|  hypothetical protein CARUB_v10012717mg             387   2e-118   Capsella rubella
ref|NP_001136621.1|  uncharacterized protein LOC100216746               371   2e-118   
ref|XP_008359946.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    397   2e-118   
ref|NP_195809.1|  leucine-rich receptor-like protein kinase             385   6e-118   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004492560.1|  PREDICTED: probably inactive leucine-rich re...    385   7e-118   Cicer arietinum [garbanzo]
gb|KFK24685.1|  hypothetical protein AALP_AA8G011600                    385   1e-117   Arabis alpina [alpine rockcress]
ref|XP_011002596.1|  PREDICTED: probably inactive leucine-rich re...    385   1e-117   Populus euphratica
gb|KFK34877.1|  Leucine-rich repeat protein kinase family protein       384   2e-117   Arabis alpina [alpine rockcress]
ref|XP_010232495.1|  PREDICTED: LOW QUALITY PROTEIN: probably ina...    384   2e-117   Brachypodium distachyon [annual false brome]
ref|XP_007140080.1|  hypothetical protein PHAVU_008G082500g             384   3e-117   Phaseolus vulgaris [French bean]
ref|XP_011019007.1|  PREDICTED: probably inactive leucine-rich re...    383   4e-117   Populus euphratica
ref|XP_012091046.1|  PREDICTED: probably inactive leucine-rich re...    383   5e-117   
ref|XP_004137674.1|  PREDICTED: probably inactive leucine-rich re...    382   9e-117   Cucumis sativus [cucumbers]
ref|XP_008442319.1|  PREDICTED: probably inactive leucine-rich re...    381   3e-116   Cucumis melo [Oriental melon]
ref|XP_006398567.1|  hypothetical protein EUTSA_v10012579mg             380   6e-116   Eutrema salsugineum [saltwater cress]
ref|XP_003516434.1|  PREDICTED: probably inactive leucine-rich re...    380   6e-116   Glycine max [soybeans]
gb|KHN11868.1|  Probably inactive leucine-rich repeat receptor-li...    380   6e-116   Glycine soja [wild soybean]
gb|KHM99411.1|  Probably inactive leucine-rich repeat receptor-li...    375   1e-115   Glycine soja [wild soybean]
gb|KJB71525.1|  hypothetical protein B456_011G127000                    378   4e-115   Gossypium raimondii
ref|XP_002439964.1|  hypothetical protein SORBIDRAFT_09g023480          376   2e-114   Sorghum bicolor [broomcorn]
ref|XP_009125388.1|  PREDICTED: probably inactive leucine-rich re...    375   2e-114   Brassica rapa
ref|XP_003521989.1|  PREDICTED: probably inactive leucine-rich re...    374   1e-113   Glycine max [soybeans]
emb|CBI25352.3|  unnamed protein product                                369   6e-113   Vitis vinifera
ref|XP_010553156.1|  PREDICTED: probably inactive leucine-rich re...    370   4e-112   Tarenaya hassleriana [spider flower]
ref|XP_004961741.1|  PREDICTED: probably inactive leucine-rich re...    367   3e-111   
ref|XP_008649763.1|  PREDICTED: probably inactive leucine-rich re...    365   2e-110   Zea mays [maize]
emb|CDP13903.1|  unnamed protein product                                362   7e-110   Coffea canephora [robusta coffee]
ref|XP_003605286.1|  Receptor-like protein kinase                       358   2e-108   Medicago truncatula
ref|XP_002509644.1|  leucine-rich repeat transmembrane protein ki...    358   2e-108   Ricinus communis
ref|XP_004514781.1|  PREDICTED: probably inactive leucine-rich re...    357   2e-107   
emb|CDP09856.1|  unnamed protein product                                353   1e-106   Coffea canephora [robusta coffee]
ref|XP_002303543.1|  leucine-rich repeat transmembrane protein ki...    353   1e-106   
ref|XP_006440456.1|  hypothetical protein CICLE_v10018802mg             353   1e-106   Citrus clementina [clementine]
ref|XP_006477322.1|  PREDICTED: probable LRR receptor-like serine...    350   2e-105   Citrus sinensis [apfelsine]
gb|KDO63698.1|  hypothetical protein CISIN_1g002759mg                   350   3e-105   Citrus sinensis [apfelsine]
ref|XP_002275029.3|  PREDICTED: probable LRR receptor-like serine...    348   8e-105   Vitis vinifera
ref|XP_004298715.1|  PREDICTED: probable LRR receptor-like serine...    348   1e-104   Fragaria vesca subsp. vesca
ref|XP_008448931.1|  PREDICTED: probable LRR receptor-like serine...    347   5e-104   Cucumis melo [Oriental melon]
ref|XP_004147984.1|  PREDICTED: probable LRR receptor-like serine...    346   5e-104   Cucumis sativus [cucumbers]
ref|XP_010546137.1|  PREDICTED: probable LRR receptor-like serine...    345   1e-103   
ref|XP_010053385.1|  PREDICTED: probable LRR receptor-like serine...    345   2e-103   Eucalyptus grandis [rose gum]
ref|XP_008782666.1|  PREDICTED: LOW QUALITY PROTEIN: probably ina...    346   2e-103   
ref|XP_007040033.1|  Leucine-rich repeat protein kinase family pr...    338   3e-103   
ref|XP_011029116.1|  PREDICTED: probable LRR receptor-like serine...    344   8e-103   Populus euphratica
ref|XP_002299581.2|  leucine-rich repeat transmembrane protein ki...    344   8e-103   
ref|XP_009400469.1|  PREDICTED: probable LRR receptor-like serine...    343   1e-102   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_012087063.1|  PREDICTED: probable LRR receptor-like serine...    342   2e-102   Jatropha curcas
gb|KJB25688.1|  hypothetical protein B456_004G204100                    342   4e-102   Gossypium raimondii
ref|XP_011015709.1|  PREDICTED: probable LRR receptor-like serine...    342   6e-102   Populus euphratica
ref|XP_010108089.1|  putative LRR receptor-like serine/threonine-...    341   7e-102   Morus notabilis
ref|XP_002988156.1|  hypothetical protein SELMODRAFT_40688              339   2e-101   
emb|CBI23559.3|  unnamed protein product                                328   2e-101   Vitis vinifera
ref|XP_002972654.1|  hypothetical protein SELMODRAFT_98598              340   2e-101   Selaginella moellendorffii
ref|XP_007040030.1|  Leucine-rich repeat protein kinase family pr...    339   3e-101   
ref|XP_007040031.1|  Leucine-rich repeat protein kinase family pr...    338   3e-101   
ref|XP_011015430.1|  PREDICTED: probable LRR receptor-like serine...    338   5e-101   Populus euphratica
ref|XP_011033860.1|  PREDICTED: probable LRR receptor-like serine...    338   8e-101   Populus euphratica
dbj|BAH20406.1|  AT1G12460                                              331   1e-100   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009373339.1|  PREDICTED: probable LRR receptor-like serine...    337   2e-100   Pyrus x bretschneideri [bai li]
ref|XP_002991210.1|  hypothetical protein SELMODRAFT_236225             335   2e-100   
ref|XP_007210377.1|  hypothetical protein PRUPE_ppa001194mg             336   5e-100   Prunus persica
ref|XP_008808300.1|  PREDICTED: LOW QUALITY PROTEIN: probably ina...    337   5e-100   
ref|XP_008238681.1|  PREDICTED: probable LRR receptor-like serine...    336   5e-100   Prunus mume [ume]
ref|XP_006363743.1|  PREDICTED: LOW QUALITY PROTEIN: probable LRR...    337   6e-100   
ref|XP_008803301.1|  PREDICTED: probable LRR receptor-like serine...    336   6e-100   Phoenix dactylifera
ref|XP_006303147.1|  hypothetical protein CARUB_v10008271mg             335   9e-100   Capsella rubella
ref|XP_002991272.1|  hypothetical protein SELMODRAFT_236241             333   1e-99    
ref|XP_004245688.1|  PREDICTED: probable LRR receptor-like serine...    335   1e-99    
ref|XP_010494199.1|  PREDICTED: probable LRR receptor-like serine...    335   1e-99    
ref|NP_001159235.1|  uncharacterized protein LOC100304322               317   3e-99    
ref|XP_009804678.1|  PREDICTED: probable LRR receptor-like serine...    333   4e-99    
ref|XP_008373864.1|  PREDICTED: probable LRR receptor-like serine...    333   6e-99    
ref|XP_009626686.1|  PREDICTED: probable LRR receptor-like serine...    333   7e-99    
ref|XP_007158425.1|  hypothetical protein PHAVU_002G152100g             333   7e-99    
ref|XP_010462668.1|  PREDICTED: probable LRR receptor-like serine...    334   1e-98    
gb|KFK43514.1|  hypothetical protein AALP_AA1G135400                    332   1e-98    
ref|XP_003538720.1|  PREDICTED: probable LRR receptor-like serine...    332   2e-98    
gb|KJB51988.1|  hypothetical protein B456_008G241300                    332   2e-98    
ref|XP_008361939.1|  PREDICTED: probable LRR receptor-like serine...    331   3e-98    
ref|XP_010476218.1|  PREDICTED: probable LRR receptor-like serine...    331   4e-98    
ref|NP_172708.1|  putative LRR receptor-like serine/threonine-pro...    331   4e-98    
gb|AAO22764.1|  putative leucine-rich repeat transmembrane protei...    331   4e-98    
ref|XP_010919178.1|  PREDICTED: probable LRR receptor-like serine...    330   8e-98    
gb|AAF79640.1|AC025416_14  F5O11.21                                     330   8e-98    
ref|XP_008780314.1|  PREDICTED: probable LRR receptor-like serine...    327   1e-97    
ref|XP_009389657.1|  PREDICTED: probable LRR receptor-like serine...    328   3e-97    
ref|XP_009148589.1|  PREDICTED: probable LRR receptor-like serine...    328   6e-97    
gb|KHN42733.1|  Putative LRR receptor-like serine/threonine-prote...    327   1e-96    
ref|XP_011071078.1|  PREDICTED: probable LRR receptor-like serine...    327   1e-96    
ref|XP_003516680.1|  PREDICTED: probable LRR receptor-like serine...    327   1e-96    
ref|XP_002889936.1|  hypothetical protein ARALYDRAFT_888571             325   4e-96    
ref|XP_003611204.1|  Protein kinase like protein                        325   9e-96    
gb|AES94162.2|  LRR receptor-like kinase family protein                 325   1e-95    
ref|XP_006391803.1|  hypothetical protein EUTSA_v10023252mg             324   1e-95    
ref|XP_006573744.1|  PREDICTED: probable LRR receptor-like serine...    323   3e-95    
ref|XP_010933925.1|  PREDICTED: probable LRR receptor-like serine...    321   2e-94    
ref|XP_010921155.1|  PREDICTED: probably inactive leucine-rich re...    321   4e-94    
ref|XP_010921154.1|  PREDICTED: probably inactive leucine-rich re...    322   4e-94    
emb|CDY30082.1|  BnaC05g09380D                                          314   6e-93    
ref|XP_001759642.1|  predicted protein                                  317   1e-92    
gb|KDO67528.1|  hypothetical protein CISIN_1g002321mg                   317   2e-92    
ref|XP_010676626.1|  PREDICTED: probable LRR receptor-like serine...    315   2e-92    
ref|XP_010276110.1|  PREDICTED: probable LRR receptor-like serine...    315   2e-92    
ref|XP_002887991.1|  hypothetical protein ARALYDRAFT_475059             315   4e-92    
gb|KHG18414.1|  hypothetical protein F383_21876                         312   3e-91    
dbj|BAJ89617.1|  predicted protein                                      305   2e-88    
dbj|BAK03696.1|  predicted protein                                      303   5e-88    
gb|KEH16892.1|  leucine-rich receptor-like kinase family protein        285   5e-87    
gb|ERN19496.1|  hypothetical protein AMTR_s00069p00201070               296   1e-85    
ref|XP_011628427.1|  PREDICTED: probable LRR receptor-like serine...    297   2e-85    
gb|KHF98277.1|  hypothetical protein F383_15451                         296   2e-85    
ref|XP_008650433.1|  PREDICTED: probable LRR receptor-like serine...    293   5e-84    
gb|EMT17457.1|  Putative LRR receptor-like serine/threonine-prote...    290   7e-84    
ref|XP_002468593.1|  hypothetical protein SORBIDRAFT_01g048690          289   2e-82    
ref|XP_004511633.1|  PREDICTED: probable LRR receptor-like serine...    283   2e-80    
gb|ABR68656.1|  receptor-like kinase Tg-34                              256   7e-78    
ref|XP_006662538.1|  PREDICTED: probable LRR receptor-like serine...    272   2e-77    
gb|EAY79312.1|  hypothetical protein OsI_34439                          272   5e-77    
ref|NP_001176249.1|  Os10g0531700                                       272   5e-77    
ref|XP_007138215.1|  hypothetical protein PHAVU_009G190400g             266   8e-77    
gb|EEE51301.1|  hypothetical protein OsJ_32252                          272   8e-77    
gb|EAY88364.1|  hypothetical protein OsI_09819                          273   1e-76    
ref|XP_006651000.1|  PREDICTED: probable LRR receptor-like serine...    271   1e-76    
ref|XP_007138216.1|  hypothetical protein PHAVU_009G190400g             265   2e-76    
ref|NP_001048834.1|  Os03g0127700                                       272   2e-76    
ref|XP_007138217.1|  hypothetical protein PHAVU_009G190400g             266   3e-76    
ref|XP_007138218.1|  hypothetical protein PHAVU_009G190400g             264   9e-76    
dbj|BAE98888.1|  protein kinase like protein                            267   7e-75    
ref|NP_176483.1|  putative leucine-rich repeat transmembrane prot...    268   7e-75    
emb|CDX98061.1|  BnaA06g08120D                                          265   3e-74    
ref|XP_006300607.1|  hypothetical protein CARUB_v10019771mg             265   4e-74    
ref|XP_009596435.1|  PREDICTED: LRR receptor-like serine/threonin...    259   5e-74    
ref|XP_008234089.1|  PREDICTED: LOW QUALITY PROTEIN: probably ina...    263   8e-74    
ref|XP_009793727.1|  PREDICTED: LRR receptor-like serine/threonin...    258   2e-73    
ref|XP_010277468.1|  PREDICTED: LOW QUALITY PROTEIN: probable LRR...    256   2e-73    
ref|XP_003562151.1|  PREDICTED: probable LRR receptor-like serine...    263   5e-73    
ref|NP_001290509.1|  probably inactive leucine-rich repeat recept...    262   1e-72    
ref|XP_007210873.1|  hypothetical protein PRUPE_ppa003105mg             253   1e-71    
ref|XP_010112590.1|  LRR receptor-like serine/threonine-protein k...    251   4e-71    
ref|XP_006581954.1|  PREDICTED: LRR receptor-like serine/threonin...    251   5e-71    
gb|KDO60347.1|  hypothetical protein CISIN_1g001752mg                   258   6e-71    
ref|XP_006480075.1|  PREDICTED: leucine-rich repeat receptor-like...    258   7e-71    
ref|XP_004985881.1|  PREDICTED: probable LRR receptor-like serine...    256   8e-71    
ref|XP_008374516.1|  PREDICTED: LRR receptor-like serine/threonin...    251   1e-70    
ref|XP_007037205.1|  Leucine-rich repeat protein kinase family pr...    251   1e-70    
ref|XP_006581953.1|  PREDICTED: LRR receptor-like serine/threonin...    251   1e-70    
ref|XP_001763904.1|  predicted protein                                  254   1e-70    
ref|XP_009343456.1|  PREDICTED: LRR receptor-like serine/threonin...    250   1e-70    
gb|ACI05905.1|  kinase-like protein pac.x.5.39                          236   2e-70    
gb|KHN19373.1|  LRR receptor-like serine/threonine-protein kinase...    250   2e-70    
ref|XP_006838718.1|  PREDICTED: LRR receptor-like serine/threonin...    250   2e-70    
ref|XP_009369360.1|  PREDICTED: LRR receptor-like serine/threonin...    250   2e-70    
gb|AES91180.2|  LRR receptor-like kinase                                250   2e-70    
ref|XP_004508778.1|  PREDICTED: LRR receptor-like serine/threonin...    249   4e-70    
ref|XP_003608983.1|  LRR receptor-like serine/threonine-protein k...    249   5e-70    
ref|XP_012080199.1|  PREDICTED: LRR receptor-like serine/threonin...    249   6e-70    
gb|KDP31199.1|  hypothetical protein JCGZ_11575                         248   7e-70    
gb|ACI05906.1|  kinase-like protein pac.x.5.43                          234   1e-69    
gb|EYU35887.1|  hypothetical protein MIMGU_mgv1a003189mg                248   1e-69    
ref|XP_010256225.1|  PREDICTED: LRR receptor-like serine/threonin...    248   1e-69    
ref|XP_003527058.1|  PREDICTED: LRR receptor-like serine/threonin...    248   1e-69    
ref|XP_009151389.1|  PREDICTED: LRR receptor-like serine/threonin...    248   1e-69    
ref|XP_004508779.1|  PREDICTED: LRR receptor-like serine/threonin...    247   2e-69    
ref|XP_009773743.1|  PREDICTED: LRR receptor-like serine/threonin...    247   2e-69    
dbj|BAB10839.1|  receptor-like protein kinase                           246   2e-69    
ref|XP_009614181.1|  PREDICTED: LRR receptor-like serine/threonin...    247   3e-69    
ref|XP_006412927.1|  hypothetical protein EUTSA_v10024302mg             253   3e-69    
ref|NP_201077.2|  leucine-rich repeat protein kinase-like protein       247   3e-69    
ref|XP_006439659.1|  hypothetical protein CICLE_v10019379mg             246   4e-69    
ref|XP_006476661.1|  PREDICTED: LRR receptor-like serine/threonin...    246   4e-69    
ref|XP_010447945.1|  PREDICTED: leucine-rich repeat receptor-like...    253   4e-69    
ref|XP_006579547.1|  PREDICTED: LRR receptor-like serine/threonin...    246   7e-69    
ref|XP_002867439.1|  hypothetical protein ARALYDRAFT_328832             251   8e-69    
gb|KHN08861.1|  LRR receptor-like serine/threonine-protein kinase...    245   1e-68    
gb|KFK28003.1|  hypothetical protein AALP_AA8G459000                    245   1e-68    
ref|XP_009398396.1|  PREDICTED: LRR receptor-like serine/threonin...    245   1e-68    
ref|XP_010433191.1|  PREDICTED: leucine-rich repeat receptor-like...    251   1e-68    
ref|XP_008660543.1|  PREDICTED: probable LRR receptor-like serine...    249   2e-68    
ref|XP_007155343.1|  hypothetical protein PHAVU_003G193100g             244   2e-68    
ref|XP_006280205.1|  hypothetical protein CARUB_v10026113mg             244   3e-68    
ref|XP_010459245.1|  PREDICTED: LRR receptor-like serine/threonin...    244   3e-68    
ref|XP_010444123.1|  PREDICTED: LRR receptor-like serine/threonin...    244   4e-68    
ref|XP_006285784.1|  hypothetical protein CARUB_v10007258mg             249   5e-68    
ref|XP_010550651.1|  PREDICTED: LRR receptor-like serine/threonin...    243   6e-68    
ref|XP_006394359.1|  hypothetical protein EUTSA_v10003855mg             243   7e-68    
emb|CDY35204.1|  BnaA01g08270D                                          249   8e-68    
ref|XP_009129466.1|  PREDICTED: leucine-rich repeat receptor-like...    249   9e-68    
ref|XP_010256230.1|  PREDICTED: LRR receptor-like serine/threonin...    243   9e-68    
gb|KHN48658.1|  LRR receptor-like serine/threonine-protein kinase...    242   2e-67    
ref|XP_002864814.1|  leucine-rich repeat family protein                 242   2e-67    
gb|KHN18521.1|  LRR receptor-like serine/threonine-protein kinase...    242   2e-67    
emb|CDY38373.1|  BnaC01g09820D                                          246   5e-67    
gb|EYU40542.1|  hypothetical protein MIMGU_mgv1a0012872mg               230   6e-67    
ref|XP_010483983.1|  PREDICTED: LRR receptor-like serine/threonin...    240   8e-67    
ref|XP_009112029.1|  PREDICTED: LRR receptor-like serine/threonin...    239   2e-66    
ref|XP_010678588.1|  PREDICTED: LRR receptor-like serine/threonin...    238   4e-66    
ref|XP_008453174.1|  PREDICTED: LRR receptor-like serine/threonin...    236   4e-66    
ref|XP_007037207.1|  Leucine-rich repeat protein kinase family pr...    235   4e-66    
gb|ABK93925.1|  unknown                                                 238   5e-66    
ref|XP_010678587.1|  PREDICTED: LRR receptor-like serine/threonin...    238   5e-66    
ref|XP_010028759.1|  PREDICTED: LRR receptor-like serine/threonin...    238   7e-66    
ref|XP_008453173.1|  PREDICTED: LRR receptor-like serine/threonin...    237   1e-65    
ref|XP_004299405.1|  PREDICTED: LRR receptor-like serine/threonin...    236   2e-65    
ref|XP_001775671.1|  predicted protein                                  239   4e-65    
ref|XP_012076552.1|  PREDICTED: phytosulfokine receptor 2               241   6e-65    
ref|NP_001067376.1|  Os12g0638100                                       235   9e-65    
ref|XP_010236962.1|  PREDICTED: LRR receptor-like serine/threonin...    234   9e-65    
tpg|DAA54785.1|  TPA: putative leucine-rich repeat receptor-like ...    235   1e-64    
emb|CDY00321.1|  BnaA06g22220D                                          234   1e-64    
ref|XP_006664782.1|  PREDICTED: LRR receptor-like serine/threonin...    234   1e-64    
emb|CDP14870.1|  unnamed protein product                                234   1e-64    
gb|EEC69743.1|  hypothetical protein OsI_39273                          234   2e-64    
ref|XP_010318957.1|  PREDICTED: LRR receptor-like serine/threonin...    234   2e-64    
ref|XP_004963330.1|  PREDICTED: LRR receptor-like serine/threonin...    234   2e-64    
ref|NP_001147056.1|  ATP binding protein                                233   6e-64    
emb|CDY56672.1|  BnaCnng30900D                                          235   2e-63    
ref|XP_009400864.1|  PREDICTED: LRR receptor-like serine/threonin...    231   2e-63    
emb|CDX84346.1|  BnaC03g51540D                                          231   2e-63    
ref|XP_006367065.1|  PREDICTED: LRR receptor-like serine/threonin...    229   8e-63    
emb|CDX87267.1|  BnaC09g05820D                                          229   8e-63    
ref|XP_008796642.1|  PREDICTED: LRR receptor-like serine/threonin...    229   8e-63    
ref|XP_002443660.1|  hypothetical protein SORBIDRAFT_08g023040          229   2e-62    
gb|ADM67539.1|  STK-like protein kinase                                 216   2e-62    
gb|KHG14766.1|  LRR receptor-like serine/threonine-protein kinase...    228   2e-62    
gb|AAF88073.1|AC025417_1  T12C24.1                                      216   5e-62    
ref|XP_004141971.1|  PREDICTED: systemin receptor SR160                 233   6e-62    
gb|KFK29405.1|  hypothetical protein AALP_AA7G129800                    231   6e-62    
gb|KHG18268.1|  LRR receptor-like serine/threonine-protein kinase...    226   8e-62    
ref|XP_009398397.1|  PREDICTED: LRR receptor-like serine/threonin...    226   1e-61    
gb|KJB39878.1|  hypothetical protein B456_007G035200                    225   2e-61    
ref|NP_001242206.1|  LRR receptor-like serine/threonine-protein k...    224   5e-61    
emb|CAN76686.1|  hypothetical protein VITISV_005469                     210   2e-60    
ref|XP_010531422.1|  PREDICTED: protein BRASSINOSTEROID INSENSITI...    228   4e-60    
ref|XP_010674258.1|  PREDICTED: leucine-rich repeat receptor-like...    226   5e-60    
ref|XP_001781606.1|  predicted protein                                  215   9e-60    
gb|AFW88861.1|  putative leucine-rich repeat receptor-like protei...    220   1e-59    
ref|XP_010555311.1|  PREDICTED: protein BRASSINOSTEROID INSENSITI...    225   2e-59    
gb|EMT09348.1|  LRR receptor-like serine/threonine-protein kinase...    220   3e-59    
ref|XP_001776133.1|  predicted protein                                  219   3e-59    
ref|NP_194594.1|  putative leucine-rich repeat transmembrane prot...    224   3e-59    
gb|AEP14546.1|  clavata 1-like protein                                  223   4e-59    
ref|XP_002510009.1|  receptor protein kinase, putative                  222   7e-59    
gb|KJB10046.1|  hypothetical protein B456_001G181900                    223   7e-59    
ref|XP_008218929.1|  PREDICTED: receptor-like protein kinase HAIKU2     222   8e-59    
ref|XP_010438416.1|  PREDICTED: leucine-rich repeat receptor-like...    223   9e-59    
ref|XP_011025575.1|  PREDICTED: systemin receptor SR160                 224   1e-58    
ref|XP_001767285.1|  predicted protein                                  217   1e-58    
ref|XP_010109178.1|  putative inactive receptor kinase                  218   2e-58    
gb|KDO57102.1|  hypothetical protein CISIN_1g046275mg                   222   4e-58    
dbj|BAJ91524.1|  predicted protein                                      213   7e-58    
ref|XP_006467628.1|  PREDICTED: probable LRR receptor-like serine...    216   8e-58    
ref|XP_010924677.1|  PREDICTED: receptor-like protein kinase HSL1       218   9e-58    
ref|XP_006427932.1|  hypothetical protein CICLE_v10024737mg             220   2e-57    
ref|XP_002510897.1|  erecta, putative                                   218   2e-57    
gb|AFW89736.1|  putative leucine-rich repeat transmembrane protei...    218   2e-57    
gb|EPS65760.1|  hypothetical protein M569_09017                         209   4e-57    
ref|XP_010268580.1|  PREDICTED: systemin receptor SR160-like            219   5e-57    
gb|KCW89004.1|  hypothetical protein EUGRSUZ_A01326                     218   6e-57    
ref|XP_004250411.1|  PREDICTED: receptor-like protein kinase HAIKU2     216   7e-57    
gb|EMS63784.1|  LRR receptor-like serine/threonine-protein kinase...    212   7e-57    
ref|XP_002310619.1|  brassinosteroid insensitive 1 precursor fami...    218   8e-57    
gb|KJB10047.1|  hypothetical protein B456_001G181900                    216   9e-57    
ref|XP_010048149.1|  PREDICTED: probable LRR receptor-like serine...    218   1e-56    
ref|XP_010241342.1|  PREDICTED: receptor-like serine/threonine-pr...    206   2e-56    
ref|XP_001768500.1|  predicted protein                                  211   2e-56    
ref|XP_001763816.1|  predicted protein                                  206   2e-56    
dbj|BAJ86808.1|  predicted protein                                      217   2e-56    
dbj|BAJ97017.1|  predicted protein                                      217   3e-56    
gb|KEH42461.1|  LRR receptor-like kinase family protein                 214   5e-56    
ref|XP_010036153.1|  PREDICTED: leucine-rich repeat receptor-like...    214   5e-56    
gb|AFN44233.1|  BRI1 protein                                            214   5e-56    
gb|ACO55044.1|  receptor-like kinase                                    198   5e-56    
ref|XP_010241344.1|  PREDICTED: receptor-like serine/threonine-pr...    204   6e-56    
ref|XP_008239850.1|  PREDICTED: LRR receptor-like serine/threonin...    210   6e-56    
ref|XP_006847569.2|  PREDICTED: receptor-like serine/threonine-pr...    204   8e-56    
ref|XP_006350342.1|  PREDICTED: receptor-like protein kinase HAIK...    213   1e-55    
gb|ABO27628.1|  BRI1 protein                                            214   1e-55    
ref|XP_009597788.1|  PREDICTED: systemin receptor SR160                 214   1e-55    
ref|XP_008437655.1|  PREDICTED: LRR receptor-like serine/threonin...    209   2e-55    
ref|XP_010460971.1|  PREDICTED: LRR receptor-like serine/threonin...    209   2e-55    
emb|CAE54285.1|  receptor-like kinase with LRR repeats                  196   2e-55    
ref|XP_010241346.1|  PREDICTED: receptor-like serine/threonine-pr...    202   2e-55    
ref|XP_010106739.1|  Receptor-like serine/threonine-protein kinase      202   3e-55    
gb|KDO44837.1|  hypothetical protein CISIN_1g008031mg                   208   3e-55    
ref|XP_010499692.1|  PREDICTED: LRR receptor-like serine/threonin...    208   4e-55    
ref|XP_010261021.1|  PREDICTED: systemin receptor SR160                 213   4e-55    
ref|XP_001777220.1|  predicted protein                                  201   8e-55    
ref|XP_008444269.1|  PREDICTED: LRR receptor-like serine/threonin...    204   1e-54    



>ref|XP_009589224.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 isoform X2 [Nicotiana tomentosiformis]
Length=938

 Score =   770 bits (1989),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/543 (78%), Positives = 480/543 (88%), Gaps = 5/543 (1%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             SAL+G IP DIC+SGSLGILQLDGNSLTG IP +IGNCSSL LLSLSHNNLSG+IP +LS
Sbjct  401   SALVGSIPGDICDSGSLGILQLDGNSLTGPIPDEIGNCSSLYLLSLSHNNLSGSIPRSLS  460

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGN  1463
             ML++LKILKLE NQLSGEIPQ+LGKLENLLAVN+SYNRL GRLP GSIFQNLD S++EGN
Sbjct  461   MLRKLKILKLEYNQLSGEIPQELGKLENLLAVNISYNRLVGRLPFGSIFQNLDQSSLEGN  520

Query  1462  DGICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRFLsvsai  1283
              GICSPLL GPCKMN PKP+V++P+ YGNQ    N GD      S R  +HHRFLS+S+I
Sbjct  521   LGICSPLLKGPCKMNVPKPLVLDPYAYGNQMGGQNRGDETSRSNSKR-FKHHRFLSISSI  579

Query  1282  vaisaaaiiavgvmvITMVNASVRRRISFVENALESMCSSTSSRSQGMATGKLILFDTKS  1103
             VAISAAA+IAVGVMVI ++NASVRR+I+FV+NALESMCSS+S     +ATGKL+L D+K+
Sbjct  580   VAISAAALIAVGVMVIALLNASVRRKIAFVDNALESMCSSSSKSGS-LATGKLVLLDSKT  638

Query  1102  SPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDFDRE  923
             SPDW +++ ESVLNKA EIGEGVFGTVYKAPLGGEG R+VAIKKL +SKILQYPEDFDRE
Sbjct  639   SPDWTNNSLESVLNKACEIGEGVFGTVYKAPLGGEG-RLVAIKKLVTSKILQYPEDFDRE  697

Query  922   VRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAVRFK  743
             VRVL KARHQNL+ LRGYYWTPQLQLLVSD+ P G+L++KLH+   +     L+W+ RFK
Sbjct  698   VRVLAKARHQNLISLRGYYWTPQLQLLVSDYAPEGSLQAKLHDRPSSSPP--LSWSNRFK  755

Query  742   IILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVMSNR  563
             I+LGTAKGLAHLHH+ +P IIHYNIKPSNILLDENLNPKISDFGLARLV KLD+H++SNR
Sbjct  756   IVLGTAKGLAHLHHAFRPAIIHYNIKPSNILLDENLNPKISDFGLARLVTKLDKHMISNR  815

Query  562   FQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRVLL  383
             FQ+A+GYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRP+EY EDNVLILNDHVRVLL
Sbjct  816   FQSALGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPIEYCEDNVLILNDHVRVLL  875

Query  382   EQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPVPNRM  203
             EQGNVLECVD  +  YP+EEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPVP RM
Sbjct  876   EQGNVLECVDPTLDTYPEEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPVPQRM  935

Query  202   EPY  194
             E Y
Sbjct  936   EAY  938


 Score = 56.6 bits (135),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 42/119 (35%), Positives = 62/119 (52%), Gaps = 0/119 (0%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
               G IPE + +  +L  L L  N + G  P  I N SSL  L  S N+L G++P+++  L
Sbjct  211   FTGAIPESVQKLNALSFLTLSNNMINGDFPQWISNMSSLEYLDFSGNSLEGSLPDSIGDL  270

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGND  1460
             K LK L L  N+LSG IP+ +    +L  + +  N LTG +P G     L+ +    N+
Sbjct  271   KMLKYLSLSGNKLSGNIPKSMVYCTSLSTIRLKENALTGSIPEGLFGIGLEEADFSRNE  329


 Score = 53.9 bits (128),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 44/137 (32%), Positives = 66/137 (48%), Gaps = 25/137 (18%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETL-  1646
             ++L G +P+ I +   L  L L GN L+G IP  +  C+SL+ + L  N L+G+IPE L 
Sbjct  257   NSLEGSLPDSIGDLKMLKYLSLSGNKLSGNIPKSMVYCTSLSTIRLKENALTGSIPEGLF  316

Query  1645  -----------------------SMLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSY  1535
                                     + + L++L L  N L+G IP ++G    L  +N+S+
Sbjct  317   GIGLEEADFSRNELSGSIPPGSGKLFESLQVLDLSGNNLTGNIPAEVGLFSKLRYLNLSW  376

Query  1534  NRLTGRLPAG-SIFQNL  1487
             N    RLP     FQNL
Sbjct  377   NNFQSRLPPEVGYFQNL  393



>emb|CDP14623.1| unnamed protein product [Coffea canephora]
Length=1020

 Score =   769 bits (1987),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/545 (78%), Positives = 484/545 (89%), Gaps = 8/545 (1%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             SAL G IPEDIC+SGS+ ILQLD NSLTG IP +IGNCSSL LLSLSHN+L+G IP ++S
Sbjct  482   SALTGSIPEDICDSGSIRILQLDENSLTGPIPNEIGNCSSLFLLSLSHNSLTGPIPPSVS  541

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAG--SIFQNLDSSAIE  1469
             +LK+LKILKLE NQLSGEIPQ LGKLENLLAVN+SYNRL GRLPAG  SIFQNLD SA+E
Sbjct  542   LLKKLKILKLEFNQLSGEIPQDLGKLENLLAVNISYNRLIGRLPAGPGSIFQNLDQSALE  601

Query  1468  GNDGICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRFLsvs  1289
             GN GICSPLL GPCKMN PKP+V++P+ YGN   + N  D  EP  STR+ RHHRFLSVS
Sbjct  602   GNLGICSPLLRGPCKMNVPKPLVLDPYAYGNHGGDQNQDD--EPSRSTRSFRHHRFLSVS  659

Query  1288  aivaisaaaiiavgvmvITMVNASVRRRISFVENALESMCSSTSSRSQGMATGKLILFDT  1109
             AIVAISAAA+IAVGVMVIT++NAS RR+I+FV+NALESMCSS S++S  +A GKLILFD+
Sbjct  660   AIVAISAAAVIAVGVMVITLINASARRKIAFVDNALESMCSS-STKSGSVAAGKLILFDS  718

Query  1108  KSSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDFD  929
             KSSPDW SS+ ES+LNKA+EIG GVFGTVYKA LGGEG +VVAIKKL +S I++YPEDFD
Sbjct  719   KSSPDWISSSLESILNKAAEIGGGVFGTVYKASLGGEG-KVVAIKKLVTSNIVEYPEDFD  777

Query  928   REVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAVR  749
             REVR LG+ARHQNL+PLRGYYWTPQLQLLVSD+ P G+L++KLHE   + A  PLTWA R
Sbjct  778   REVRTLGRARHQNLIPLRGYYWTPQLQLLVSDYAPEGSLQAKLHERPPSAA--PLTWATR  835

Query  748   FKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVMS  569
             FKI+LGTAKGLAHLHHS +PPIIHYN+KPSNILLDE++NPKISDFGLARL+ KLD+HV+S
Sbjct  836   FKIVLGTAKGLAHLHHSIRPPIIHYNVKPSNILLDEHMNPKISDFGLARLLTKLDKHVIS  895

Query  568   NRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRV  389
             +RFQ+A+GYVAPELACQSLRVNEKCDV+GFG+LILEIVTGRRPVEYGEDNV+IL+DHVRV
Sbjct  896   SRFQSALGYVAPELACQSLRVNEKCDVFGFGVLILEIVTGRRPVEYGEDNVMILSDHVRV  955

Query  388   LLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPVPN  209
             LLEQGN L+CVD  MG YP++EV PVLKLALVCTSQIPSSRPSMAEVVQILQVIKTP+P 
Sbjct  956   LLEQGNALDCVDPSMGNYPEDEVSPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPLPQ  1015

Query  208   RMEPY  194
             RME Y
Sbjct  1016  RMEAY  1020


 Score = 60.8 bits (146),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 56/102 (55%), Gaps = 0/102 (0%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G++P  I    +L  L L GN  +G+IP  IG C  L+ +  S+N  +G +PE+L  L
Sbjct  244   LSGQLPLGISAMHNLKELLLQGNHFSGSIPTDIGFCPHLSTIDFSNNLFTGALPESLQRL  303

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP  1511
               L    L  N L G+ PQ + KL +L  ++ S N+L G LP
Sbjct  304   NALNFFSLSNNVLDGDFPQWINKLSSLEYLDFSGNKLQGSLP  345


 Score = 52.8 bits (125),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 44/104 (42%), Positives = 61/104 (59%), Gaps = 2/104 (2%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G +P  I E  +L  L L  N LTG IP  +  C  L+++ LS N L+G+IPE L  +
Sbjct  340   LQGSLPMSIGEMNALEFLDLSNNRLTGNIPTSMALCGGLSVIQLSGNALNGSIPEGLFDM  399

Query  1636  KRLKILKLEVNQLSGEIPQQLGKL-ENLLAVNVSYNRLTGRLPA  1508
             + L  L L  N+L+G IP    +L E+L  +++S N LTG LPA
Sbjct  400   E-LDELDLSRNELTGSIPSGSSELFESLHVLDLSGNNLTGGLPA  442



>ref|XP_009589223.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 isoform X1 [Nicotiana tomentosiformis]
Length=1012

 Score =   769 bits (1986),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/543 (78%), Positives = 480/543 (88%), Gaps = 5/543 (1%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             SAL+G IP DIC+SGSLGILQLDGNSLTG IP +IGNCSSL LLSLSHNNLSG+IP +LS
Sbjct  475   SALVGSIPGDICDSGSLGILQLDGNSLTGPIPDEIGNCSSLYLLSLSHNNLSGSIPRSLS  534

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGN  1463
             ML++LKILKLE NQLSGEIPQ+LGKLENLLAVN+SYNRL GRLP GSIFQNLD S++EGN
Sbjct  535   MLRKLKILKLEYNQLSGEIPQELGKLENLLAVNISYNRLVGRLPFGSIFQNLDQSSLEGN  594

Query  1462  DGICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRFLsvsai  1283
              GICSPLL GPCKMN PKP+V++P+ YGNQ    N GD      S R  +HHRFLS+S+I
Sbjct  595   LGICSPLLKGPCKMNVPKPLVLDPYAYGNQMGGQNRGDETSRSNSKR-FKHHRFLSISSI  653

Query  1282  vaisaaaiiavgvmvITMVNASVRRRISFVENALESMCSSTSSRSQGMATGKLILFDTKS  1103
             VAISAAA+IAVGVMVI ++NASVRR+I+FV+NALESMCSS+S     +ATGKL+L D+K+
Sbjct  654   VAISAAALIAVGVMVIALLNASVRRKIAFVDNALESMCSSSSKSGS-LATGKLVLLDSKT  712

Query  1102  SPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDFDRE  923
             SPDW +++ ESVLNKA EIGEGVFGTVYKAPLGGEG R+VAIKKL +SKILQYPEDFDRE
Sbjct  713   SPDWTNNSLESVLNKACEIGEGVFGTVYKAPLGGEG-RLVAIKKLVTSKILQYPEDFDRE  771

Query  922   VRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAVRFK  743
             VRVL KARHQNL+ LRGYYWTPQLQLLVSD+ P G+L++KLH+   +     L+W+ RFK
Sbjct  772   VRVLAKARHQNLISLRGYYWTPQLQLLVSDYAPEGSLQAKLHDRPSSSPP--LSWSNRFK  829

Query  742   IILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVMSNR  563
             I+LGTAKGLAHLHH+ +P IIHYNIKPSNILLDENLNPKISDFGLARLV KLD+H++SNR
Sbjct  830   IVLGTAKGLAHLHHAFRPAIIHYNIKPSNILLDENLNPKISDFGLARLVTKLDKHMISNR  889

Query  562   FQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRVLL  383
             FQ+A+GYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRP+EY EDNVLILNDHVRVLL
Sbjct  890   FQSALGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPIEYCEDNVLILNDHVRVLL  949

Query  382   EQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPVPNRM  203
             EQGNVLECVD  +  YP+EEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPVP RM
Sbjct  950   EQGNVLECVDPTLDTYPEEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPVPQRM  1009

Query  202   EPY  194
             E Y
Sbjct  1010  EAY  1012


 Score = 57.0 bits (136),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 57/104 (55%), Gaps = 0/104 (0%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
               G IPE + +  +L  L L  N + G  P  I N SSL  L  S N+L G++P+++  L
Sbjct  285   FTGAIPESVQKLNALSFLTLSNNMINGDFPQWISNMSSLEYLDFSGNSLEGSLPDSIGDL  344

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAG  1505
             K LK L L  N+LSG IP+ +    +L  + +  N LTG +P G
Sbjct  345   KMLKYLSLSGNKLSGNIPKSMVYCTSLSTIRLKENALTGSIPEG  388


 Score = 53.9 bits (128),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 44/137 (32%), Positives = 66/137 (48%), Gaps = 25/137 (18%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETL-  1646
             ++L G +P+ I +   L  L L GN L+G IP  +  C+SL+ + L  N L+G+IPE L 
Sbjct  331   NSLEGSLPDSIGDLKMLKYLSLSGNKLSGNIPKSMVYCTSLSTIRLKENALTGSIPEGLF  390

Query  1645  -----------------------SMLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSY  1535
                                     + + L++L L  N L+G IP ++G    L  +N+S+
Sbjct  391   GIGLEEADFSRNELSGSIPPGSGKLFESLQVLDLSGNNLTGNIPAEVGLFSKLRYLNLSW  450

Query  1534  NRLTGRLPAG-SIFQNL  1487
             N    RLP     FQNL
Sbjct  451   NNFQSRLPPEVGYFQNL  467



>ref|XP_011073820.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Sesamum indicum]
Length=1009

 Score =   768 bits (1984),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/543 (78%), Positives = 484/543 (89%), Gaps = 6/543 (1%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             S LIG IP DIC+SGSL ILQLDGNSLTG +P +IGNCSSL LLSLSHNNLSG IPE++S
Sbjct  473   SGLIGSIPGDICDSGSLAILQLDGNSLTGPVPEEIGNCSSLYLLSLSHNNLSGPIPESMS  532

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGN  1463
             +L +LKILKLEVNQLSGEIPQ+LG+LENLL  N+SYNRL GRLPAG IFQ LD+SAIEGN
Sbjct  533   LLSKLKILKLEVNQLSGEIPQELGRLENLLIANISYNRLVGRLPAGGIFQTLDASAIEGN  592

Query  1462  DGICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRFLsvsai  1283
              GICSPLL GPCK+N PKP+V++P+ YGNQ    N G+  E   S+ N RHHRFLSVSAI
Sbjct  593   LGICSPLLKGPCKLNVPKPLVLDPYAYGNQMGGQNRGN--ERSRSSTNFRHHRFLSVSAI  650

Query  1282  vaisaaaiiavgvmvITMVNASVRRRISFVENALESMCSSTSSRSQGMATGKLILFDTKS  1103
             VAISAAA+IAVGV+VI+++NAS RRRI+FV+NALESMCSS S+RS  MA GKLILFD+KS
Sbjct  651   VAISAAAVIAVGVVVISLLNASARRRIAFVDNALESMCSS-STRSANMAAGKLILFDSKS  709

Query  1102  SPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDFDRE  923
             SPDW S++F+SVLNKA+EIGEGVFGTVYKA +GG+G+  VAIKKL ++  LQY E+FDRE
Sbjct  710   SPDWLSTSFDSVLNKAAEIGEGVFGTVYKASVGGQGT-TVAIKKLITANTLQYQEEFDRE  768

Query  922   VRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAVRFK  743
             VR+LGKARH NL+PLRGYYWTPQLQLLVSD+   G+L++KLHE + +  + PLTWA RFK
Sbjct  769   VRILGKARHPNLIPLRGYYWTPQLQLLVSDYAVEGSLQAKLHEPSPS--SLPLTWANRFK  826

Query  742   IILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVMSNR  563
             I++GTAKGLAHLHHSC+PPIIHYNIKPSNILLDENLNPKISDFGLARL+ KLD+HV+SNR
Sbjct  827   IVMGTAKGLAHLHHSCRPPIIHYNIKPSNILLDENLNPKISDFGLARLLTKLDKHVVSNR  886

Query  562   FQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRVLL  383
             FQ+A GYVAPELACQSLRVNEKCDVYGFG+LILE+V+GRRPVEYGEDNV+IL+DHVRVLL
Sbjct  887   FQSAPGYVAPELACQSLRVNEKCDVYGFGVLILELVSGRRPVEYGEDNVVILSDHVRVLL  946

Query  382   EQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPVPNRM  203
             EQGNVL+CVD  MG YP+EEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPVPNRM
Sbjct  947   EQGNVLDCVDLSMGKYPEEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPVPNRM  1006

Query  202   EPY  194
             E +
Sbjct  1007  EAF  1009


 Score = 60.1 bits (144),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 44/119 (37%), Positives = 63/119 (53%), Gaps = 0/119 (0%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             LIG +P+ +    +L  L L  N LTG  P  IG  SSL  L  S+N L+G++P ++  L
Sbjct  283   LIGPVPQSLQRLNALKFLSLANNFLTGDFPQWIGQMSSLEYLDFSNNGLTGSLPTSMGDL  342

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGND  1460
             K LK L L  N+LSG IP  + ++ +L  V +  N   G +P G     LD   +  N+
Sbjct  343   KSLKFLSLSNNKLSGSIPTTIAEISSLSLVRLRGNTFNGSIPEGLFDMKLDEVDLSRNE  401


 Score = 58.2 bits (139),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/103 (38%), Positives = 58/103 (56%), Gaps = 0/103 (0%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G +P  +    +L  L L GN  +G +P  +G C  L+ L  S+N L G +P++L  L
Sbjct  235   LTGPVPVGMAVMHNLKELILHGNQFSGALPADVGLCPHLSRLDFSNNLLIGPVPQSLQRL  294

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPA  1508
               LK L L  N L+G+ PQ +G++ +L  ++ S N LTG LP 
Sbjct  295   NALKFLSLANNFLTGDFPQWIGQMSSLEYLDFSNNGLTGSLPT  337


 Score = 57.4 bits (137),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 35/111 (32%), Positives = 57/111 (51%), Gaps = 1/111 (1%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G IP  I E  SL +++L GN+  G+IP  + +     +    +       P +  + 
Sbjct  355   LSGSIPTTIAEISSLSLVRLRGNTFNGSIPEGLFDMKLDEVDLSRNELTGSIPPASSKLS  414

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAG-SIFQNL  1487
             + L+IL L  N ++G+IP ++G    L  +N+S+N L  R+P     FQNL
Sbjct  415   ETLQILDLSGNNITGDIPAEMGLFSRLRYLNLSWNNLESRMPPELGFFQNL  465



>ref|XP_009765958.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Nicotiana sylvestris]
Length=1012

 Score =   766 bits (1977),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/543 (78%), Positives = 478/543 (88%), Gaps = 5/543 (1%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             SAL+G IP DIC+SGSLGILQLDGNS TG IP +IGNCSSL LLSLSHNNLSG+IP +LS
Sbjct  475   SALVGSIPGDICDSGSLGILQLDGNSFTGPIPDEIGNCSSLYLLSLSHNNLSGSIPRSLS  534

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGN  1463
             ML++LKILKLE NQLSGEIPQ LGKLENLLAVN+SYNRL GRLP G+IFQNLD S++EGN
Sbjct  535   MLRKLKILKLEYNQLSGEIPQDLGKLENLLAVNISYNRLVGRLPLGNIFQNLDQSSLEGN  594

Query  1462  DGICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRFLsvsai  1283
              GICSPLL GPCKMN PKP+V++P+ YGNQ    N GD      S R  +HHRFLS+S+I
Sbjct  595   LGICSPLLKGPCKMNVPKPLVLDPYAYGNQMGGQNRGDETSRSNSKR-FKHHRFLSISSI  653

Query  1282  vaisaaaiiavgvmvITMVNASVRRRISFVENALESMCSSTSSRSQGMATGKLILFDTKS  1103
             VAISAAA+IA+GVMVI ++NASVRR+I+FV+NALESMCSS+S     +ATGKL+L D+KS
Sbjct  654   VAISAAAVIAIGVMVIALLNASVRRKIAFVDNALESMCSSSSKSGS-LATGKLVLLDSKS  712

Query  1102  SPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDFDRE  923
             SPDW +++ ESVLNKA EIGEGVFGTVYKAPLGGEG R+VAIKKL +SKILQYPEDFDRE
Sbjct  713   SPDWTNTSLESVLNKACEIGEGVFGTVYKAPLGGEG-RLVAIKKLVTSKILQYPEDFDRE  771

Query  922   VRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAVRFK  743
             VRVL KARHQNL+ LRGYYWTPQLQLLVSD+ P G+L++KLHE   +     L+W+ RFK
Sbjct  772   VRVLAKARHQNLISLRGYYWTPQLQLLVSDYAPEGSLQAKLHERPSSSPP--LSWSTRFK  829

Query  742   IILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVMSNR  563
             I+LGTAKGLAHLHH+ +P IIHYNIKPSNILLDENLNPKISDFGLARLV KLD+H++SNR
Sbjct  830   IVLGTAKGLAHLHHAFRPAIIHYNIKPSNILLDENLNPKISDFGLARLVTKLDKHMISNR  889

Query  562   FQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRVLL  383
             FQ+A+GYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRP+EY EDNVLILNDHVRVLL
Sbjct  890   FQSALGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPIEYCEDNVLILNDHVRVLL  949

Query  382   EQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPVPNRM  203
             EQGNVL+CVD  +  YP+EEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPVP RM
Sbjct  950   EQGNVLDCVDPTLDTYPEEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPVPQRM  1009

Query  202   EPY  194
             E Y
Sbjct  1010  EAY  1012


 Score = 58.9 bits (141),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 42/119 (35%), Positives = 63/119 (53%), Gaps = 0/119 (0%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
               G IPE + +  +L  L L  N + G  P  I N SSL  L  S N++ GT+P+++  L
Sbjct  285   FTGAIPESVQKLNALSFLSLSNNMINGDFPQWISNMSSLEYLDFSGNSIEGTLPDSIGDL  344

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGND  1460
             K LK L L  N+LSG+IP+ +    +L  + +  N LTG +P G     L+ +    N+
Sbjct  345   KMLKYLSLSGNKLSGKIPKSMVYCTSLSTIRLKENALTGSIPEGLFGIGLEEADFSRNE  403



>ref|XP_004247993.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Solanum lycopersicum]
Length=1012

 Score =   751 bits (1940),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/543 (78%), Positives = 482/543 (89%), Gaps = 2/543 (0%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             SAL+G IP DIC+SGSLGILQLDGNS TG IP +IGNCSSL LLSLSHNNLSG+IP +LS
Sbjct  472   SALVGSIPGDICDSGSLGILQLDGNSFTGPIPDEIGNCSSLYLLSLSHNNLSGSIPRSLS  531

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGN  1463
             MLK+LKILKLE NQLSGEIPQ+LGKLENLLAVN+SYNRL GRLP  SIFQNLD S++EGN
Sbjct  532   MLKKLKILKLEYNQLSGEIPQELGKLENLLAVNISYNRLVGRLPMSSIFQNLDQSSLEGN  591

Query  1462  DGICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRFLsvsai  1283
              GICSPLL GPCKMN PKP+V++P+ YGNQ+     GD+    ++ ++ ++HRFLSVS+I
Sbjct  592   LGICSPLLKGPCKMNVPKPLVLDPYAYGNQSRGGQNGDDGASRSNNKSFKNHRFLSVSSI  651

Query  1282  vaisaaaiiavgvmvITMVNASVRRRISFVENALESMCSSTSSRSQGMATGKLILFDTKS  1103
             VAISAAA+IAVGVM+IT++NASVRRRI+FV+NALESMCSS+S     +ATGKL+L DTKS
Sbjct  652   VAISAAAVIAVGVMIITLLNASVRRRITFVDNALESMCSSSSKSGT-LATGKLVLLDTKS  710

Query  1102  SPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDFDRE  923
             SPDW +S+ ES+L+KAS+IGEGVFGTVYKAPLGGEG R+VA+KKL +SKILQYPEDFDRE
Sbjct  711   SPDWTNSSLESILDKASQIGEGVFGTVYKAPLGGEG-RIVAVKKLVTSKILQYPEDFDRE  769

Query  922   VRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAVRFK  743
             VRVL KARH NL+ L+GYYWTPQLQLLVSD+ P G+L++ LHE   +  + PL+W+ RF 
Sbjct  770   VRVLAKARHPNLISLKGYYWTPQLQLLVSDYAPEGSLQAILHERPSSSTSLPLSWSTRFN  829

Query  742   IILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVMSNR  563
             I+LGTAKGLAHLHH+ +P IIHYNIKPSNILLDEN NP+ISDFGLARLV KLD+H++S+R
Sbjct  830   IVLGTAKGLAHLHHAFRPAIIHYNIKPSNILLDENFNPRISDFGLARLVTKLDKHMISSR  889

Query  562   FQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRVLL  383
             FQ+A+GYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRVLL
Sbjct  890   FQSALGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRVLL  949

Query  382   EQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPVPNRM  203
             EQGNVLECVD  M  YP+EEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPVP RM
Sbjct  950   EQGNVLECVDPTMNTYPEEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPVPQRM  1009

Query  202   EPY  194
             E Y
Sbjct  1010  EVY  1012


 Score = 54.7 bits (130),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 39/104 (38%), Positives = 56/104 (54%), Gaps = 0/104 (0%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
               G+IP  + +  +L  L L  N + G  P  I N SSL  L LS N+L G +P+++  L
Sbjct  282   FTGQIPMSLQKVNALSFLSLSNNMINGDFPQWISNMSSLEYLDLSGNSLEGALPDSIGDL  341

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAG  1505
             K LK L L  N+LSG IP+ +    +L  + +  N  TG +P G
Sbjct  342   KMLKYLSLSGNKLSGNIPKSMVYCTSLSTIRIKENAFTGSIPEG  385


 Score = 53.5 bits (127),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 42/137 (31%), Positives = 64/137 (47%), Gaps = 25/137 (18%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETL-  1646
             ++L G +P+ I +   L  L L GN L+G IP  +  C+SL+ + +  N  +G+IPE L 
Sbjct  328   NSLEGALPDSIGDLKMLKYLSLSGNKLSGNIPKSMVYCTSLSTIRIKENAFTGSIPEGLF  387

Query  1645  -----------------------SMLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSY  1535
                                       + L++L L  N L+G IP ++G    L  +N+S+
Sbjct  388   GIGLEEADFSRNELTGSIPPGSGKFFESLQVLDLSGNNLTGNIPAEVGLFSKLRYLNLSW  447

Query  1534  NRLTGRLPAG-SIFQNL  1487
             N    RLP     FQNL
Sbjct  448   NNFQSRLPPEVGYFQNL  464



>ref|XP_006364689.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Solanum tuberosum]
Length=1011

 Score =   745 bits (1924),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/543 (78%), Positives = 477/543 (88%), Gaps = 3/543 (1%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             SAL+G IP DIC+SGSLGILQLDGNS TG IP +IGNCSSL LLSLSHNNLSG+IP +LS
Sbjct  472   SALVGSIPGDICDSGSLGILQLDGNSFTGPIPDEIGNCSSLYLLSLSHNNLSGSIPRSLS  531

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGN  1463
             MLK+LKILKLE NQLSGEIPQ+LGKLENLLAVN+SYNRL GRLP  SIFQNLD S++EGN
Sbjct  532   MLKKLKILKLEYNQLSGEIPQELGKLENLLAVNISYNRLVGRLPMSSIFQNLDQSSLEGN  591

Query  1462  DGICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRFLsvsai  1283
              GICSPLL GPCKMN PKP+V++P+ YGNQ    N  D     ++ ++ ++HRFLSVS+I
Sbjct  592   LGICSPLLKGPCKMNVPKPLVLDPYAYGNQRGGQNRDDGTSR-SNNKSFKNHRFLSVSSI  650

Query  1282  vaisaaaiiavgvmvITMVNASVRRRISFVENALESMCSSTSSRSQGMATGKLILFDTKS  1103
             VAISAAA+IAVGVM+IT++NASVRRRI+FV+NALESMCSS+S     +ATGKL+L DTK 
Sbjct  651   VAISAAAVIAVGVMIITLLNASVRRRITFVDNALESMCSSSSKSGS-LATGKLVLLDTKL  709

Query  1102  SPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDFDRE  923
             SPDW +S+ ES+LNKAS+IGEGVFGTVYKAPLGGEG R+VAIKKL +SKILQYPEDFDRE
Sbjct  710   SPDWTNSSLESILNKASQIGEGVFGTVYKAPLGGEG-RIVAIKKLVTSKILQYPEDFDRE  768

Query  922   VRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAVRFK  743
             VR L KARH NL+ L+GYYWTPQLQLLVSD+ P G+L++ LHE   +  + PL+W+ RF 
Sbjct  769   VRALAKARHPNLISLKGYYWTPQLQLLVSDYAPEGSLQTILHERPSSSTSLPLSWSTRFN  828

Query  742   IILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVMSNR  563
             I+LGTAKGLAHLHH+ +P IIHYNIKPSNILLDEN NP+ISDFGLARLV KLD+H++SNR
Sbjct  829   IVLGTAKGLAHLHHAFRPAIIHYNIKPSNILLDENFNPRISDFGLARLVTKLDKHMISNR  888

Query  562   FQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRVLL  383
             FQ+A+GYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRVLL
Sbjct  889   FQSALGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRVLL  948

Query  382   EQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPVPNRM  203
             EQGNVLECVD  M  YP+EEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPVP RM
Sbjct  949   EQGNVLECVDPTMKTYPEEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPVPQRM  1008

Query  202   EPY  194
               Y
Sbjct  1009  SAY  1011


 Score = 53.5 bits (127),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 43/137 (31%), Positives = 65/137 (47%), Gaps = 25/137 (18%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETL-  1646
             ++L G +P+ I +   L  L L GN L+G IP  +  C+SL+ + +  N L+G+IPE L 
Sbjct  328   NSLEGALPDSIGDLKMLKYLSLSGNKLSGNIPKSMVYCTSLSTIRMKENALTGSIPEGLF  387

Query  1645  -----------------------SMLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSY  1535
                                       + L++L L  N L+G IP ++G    L  +N+S+
Sbjct  388   GIGLEEADFSRNELTGSIPPGSGKFFESLQVLDLSGNNLTGNIPAEVGLFSKLRYLNLSW  447

Query  1534  NRLTGRLPAG-SIFQNL  1487
             N    RLP     FQNL
Sbjct  448   NNFQSRLPPEVGYFQNL  464


 Score = 53.5 bits (127),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 55/104 (53%), Gaps = 0/104 (0%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
               G+IP  +     L  L L  N + G  P  I N SSL  L LS N+L G +P+++  L
Sbjct  282   FTGQIPMSLQRVNVLSFLSLSNNMINGDFPQWISNMSSLEYLDLSGNSLEGALPDSIGDL  341

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAG  1505
             K LK L L  N+LSG IP+ +    +L  + +  N LTG +P G
Sbjct  342   KMLKYLSLSGNKLSGNIPKSMVYCTSLSTIRMKENALTGSIPEG  385



>gb|EYU32740.1| hypothetical protein MIMGU_mgv1a000860mg [Erythranthe guttata]
Length=957

 Score =   743 bits (1917),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/540 (75%), Positives = 470/540 (87%), Gaps = 11/540 (2%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             S LIG IP DIC+S SL ILQLDGNSLTG IP +IGNCSSL LLSLSHNNLSGTIPE++S
Sbjct  429   SGLIGSIPGDICDSSSLAILQLDGNSLTGQIPYEIGNCSSLYLLSLSHNNLSGTIPESMS  488

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGN  1463
             +L +LKILKLEVNQL+GEIPQQLGKLENLL  NVSYNRL GRLPAG IFQ LDSSAIEGN
Sbjct  489   LLTKLKILKLEVNQLTGEIPQQLGKLENLLIANVSYNRLVGRLPAGGIFQTLDSSAIEGN  548

Query  1462  DGICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRFLsvsai  1283
              GICSPLLTGPCK+N PKP+V++P+ YGNQ   ++          + N RHHRFLSVS+I
Sbjct  549   LGICSPLLTGPCKLNVPKPLVLDPYAYGNQNGAHDRAR-----ERSTNFRHHRFLSVSSI  603

Query  1282  vaisaaaiiavgvmvITMVNASVRRRISFVENALESMCSSTSSRSQGMATGKLILFDTKS  1103
             VAISAAA+IA GVMVIT++NAS RRR++FV+NALESMCSS S+RS  +  GKLILFD+KS
Sbjct  604   VAISAAAVIAAGVMVITLLNASARRRMAFVDNALESMCSS-STRSGNLTAGKLILFDSKS  662

Query  1102  SPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDFDRE  923
             S DW S+  ++VLNKA+EIGEGVFGTVY+A   G+G  +VAIKKL +S  LQY E+FDRE
Sbjct  663   SLDWLSTNLDNVLNKAAEIGEGVFGTVYRA---GQGQAMVAIKKLVTSNTLQYQEEFDRE  719

Query  922   VRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAVRFK  743
             +R+L KARH NL+PLRGYYWTPQLQLLVSD+   G+L++KLHE + +  + PLTW  RFK
Sbjct  720   IRILAKARHPNLIPLRGYYWTPQLQLLVSDYAVQGSLQAKLHEHSPS--SMPLTWPDRFK  777

Query  742   IILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVMSNR  563
             I+LGTAKGL+HLHHS +PPI+HYN+KPSNILLDENLNPKISDFGLAR++ KLD+HVMS+R
Sbjct  778   IVLGTAKGLSHLHHSFRPPIVHYNVKPSNILLDENLNPKISDFGLARILTKLDKHVMSSR  837

Query  562   FQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRVLL  383
             FQ+A GYVAPELACQSLRVNEKCDVYGFG+L+LE+VTGRRPVEYGEDNV+IL+DHVRV+L
Sbjct  838   FQSAPGYVAPELACQSLRVNEKCDVYGFGVLVLELVTGRRPVEYGEDNVVILSDHVRVML  897

Query  382   EQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPVPNRM  203
             E+GNVL+CVD  MG YP+EEVLPV+KLALVCTSQIPSSRPSMAEVVQIL+VIKTP+PNRM
Sbjct  898   ERGNVLDCVDLEMGEYPEEEVLPVVKLALVCTSQIPSSRPSMAEVVQILEVIKTPLPNRM  957


 Score = 58.9 bits (141),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 40/109 (37%), Positives = 58/109 (53%), Gaps = 4/109 (4%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             +A  G +P  +    +L  L L+ N  +G++PP IG C  L+ +  S+N  +GTIP +L 
Sbjct  185   NAFSGSVPIGMSAVHNLKELLLNRNQFSGSVPPDIGLCPHLSRIDFSNNLFTGTIPASLQ  244

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLA----VNVSYNRLTGRLPA  1508
              L  L  L L  N L+G+ PQ +G      A    ++ S N LTG LPA
Sbjct  245   KLNSLNFLNLSFNFLTGDFPQWIGSQTTTAAAFEYIDFSNNALTGTLPA  293


 Score = 56.6 bits (135),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 35/111 (32%), Positives = 58/111 (52%), Gaps = 1/111 (1%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G +P  +    SL +++L GN+  GTIP  + +     +    +N      P +  + 
Sbjct  311   LSGPLPNSLSGLASLSVIRLKGNAFNGTIPNGLFDMKLDEIDLSRNNLAGPIPPASSKLF  370

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAG-SIFQNL  1487
             + L++L L  N L+G+IP ++G    L  +N+S+N+L  RLP     FQNL
Sbjct  371   ETLQVLDLSENNLAGDIPAEMGLFGKLTYLNLSWNQLESRLPPEIGYFQNL  421


 Score = 55.8 bits (133),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 60/123 (49%), Gaps = 4/123 (3%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGN----CssltllslshnnlSGTIPET  1649
               G IP  + +  SL  L L  N LTG  P  IG+     ++   +  S+N L+GT+P T
Sbjct  235   FTGTIPASLQKLNSLNFLNLSFNFLTGDFPQWIGSQTTTAAAFEYIDFSNNALTGTLPAT  294

Query  1648  LSMLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIE  1469
             +  LK LK L L  N+LSG +P  L  L +L  + +  N   G +P G     LD   + 
Sbjct  295   IGDLKSLKFLSLSENKLSGPLPNSLSGLASLSVIRLKGNAFNGTIPNGLFDMKLDEIDLS  354

Query  1468  GND  1460
              N+
Sbjct  355   RNN  357



>ref|XP_003621730.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Medicago truncatula]
 gb|AES77948.1| LRR receptor-like kinase family protein [Medicago truncatula]
Length=1016

 Score =   734 bits (1894),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/544 (73%), Positives = 463/544 (85%), Gaps = 7/544 (1%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             SAL G IPED C+SG+L +LQLDGNSL G+IP +IGNCSSL LL LSHNNL+G +P+++S
Sbjct  479   SALFGSIPEDTCDSGNLAVLQLDGNSLKGSIPEKIGNCSSLYLLGLSHNNLTGPVPKSMS  538

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGN  1463
              L +LKILKLE N+LSGE+P +LGKL+NLLAVN+S+N LTGRLP GSIFQNLD S++EGN
Sbjct  539   NLNKLKILKLEFNELSGELPMELGKLQNLLAVNISHNSLTGRLPIGSIFQNLDKSSLEGN  598

Query  1462  DGICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRFLsvsai  1283
              G+CSPLLTGPCKMN PKP+V++P  Y +Q +     +  E   S+    HHRFLS+SAI
Sbjct  599   YGLCSPLLTGPCKMNVPKPLVLDPHGYNDQMNPRIPRN--ESSESSSPIHHHRFLSISAI  656

Query  1282  vaisaaaiiavgvmvITMVNASVRRRISFVENALESMCSSTSSRSQGMATGKLILFDTKS  1103
             +AISA  +I +GV+ I++VNASVRR+++FVENALESMCSS+S      ATGKLILFD++S
Sbjct  657   IAISAIIVIVIGVIAISLVNASVRRKLAFVENALESMCSSSSRSG-APATGKLILFDSQS  715

Query  1102  SPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDFDRE  923
             SPDW S+  E++LNKASEIGEGVFGTV+K PLG +  R VAIKKL +S ILQYPEDFDRE
Sbjct  716   SPDWISNP-ENLLNKASEIGEGVFGTVFKVPLGSQQGRNVAIKKLITSNILQYPEDFDRE  774

Query  922   VRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAVRFK  743
             VR+LG ARH NL+ L+GYYWTPQLQLLVS+F P GNL+SKLHE   +  +PPL+W  RFK
Sbjct  775   VRILGNARHPNLIALKGYYWTPQLQLLVSEFAPNGNLQSKLHEKLPS--SPPLSWPNRFK  832

Query  742   IILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVMSNR  563
             I+LGTAKGLAHLHHS +PPIIHYNIKPSNILLDEN N KISDFGLARL+ KLD+HVMSNR
Sbjct  833   ILLGTAKGLAHLHHSFRPPIIHYNIKPSNILLDENFNAKISDFGLARLLTKLDKHVMSNR  892

Query  562   FQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRVLL  383
             FQ+A+GYVAPELACQSLRVNEKCDVYGFG++ILEIVTGRRPVEYGEDNVLILNDHVRVLL
Sbjct  893   FQSALGYVAPELACQSLRVNEKCDVYGFGVMILEIVTGRRPVEYGEDNVLILNDHVRVLL  952

Query  382   EQGNVLECVDQG-MGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPVPNR  206
             E GN LECVD   M  YP++EVLPVLKLA+VCTSQIPSSRP+MAEVVQILQVIKTPVP R
Sbjct  953   EHGNALECVDPSLMNEYPEDEVLPVLKLAMVCTSQIPSSRPTMAEVVQILQVIKTPVPQR  1012

Query  205   MEPY  194
             ME +
Sbjct  1013  MEVF  1016


 Score = 54.7 bits (130),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 37/104 (36%), Positives = 56/104 (54%), Gaps = 0/104 (0%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             +AL G +   I    +L  L L+ N  +G +P  IG C  L  + LS N  SG +PE+  
Sbjct  263   NALSGNLVNGISSLHNLKELLLENNQFSGQLPNDIGFCLHLNRVDLSTNQFSGELPESFG  322

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP  1511
              L  L  L++  N L GE PQ +G L +L  +++S+N+  G +P
Sbjct  323   RLNSLSYLRVSNNLLFGEFPQWIGNLISLEDLDLSHNQFYGNIP  366



>ref|XP_007034091.1| Leucine-rich receptor-like protein kinase family protein [Theobroma 
cacao]
 gb|EOY05017.1| Leucine-rich receptor-like protein kinase family protein [Theobroma 
cacao]
Length=1011

 Score =   732 bits (1890),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/543 (73%), Positives = 462/543 (85%), Gaps = 8/543 (1%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             + L G +P DICESGSL ILQ+DGNSLTG IP +IGNCSSL +LSLSHNNLSG+IP+T+S
Sbjct  477   NTLYGAVPGDICESGSLAILQMDGNSLTGPIPEEIGNCSSLYMLSLSHNNLSGSIPKTIS  536

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGN  1463
              L +LKILKLE N+LSGEIPQ++G L+NLLAVN+SYN+LTGRLP G IF +LD SA++GN
Sbjct  537   NLSKLKILKLEFNELSGEIPQEIGLLQNLLAVNISYNQLTGRLPVGGIFPSLDQSALQGN  596

Query  1462  DGICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRFLsvsai  1283
              GICSPLL GPCKMN PKP+V++P  Y +Q   +   +  E    T+  RH  FLSVSAI
Sbjct  597   LGICSPLLKGPCKMNVPKPLVLDPDAYNSQMGGHRQRN--ESSIPTKFHRH-MFLSVSAI  653

Query  1282  vaisaaaiiavgvmvITMVNASVRRRISFVENALESMCSSTSSRSQGMATGKLILFDTKS  1103
             VAISAA +I  GV++I+++N S RRR++FVE ALESMCSS S+RS  + TGKLILFD+K 
Sbjct  654   VAISAAILIVSGVIIISLLNVSARRRLAFVETALESMCSS-STRSGSLPTGKLILFDSKL  712

Query  1102  SPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDFDRE  923
             SPD   +  E +LNKA+EIGEGVFGTVYK PLG +G R+VAIKKL +S I+QYP+DFDRE
Sbjct  713   SPDRIGNP-EVLLNKAAEIGEGVFGTVYKVPLGAQG-RIVAIKKLVTSNIIQYPDDFDRE  770

Query  922   VRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAVRFK  743
             VRVLGKARH NL+ L GYYWTPQ QLLV+++ P GNL++KLHE   +   PPL+W+ RFK
Sbjct  771   VRVLGKARHPNLISLEGYYWTPQSQLLVTEYAPNGNLQTKLHERIGS--APPLSWSNRFK  828

Query  742   IILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVMSNR  563
             IILGTAKGLAHLHHS +PPIIHYNIKPSNILLDEN NPKISDFGLARL+ KL+RHV+SNR
Sbjct  829   IILGTAKGLAHLHHSFRPPIIHYNIKPSNILLDENSNPKISDFGLARLLMKLERHVISNR  888

Query  562   FQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRVLL  383
             FQ+A+GYVAPELACQSLRVNEKCDVYGFG+LILE+VTGRRPVEYGEDNV+IL+DHVRVLL
Sbjct  889   FQSALGYVAPELACQSLRVNEKCDVYGFGVLILELVTGRRPVEYGEDNVVILSDHVRVLL  948

Query  382   EQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPVPNRM  203
             EQGNVLECVD  MG YP++EVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPVP RM
Sbjct  949   EQGNVLECVDVSMGDYPEDEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPVPQRM  1008

Query  202   EPY  194
             E +
Sbjct  1009  EIF  1011


 Score = 57.8 bits (138),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 37/101 (37%), Positives = 54/101 (53%), Gaps = 0/101 (0%)
 Frame = -1

Query  1810  GEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSMLKR  1631
             G +PE +    +L  L L  N  +G +P  IG C  L  L LS+N  +G +P++L  L  
Sbjct  241   GTVPEGVFALHNLKELLLQDNRFSGPMPLDIGFCPHLNTLDLSYNLFTGPLPDSLQRLNF  300

Query  1630  LKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPA  1508
             L    L  N  +G+ PQ +G + NL  ++ S N LTG LP+
Sbjct  301   LSFFSLSNNMFTGDFPQGIGNMSNLAYLDFSSNSLTGSLPS  341


 Score = 54.7 bits (130),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 42/110 (38%), Positives = 61/110 (55%), Gaps = 3/110 (3%)
 Frame = -1

Query  1810  GEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSMLKR  1631
             G+ P+ I    +L  L    NSLTG++P  IGN  +L  L LS+N L+G IP +L    +
Sbjct  313   GDFPQGIGNMSNLAYLDFSSNSLTGSLPSSIGNLKALNYLRLSNNRLTGNIPTSLGYCFQ  372

Query  1630  LKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGS--IFQNL  1487
             L  + L  N  +G +P  L  L  L  ++ S N LTG +P GS  +F++L
Sbjct  373   LSTIHLRDNGFNGSLPAGLFDL-GLEEIDFSNNALTGSIPRGSSRLFESL  421


 Score = 53.5 bits (127),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 41/137 (30%), Positives = 63/137 (46%), Gaps = 25/137 (18%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETL-  1646
             ++L G +P  I    +L  L+L  N LTG IP  +G C  L+ + L  N  +G++P  L 
Sbjct  333   NSLTGSLPSSIGNLKALNYLRLSNNRLTGNIPTSLGYCFQLSTIHLRDNGFNGSLPAGLF  392

Query  1645  -----------------------SMLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSY  1535
                                     + + L+ L L  N L G IP ++G   N+  +N+S+
Sbjct  393   DLGLEEIDFSNNALTGSIPRGSSRLFESLQELDLSRNSLQGSIPAEMGLFANMRYLNLSW  452

Query  1534  NRLTGRLPAG-SIFQNL  1487
             N L  R+P    +FQNL
Sbjct  453   NNLQSRIPPELGLFQNL  469



>ref|XP_004296675.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Fragaria vesca subsp. vesca]
Length=1006

 Score =   729 bits (1883),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/543 (72%), Positives = 466/543 (86%), Gaps = 6/543 (1%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             SAL G IP +IC+SGSL ILQLDGNSLTG IP +IGNCSSL L+SLSHNNLSG IP+++S
Sbjct  470   SALSGPIPGEICDSGSLDILQLDGNSLTGPIPDEIGNCSSLYLMSLSHNNLSGVIPKSIS  529

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGN  1463
              L +L ILKLE N+LSGEIP +LGKLENLLAVN+SYNRLTGRLP GS+FQ+LD SA++GN
Sbjct  530   KLGKLVILKLEFNELSGEIPLELGKLENLLAVNISYNRLTGRLPVGSVFQSLDQSALQGN  589

Query  1462  DGICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRFLsvsai  1283
              GICSPLL GPC MN PKP+V++P  Y NQ    +   + +  + +R   HH FLS+SAI
Sbjct  590   LGICSPLLKGPCTMNVPKPLVLDPNAYPNQMGGGDHRYHGDS-SESRKGHHHMFLSISAI  648

Query  1282  vaisaaaiiavgvmvITMVNASVRRRISFVENALESMCSSTSSRSQGMATGKLILFDTKS  1103
             VAISAA +IAVGV+VI+++NAS RRR +FVE ALESMCS  SSRS  +A+GKLILFD++S
Sbjct  649   VAISAATLIAVGVIVISLLNASARRRPAFVETALESMCS-MSSRSGSLASGKLILFDSRS  707

Query  1102  SPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDFDRE  923
             SPDW SS  ES+LNKASE+GEGVFGTVYK PLG +G R+VAIKKL ++ ILQ  EDFDRE
Sbjct  708   SPDWISSP-ESLLNKASELGEGVFGTVYKVPLGAQG-RMVAIKKLVTTNILQCLEDFDRE  765

Query  922   VRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAVRFK  743
             VRVLGKARH NLV L+GYYWTPQ+QLLV+++ P G+L+SKLH+   +  + PL+W  RFK
Sbjct  766   VRVLGKARHPNLVALKGYYWTPQMQLLVNEYAPNGSLQSKLHDRLYS--SSPLSWDDRFK  823

Query  742   IILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVMSNR  563
             I+LGTAKGL+HLHHS +PPIIHYN+KPSNILLDE+LNPKISDF LARL+ K+DRHV+SNR
Sbjct  824   ILLGTAKGLSHLHHSFRPPIIHYNVKPSNILLDEDLNPKISDFALARLLTKIDRHVVSNR  883

Query  562   FQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRVLL  383
             FQ+A+GYVAPELACQSLRVNEKCDVYGFG+LILE+VTGRRPVEYGEDNV+ILNDHV+VLL
Sbjct  884   FQSALGYVAPELACQSLRVNEKCDVYGFGVLILELVTGRRPVEYGEDNVVILNDHVKVLL  943

Query  382   EQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPVPNRM  203
             EQGNVL C+D  MG YP++EVLPVLKLALVCTSQIPS RP+MAEVVQILQ+IKTP+P R+
Sbjct  944   EQGNVLGCIDVSMGEYPEDEVLPVLKLALVCTSQIPSCRPTMAEVVQILQIIKTPLPQRI  1003

Query  202   EPY  194
             E +
Sbjct  1004  ERF  1006


 Score = 58.2 bits (139),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 37/104 (36%), Positives = 56/104 (54%), Gaps = 0/104 (0%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             +AL G +P+ I    +L  + +  N  +GTIP  IG C  L  +  S N  +G +P++L 
Sbjct  230   NALSGFVPKGISSIHNLKEILIQRNHFSGTIPFDIGLCPHLGRIDFSENLFTGELPQSLQ  289

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP  1511
             ML  L  + L  N  +G+ PQ +G L +L  ++ S N  TG LP
Sbjct  290   MLNFLTFMSLSDNMFNGDFPQWIGNLSSLEYLDFSNNGFTGSLP  333


 Score = 55.1 bits (131),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 43/110 (39%), Positives = 64/110 (58%), Gaps = 3/110 (3%)
 Frame = -1

Query  1810  GEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSMLKR  1631
             G+ P+ I    SL  L    N  TG++PP +G+  SL+ LSLS+N L GT+P +L    +
Sbjct  306   GDFPQWIGNLSSLEYLDFSNNGFTGSLPPSMGDLRSLSYLSLSNNKLVGTLPTSLVYCNK  365

Query  1630  LKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGS--IFQNL  1487
             L +++L  N  SG IP+ L  L  L  ++ S   LTG +P GS  +F++L
Sbjct  366   LSVIRLRGNDFSGSIPEGLFDL-GLEEIDFSNMGLTGSIPPGSSKLFESL  414


 Score = 54.3 bits (129),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/111 (29%), Positives = 53/111 (48%), Gaps = 1/111 (1%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L+G +P  +     L +++L GN  +G+IP  + +     +   +        P +  + 
Sbjct  352   LVGTLPTSLVYCNKLSVIRLRGNDFSGSIPEGLFDLGLEEIDFSNMGLTGSIPPGSSKLF  411

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAG-SIFQNL  1487
             + LK+L L  N L G IP ++G   NL  +N S+N L  R+P     F NL
Sbjct  412   ESLKMLDLSRNNLKGNIPAEVGLFSNLRYLNFSWNNLQSRIPPELGFFSNL  462



>ref|XP_002321093.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|EEE99408.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=1006

 Score =   729 bits (1881),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/545 (72%), Positives = 465/545 (85%), Gaps = 12/545 (2%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             +AL G IP DICESGSL ILQLDGNSL G +P +IGNCSSL LLSLS NNLSG+IP+++S
Sbjct  472   NALAGSIPADICESGSLNILQLDGNSLVGQVPEEIGNCSSLYLLSLSQNNLSGSIPKSIS  531

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGN  1463
              L +LKILKLE N+L+GE+PQ+LGKLENLLAVN+SYN+L GRLP   IF +LD SA++GN
Sbjct  532   RLDKLKILKLEFNELTGEVPQELGKLENLLAVNISYNKLIGRLPVRGIFPSLDQSALQGN  591

Query  1462  DGICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSR--HHRFLsvs  1289
              GICSPLL GPCKMN PKP+V++P  YGNQ D           AS+R +R  HH FLSVS
Sbjct  592   LGICSPLLKGPCKMNVPKPLVLDPNAYGNQGDGQKPRS-----ASSRPARFHHHMFLSVS  646

Query  1288  aivaisaaaiiavgvmvITMVNASVRRRISFVENALESMCSSTSSRSQGMATGKLILFDT  1109
             AI+AISAA  I  GV++I+++N SVR+R++FV++ALESMCSS+S     + TGKL+LFD+
Sbjct  647   AIIAISAAIFIMFGVILISLLNVSVRKRLAFVDHALESMCSSSSKSGN-LVTGKLVLFDS  705

Query  1108  KSSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDFD  929
             KSSPDW +S  ES+LNKA+EIG+GVFGTVYK  LG E +R+VAIKKL +S I+QYPEDFD
Sbjct  706   KSSPDWINSP-ESLLNKAAEIGQGVFGTVYKVSLGSE-ARMVAIKKLITSNIIQYPEDFD  763

Query  928   REVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAVR  749
             REVRVLGKARH NL+ L+GYYWTPQLQLLVS++ P G+L+SKLHE   +  TPPL+WA R
Sbjct  764   REVRVLGKARHPNLLSLKGYYWTPQLQLLVSEYAPNGSLQSKLHERLTS--TPPLSWANR  821

Query  748   FKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVMS  569
              KI+LGTAKGLAHLHHS +PPIIHYNIKPSNILLDEN NPKISDFGLARL+ KLDRHVMS
Sbjct  822   LKIVLGTAKGLAHLHHSFRPPIIHYNIKPSNILLDENFNPKISDFGLARLLTKLDRHVMS  881

Query  568   NRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRV  389
             +RFQ+A+GYVAPELACQSLR+NEKCD+YGFG+LILE+VTGRRPVEYGEDNV+I NDHVRV
Sbjct  882   SRFQSALGYVAPELACQSLRINEKCDIYGFGVLILELVTGRRPVEYGEDNVVIQNDHVRV  941

Query  388   LLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPVPN  209
             LLEQGN L+CVD  MG YP++EV+PVLKLALVCTSQIPSSRPSMAEVVQILQVI+TPVP 
Sbjct  942   LLEQGNALDCVDPSMGDYPEDEVMPVLKLALVCTSQIPSSRPSMAEVVQILQVIRTPVPQ  1001

Query  208   RMEPY  194
             RME +
Sbjct  1002  RMEIF  1006


 Score = 59.3 bits (142),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 38/101 (38%), Positives = 55/101 (54%), Gaps = 0/101 (0%)
 Frame = -1

Query  1810  GEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSMLKR  1631
             G +P+ +    +L  L L GN  +G +P  IG C  L  L LS N  SG +PE+L  L  
Sbjct  236   GSVPQGVSAIHNLKELHLQGNRFSGPLPVDIGLCRHLNRLDLSSNLFSGALPESLQGLSS  295

Query  1630  LKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPA  1508
             +    L  N L+GE P+ +G L NL  +++S N LTG + +
Sbjct  296   INYFSLSKNMLTGEFPRWIGSLSNLEYLDLSSNALTGSISS  336



>ref|XP_011000023.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Populus euphratica]
Length=1006

 Score =   725 bits (1872),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/545 (72%), Positives = 464/545 (85%), Gaps = 12/545 (2%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             +AL G IP DICESGSL ILQLDGNSL G +P +IGNCSSL LLSLS NNLSG+IP+++S
Sbjct  472   NALAGSIPADICESGSLNILQLDGNSLVGQVPEEIGNCSSLYLLSLSQNNLSGSIPKSIS  531

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGN  1463
              L +LKILKLE N+L+GE+PQ+LGKLENLLAVN+SYN+L GRLP G IF +LD SA++GN
Sbjct  532   RLDKLKILKLEFNELTGEVPQELGKLENLLAVNISYNKLIGRLPVGGIFPSLDQSALQGN  591

Query  1462  DGICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSR--HHRFLsvs  1289
              GICSPLL GPCKMN PKP+V++P  YGNQ D           AS+R +R  HH FLSVS
Sbjct  592   LGICSPLLKGPCKMNVPKPLVLDPNAYGNQGDGQKPRS-----ASSRPARFHHHMFLSVS  646

Query  1288  aivaisaaaiiavgvmvITMVNASVRRRISFVENALESMCSSTSSRSQGMATGKLILFDT  1109
             AI+AISAA  I  GV++I+++N SVR+R++FV++ALESMCSS+S     + TGKL+LFD+
Sbjct  647   AIIAISAAIFIMFGVILISLLNVSVRKRLTFVDHALESMCSSSSKSGN-LVTGKLVLFDS  705

Query  1108  KSSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDFD  929
             KSSPDW ++  ES+LNKA+EIG+GVFGTVYK  L  E +R+VA+KKL +S I+QYPEDFD
Sbjct  706   KSSPDWINNP-ESLLNKAAEIGQGVFGTVYKVSLCSE-ARMVAVKKLITSNIIQYPEDFD  763

Query  928   REVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAVR  749
             REVRVLGKARH NL+ L+GYYWTPQLQLLVS++ P G+L+SKLHE   +  TPPL+WA R
Sbjct  764   REVRVLGKARHPNLLSLKGYYWTPQLQLLVSEYAPNGSLQSKLHERLTS--TPPLSWANR  821

Query  748   FKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVMS  569
              KI+LGTAKGLAHLHHS +PPIIHYNIKPSNILLDEN NPKISDFGLARL+ KLDRHVMS
Sbjct  822   LKIVLGTAKGLAHLHHSFRPPIIHYNIKPSNILLDENFNPKISDFGLARLLTKLDRHVMS  881

Query  568   NRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRV  389
             +RFQ+A+GYVAPELACQSLR+NEKCD+YGFG+LILE+VTGRRPVEYGEDNV+I NDHVRV
Sbjct  882   SRFQSALGYVAPELACQSLRINEKCDIYGFGVLILELVTGRRPVEYGEDNVVIQNDHVRV  941

Query  388   LLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPVPN  209
             LLEQGN L+CVD  MG YP++EV+PVLKLALVCTSQIPSSRPSMAEVVQILQVIKTP P 
Sbjct  942   LLEQGNALDCVDPSMGDYPEDEVMPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPAPQ  1001

Query  208   RMEPY  194
             RME +
Sbjct  1002  RMEIF  1006


 Score = 57.8 bits (138),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 37/101 (37%), Positives = 53/101 (52%), Gaps = 0/101 (0%)
 Frame = -1

Query  1810  GEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSMLKR  1631
             G +P  +    +L  LQL GN  +G +P  IG C  L  L  S N  SG +PE+L  L  
Sbjct  236   GSVPRGVSAIHNLKELQLQGNRFSGPLPVDIGLCPHLNRLDFSSNLFSGALPESLQRLSS  295

Query  1630  LKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPA  1508
             +       N L+GE P+ +G L NL  +++S N LTG + +
Sbjct  296   INYFSSSKNMLTGEFPRWIGSLSNLEYLDLSSNALTGSISS  336


 Score = 56.6 bits (135),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 44/105 (42%), Positives = 60/105 (57%), Gaps = 1/105 (1%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L GE P  I    +L  L L  N+LTG+I   IG+  SL  LSLS N L G IP ++   
Sbjct  306   LTGEFPRWIGSLSNLEYLDLSSNALTGSISSSIGDLKSLRYLSLSDNKLLGNIPASIVSC  365

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGS  1502
               L +++L  N  +G IP+ L +L  L  V+ S+N LTG +P+GS
Sbjct  366   TMLSVIRLRGNSFNGSIPEGLFEL-GLEGVDFSHNGLTGSIPSGS  409



>gb|KHN13843.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Glycine soja]
Length=1007

 Score =   723 bits (1865),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/549 (72%), Positives = 466/549 (85%), Gaps = 20/549 (4%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             SAL G IP DIC+SG+L +LQLDGNS  G IP +IGNCSSL LLSLSHNNL+G+IP+++S
Sbjct  473   SALHGSIPADICDSGNLAVLQLDGNSFEGNIPSEIGNCSSLYLLSLSHNNLTGSIPKSMS  532

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGN  1463
              L +LKILKLE N+LSGEIP +LG L++LLAVN+SYNRLTGRLP  SIFQNLD S++EGN
Sbjct  533   KLNKLKILKLEFNELSGEIPMELGMLQSLLAVNISYNRLTGRLPTSSIFQNLDKSSLEGN  592

Query  1462  DGICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNS------RHHRF  1301
              G+CSPLL GPCKMN PKP+V++P  Y NQ           P   T  S        HRF
Sbjct  593   LGLCSPLLKGPCKMNVPKPLVLDPNAYNNQI---------SPQRQTNESSESGPVHRHRF  643

Query  1300  LsvsaivaisaaaiiavgvmvITMVNASVRRRISFVENALESMCSSTSSRSQGMATGKLI  1121
             LSVSAIVAISA+ +I +GV+ ++++N SVRRR++F++NALESMCSS+S      ATGKLI
Sbjct  644   LSVSAIVAISASFVIVLGVIAVSLLNVSVRRRLTFLDNALESMCSSSSRSGSP-ATGKLI  702

Query  1120  LFDTKSSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYP  941
             LFD++SSPDW S+  ES+LNKASEIGEGVFGT+YK PLG +G R+VAIKKL S+ I+QYP
Sbjct  703   LFDSQSSPDWISNP-ESLLNKASEIGEGVFGTLYKVPLGSQG-RMVAIKKLISTNIIQYP  760

Query  940   EDFDREVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLT  761
             EDFDREVR+LGKARH NL+ L+GYYWTPQLQLLV++F P G+L++KLHE   +  +PPL+
Sbjct  761   EDFDREVRILGKARHPNLIALKGYYWTPQLQLLVTEFAPNGSLQAKLHERLPS--SPPLS  818

Query  760   WAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDR  581
             WA+RFKI+LGTAKGLAHLHHS +PPIIHYNIKPSNILLDEN N KISDFGLARL+ KLDR
Sbjct  819   WAIRFKILLGTAKGLAHLHHSFRPPIIHYNIKPSNILLDENYNAKISDFGLARLLTKLDR  878

Query  580   HVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILND  401
             HVMSNRFQ+A+GYVAPELACQSLRVNEKCDVYGFG++ILE+VTGRRPVEYGEDNVLILND
Sbjct  879   HVMSNRFQSALGYVAPELACQSLRVNEKCDVYGFGVMILELVTGRRPVEYGEDNVLILND  938

Query  400   HVRVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKT  221
             HVRVLLEQGNVLECVDQ M  YP++EVLPVLKLA+VCTSQIPSSRP+MAEVVQILQVIKT
Sbjct  939   HVRVLLEQGNVLECVDQSMSEYPEDEVLPVLKLAMVCTSQIPSSRPTMAEVVQILQVIKT  998

Query  220   PVPNRMEPY  194
             PVP RME +
Sbjct  999   PVPQRMEVF  1007


 Score = 55.8 bits (133),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 36/104 (35%), Positives = 52/104 (50%), Gaps = 0/104 (0%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             +AL G +P  I    +   + L GN  +G +   IG C  L  L  S N  SG +PE+L 
Sbjct  233   NALSGSLPNGISSIHNFKEILLQGNQFSGPLSTDIGFCLHLNRLDFSDNQFSGELPESLG  292

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP  1511
             ML  L   K   N  + E PQ +G + +L  + +S N+ TG +P
Sbjct  293   MLSSLSYFKASNNHFNSEFPQWIGNMTSLEYLELSNNQFTGSIP  336



>ref|XP_003552656.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Glycine max]
Length=1007

 Score =   722 bits (1864),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/549 (72%), Positives = 466/549 (85%), Gaps = 20/549 (4%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             SAL G IP DIC+SG+L +LQLDGNS  G IP +IGNCSSL LLSLSHNNL+G+IP+++S
Sbjct  473   SALHGSIPADICDSGNLAVLQLDGNSFEGNIPSEIGNCSSLYLLSLSHNNLTGSIPKSMS  532

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGN  1463
              L +LKILKLE N+LSGEIP +LG L++LLAVN+SYNRLTGRLP  SIFQNLD S++EGN
Sbjct  533   KLNKLKILKLEFNELSGEIPMELGMLQSLLAVNISYNRLTGRLPTSSIFQNLDKSSLEGN  592

Query  1462  DGICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNS------RHHRF  1301
              G+CSPLL GPCKMN PKP+V++P  Y NQ           P   T  S        HRF
Sbjct  593   LGLCSPLLKGPCKMNVPKPLVLDPNAYNNQI---------SPQRQTNESSESGPVHRHRF  643

Query  1300  LsvsaivaisaaaiiavgvmvITMVNASVRRRISFVENALESMCSSTSSRSQGMATGKLI  1121
             LSVSAIVAISA+ +I +GV+ ++++N SVRRR++F++NALESMCSS+S      ATGKLI
Sbjct  644   LSVSAIVAISASFVIVLGVIAVSLLNVSVRRRLTFLDNALESMCSSSSRSGSP-ATGKLI  702

Query  1120  LFDTKSSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYP  941
             LFD++SSPDW S+  ES+LNKASEIGEGVFGT+YK PLG +G R+VAIKKL S+ I+QYP
Sbjct  703   LFDSQSSPDWISNP-ESLLNKASEIGEGVFGTLYKVPLGSQG-RMVAIKKLISTNIIQYP  760

Query  940   EDFDREVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLT  761
             EDFDREVR+LGKARH NL+ L+GYYWTPQLQLLV++F P G+L++KLHE   +  +PPL+
Sbjct  761   EDFDREVRILGKARHPNLIALKGYYWTPQLQLLVTEFAPNGSLQAKLHERLPS--SPPLS  818

Query  760   WAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDR  581
             WA+RFKI+LGTAKGLAHLHHS +PPIIHYNIKPSNILLDEN N KISDFGLARL+ KLDR
Sbjct  819   WAIRFKILLGTAKGLAHLHHSFRPPIIHYNIKPSNILLDENYNAKISDFGLARLLTKLDR  878

Query  580   HVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILND  401
             HVMSNRFQ+A+GYVAPELACQSLRVNEKCDVYGFG++ILE+VTGRRPVEYGEDNVLILND
Sbjct  879   HVMSNRFQSALGYVAPELACQSLRVNEKCDVYGFGVMILELVTGRRPVEYGEDNVLILND  938

Query  400   HVRVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKT  221
             HVRVLLEQGNVLECVDQ M  YP++EVLPVLKLA+VCTSQIPSSRP+MAEVVQILQVIKT
Sbjct  939   HVRVLLEQGNVLECVDQSMSEYPEDEVLPVLKLAMVCTSQIPSSRPTMAEVVQILQVIKT  998

Query  220   PVPNRMEPY  194
             PVP RME +
Sbjct  999   PVPQRMEVF  1007


 Score = 56.2 bits (134),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 36/104 (35%), Positives = 52/104 (50%), Gaps = 0/104 (0%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             +AL G +P  I    +   + L GN  +G +   IG C  L  L  S N  SG +PE+L 
Sbjct  233   NALSGSLPNGISSVHNFKEILLQGNQFSGPLSTDIGFCLHLNRLDFSDNQFSGELPESLG  292

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP  1511
             ML  L   K   N  + E PQ +G + +L  + +S N+ TG +P
Sbjct  293   MLSSLSYFKASNNHFNSEFPQWIGNMTSLEYLELSNNQFTGSIP  336



>gb|KHN27185.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Glycine soja]
Length=1007

 Score =   722 bits (1863),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/543 (73%), Positives = 464/543 (85%), Gaps = 8/543 (1%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             SAL G IP DIC+SG+L +LQLDGNS  G IP +IGNCSSL LLS SHNNL+G+IP++++
Sbjct  473   SALHGSIPADICDSGNLAVLQLDGNSFEGNIPSEIGNCSSLYLLSSSHNNLTGSIPKSMA  532

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGN  1463
              L +LKILKLE N+LSGEIP +LG L++LLAVN+SYNRLTGRLP  SIFQNLD S++EGN
Sbjct  533   KLNKLKILKLEFNELSGEIPMELGMLQSLLAVNISYNRLTGRLPTSSIFQNLDKSSLEGN  592

Query  1462  DGICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRFLsvsai  1283
              G+CSPLL GPCKMN PKP+V++P  Y NQ       + +   + +     HRFLSVSAI
Sbjct  593   LGLCSPLLKGPCKMNVPKPLVLDPNAYNNQISPQRQRNES---SESGQVHRHRFLSVSAI  649

Query  1282  vaisaaaiiavgvmvITMVNASVRRRISFVENALESMCSSTSSRSQGMATGKLILFDTKS  1103
             VAISA+ +I +GV+ ++++N SVRRR++FV+NALESMCSS+S      ATGKLILFD+ S
Sbjct  650   VAISASFVIVLGVIAVSLLNVSVRRRLTFVDNALESMCSSSSRSGSP-ATGKLILFDSHS  708

Query  1102  SPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDFDRE  923
             SPDW S+  ES+LNKASEIGEGVFGT+YK PLG +G R+VAIKKL SS I+QYPEDFDRE
Sbjct  709   SPDWISNP-ESLLNKASEIGEGVFGTLYKVPLGSQG-RMVAIKKLISSNIIQYPEDFDRE  766

Query  922   VRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAVRFK  743
             VR+LGKARH NL+ L+GYYWTPQLQLLV++F P G+L++KLHE   +  +PPL+WA+RFK
Sbjct  767   VRILGKARHPNLIALKGYYWTPQLQLLVTEFAPNGSLQAKLHERLPS--SPPLSWAIRFK  824

Query  742   IILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVMSNR  563
             I+LGTAKGLAHLHHS +PPIIHYNIKPSNILLDEN N KISDFGLARL+ KLDRHVMSNR
Sbjct  825   ILLGTAKGLAHLHHSFRPPIIHYNIKPSNILLDENYNAKISDFGLARLLTKLDRHVMSNR  884

Query  562   FQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRVLL  383
             FQ+A+GYVAPELACQSLRVNEKCDVYGFG++ILE+VTGRRPVEYGEDNVLILNDHVRVLL
Sbjct  885   FQSALGYVAPELACQSLRVNEKCDVYGFGVMILELVTGRRPVEYGEDNVLILNDHVRVLL  944

Query  382   EQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPVPNRM  203
             E GNVLECVDQ M  YP++EVLPVLKLA+VCTSQIPSSRP+MAEVVQILQVIKTPVP RM
Sbjct  945   EHGNVLECVDQSMSEYPEDEVLPVLKLAMVCTSQIPSSRPTMAEVVQILQVIKTPVPQRM  1004

Query  202   EPY  194
             E +
Sbjct  1005  EVF  1007


 Score = 58.2 bits (139),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 38/104 (37%), Positives = 54/104 (52%), Gaps = 0/104 (0%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             +AL G +P  I    +   + L GN  +G +   IG C  L+ L  S N LSG +PE+L 
Sbjct  233   NALSGSLPNGISSIHNFKEILLQGNQFSGPLSTDIGFCLHLSRLDFSDNQLSGELPESLG  292

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP  1511
             ML  L   K   N  + E PQ +G + NL  + +S N+ TG +P
Sbjct  293   MLSSLSYFKASNNHFNSEFPQWIGNMTNLEYLELSNNQFTGSIP  336


 Score = 56.6 bits (135),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 49/122 (40%), Positives = 70/122 (57%), Gaps = 8/122 (7%)
 Frame = -1

Query  1807  EIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSMLKRL  1628
             E P+ I    +L  L+L  N  TG+IP  IG   SLT LS+S+N L GTIP +LS   +L
Sbjct  310   EFPQWIGNMTNLEYLELSNNQFTGSIPQSIGELRSLTHLSISNNKLVGTIPSSLSSCTKL  369

Query  1627  KILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGS-----IFQNLDSS--AIE  1469
              +++L  N  +G IP+ L  L  L  +++S+N L+G +P GS        NLD S   ++
Sbjct  370   SVVQLRGNGFNGTIPEALFGL-GLEDIDLSHNGLSGSIPPGSSRLLETLTNLDLSDNHLQ  428

Query  1468  GN  1463
             GN
Sbjct  429   GN  430


 Score = 53.5 bits (127),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 58/104 (56%), Gaps = 2/104 (2%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
               G IP+ I E  SL  L +  N L GTIP  + +C+ L+++ L  N  +GTIPE L  L
Sbjct  331   FTGSIPQSIGELRSLTHLSISNNKLVGTIPSSLSSCTKLSVVQLRGNGFNGTIPEALFGL  390

Query  1636  KRLKILKLEVNQLSGEIPQQLGK-LENLLAVNVSYNRLTGRLPA  1508
               L+ + L  N LSG IP    + LE L  +++S N L G +PA
Sbjct  391   G-LEDIDLSHNGLSGSIPPGSSRLLETLTNLDLSDNHLQGNIPA  433



>ref|XP_003518672.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Glycine max]
Length=1007

 Score =   721 bits (1862),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/543 (73%), Positives = 464/543 (85%), Gaps = 8/543 (1%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             SAL G IP DIC+SG+L +LQLDGNS  G IP +IGNCSSL LLS SHNNL+G+IP++++
Sbjct  473   SALHGSIPADICDSGNLAVLQLDGNSFEGNIPSEIGNCSSLYLLSSSHNNLTGSIPKSMA  532

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGN  1463
              L +LKILKLE N+LSGEIP +LG L++LLAVN+SYNRLTGRLP  SIFQNLD S++EGN
Sbjct  533   KLNKLKILKLEFNELSGEIPMELGMLQSLLAVNISYNRLTGRLPTSSIFQNLDKSSLEGN  592

Query  1462  DGICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRFLsvsai  1283
              G+CSPLL GPCKMN PKP+V++P  Y NQ       + +   + +     HRFLSVSAI
Sbjct  593   LGLCSPLLKGPCKMNVPKPLVLDPNAYNNQISPQRQRNES---SESGQVHRHRFLSVSAI  649

Query  1282  vaisaaaiiavgvmvITMVNASVRRRISFVENALESMCSSTSSRSQGMATGKLILFDTKS  1103
             VAISA+ +I +GV+ ++++N SVRRR++FV+NALESMCSS+S      ATGKLILFD+ S
Sbjct  650   VAISASFVIVLGVIAVSLLNVSVRRRLTFVDNALESMCSSSSRSGSP-ATGKLILFDSHS  708

Query  1102  SPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDFDRE  923
             SPDW S+  ES+LNKASEIGEGVFGT+YK PLG +G R+VAIKKL SS I+QYPEDFDRE
Sbjct  709   SPDWISNP-ESLLNKASEIGEGVFGTLYKVPLGSQG-RMVAIKKLISSNIIQYPEDFDRE  766

Query  922   VRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAVRFK  743
             VR+LGKARH NL+ L+GYYWTPQLQLLV++F P G+L++KLHE   +  +PPL+WA+RFK
Sbjct  767   VRILGKARHPNLIALKGYYWTPQLQLLVTEFAPNGSLQAKLHERLPS--SPPLSWAIRFK  824

Query  742   IILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVMSNR  563
             I+LGTAKGLAHLHHS +PPIIHYNIKPSNILLDEN N KISDFGLARL+ KLDRHVMSNR
Sbjct  825   ILLGTAKGLAHLHHSFRPPIIHYNIKPSNILLDENYNAKISDFGLARLLTKLDRHVMSNR  884

Query  562   FQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRVLL  383
             FQ+A+GYVAPELACQSLRVNEKCDVYGFG++ILE+VTGRRPVEYGEDNVLILNDHVRVLL
Sbjct  885   FQSALGYVAPELACQSLRVNEKCDVYGFGVMILELVTGRRPVEYGEDNVLILNDHVRVLL  944

Query  382   EQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPVPNRM  203
             E GNVLECVDQ M  YP++EVLPVLKLA+VCTSQIPSSRP+MAEVVQILQVIKTPVP RM
Sbjct  945   EHGNVLECVDQSMSEYPEDEVLPVLKLAMVCTSQIPSSRPTMAEVVQILQVIKTPVPQRM  1004

Query  202   EPY  194
             E +
Sbjct  1005  EVF  1007


 Score = 58.2 bits (139),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 38/104 (37%), Positives = 54/104 (52%), Gaps = 0/104 (0%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             +AL G +P  I    +   + L GN  +G +   IG C  L+ L  S N LSG +PE+L 
Sbjct  233   NALSGSLPNGISSIHNFKEILLQGNQFSGPLSTDIGFCLHLSRLDFSDNQLSGELPESLG  292

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP  1511
             ML  L   K   N  + E PQ +G + NL  + +S N+ TG +P
Sbjct  293   MLSSLSYFKASNNHFNSEFPQWIGNMTNLEYLELSNNQFTGSIP  336


 Score = 56.6 bits (135),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 49/122 (40%), Positives = 70/122 (57%), Gaps = 8/122 (7%)
 Frame = -1

Query  1807  EIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSMLKRL  1628
             E P+ I    +L  L+L  N  TG+IP  IG   SLT LS+S+N L GTIP +LS   +L
Sbjct  310   EFPQWIGNMTNLEYLELSNNQFTGSIPQSIGELRSLTHLSISNNKLVGTIPSSLSSCTKL  369

Query  1627  KILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGS-----IFQNLDSS--AIE  1469
              +++L  N  +G IP+ L  L  L  +++S+N L+G +P GS        NLD S   ++
Sbjct  370   SVVQLRGNGFNGTIPEALFGL-GLEDIDLSHNGLSGSIPPGSSRLLETLTNLDLSDNHLQ  428

Query  1468  GN  1463
             GN
Sbjct  429   GN  430


 Score = 53.5 bits (127),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 58/104 (56%), Gaps = 2/104 (2%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
               G IP+ I E  SL  L +  N L GTIP  + +C+ L+++ L  N  +GTIPE L  L
Sbjct  331   FTGSIPQSIGELRSLTHLSISNNKLVGTIPSSLSSCTKLSVVQLRGNGFNGTIPEALFGL  390

Query  1636  KRLKILKLEVNQLSGEIPQQLGK-LENLLAVNVSYNRLTGRLPA  1508
               L+ + L  N LSG IP    + LE L  +++S N L G +PA
Sbjct  391   G-LEDIDLSHNGLSGSIPPGSSRLLETLTNLDLSDNHLQGNIPA  433



>ref|XP_002518223.1| receptor protein kinase, putative [Ricinus communis]
 gb|EEF44166.1| receptor protein kinase, putative [Ricinus communis]
Length=1007

 Score =   721 bits (1860),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/543 (71%), Positives = 460/543 (85%), Gaps = 6/543 (1%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             SA+ G IP DICESGSL ILQLDGNS+ G+IP +IGNCS++ LLSLSHNNLSG IP++++
Sbjct  471   SAISGSIPADICESGSLSILQLDGNSIVGSIPEEIGNCSTMYLLSLSHNNLSGPIPKSIA  530

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGN  1463
              L  LKILKLE N+LSGEIP +LGKLENLLAVN+SYN L GRLP+G IF +LD SA++GN
Sbjct  531   KLNNLKILKLEFNKLSGEIPLELGKLENLLAVNISYNMLIGRLPSGGIFPSLDQSALQGN  590

Query  1462  DGICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRFLsvsai  1283
              GICSPLL GPCKMN PKP+V++PF YGNQ + +   +  E   STR S +H  LSVS+I
Sbjct  591   LGICSPLLKGPCKMNVPKPLVLDPFAYGNQMEGHRPRN--ESPDSTR-SHNHMLLSVSSI  647

Query  1282  vaisaaaiiavgvmvITMVNASVRRRISFVENALESMCSSTSSRSQGMATGKLILFDTKS  1103
             +AISAA  I  GV++I+++N S R+R++FV++ALES+ SS+S      A GKL+LFD+KS
Sbjct  648   IAISAAVFIVFGVIIISLLNISARKRLAFVDHALESLFSSSSRSGNLAAAGKLVLFDSKS  707

Query  1102  SPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDFDRE  923
             SPD  ++  ES+LNKA+EIGEGVFGTVYK  LGG   R+VAIKKL SS I+QYPEDF+RE
Sbjct  708   SPDEINNP-ESLLNKAAEIGEGVFGTVYKVSLGGSHGRMVAIKKLVSSNIIQYPEDFERE  766

Query  922   VRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAVRFK  743
             V++LGKARH NL+ L GYYWTPQLQLLVS+F P G+L++KLH      +TPPL+WA RFK
Sbjct  767   VQILGKARHPNLISLTGYYWTPQLQLLVSEFAPSGSLQAKLH--GRPPSTPPLSWANRFK  824

Query  742   IILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVMSNR  563
             I+LGTAKGLAHLHHS +PPIIHYNIKPSNILLDEN NPKISDFGL+RL+ KLD+HV++NR
Sbjct  825   IVLGTAKGLAHLHHSFRPPIIHYNIKPSNILLDENNNPKISDFGLSRLLTKLDKHVINNR  884

Query  562   FQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRVLL  383
             FQ+A+GYVAPELACQSLRVNEKCDVYGFG+LILE+VTGRRP+EYGEDNV+ILNDHVRVLL
Sbjct  885   FQSALGYVAPELACQSLRVNEKCDVYGFGILILELVTGRRPIEYGEDNVVILNDHVRVLL  944

Query  382   EQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPVPNRM  203
             EQGN L+CVD  MG YP++EVLPVLKLALVCTSQIPSSRPSM EVVQILQVIKTPVP RM
Sbjct  945   EQGNALDCVDPSMGDYPEDEVLPVLKLALVCTSQIPSSRPSMGEVVQILQVIKTPVPQRM  1004

Query  202   EPY  194
             E +
Sbjct  1005  EIF  1007


 Score = 58.9 bits (141),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 37/101 (37%), Positives = 56/101 (55%), Gaps = 0/101 (0%)
 Frame = -1

Query  1810  GEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSMLKR  1631
             G +P  +    +L  LQL GN  +GT+P   G C+ L  L LS+N  +G +P++L  L  
Sbjct  235   GSLPIGVSSLHNLKDLQLQGNRFSGTLPVDTGLCTHLLRLDLSNNLFTGALPDSLKWLGS  294

Query  1630  LKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPA  1508
             L  + L  N  + + PQ +G + NL  ++ S N LTG LP+
Sbjct  295   LTFISLSNNMFTDDFPQWIGNIRNLEYLDFSSNLLTGSLPS  335


 Score = 53.9 bits (128),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 46/122 (38%), Positives = 64/122 (52%), Gaps = 8/122 (7%)
 Frame = -1

Query  1810  GEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS-MLK  1634
             G+IP  + +   L +++L GNS  GTIP  + N   L  +  S N L G+IP   S    
Sbjct  355   GQIPTSMVQFSKLSVIRLRGNSFIGTIPEGLFNL-GLEEVDFSDNKLIGSIPAGSSKFYG  413

Query  1633  RLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAG-SIFQNLD-----SSAI  1472
              L+IL L  N L+G I  ++G   NL  +N+S+N L  R+P     FQNL      +SAI
Sbjct  414   SLQILDLSRNNLTGNIRAEMGLSSNLRYLNLSWNNLQSRMPQELGYFQNLTVLDLRNSAI  473

Query  1471  EG  1466
              G
Sbjct  474   SG  475



>ref|XP_007139297.1| hypothetical protein PHAVU_008G017400g [Phaseolus vulgaris]
 gb|ESW11291.1| hypothetical protein PHAVU_008G017400g [Phaseolus vulgaris]
Length=1018

 Score =   718 bits (1853),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/546 (73%), Positives = 467/546 (86%), Gaps = 14/546 (3%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             SAL G +P DIC+SG+L +LQLD NSL G IP  IGNCSSL LLSLSHNNL+G+IP+++S
Sbjct  484   SALHGSVPADICDSGNLAVLQLDENSLQGNIPEGIGNCSSLYLLSLSHNNLTGSIPKSMS  543

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGN  1463
              L +LKILKLE N+LSGEIP +LG L++LLAVN+SYNRLTGRLP GSIFQNLD S++EGN
Sbjct  544   KLNKLKILKLESNELSGEIPMELGMLQSLLAVNISYNRLTGRLPTGSIFQNLDKSSLEGN  603

Query  1462  DGICSPLLTGPCKMNAPKPIVINPFVYGNQTd---nnnggdnNEPLASTRNSRHHRFLsv  1292
              G+CSPLL GPCKMN PKP+V++P  Y NQ       N    +EP+        HRFLSV
Sbjct  604   LGLCSPLLEGPCKMNVPKPLVLDPNAYNNQISPQRQRNESSESEPV------HRHRFLSV  657

Query  1291  saivaisaaaiiavgvmvITMVNASVRRRISFVENALESMCSSTSSRSQGMATGKLILFD  1112
             SAIVAISA+ +I +GV+ ++++N SVRRR+SFV+NALESMCSS+S      ATGKLILFD
Sbjct  658   SAIVAISASFVIVLGVIAVSLLNVSVRRRLSFVDNALESMCSSSSRSGSP-ATGKLILFD  716

Query  1111  TKSSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDF  932
             ++SSPDW SS  ES+LNKASEIGEGVFGT+YK PLG +G R+VAIKKL S+ I+QYPEDF
Sbjct  717   SQSSPDWISSP-ESLLNKASEIGEGVFGTLYKVPLGSQG-RMVAIKKLISTNIIQYPEDF  774

Query  931   DREVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAV  752
             D+EVR+LGKARH NL+ L+GYYWTPQLQLLV++F P G+L++KLHE   +  +PPL+W +
Sbjct  775   DKEVRILGKARHPNLIALKGYYWTPQLQLLVTEFAPNGSLQAKLHERLPS--SPPLSWPI  832

Query  751   RFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVM  572
             RFKI+LGTAKGLAHLHHS +PPIIHYNIKPSNILLDEN NPKISDFGLARL+ KLDRHVM
Sbjct  833   RFKILLGTAKGLAHLHHSFRPPIIHYNIKPSNILLDENCNPKISDFGLARLLTKLDRHVM  892

Query  571   SNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVR  392
             SNRFQ+A+GYVAPELACQSLRVNEKCDVYGFG++ILE+VTGRRPVEYGEDNVLILNDHVR
Sbjct  893   SNRFQSALGYVAPELACQSLRVNEKCDVYGFGVMILELVTGRRPVEYGEDNVLILNDHVR  952

Query  391   VLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPVP  212
             VLLEQGNVLECVD  M  YP++EVLPVLKLA+VCTSQIPSSRP+M+EVVQILQVIKTPVP
Sbjct  953   VLLEQGNVLECVDHSMIEYPEDEVLPVLKLAMVCTSQIPSSRPTMSEVVQILQVIKTPVP  1012

Query  211   NRMEPY  194
              RME +
Sbjct  1013  QRMEVF  1018



>ref|XP_010268319.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Nelumbo nucifera]
Length=1009

 Score =   714 bits (1844),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/543 (72%), Positives = 464/543 (85%), Gaps = 9/543 (2%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             SAL G IPED+C+S SL ILQLDGNSLTG IP +IGNCSSL LLSLS+N L+G+IP+ +S
Sbjct  476   SALYGSIPEDLCDSTSLAILQLDGNSLTGPIPDEIGNCSSLYLLSLSNNQLNGSIPKAMS  535

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGN  1463
              LK+LKILKLE N+LSGEIPQ+LGKL+NLLAVN+SYN+L GRLP G IFQNLD SA++GN
Sbjct  536   RLKKLKILKLEFNELSGEIPQELGKLDNLLAVNISYNKLVGRLPVGGIFQNLDQSALQGN  595

Query  1462  DGICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRFLsvsai  1283
              GICSPLL GPCKMN PKP+V++P  Y NQ    N     E   S +  RH RFLSVSAI
Sbjct  596   LGICSPLLRGPCKMNVPKPLVLDPNAYNNQMGGPNVVP--ESTGSAK-LRHRRFLSVSAI  652

Query  1282  vaisaaaiiavgvmvITMVNASVRRRISFVENALESMCSSTSSRSQGMATGKLILFDTKS  1103
             VAISAA +I  GV++++++N S RRR++FV+NALESMCSS S RS  +ATGKLILFD++S
Sbjct  653   VAISAALVIVCGVVIVSLLNVSARRRLAFVDNALESMCSS-SQRSGSLATGKLILFDSRS  711

Query  1102  SPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDFDRE  923
             S DWA +  E++LNKASEIG+GVFGTVYKA LG EG R+VAIKKL +S I+QYPEDFDRE
Sbjct  712   SDDWAQNA-ETLLNKASEIGKGVFGTVYKASLG-EG-RIVAIKKLVTSNIIQYPEDFDRE  768

Query  922   VRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAVRFK  743
             VR+LGKARH NL+ L+GY+WTPQLQLL+S++ P G+L S+LHE + +  +PPL+WA RFK
Sbjct  769   VRILGKARHPNLITLKGYFWTPQLQLLISEYAPNGSLHSRLHERSPS--SPPLSWANRFK  826

Query  742   IILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVMSNR  563
             I LGTAKGL HLH + +PPIIHY+IKPSNILLDEN NPKISDFGLARL+ KLD+HV+S+R
Sbjct  827   IALGTAKGLVHLHQNFRPPIIHYSIKPSNILLDENYNPKISDFGLARLLTKLDKHVISSR  886

Query  562   FQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRVLL  383
             FQ+A+GYVAPELACQSLR+NEKCD+YGFG++ILE+VTGR+PVEYGED+V+IL+DHVRV+L
Sbjct  887   FQSALGYVAPELACQSLRINEKCDIYGFGVMILELVTGRKPVEYGEDDVVILSDHVRVML  946

Query  382   EQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPVPNRM  203
             EQG VL CVD  MG YP+EEVLPVLKL LVCTSQIPSSRPSMAEVVQILQVIKTPVP RM
Sbjct  947   EQGKVLSCVDPTMGEYPEEEVLPVLKLGLVCTSQIPSSRPSMAEVVQILQVIKTPVPQRM  1006

Query  202   EPY  194
             E +
Sbjct  1007  EAF  1009



>ref|XP_002265846.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Vitis vinifera]
Length=1012

 Score =   710 bits (1832),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/541 (71%), Positives = 461/541 (85%), Gaps = 7/541 (1%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G IP DIC+SGSLGILQLDGNSLTG IP + GNCSSL LLS+SHN L+G+IP++ +ML
Sbjct  479   LFGSIPGDICDSGSLGILQLDGNSLTGPIPDEFGNCSSLYLLSMSHNELNGSIPKSFAML  538

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
             K+L+IL+LE N+LSGEIP++LG LENLLAVNVSYNRL GRLP G IFQ+LD SA++GN G
Sbjct  539   KKLEILRLEFNELSGEIPRELGSLENLLAVNVSYNRLIGRLPVGGIFQSLDQSALQGNLG  598

Query  1456  ICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRFLsvsaiva  1277
             ICSPLL GPCK+N  KP+V++P+ +G   +  N  +  E   +    RHH FLSVSAI+A
Sbjct  599   ICSPLLKGPCKLNVSKPLVLDPYDFGKPINGQNRRN--ESTTTPMRFRHHMFLSVSAIIA  656

Query  1276  isaaaiiavgvmvITMVNASVRRRISFVENALESMCSSTSSRSQGMATGKLILFDTKSSP  1097
             I+AAA I +GV+VI+++N S RRR++F++ ALESMCSS+S       TGKLILFD+++S 
Sbjct  657   ITAAAFILIGVVVISLLNVSARRRLAFIDTALESMCSSSSRSGSP-PTGKLILFDSRASQ  715

Query  1096  DWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDFDREVR  917
             DW ++  E++LNKA+EIG GVFGTVYK  LGG G+R+VAIKKL +S I+QYPEDFDREVR
Sbjct  716   DWIANP-ENLLNKAAEIGGGVFGTVYKVSLGG-GARMVAIKKLVTSNIIQYPEDFDREVR  773

Query  916   VLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAVRFKII  737
             +LGKARHQNL+ L+GYYWTPQLQLLV+D+ P G+L+++LHE      TPPL+W  RF+II
Sbjct  774   ILGKARHQNLISLKGYYWTPQLQLLVTDYAPNGSLQARLHERPPT--TPPLSWPNRFRII  831

Query  736   LGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVMSNRFQ  557
             LGTAKGLAHLHHS +PPIIHYN+KPSNILLDEN NP ISD+GLARL+ KLD+HV+S+RFQ
Sbjct  832   LGTAKGLAHLHHSFRPPIIHYNLKPSNILLDENCNPMISDYGLARLLTKLDKHVISSRFQ  891

Query  556   AAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRVLLEQ  377
             +A+GYVAPELACQSLRVNEKCD+YGFG++ILEIVTGRRPVEYGEDNV+ILNDHVRVLLEQ
Sbjct  892   SALGYVAPELACQSLRVNEKCDIYGFGVMILEIVTGRRPVEYGEDNVVILNDHVRVLLEQ  951

Query  376   GNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPVPNRMEP  197
             GNVLECVD  M  YP+EEVLPVLKLALVCTSQIPSSRP+MAEVVQILQVIKTP+P RME 
Sbjct  952   GNVLECVDPSMNEYPEEEVLPVLKLALVCTSQIPSSRPTMAEVVQILQVIKTPIPQRMEA  1011

Query  196   Y  194
             +
Sbjct  1012  F  1012


 Score = 58.2 bits (139),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/101 (36%), Positives = 55/101 (54%), Gaps = 0/101 (0%)
 Frame = -1

Query  1810  GEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSMLKR  1631
             G +P+ +    +L  LQL GN  +G +P  IG C  L  L   HN  +G++P++L  L  
Sbjct  241   GSVPDGVAAIHNLKELQLQGNRFSGPLPVDIGLCPHLRRLDFCHNLFTGSLPDSLQRLNS  300

Query  1630  LKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPA  1508
             L    +  N L+G+ PQ +G + ++  V+ S N  TG LPA
Sbjct  301   LVFFGVSNNLLAGDFPQWIGSMSSVEYVDFSGNGFTGSLPA  341


 Score = 56.6 bits (135),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 68/120 (57%), Gaps = 3/120 (3%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G+ P+ I    S+  +   GN  TG++P  +GN  SL  LSLS N L+G+IP +L   
Sbjct  311   LAGDFPQWIGSMSSVEYVDFSGNGFTGSLPASMGNLKSLQFLSLSDNRLTGSIPGSLFYC  370

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGS--IFQNLDSSAIEGN  1463
              +L +++L  N  SG IP+ L  L  L  V++S N L G +P GS  +F++L S  +  N
Sbjct  371   PKLSVIRLRGNGFSGSIPEGLFDL-GLDEVDLSGNELEGPIPPGSSRLFESLHSLDLSRN  429



>ref|XP_009371148.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Pyrus x bretschneideri]
Length=1009

 Score =   707 bits (1824),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/543 (73%), Positives = 467/543 (86%), Gaps = 8/543 (1%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             SAL G IPED+C+SGSL ILQLDGNSLTG+IP +IGNCSSL L+SLSHNNLSGTIP+++S
Sbjct  475   SALFGSIPEDVCDSGSLAILQLDGNSLTGSIPDEIGNCSSLYLMSLSHNNLSGTIPKSIS  534

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGN  1463
              L +LKILKLE N+LSGEIPQ+LGKLENLLAVN+SYNRL GRLPAGS+FQ+LD +A++GN
Sbjct  535   KLNKLKILKLEFNELSGEIPQELGKLENLLAVNISYNRLVGRLPAGSVFQSLDQTALQGN  594

Query  1462  DGICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRFLsvsai  1283
              GICSPLL GPC +N PKP+V++P  Y NQ   +   +  +   ST++ RH  FLS+SAI
Sbjct  595   LGICSPLLQGPCTLNVPKPLVLDPTAYNNQMGGHRHHN--KSATSTKDQRH-TFLSLSAI  651

Query  1282  vaisaaaiiavgvmvITMVNASVRRRISFVENALESMCSSTSSRSQGMATGKLILFDTKS  1103
             VAISAA++I +GV+VI+++NAS RRR +FVE ALESMCSS+S     +A+GKLILFD++S
Sbjct  652   VAISAASLIVLGVIVISLLNASARRRPAFVETALESMCSSSSRSGS-LASGKLILFDSRS  710

Query  1102  SPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDFDRE  923
             SP+W SS  ES+LNKASEIGEGVFGTVYK PLG +G RVVAIKKL +S I+Q  EDFDRE
Sbjct  711   SPEWISSP-ESLLNKASEIGEGVFGTVYKIPLGAQG-RVVAIKKLVTSNIIQCLEDFDRE  768

Query  922   VRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAVRFK  743
             VR+LGKARH NL+ L+GYYWTP++QLLV++F   G+L+SKLHE   +  +PPL+WA RFK
Sbjct  769   VRILGKARHPNLIALKGYYWTPRMQLLVTEFATNGSLQSKLHERPHS--SPPLSWANRFK  826

Query  742   IILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVMSNR  563
             I+LGTAKGLAHLHHS +PPIIHYNIKPSNILLDE  N KISDF LARL+ K+DRHV+SNR
Sbjct  827   ILLGTAKGLAHLHHSYRPPIIHYNIKPSNILLDETYNAKISDFALARLLTKIDRHVVSNR  886

Query  562   FQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRVLL  383
             FQ+A+GYVAPELACQSLRVNEKCDVYGFG+LILEIVTGRRPVEYGEDNV+ILNDHVRVLL
Sbjct  887   FQSALGYVAPELACQSLRVNEKCDVYGFGVLILEIVTGRRPVEYGEDNVVILNDHVRVLL  946

Query  382   EQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPVPNRM  203
             EQGN L C+D  MG YP++EVLPVLKLALVCTSQIPS RP+MAEVVQI+Q+IKTP+P  M
Sbjct  947   EQGNALGCIDVSMGDYPEDEVLPVLKLALVCTSQIPSCRPTMAEVVQIMQIIKTPIPQTM  1006

Query  202   EPY  194
             E Y
Sbjct  1007  EAY  1009


 Score = 60.1 bits (144),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 35/111 (32%), Positives = 55/111 (50%), Gaps = 1/111 (1%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L+G IP  +     L +++L GN+ TG+IP  + N     +            P +  + 
Sbjct  357   LVGTIPTSLAYCNDLLVIRLRGNTFTGSIPEGLFNLGLEEIDFSHMGLTGSIPPGSSRLF  416

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAG-SIFQNL  1487
             + L++L L  N L G IP ++G   NL  +N+S+N L  R+P     FQNL
Sbjct  417   ESLRMLDLSSNNLKGNIPAEVGLFSNLRYLNLSWNNLQSRMPPELGFFQNL  467


 Score = 55.1 bits (131),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 45/123 (37%), Positives = 69/123 (56%), Gaps = 8/123 (7%)
 Frame = -1

Query  1810  GEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSMLKR  1631
             G+ P+ I    SL  L    N  TG++PP + +  SL  LSLS+N L GTIP +L+    
Sbjct  311   GDFPQWIGSMSSLKYLDFSNNGFTGSLPPSMSDLRSLNYLSLSNNKLVGTIPTSLAYCND  370

Query  1630  LKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGS--IFQ-----NLDSSAI  1472
             L +++L  N  +G IP+ L  L  L  ++ S+  LTG +P GS  +F+     +L S+ +
Sbjct  371   LLVIRLRGNTFTGSIPEGLFNL-GLEEIDFSHMGLTGSIPPGSSRLFESLRMLDLSSNNL  429

Query  1471  EGN  1463
             +GN
Sbjct  430   KGN  432



>ref|XP_002302895.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|EEE82168.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=1012

 Score =   706 bits (1822),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/543 (71%), Positives = 455/543 (84%), Gaps = 8/543 (1%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             SAL+G IP DICESGSL ILQLDGNSL G IP +IGNCSSL LLSLS NNLSG+IPE++S
Sbjct  478   SALVGLIPADICESGSLNILQLDGNSLVGQIPEEIGNCSSLYLLSLSQNNLSGSIPESIS  537

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGN  1463
              L +LKILKLE N+L+GEIPQ+LGKLENLLAVNVSYN+L GRLP G IF +LD SA++GN
Sbjct  538   RLNKLKILKLEFNELTGEIPQELGKLENLLAVNVSYNKLVGRLPVGGIFPSLDRSALQGN  597

Query  1462  DGICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRFLsvsai  1283
              G+CSPLL GPCKMN PKP+V++P+ Y NQ D     + +   A      HH FLSVS I
Sbjct  598   LGLCSPLLKGPCKMNVPKPLVLDPYAYDNQGDGKKPRNVSSHPARFH---HHMFLSVSTI  654

Query  1282  vaisaaaiiavgvmvITMVNASVRRRISFVENALESMCSSTSSRSQGMATGKLILFDTKS  1103
             +AISAA  I  GV++++++N SVR+R++FV++ALESMCSS+S     ++TGKL+LFD+KS
Sbjct  655   IAISAAIFILFGVILVSLLNVSVRKRLAFVDHALESMCSSSSRSGN-LSTGKLVLFDSKS  713

Query  1102  SPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDFDRE  923
             SPDW S+  E++LNKA+EIG GVFGTVYK  LG E +R+VAIKKL +  I+QYPEDFDRE
Sbjct  714   SPDWISNP-EALLNKAAEIGHGVFGTVYKVSLGSE-ARMVAIKKLLTLNIIQYPEDFDRE  771

Query  922   VRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAVRFK  743
             V+VLGKARH NL+ L+GYYWTPQLQLLVS++ P G+L++KLHE   +   P L+WA R K
Sbjct  772   VQVLGKARHPNLLSLKGYYWTPQLQLLVSEYAPNGSLQAKLHERIPS--APRLSWANRLK  829

Query  742   IILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVMSNR  563
             I+LGTAKGLAHLHHS +PPIIH +IKPSNILLDEN NPKISDFGLAR +AKLDRHV+S R
Sbjct  830   IVLGTAKGLAHLHHSFRPPIIHCDIKPSNILLDENFNPKISDFGLARFLAKLDRHVISTR  889

Query  562   FQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRVLL  383
             FQ+A+GYVAPEL+CQSLR+NEKCD+YGFG+LILE+VTGRRPVEYGEDNVLIL DHVR LL
Sbjct  890   FQSALGYVAPELSCQSLRINEKCDIYGFGILILELVTGRRPVEYGEDNVLILKDHVRFLL  949

Query  382   EQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPVPNRM  203
             EQGNV +CVD  MG YP++EVLPVLKLALVCTS IPSSRPSMAEVVQILQVIKTPVP R 
Sbjct  950   EQGNVFDCVDPSMGDYPEDEVLPVLKLALVCTSHIPSSRPSMAEVVQILQVIKTPVPQRT  1009

Query  202   EPY  194
             E +
Sbjct  1010  EFF  1012


 Score = 56.2 bits (134),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 48/121 (40%), Positives = 67/121 (55%), Gaps = 3/121 (2%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L GE P  I    +L  L L  N+LTG+IP  IG+  SL  LSLS+N L G IP ++   
Sbjct  312   LAGEFPRWIGSLTNLEYLDLSSNALTGSIPSSIGDLKSLRYLSLSNNKLFGIIPTSMVSC  371

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSI--FQNLDSSAIEGN  1463
               L +++L  N  +G IP+ L  L  L  V+ S N L G +P+GSI  F +L +  +  N
Sbjct  372   TMLSVIRLRGNSFNGSIPEGLFDLR-LEEVDFSDNGLVGSIPSGSITFFSSLHTLDLSKN  430

Query  1462  D  1460
             +
Sbjct  431   N  431


 Score = 55.8 bits (133),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 40/101 (40%), Positives = 57/101 (56%), Gaps = 0/101 (0%)
 Frame = -1

Query  1810  GEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSMLKR  1631
             G +P+ +     L  LQL GN  +G +P  IG C  L  L LS N  SG +PE+L  L  
Sbjct  242   GSVPQGVSAIHFLKELQLQGNRFSGPLPGDIGLCPHLNRLDLSRNLFSGALPESLQRLSS  301

Query  1630  LKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPA  1508
             + +  L  N L+GE P+ +G L NL  +++S N LTG +P+
Sbjct  302   MSLFSLSKNMLAGEFPRWIGSLTNLEYLDLSSNALTGSIPS  342


 Score = 53.5 bits (127),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 44/137 (32%), Positives = 64/137 (47%), Gaps = 25/137 (18%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPE---  1652
             +AL G IP  I +  SL  L L  N L G IP  + +C+ L+++ L  N+ +G+IPE   
Sbjct  334   NALTGSIPSSIGDLKSLRYLSLSNNKLFGIIPTSMVSCTMLSVIRLRGNSFNGSIPEGLF  393

Query  1651  ---------------------TLSMLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSY  1535
                                  +++    L  L L  N L+G IP + G   NL  +N+S+
Sbjct  394   DLRLEEVDFSDNGLVGSIPSGSITFFSSLHTLDLSKNNLTGHIPAERGLSSNLRYLNLSW  453

Query  1534  NRLTGRLPAG-SIFQNL  1487
             N L  R+P     FQNL
Sbjct  454   NNLESRMPLELGYFQNL  470



>ref|XP_011042759.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Populus euphratica]
 ref|XP_011042760.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Populus euphratica]
Length=1012

 Score =   701 bits (1809),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/543 (71%), Positives = 454/543 (84%), Gaps = 8/543 (1%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             SAL+G IP DICESGSL ILQLDGNSL G IP +IGNCSSL LLSLS NNLSG+IPE++S
Sbjct  478   SALVGFIPADICESGSLNILQLDGNSLVGQIPEEIGNCSSLYLLSLSQNNLSGSIPESIS  537

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGN  1463
              L +LKILKLE N+L+GEIP +LGKLENLLAVNVSYN+L GRLP G IF +LD SA++GN
Sbjct  538   RLNKLKILKLEFNELTGEIPLELGKLENLLAVNVSYNKLEGRLPVGGIFPSLDQSALQGN  597

Query  1462  DGICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRFLsvsai  1283
              GICSPLL GPCKMN PKP+V++P+ YGNQ D     + +   A      HH FLSVS I
Sbjct  598   LGICSPLLKGPCKMNVPKPLVLDPYAYGNQGDGKKPRNVSSHPARFH---HHVFLSVSTI  654

Query  1282  vaisaaaiiavgvmvITMVNASVRRRISFVENALESMCSSTSSRSQGMATGKLILFDTKS  1103
             +AISAA +I  GV++++++N SVR+R++FV++ALESMCSS+S     ++TGKL+LFD+KS
Sbjct  655   IAISAAILILFGVILVSLLNVSVRKRLAFVDHALESMCSSSSRSGN-LSTGKLVLFDSKS  713

Query  1102  SPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDFDRE  923
             SPDW S+  E++LNKA+EIG+GVFGTVYK  LG E +R+VAIKKL +  I QYPEDFDRE
Sbjct  714   SPDWISNP-EALLNKAAEIGQGVFGTVYKVSLGSE-ARMVAIKKLFTLNITQYPEDFDRE  771

Query  922   VRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAVRFK  743
             V+VLGKARH NL+ L+GYYWTPQLQLLVS++ P G+L+++LHE   + +   L+WA R K
Sbjct  772   VQVLGKARHPNLLSLKGYYWTPQLQLLVSEYAPNGSLQAELHERIPSASR--LSWANRLK  829

Query  742   IILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVMSNR  563
             I+LGTAKGLAHLHHS +PPIIH++IKPSNILLDEN NPKISDFGLAR  AKLDRHV+S R
Sbjct  830   IVLGTAKGLAHLHHSFRPPIIHFDIKPSNILLDENFNPKISDFGLARFFAKLDRHVISTR  889

Query  562   FQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRVLL  383
             FQ+A+GYVAPEL CQSL +NEKCDVYGFG+LILE+VTGRRPVEYGEDNVLIL DHVR LL
Sbjct  890   FQSALGYVAPELLCQSLIINEKCDVYGFGILILELVTGRRPVEYGEDNVLILKDHVRFLL  949

Query  382   EQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPVPNRM  203
             EQGNV +CVD  MG YP++EVLPVLKLALVCTS IPSSRPSMAEVVQILQVIKTPVP R 
Sbjct  950   EQGNVFDCVDPSMGDYPEDEVLPVLKLALVCTSHIPSSRPSMAEVVQILQVIKTPVPQRT  1009

Query  202   EPY  194
             E +
Sbjct  1010  EFF  1012


 Score = 55.8 bits (133),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 40/101 (40%), Positives = 56/101 (55%), Gaps = 0/101 (0%)
 Frame = -1

Query  1810  GEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSMLKR  1631
             G +P+ +     L  LQL GN  +G +P  IG C  L  L LS N  SG +PE+L  L  
Sbjct  242   GSVPQGVSAIHFLKELQLQGNRFSGPLPGDIGLCPHLNRLDLSRNLFSGVLPESLRRLSS  301

Query  1630  LKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPA  1508
             +    L  N L+GE P+ +G L NL  +++S N LTG +P+
Sbjct  302   MSFFSLSKNMLAGEFPRWIGSLTNLEYLDLSSNALTGSIPS  342


 Score = 55.5 bits (132),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 48/121 (40%), Positives = 67/121 (55%), Gaps = 3/121 (2%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L GE P  I    +L  L L  N+LTG+IP  IG+  SL  LSLS+N L G IP ++   
Sbjct  312   LAGEFPRWIGSLTNLEYLDLSSNALTGSIPSSIGDLKSLRYLSLSNNKLFGIIPTSVVSC  371

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSI--FQNLDSSAIEGN  1463
               L +++L  N  +G IP+ L  L  L  V+ S N L G +P+GSI  F +L +  +  N
Sbjct  372   TMLSVIRLRGNSFNGSIPEGLFDL-GLEEVDFSDNGLVGSIPSGSITFFSSLHTLDLSKN  430

Query  1462  D  1460
             +
Sbjct  431   N  431


 Score = 54.3 bits (129),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 44/137 (32%), Positives = 64/137 (47%), Gaps = 25/137 (18%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPE---  1652
             +AL G IP  I +  SL  L L  N L G IP  + +C+ L+++ L  N+ +G+IPE   
Sbjct  334   NALTGSIPSSIGDLKSLRYLSLSNNKLFGIIPTSVVSCTMLSVIRLRGNSFNGSIPEGLF  393

Query  1651  ---------------------TLSMLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSY  1535
                                  +++    L  L L  N L+G IP + G   NL  +N+S+
Sbjct  394   DLGLEEVDFSDNGLVGSIPSGSITFFSSLHTLDLSKNNLTGHIPAERGLSSNLRYLNLSW  453

Query  1534  NRLTGRLPAG-SIFQNL  1487
             N L  R+P     FQNL
Sbjct  454   NNLESRMPLELGYFQNL  470



>ref|XP_008337525.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Malus domestica]
Length=1009

 Score =   698 bits (1801),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/543 (72%), Positives = 465/543 (86%), Gaps = 8/543 (1%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             SAL G IPED+C+S SL ILQLDGNSLTG+IP +IGNCSSL L+SLSHNNLSGTIP+++S
Sbjct  475   SALFGSIPEDVCDSASLAILQLDGNSLTGSIPDEIGNCSSLYLMSLSHNNLSGTIPKSIS  534

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGN  1463
              L +LKILKLE N+LSGEIPQ+LGKLENLLAVN+SYNRL GRLPAGS+FQ+LD +A++GN
Sbjct  535   KLNKLKILKLEFNELSGEIPQELGKLENLLAVNISYNRLVGRLPAGSVFQSLDQTALQGN  594

Query  1462  DGICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRFLsvsai  1283
              GICSPLL GPC MN PKP+V++P  Y NQ   +   +  +   ST++ R   FLS+SAI
Sbjct  595   LGICSPLLKGPCTMNVPKPLVLDPTAYNNQMGGHRHHN--KSATSTKDQRR-TFLSLSAI  651

Query  1282  vaisaaaiiavgvmvITMVNASVRRRISFVENALESMCSSTSSRSQGMATGKLILFDTKS  1103
             VAISAA++I +GV+VI+++NAS RRR +FVE ALESMCSS+S     +A+GKLILFD++S
Sbjct  652   VAISAASLIVLGVIVISLLNASARRRPAFVETALESMCSSSSRSGS-LASGKLILFDSRS  710

Query  1102  SPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDFDRE  923
             SP+W SS  ES+LNKASEIGEGVFGTVYK PLG +G RVVAIK+L +S I+Q  EDFDRE
Sbjct  711   SPEWISSP-ESLLNKASEIGEGVFGTVYKIPLGAQG-RVVAIKRLVTSNIIQCLEDFDRE  768

Query  922   VRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAVRFK  743
             VR+LGKARH NL+ L+GYYWTPQ+QLLV++F   G+L+SKLHE   +  +PPL+WA RFK
Sbjct  769   VRILGKARHPNLIALKGYYWTPQMQLLVTEFATNGSLQSKLHERPHS--SPPLSWANRFK  826

Query  742   IILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVMSNR  563
             I+LGTAKGLA LHHS +PPIIHYNIKPSNILLDE+ N KISDF LARL+ K+D+HV+SNR
Sbjct  827   ILLGTAKGLAQLHHSYRPPIIHYNIKPSNILLDESYNAKISDFALARLLTKIDQHVVSNR  886

Query  562   FQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRVLL  383
             FQ+A+GYVAPELACQSLRVNEKCDVYGFG+LILEIVTGRRPVEYGEDNV+ILNDHVRVLL
Sbjct  887   FQSALGYVAPELACQSLRVNEKCDVYGFGVLILEIVTGRRPVEYGEDNVVILNDHVRVLL  946

Query  382   EQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPVPNRM  203
             EQGN L C+D  MG YP++EVLPVLKLALVCTSQIPS RP+MAEVVQI+Q+IKTP+P  M
Sbjct  947   EQGNALGCIDVSMGYYPEDEVLPVLKLALVCTSQIPSCRPTMAEVVQIMQIIKTPIPQTM  1006

Query  202   EPY  194
             E Y
Sbjct  1007  EAY  1009


 Score = 61.6 bits (148),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/111 (32%), Positives = 55/111 (50%), Gaps = 1/111 (1%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L+G IP  +     L +++L GN+ TG+IP  + N     +            P +  + 
Sbjct  357   LVGTIPTSLAYCNDLSVIRLRGNTFTGSIPEGLFNLGLEEIDFSHMGLTGSIPPGSSKLF  416

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAG-SIFQNL  1487
             + L++L L  N L G IP ++G   NL  +N+S+N L  R+P     FQNL
Sbjct  417   ESLRMLDLSSNNLKGNIPAEVGLFSNLRYLNLSWNNLQSRMPPELGFFQNL  467


 Score = 55.8 bits (133),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 45/123 (37%), Positives = 69/123 (56%), Gaps = 8/123 (7%)
 Frame = -1

Query  1810  GEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSMLKR  1631
             G+ P+ I    SL  L    N  TG++PP + +  SL  LSLS+N L GTIP +L+    
Sbjct  311   GDFPQWIGSMSSLKYLDFSNNGFTGSLPPSMSDLRSLNYLSLSNNKLVGTIPTSLAYCND  370

Query  1630  LKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGS--IFQ-----NLDSSAI  1472
             L +++L  N  +G IP+ L  L  L  ++ S+  LTG +P GS  +F+     +L S+ +
Sbjct  371   LSVIRLRGNTFTGSIPEGLFNL-GLEEIDFSHMGLTGSIPPGSSKLFESLRMLDLSSNNL  429

Query  1471  EGN  1463
             +GN
Sbjct  430   KGN  432



>ref|XP_007225370.1| hypothetical protein PRUPE_ppa000838mg [Prunus persica]
 gb|EMJ26569.1| hypothetical protein PRUPE_ppa000838mg [Prunus persica]
Length=986

 Score =   697 bits (1798),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/543 (72%), Positives = 463/543 (85%), Gaps = 8/543 (1%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             SAL G IP DIC+SGSLGILQLDGNSL G IP +IGNCSSL L+SLSHNNLSG IP+++S
Sbjct  452   SALFGSIPGDICDSGSLGILQLDGNSLNGPIPNEIGNCSSLYLMSLSHNNLSGLIPKSIS  511

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGN  1463
              L +LKILKLE N+LSGEIPQ+LG+LENLLAVN+SYNRL GRLP GS+FQ+LD +A++GN
Sbjct  512   KLNKLKILKLEYNELSGEIPQELGRLENLLAVNISYNRLVGRLPVGSVFQSLDQTALQGN  571

Query  1462  DGICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRFLsvsai  1283
              GICSPLL GPC MN PKP+V++P  Y NQ   +   D   P+++T   RHH FLS+SAI
Sbjct  572   LGICSPLLKGPCTMNVPKPLVLDPNAYNNQMGGHRHRDE-SPMSTT--DRHHMFLSISAI  628

Query  1282  vaisaaaiiavgvmvITMVNASVRRRISFVENALESMCSSTSSRSQGMATGKLILFDTKS  1103
             VAISAA +I VGV++I+++N S RRR +FVE ALESMCSS+S     +A+GKLILFD++S
Sbjct  629   VAISAATLIVVGVIIISLLNVSARRRPAFVETALESMCSSSSRSGS-LASGKLILFDSRS  687

Query  1102  SPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDFDRE  923
             SP+W SS  ES+LNKASEIGEGVFGTVYK PLG +G RVVAIKKL +S I+Q  EDFDRE
Sbjct  688   SPEWISSP-ESLLNKASEIGEGVFGTVYKIPLGVQG-RVVAIKKLVTSNIIQCLEDFDRE  745

Query  922   VRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAVRFK  743
             VR+LGKARH NL+ L+GYYWTPQ+QLLV++F   G+L+SKLHE   +  TPPL+WA RFK
Sbjct  746   VRILGKARHPNLIALKGYYWTPQMQLLVTEFATNGSLQSKLHERLPS--TPPLSWANRFK  803

Query  742   IILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVMSNR  563
             I+LGTAKGLAHLHHS +PPIIHYNIKPSNILLDEN NPKISDF L RL+ K+D+HV+SNR
Sbjct  804   ILLGTAKGLAHLHHSYRPPIIHYNIKPSNILLDENYNPKISDFALVRLLTKIDQHVVSNR  863

Query  562   FQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRVLL  383
             FQ A+GYVAPELACQSLRVNEKCDVYGFG+LILE+VTGRRPVEYGEDNV+IL DHVRVLL
Sbjct  864   FQTALGYVAPELACQSLRVNEKCDVYGFGVLILELVTGRRPVEYGEDNVVILTDHVRVLL  923

Query  382   EQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPVPNRM  203
             EQGNVL C+D  MG YP++EVLPVLKLALVCTSQIPS RP+MAEVVQI+Q+IKTP+P+ +
Sbjct  924   EQGNVLGCIDLSMGEYPEDEVLPVLKLALVCTSQIPSCRPTMAEVVQIMQIIKTPIPHTL  983

Query  202   EPY  194
             E +
Sbjct  984   EAF  986


 Score = 61.6 bits (148),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/105 (34%), Positives = 56/105 (53%), Gaps = 0/105 (0%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             +A  G  P+ I    +L +L L GN  +G +P  IG C  L  + +S+N  +G +P++L 
Sbjct  212   NAFSGSAPQGISALHNLKVLLLQGNDFSGPVPADIGLCPHLGRVDISYNLFTGALPDSLQ  271

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPA  1508
              L  L    L  N  +G+ PQ +G + +L  ++ S N  TG LPA
Sbjct  272   RLNSLTFFSLSDNMFTGDFPQWIGNMSSLKYLDFSNNGFTGSLPA  316


 Score = 57.4 bits (137),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 34/111 (31%), Positives = 55/111 (50%), Gaps = 1/111 (1%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L+G IP  +    +L +++L  NS +G+IP  + +     +            P +  + 
Sbjct  334   LVGAIPLSLAYCNALSVIRLSDNSFSGSIPEGLFDLGLEEIHFSQMGLTGSIPPGSSRLF  393

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAG-SIFQNL  1487
             + LK+L L  N L G IP ++G   NL  +N+S+N L  R+P     FQNL
Sbjct  394   ESLKMLDLSRNNLKGNIPAEVGLFSNLRYLNLSWNNLQSRMPPELGFFQNL  444



>ref|XP_010023583.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Eucalyptus grandis]
 gb|KCW59891.1| hypothetical protein EUGRSUZ_H02618 [Eucalyptus grandis]
Length=1012

 Score =   696 bits (1797),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/542 (71%), Positives = 448/542 (83%), Gaps = 12/542 (2%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G IP DIC+S SL ILQLDGN+LTG IP +I NCSSL LLSLSHNNLSG IP+++SML
Sbjct  482   LYGSIPGDICDSRSLAILQLDGNALTGPIPEEIENCSSLYLLSLSHNNLSGPIPKSVSML  541

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
               LKILKLE N+LSGEIPQ+LGKLE+LLAVN+S+NRLTGRLPAG IF +LD SAI+GN G
Sbjct  542   SNLKILKLEFNELSGEIPQELGKLEDLLAVNISHNRLTGRLPAGGIFPSLDQSAIQGNLG  601

Query  1456  ICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRH-HRFLsvsaiv  1280
             ICSP+L GPC MN PKP+V++P+ YGN   + +             S H H FLSVSAIV
Sbjct  602   ICSPILKGPCVMNVPKPLVLDPYAYGNGQQDGHKHR-------NEGSGHSHMFLSVSAIV  654

Query  1279  aisaaaiiavgvmvITMVNASVRRRISFVENALESMCSSTSSRSQGMATGKLILFDTKSS  1100
             AISAA +IA GV+V++++N S RRR++F++ A ES CS+ SSRS  +ATGKLILFD K S
Sbjct  655   AISAAFLIACGVIVVSLLNVSARRRLAFIDTASESKCSN-SSRSGNLATGKLILFDLKVS  713

Query  1099  PDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDFDREV  920
             PD + S   S+LNKAS+IGEGVFGTV+K P G +G ++VA+K+L +S I+Q  EDFDREV
Sbjct  714   PDISLSNPHSLLNKASKIGEGVFGTVFKVPSGVQG-KMVAVKRLVTSNIVQNQEDFDREV  772

Query  919   RVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAVRFKI  740
             R LGKARH NL+ L GY+WTPQLQL+V+++ P G+L SKLHE   +  + PL+WA RFKI
Sbjct  773   RSLGKARHPNLIVLIGYWWTPQLQLIVTEYAPNGSLHSKLHERLPS--SSPLSWATRFKI  830

Query  739   ILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVMSNRF  560
              LG  KGLAHLHH   PPIIHYNIKPSNILLDEN NPKISDFGLARL+ KLDRHVMSNRF
Sbjct  831   ALGVGKGLAHLHHDFHPPIIHYNIKPSNILLDENDNPKISDFGLARLLTKLDRHVMSNRF  890

Query  559   QAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRVLLE  380
             Q+A GYVAPELACQSLRVNEKCDVYGFG+LILE+VTGRRPVEYGEDNV+IL+DHVRVLLE
Sbjct  891   QSAPGYVAPELACQSLRVNEKCDVYGFGILILELVTGRRPVEYGEDNVVILSDHVRVLLE  950

Query  379   QGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPVPNRME  200
             QGN L+CVD  +  YP++EVLPVLKLALVCTSQ+PSSRPSMAEVVQILQVIKTPVP+RME
Sbjct  951   QGNALDCVDPSITEYPEDEVLPVLKLALVCTSQVPSSRPSMAEVVQILQVIKTPVPHRME  1010

Query  199   PY  194
             PY
Sbjct  1011  PY  1012



>gb|KHG00472.1| hypothetical protein F383_20103 [Gossypium arboreum]
Length=989

 Score =   692 bits (1785),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/544 (70%), Positives = 449/544 (83%), Gaps = 12/544 (2%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             +AL G++  DICESG+L ILQLDGNSLTG IP +IGNCSSL  L+LSHNNL+G+IP+++S
Sbjct  455   NALSGDVAGDICESGTLVILQLDGNSLTGPIPDEIGNCSSLYSLTLSHNNLTGSIPKSIS  514

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGN  1463
              L  LKILKLE N+LSGEIP++LG LENLLAVNVSYN+L GRLP G IF +LD SA++GN
Sbjct  515   KLTELKILKLEFNELSGEIPKELGLLENLLAVNVSYNQLIGRLPVGGIFPSLDQSALQGN  574

Query  1462  DGICSPLLTGPCKMNAPKPIVINPFVY-GNQTdnnnggdnNEPLASTRNSRHHR-FLsvs  1289
              GICSPLL GPCK+N PKP+V++P  Y G   D+    ++  P+       HHR  LSVS
Sbjct  575   LGICSPLLKGPCKLNVPKPLVLDPDAYKGRMGDHRRRNESANPIR-----FHHRNSLSVS  629

Query  1288  aivaisaaaiiavgvmvITMVNASVRRRISFVENALESMCSSTSSRSQGMATGKLILFDT  1109
             AI+AISAA +I  GV++I+++N SVRRR+ FVE  LESMCSS S+RS     GKLILFD+
Sbjct  630   AIIAISAAVLIVCGVIIISLLNISVRRRLEFVETTLESMCSS-STRSGSPTAGKLILFDS  688

Query  1108  KSSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDFD  929
             K S +   +  E +LNKA+EIGEGVFGTVYK PL  +G R VAIKKL  S ++QYPEDFD
Sbjct  689   KLSTNGIGNP-EILLNKAAEIGEGVFGTVYKVPLNPQG-RFVAIKKLVISNMIQYPEDFD  746

Query  928   REVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAVR  749
             REVRVLGKARH NL+ L GYYWTPQ QLL++++   G+L++KLHE   +   PPL+W+ R
Sbjct  747   REVRVLGKARHPNLISLEGYYWTPQSQLLITEYATNGDLQTKLHERPAS--APPLSWSNR  804

Query  748   FKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVMS  569
             FKIILGTAKGLAHLHHS +PPIIHYNIKPSNILLDEN NPKISDFGLARL+ KL+ HV+S
Sbjct  805   FKIILGTAKGLAHLHHSFRPPIIHYNIKPSNILLDENYNPKISDFGLARLLTKLENHVIS  864

Query  568   NRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRV  389
             NRFQ+A+GYVAPELACQ+LRVNEKCDV+GFGMLILE+VTGRRPVEYGEDNV+IL+DHVRV
Sbjct  865   NRFQSALGYVAPELACQNLRVNEKCDVFGFGMLILELVTGRRPVEYGEDNVVILSDHVRV  924

Query  388   LLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPVPN  209
              +EQGNVL+CVD  MG YP++EV PVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPVP 
Sbjct  925   SVEQGNVLDCVDLSMGDYPEDEVFPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPVPQ  984

Query  208   RMEP  197
             RMEP
Sbjct  985   RMEP  988


 Score = 53.9 bits (128),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 57/107 (53%), Gaps = 3/107 (3%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQI-GNCssltllslshnnlSGTIPETLSM  1640
             L G IP       S+  L L GNSL+G+IP ++   CSSL  LSLS N+  G +P TLS 
Sbjct  142   LSGSIPSTFVNMNSIRFLDLSGNSLSGSIPEELFQTCSSLRFLSLSENSFDGQLPSTLSK  201

Query  1639  LKRLKILKLEVNQLSGEIPQQLG--KLENLLAVNVSYNRLTGRLPAG  1505
                L  L L  N  SG I    G   +  L A+++SYN  +G +P G
Sbjct  202   CSYLNYLNLSKNHFSGNIDFVSGIWSMYRLRALDLSYNSFSGSVPEG  248



>gb|KJB37929.1| hypothetical protein B456_006G227000 [Gossypium raimondii]
Length=988

 Score =   691 bits (1784),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/544 (70%), Positives = 450/544 (83%), Gaps = 12/544 (2%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             +AL G++  DICESGSL ILQLDGNSLTG IP +IGNCSSL  L+LSHNNL+G+IP+++S
Sbjct  454   NALSGDVAGDICESGSLVILQLDGNSLTGPIPDEIGNCSSLYSLTLSHNNLTGSIPKSIS  513

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGN  1463
              L  LKILKLE N+LSGEIP++LG LENLLAVNVSYN+L GRLP G IF +LD SA++GN
Sbjct  514   KLTELKILKLEFNELSGEIPKELGLLENLLAVNVSYNQLIGRLPVGGIFPSLDQSALQGN  573

Query  1462  DGICSPLLTGPCKMNAPKPIVINPFVY-GNQTdnnnggdnNEPLASTRNSRHHR-FLsvs  1289
              GICSPLL GPCK+N PKP+V++P  Y G   D+    ++  P+       HHR  LSVS
Sbjct  574   LGICSPLLKGPCKLNVPKPLVLDPDAYKGRMGDHRRRNESANPIR-----FHHRNSLSVS  628

Query  1288  aivaisaaaiiavgvmvITMVNASVRRRISFVENALESMCSSTSSRSQGMATGKLILFDT  1109
             AI+AISAA +I  GV++I+++N SV+RR+ FVE ALESMCSS S+RS     GKLILFD+
Sbjct  629   AIIAISAAVLIVCGVIIISLLNISVQRRLEFVETALESMCSS-STRSGSPTAGKLILFDS  687

Query  1108  KSSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDFD  929
             K S +   +  E +LNKA+EIGEGVFGTVYK PL  +G R VAIKKL  S ++QYPEDFD
Sbjct  688   KLSTNGIGNP-EILLNKAAEIGEGVFGTVYKVPLNPQG-RFVAIKKLVISNMIQYPEDFD  745

Query  928   REVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAVR  749
             REVRVL KARH NL+ L GYYWTPQ QLL++++   G+L++KLHE       PPL+W+ R
Sbjct  746   REVRVLRKARHPNLISLEGYYWTPQSQLLITEYATNGDLQTKLHERPAT--APPLSWSNR  803

Query  748   FKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVMS  569
             FKIILGTAKGLAHLHHS +PP+IHYNIKPSNILLDEN NPKISDFGLARL+ KL++HV+S
Sbjct  804   FKIILGTAKGLAHLHHSFRPPVIHYNIKPSNILLDENYNPKISDFGLARLLTKLEKHVIS  863

Query  568   NRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRV  389
             NRFQ+A+GYVAPELACQ+LRVNEKCDV+GFGMLILE+VTGRRPVEYGEDNV+IL+DHVRV
Sbjct  864   NRFQSALGYVAPELACQNLRVNEKCDVFGFGMLILELVTGRRPVEYGEDNVVILSDHVRV  923

Query  388   LLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPVPN  209
              +EQGNVL+CVD GMG YP++EV PVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPVP 
Sbjct  924   SVEQGNVLDCVDLGMGDYPEDEVFPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPVPQ  983

Query  208   RMEP  197
             RMEP
Sbjct  984   RMEP  987



>ref|XP_004492049.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Cicer arietinum]
Length=1011

 Score =   690 bits (1780),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/545 (70%), Positives = 456/545 (84%), Gaps = 11/545 (2%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             SAL G IPE  C+SG+L +LQLDGNSL G IP +IGNCSSL LLSLSHNNL+G+IP+++S
Sbjct  476   SALFGSIPEGTCDSGNLDVLQLDGNSLKGPIPEEIGNCSSLYLLSLSHNNLTGSIPKSMS  535

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGN  1463
              L +LKILKLE N+LSGE+P +LG L+NLLAVN+S+N LTGRLP  +IFQNLD S++EGN
Sbjct  536   KLNKLKILKLEFNELSGELPMELGMLQNLLAVNISHNNLTGRLPTSTIFQNLDKSSLEGN  595

Query  1462  DGICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRFLsvsai  1283
              G+CSPLL GPC MN PKP+V++P    NQ D             + +  HHRFLS+SAI
Sbjct  596   IGLCSPLLKGPCMMNVPKPLVLDPHANNNQMDPQRNESTM-----SSSFHHHRFLSISAI  650

Query  1282  vaisaaaiiavgvmvITMVNASVRRRISFVENALESMCSSTSSRSQGMATGKLILFDTKS  1103
             +AISA+ +I +GV+ IT++N SVRR++SFV+NALESMCSS+S       TGKLILFD++S
Sbjct  651   IAISASFVIVLGVIAITLLNVSVRRKLSFVDNALESMCSSSSRSG-APTTGKLILFDSQS  709

Query  1102  SPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGS-RVVAIKKLTSSKILQYPEDFDR  926
             SP+W ++  +S+LNKA++IGEGVFGTVYK PLG     R+VAIKKL +S ILQY EDFDR
Sbjct  710   SPEWIANP-DSLLNKATQIGEGVFGTVYKVPLGSSSQGRMVAIKKLVTSNILQYQEDFDR  768

Query  925   EVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAVRF  746
             EVR+LGKARH NL+ L+GYYWTPQLQLLVS+F P GNL+SKLHE   +   PPL+W +RF
Sbjct  769   EVRILGKARHPNLIALKGYYWTPQLQLLVSEFAPNGNLQSKLHERLPS--NPPLSWPIRF  826

Query  745   KIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVMSN  566
             KI+LGTAKGLAHLHHS +P IIHYNIKPSNILLDEN NPK+SDFGLARL+ K+++HVMSN
Sbjct  827   KILLGTAKGLAHLHHSFRPSIIHYNIKPSNILLDENFNPKLSDFGLARLLTKVEKHVMSN  886

Query  565   RFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRVL  386
             RFQ+A+GYVAPELACQSLRVNEKCDVYGFG++ILE+VTGRRPVEYGEDNVLILNDHVRVL
Sbjct  887   RFQSALGYVAPELACQSLRVNEKCDVYGFGVMILELVTGRRPVEYGEDNVLILNDHVRVL  946

Query  385   LEQGNVLECVDQG-MGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPVPN  209
             LE GNVL+CVD   M  YP++EVLPVLKLA+VCTSQIPSSRPSMAEVVQILQVIKTPVP 
Sbjct  947   LEHGNVLDCVDPNLMNEYPEDEVLPVLKLAMVCTSQIPSSRPSMAEVVQILQVIKTPVPQ  1006

Query  208   RMEPY  194
             RME Y
Sbjct  1007  RMEVY  1011


 Score = 53.9 bits (128),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 38/104 (37%), Positives = 57/104 (55%), Gaps = 0/104 (0%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             + L G + + I    +L  L L  N  +G++P  IG C  L+ L LS N+ SG +PE++ 
Sbjct  236   NGLSGNLNDGISYIHNLKELFLQNNQFSGSLPNDIGLCIHLSKLDLSTNHFSGELPESIK  295

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP  1511
              L  L  LK+  N L GE PQ +G L +L  + +S N  +G +P
Sbjct  296   RLSSLSYLKVSNNVLFGEFPQWIGNLTSLEHLEISNNEFSGLIP  339



>ref|XP_008244427.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Prunus mume]
Length=1009

 Score =   689 bits (1777),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/543 (72%), Positives = 460/543 (85%), Gaps = 8/543 (1%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             SAL G IP DIC+SGSLGILQLDGNSL G IP +IGNCSSL L+SLSHNNLSG IP+++S
Sbjct  475   SALFGSIPGDICDSGSLGILQLDGNSLNGPIPNEIGNCSSLYLMSLSHNNLSGLIPKSIS  534

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGN  1463
              L +LKILKLE N+LSGEIPQ+LG+LENLLAVN+SYNRL GRLP GS+FQ+LD +A++GN
Sbjct  535   KLNKLKILKLEYNELSGEIPQELGRLENLLAVNISYNRLVGRLPVGSVFQSLDQTALQGN  594

Query  1462  DGICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRFLsvsai  1283
              GICSPLL GPC MN PKP+V++P  Y NQ   +   D   P+++T   RHH FLS+SAI
Sbjct  595   LGICSPLLKGPCTMNVPKPLVLDPNAYNNQMGGHRHRDE-SPMSTT--GRHHMFLSISAI  651

Query  1282  vaisaaaiiavgvmvITMVNASVRRRISFVENALESMCSSTSSRSQGMATGKLILFDTKS  1103
             VAISAA +I VGV++I+++N S RRR +FVE ALESMCSS+S     +A+GKLILFD++S
Sbjct  652   VAISAATLIVVGVIIISLLNVSARRRPAFVETALESMCSSSSRSGS-LASGKLILFDSRS  710

Query  1102  SPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDFDRE  923
             SP+W SS  ES+LNKASEIGEGVFGTVYK PLG +G RVVAIKKL +S I+Q  EDFDRE
Sbjct  711   SPEWISSP-ESLLNKASEIGEGVFGTVYKIPLGVQG-RVVAIKKLVTSNIIQCLEDFDRE  768

Query  922   VRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAVRFK  743
             VR+LGKARH NL+ L+GYYWTPQ+QLLV++F   G+L+SKLHE   +  T PL+WA RFK
Sbjct  769   VRILGKARHPNLIALKGYYWTPQMQLLVTEFATNGSLQSKLHERLPS--TLPLSWANRFK  826

Query  742   IILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVMSNR  563
             I+LG AKGLAHLHHS +PPIIHYNIKPSNILLDEN NPKISDF L RL+ K D+HV+SNR
Sbjct  827   ILLGAAKGLAHLHHSYRPPIIHYNIKPSNILLDENYNPKISDFALVRLLTKTDQHVVSNR  886

Query  562   FQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRVLL  383
             FQ+A+GYVAPELAC SLRVNEKCDVYGFG+LILE+VTGRRPVEYGEDNV+IL DHVRVLL
Sbjct  887   FQSALGYVAPELACHSLRVNEKCDVYGFGVLILELVTGRRPVEYGEDNVVILTDHVRVLL  946

Query  382   EQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPVPNRM  203
             EQGNVL C+D  MG YP++EVLPVLKLALVCTSQIPS RP+MAEVVQI+Q+IKTP+P+ +
Sbjct  947   EQGNVLGCIDLSMGEYPEDEVLPVLKLALVCTSQIPSCRPTMAEVVQIMQIIKTPIPHTL  1006

Query  202   EPY  194
             E +
Sbjct  1007  EAF  1009


 Score = 61.6 bits (148),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 56/105 (53%), Gaps = 0/105 (0%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             +A  G  P+ I    +L +L L GN  +G +P  IG C  L  + LS+N  +G +P++L 
Sbjct  235   NAFSGSAPQGISALHNLKVLLLQGNDFSGPVPADIGLCPHLGRVDLSYNLFTGALPDSLQ  294

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPA  1508
              L  L    L  N  +G+ PQ +G + +L  ++ S N  TG LPA
Sbjct  295   RLNSLTFFSLSDNMFTGDFPQWIGNMSSLKYLDFSNNGFTGSLPA  339


 Score = 56.2 bits (134),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 34/111 (31%), Positives = 54/111 (49%), Gaps = 1/111 (1%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L+G IP  +     L +++L  NS +G+IP  + +     +            P +  + 
Sbjct  357   LVGAIPLSLAYCNELSVIRLRDNSFSGSIPEGLFDLGLEEIDFSQMGLTGSIPPGSSRLF  416

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAG-SIFQNL  1487
             + LK+L L  N L G IP ++G   NL  +N+S+N L  R+P     FQNL
Sbjct  417   ESLKMLDLSRNNLKGNIPAEVGLFSNLRYLNLSWNNLQSRMPPELGFFQNL  467



>ref|XP_012072583.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Jatropha curcas]
 gb|KDP37890.1| hypothetical protein JCGZ_05772 [Jatropha curcas]
Length=1001

 Score =   687 bits (1772),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/544 (71%), Positives = 455/544 (84%), Gaps = 14/544 (3%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             SA+ G IP DICESG L ILQLDGNSL G+IP +IGNCSSL LLSLSHNNLSG IP+++S
Sbjct  471   SAIFGSIPADICESGRLSILQLDGNSLGGSIPEEIGNCSSLYLLSLSHNNLSGPIPKSIS  530

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGN  1463
              L +LKILKLE N+LSGEIP +LGKLENLLAVN+SYN L GRLP+  IF +LD SA++GN
Sbjct  531   KLSKLKILKLEFNELSGEIPLELGKLENLLAVNISYNNLIGRLPSEGIFPSLDQSALQGN  590

Query  1462  DGICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRFLsvsai  1283
              GICSPLL GPCKMN PKP+V+NP+ YGN    N   D       + +S H   LS SAI
Sbjct  591   LGICSPLLKGPCKMNVPKPLVLNPYAYGNNRPRNVSSDY-----DSISSHHRMLLSTSAI  645

Query  1282  vaisaaaiiavgvmvITMVNASVRRRISFVENALESMCSSTSSRSQGMATGKLILFDTKS  1103
             +AISAA  I  GV+VI+++N S ++R++FV++ALES+ SS+S  +   ATGKLILFD++S
Sbjct  646   IAISAAVFIVFGVIVISLLNISAKKRLAFVDHALESIFSSSSRSASP-ATGKLILFDSRS  704

Query  1102  S-PDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDFDR  926
             S PD+ ++  ES+LNKASEIGEGVFGTVYK  LGG   R+VAIKKL +S I+QY EDFDR
Sbjct  705   SSPDFINNP-ESLLNKASEIGEGVFGTVYKVSLGGSQERMVAIKKLVTSNIIQYCEDFDR  763

Query  925   EVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAVRF  746
             EVR+LGKA+H NL+ L+GYYWTPQ QLLVS+F   G+L++KLH      ATPPL+WA RF
Sbjct  764   EVRILGKAKHPNLISLKGYYWTPQFQLLVSEFANNGSLQAKLH------ATPPLSWANRF  817

Query  745   KIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVMSN  566
             KI+LGTAKGLA+LHHS +PPIIHYNIKPSNILLD+N NPKISDFGLARL+ KLD+HVMSN
Sbjct  818   KIVLGTAKGLAYLHHSFRPPIIHYNIKPSNILLDDNCNPKISDFGLARLLTKLDKHVMSN  877

Query  565   RFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRVL  386
             RFQ+A+GYVAPELACQSLRVNEKCDVYGFG++ILE+VTGRRP+EYGEDNV+ILNDHVRVL
Sbjct  878   RFQSALGYVAPELACQSLRVNEKCDVYGFGIMILEVVTGRRPIEYGEDNVVILNDHVRVL  937

Query  385   LEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPVPNR  206
             LEQGN L+CVD  MG YP++EVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPVP R
Sbjct  938   LEQGNSLDCVDPNMGDYPEDEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPVPQR  997

Query  205   MEPY  194
             ME +
Sbjct  998   MEMF  1001


 Score = 68.2 bits (165),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 40/100 (40%), Positives = 56/100 (56%), Gaps = 0/100 (0%)
 Frame = -1

Query  1810  GEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSMLKR  1631
             G +PE I    ++ +LQL+GN  +G +P  IG C  L  L  S N  +G +PE+L  L  
Sbjct  235   GSVPEGISALHNMKVLQLEGNQFSGPLPIDIGLCIHLYKLDFSDNLFTGPLPESLRQLTS  294

Query  1630  LKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP  1511
             L  + L  N LS + PQ +G L  L+ ++ S N LTG LP
Sbjct  295   LSYINLSNNMLSSDFPQWIGDLSKLVYIDFSSNSLTGSLP  334


 Score = 53.1 bits (126),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 45/137 (33%), Positives = 66/137 (48%), Gaps = 25/137 (18%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             ++L G +P  I E  +L  L L  N L+G IP  I  CS L+++ L  N+ +GTIPE L 
Sbjct  327   NSLTGSLPLSISEIKALTYLSLSNNKLSGNIPISIVYCSMLSVIRLKGNSFNGTIPEGLF  386

Query  1642  ML------------------------KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSY  1535
              L                        + ++ L L  N L+G +  ++G   NL  +N+S+
Sbjct  387   DLGLEVVDFSDNQLVGSIPAGSRRFYEEIRTLDLSRNNLTGNVTAEMGLSSNLRYLNLSW  446

Query  1534  NRLTGRLPAG-SIFQNL  1487
             N L  R+PA    FQNL
Sbjct  447   NNLQSRMPAEVGYFQNL  463



>ref|XP_010107246.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Morus notabilis]
 gb|EXC14270.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Morus notabilis]
Length=1023

 Score =   681 bits (1758),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/547 (67%), Positives = 450/547 (82%), Gaps = 7/547 (1%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             SAL G IP D+C+SGSL ILQLDGNSLTG IP +IGNCSSL LLSLSHN L+G IP+++S
Sbjct  480   SALYGSIPGDLCDSGSLDILQLDGNSLTGQIPEEIGNCSSLYLLSLSHNKLTGPIPKSIS  539

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGN  1463
              + +LKILK+E NQLSGEIP +LGKL+ LLAVNVSYNRL GRLP   IFQ+LD S+++GN
Sbjct  540   KISKLKILKMEFNQLSGEIPMELGKLQYLLAVNVSYNRLIGRLPVRGIFQSLDQSSLQGN  599

Query  1462  DGICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRFLsvsai  1283
              GICSPLL GPCKMN  KP+V++P  Y  Q D  +   ++E    T  S H  FLSVSAI
Sbjct  600   LGICSPLLKGPCKMNVSKPLVLDPNAYNTQMDGGDHKHHSESSPLTAKSHHKLFLSVSAI  659

Query  1282  vaisaaaiiavgvmvITMVNASVRRRISFVENALESMCSSTSSRSQGMATGKLILFDTKS  1103
             +AISAA +I +GV++I+++N S R+R++FVE ALESMCSS+S     +A GKLILFD++S
Sbjct  660   IAISAATLIVIGVVIISLLNISARKRLAFVEEALESMCSSSSRSGASVAVGKLILFDSRS  719

Query  1102  SPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSR----VVAIKKLTSSKILQYPED  935
             + +   +   S+LNKA+EIGEGVFGTVYK  LG + +     V  IKKL +S I QYPED
Sbjct  720   TLEGLENPV-SLLNKANEIGEGVFGTVYKVSLGADHNHQERTVFVIKKLVTSNITQYPED  778

Query  934   FDREVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWA  755
             FDREVR+L KA+H N+V L+GYYWTPQ+QLLV ++ P G+L+S+LHE   +  + PL+W 
Sbjct  779   FDREVRILAKAKHPNIVSLKGYYWTPQIQLLVLEYAPNGSLQSRLHERHPS--SQPLSWP  836

Query  754   VRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHV  575
              RFKI+LGTAKGLAHLHHS +PPI+HYN+KPSNILLDEN NP+ISDFGL+RL+ KLD+HV
Sbjct  837   QRFKILLGTAKGLAHLHHSIRPPIVHYNLKPSNILLDENFNPRISDFGLSRLLTKLDKHV  896

Query  574   MSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHV  395
             +SNRFQ+A+GYVAPE+ACQSLRVNEKCDVYGFG+LILE+VTGRRPVEYGEDNV+IL+DH 
Sbjct  897   ISNRFQSALGYVAPEMACQSLRVNEKCDVYGFGVLILELVTGRRPVEYGEDNVVILSDHA  956

Query  394   RVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPV  215
             RVLLE+GNVLECVDQ +G YP++EVLPVLKLALVCTSQ+PSSRPSMAEVVQIL VIKTPV
Sbjct  957   RVLLEEGNVLECVDQSIGDYPEDEVLPVLKLALVCTSQVPSSRPSMAEVVQILHVIKTPV  1016

Query  214   PNRMEPY  194
             P R+E +
Sbjct  1017  PQRLEVF  1023


 Score = 55.8 bits (133),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 44/112 (39%), Positives = 64/112 (57%), Gaps = 3/112 (3%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G+ P  I E   L  L   GN  TG++P  +G+  SL  LSLS+N LSG IP +L   
Sbjct  314   LSGDFPHWIGELRKLEYLDFSGNGFTGSLPSTMGDMKSLIFLSLSNNKLSGIIPSSLGYC  373

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGS--IFQNL  1487
              +L ++ L  N  +G IP+ L  L  L   ++S N++TG +P GS  +F++L
Sbjct  374   TKLSVIHLSGNSFNGSIPEDLFDLA-LEEADLSKNQITGSIPTGSSKLFESL  424


 Score = 55.8 bits (133),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 45/150 (30%), Positives = 73/150 (49%), Gaps = 30/150 (20%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETL-  1646
             +   G +P  + +  SL  L L  N L+G IP  +G C+ L+++ LS N+ +G+IPE L 
Sbjct  336   NGFTGSLPSTMGDMKSLIFLSLSNNKLSGIIPSSLGYCTKLSVIHLSGNSFNGSIPEDLF  395

Query  1645  -----------------------SMLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSY  1535
                                     + + L +L L  N++ G IP ++G   NL  +N+S+
Sbjct  396   DLALEEADLSKNQITGSIPTGSSKLFESLHVLDLSSNKIKGTIPAEMGLFSNLKYLNLSW  455

Query  1534  NRLTGRL-PAGSIFQNLD-----SSAIEGN  1463
             N L  R+ P   +F+NL      SSA+ G+
Sbjct  456   NNLQSRIPPEFGLFRNLTVLDLRSSALYGS  485



>gb|KDO44075.1| hypothetical protein CISIN_1g0027171mg [Citrus sinensis]
Length=843

 Score =   670 bits (1729),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/543 (68%), Positives = 450/543 (83%), Gaps = 9/543 (2%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             +AL G IP+++CES SLGILQLDGNSLTG IP  I NC+SL LLSLSHN+LSG+IP+++S
Sbjct  310   NALYGSIPQEVCESRSLGILQLDGNSLTGPIPQVIRNCTSLYLLSLSHNHLSGSIPKSIS  369

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGN  1463
              L +LKILKLE N+LSGEIPQ+LGKL +LLAVNVSYNRL GRLP G +F  LD S+++GN
Sbjct  370   NLNKLKILKLEFNELSGEIPQELGKLASLLAVNVSYNRLIGRLPVGGVFPTLDQSSLQGN  429

Query  1462  DGICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRFLsvsai  1283
              GICSPLL GPCKMN PKP+V++P  Y +   + +         S  ++ HH F SVSAI
Sbjct  430   LGICSPLLKGPCKMNVPKPLVLDPDAYNSNQMDGHIHS-----HSFSSNHHHMFFSVSAI  484

Query  1282  vaisaaaiiavgvmvITMVNASVRRRISFVENALESMCSSTSSRSQGMATGKLILFDTKS  1103
             VAI AA +IA GV+VI+++N S RRR++FVE  LESMCSS+S     +A GK+ILFD++S
Sbjct  485   VAIIAAILIAGGVLVISLLNVSTRRRLTFVETTLESMCSSSSRSVN-LAAGKVILFDSRS  543

Query  1102  SPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDFDRE  923
             S    S   E++L KA+E+GEGVFGTVYK   G +G R++A+KKL +S I+QYPEDF+RE
Sbjct  544   SSLDCSIDPETLLEKAAEVGEGVFGTVYKVSFGTQG-RMLAVKKLVTSDIIQYPEDFERE  602

Query  922   VRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAVRFK  743
             VRVLGKARH NL+ L GYYWTPQL+LLVSD+ P G+L++KLHE   +  TPPL+W  RFK
Sbjct  603   VRVLGKARHPNLISLEGYYWTPQLKLLVSDYAPNGSLQAKLHERLPS--TPPLSWTNRFK  660

Query  742   IILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVMSNR  563
             +ILGTAKGLAHLHHS +PPIIHYN+KPSNILLD+N NP+ISDFGLARL+ +LD+HVMSNR
Sbjct  661   VILGTAKGLAHLHHSFRPPIIHYNLKPSNILLDDNYNPRISDFGLARLLTRLDKHVMSNR  720

Query  562   FQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRVLL  383
             FQ+A+GYVAPEL CQSLRVNEKCD+YGFG+LILE+VTGRRPVEYGEDNV+IL++HVRVLL
Sbjct  721   FQSALGYVAPELTCQSLRVNEKCDIYGFGVLILELVTGRRPVEYGEDNVVILSEHVRVLL  780

Query  382   EQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPVPNRM  203
             E+GNVL+CVD  MG YP++EVLPVLKLALVCT  IPSSRPSMAEVVQILQVIKTP+P RM
Sbjct  781   EEGNVLDCVDPSMGDYPEDEVLPVLKLALVCTCHIPSSRPSMAEVVQILQVIKTPLPQRM  840

Query  202   EPY  194
             E +
Sbjct  841   EVF  843


 Score = 57.0 bits (136),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 39/106 (37%), Positives = 59/106 (56%), Gaps = 1/106 (1%)
 Frame = -1

Query  1810  GEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSMLKR  1631
             G IP+ +     L  L L GN  +G +P  IG C  LT L LS+N  +G +P +L +L  
Sbjct  93    GSIPQGVAALHYLKELLLQGNQFSGPLPADIGFCPHLTTLDLSNNLFTGQLPVSLRLLNS  152

Query  1630  LKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQ  1493
             +  + +  N L+G+IP  +G +  L  ++ S N LTG LP+ S+F 
Sbjct  153   MIFISVSNNTLTGDIPHWIGNISTLEFLDFSNNHLTGSLPS-SLFN  197


 Score = 54.3 bits (129),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 41/133 (31%), Positives = 62/133 (47%), Gaps = 29/133 (22%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETL-  1646
             + L G+IP  I    +L  L    N LTG++P  + NC  L+++ L  N+L+G IPE L 
Sbjct  161   NTLTGDIPHWIGNISTLEFLDFSNNHLTGSLPSSLFNCKKLSVIRLRGNSLNGNIPEGLF  220

Query  1645  ----------------------------SMLKRLKILKLEVNQLSGEIPQQLGKLENLLA  1550
                                         ++ + L+IL L  N L G+IP ++G   NL  
Sbjct  221   DLGLEEIDLSENGFMGSIPPGSSSSSSSTLFQTLRILDLSSNNLVGDIPAEMGLFANLRY  280

Query  1549  VNVSYNRLTGRLP  1511
             +N+S N L  R+P
Sbjct  281   LNLSSNHLRSRIP  293



>ref|XP_006494521.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Citrus sinensis]
Length=1003

 Score =   676 bits (1743),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/543 (69%), Positives = 452/543 (83%), Gaps = 9/543 (2%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             +AL G IP+++CES SLGILQLDGNSLTG IP +IGNC+SL LLSLSHN+LSG+IP+++S
Sbjct  470   NALYGSIPQEVCESRSLGILQLDGNSLTGPIPQEIGNCTSLYLLSLSHNHLSGSIPKSIS  529

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGN  1463
              L +LKILKLE N+LS EIPQ+LGKLE+LLAVNVSYNRL GRLP G +F  LD S+++GN
Sbjct  530   NLNKLKILKLEFNELSEEIPQELGKLESLLAVNVSYNRLIGRLPVGGVFPTLDQSSLQGN  589

Query  1462  DGICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRFLsvsai  1283
              GICSPLL GPCKMN PKP+V++P  Y +   + +         S  ++ HH F SVSAI
Sbjct  590   LGICSPLLKGPCKMNVPKPLVLDPDAYNSNQMDGHIHS-----HSFSSNHHHMFFSVSAI  644

Query  1282  vaisaaaiiavgvmvITMVNASVRRRISFVENALESMCSSTSSRSQGMATGKLILFDTKS  1103
             VAI AA +IA GV+VI+++N S RRR++FVE  LESMCSS+S     +A GKLILFD++S
Sbjct  645   VAIIAAILIAGGVLVISLLNVSTRRRLTFVETTLESMCSSSSRSVN-LAAGKLILFDSRS  703

Query  1102  SPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDFDRE  923
             S    S   E++L KA+E+GEGVFGTVYK   G +G R++A+KKL +S I+QYPEDF+RE
Sbjct  704   SSLDCSIDPETLLEKAAEVGEGVFGTVYKVSFGTQG-RMLAVKKLVTSDIIQYPEDFERE  762

Query  922   VRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAVRFK  743
             VRVLGKARH NL+ L GYYWTPQL+LLVSD+ P G+L++KLHE   +  TPPL+W  RFK
Sbjct  763   VRVLGKARHPNLISLEGYYWTPQLKLLVSDYAPNGSLQAKLHERLPS--TPPLSWTNRFK  820

Query  742   IILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVMSNR  563
             +ILGTAKGLAHLHHS +PPIIHYN+KPSNILLD+N NP+ISDFGLARL+ +LD+HVMSNR
Sbjct  821   VILGTAKGLAHLHHSFRPPIIHYNLKPSNILLDDNYNPRISDFGLARLLTRLDKHVMSNR  880

Query  562   FQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRVLL  383
             FQ+A+GYVAPEL CQSLRVNEKCD+YGFG+LILE+VTGRRPVEYGEDNV+IL++HVRVLL
Sbjct  881   FQSALGYVAPELTCQSLRVNEKCDIYGFGVLILELVTGRRPVEYGEDNVVILSEHVRVLL  940

Query  382   EQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPVPNRM  203
             E+GNVL+CVD  MG YP++EVLPVLKLALVCT  IPSSRPSMAEVVQILQVIKTP+P RM
Sbjct  941   EEGNVLDCVDPSMGDYPEDEVLPVLKLALVCTCHIPSSRPSMAEVVQILQVIKTPLPQRM  1000

Query  202   EPY  194
             E +
Sbjct  1001  EVF  1003


 Score = 56.2 bits (134),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 37/100 (37%), Positives = 55/100 (55%), Gaps = 0/100 (0%)
 Frame = -1

Query  1810  GEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSMLKR  1631
             G IP+ +     L  L L GN  +G +P  IG C  LT L LS+N  +G +P +L +L  
Sbjct  253   GSIPQGVAALHYLKELLLQGNQFSGPLPADIGFCPHLTTLDLSNNLFTGQLPVSLRLLNS  312

Query  1630  LKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP  1511
             +  + +  N L+G+IP  +G +  L  ++ S N LTG LP
Sbjct  313   MIFISVSNNTLTGDIPHWIGNISTLEFLDFSNNHLTGSLP  352


 Score = 53.5 bits (127),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 44/142 (31%), Positives = 65/142 (46%), Gaps = 30/142 (21%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETL-  1646
             + L G+IP  I    +L  L    N LTG++P  + NC  L+++ L  N+L+G IPE L 
Sbjct  321   NTLTGDIPHWIGNISTLEFLDFSNNHLTGSLPLSLFNCKKLSVIRLRGNSLNGNIPEGLF  380

Query  1645  ----------------------------SMLKRLKILKLEVNQLSGEIPQQLGKLENLLA  1550
                                         ++ + L+IL L  N L G+IP ++G   NL  
Sbjct  381   DLGLEEIDLSENGFMGSIPPGSSSSSSSTLFQTLRILDLSSNNLVGDIPAEMGLFANLRY  440

Query  1549  VNVSYNRLTGRLPAG-SIFQNL  1487
             +N+S N L  R+P     F NL
Sbjct  441   LNLSSNHLRSRIPPELGYFHNL  462



>gb|KDO44074.1| hypothetical protein CISIN_1g0027171mg, partial [Citrus sinensis]
Length=866

 Score =   671 bits (1730),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/543 (68%), Positives = 450/543 (83%), Gaps = 9/543 (2%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             +AL G IP+++CES SLGILQLDGNSLTG IP  I NC+SL LLSLSHN+LSG+IP+++S
Sbjct  333   NALYGSIPQEVCESRSLGILQLDGNSLTGPIPQVIRNCTSLYLLSLSHNHLSGSIPKSIS  392

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGN  1463
              L +LKILKLE N+LSGEIPQ+LGKL +LLAVNVSYNRL GRLP G +F  LD S+++GN
Sbjct  393   NLNKLKILKLEFNELSGEIPQELGKLASLLAVNVSYNRLIGRLPVGGVFPTLDQSSLQGN  452

Query  1462  DGICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRFLsvsai  1283
              GICSPLL GPCKMN PKP+V++P  Y +   + +         S  ++ HH F SVSAI
Sbjct  453   LGICSPLLKGPCKMNVPKPLVLDPDAYNSNQMDGHIHS-----HSFSSNHHHMFFSVSAI  507

Query  1282  vaisaaaiiavgvmvITMVNASVRRRISFVENALESMCSSTSSRSQGMATGKLILFDTKS  1103
             VAI AA +IA GV+VI+++N S RRR++FVE  LESMCSS+S     +A GK+ILFD++S
Sbjct  508   VAIIAAILIAGGVLVISLLNVSTRRRLTFVETTLESMCSSSSRSVN-LAAGKVILFDSRS  566

Query  1102  SPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDFDRE  923
             S    S   E++L KA+E+GEGVFGTVYK   G +G R++A+KKL +S I+QYPEDF+RE
Sbjct  567   SSLDCSIDPETLLEKAAEVGEGVFGTVYKVSFGTQG-RMLAVKKLVTSDIIQYPEDFERE  625

Query  922   VRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAVRFK  743
             VRVLGKARH NL+ L GYYWTPQL+LLVSD+ P G+L++KLHE   +  TPPL+W  RFK
Sbjct  626   VRVLGKARHPNLISLEGYYWTPQLKLLVSDYAPNGSLQAKLHERLPS--TPPLSWTNRFK  683

Query  742   IILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVMSNR  563
             +ILGTAKGLAHLHHS +PPIIHYN+KPSNILLD+N NP+ISDFGLARL+ +LD+HVMSNR
Sbjct  684   VILGTAKGLAHLHHSFRPPIIHYNLKPSNILLDDNYNPRISDFGLARLLTRLDKHVMSNR  743

Query  562   FQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRVLL  383
             FQ+A+GYVAPEL CQSLRVNEKCD+YGFG+LILE+VTGRRPVEYGEDNV+IL++HVRVLL
Sbjct  744   FQSALGYVAPELTCQSLRVNEKCDIYGFGVLILELVTGRRPVEYGEDNVVILSEHVRVLL  803

Query  382   EQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPVPNRM  203
             E+GNVL+CVD  MG YP++EVLPVLKLALVCT  IPSSRPSMAEVVQILQVIKTP+P RM
Sbjct  804   EEGNVLDCVDPSMGDYPEDEVLPVLKLALVCTCHIPSSRPSMAEVVQILQVIKTPLPQRM  863

Query  202   EPY  194
             E +
Sbjct  864   EVF  866


 Score = 57.0 bits (136),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 39/106 (37%), Positives = 59/106 (56%), Gaps = 1/106 (1%)
 Frame = -1

Query  1810  GEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSMLKR  1631
             G IP+ +     L  L L GN  +G +P  IG C  LT L LS+N  +G +P +L +L  
Sbjct  116   GSIPQGVAALHYLKELLLQGNQFSGPLPADIGFCPHLTTLDLSNNLFTGQLPVSLRLLNS  175

Query  1630  LKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQ  1493
             +  + +  N L+G+IP  +G +  L  ++ S N LTG LP+ S+F 
Sbjct  176   MIFISVSNNTLTGDIPHWIGNISTLEFLDFSNNHLTGSLPS-SLFN  220


 Score = 54.3 bits (129),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 41/133 (31%), Positives = 62/133 (47%), Gaps = 29/133 (22%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETL-  1646
             + L G+IP  I    +L  L    N LTG++P  + NC  L+++ L  N+L+G IPE L 
Sbjct  184   NTLTGDIPHWIGNISTLEFLDFSNNHLTGSLPSSLFNCKKLSVIRLRGNSLNGNIPEGLF  243

Query  1645  ----------------------------SMLKRLKILKLEVNQLSGEIPQQLGKLENLLA  1550
                                         ++ + L+IL L  N L G+IP ++G   NL  
Sbjct  244   DLGLEEIDLSENGFMGSIPPGSSSSSSSTLFQTLRILDLSSNNLVGDIPAEMGLFANLRY  303

Query  1549  VNVSYNRLTGRLP  1511
             +N+S N L  R+P
Sbjct  304   LNLSSNHLRSRIP  316



>ref|XP_006421080.1| hypothetical protein CICLE_v10004238mg [Citrus clementina]
 gb|ESR34320.1| hypothetical protein CICLE_v10004238mg [Citrus clementina]
Length=1003

 Score =   671 bits (1730),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/543 (69%), Positives = 451/543 (83%), Gaps = 9/543 (2%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             +AL G IP+++CES SLGILQLDGNSLTG IP  I NC+SL LLSLSHN+LSG+IP+++S
Sbjct  470   NALYGSIPQEVCESRSLGILQLDGNSLTGPIPQVIRNCTSLYLLSLSHNHLSGSIPKSIS  529

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGN  1463
              L +LKILKLE N+LSGEIPQ+LGKL +LLAVNVSYNRL GRLP G +F  LD S+++GN
Sbjct  530   NLNKLKILKLEFNELSGEIPQELGKLASLLAVNVSYNRLIGRLPVGGVFPTLDQSSLQGN  589

Query  1462  DGICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRFLsvsai  1283
              GICSPLL GPCKMN PKP+V++P  Y +   + +         S  ++ HH F SVSAI
Sbjct  590   LGICSPLLKGPCKMNVPKPLVLDPDAYNSNQMDGHIHS-----HSFSSNHHHMFFSVSAI  644

Query  1282  vaisaaaiiavgvmvITMVNASVRRRISFVENALESMCSSTSSRSQGMATGKLILFDTKS  1103
             VAI AA +IA GV+VI+++N S RRR++FVE  LESM  S+SSRS  +A GK+ILFD++S
Sbjct  645   VAIIAAILIAGGVLVISLLNVSTRRRLTFVETTLESM-CSSSSRSVNLAAGKVILFDSRS  703

Query  1102  SPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDFDRE  923
             S    S   E++L KA+E+GEGVFGTVYK   G +G R++A+KKL +S I+QYPEDF+RE
Sbjct  704   SSLDCSIDPETLLEKAAEVGEGVFGTVYKVSFGTQG-RMLAVKKLVTSDIIQYPEDFERE  762

Query  922   VRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAVRFK  743
             VRVLGKARH NL+ L GYYWTPQL+LLVSD+ P G+L++KLHE   +  TPPL+W  RFK
Sbjct  763   VRVLGKARHPNLISLEGYYWTPQLKLLVSDYAPNGSLQAKLHERLPS--TPPLSWTNRFK  820

Query  742   IILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVMSNR  563
             +ILGTAKGLAHLHHS +PPIIHYN+KPSNILLD+N NP+ISDFGLARL+ +LD+HVMSNR
Sbjct  821   VILGTAKGLAHLHHSFRPPIIHYNLKPSNILLDDNYNPRISDFGLARLLTRLDKHVMSNR  880

Query  562   FQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRVLL  383
             FQ+A+GYVAPEL CQSLRVNEKCD+YGFG+LILE+VTGRRPVEYGEDNV+IL++HVRVLL
Sbjct  881   FQSALGYVAPELTCQSLRVNEKCDIYGFGVLILELVTGRRPVEYGEDNVVILSEHVRVLL  940

Query  382   EQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPVPNRM  203
             E+GNVL+CVD  MG YP++EVLPVLKLALVCT  IPSSRPSMAEVVQILQVIKTP+P RM
Sbjct  941   EEGNVLDCVDPSMGDYPEDEVLPVLKLALVCTCHIPSSRPSMAEVVQILQVIKTPLPQRM  1000

Query  202   EPY  194
             E +
Sbjct  1001  EVF  1003


 Score = 57.0 bits (136),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 39/106 (37%), Positives = 59/106 (56%), Gaps = 1/106 (1%)
 Frame = -1

Query  1810  GEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSMLKR  1631
             G IP+ +     L  L L GN  +G +P  IG C  LT L LS+N  +G +P +L +L  
Sbjct  253   GSIPQGVAALHYLKELLLQGNKFSGPLPADIGFCPHLTTLDLSNNLFTGQLPVSLRLLNS  312

Query  1630  LKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQ  1493
             +  + +  N L+G+IP  +G +  L  ++ S N LTG LP+ S+F 
Sbjct  313   MIFISVSNNTLTGDIPHWIGNISTLEFLDFSNNHLTGSLPS-SLFN  357



>ref|XP_010528265.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Tarenaya hassleriana]
Length=1011

 Score =   664 bits (1713),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/548 (68%), Positives = 445/548 (81%), Gaps = 12/548 (2%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             SAL G +P DICES SL ILQLDGNSL G IP  IGNCSSL LLSLSHNNL G IP++LS
Sbjct  471   SALTGSVPADICESQSLQILQLDGNSLIGPIPEGIGNCSSLNLLSLSHNNLIGQIPKSLS  530

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGN  1463
              L++LKILKLEVN L GEIP +LGKL+NLLAVN S+N L GRLP G++F++LD SA++GN
Sbjct  531   NLRKLKILKLEVNDLRGEIPPELGKLQNLLAVNFSFNHLVGRLPVGNVFESLDQSALQGN  590

Query  1462  DGICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRFLsvsai  1283
              GICSPLL GPC +N PKP+VI+P  YGN  ++         ++ +  S H  FLSVS I
Sbjct  591   LGICSPLLKGPCTLNVPKPLVIDPNAYGNNKNHTQRD---RTISGSGRSHHGMFLSVSVI  647

Query  1282  vaisaaaiiavgvmvITMVNASVRRRISFVENALESMCSSTSSRSQGMATGKLILFDTKS  1103
             VAISAA +I  GV++IT++NASVRRR++FV+NALES+ S  SSRS  +A GKL+LF+++S
Sbjct  648   VAISAAILITSGVIIITLLNASVRRRLAFVDNALESIFSG-SSRSGSVAAGKLVLFNSRS  706

Query  1102  SPDWASSTF-----ESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPE  938
             S    SST      E  LNKA+EIGEGVFGTVYKAPLG  GS  +A+KKL  S  LQ PE
Sbjct  707   SSSSLSSTEFSRNPEFFLNKATEIGEGVFGTVYKAPLGERGS-FLAVKKLVPSTTLQNPE  765

Query  937   DFDREVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTW  758
             DFDREVR+L K + +NLV ++GY+WTP LQLLVSD+VP GNL+SKLHE      TPPL+W
Sbjct  766   DFDREVRILSKVKDENLVLIKGYFWTPDLQLLVSDYVPNGNLQSKLHERNPT--TPPLSW  823

Query  757   AVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRH  578
             + RF+IILGTAKGLA+LHHSC+PPI+H+N+KP+NIL DEN NPKISDFGL RL+ K DR+
Sbjct  824   SARFRIILGTAKGLAYLHHSCRPPIVHFNLKPTNILFDENNNPKISDFGLTRLLTKHDRN  883

Query  577   VMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDH  398
             +M++RFQ A+GY+APEL CQSLRVNEKCDVYGFG+LILE+VTGRRPVEYGED+ +IL+DH
Sbjct  884   MMNSRFQNALGYIAPELECQSLRVNEKCDVYGFGVLILELVTGRRPVEYGEDSFVILSDH  943

Query  397   VRVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTP  218
             VRVLLEQGNVLECVD  M  Y ++EVLPVLKLALVCTSQIPS+RP+MAE+VQILQVIKTP
Sbjct  944   VRVLLEQGNVLECVDPTMDEYSEDEVLPVLKLALVCTSQIPSNRPTMAEIVQILQVIKTP  1003

Query  217   VPNRMEPY  194
             VP R+E +
Sbjct  1004  VPQRLETF  1011


 Score = 56.2 bits (134),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 56/105 (53%), Gaps = 0/105 (0%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             ++L G IP  I     L +L L GN  +G +P  IG C  L  L LS+N  SG +P  L 
Sbjct  231   NSLSGLIPSGIPALQLLKVLHLRGNKFSGPLPADIGFCPHLKRLDLSYNLFSGEVPSPLQ  290

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPA  1508
              L  L    L  N LSG+ PQ +  L +L  +++S N L+G LP+
Sbjct  291   RLNSLMFFSLSNNVLSGDFPQWITSLSSLEHLDLSNNALSGELPS  335


 Score = 53.9 bits (128),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 42/102 (41%), Positives = 54/102 (53%), Gaps = 0/102 (0%)
 Frame = -1

Query  1810  GEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSMLKR  1631
             GE+P  +    SL    L  N L+G  P  I + SSL  L LS+N LSG +P ++  L+ 
Sbjct  283   GEVPSPLQRLNSLMFFSLSNNVLSGDFPQWITSLSSLEHLDLSNNALSGELPSSMGNLRS  342

Query  1630  LKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAG  1505
             LK L L  NQL GEIP  L     L  + +  N  TG +PAG
Sbjct  343   LKHLVLSKNQLKGEIPASLAYCTELSVIQLKGNSFTGSVPAG  384



>ref|XP_010929848.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Elaeis guineensis]
Length=1011

 Score =   662 bits (1709),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/548 (66%), Positives = 448/548 (82%), Gaps = 18/548 (3%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             SAL G IP D+C+SG L +LQLD NSL+G IP ++GNCSSL LLSLSHNNL+G+IP +++
Sbjct  476   SALYGPIPGDLCDSGGLAVLQLDSNSLSGRIPEEMGNCSSLYLLSLSHNNLNGSIPASMA  535

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGN  1463
              LK+L+IL LE N LSGEIPQQLG L+NLLAVN+S+N+L GRLP G +FQ+LD SA++GN
Sbjct  536   RLKKLEILNLEFNNLSGEIPQQLGGLDNLLAVNISHNQLIGRLPTGGVFQSLDQSALQGN  595

Query  1462  DGICSPLLTGPCKMNAPKPIVINP--FVYGNQTdnnnggdnNEPLASTRNSRHHRFLsvs  1289
              G+C+PL+  PCKMN PKP+V++P  + +GN            P       RH +FLSVS
Sbjct  596   LGLCTPLVMEPCKMNVPKPLVLDPNAYTHGNGGTLVTVATPVIP-------RHKKFLSVS  648

Query  1288  aivaisaaaiiavgvmvITMVNASVRRRISFVENALESMCSSTSSRSQGMATGKLILFDT  1109
             AIVAISAA +I +GV+V+T++N S RRRI  +ENALES+CSS S+RS   A GK++LF T
Sbjct  649   AIVAISAALVIVLGVLVVTLLNISARRRIGLLENALESICSS-STRSGSPAVGKMVLFGT  707

Query  1108  KS---SPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPE  938
             +S   S D      ES+L+KA+EIG GVFGTVYKA +G EG R++AIKKL +S I+QY +
Sbjct  708   RSNLRSEDLFGGA-ESLLSKATEIGRGVFGTVYKASVG-EG-RIMAIKKLLTSNIIQYHD  764

Query  937   DFDREVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTW  758
             DFDREVR+LGKARH N++PL+GYYWTPQLQLL+SD+ P G+L S+LHE + +M  PPL+W
Sbjct  765   DFDREVRILGKARHPNVMPLKGYYWTPQLQLLISDYAPHGSLHSRLHENSGSM--PPLSW  822

Query  757   AVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRH  578
             A RF I LG AKGLA+LH S +PPIIHYNIKPSNILLDEN NPKISDFGLARL+ KLD+H
Sbjct  823   ADRFNIALGAAKGLAYLHQSFRPPIIHYNIKPSNILLDENCNPKISDFGLARLLPKLDKH  882

Query  577   VMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDH  398
             ++S+RFQ+A+GY+APELACQSLR+NEKCDVYGFG+LILE+VTGR+PVEYG+D+V+IL D 
Sbjct  883   IISSRFQSAMGYMAPELACQSLRINEKCDVYGFGVLILELVTGRKPVEYGDDDVVILIDQ  942

Query  397   VRVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTP  218
             VRVLLEQGNVL+C+D  MG +P+EEVLPVLKL LVCTSQIPSSRPSMAEVVQILQVIKTP
Sbjct  943   VRVLLEQGNVLDCMDSSMGEFPEEEVLPVLKLGLVCTSQIPSSRPSMAEVVQILQVIKTP  1002

Query  217   VPNRMEPY  194
             V  RME +
Sbjct  1003  VIERMEAF  1010


 Score = 56.2 bits (134),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 39/101 (39%), Positives = 57/101 (56%), Gaps = 0/101 (0%)
 Frame = -1

Query  1810  GEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSMLKR  1631
             G +PE +    +L  L L  N  +G IP  +G C  LT L LSHN+    +P+++  L  
Sbjct  240   GSLPEAVANLHNLKNLGLSSNCFSGPIPVGVGLCPHLTSLDLSHNSFDAPLPDSIQWLAS  299

Query  1630  LKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPA  1508
             L  L L  NQLSG++P  +  +  L  +++S N+LTG LPA
Sbjct  300   LTFLNLSNNQLSGDLPAWISNMTALQHLDLSSNQLTGSLPA  340


 Score = 55.1 bits (131),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 54/135 (40%), Positives = 69/135 (51%), Gaps = 10/135 (7%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQI---GNCssltllslshnnlSGTIPE  1652
             +A  G +P+D+    SL  + L  NSL+G IP  +     CSSL  LSL+ N L G IP 
Sbjct  137   NAFSGRLPQDLGNIPSLRSVDLSSNSLSGPIPDSLFSAATCSSLRYLSLAENRLEGPIPS  196

Query  1651  TLSMLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP-AGSIFQNLDSSA  1475
             TLS    L  L L  NQLSG  P  L  L  L A+++S N  +G LP A +   NL    
Sbjct  197   TLSRCSFLLHLNLSGNQLSGSPPSALWSLSRLRALDLSRNFFSGSLPEAVANLHNLK---  253

Query  1474  IEGNDGICSPLLTGP  1430
                N G+ S   +GP
Sbjct  254   ---NLGLSSNCFSGP  265


 Score = 54.7 bits (130),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 43/105 (41%), Positives = 62/105 (59%), Gaps = 1/105 (1%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G++P  I    +L  L L  N LTG++P  + +   L  LSLS N L+G IP++ +  
Sbjct  310   LSGDLPAWISNMTALQHLDLSSNQLTGSLPASLDHLKELNYLSLSDNMLAGPIPDSAAEC  369

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGS  1502
             +RL  L L+ N+L+G IPQ L  L  L  +++S N LTG +P GS
Sbjct  370   RRLSQLWLKKNRLNGSIPQALFDL-GLEVLDLSSNELTGTIPPGS  413



>ref|XP_009403616.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Musa acuminata subsp. malaccensis]
Length=1003

 Score =   651 bits (1679),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/540 (65%), Positives = 439/540 (81%), Gaps = 13/540 (2%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             SAL G IP D+CESGSL +LQLDGNSLTG IP +IGNCSSL LLS SHN+L+G+IP ++ 
Sbjct  473   SALYGSIPGDLCESGSLSVLQLDGNSLTGPIPEEIGNCSSLYLLSFSHNSLNGSIPASMG  532

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGN  1463
              LK+L+ILKLE N LSGEIPQQLG+L+NLLAVN+S+N+  GRLP G +FQ+LD SA++GN
Sbjct  533   ELKKLEILKLEFNNLSGEIPQQLGRLDNLLAVNISHNQFVGRLPVGGVFQSLDQSALQGN  592

Query  1462  DGICSPLLTGPCKMNAPKPIVINPFVYGN-QTdnnnggdnNEPLASTRNSRHHRFLsvsa  1286
              G+C+PL+  PCK+N PKP+V++P+ Y N   ++N+      P  S R   H RFLSVS+
Sbjct  593   LGLCTPLVAEPCKLNVPKPLVLDPYAYINGNNNDNDVPTVANPAVSMR---HRRFLSVSS  649

Query  1285  ivaisaaaiiavgvmvITMVNASVRRRISFVENALESMCSSTSSRSQGMATGKLILFDTK  1106
             IVAISAA +I +GV+V+T++N S RRRI  +ENALESMCSS S+RS G A G++++F  +
Sbjct  650   IVAISAALVIVLGVVVVTLLNISARRRIGLLENALESMCSS-STRSTGPAVGRMVVFGPR  708

Query  1105  SS---PDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPED  935
             SS    D      E++L KA+E+G GVFGTVY+A +GG G+  +A+KKL ++ I+QY +D
Sbjct  709   SSLRSEDLVGGA-EALLTKATELGRGVFGTVYRASIGGGGT--IAVKKLLTANIVQYHDD  765

Query  934   FDREVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWA  755
             FDREVR+LGK  H NLV L+GYYWTPQLQLL+SD  P G+L ++LHE   A+  PPL+WA
Sbjct  766   FDREVRILGKVMHPNLVQLKGYYWTPQLQLLISDCAPHGSLHARLHERPEAI--PPLSWA  823

Query  754   VRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHV  575
              RFKI LGTAKG+AHLH S +PPI+HYN+KP+NILLDE   PKISDFGL RL+ KLD+H+
Sbjct  824   DRFKIALGTAKGIAHLHQSFRPPIVHYNLKPTNILLDEKCEPKISDFGLVRLLQKLDKHM  883

Query  574   MSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHV  395
             +S+RFQ+A+GY+APELACQSLRVNEKCD+YGFG+LILE+VTG++PVEYGED+V+IL DHV
Sbjct  884   ISSRFQSAMGYMAPELACQSLRVNEKCDIYGFGVLILELVTGKKPVEYGEDDVVILIDHV  943

Query  394   RVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPV  215
             R L+EQGN +ECVD  MG +P+EEVLPVLKL LVCTSQIPSSRPSMAEVVQILQVIK P+
Sbjct  944   RALVEQGNAVECVDSSMGEFPEEEVLPVLKLGLVCTSQIPSSRPSMAEVVQILQVIKAPL  1003


 Score = 55.5 bits (132),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 40/101 (40%), Positives = 60/101 (59%), Gaps = 0/101 (0%)
 Frame = -1

Query  1810  GEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSMLKR  1631
             G +PE I    +L  L L+GN  +G IP  +G C  L+ L LS+N+  G +P ++  L  
Sbjct  237   GGVPEGIARLHTLKSLHLNGNRFSGPIPAGVGLCPHLSSLDLSYNSFVGALPSSMRYLHS  296

Query  1630  LKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPA  1508
             L  L L  N+LSG+IP  +G L  +  +++S N+LTG LP+
Sbjct  297   LTSLSLSNNRLSGDIPSWIGNLTAIQHLDLSDNKLTGNLPS  337


 Score = 54.3 bits (129),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 46/118 (39%), Positives = 67/118 (57%), Gaps = 6/118 (5%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G+IP  I    ++  L L  N LTG +P  +G  + L  LSL+ N L+G IP++++  
Sbjct  307   LSGDIPSWIGNLTAIQHLDLSDNKLTGNLPSSLGGLTDLNYLSLTTNMLTGAIPDSIAGC  366

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIF-----QNLDSS  1478
              +L  L L+ N L G IP+ L  L  L  +++S N LTG +PAGS +     Q+LD S
Sbjct  367   TKLTELHLKGNGLDGSIPKGLFDL-GLQVLDLSSNGLTGTMPAGSTWISETLQSLDLS  423



>ref|XP_008776998.1| PREDICTED: LOW QUALITY PROTEIN: probably inactive leucine-rich 
repeat receptor-like protein kinase At3g28040 [Phoenix dactylifera]
Length=1008

 Score =   650 bits (1677),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/548 (66%), Positives = 444/548 (81%), Gaps = 18/548 (3%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             SAL G +P ++C+SG L +LQLD NSL+G IP +IGNCSSL LLSLSHN+L+ +IP +++
Sbjct  474   SALYGPVPGELCDSGGLAVLQLDSNSLSGPIPEEIGNCSSLYLLSLSHNSLNSSIPASMA  533

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGN  1463
              LK+L+IL LE N LSGEIPQ LG L+NLLAVN+S+NRL GRLP G +FQ+LD SA++GN
Sbjct  534   RLKKLEILNLEFNNLSGEIPQLLGGLDNLLAVNISHNRLIGRLPTGGVFQSLDQSALQGN  593

Query  1462  DGICSPLLTGPCKMNAPKPIVINPFVY--GNQTdnnnggdnNEPLASTRNSRHHRFLsvs  1289
              G+C+PL+T PCKMN PKP+V++P  Y  GN            P       RH +FLSVS
Sbjct  594   LGLCTPLVTEPCKMNVPKPLVLDPNAYPHGNGGTLVTVATPVIP-------RHKKFLSVS  646

Query  1288  aivaisaaaiiavgvmvITMVNASVRRRISFVENALESMCSSTSSRSQGMATGKLILFDT  1109
             AIVAISAA +I +GV+V+T++N S RRRI  +ENALES+CSS S+RS   A GK++LF  
Sbjct  647   AIVAISAALVIVLGVLVVTLLNISARRRIGLLENALESICSS-STRSGSPAVGKMVLFGP  705

Query  1108  KS---SPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPE  938
             +S   S D      ES+L+KASEIG GVFGTVYKA +G EG R++AIKKL +S I+QY +
Sbjct  706   RSNLRSEDLFGGA-ESLLSKASEIGRGVFGTVYKASVG-EG-RIMAIKKLLTSNIIQYHD  762

Query  937   DFDREVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTW  758
             DFDREVR+LGKARH N++PL+GYYWTPQLQLL+SD+ P G L S+LHE + +M  PPL+W
Sbjct  763   DFDREVRILGKARHPNVMPLKGYYWTPQLQLLISDYAPHGCLHSRLHENSGSM--PPLSW  820

Query  757   AVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRH  578
             A RF I LGTAKGLA+LH S +PPIIHYNIKPSNILLDE+ +P+ISDFGLARL+ KLD H
Sbjct  821   ADRFNIALGTAKGLAYLHQSFRPPIIHYNIKPSNILLDESCSPRISDFGLARLLPKLDNH  880

Query  577   VMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDH  398
             ++S+RFQ+A+GY+APELACQSLR+NEKCDVYGFG+LILE+VTGR+PV+YG+D+V+IL D 
Sbjct  881   IISSRFQSAMGYMAPELACQSLRINEKCDVYGFGVLILELVTGRKPVQYGDDDVVILIDQ  940

Query  397   VRVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTP  218
             VRVLLEQGNVL+CVD  MG +P+EEVLPVLKL LVCTSQIPSSRPSMAEVVQILQVIKTP
Sbjct  941   VRVLLEQGNVLDCVDSRMGEFPEEEVLPVLKLGLVCTSQIPSSRPSMAEVVQILQVIKTP  1000

Query  217   VPNRMEPY  194
             V  RME +
Sbjct  1001  VIERMEAF  1008


 Score = 56.6 bits (135),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 39/101 (39%), Positives = 57/101 (56%), Gaps = 0/101 (0%)
 Frame = -1

Query  1810  GEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSMLKR  1631
             G + E +    +L  L L  N  +G IP  IG C  LT L +SHN+    +P+++  L  
Sbjct  238   GSLHEAVANLHNLKNLDLSSNYFSGPIPVGIGLCPHLTSLDMSHNSFDAPLPDSIKWLAS  297

Query  1630  LKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPA  1508
             L  L L  NQLSG++P  +G +  L  +++S N+LTG LPA
Sbjct  298   LTFLSLSNNQLSGDLPAWIGNMTALQHLDLSSNQLTGSLPA  338



>ref|XP_004152295.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Cucumis sativus]
 gb|KGN53091.1| Receptor protein kinase [Cucumis sativus]
Length=1007

 Score =   647 bits (1669),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/543 (66%), Positives = 441/543 (81%), Gaps = 12/543 (2%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             S L G IP ++C+SGSL ILQLDGNSL G IP +IGNC SL LLSLSHNNLSG IP+++S
Sbjct  474   SDLYGSIPGELCDSGSLKILQLDGNSLVGPIPDEIGNCLSLYLLSLSHNNLSGEIPKSIS  533

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGN  1463
              L +L+IL+LE N+LSGEIPQ+LG L+NLLAVN+SYN LTGRLP G IF +LD SA++GN
Sbjct  534   KLSKLEILRLESNELSGEIPQELGILQNLLAVNISYNMLTGRLPVGGIFPSLDQSALQGN  593

Query  1462  DGICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRFLsvsai  1283
              G+CSPLL GPCKMN PKP+V++P  Y NQ    +  +   P   + +S HH F SVSAI
Sbjct  594   LGLCSPLLKGPCKMNVPKPLVLDPNAYPNQMGGQSSRN--RPSQLSNHSSHHVFFSVSAI  651

Query  1282  vaisaaaiiavgvmvITMVNASVRRR-ISFVENALESMCSSTSSRSQGMATGKLILFDT-  1109
             VAISAA +IA+GV+VIT++N S RRR ++FV+NALES  SS+ S +  +  GKLILFD+ 
Sbjct  652   VAISAATLIALGVLVITLLNVSARRRSLAFVDNALESCSSSSKSGT--VTAGKLILFDSN  709

Query  1108  -KSSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDF  932
              K+S +W S+  E++LNKASEIG GVFGTVYK  LG  G   VA+KKL  S I+Q PEDF
Sbjct  710   SKASLNWVSN-HEALLNKASEIGGGVFGTVYKVSLGDGGD--VAMKKLVKSDIIQNPEDF  766

Query  931   DREVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAV  752
             DRE+RVLGK +H NL+ L+GYYWT Q QLLV ++   G+L+++LH      + PPL+W  
Sbjct  767   DREIRVLGKVKHPNLISLKGYYWTVQTQLLVMEYANNGSLQTQLH--GRLPSAPPLSWDN  824

Query  751   RFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVM  572
             RFKI+LGTAKGLAHLHHS +PPI+HYN+KP+NILLDEN NPKISD+GLARL+ KLD+HVM
Sbjct  825   RFKIVLGTAKGLAHLHHSFRPPIVHYNLKPTNILLDENFNPKISDYGLARLLTKLDKHVM  884

Query  571   SNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVR  392
             +NRFQ+A+GYVAPELACQS+RVNEKCDV+GFG++ILEIVTGRRPVEYGEDNV+IL DHVR
Sbjct  885   NNRFQSALGYVAPELACQSIRVNEKCDVHGFGVMILEIVTGRRPVEYGEDNVVILTDHVR  944

Query  391   VLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPVP  212
              LLE+GNVL+CVD  M  Y ++EV+P+LKLALVCTSQIPSSRPSMAEVVQILQVIK P+P
Sbjct  945   YLLERGNVLDCVDPSMTQYSEDEVVPILKLALVCTSQIPSSRPSMAEVVQILQVIKAPLP  1004

Query  211   NRM  203
              R+
Sbjct  1005  QRI  1007



>ref|XP_009406353.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Musa acuminata subsp. malaccensis]
Length=1025

 Score =   647 bits (1668),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/548 (66%), Positives = 440/548 (80%), Gaps = 15/548 (3%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             S L G IP D+C+SGSL +LQLDGNS +G IP +IGNCSSL LLSLSHN+L+G+IP +LS
Sbjct  488   SKLYGTIPADMCKSGSLSVLQLDGNSFSGPIPDEIGNCSSLYLLSLSHNSLNGSIPASLS  547

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGN  1463
              LK+L+ILKLE N LSGEIPQQLG L+NLLAVN+S+NRL GRLP   IFQ+LD SA++GN
Sbjct  548   RLKKLEILKLEFNNLSGEIPQQLGGLDNLLAVNISHNRLIGRLPMEGIFQSLDGSALQGN  607

Query  1462  DGICSPLLTGPCKMNAPKPIVINPFVY--GNQTdnnnggdnNEPLASTRNSRHHRFLsvs  1289
              G+CSPL+  PCKMN PKP+V++P  Y  GN  +        +P A+    RH +FLS+S
Sbjct  608   LGLCSPLVLEPCKMNVPKPLVLDPDAYTRGNGNNMVTV----DP-ANPVVVRHRKFLSIS  662

Query  1288  aivaisaaaiiavgvmvITMVNASVRRRISFVENALESMCSSTSSRSQGMATGKLILFDT  1109
             ++VAISAA +IA GV+VIT++N S RRRI  +ENALES CSS++  +   A GK+++F  
Sbjct  663   SMVAISAALVIASGVLVITLLNMSARRRIVQLENALESKCSSSTRSTGTPAAGKMVVFGP  722

Query  1108  KS---SPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPE  938
             K+   S D A S  E++L KA+EIG GVFGTVY+A +G EG R VAIKKL ++ I+QY +
Sbjct  723   KNDLRSEDLAGSA-EALLAKATEIGRGVFGTVYRASMG-EG-RTVAIKKLLTANIVQYHD  779

Query  937   DFDREVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTW  758
             DFDREVRVLGK RH NL+PLRGYYWTPQLQLL+SD+   G+L S+LHE   +M  PPL+W
Sbjct  780   DFDREVRVLGKVRHPNLMPLRGYYWTPQLQLLISDYARHGSLHSRLHENPESM--PPLSW  837

Query  757   AVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRH  578
             A RF I++GTA GLAHLH S +PPIIHYN+KP+NILLDE+ NP ISDFG ARL+ KLD+H
Sbjct  838   ADRFHIVIGTADGLAHLHQSFRPPIIHYNLKPTNILLDESCNPIISDFGHARLLPKLDKH  897

Query  577   VMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDH  398
             ++S+RFQ+A+GY+APELACQSLRVNEKCDVYGFG+LILE+VTGR+PVEY +D+V+IL D 
Sbjct  898   IISSRFQSAMGYMAPELACQSLRVNEKCDVYGFGVLILELVTGRKPVEYRDDDVVILIDQ  957

Query  397   VRVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTP  218
             VR+LLEQG  LEC+D  MG YP+EEVLPVLKL LVC SQIPSSRPSMAEVVQILQVIKTP
Sbjct  958   VRLLLEQGKALECIDASMGEYPEEEVLPVLKLGLVCASQIPSSRPSMAEVVQILQVIKTP  1017

Query  217   VPNRMEPY  194
             V  RME +
Sbjct  1018  VLERMEAF  1025


 Score = 57.8 bits (138),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 57/102 (56%), Gaps = 0/102 (0%)
 Frame = -1

Query  1810  GEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSMLKR  1631
             G +P+ +    S+  L L  N L+G + P IGN +S+  L LS+N  +G++P +L  LK 
Sbjct  300   GHLPDSVQYLSSMTFLSLSNNQLSGDVLPWIGNLTSVQHLDLSNNKFTGSLPPSLGGLKE  359

Query  1630  LKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAG  1505
             L  L L  N+L+G IP  + +   L  + +  NRL G +P G
Sbjct  360   LTYLSLSNNKLTGTIPDAVAECSKLTELRLKGNRLNGSIPQG  401


 Score = 57.4 bits (137),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 38/100 (38%), Positives = 57/100 (57%), Gaps = 0/100 (0%)
 Frame = -1

Query  1810  GEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSMLKR  1631
             G IP  I +  +L  LQL+ N  +G IP  IG C  L  L LS N+  G +P+++  L  
Sbjct  252   GPIPAGIGDLHNLKHLQLNHNQFSGVIPAGIGLCPHLDTLDLSFNSFDGHLPDSVQYLSS  311

Query  1630  LKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP  1511
             +  L L  NQLSG++   +G L ++  +++S N+ TG LP
Sbjct  312   MTFLSLSNNQLSGDVLPWIGNLTSVQHLDLSNNKFTGSLP  351


 Score = 54.3 bits (129),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 47/119 (39%), Positives = 69/119 (58%), Gaps = 6/119 (5%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G++   I    S+  L L  N  TG++PP +G    LT LSLS+N L+GTIP+ ++  
Sbjct  322   LSGDVLPWIGNLTSVQHLDLSNNKFTGSLPPSLGGLKELTYLSLSNNKLTGTIPDAVAEC  381

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGS-----IFQNLDSSA  1475
              +L  L+L+ N+L+G IPQ L  L  L  +++S N L+G +P GS        +LD SA
Sbjct  382   SKLTELRLKGNRLNGSIPQGLFNL-GLEVLDLSSNELSGAMPPGSTRISETLHSLDLSA  439



>ref|XP_010555906.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 isoform X2 [Tarenaya hassleriana]
Length=993

 Score =   644 bits (1661),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/550 (65%), Positives = 446/550 (81%), Gaps = 12/550 (2%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             S+L G IP +ICES SL ILQLDGNSL G IP  IGNC SL LLSLSH++L+G IP++LS
Sbjct  449   SSLSGSIPANICESRSLEILQLDGNSLIGPIPEGIGNCLSLNLLSLSHDHLTGPIPKSLS  508

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGN  1463
              L +L+ILKLE N+LSGEIP +LGKL+NLLAVN+SYNRL G+LP G +FQ+LD SAI+GN
Sbjct  509   NLHQLRILKLESNELSGEIPPELGKLQNLLAVNISYNRLVGKLPGGIVFQSLDQSAIQGN  568

Query  1462  DGICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRFLsvsai  1283
              GICSPLL GPC++N PKP+VI+P   GN  D++    + +   + R   H  FLSVSAI
Sbjct  569   LGICSPLLKGPCRLNVPKPLVIDPNSDGNNNDHSPRDRSIDGSGNGR-FHHGMFLSVSAI  627

Query  1282  vaisaaaiiavgvmvITMVNASVRRRISFVENALESMCSSTSSRSQGMATGKLILFDTKS  1103
             +AISAA +IA GV++I+++NASVRRR++FV+NALES+ S  SSRS  MA GKL+L + +S
Sbjct  628   IAISAAILIASGVIIISLLNASVRRRLAFVDNALESIFSG-SSRSGSMAAGKLVLLNARS  686

Query  1102  SPDWA------SSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYP  941
             S   +      S   E  LNKA+E+GEGVFGTVY+A LG EGS V+A+KKL  S IL  P
Sbjct  687   SSSSSLSATEFSRNPEFFLNKAAEVGEGVFGTVYRATLGEEGS-VLAVKKLDPSTILHNP  745

Query  940   EDFDREVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLT  761
             EDFDR+VR+L K +H+NLVP++GY+WTP LQLLVS+++P GNL+SKLH      ++PPL+
Sbjct  746   EDFDRQVRILAKVKHENLVPIKGYFWTPDLQLLVSEYIPNGNLQSKLH--VRDPSSPPLS  803

Query  760   WAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDR  581
             WA RF+IILGTAKGLA+LHHS +PPI+H+N+KP+NILLD++ NPKISDFGL RL+ K DR
Sbjct  804   WAARFRIILGTAKGLAYLHHSFRPPIVHFNLKPTNILLDKDNNPKISDFGLTRLLTKHDR  863

Query  580   HVMSN-RFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILN  404
             + M+N RFQ A+GYVAPEL C+SLRVNEKCDVYGFG+LILE+VTGRRPVEYGE + ++L+
Sbjct  864   NTMNNNRFQNALGYVAPELECESLRVNEKCDVYGFGVLILELVTGRRPVEYGEHSFVVLS  923

Query  403   DHVRVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIK  224
             DHVRVLLEQGN LECVD  M  + ++EVLPVLKLALVCTSQ+PS+RP+MAE+VQIL VIK
Sbjct  924   DHVRVLLEQGNALECVDPTMDEFSEDEVLPVLKLALVCTSQVPSNRPTMAEIVQILHVIK  983

Query  223   TPVPNRMEPY  194
             TPVP+R+E +
Sbjct  984   TPVPHRLETF  993


 Score = 61.2 bits (147),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 59/105 (56%), Gaps = 0/105 (0%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             ++L G +P  I    +L  L L GN  +G++P  +G+C  L  L LS+N  SG +P    
Sbjct  209   NSLSGSMPSGISSLHNLKELNLQGNQFSGSLPADVGSCPHLNRLDLSYNLFSGEVPSAFQ  268

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPA  1508
              L  L  L L  N LSG+ P+ +G L +L  +++S N LTG LP+
Sbjct  269   RLNSLMFLSLSHNLLSGDFPRWIGTLRSLEHLDLSNNALTGELPS  313


 Score = 58.2 bits (139),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 48/121 (40%), Positives = 68/121 (56%), Gaps = 3/121 (2%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G+ P  I    SL  L L  N+LTG +P  +GN  SL  L LS+N L G IP ++S  
Sbjct  283   LSGDFPRWIGTLRSLEHLDLSNNALTGELPSSMGNLRSLKFLVLSNNQLKGEIPSSVSDC  342

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGS--IFQNLDSSAIEGN  1463
               L +++L+ N  +G IP  L  L  L  +++S+N LTG LP GS  +F++L    +  N
Sbjct  343   TELSVIQLKGNSFTGRIPDGLFDL-GLEEIDISHNGLTGSLPLGSRRLFESLRVLDLSCN  401

Query  1462  D  1460
             D
Sbjct  402   D  402


 Score = 57.0 bits (136),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 53/102 (52%), Gaps = 0/102 (0%)
 Frame = -1

Query  1810  GEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSMLKR  1631
             GE+P       SL  L L  N L+G  P  IG   SL  L LS+N L+G +P ++  L+ 
Sbjct  261   GEVPSAFQRLNSLMFLSLSHNLLSGDFPRWIGTLRSLEHLDLSNNALTGELPSSMGNLRS  320

Query  1630  LKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAG  1505
             LK L L  NQL GEIP  +     L  + +  N  TGR+P G
Sbjct  321   LKFLVLSNNQLKGEIPSSVSDCTELSVIQLKGNSFTGRIPDG  362



>ref|XP_010673272.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Beta vulgaris subsp. vulgaris]
Length=1009

 Score =   644 bits (1662),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/520 (68%), Positives = 428/520 (82%), Gaps = 11/520 (2%)
 Frame = -1

Query  1750  NSLTGTIPPQIGNCssltllslshnnlSGTIPETLSMLKRLKILKLEVNQLSGEIPQQLG  1571
             N+LTG IP +IGNCSSL LLSLSHN+LSG IP ++SMLKRL+IL+LE N+LSGE+P++LG
Sbjct  500   NALTGPIPQEIGNCSSLYLLSLSHNSLSGAIPSSISMLKRLEILRLESNELSGEMPKELG  559

Query  1570  KLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDGICSPLLTGPCKMNAPKPIVINP  1391
              L++LLAVNVSYN+L GRLP G IF NLD+SA++GN G+CSPLL GPCKMN  KP+V++P
Sbjct  560   TLQDLLAVNVSYNKLIGRLPPGGIFPNLDASALQGNLGLCSPLLKGPCKMNVQKPLVLDP  619

Query  1390  FVYGNQTdnnnggdnNEPLASTRNSRHHRFLsvsaivaisaaaiiavgvmvITMVNASVR  1211
               Y NQ   N+ G+        +    H+FLS+SAI+AISAA II  GV++IT++NAS R
Sbjct  620   NAYPNQVHGNDAGNQI-----AKGLEPHKFLSISAIIAISAAVIIVCGVVIITLLNASAR  674

Query  1210  RRISFVENALESMCSSTSSRSQGMATGKLILFDTKSSPDWASSTFESVLNKASEIGEGVF  1031
             R+++F++NALES+ SS+S      + G+L+LFDT+SS +  +   ES++NK+SEIG GVF
Sbjct  675   RKLAFIDNALESIFSSSSRSGTP-SVGRLVLFDTRSSGNLFADP-ESLINKSSEIGGGVF  732

Query  1030  GTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDFDREVRVLGKARHQNLVPLRGYYWTPQL  851
             GTVYKA +G EG R+VA+KKL  S ILQYPEDFDREVR LGK RH N+  LRGYYWTPQL
Sbjct  733   GTVYKASIGAEG-RIVAVKKLYKSNILQYPEDFDREVRALGKVRHLNVASLRGYYWTPQL  791

Query  850   QLLVSDFVPLGNLESKLHEMAMAMATPPLTWAVRFKIILGTAKGLAHLHHSCQPPIIHYN  671
             QLLVSD+    +L+ +LHE  + MA  PL+WA RF+++LGTAKGLAHLHHSC PPIIHYN
Sbjct  792   QLLVSDYAYNESLQFRLHERPLNMA--PLSWATRFRVLLGTAKGLAHLHHSCTPPIIHYN  849

Query  670   IKPSNILLDENLNPKISDFGLARLVAKLDRHVMS-NRFQAAIGYVAPELACQSLRVNEKC  494
             +KPSNILLDEN N K++DFGLA+L+ K+D H MS NRFQ A GY APELACQSLRVNEKC
Sbjct  850   LKPSNILLDENYNAKVADFGLAKLLTKIDNHSMSGNRFQGAPGYAAPELACQSLRVNEKC  909

Query  493   DVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGMGGYPDEEVLP  314
             DVY FG++ LEIVTGRRP+EYGEDNVLILNDHVRVLLE+GNVLECVDQ +G YPDEEVLP
Sbjct  910   DVYSFGVMALEIVTGRRPIEYGEDNVLILNDHVRVLLEEGNVLECVDQSIGEYPDEEVLP  969

Query  313   VLKLALVCTSQIPSSRPSMAEVVQILQVIKTPVPNRMEPY  194
             VLKLALVCTSQIPSSRPSM+EVVQILQVIKTPVP R E Y
Sbjct  970   VLKLALVCTSQIPSSRPSMSEVVQILQVIKTPVPQRQEAY  1009


 Score = 62.4 bits (150),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 46/102 (45%), Positives = 54/102 (53%), Gaps = 0/102 (0%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G  P  I    +L  L L GN  + +IP  IG C  L  L LS+N  +G IP T   L
Sbjct  237   LSGNFPTGIYTLHNLKELHLQGNQFSDSIPFDIGLCPHLLKLDLSNNYFTGEIPTTFGTL  296

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP  1511
             K L  L L  N LSGE PQ +G L NL  ++ S N LTG LP
Sbjct  297   KSLVFLSLAHNTLSGEFPQWVGNLINLQHLDFSKNGLTGVLP  338



>ref|XP_008453972.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Cucumis melo]
Length=1010

 Score =   644 bits (1661),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/546 (66%), Positives = 441/546 (81%), Gaps = 12/546 (2%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             S L G IP ++C+SGSL ILQLDGNSL G IP +IGNC SL LLSLSHNNLSG IP+++S
Sbjct  474   SDLYGSIPGELCDSGSLKILQLDGNSLVGPIPDEIGNCLSLYLLSLSHNNLSGEIPKSIS  533

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGN  1463
              L +L+IL+LE N+LSGEIPQ+LG L+NLLAVN+SYN LTGRLP G IF +LD SA++GN
Sbjct  534   KLSKLEILRLESNELSGEIPQELGILQNLLAVNISYNMLTGRLPVGGIFPSLDQSALQGN  593

Query  1462  DGICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRFLsvsai  1283
              G+CSPLL GPCKMN PKP+V++P  Y NQ    +  +   P   +  S HH F SVSAI
Sbjct  594   LGLCSPLLKGPCKMNVPKPLVLDPNAYPNQMGGQSSRN--SPSRFSNPSPHHVFFSVSAI  651

Query  1282  vaisaaaiiavgvmvITMVNASVRRR-ISFVENALESMCSSTSSRSQGMATGKLILFDTK  1106
             VAISAA +IA+GV+VIT++N S RRR ++FV+NALES  SS+ S +  +  GKLILFD+ 
Sbjct  652   VAISAATLIALGVLVITLLNVSARRRSLTFVDNALESCSSSSKSGT--VTAGKLILFDSN  709

Query  1105  S--SPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDF  932
             S  S +W S+  E++LNKASEIG GVFGTVYK  LG  G   VA+KKL  S I+Q PEDF
Sbjct  710   SRASSNWVSN-HEALLNKASEIGGGVFGTVYKVSLGDGGD--VAMKKLVKSDIIQNPEDF  766

Query  931   DREVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAV  752
             DRE+R+LGK +H NL+ L+GYYWT Q QLLV ++   G+L+++LH      + PPL+W  
Sbjct  767   DREIRILGKVKHPNLISLKGYYWTVQTQLLVMEYANNGSLQTQLH--GRLPSAPPLSWDN  824

Query  751   RFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVM  572
             RFKI+LGTAKGLAHLHHS +PPI+HYN+KP+NILLDEN NPKISD+GLARL+ KLD+HV+
Sbjct  825   RFKIVLGTAKGLAHLHHSFRPPIVHYNLKPTNILLDENFNPKISDYGLARLLTKLDKHVV  884

Query  571   SNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVR  392
             +NRFQ+A+GYVAPELACQS+RVNEKCDV+GFG++ILEIVTGRRPVEYGEDNV+IL DHVR
Sbjct  885   NNRFQSALGYVAPELACQSIRVNEKCDVHGFGVMILEIVTGRRPVEYGEDNVVILTDHVR  944

Query  391   VLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPVP  212
              LLE+GNVL+CVD  M  Y ++EV+P+LKLALVCTSQIPSSRPSMAEVVQILQVIK P+P
Sbjct  945   YLLERGNVLDCVDPSMTQYSEDEVVPILKLALVCTSQIPSSRPSMAEVVQILQVIKAPLP  1004

Query  211   NRMEPY  194
              R++ +
Sbjct  1005  QRIQGF  1010


 Score = 52.8 bits (125),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 36/123 (29%), Positives = 61/123 (50%), Gaps = 0/123 (0%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G +P  +    SL    +  NS +  +P  IGN + L  +  S N  +G++P T+ +L
Sbjct  284   LTGPLPNSMRLLTSLTFFNIGFNSFSDELPQWIGNMTRLEYMDFSSNGFTGSLPLTMGVL  343

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
             + +K +    N+L+G IP+ L +   L  + +  NR  GR+P G     L+   +  N+ 
Sbjct  344   RSVKYMSFSNNKLTGNIPETLMECSELSVIKLEGNRFNGRVPEGLFELGLEEMDLSKNEL  403

Query  1456  ICS  1448
             I S
Sbjct  404   IGS  406



>ref|XP_010555905.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 isoform X1 [Tarenaya hassleriana]
Length=1017

 Score =   643 bits (1659),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/550 (65%), Positives = 446/550 (81%), Gaps = 12/550 (2%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             S+L G IP +ICES SL ILQLDGNSL G IP  IGNC SL LLSLSH++L+G IP++LS
Sbjct  473   SSLSGSIPANICESRSLEILQLDGNSLIGPIPEGIGNCLSLNLLSLSHDHLTGPIPKSLS  532

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGN  1463
              L +L+ILKLE N+LSGEIP +LGKL+NLLAVN+SYNRL G+LP G +FQ+LD SAI+GN
Sbjct  533   NLHQLRILKLESNELSGEIPPELGKLQNLLAVNISYNRLVGKLPGGIVFQSLDQSAIQGN  592

Query  1462  DGICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRFLsvsai  1283
              GICSPLL GPC++N PKP+VI+P   GN  D++    + +   + R   H  FLSVSAI
Sbjct  593   LGICSPLLKGPCRLNVPKPLVIDPNSDGNNNDHSPRDRSIDGSGNGR-FHHGMFLSVSAI  651

Query  1282  vaisaaaiiavgvmvITMVNASVRRRISFVENALESMCSSTSSRSQGMATGKLILFDTKS  1103
             +AISAA +IA GV++I+++NASVRRR++FV+NALES+ S  SSRS  MA GKL+L + +S
Sbjct  652   IAISAAILIASGVIIISLLNASVRRRLAFVDNALESIFSG-SSRSGSMAAGKLVLLNARS  710

Query  1102  SPDWA------SSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYP  941
             S   +      S   E  LNKA+E+GEGVFGTVY+A LG EGS V+A+KKL  S IL  P
Sbjct  711   SSSSSLSATEFSRNPEFFLNKAAEVGEGVFGTVYRATLGEEGS-VLAVKKLDPSTILHNP  769

Query  940   EDFDREVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLT  761
             EDFDR+VR+L K +H+NLVP++GY+WTP LQLLVS+++P GNL+SKLH      ++PPL+
Sbjct  770   EDFDRQVRILAKVKHENLVPIKGYFWTPDLQLLVSEYIPNGNLQSKLH--VRDPSSPPLS  827

Query  760   WAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDR  581
             WA RF+IILGTAKGLA+LHHS +PPI+H+N+KP+NILLD++ NPKISDFGL RL+ K DR
Sbjct  828   WAARFRIILGTAKGLAYLHHSFRPPIVHFNLKPTNILLDKDNNPKISDFGLTRLLTKHDR  887

Query  580   HVMSN-RFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILN  404
             + M+N RFQ A+GYVAPEL C+SLRVNEKCDVYGFG+LILE+VTGRRPVEYGE + ++L+
Sbjct  888   NTMNNNRFQNALGYVAPELECESLRVNEKCDVYGFGVLILELVTGRRPVEYGEHSFVVLS  947

Query  403   DHVRVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIK  224
             DHVRVLLEQGN LECVD  M  + ++EVLPVLKLALVCTSQ+PS+RP+MAE+VQIL VIK
Sbjct  948   DHVRVLLEQGNALECVDPTMDEFSEDEVLPVLKLALVCTSQVPSNRPTMAEIVQILHVIK  1007

Query  223   TPVPNRMEPY  194
             TPVP+R+E +
Sbjct  1008  TPVPHRLETF  1017


 Score = 61.2 bits (147),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 59/105 (56%), Gaps = 0/105 (0%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             ++L G +P  I    +L  L L GN  +G++P  +G+C  L  L LS+N  SG +P    
Sbjct  233   NSLSGSMPSGISSLHNLKELNLQGNQFSGSLPADVGSCPHLNRLDLSYNLFSGEVPSAFQ  292

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPA  1508
              L  L  L L  N LSG+ P+ +G L +L  +++S N LTG LP+
Sbjct  293   RLNSLMFLSLSHNLLSGDFPRWIGTLRSLEHLDLSNNALTGELPS  337


 Score = 57.8 bits (138),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 48/121 (40%), Positives = 68/121 (56%), Gaps = 3/121 (2%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G+ P  I    SL  L L  N+LTG +P  +GN  SL  L LS+N L G IP ++S  
Sbjct  307   LSGDFPRWIGTLRSLEHLDLSNNALTGELPSSMGNLRSLKFLVLSNNQLKGEIPSSVSDC  366

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGS--IFQNLDSSAIEGN  1463
               L +++L+ N  +G IP  L  L  L  +++S+N LTG LP GS  +F++L    +  N
Sbjct  367   TELSVIQLKGNSFTGRIPDGLFDL-GLEEIDISHNGLTGSLPLGSRRLFESLRVLDLSCN  425

Query  1462  D  1460
             D
Sbjct  426   D  426


 Score = 57.0 bits (136),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 53/102 (52%), Gaps = 0/102 (0%)
 Frame = -1

Query  1810  GEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSMLKR  1631
             GE+P       SL  L L  N L+G  P  IG   SL  L LS+N L+G +P ++  L+ 
Sbjct  285   GEVPSAFQRLNSLMFLSLSHNLLSGDFPRWIGTLRSLEHLDLSNNALTGELPSSMGNLRS  344

Query  1630  LKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAG  1505
             LK L L  NQL GEIP  +     L  + +  N  TGR+P G
Sbjct  345   LKFLVLSNNQLKGEIPSSVSDCTELSVIQLKGNSFTGRIPDG  386



>emb|CDX85183.1| BnaC07g24940D, partial [Brassica napus]
Length=933

 Score =   636 bits (1641),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/549 (65%), Positives = 442/549 (81%), Gaps = 19/549 (3%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             SALIG +P DICE+ SL ILQLDGNSLTG+IP  IGNCS L LLSLSHNNL+G IP++LS
Sbjct  391   SALIGSVPADICEAQSLQILQLDGNSLTGSIPEGIGNCSYLKLLSLSHNNLTGPIPKSLS  450

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGN  1463
              L+ LKILKLE N+ SGEIP++LGKL+NLL VN+S+NRL GRLP+G +FQ+LD SA++GN
Sbjct  451   NLEELKILKLEANKFSGEIPKELGKLQNLLLVNISFNRLIGRLPSGGVFQSLDQSALQGN  510

Query  1462  DGICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHH--RFLsvs  1289
              GICSPLL GPC +N PKP+VI+P  Y N         NN+ ++  R S+ H   FLSVS
Sbjct  511   LGICSPLLRGPCTLNVPKPLVIDPNSYRNGN-------NNQEVSGNRASKFHGGMFLSVS  563

Query  1288  aivaisaaaiiavgvmvITMVNASVRRRISFVENALESMCSSTSSRSQGMATGKLILFDT  1109
              IVAISAA +I  G+++IT++NASVRRR++FV+ ALES+ S +S   + +  GKL+L ++
Sbjct  564   VIVAISAAILIVSGIIIITLLNASVRRRLAFVDTALESIFSGSSRSGRSLEAGKLVLLNS  623

Query  1108  KSSPDWASSTF-----ESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQY  944
             ++S   +SS       ESVLNKAS IGEGVFGTVYKAPLG  G R VA+KKL  S I++ 
Sbjct  624   RTSRSSSSSQEFSRNPESVLNKASRIGEGVFGTVYKAPLGEHG-RNVAVKKLVPSPIIEN  682

Query  943   PEDFDREVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPL  764
              EDFDREVR+L KA+H NLV ++GYYWTP++QLLVS+++P GNL+SKLH+     +TPPL
Sbjct  683   LEDFDREVRILAKAKHPNLVSMKGYYWTPEMQLLVSEYIPNGNLQSKLHK--REPSTPPL  740

Query  763   TWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLD  584
              W  R++IILGTAKGLA+LHH+ +P  +H+N+KP+NILLDE  NPKISDFGLARL+   D
Sbjct  741   PWDARYRIILGTAKGLAYLHHTFRPATVHFNLKPTNILLDEKYNPKISDFGLARLLTTQD  800

Query  583   RHVM-SNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLIL  407
              + M +NRFQ A+GYVAPEL CQ+LRVNEKCDVYGFG+LILE+VTGRRPVEYGED+ +IL
Sbjct  801   GNTMNTNRFQNALGYVAPELECQNLRVNEKCDVYGFGVLILELVTGRRPVEYGEDSFVIL  860

Query  406   NDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  230
             +DHVRVLLEQGNVLEC+D  M G Y ++EVLPVLKLALVCTSQIPS+RP+MAE+VQILQV
Sbjct  861   SDHVRVLLEQGNVLECIDPTMEGEYSEDEVLPVLKLALVCTSQIPSNRPTMAEIVQILQV  920

Query  229   IKTPVPNRM  203
             I +PVP+RM
Sbjct  921   ISSPVPHRM  929


 Score = 67.0 bits (162),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 44/105 (42%), Positives = 60/105 (57%), Gaps = 0/105 (0%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             +AL G IP  I    +L +L L GN  +G++P  IG C  L  + +S N  SG IP TL 
Sbjct  169   NALSGSIPLGILYVHNLKVLHLQGNQFSGSLPSDIGLCPHLNRVDVSFNRFSGEIPTTLQ  228

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPA  1508
              L+ L  L L  N LSG  P  +G +  L+ ++VS N LTG+LP+
Sbjct  229   RLRYLNHLDLSKNMLSGGFPVWIGDMTGLVHLDVSSNVLTGKLPS  273


 Score = 53.1 bits (126),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 56/104 (54%), Gaps = 0/104 (0%)
 Frame = -1

Query  1810  GEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSMLKR  1631
             GEIP  +     L  L L  N L+G  P  IG+ + L  L +S N L+G +P ++S L+ 
Sbjct  221   GEIPTTLQRLRYLNHLDLSKNMLSGGFPVWIGDMTGLVHLDVSSNVLTGKLPSSISNLRS  280

Query  1630  LKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSI  1499
             LK L L  N+LSGE+P+ L   + L  V +  N  TG    GSI
Sbjct  281   LKALILSENKLSGEVPESLEACKELTVVQLKGNGFTGNGLTGSI  324



>ref|NP_189443.2| probably inactive leucine-rich repeat receptor-like protein kinase 
[Arabidopsis thaliana]
 sp|Q9LRT1.1|Y3804_ARATH RecName: Full=Probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040; Flags: Precursor [Arabidopsis 
thaliana]
 dbj|BAB01126.1| receptor protein kinase [Arabidopsis thaliana]
 gb|ACN59324.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEE77394.1| probably inactive leucine-rich repeat receptor-like protein kinase 
[Arabidopsis thaliana]
Length=1016

 Score =   639 bits (1648),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/549 (66%), Positives = 441/549 (80%), Gaps = 18/549 (3%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             SALIG +P DICES SL ILQLDGNSLTG+IP  IGNCSSL LLSLSHNNL+G IP++LS
Sbjct  473   SALIGSVPADICESQSLQILQLDGNSLTGSIPEGIGNCSSLKLLSLSHNNLTGPIPKSLS  532

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGN  1463
              L+ LKILKLE N+LSGEIP++LG L+NLL VNVS+NRL GRLP G +FQ+LD SAI+GN
Sbjct  533   NLQELKILKLEANKLSGEIPKELGDLQNLLLVNVSFNRLIGRLPLGDVFQSLDQSAIQGN  592

Query  1462  DGICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHR--FLsvs  1289
              GICSPLL GPC +N PKP+VINP  YGN  +           AS  +   HR  FLSVS
Sbjct  593   LGICSPLLRGPCTLNVPKPLVINPNSYGNGNNMPGNR------ASGGSGTFHRRMFLSVS  646

Query  1288  aivaisaaaiiavgvmvITMVNASVRRRISFVENALESMCSSTSSRSQGMATGKLILFDT  1109
              IVAISAA +I  GV++IT++NASVRRR++FV+NALES+ S +S   + +  GKL+L ++
Sbjct  647   VIVAISAAILIFSGVIIITLLNASVRRRLAFVDNALESIFSGSSKSGRSLMMGKLVLLNS  706

Query  1108  KSSPDWASSTF-----ESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQY  944
             ++S   +SS       ES+LNKAS IGEGVFGTVYKAPLG +G R +A+KKL  S ILQ 
Sbjct  707   RTSRSSSSSQEFERNPESLLNKASRIGEGVFGTVYKAPLGEQG-RNLAVKKLVPSPILQN  765

Query  943   PEDFDREVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPL  764
              EDFDREVR+L KA+H NLV ++GY+WTP L LLVS+++P GNL+SKLHE     +TPPL
Sbjct  766   LEDFDREVRILAKAKHPNLVSIKGYFWTPDLHLLVSEYIPNGNLQSKLHE--REPSTPPL  823

Query  763   TWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLD  584
             +W VR+KIILGTAKGLA+LHH+ +P  IH+N+KP+NILLDE  NPKISDFGL+RL+   D
Sbjct  824   SWDVRYKIILGTAKGLAYLHHTFRPTTIHFNLKPTNILLDEKNNPKISDFGLSRLLTTQD  883

Query  583   RHVM-SNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLIL  407
              + M +NRFQ A+GYVAPEL CQ+LRVNEKCDVYGFG+LILE+VTGRRPVEYGED+ +IL
Sbjct  884   GNTMNNNRFQNALGYVAPELECQNLRVNEKCDVYGFGVLILELVTGRRPVEYGEDSFVIL  943

Query  406   NDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  230
             +DHVRV+LEQGNVLEC+D  M   Y ++EVLPVLKLALVCTSQIPS+RP+MAE+VQILQV
Sbjct  944   SDHVRVMLEQGNVLECIDPVMEEQYSEDEVLPVLKLALVCTSQIPSNRPTMAEIVQILQV  1003

Query  229   IKTPVPNRM  203
             I +PVP+R+
Sbjct  1004  INSPVPHRI  1012


 Score = 60.8 bits (146),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 41/116 (35%), Positives = 61/116 (53%), Gaps = 0/116 (0%)
 Frame = -1

Query  1810  GEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSMLKR  1631
             GE+P  + +  SL    +  N L+G  PP IG+ + L  L  S N L+G +P ++S L+ 
Sbjct  285   GELPRTLQKLKSLNHFDVSNNLLSGDFPPWIGDMTGLVHLDFSSNELTGKLPSSISNLRS  344

Query  1630  LKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGN  1463
             LK L L  N+LSGE+P+ L   + L+ V +  N  +G +P G     L      GN
Sbjct  345   LKDLNLSENKLSGEVPESLESCKELMIVQLKGNDFSGNIPDGFFDLGLQEMDFSGN  400


 Score = 60.1 bits (144),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 58/105 (55%), Gaps = 0/105 (0%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             ++L G IP  I    +L  LQL  N  +G +P  IG C  L  + LS N+ SG +P TL 
Sbjct  233   NSLSGSIPLGILSLHNLKELQLQRNQFSGALPSDIGLCPHLNRVDLSSNHFSGELPRTLQ  292

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPA  1508
              LK L    +  N LSG+ P  +G +  L+ ++ S N LTG+LP+
Sbjct  293   KLKSLNHFDVSNNLLSGDFPPWIGDMTGLVHLDFSSNELTGKLPS  337



>ref|XP_006290541.1| hypothetical protein CARUB_v10016623mg [Capsella rubella]
 gb|EOA23439.1| hypothetical protein CARUB_v10016623mg [Capsella rubella]
Length=1017

 Score =   637 bits (1644),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/549 (65%), Positives = 442/549 (81%), Gaps = 18/549 (3%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             SALIG +P DICES SL ILQLDGNSLTG+IP  IGNCSSL LLSLSHN L+G IP++LS
Sbjct  474   SALIGSVPADICESQSLQILQLDGNSLTGSIPEGIGNCSSLKLLSLSHNKLTGPIPKSLS  533

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGN  1463
              L+ LKILKLE N+LSGEIP++LG+L+NLL VNVS+NRL GRLP G +FQ+LD SAI+GN
Sbjct  534   NLQELKILKLEANKLSGEIPKELGELQNLLLVNVSFNRLIGRLPLGDVFQSLDQSAIQGN  593

Query  1462  DGICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHR--FLsvs  1289
              GICSPLL GPC +N PKP+VI+P  YG   +           AS  + + HR  FLSVS
Sbjct  594   LGICSPLLRGPCTLNVPKPLVIDPNAYGKGKNMPGDR------ASNGSGKFHRGMFLSVS  647

Query  1288  aivaisaaaiiavgvmvITMVNASVRRRISFVENALESMCSSTSSRSQGMATGKLILFDT  1109
              IVAISAA +I  G+++IT++NASVRRR++FV+NALES+ S +S   + +  GKL+L ++
Sbjct  648   VIVAISAAILIFAGIIIITLLNASVRRRLAFVDNALESIFSGSSKSGRSLVMGKLVLLNS  707

Query  1108  KSSPDWASSTF-----ESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQY  944
             ++S   +SS       ES+LNKAS IGEGVFGTVYKAPLG +G R +A+KKL  S ILQ 
Sbjct  708   RTSRSSSSSQEFERNPESLLNKASRIGEGVFGTVYKAPLGEQG-RNLAVKKLVPSPILQN  766

Query  943   PEDFDREVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPL  764
              EDFDREVR+L KA+H NLV ++GY+WTP+L LLVS+++P GNL+SKLHE     +TPPL
Sbjct  767   LEDFDREVRILAKAKHPNLVSIKGYFWTPELHLLVSEYIPNGNLQSKLHE--REPSTPPL  824

Query  763   TWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLD  584
             +W VR++IILGTAKGLA+LHH+ +P  +H+N+KP+NILLDE  NPKISDFGL+RL+   D
Sbjct  825   SWDVRYRIILGTAKGLAYLHHTFRPATVHFNLKPTNILLDEKNNPKISDFGLSRLLTTQD  884

Query  583   RHVM-SNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLIL  407
              + M +NRFQ A+GYVAPEL CQ+LRVNEKCDVYGFG+LILE+VTGRRPVEYGED+ +IL
Sbjct  885   GNTMNNNRFQNALGYVAPELECQNLRVNEKCDVYGFGVLILELVTGRRPVEYGEDSFVIL  944

Query  406   NDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  230
             +DHVRVLLEQGNVLEC+D  M   Y ++EVLPVLKLALVCTSQIPS+RP+MAE+VQILQV
Sbjct  945   SDHVRVLLEQGNVLECIDPVMEEQYSEDEVLPVLKLALVCTSQIPSNRPTMAEIVQILQV  1004

Query  229   IKTPVPNRM  203
             I +PVP+R+
Sbjct  1005  INSPVPHRI  1013


 Score = 56.2 bits (134),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 56/105 (53%), Gaps = 0/105 (0%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             ++L G IP  I    +L +LQL  N  +G +P  IG C  L  + LS N  SG +P TL 
Sbjct  234   NSLSGPIPLGILTLHNLKVLQLQRNQFSGPLPSDIGLCPHLNRVDLSFNLFSGELPRTLQ  293

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPA  1508
              +K L    L  N LSG+ P  +G +  L+ ++ S N LTG L +
Sbjct  294   RVKSLYHFDLSNNLLSGDFPGWIGDMSGLVHLDFSSNELTGELAS  338



>ref|XP_010502811.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Camelina sativa]
Length=1017

 Score =   637 bits (1642),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/549 (65%), Positives = 443/549 (81%), Gaps = 18/549 (3%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             SALIG +P DICES SL ILQLDGNSLTG+IP  IGNC+SL LLSLSHNNL+G IP++LS
Sbjct  474   SALIGSVPADICESQSLQILQLDGNSLTGSIPEGIGNCTSLKLLSLSHNNLTGPIPKSLS  533

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGN  1463
              L+ LKILKLE N+L+GEIP++LG+L+NLL VNVS+NRL GRLP G +FQ+LD SAI+GN
Sbjct  534   NLQELKILKLEANKLTGEIPKELGELQNLLLVNVSFNRLIGRLPFGGVFQSLDQSAIQGN  593

Query  1462  DGICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHR--FLsvs  1289
              GICSPLL GPC +N PKP+VI+P  YG   +           AS  + + HR  FLSVS
Sbjct  594   LGICSPLLRGPCTLNVPKPLVIDPNSYGKGNNMPGNR------ASDGSGKFHRGMFLSVS  647

Query  1288  aivaisaaaiiavgvmvITMVNASVRRRISFVENALESMCSSTSSRSQGMATGKLILFDT  1109
              IVAISAA +I  G+++IT++NASVRRR++FV+NALES+ S +S   + +  GKL+L ++
Sbjct  648   VIVAISAAILIFAGIIIITLLNASVRRRLAFVDNALESIFSGSSKSGRSLVMGKLVLLNS  707

Query  1108  KSSPDWASSTF-----ESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQY  944
             ++S   +SS       ES+LNKAS IGEGVFGTVYKAPLG +G R +A+KKL  S  LQ 
Sbjct  708   RTSRSSSSSQEFERNPESLLNKASRIGEGVFGTVYKAPLGEQG-RNLAVKKLVPSPNLQN  766

Query  943   PEDFDREVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPL  764
              EDFDREVR+L KA+H NLV ++GY+WTP+L LLVS+++P GNL+SKLHE     +TPPL
Sbjct  767   LEDFDREVRILAKAKHPNLVSIKGYFWTPELHLLVSEYIPNGNLQSKLHE--REPSTPPL  824

Query  763   TWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLD  584
             +W VR++IILGTAKGLA+LHH+C+P  IH+N+KP+NILLDE  NPKISDFGL+RL+   D
Sbjct  825   SWDVRYRIILGTAKGLAYLHHTCRPATIHFNLKPTNILLDEKNNPKISDFGLSRLLTTQD  884

Query  583   RHVM-SNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLIL  407
              + M +NRFQ A+GYVAPEL CQ+LRVNEKCDVYGFG+LILE+VTGRRPVEYGED+ +IL
Sbjct  885   GNTMNNNRFQNALGYVAPELECQNLRVNEKCDVYGFGVLILELVTGRRPVEYGEDSFVIL  944

Query  406   NDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  230
             +DHVRVLLEQGNVLEC+D  M   Y ++EVLPVLKLALVCTSQIPS+RP+MAE+VQILQV
Sbjct  945   SDHVRVLLEQGNVLECIDPVMEEQYSEDEVLPVLKLALVCTSQIPSNRPTMAEIVQILQV  1004

Query  229   IKTPVPNRM  203
             I +PVP+R+
Sbjct  1005  INSPVPHRI  1013


 Score = 54.3 bits (129),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 54/105 (51%), Gaps = 0/105 (0%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             ++L G +P  I    +L  LQL  N   G +P  IG C  L  + LS N  SG +P TL 
Sbjct  234   NSLSGSVPLGILSLHNLKWLQLQRNQFQGPLPSDIGLCPHLNRVDLSFNLFSGELPRTLQ  293

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPA  1508
              L+ L    L  N LSG+ P  +  +  L+ ++ S N LTG LP+
Sbjct  294   RLRSLYHFDLSNNLLSGDFPVWISDMTGLVHLDFSSNELTGELPS  338



>ref|XP_010514517.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Camelina sativa]
Length=1017

 Score =   635 bits (1639),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/549 (65%), Positives = 442/549 (81%), Gaps = 18/549 (3%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             SALIG +P DICES SL ILQLDGNSLTG+IP  IGNCSSL LLSLSHNNL+G IP++LS
Sbjct  474   SALIGSVPVDICESQSLQILQLDGNSLTGSIPEGIGNCSSLKLLSLSHNNLTGPIPKSLS  533

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGN  1463
              L+ LKILKLE N+L+GEIP++LG+L+NLL VNVS+NR  GRLP G +FQ+LD SAI+GN
Sbjct  534   NLQELKILKLEANKLTGEIPKELGELQNLLLVNVSFNRFIGRLPFGGVFQSLDQSAIQGN  593

Query  1462  DGICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHR--FLsvs  1289
              GICSPLL GPC +N PKP+VI+P  YG   +           AS  + + HR  FLSVS
Sbjct  594   LGICSPLLRGPCTLNVPKPLVIDPNSYGKGNNMQGNQ------ASNGSGKFHRGMFLSVS  647

Query  1288  aivaisaaaiiavgvmvITMVNASVRRRISFVENALESMCSSTSSRSQGMATGKLILFDT  1109
              IVAISAA +I  G+++IT++NASVRRR++FV+NALES+ S +S   + +  GKL+L ++
Sbjct  648   VIVAISAAILIFAGIIIITLLNASVRRRLAFVDNALESIFSGSSKSGRSLVMGKLVLLNS  707

Query  1108  KSSPDWASSTF-----ESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQY  944
             ++S   +SS       ES+LNKAS IGEGVFGTVYKAPLG +G R +A+KKL  S  LQ 
Sbjct  708   RTSRSSSSSQEFERNPESLLNKASRIGEGVFGTVYKAPLGEQG-RNLAVKKLVPSPNLQN  766

Query  943   PEDFDREVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPL  764
              EDFDREVR+L KA+H NLV ++GY+WTP+L LLVS+++P GNL+SKLHE     +TPPL
Sbjct  767   LEDFDREVRILAKAKHPNLVSIKGYFWTPELHLLVSEYIPNGNLQSKLHE--REPSTPPL  824

Query  763   TWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLD  584
             +W VR++IILGTAKGLA+LHH+C+P  IH+N+KP+NILLDE  NPKISDFGL+RL+   D
Sbjct  825   SWDVRYRIILGTAKGLAYLHHTCRPATIHFNLKPTNILLDEKNNPKISDFGLSRLLTTQD  884

Query  583   RHVM-SNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLIL  407
              + M +NRFQ A+GYVAPEL CQ+LRVNEKCDVYGFG+LILE+VTGRRPVEYGED+ +IL
Sbjct  885   GNTMNNNRFQNALGYVAPELECQNLRVNEKCDVYGFGVLILELVTGRRPVEYGEDSFVIL  944

Query  406   NDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  230
             +DHVRVLLEQGNVLEC+D  M   Y ++EVLPVLKLALVCTSQIPS+RP+MAE+VQILQV
Sbjct  945   SDHVRVLLEQGNVLECIDPVMEEQYSEDEVLPVLKLALVCTSQIPSNRPTMAEIVQILQV  1004

Query  229   IKTPVPNRM  203
             I +PVP+R+
Sbjct  1005  INSPVPHRI  1013


 Score = 57.4 bits (137),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 55/105 (52%), Gaps = 0/105 (0%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             ++L G +P  I    +L  LQL  N   G +P  IG C  L  + LS N  SG +P TL 
Sbjct  234   NSLYGSVPLGILSLHNLKWLQLQRNQFQGPLPSDIGLCPHLNRVDLSFNLFSGELPRTLQ  293

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPA  1508
              L+ L    L  N LSG+ P  +  + +L+ V+ S N LTG LP+
Sbjct  294   RLRSLNHFDLSNNLLSGDFPVWISDMTSLVHVDFSSNELTGELPS  338



>ref|XP_010425587.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Camelina sativa]
Length=1017

 Score =   635 bits (1639),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/549 (65%), Positives = 443/549 (81%), Gaps = 18/549 (3%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             SALIG +P DICES SL ILQLDGNSLTG+IP  IGNCSSL LLSLSHNNL+G IP++LS
Sbjct  474   SALIGSVPADICESQSLQILQLDGNSLTGSIPEGIGNCSSLKLLSLSHNNLTGPIPKSLS  533

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGN  1463
              L+ LKILKLE N+L+GEIP++LG+L+NLL VNVS+NRL GRLP G +FQ+LD SAI+GN
Sbjct  534   NLQELKILKLEANKLTGEIPKELGELQNLLLVNVSFNRLIGRLPFGGVFQSLDQSAIQGN  593

Query  1462  DGICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHR--FLsvs  1289
              GICSPLL GPC +N PKP+VI+P  YG   +           AS  + + HR  FLSVS
Sbjct  594   LGICSPLLRGPCTLNVPKPLVIDPNSYGKGNNMPGNR------ASNGSGKFHRGMFLSVS  647

Query  1288  aivaisaaaiiavgvmvITMVNASVRRRISFVENALESMCSSTSSRSQGMATGKLILFDT  1109
              IVAISAA +I  G+++IT++NASVRRR++FV+NALES+ S +S   + +  GKL+L ++
Sbjct  648   VIVAISAAILIFAGIIIITLLNASVRRRLAFVDNALESIFSGSSKSGRSLVMGKLVLLNS  707

Query  1108  KSSPDWASSTF-----ESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQY  944
             ++S   +SS       ES+LNKAS IGEGVFGTVYKAPLG +G R +A+KKL  S  LQ 
Sbjct  708   RTSRSSSSSQEFERNPESLLNKASRIGEGVFGTVYKAPLGEQG-RNLAVKKLVPSPNLQN  766

Query  943   PEDFDREVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPL  764
              EDFDREVR+L KA+H NLV ++GY+WTP+L LLVS+++P GNL+SKLHE     +TPPL
Sbjct  767   LEDFDREVRILAKAKHPNLVSIKGYFWTPELHLLVSEYIPNGNLQSKLHE--REPSTPPL  824

Query  763   TWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLD  584
             +W VR++IILGTAKGLA+LHH+C+P  IH+N+KP+NILLDE  NPKISDFGL+RL+   D
Sbjct  825   SWDVRYRIILGTAKGLAYLHHTCRPATIHFNLKPTNILLDEKNNPKISDFGLSRLLTTQD  884

Query  583   RHVM-SNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLIL  407
              + M +NRFQ A+GYVAPEL CQ+LRVNEKCDVYGFG+LILE+VTGRRPVEYGED+ +IL
Sbjct  885   GNTMNNNRFQNALGYVAPELECQNLRVNEKCDVYGFGVLILELVTGRRPVEYGEDSFVIL  944

Query  406   NDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  230
             +DHVRVLLEQGNVLEC+D  M   Y ++EVLPVLKLALVCTSQIPS+RP+MAE+VQILQV
Sbjct  945   SDHVRVLLEQGNVLECIDPVMEEQYSEDEVLPVLKLALVCTSQIPSNRPTMAEIVQILQV  1004

Query  229   IKTPVPNRM  203
             I +PVP+R+
Sbjct  1005  INSPVPHRI  1013


 Score = 54.7 bits (130),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 54/105 (51%), Gaps = 0/105 (0%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             ++L G IP  I    +L  LQL  N   G +P  IG C  L  + LS N  SG +P TL 
Sbjct  234   NSLSGSIPLGILSLHNLKWLQLQRNQFQGPLPSDIGLCPHLNRVDLSFNIFSGELPRTLQ  293

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPA  1508
              L+ L    L  N LSG+ P  +  +  L+ ++ S N LTG LP+
Sbjct  294   RLRSLYHFDLSNNLLSGDFPVWISDMTGLIHMDFSSNDLTGELPS  338


 Score = 53.1 bits (126),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 42/130 (32%), Positives = 63/130 (48%), Gaps = 1/130 (1%)
 Frame = -1

Query  1810  GEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSMLKR  1631
             GE+P  +    SL    L  N L+G  P  I + + L  +  S N+L+G +P ++  L+ 
Sbjct  286   GELPRTLQRLRSLYHFDLSNNLLSGDFPVWISDMTGLIHMDFSSNDLTGELPSSIGNLRS  345

Query  1630  LKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDGIC  1451
             LK L L  N+LSGE+P+ L     L+ V +  N   G +P G     L    I GN G  
Sbjct  346   LKHLILSKNKLSGELPESLESCNELMVVQLKGNGFVGSIPDGLFDLGLQEMDISGN-GFT  404

Query  1450  SPLLTGPCKM  1421
              P+  G  ++
Sbjct  405   GPIPRGSSRL  414



>ref|XP_002875419.1| hypothetical protein ARALYDRAFT_484589 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51678.1| hypothetical protein ARALYDRAFT_484589 [Arabidopsis lyrata subsp. 
lyrata]
Length=1014

 Score =   635 bits (1637),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/548 (65%), Positives = 440/548 (80%), Gaps = 16/548 (3%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             SALIG +P DICES SL ILQLDGNSLTG+IP  IGNCSSL LLSLSHNNL+G IP++LS
Sbjct  471   SALIGSVPADICESQSLQILQLDGNSLTGSIPEGIGNCSSLKLLSLSHNNLTGPIPKSLS  530

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGN  1463
              L+ LKILKLE N+LSGEIP++LG+L+NLL VNVS+NRL GRLP G +FQ+LD SAI+GN
Sbjct  531   NLQELKILKLEANKLSGEIPKELGELQNLLLVNVSFNRLIGRLPVGGVFQSLDQSAIQGN  590

Query  1462  DGICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHR-FLsvsa  1286
              GICSPLL GPC +N PKP+VI+P  YG+  +           +S     HHR FLSVS 
Sbjct  591   LGICSPLLRGPCTLNVPKPLVIDPNSYGHGNNMPGNRG-----SSGSGKFHHRMFLSVSV  645

Query  1285  ivaisaaaiiavgvmvITMVNASVRRRISFVENALESMCSSTSSRSQGMATGKLILFD-T  1109
             IVAISAA +I  GV++IT++NASVRRR++FV+NALES+ S +S   + +  GKL+L +  
Sbjct  646   IVAISAAILIFSGVIIITLLNASVRRRLAFVDNALESIFSGSSKSGRSLMMGKLVLLNSR  705

Query  1108  KSSPDWASSTFE----SVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYP  941
              S    +S  FE    S+LNKAS IGEGVFGTVYKAPLG +G R +A+KKL  S ILQ  
Sbjct  706   TSRSSSSSQEFERNPDSLLNKASRIGEGVFGTVYKAPLGEQG-RNLAVKKLVPSPILQNL  764

Query  940   EDFDREVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLT  761
             EDFDREVR+L KA+H NLV ++GY+WTP+L LLVS+++P GNL+SKLHE     +TPPL+
Sbjct  765   EDFDREVRILAKAKHPNLVSIKGYFWTPELHLLVSEYIPNGNLQSKLHE--REPSTPPLS  822

Query  760   WAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDR  581
             W VR++IILGTAKGLA+LHH+ +P  IH+N+KP+NILLDE  NPKISDFGL+RL+   D 
Sbjct  823   WDVRYRIILGTAKGLAYLHHTFRPATIHFNLKPTNILLDEKNNPKISDFGLSRLLTTQDG  882

Query  580   HVM-SNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILN  404
             + M +NRFQ A+GYVAPEL CQ+LRVNEKCDVYGFG+LILE+VTGRRPVEYGED+ +IL+
Sbjct  883   NTMNNNRFQNALGYVAPELECQNLRVNEKCDVYGFGVLILELVTGRRPVEYGEDSFVILS  942

Query  403   DHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVI  227
             DHVRV+LEQGNVLEC+D  M   Y ++EVLPVLKLALVCTSQIPS+RP+MAE+VQILQVI
Sbjct  943   DHVRVMLEQGNVLECIDPVMEEQYSEDEVLPVLKLALVCTSQIPSNRPTMAEIVQILQVI  1002

Query  226   KTPVPNRM  203
              +PVP+++
Sbjct  1003  NSPVPHQI  1010


 Score = 60.5 bits (145),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 57/105 (54%), Gaps = 0/105 (0%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             ++L G IP  I    +L  LQL  N  +G++P  IG C  L  + LS N  SG +P TL 
Sbjct  231   NSLSGSIPLGILSLHNLKELQLQRNQFSGSLPSDIGLCPHLNRVDLSFNLFSGELPRTLQ  290

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPA  1508
              L+ L    L  N LSG+ P  +G +  L+ ++ S N LTG LP+
Sbjct  291   KLRSLNHFDLSKNLLSGDFPAWIGDMTGLVHLDFSSNELTGELPS  335


 Score = 53.5 bits (127),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 40/116 (34%), Positives = 58/116 (50%), Gaps = 0/116 (0%)
 Frame = -1

Query  1810  GEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSMLKR  1631
             GE+P  + +  SL    L  N L+G  P  IG+ + L  L  S N L+G +P  +  L+ 
Sbjct  283   GELPRTLQKLRSLNHFDLSKNLLSGDFPAWIGDMTGLVHLDFSSNELTGELPSLIGNLRS  342

Query  1630  LKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGN  1463
             LK L L  N++SGEIP+ L   + L+ V +  N  +G +P G     L      GN
Sbjct  343   LKDLILSENKISGEIPESLESCQELMIVQLKGNGFSGSIPDGLFDLGLQEMDFSGN  398


 Score = 53.5 bits (127),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 46/105 (44%), Positives = 58/105 (55%), Gaps = 1/105 (1%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQI-GNCssltllslshnnlSGTIPETLSM  1640
             L G+IP  +    SL  L L GNS +GT+      NCSSL  LSLSHN+L G IP TL  
Sbjct  136   LSGQIPSSLGSISSLQHLDLTGNSFSGTLSDDFFNNCSSLRYLSLSHNHLEGQIPSTLFQ  195

Query  1639  LKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAG  1505
                L  L L  N+ SG       +LE L A+++S N L+G +P G
Sbjct  196   CSVLNSLNLSRNRFSGSFVSGFWRLERLRALDLSSNSLSGSIPLG  240



>ref|XP_009415955.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Musa acuminata subsp. malaccensis]
Length=1020

 Score =   633 bits (1632),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/540 (64%), Positives = 432/540 (80%), Gaps = 15/540 (3%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             SAL G IP D+CESGSL +LQLDGNSLTG IP +IGNCSSL LLSLSHN+L+G+IP +LS
Sbjct  492   SALYGSIPGDLCESGSLSVLQLDGNSLTGPIPEEIGNCSSLYLLSLSHNSLNGSIPASLS  551

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGN  1463
              LK L+IL LE N LSGEIP+QLG L+NLLAVN+S+N+L GRLP G IFQ+LDSSA++GN
Sbjct  552   QLKNLEILNLEFNNLSGEIPEQLGGLDNLLAVNISHNQLIGRLPMGGIFQSLDSSALQGN  611

Query  1462  DGICSPLLTGPCKMNAPKPIVINPFVY--GNQTdnnnggdnNEPLASTRNSRHHRFLsvs  1289
              G+C+PL+  PCK++ PKP+V++P  Y  GN        +   P+      RH RFLSVS
Sbjct  612   LGLCTPLVMEPCKLDVPKPLVLDPDAYARGNGNGVPAVTNPAMPM------RHRRFLSVS  665

Query  1288  aivaisaaaiiavgvmvITMVNASVRRRISFVENALESMCSSTSSRSQGMATGKLILFDT  1109
             AIVAISAA +I +GVM +T++N S RRR   +ENALE +CSS S+RS G   G +++F  
Sbjct  666   AIVAISAAVVIFLGVMAVTLLNMSARRRAGLMENALERVCSS-STRSGGSDLGTMVVFGP  724

Query  1108  KSS--PDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPED  935
              S+  P+  +   E++L KA+++G GVFGTVY+A +G E  RV AIKKL+++ I+Q+ ED
Sbjct  725   GSNLRPEDLAIGTEALLAKATKLGRGVFGTVYRASVGEE--RVFAIKKLSTANIVQHQED  782

Query  934   FDREVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWA  755
             FDREV+ LGK RH NL+ L GYYWTP+LQLL+SD+   G+L S+LH+   +  TPPL W 
Sbjct  783   FDREVQRLGKVRHPNLMQLEGYYWTPELQLLISDYAHHGSLHSRLHKRTES--TPPLPWR  840

Query  754   VRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHV  575
              RFKI LGTAKGLAHLH S +PPIIHYN+KP+NILLDEN +PKISDFGLARL+ KLD+H+
Sbjct  841   DRFKIALGTAKGLAHLHQSVRPPIIHYNLKPTNILLDENCDPKISDFGLARLLQKLDKHI  900

Query  574   MSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHV  395
             +S+RFQ+A+GY+APELACQSLRVNEKCDVYG+G+LI E+VTG++PVEYG+D+V+IL DHV
Sbjct  901   ISSRFQSAMGYMAPELACQSLRVNEKCDVYGYGVLIAELVTGKKPVEYGDDDVVILIDHV  960

Query  394   RVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPV  215
             R LLEQG VL+CVD  MG +P+EEVLPVLKL LVCTSQIPS+RPSMAEVVQILQVIK P+
Sbjct  961   RALLEQGRVLDCVDSSMGEFPEEEVLPVLKLGLVCTSQIPSTRPSMAEVVQILQVIKAPL  1020


 Score = 69.3 bits (168),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 43/101 (43%), Positives = 62/101 (61%), Gaps = 0/101 (0%)
 Frame = -1

Query  1810  GEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSMLKR  1631
             G +P+ I     L  LQL+GN  +GTIP  +G C  L++L LS+N+  G +P ++  L  
Sbjct  256   GPVPDGIANLHRLRNLQLNGNRFSGTIPAGVGLCRHLSILDLSYNSFEGALPSSMRYLGS  315

Query  1630  LKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPA  1508
             L  LKL  NQLSG++P  +G L  +  V++S N+L G LPA
Sbjct  316   LTSLKLSDNQLSGDVPAWIGNLTTIQQVDLSNNKLAGNLPA  356


 Score = 54.7 bits (130),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 42/117 (36%), Positives = 63/117 (54%), Gaps = 3/117 (3%)
 Frame = -1

Query  1810  GEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSMLKR  1631
             G +P  +   GSL  L+L  N L+G +P  IGN +++  + LS+N L+G +P +L  LK 
Sbjct  304   GALPSSMRYLGSLTSLKLSDNQLSGDVPAWIGNLTTIQQVDLSNNKLAGNLPASLGGLKE  363

Query  1630  LKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSI---FQNLDSSAIE  1469
             +  L L  N L+G IP  +     L  +++  NRL G +P G      Q LD S+ E
Sbjct  364   VNYLSLSNNLLTGAIPDTVAGCTKLSELHLKGNRLNGSVPLGLFDLGLQVLDLSSNE  420



>gb|KFK33718.1| hypothetical protein AALP_AA5G051000 [Arabis alpina]
Length=1018

 Score =   632 bits (1629),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/550 (65%), Positives = 448/550 (81%), Gaps = 17/550 (3%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             SALIG IP DICES SL ILQLDGNSLTG+IP  IGNCSSL LLSLSHNN++G IP++LS
Sbjct  472   SALIGSIPADICESQSLQILQLDGNSLTGSIPEGIGNCSSLKLLSLSHNNITGPIPKSLS  531

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGN  1463
              L++LKILKLEVN+LSGEIP++LG+L+NLL VN+S+NRL GRLP G +FQ+LD SA++GN
Sbjct  532   NLEQLKILKLEVNKLSGEIPKELGELQNLLLVNISFNRLIGRLPDGGVFQSLDQSALQGN  591

Query  1462  DGICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHR--FLsvs  1289
              GICSPLL GPC +N PKP+VINP  YGN  +N     N    AS  + + HR  FLSVS
Sbjct  592   LGICSPLLRGPCTLNVPKPLVINPNSYGNGNNNEGTNGNR---ASNSSGKSHRGMFLSVS  648

Query  1288  aivaisaaaiiavgvmvITMVNASVRRRISFVENALESMCSSTSSRSQGMATGKLILFD-  1112
              IVAISAA +I  GV+VIT++NA+VRRR++FV+NALES+ S +S   + +  GKL+L + 
Sbjct  649   VIVAISAAILIFSGVVVITLLNATVRRRLAFVDNALESIFSGSSKSGRSLVMGKLVLLNS  708

Query  1111  -----TKSSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQ  947
                  + SS ++A +  ES+LNKAS IGEGVFGTVYKAPLG +G R +A+KKL  S IL+
Sbjct  709   RSSRSSSSSQEFARNP-ESLLNKASRIGEGVFGTVYKAPLGDQG-RNLAVKKLVPSPILE  766

Query  946   YPEDFDREVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPP  767
               EDFDRE+R+L KA+H NLV ++GYYWTP++QLLVS+++P GNL+SKLHE     +TP 
Sbjct  767   NLEDFDREIRILAKAKHANLVSIKGYYWTPEMQLLVSEYIPNGNLQSKLHE--REPSTPA  824

Query  766   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKL  587
             L+W  R++IILGTAKGLA+LHH+ +PP +H+N+KP+NILLDE  NPKISDFGL+RL+   
Sbjct  825   LSWDARYRIILGTAKGLAYLHHTFRPPTVHFNLKPTNILLDEKYNPKISDFGLSRLLTTQ  884

Query  586   DRHVM-SNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLI  410
             D + M +NRFQ A+GYVAPEL CQ+LRVNEKCDVYGFG+LILE+VTGRRPVEYGED+ +I
Sbjct  885   DGNTMNNNRFQNALGYVAPELECQNLRVNEKCDVYGFGVLILELVTGRRPVEYGEDSFVI  944

Query  409   LNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQ  233
             L+DHVRV+LEQGNVLEC+D  M   Y ++EVLPVLKLALVCTSQIPS+RP+MAE+VQILQ
Sbjct  945   LSDHVRVMLEQGNVLECIDPVMEQEYSEDEVLPVLKLALVCTSQIPSNRPTMAEIVQILQ  1004

Query  232   VIKTPVPNRM  203
             VI +PVP+RM
Sbjct  1005  VINSPVPHRM  1014


 Score = 63.5 bits (153),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 44/105 (42%), Positives = 57/105 (54%), Gaps = 0/105 (0%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             +AL G IP  I    +L  L L GN  +G++P  IG C  L  + LS N  SG +P TL 
Sbjct  232   NALSGSIPLGILSLHNLKELHLQGNQFSGSLPSDIGLCPHLNRVDLSFNRFSGELPRTLQ  291

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPA  1508
              L  L    L  N LSGE P  +G L  L+ ++ S N LTG+LP+
Sbjct  292   KLSSLTHFDLSNNLLSGEFPAWIGDLNGLVHLDFSSNGLTGKLPS  336


 Score = 55.5 bits (132),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 48/112 (43%), Positives = 64/112 (57%), Gaps = 3/112 (3%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L GE P  I +   L  L    N LTG +P  +GN  SL  L LS NN+SG IPE+L   
Sbjct  306   LSGEFPAWIGDLNGLVHLDFSSNGLTGKLPSSVGNLRSLKDLILSKNNISGEIPESLESC  365

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGS--IFQNL  1487
             K L+I++L+ N  +G IP  L  L  L  ++ S N LTG +P GS  +F++L
Sbjct  366   KELEIIQLKGNGFTGSIPDGLFDL-GLQEMDFSGNGLTGLIPRGSSRLFESL  416



>gb|EPS70115.1| hypothetical protein M569_04636, partial [Genlisea aurea]
Length=976

 Score =   630 bits (1625),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/552 (62%), Positives = 422/552 (76%), Gaps = 31/552 (6%)
 Frame = -1

Query  1819  ALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSM  1640
                G IP DIC+SGSL ILQLDGNSLTG IP +IGNCSSL  L LS+NNLSGTIPE+LS 
Sbjct  446   GFTGSIPGDICDSGSLNILQLDGNSLTGAIPDEIGNCSSLHQLGLSNNNLSGTIPESLSR  505

Query  1639  LKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGND  1460
             L +L++L+LE+NQLSGEIPQ+L  LENL   NVS+N+L GRLP G IFQ+LD+SAIEGN 
Sbjct  506   LSKLEVLELEMNQLSGEIPQRLADLENLRIANVSHNQLIGRLPPGGIFQSLDASAIEGNL  565

Query  1459  GICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRFLsvsaiv  1280
             GICSPL+ GPCK+N PKP+V++P+ YG++               +RN+ H R  S S   
Sbjct  566   GICSPLIEGPCKLNVPKPLVLDPYSYGSEM-------------GSRNN-HFRHSSASHSF  611

Query  1279  aisaaaiiavgvm-------vITMVNASVRRRISFVENALESMCSSTSSRSQGMATGKLI  1121
               ++A +             V+T++NASVRR++SFV+N LESMCSS+++    +  GKL 
Sbjct  612   FSASAIVAIAAAAFIAVGIIVVTLLNASVRRQLSFVDNTLESMCSSSAN----LTPGKLT  667

Query  1120  LFDTKSSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKL-TSSKILQY  944
              FD+KSS D+ ++T ESVLNK++EIG GVFGTVYKA +G +G R++AIKKL  S++ L +
Sbjct  668   FFDSKSSLDFLNTTLESVLNKSTEIGGGVFGTVYKASIGRQG-RLLAIKKLVASTQTLVF  726

Query  943   PEDFDREVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPL  764
              E+FDRE+R L KA+H NL PLRGYYWT  LQLLVS++   GNLE+KLH+ + +  +  L
Sbjct  727   QEEFDREIRGLAKAKHPNLNPLRGYYWTSGLQLLVSEYAVGGNLETKLHDPSSS--SHEL  784

Query  763   TWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLD  584
             +W  R  I+ G AKG+AHLHH  QPPIIHYNIKP+NILLDE LNPKISDFGLARL+ K D
Sbjct  785   SWQNRLNIVNGIAKGIAHLHHDFQPPIIHYNIKPTNILLDEKLNPKISDFGLARLLGKFD  844

Query  583   RHVM--SNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLI  410
               ++  SNR QA  GY APEL C+SLRVNEKCDVYGFG+LILE+VTG++PVE+GE NV+I
Sbjct  845   SKLLDRSNRSQAESGYAAPELTCRSLRVNEKCDVYGFGVLILELVTGKKPVEHGEGNVVI  904

Query  409   LNDHVRVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  230
             L+D VR LLEQGN+  CVD+ MG YP+EEVLPV+KLALVCTSQIPSSRPSMAEVVQILQV
Sbjct  905   LSDRVRELLEQGNISRCVDKRMGPYPEEEVLPVIKLALVCTSQIPSSRPSMAEVVQILQV  964

Query  229   IKTPVPNRMEPY  194
             IK P+PNRM  +
Sbjct  965   IKAPLPNRMTAF  976


 Score = 58.9 bits (141),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 46/103 (45%), Positives = 57/103 (55%), Gaps = 1/103 (1%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G IP  I    SL  L L GN  +G +P  IG C  LT L LS N  +GTIPE+L  L
Sbjct  203   LSGSIPGGISVVRSLKQLSLHGNQFSGPLPEDIGFCPHLTHLDLSKNQFTGTIPESLQNL  262

Query  1636  -KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP  1511
                L+ L L  N L+G+ P  +  +  L  ++VS NRLTG LP
Sbjct  263   TTTLQHLDLSNNFLTGDFPHWIHHISALQRIDVSNNRLTGSLP  305



>ref|XP_009151898.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Brassica rapa]
 emb|CDX86452.1| BnaA06g31690D [Brassica napus]
Length=1011

 Score =   631 bits (1627),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/550 (65%), Positives = 443/550 (81%), Gaps = 21/550 (4%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             SALIG +P DICE+ SL ILQLDGNSLTG+IP  IGNCSSL LLSLSHNNLSG IP++LS
Sbjct  469   SALIGSVPADICEAQSLQILQLDGNSLTGSIPEGIGNCSSLKLLSLSHNNLSGPIPKSLS  528

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGN  1463
              L+ LKILKLE N+LSGEIP++LGKL+NLL VN+S+NRL GRLP+G +FQ+LD S+++GN
Sbjct  529   NLEELKILKLEANKLSGEIPKELGKLQNLLLVNISFNRLIGRLPSGGVFQSLDQSSLQGN  588

Query  1462  DGICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHH--RFLsvs  1289
              GICSPLL GPC +N PKP+VI+P  Y N         +NE  +  R S+ H   FLSVS
Sbjct  589   LGICSPLLRGPCTLNVPKPLVIDPNSYRNGN-------SNEEASGNRPSKFHGGMFLSVS  641

Query  1288  aivaisaaaiiavgvmvITMVNASVRRRISFVENALESMCSSTSSRSQGMATGKLILFD-  1112
              IVAISAA +I  GV++IT++NASVRRR++FV+ ALES+ S +S   + +  GKL+L + 
Sbjct  642   VIVAISAAILIVSGVIIITLLNASVRRRLAFVDTALESIFSGSSRSGRSLEAGKLVLLNS  701

Query  1111  -----TKSSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQ  947
                  + SS ++A +  ESVLNKAS IGEGVFGTVYKAPLG +G R +A+KKL  S I++
Sbjct  702   RTSRSSSSSQEFARNP-ESVLNKASRIGEGVFGTVYKAPLGDQG-RNLAVKKLVPSPIIE  759

Query  946   YPEDFDREVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPP  767
               EDFDREVR+L KA+H NLV ++GYYWTP++QLLVS+++P GNL+SKLHE     +TPP
Sbjct  760   NLEDFDREVRILAKAKHPNLVSMKGYYWTPEMQLLVSEYIPNGNLQSKLHE--REPSTPP  817

Query  766   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKL  587
             L W  R++IILGTAKGLA+LHH+ +P  +H+N+KP+NILLDE  NPKISDFGLARL+   
Sbjct  818   LPWDARYRIILGTAKGLAYLHHTFRPATVHFNLKPTNILLDEKYNPKISDFGLARLLTTQ  877

Query  586   DRHVM-SNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLI  410
             D + M +NRFQ A+GYVAPEL CQ+LRVNEKCDVYGFG+LILE+VTGRRPVEYGED+ +I
Sbjct  878   DGNTMNTNRFQNALGYVAPELECQNLRVNEKCDVYGFGVLILELVTGRRPVEYGEDSFVI  937

Query  409   LNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQ  233
             L+DHVRVLLEQGNVLEC+D  M   Y ++EVLPVLKLALVCTSQIPS+RP+MAE+VQILQ
Sbjct  938   LSDHVRVLLEQGNVLECIDPTMEEEYSEDEVLPVLKLALVCTSQIPSNRPTMAEIVQILQ  997

Query  232   VIKTPVPNRM  203
             VI +PVP+R+
Sbjct  998   VISSPVPHRI  1007


 Score = 65.5 bits (158),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 44/105 (42%), Positives = 59/105 (56%), Gaps = 0/105 (0%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             +AL G IP  +    +L +L L GN   G++P  IG C  L  + LS N  SG IP TL 
Sbjct  229   NALSGSIPLGMLYVHNLKVLHLQGNQFYGSLPSDIGLCPHLNRVDLSFNRFSGEIPTTLQ  288

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPA  1508
              L+ L  L L  N LSG  P  +G +  L+ ++VS N LTG+LP+
Sbjct  289   RLRYLNHLDLSKNMLSGGFPVWIGDMTGLVHLDVSSNMLTGKLPS  333


 Score = 58.5 bits (140),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 44/116 (38%), Positives = 60/116 (52%), Gaps = 0/116 (0%)
 Frame = -1

Query  1810  GEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSMLKR  1631
             GEIP  +     L  L L  N L+G  P  IG+ + L  L +S N L+G +P ++S L+ 
Sbjct  281   GEIPTTLQRLRYLNHLDLSKNMLSGGFPVWIGDMTGLVHLDVSSNMLTGKLPSSISNLRS  340

Query  1630  LKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGN  1463
             LK L L  N+LSGEIP+ L   + L+ V +  N  TG +P G     L      GN
Sbjct  341   LKALILSDNKLSGEIPESLESCKELMVVQLKGNGFTGSIPDGLFDLGLQEMDFSGN  396



>emb|CDY20032.1| BnaA09g02190D [Brassica napus]
Length=1014

 Score =   622 bits (1603),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/549 (63%), Positives = 441/549 (80%), Gaps = 16/549 (3%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             +ALIG +P DICE  SL ILQLDGNSLTG+IP  IGNCSSL LLSLSHNNL+G IP++LS
Sbjct  469   NALIGSVPADICEPQSLEILQLDGNSLTGSIPEGIGNCSSLKLLSLSHNNLTGPIPKSLS  528

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGN  1463
              L++LKILKLE N+LSGEIP++LG L NLL VN+S+NRL GRLP G +FQ LD SA++GN
Sbjct  529   KLQQLKILKLEANKLSGEIPKELGGLHNLLLVNISFNRLIGRLPNGGVFQRLDQSALQGN  588

Query  1462  DGICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHR--FLsvs  1289
              GICSPLL GPC+MN  KPIVI+P  YGN+ +N     N     S  +S++H   FLSVS
Sbjct  589   LGICSPLLRGPCRMNVSKPIVIDPNSYGNRNNNEGRHGNR---TSNGSSKYHNGMFLSVS  645

Query  1288  aivaisaaaiiavgvmvITMVNASVRRRISFVENALESMCSSTSSRSQGMATGKLILFDT  1109
              +VAISAA +I +GV+++T++NASVRR+++FV+NAL+S+ S +S   + +  GKL++ ++
Sbjct  646   VVVAISAAILIFLGVIIVTLLNASVRRKLAFVDNALDSIFSGSSRSGRSLVAGKLVMLNS  705

Query  1108  KSS------PDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQ  947
             ++S       ++A +  ES LNKAS IGEGVFGTVYKAPLG +GS + A+KKL  S I++
Sbjct  706   RTSRSSSSSQEFARNP-ESHLNKASRIGEGVFGTVYKAPLGEQGSNL-AVKKLVLSPIIE  763

Query  946   YPEDFDREVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPP  767
               EDFDREVR+L KA+H NLV ++GYYWTP+ QLLVS+++P GNL+SKLH       TPP
Sbjct  764   NLEDFDREVRILAKAKHPNLVLIKGYYWTPETQLLVSEYIPNGNLQSKLH--GREPLTPP  821

Query  766   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKL  587
             L+W  R++IILGTAKGLA+LHH+C+P  IH+N+KPSNILLDE  NPKISDFGL+RLV + 
Sbjct  822   LSWDARYRIILGTAKGLAYLHHTCRPTTIHFNLKPSNILLDEKYNPKISDFGLSRLVTQD  881

Query  586   DRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLIL  407
                + +NRFQ A+GY+APEL CQ+LRVNEKCDVYGFG+LILE+VTGRRPVEYGED  +IL
Sbjct  882   GNTMNNNRFQNALGYMAPELECQNLRVNEKCDVYGFGVLILELVTGRRPVEYGEDIFVIL  941

Query  406   NDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  230
             +DHVR++LEQGNVLEC+D  M   Y ++EVLPV+KLALVCTSQIPS+RP+MAE+VQILQV
Sbjct  942   SDHVRIMLEQGNVLECIDPTMEDEYSEDEVLPVVKLALVCTSQIPSNRPTMAEIVQILQV  1001

Query  229   IKTPVPNRM  203
             I +PVP+RM
Sbjct  1002  ITSPVPHRM  1010


 Score = 64.7 bits (156),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 44/105 (42%), Positives = 59/105 (56%), Gaps = 0/105 (0%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             +AL G +P  I    SL +LQL GN  +G +P  IG C  L  + LS N  SG +P TL 
Sbjct  229   NALSGTLPLGILSLHSLKVLQLQGNRFSGPLPSDIGLCPHLNRVDLSFNRFSGEVPATLQ  288

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPA  1508
              L+ L  L L  N LSG  P  +G +  L+ ++VS N LTG +P+
Sbjct  289   RLRSLNHLDLSKNLLSGGFPVWIGDMTGLVHLDVSRNELTGAIPS  333


 Score = 57.4 bits (137),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 62/116 (53%), Gaps = 0/116 (0%)
 Frame = -1

Query  1810  GEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSMLKR  1631
             GE+P  +    SL  L L  N L+G  P  IG+ + L  L +S N L+G IP ++  L+ 
Sbjct  281   GEVPATLQRLRSLNHLDLSKNLLSGGFPVWIGDMTGLVHLDVSRNELTGAIPSSVGSLRS  340

Query  1630  LKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGN  1463
             LK++ L  N+LSGEIP+ L   + L++V +  N + G +P G     L      GN
Sbjct  341   LKVIILSENKLSGEIPESLESCKELVSVQLKGNGIVGSIPDGLFNLGLQEIDFSGN  396



>ref|XP_009111587.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Brassica rapa]
Length=1014

 Score =   621 bits (1602),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/549 (63%), Positives = 441/549 (80%), Gaps = 16/549 (3%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             +ALIG +P DICE  SL ILQLDGNSLTG+IP  IGNCSSL LLSLSHNNL+G IP++LS
Sbjct  469   NALIGSVPADICEPQSLEILQLDGNSLTGSIPEGIGNCSSLKLLSLSHNNLTGPIPKSLS  528

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGN  1463
              L++LKILKLE N+LSGEIP++LG L NLL VN+S+NRL GRLP G +FQ LD SA++GN
Sbjct  529   KLQQLKILKLEANKLSGEIPKELGGLHNLLLVNISFNRLIGRLPNGGVFQRLDQSALQGN  588

Query  1462  DGICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHR--FLsvs  1289
              GICSPLL GPC+MN  KPIVI+P  YGN+ +N     N     S  +S++H   FLSVS
Sbjct  589   LGICSPLLRGPCRMNVSKPIVIDPNSYGNRNNNEGRHGNR---TSNGSSKYHNGMFLSVS  645

Query  1288  aivaisaaaiiavgvmvITMVNASVRRRISFVENALESMCSSTSSRSQGMATGKLILFDT  1109
              +VAISAA +I +GV+++T++NASVRR+++FV+NAL+S+ S +S   + +  GKL++ ++
Sbjct  646   VVVAISAAILIFLGVIIVTLLNASVRRKLAFVDNALDSIFSGSSRSGRSLVAGKLVMLNS  705

Query  1108  KSS------PDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQ  947
             ++S       ++A +  ES LNKAS IGEGVFGTVYKAPLG +GS + A+KKL  S I++
Sbjct  706   RTSWSSSSSQEFARNP-ESHLNKASRIGEGVFGTVYKAPLGEQGSNL-AVKKLVLSPIIE  763

Query  946   YPEDFDREVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPP  767
               EDFDREVR+L KA+H NLV ++GYYWTP+ QLLVS+++P GNL SKLH      +TPP
Sbjct  764   NLEDFDREVRILAKAKHPNLVLIKGYYWTPETQLLVSEYIPNGNLHSKLH--GREPSTPP  821

Query  766   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKL  587
             L+W  R++IILGTAKGLA+LHH+C+P  IH+N+KPSNILLDE  NPKISDFGL+RLV + 
Sbjct  822   LSWDARYRIILGTAKGLAYLHHTCRPTTIHFNLKPSNILLDEKYNPKISDFGLSRLVTQD  881

Query  586   DRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLIL  407
                + +NRFQ A+GY+APEL CQ+LRVNEKCDVYGFG+LILE+VTGRRPVEYGED  +IL
Sbjct  882   GNTMNNNRFQNALGYMAPELECQNLRVNEKCDVYGFGVLILELVTGRRPVEYGEDIFVIL  941

Query  406   NDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  230
             +DHVR++LEQGNVLEC+D  M   Y ++EVLPV+KLALVCTSQIPS+RP+MAE+VQILQV
Sbjct  942   SDHVRIMLEQGNVLECIDPTMEDEYSEDEVLPVVKLALVCTSQIPSNRPTMAEIVQILQV  1001

Query  229   IKTPVPNRM  203
             I +PVP+RM
Sbjct  1002  ITSPVPHRM  1010


 Score = 63.2 bits (152),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 43/105 (41%), Positives = 57/105 (54%), Gaps = 0/105 (0%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             +AL G +P  I    SL +LQL GN  +G +P  IG C  L  + LS N   G +P TL 
Sbjct  229   NALSGTLPLGILSLHSLKVLQLQGNRFSGPLPSDIGLCPHLNTVDLSFNRFYGEVPTTLQ  288

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPA  1508
              LK L  L L  N LS   P  +G +  L+ ++VS N LTG +P+
Sbjct  289   RLKSLNHLDLSKNFLSSGFPVWIGDMTGLVHLDVSRNELTGAIPS  333


 Score = 56.2 bits (134),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 44/130 (34%), Positives = 67/130 (52%), Gaps = 1/130 (1%)
 Frame = -1

Query  1810  GEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSMLKR  1631
             GE+P  +    SL  L L  N L+   P  IG+ + L  L +S N L+G IP ++  L+ 
Sbjct  281   GEVPTTLQRLKSLNHLDLSKNFLSSGFPVWIGDMTGLVHLDVSRNELTGAIPSSVGSLRS  340

Query  1630  LKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDGIC  1451
             LK++ L  N+LSGEIP+ L   + L++V +  N   G +P G     L      GN G+ 
Sbjct  341   LKVIILSENKLSGEIPESLESCKELVSVQLKGNGFVGSIPDGLFNLGLQEIDFSGN-GLT  399

Query  1450  SPLLTGPCKM  1421
             S +  G  ++
Sbjct  400   SSIPRGSSRL  409



>ref|XP_006395381.1| hypothetical protein EUTSA_v10003580mg [Eutrema salsugineum]
 gb|ESQ32667.1| hypothetical protein EUTSA_v10003580mg [Eutrema salsugineum]
Length=1018

 Score =   619 bits (1595),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/550 (64%), Positives = 440/550 (80%), Gaps = 17/550 (3%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             SALIG +P DIC S SL ILQLDGNSLTG+IP  IGNCSSL LLSLSHNNL+G IP +LS
Sbjct  472   SALIGSVPADICASQSLQILQLDGNSLTGSIPEGIGNCSSLKLLSLSHNNLTGPIPRSLS  531

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGN  1463
              L++LKILKLEVN+LSGEIP++LG L+NLL VN+S+NR+ GRLP G +FQ+LD SA++GN
Sbjct  532   NLQQLKILKLEVNKLSGEIPKELGDLQNLLLVNISFNRIIGRLPLGGVFQSLDQSALQGN  591

Query  1462  DGICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHR--FLsvs  1289
              GICSPLL GPC +N PKP+VI+P  YG   +N     N E   S  + + HR  FLSVS
Sbjct  592   LGICSPLLRGPCTLNVPKPLVIDPNSYGKGNNNEGMPTNQE---SNGSRKFHRGMFLSVS  648

Query  1288  aivaisaaaiiavgvmvITMVNASVRRRISFVENALESMCSSTSSRSQGMATGKLILFD-  1112
              IVAISAA +I  GV++IT++NASVRRR++FV+NALES+ S +S   + +  GKL+L + 
Sbjct  649   VIVAISAAILIFSGVIIITLLNASVRRRLAFVDNALESIFSGSSRSGRSLVAGKLVLLNS  708

Query  1111  -----TKSSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQ  947
                  + SS ++A +  ES+LNKAS IGEGVFGTVYKAPLG +G R +A+KKL  S I+Q
Sbjct  709   RSSRSSSSSQEFARNP-ESLLNKASRIGEGVFGTVYKAPLGEQG-RNLAVKKLVPSPIIQ  766

Query  946   YPEDFDREVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPP  767
               EDFDREVR+L KA+H NLV ++GY WTP++QLLVS+++P GNL+SKLHE     +TPP
Sbjct  767   NLEDFDREVRILAKAKHPNLVLIKGYLWTPEMQLLVSEYIPNGNLQSKLHE--REPSTPP  824

Query  766   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKL  587
             L+W  R++IILG AKGL +LHH+ +P  +H+N+KP+NILLDE  NPKISDFGL+RL+   
Sbjct  825   LSWDARYRIILGLAKGLEYLHHTLRPTTVHFNLKPTNILLDEKYNPKISDFGLSRLLTTQ  884

Query  586   DRHVM-SNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLI  410
             D + M +NRFQ A+GYVAPEL CQ+LR NEKCDVYGFG+LILE+VTGRRPVEYGED+ +I
Sbjct  885   DGNTMNNNRFQNALGYVAPELECQNLRANEKCDVYGFGVLILELVTGRRPVEYGEDSFVI  944

Query  409   LNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQ  233
             L+DHVRVLLEQGNVLEC+D  M   Y ++EVLPVLKLALVCTSQIPS+RP+MAE+V+ILQ
Sbjct  945   LSDHVRVLLEQGNVLECIDPVMEEEYSEDEVLPVLKLALVCTSQIPSNRPTMAEIVKILQ  1004

Query  232   VIKTPVPNRM  203
             +I +PVP+RM
Sbjct  1005  IINSPVPHRM  1014


 Score = 65.5 bits (158),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 44/105 (42%), Positives = 58/105 (55%), Gaps = 0/105 (0%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             + L G IP  I    +L  LQL GN  +G++P  IG C  L  + LS N  SG  P TL 
Sbjct  232   NTLSGSIPLGILSLHNLKELQLQGNQFSGSLPSDIGLCPHLNRVDLSFNRFSGEFPSTLQ  291

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPA  1508
              L+ L  L L  N LSGE P  +G +  L+ ++ S N LTG+LP+
Sbjct  292   KLRSLNHLDLSNNLLSGEFPAWIGDMTGLVHLDFSSNELTGKLPS  336


 Score = 58.2 bits (139),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 50/112 (45%), Positives = 62/112 (55%), Gaps = 3/112 (3%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L GE P  I +   L  L    N LTG +P  IGN  SL  L  S+N LSG IPE+L   
Sbjct  306   LSGEFPAWIGDMTGLVHLDFSSNELTGKLPSSIGNLRSLKDLIFSNNKLSGEIPESLESC  365

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGS--IFQNL  1487
             K L IL+L+ N  SG IP  L  L  L  ++ S N LTG +P GS  +F++L
Sbjct  366   KELMILQLKGNGFSGNIPDGLFDL-GLQEMDFSGNSLTGSVPRGSSRLFESL  416


 Score = 53.9 bits (128),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 40/116 (34%), Positives = 58/116 (50%), Gaps = 0/116 (0%)
 Frame = -1

Query  1810  GEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSMLKR  1631
             GE P  + +  SL  L L  N L+G  P  IG+ + L  L  S N L+G +P ++  L+ 
Sbjct  284   GEFPSTLQKLRSLNHLDLSNNLLSGEFPAWIGDMTGLVHLDFSSNELTGKLPSSIGNLRS  343

Query  1630  LKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGN  1463
             LK L    N+LSGEIP+ L   + L+ + +  N  +G +P G     L      GN
Sbjct  344   LKDLIFSNNKLSGEIPESLESCKELMILQLKGNGFSGNIPDGLFDLGLQEMDFSGN  399



>emb|CDY00141.1| BnaC09g01600D [Brassica napus]
Length=1013

 Score =   613 bits (1580),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/549 (63%), Positives = 435/549 (79%), Gaps = 17/549 (3%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             +ALIG +P DICE  SL ILQLDGNSLTG+IP  IGNC SL LLSLSHNNL+G IP++LS
Sbjct  469   NALIGSVPADICEPQSLEILQLDGNSLTGSIPEGIGNCYSLKLLSLSHNNLTGPIPKSLS  528

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGN  1463
              L+ LKI+ LE N+LSGE+P++LG L NLL VN+S+NRL GRLP G +FQ LD SA++GN
Sbjct  529   NLQELKIVNLEANKLSGEVPKELGGLHNLLLVNISFNRLIGRLPNGGVFQRLDQSALQGN  588

Query  1462  DGICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHR--FLsvs  1289
              GICSPLL GPC MN  KPIVI+P  YGN+ +N     N     S  +S++H   FLSVS
Sbjct  589   LGICSPLLRGPCMMNVSKPIVIDPNSYGNRNNNEGRHGNR---TSNGSSKYHNGMFLSVS  645

Query  1288  aivaisaaaiiavgvmvITMVNASVRRRISFVENALESMCSSTSSRSQGMATGKLILFD-  1112
              +VAISAA +I +GV+++T++NASVRR+++FV+NALES+ S +S   + +  GKL++ + 
Sbjct  646   VVVAISAAILIFLGVIIVTLLNASVRRKLAFVDNALESIFSGSSRSGRSLVAGKLVMLNT  705

Query  1111  -----TKSSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQ  947
                  + SS ++A +  ES LNKAS IGEGVFGTVYKAPLG +GS  +A+KKL  S I++
Sbjct  706   RTSRSSSSSQEFARNP-ESHLNKASRIGEGVFGTVYKAPLGEQGSN-LAVKKLVMSPIIE  763

Query  946   YPEDFDREVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPP  767
               EDFDREVR+L KA+H NLV ++GYYWTP+ QLLVS+++P GNL SKLH      + PP
Sbjct  764   NLEDFDREVRILAKAKHPNLVLIKGYYWTPETQLLVSEYIPNGNLHSKLH--GREPSAPP  821

Query  766   LTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKL  587
             L+W  R++IILGTAKGLA+LHH+C+P  IH+N+KPSNILLDE  N KISDFGL+ LV + 
Sbjct  822   LSWDARYRIILGTAKGLAYLHHTCRPTTIHFNLKPSNILLDEKYNRKISDFGLSCLVTQ-  880

Query  586   DRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLIL  407
             D + M+NRFQ A+GY+APEL CQ+LRVNEKCDVYGFG+LILE+VTGRRPVEYGED+ +IL
Sbjct  881   DGNTMNNRFQNALGYMAPELECQNLRVNEKCDVYGFGVLILELVTGRRPVEYGEDSFVIL  940

Query  406   NDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  230
             +DHVRV+LEQG VLEC+D  M   Y ++EVLPV+KLALVCTSQIPS+RP+MAE+VQILQV
Sbjct  941   SDHVRVMLEQGTVLECIDPTMEDEYSEDEVLPVVKLALVCTSQIPSNRPTMAEIVQILQV  1000

Query  229   IKTPVPNRM  203
             I +PVP+RM
Sbjct  1001  ITSPVPHRM  1009


 Score = 65.1 bits (157),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 44/104 (42%), Positives = 57/104 (55%), Gaps = 0/104 (0%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             +AL G +P  I    SL +LQL GN  +G +P  IG C  L  + LS N  SG +P TL 
Sbjct  229   NALSGTLPLGILSQHSLKVLQLQGNRFSGRLPSDIGLCPHLNRVDLSFNRFSGEVPTTLQ  288

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP  1511
              L+ L  L L  N LSG  P  +G +  L+ ++ S N LTG LP
Sbjct  289   RLRSLNHLDLSKNLLSGGFPVWIGDMTGLVHLDFSRNELTGALP  332


 Score = 55.8 bits (133),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 41/116 (35%), Positives = 60/116 (52%), Gaps = 0/116 (0%)
 Frame = -1

Query  1810  GEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSMLKR  1631
             GE+P  +    SL  L L  N L+G  P  IG+ + L  L  S N L+G +P ++  L+ 
Sbjct  281   GEVPTTLQRLRSLNHLDLSKNLLSGGFPVWIGDMTGLVHLDFSRNELTGALPFSVGTLRS  340

Query  1630  LKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGN  1463
             LK++ L  N+LSGEIP+ L   + L++V +  N   G +P G     L      GN
Sbjct  341   LKVIILSENKLSGEIPESLESCKELVSVQLKGNGFVGSIPEGLFNLGLQEIDFSGN  396



>ref|NP_001045445.1| Os01g0957100 [Oryza sativa Japonica Group]
 dbj|BAF07359.1| Os01g0957100, partial [Oryza sativa Japonica Group]
Length=923

 Score =   605 bits (1560),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/549 (63%), Positives = 430/549 (78%), Gaps = 22/549 (4%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             S L G +P D+CE+GSL +LQLDGNSL G IP  IGNCSSL LLSL HN+L+G IP  +S
Sbjct  374   SGLYGTMPSDLCEAGSLAVLQLDGNSLAGPIPDNIGNCSSLYLLSLGHNSLTGPIPVGMS  433

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGN  1463
              LK+L+IL+LE N LSGEIPQQLG +E+LLAVNVS+NRL GRLPA  +FQ+LD+SA+EGN
Sbjct  434   ELKKLEILRLEYNNLSGEIPQQLGGIESLLAVNVSHNRLVGRLPASGVFQSLDASALEGN  493

Query  1462  DGICSPLLTGPCKMNAPKPIVINP--FVYGNQTdnnnggdnNEPLASTRNSRHHRFLsvs  1289
              GICSPL+T PC+MN  KP+V++P  + +G   DNN       P +     R  RFLSVS
Sbjct  494   LGICSPLVTQPCRMNVAKPLVLDPNEYPHGGDGDNNLETSGRGPASP----RKRRFLSVS  549

Query  1288  aivaisaaaiiavgvmvITMVNASVRRR-----ISFVENALESMCSSTSSRSQGMATGKL  1124
             A+VAI AA  I +GV+VIT++N S RRR      +  E  LES+ SS++  S+ +ATGK+
Sbjct  550   AMVAICAAVFIILGVIVITLLNMSARRRAGDGGTTTPEKELESIVSSSTKSSK-LATGKM  608

Query  1123  ILF---DTKSSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKI  953
             + F   ++  S D+     +++L+KA+EIG GVFGTVY+A +G EG RVVAIKKL ++ I
Sbjct  609   VTFGPGNSLRSEDFVGGA-DALLSKATEIGRGVFGTVYRASVG-EG-RVVAIKKLATASI  665

Query  952   LQYPEDFDREVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMAT  773
             ++  +DFDREVR+LGKARH NL+PL+GYYWTPQLQLL++D+ P G+LE++LH      A 
Sbjct  666   VESRDDFDREVRILGKARHPNLLPLKGYYWTPQLQLLITDYAPHGSLEARLHGNGDG-AF  724

Query  772   PPLTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVA  593
             PPLTWA RF+I+ GTA+GLAHLH S +PP+IHYN+KPSNILLDE  NP + DFGLARL+ 
Sbjct  725   PPLTWAERFRIVAGTARGLAHLHQSFRPPMIHYNVKPSNILLDEQCNPMVGDFGLARLLP  784

Query  592   KLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVL  413
             KLD+HVMS+RFQ  +GYVAPELACQSLR+NEKCD+YGFG+LILE+VTGRR VEYG+D+V+
Sbjct  785   KLDKHVMSSRFQGGMGYVAPELACQSLRINEKCDIYGFGVLILELVTGRRAVEYGDDDVV  844

Query  412   ILNDHVRVLLEQG---NVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQ  242
             IL D VRVLL+ G   NVLECVD  +G +P+EEVLPVLKL +VCTSQIPS+RPSMAEVVQ
Sbjct  845   ILIDQVRVLLDHGGGSNVLECVDPSIGEFPEEEVLPVLKLGMVCTSQIPSNRPSMAEVVQ  904

Query  241   ILQVIKTPV  215
             ILQVIK PV
Sbjct  905   ILQVIKAPV  913


 Score = 59.3 bits (142),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 36/104 (35%), Positives = 58/104 (56%), Gaps = 0/104 (0%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             +A  G++P+ I   GSL      GN  +G +P  +G+ ++L  L  S N L+G +P++L 
Sbjct  182   NAFDGQLPDSIAHLGSLVYFAASGNRFSGDVPAWLGDLAALQHLDFSDNALTGRLPDSLG  241

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP  1511
              LK L+ L +  NQLSG IP  +     L  +++  N L+G +P
Sbjct  242   KLKDLRYLSMSENQLSGAIPDAMSGCTKLAELHLRANNLSGSIP  285


 Score = 54.3 bits (129),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 51/100 (51%), Gaps = 0/100 (0%)
 Frame = -1

Query  1810  GEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSMLKR  1631
             G +   I    +L  + L GN   G +P  IG C  L+ + +S N   G +P++++ L  
Sbjct  138   GTVTTGIANLHNLKTIDLSGNRFFGAVPSDIGLCPHLSTVDISSNAFDGQLPDSIAHLGS  197

Query  1630  LKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP  1511
             L       N+ SG++P  LG L  L  ++ S N LTGRLP
Sbjct  198   LVYFAASGNRFSGDVPAWLGDLAALQHLDFSDNALTGRLP  237



>dbj|BAB92869.1| putative receptor-like protein kinase [Oryza sativa Japonica 
Group]
 gb|EAZ14887.1| hypothetical protein OsJ_04818 [Oryza sativa Japonica Group]
Length=1013

 Score =   605 bits (1560),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/549 (63%), Positives = 430/549 (78%), Gaps = 22/549 (4%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             S L G +P D+CE+GSL +LQLDGNSL G IP  IGNCSSL LLSL HN+L+G IP  +S
Sbjct  464   SGLYGTMPSDLCEAGSLAVLQLDGNSLAGPIPDNIGNCSSLYLLSLGHNSLTGPIPVGMS  523

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGN  1463
              LK+L+IL+LE N LSGEIPQQLG +E+LLAVNVS+NRL GRLPA  +FQ+LD+SA+EGN
Sbjct  524   ELKKLEILRLEYNNLSGEIPQQLGGIESLLAVNVSHNRLVGRLPASGVFQSLDASALEGN  583

Query  1462  DGICSPLLTGPCKMNAPKPIVINP--FVYGNQTdnnnggdnNEPLASTRNSRHHRFLsvs  1289
              GICSPL+T PC+MN  KP+V++P  + +G   DNN       P     + R  RFLSVS
Sbjct  584   LGICSPLVTQPCRMNVAKPLVLDPNEYPHGGDGDNNLETSGRGP----ASPRKRRFLSVS  639

Query  1288  aivaisaaaiiavgvmvITMVNASVRRR-----ISFVENALESMCSSTSSRSQGMATGKL  1124
             A+VAI AA  I +GV+VIT++N S RRR      +  E  LES+ SS++  S+ +ATGK+
Sbjct  640   AMVAICAAVFIILGVIVITLLNMSARRRAGDGGTTTPEKELESIVSSSTKSSK-LATGKM  698

Query  1123  ILF---DTKSSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKI  953
             + F   ++  S D+     +++L+KA+EIG GVFGTVY+A +G EG RVVAIKKL ++ I
Sbjct  699   VTFGPGNSLRSEDFVGGA-DALLSKATEIGRGVFGTVYRASVG-EG-RVVAIKKLATASI  755

Query  952   LQYPEDFDREVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMAT  773
             ++  +DFDREVR+LGKARH NL+PL+GYYWTPQLQLL++D+ P G+LE++LH      A 
Sbjct  756   VESRDDFDREVRILGKARHPNLLPLKGYYWTPQLQLLITDYAPHGSLEARLHGNGDG-AF  814

Query  772   PPLTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVA  593
             PPLTWA RF+I+ GTA+GLAHLH S +PP+IHYN+KPSNILLDE  NP + DFGLARL+ 
Sbjct  815   PPLTWAERFRIVAGTARGLAHLHQSFRPPMIHYNVKPSNILLDEQCNPMVGDFGLARLLP  874

Query  592   KLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVL  413
             KLD+HVMS+RFQ  +GYVAPELACQSLR+NEKCD+YGFG+LILE+VTGRR VEYG+D+V+
Sbjct  875   KLDKHVMSSRFQGGMGYVAPELACQSLRINEKCDIYGFGVLILELVTGRRAVEYGDDDVV  934

Query  412   ILNDHVRVLLEQG---NVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQ  242
             IL D VRVLL+ G   NVLECVD  +G +P+EEVLPVLKL +VCTSQIPS+RPSMAEVVQ
Sbjct  935   ILIDQVRVLLDHGGGSNVLECVDPSIGEFPEEEVLPVLKLGMVCTSQIPSNRPSMAEVVQ  994

Query  241   ILQVIKTPV  215
             ILQVIK PV
Sbjct  995   ILQVIKAPV  1003


 Score = 59.3 bits (142),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 36/104 (35%), Positives = 58/104 (56%), Gaps = 0/104 (0%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             +A  G++P+ I   GSL      GN  +G +P  +G+ ++L  L  S N L+G +P++L 
Sbjct  272   NAFDGQLPDSIAHLGSLVYFAASGNRFSGDVPAWLGDLAALQHLDFSDNALTGRLPDSLG  331

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP  1511
              LK L+ L +  NQLSG IP  +     L  +++  N L+G +P
Sbjct  332   KLKDLRYLSMSENQLSGAIPDAMSGCTKLAELHLRANNLSGSIP  375


 Score = 54.7 bits (130),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 51/100 (51%), Gaps = 0/100 (0%)
 Frame = -1

Query  1810  GEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSMLKR  1631
             G +   I    +L  + L GN   G +P  IG C  L+ + +S N   G +P++++ L  
Sbjct  228   GTVTTGIANLHNLKTIDLSGNRFFGAVPSDIGLCPHLSTVDISSNAFDGQLPDSIAHLGS  287

Query  1630  LKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP  1511
             L       N+ SG++P  LG L  L  ++ S N LTGRLP
Sbjct  288   LVYFAASGNRFSGDVPAWLGDLAALQHLDFSDNALTGRLP  327



>gb|EAY77289.1| hypothetical protein OsI_05265 [Oryza sativa Indica Group]
Length=1013

 Score =   605 bits (1559),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/549 (63%), Positives = 430/549 (78%), Gaps = 22/549 (4%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             S L G +P D+CE+GSL +LQLDGNSL G IP  IGNCSSL LLSL HN+L+G IP  +S
Sbjct  464   SGLYGTMPSDLCEAGSLAVLQLDGNSLAGPIPDNIGNCSSLYLLSLGHNSLTGPIPVGMS  523

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGN  1463
              LK+L+IL+LE N LSGEIPQQLG +E+LLAVNVS+NRL GRLPA  +FQ+LD+SA+EGN
Sbjct  524   ELKKLEILRLEYNNLSGEIPQQLGGIESLLAVNVSHNRLVGRLPASGVFQSLDASALEGN  583

Query  1462  DGICSPLLTGPCKMNAPKPIVINP--FVYGNQTdnnnggdnNEPLASTRNSRHHRFLsvs  1289
              GICSPL+T PC+MN  KP+V++P  + +G   DNN       P     + R  RFLSVS
Sbjct  584   LGICSPLVTQPCRMNVAKPLVLDPNEYPHGGDGDNNLETSGRGP----ASPRKRRFLSVS  639

Query  1288  aivaisaaaiiavgvmvITMVNASVRRR-----ISFVENALESMCSSTSSRSQGMATGKL  1124
             A+VAI AA  I +GV+VIT++N S RRR      +  E  LES+ SS++  S+ +ATGK+
Sbjct  640   AMVAICAAVFIILGVIVITLLNMSARRRAGDGGTTTPEKELESIVSSSTKSSK-LATGKM  698

Query  1123  ILF---DTKSSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKI  953
             + F   ++  S D+     +++L+KA+EIG GVFGTVY+A +G EG RVVAIKKL ++ I
Sbjct  699   VTFGPGNSLRSEDFVGGA-DALLSKATEIGRGVFGTVYRASVG-EG-RVVAIKKLATASI  755

Query  952   LQYPEDFDREVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMAT  773
             ++  +DFDREVR+LGKARH NL+PL+GYYWTPQLQLL++D+ P G+LE++LH      A 
Sbjct  756   VESRDDFDREVRILGKARHPNLLPLKGYYWTPQLQLLITDYAPHGSLEARLHGNGDG-AF  814

Query  772   PPLTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVA  593
             PPLTWA RF+I+ GTA+GLAHLH S +PP+IHYN+KPSNILLDE  NP + DFGLARL+ 
Sbjct  815   PPLTWAERFRIVAGTARGLAHLHQSFRPPMIHYNVKPSNILLDEQCNPMVGDFGLARLLP  874

Query  592   KLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVL  413
             KLD+HVMS+RFQ  +GYVAPELACQSLR+NEKCD+YGFG+LILE+VTGRR VEYG+D+V+
Sbjct  875   KLDKHVMSSRFQGGMGYVAPELACQSLRINEKCDIYGFGVLILELVTGRRAVEYGDDDVV  934

Query  412   ILNDHVRVLLEQG---NVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQ  242
             IL D VRVLL+ G   NVLECVD  +G +P+EEVLPVLKL +VCTSQIPS+RPSMAEVVQ
Sbjct  935   ILIDQVRVLLDHGGGSNVLECVDPTIGEFPEEEVLPVLKLGMVCTSQIPSNRPSMAEVVQ  994

Query  241   ILQVIKTPV  215
             ILQVIK PV
Sbjct  995   ILQVIKAPV  1003


 Score = 59.3 bits (142),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 36/104 (35%), Positives = 58/104 (56%), Gaps = 0/104 (0%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             +A  G++P+ I   GSL      GN  +G +P  +G+ ++L  L  S N L+G +P++L 
Sbjct  272   NAFDGQLPDSIAHLGSLVYFAASGNRFSGDVPAWLGDLAALQHLDFSDNALTGRLPDSLG  331

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP  1511
              LK L+ L +  NQLSG IP  +     L  +++  N L+G +P
Sbjct  332   KLKDLRYLSMSENQLSGAIPDAMSGCTKLAELHLRANNLSGSIP  375


 Score = 54.7 bits (130),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 51/100 (51%), Gaps = 0/100 (0%)
 Frame = -1

Query  1810  GEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSMLKR  1631
             G +   I    +L  + L GN   G +P  IG C  L+ + +S N   G +P++++ L  
Sbjct  228   GTVTTGIANLHNLKTIDLSGNRFFGAVPSDIGLCPHLSTVDISSNAFDGQLPDSIAHLGS  287

Query  1630  LKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP  1511
             L       N+ SG++P  LG L  L  ++ S N LTGRLP
Sbjct  288   LVYFAASGNRFSGDVPAWLGDLAALQHLDFSDNALTGRLP  327



>ref|XP_006646695.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Oryza brachyantha]
Length=975

 Score =   593 bits (1529),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/557 (61%), Positives = 431/557 (77%), Gaps = 26/557 (5%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             S L G +P D+CE+GSL +LQLDGNSL G IP  IGNCSSL LLSL HN+L+G IP  +S
Sbjct  430   SGLYGTMPTDLCEAGSLAVLQLDGNSLAGPIPDNIGNCSSLYLLSLGHNSLTGPIPVGIS  489

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGN  1463
              LK+L+IL+LE N LSGEIPQQLG +E+LLAVN+S+NRL GRLPA  +FQ+LD+SA+EGN
Sbjct  490   ELKKLEILRLEYNNLSGEIPQQLGGIESLLAVNISHNRLIGRLPASGVFQSLDASALEGN  549

Query  1462  DGICSPLLTGPCKMNAPKPIVINP--FVYGNQTdnnnggdnNEPLASTRNSRHHRFLsvs  1289
              GICSPL+T PC+M+ PKP+V++P  + +G   DNN   +   P +     R  RFLSVS
Sbjct  550   LGICSPLVTEPCRMDVPKPLVLDPNEYPHGGDGDNNLETNGRGPASP----RKRRFLSVS  605

Query  1288  aivaisaaaiiavgvmvITMVNASVRRRI--SFVENALESMCSSTSSRSQGMATGKLILF  1115
             A+VAI AA  I +GV+VIT++N S RRR   S  E  LES+ SS++  S+ +ATGK++ F
Sbjct  606   AMVAICAAVFIILGVIVITLLNISARRRSGDSLPEKELESIVSSSTKSSK-LATGKMVTF  664

Query  1114  ---DTKSSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQY  944
                ++  S D+     +++L+KA+EIG G  GTVY+A +G EG RVVAIKKL ++ I+Q 
Sbjct  665   GPGNSLRSEDFVGGA-DALLSKATEIGRGALGTVYRASVG-EG-RVVAIKKLATASIVQS  721

Query  943   PEDFDREVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPL  764
              +DFDREVR+LGKARH NL+PL+GYYWTPQLQLL+SD+ P G++E++LH  A+    PPL
Sbjct  722   RDDFDREVRILGKARHPNLLPLKGYYWTPQLQLLISDYAPHGSVEARLHHGAL----PPL  777

Query  763   TWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLD  584
             TW  RF+++ G A+ LAHLH S +PP+IHYN+KPSNILLDE  NP ++DFGLARL+ KLD
Sbjct  778   TWPERFRVVAGVARALAHLHQSFRPPMIHYNVKPSNILLDEQCNPMVADFGLARLLPKLD  837

Query  583   RHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILN  404
             +H++S+RFQ  +GYVAPELACQSLR+NEKCD+YGFG+L+LE+VTGRR VEY +D+V+IL 
Sbjct  838   KHMISSRFQGGMGYVAPELACQSLRINEKCDIYGFGVLVLELVTGRRAVEYSDDDVVILI  897

Query  403   DHVRVLLEQG--NVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQV  230
             D VRVLL+ G  NVLECVD  +G +P+EEVLPVLKL +VCTSQIPS+RPSM EVVQILQV
Sbjct  898   DQVRVLLDHGGNNVLECVDPALGEFPEEEVLPVLKLGMVCTSQIPSNRPSMVEVVQILQV  957

Query  229   IKTPV-----PNRMEPY  194
             IK PV       RME +
Sbjct  958   IKAPVAASPSATRMEAF  974


 Score = 58.5 bits (140),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 38/104 (37%), Positives = 58/104 (56%), Gaps = 0/104 (0%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             +A  G++P+ I    SL  L   GN  +G +P  +G+ ++L  L  S N L+G +PE+L 
Sbjct  238   NAFDGQLPDSIGHLSSLVHLSASGNRFSGDVPAWLGDLAALQQLDFSDNALTGRLPESLG  297

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP  1511
              LK L+ L L  NQLSG IP  +     L  +++  N L+G +P
Sbjct  298   KLKDLRYLSLSKNQLSGAIPDAMSGCTKLAELHLRANNLSGSIP  341


 Score = 54.7 bits (130),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 51/100 (51%), Gaps = 0/100 (0%)
 Frame = -1

Query  1810  GEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSMLKR  1631
             G +   I    +L  + L GN   G +P  IG C  L+ + +S N   G +P+++  L  
Sbjct  194   GPVTAGIANLHNLKTIDLSGNRFFGAVPNDIGMCPHLSSVDISSNAFDGQLPDSIGHLSS  253

Query  1630  LKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP  1511
             L  L    N+ SG++P  LG L  L  ++ S N LTGRLP
Sbjct  254   LVHLSASGNRFSGDVPAWLGDLAALQQLDFSDNALTGRLP  293


 Score = 54.3 bits (129),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 48/123 (39%), Positives = 69/123 (56%), Gaps = 3/123 (2%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             +AL G +PE + +   L  L L  N L+G IP  +  C+ L  L L  NNLSG+IP+ L 
Sbjct  286   NALTGRLPESLGKLKDLRYLSLSKNQLSGAIPDAMSGCTKLAELHLRANNLSGSIPDALF  345

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKL-ENLLAVNVSYNRLTGRLPAG-SIFQNLDSSAIE  1469
              +  L+ L +  N LSG +P    KL E L  +++S N+LTG +PA  ++F NL    + 
Sbjct  346   DVG-LETLDMSSNALSGVLPSGSTKLAETLQWLDLSVNQLTGGIPAEMALFMNLRYLNLS  404

Query  1468  GND  1460
              ND
Sbjct  405   RND  407



>ref|XP_004971314.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Setaria italica]
Length=1029

 Score =   569 bits (1467),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/555 (58%), Positives = 409/555 (74%), Gaps = 22/555 (4%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             + L G +P D+CESGSL +LQLDGNSL G IP  IGNCSSL LLSL HN L+G IP  +S
Sbjct  478   TGLYGAVPADLCESGSLAVLQLDGNSLAGPIPDSIGNCSSLYLLSLGHNGLTGPIPAGIS  537

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGN  1463
              LK+L+IL+LE N LSGEIPQQLG LE+LLAVN+S+NRL GRLPA  +FQ+LD+SA+EGN
Sbjct  538   ELKKLEILRLEYNNLSGEIPQQLGALESLLAVNISHNRLVGRLPASGVFQSLDASALEGN  597

Query  1462  DGICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRFLsvsai  1283
              GICSPL+T PC+MN PKP+V++P  Y +     +        A     R  RFLSVSA+
Sbjct  598   LGICSPLVTQPCRMNVPKPLVLDPNEYTHGGGGGDNNLETNG-AGAGMPRKRRFLSVSAM  656

Query  1282  vaisaaaiiavgvmvITMVNASV----------RRRISFVENALESMCSSTSSRSQGMAT  1133
             VAI AA +I +GV+VIT++N S           ++ +  +     +  SS+ +  + +A 
Sbjct  657   VAICAALVIVLGVIVITLLNMSARRRAEAAAPEQKELESIVTGSSTTKSSSGNGGKQLAA  716

Query  1132  GKLILFDTKS---SPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTS  962
             GK++ F   +   S D  +   +++L+KA+EIG G FGTVY+A + GEG RVVAIKKL +
Sbjct  717   GKMVTFGPGTSLRSEDLVAGA-DALLSKATEIGRGAFGTVYRASV-GEG-RVVAIKKLAA  773

Query  961   SKILQYPEDFDREVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMA  782
             +  +   +DFDREVRVLGKA+H NL+PL+GYYWTPQLQLL++D+ P G+LE++LH  A A
Sbjct  774   ASAVASRDDFDREVRVLGKAKHPNLLPLKGYYWTPQLQLLITDYAPHGSLEARLHGGA-A  832

Query  781   MATPPLTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLAR  602
                PP+TW  RF+++ GTA+GLAHLH + +PP+IHY++KPSNI LDE  NP + DFGLAR
Sbjct  833   DGRPPMTWEERFRVVSGTARGLAHLHQAFRPPLIHYDVKPSNIFLDERCNPAVGDFGLAR  892

Query  601   LVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGED  422
             L   L R     R+    GYVAPELACQSLRVNEKCD+YG G++ILE+VTGRR VEYG+D
Sbjct  893   L---LPRPEQQRRYALGSGYVAPELACQSLRVNEKCDIYGLGVVILEVVTGRRAVEYGDD  949

Query  421   NVLILNDHVRVLLEQGNVLECVDQGMGG-YPDEEVLPVLKLALVCTSQIPSSRPSMAEVV  245
             +V++L D VRVLLE GN LECVD GMGG +P+EEVLPVLKL +VCTSQIPS+RPSMAEVV
Sbjct  950   DVVVLQDQVRVLLEHGNALECVDPGMGGAFPEEEVLPVLKLGMVCTSQIPSNRPSMAEVV  1009

Query  244   QILQVIKTPVPNRME  200
             QILQVIK PV  RME
Sbjct  1010  QILQVIKAPVGGRME  1024


 Score = 55.5 bits (132),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 50/131 (38%), Positives = 75/131 (57%), Gaps = 6/131 (5%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G++P  + +  ++  L L  N+LTG++P  +G+  +L  LSLS N LSG++P +LS  
Sbjct  312   LSGDVPAWLGKLAAVQHLDLSDNALTGSLPDSLGDLKALKYLSLSRNQLSGSVPASLSGC  371

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGS-----IFQNLDSSAI  1472
              +L  L+L  N LSG IP  L  +  L  +++S N LTG LP+GS       Q LD S  
Sbjct  372   AKLAELRLRGNSLSGGIPDALFDV-GLETLDMSSNALTGVLPSGSTRMAETLQWLDLSGN  430

Query  1471  EGNDGICSPLL  1439
             +   GI + +L
Sbjct  431   QLTGGIPTEML  441



>ref|XP_002459131.1| hypothetical protein SORBIDRAFT_03g046350 [Sorghum bicolor]
 gb|EES04251.1| hypothetical protein SORBIDRAFT_03g046350 [Sorghum bicolor]
Length=1059

 Score =   545 bits (1403),  Expect = 8e-178, Method: Compositional matrix adjust.
 Identities = 320/576 (56%), Positives = 400/576 (69%), Gaps = 43/576 (7%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             + L G +P D+CESGSL +LQLDGNSL+G IP  IGNCSSL LLSL HN L+G IP  +S
Sbjct  474   TGLYGAMPADLCESGSLAVLQLDGNSLSGPIPDSIGNCSSLYLLSLGHNGLTGPIPAGIS  533

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGN  1463
              LK+L+IL+LE N LSGEIP QLG LENLLAVN+S+NRL GRLPA  +FQ+LD+SA+EGN
Sbjct  534   ELKKLEILRLEYNNLSGEIPAQLGGLENLLAVNISHNRLVGRLPASGVFQSLDASALEGN  593

Query  1462  DGICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEP---LASTRNSRHHRFLsv  1292
              GICSPL+  PC+MN PKP+V++P  Y +        +N E           R  RFLSV
Sbjct  594   LGICSPLVAEPCRMNVPKPLVLDPNEYTHGGAGGGDNNNLETNGGGGGVGAPRKRRFLSV  653

Query  1291  saivaisaaaiiavgvmvITMVNASVRRRISFVENALESMCSSTSSRS------------  1148
             SA+VAI AA  I +GV+VIT++N S RRR                  S            
Sbjct  654   SAMVAICAAVAIVLGVIVITLLNVSARRRAEAAGGGHGHGQKKEVDESIVTASTTTKSSS  713

Query  1147  ----------QGMATGKLILFDTKS---SPDWASSTFESVLNKASEIGEGVFGTVYKAPL  1007
                         +A GK++ F   S   S D  +   +++L+KA+EIG G FGTVY+AP+
Sbjct  714   SPPGGKGKGKDKLAAGKMVTFGPGSSLRSEDLVAGA-DALLSKATEIGRGAFGTVYRAPV  772

Query  1006  GGEGSRVVAIKKLTSSKILQYPEDFDREVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFV  827
             G    RVVA+KKL ++ +++  E+F+REVRVLGKARH NL+PL+GYYWTPQLQLL++D+ 
Sbjct  773   G--DGRVVAVKKLVAANMVRSREEFEREVRVLGKARHPNLLPLKGYYWTPQLQLLITDYA  830

Query  826   PLGNLESKLHEMAMAMATPPLTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNI-L  650
               G+LE++LH        PP+TW  RF+++ GTA+ LAHLH + +PP++HYN+KPSNI L
Sbjct  831   AHGSLEARLHLNGGEELLPPMTWEERFRVVSGTARALAHLHQAFRPPLVHYNVKPSNIFL  890

Query  649   LDENLNPKISDFGLARLVAKLDRHVMS--NRFQAA-----IGYVAPELACQSLRVNEKCD  491
             LD   NP + DFGLARL+    +       RF AA     +GYVAPELACQSLRVNEKCD
Sbjct  891   LDAECNPAVGDFGLARLLPVPGKLADGGCGRFHAAGGGGGMGYVAPELACQSLRVNEKCD  950

Query  490   VYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGM---GGY-PDEE  323
             +YG G+LILE+VTGRR VEYG+D+V++L D VRVLLE GN LECVD GM   GG+ P+EE
Sbjct  951   IYGLGVLILELVTGRRAVEYGDDDVVVLMDQVRVLLEHGNALECVDPGMGMGGGHVPEEE  1010

Query  322   VLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPV  215
             VLPVLKLA+VCTSQIPS+RPSMAEVVQILQVIK PV
Sbjct  1011  VLPVLKLAMVCTSQIPSNRPSMAEVVQILQVIKAPV  1046


 Score = 61.2 bits (147),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 65/120 (54%), Gaps = 0/120 (0%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             +A  G +P+ I + GSL  L   GN L+G +P  +G  +++  L LS N  +G++P++L 
Sbjct  282   NAFDGHLPDSIGQLGSLVYLSASGNRLSGDVPAWLGKLAAVQHLDLSDNAFTGSLPDSLG  341

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGN  1463
              LK LK L L  NQLSG +P  +     L  +++  N L+G +P       L++  +  N
Sbjct  342   DLKALKYLSLSRNQLSGAVPASMSGCTKLAELHLRGNSLSGSIPDALFDVGLETLDVSSN  401


 Score = 57.0 bits (136),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 54/100 (54%), Gaps = 0/100 (0%)
 Frame = -1

Query  1810  GEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSMLKR  1631
             G + + I    +L  L L GN  +G +P  IG C  L+ + LS N   G +P+++  L  
Sbjct  238   GPVTDGIARLHNLKTLSLSGNRFSGAVPADIGLCPHLSTIDLSSNAFDGHLPDSIGQLGS  297

Query  1630  LKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP  1511
             L  L    N+LSG++P  LGKL  +  +++S N  TG LP
Sbjct  298   LVYLSASGNRLSGDVPAWLGKLAAVQHLDLSDNAFTGSLP  337



>ref|XP_006840189.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Amborella trichopoda]
 gb|ERN01864.1| hypothetical protein AMTR_s00089p00108500 [Amborella trichopoda]
Length=975

 Score =   532 bits (1370),  Expect = 7e-174, Method: Compositional matrix adjust.
 Identities = 306/544 (56%), Positives = 403/544 (74%), Gaps = 20/544 (4%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             S L G I E++C S SL +L LDGNSL+G IP +IG+CS+L +LSLS+N+L+G+IP +L 
Sbjct  451   SGLHGSIAENLCSSKSLSVLALDGNSLSGPIPQEIGSCSNLYVLSLSNNSLNGSIPSSLL  510

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGN  1463
              L++L++L + +N+LSGEIPQ+LG LE+L+AVN+SYN+LTGRLP+G IFQ+LD S++EGN
Sbjct  511   KLQKLEVLNMALNKLSGEIPQELGGLESLVAVNLSYNQLTGRLPSGGIFQSLDQSSLEGN  570

Query  1462  DGICSPLLTG-PCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRFLsvsa  1286
              GICSP+L   PCKMN PKP+V++P  Y         G     L ++  S+   FLSVSA
Sbjct  571   LGICSPILNDQPCKMNTPKPLVLDPNAYDG-----VAGTIVPDLRNSGKSKRKEFLSVSA  625

Query  1285  ivaisaaaiiavgvmvITMVNASVRRRISFVENALESMCSSTSSRSQGMATGKLILFDTK  1106
             I+AISAA++I +GV+V+T++N S +RR     N      SS  S+    A G+L++F+  
Sbjct  626   IIAISAASLIILGVLVVTLLNVSAQRRAP--NNIPIDSLSSGGSKCSNQAMGRLVMFEAG  683

Query  1105  SSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDFDR  926
             S  DW ++  +S+LNKASE+G G FGT+YKA +G EG RVVAIK+L SS +    EDFD 
Sbjct  684   SE-DWVNNA-QSLLNKASEVGRGAFGTLYKATVG-EG-RVVAIKRLPSSNLSLSEEDFDN  739

Query  925   EVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAVRF  746
             EVR L +ARH NLV L+GYYW PQLQLL+S+FVP G+L    HE   +  +P L+WA+RF
Sbjct  740   EVRNLARARHPNLVGLKGYYWAPQLQLLISEFVPGGSL----HERLFSGKSPSLSWAIRF  795

Query  745   KIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVMSN  566
             KI LG AK LAHLHH+C+P I+HY +KPSN+LLD N  PK+SD+GL RL + L +  +S 
Sbjct  796   KIALGVAKSLAHLHHACRPTIVHYGLKPSNVLLDANCIPKLSDYGLVRLFSSLGKRGLS-  854

Query  565   RFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRVL  386
                 + GY+APEL C SL VNEKCDVY FG+L+LEIV+GRR VEY ED++++L + VR +
Sbjct  855   ---MSPGYMAPELTCGSLCVNEKCDVYSFGVLLLEIVSGRRAVEYREDDMVMLCEDVRSM  911

Query  385   LEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPVPNR  206
             +E+G  LECVD  M  Y +EEV+P+L+L LVCTSQ+PSSRPSMAEVVQILQVIKTPVP R
Sbjct  912   VERGRGLECVDMKMEEYAEEEVVPLLRLGLVCTSQVPSSRPSMAEVVQILQVIKTPVPER  971

Query  205   MEPY  194
             ME +
Sbjct  972   MEVF  975



>dbj|BAJ85468.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1052

 Score =   531 bits (1368),  Expect = 8e-173, Method: Compositional matrix adjust.
 Identities = 320/576 (56%), Positives = 410/576 (71%), Gaps = 44/576 (8%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             S L G +P D+C+SGSL +LQLDGNSL G IP  IG CSSL LLS+ HN+L+G IP  + 
Sbjct  470   SGLYGPVPGDLCDSGSLAVLQLDGNSLAGPIPDNIGKCSSLYLLSMGHNSLTGPIPAGMG  529

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGN  1463
              LK+L+IL+LE N L+GEIPQQLG LE+LLAVN+S+NRL GRLPA  +FQ+LD+SA+EGN
Sbjct  530   ELKKLEILRLEDNNLTGEIPQQLGGLESLLAVNISHNRLVGRLPASGVFQSLDASALEGN  589

Query  1462  DGICSPLLTGPCKMNAPKPIVINP--FVYGNQTdnnnggdnNEPLASTRNSRHHRFLsvs  1289
              G+CSPL+  PC MN PKP+V++P  + +G  T++++   N +  A     R  RFLSVS
Sbjct  590   LGVCSPLVAEPCVMNVPKPLVLDPNEYTHGGNTNDSDLAANGDGSAGEAVPRKRRFLSVS  649

Query  1288  aivaisaaaiiavgvmvITMVNASVRRRIS---------FVENALE---SMCSSTSSRSQ  1145
             A+VAI AA  I +GV+VI ++N S RRR           F    LE   S+ S +S++S 
Sbjct  650   AMVAICAALSIVLGVVVIALLNVSARRRRGVGGGSADGLFQGKELELESSIVSGSSTKSS  709

Query  1144  GMA-TGKLILFDTKSS---PDWASSTFESVLNKASEIG-EGVFGTVYKAPLGGEGSRVVA  980
              +A TGK++ F   SS    D+     +++L+KA+EIG  G FGT Y+A +G EG RVVA
Sbjct  710   KLAVTGKMVTFGPGSSLRTEDFVGGA-DALLSKATEIGLGGAFGTTYRASVG-EG-RVVA  766

Query  979   IKKLTSSKILQYPEDFDREVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKL  800
             +KKL+++ +++  ++FDRE RVLGKARH NL+PL+GYYWTPQLQLLV+D+ P G+LE++L
Sbjct  767   VKKLSTASVVESRDEFDREARVLGKARHPNLMPLKGYYWTPQLQLLVTDYAPHGSLEARL  826

Query  799   HEMAMAMATPPLTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKIS  620
             H      A PPLTWA RF+++ GTA+GLA+LH S +PP+IHYN+KPSNILLD   NP I+
Sbjct  827   HGKDGGAAFPPLTWAERFRVVAGTARGLAYLHQSFRPPVIHYNLKPSNILLDSRCNPLIA  886

Query  619   DFGLARLVAKLDRHVM-----------SNRF--QAAIGYVAPELACQSLRVNEKCDVYGF  479
             DFGLARL+ K  +              S RF   AA+GY APELAC SLRVNEKCDVYGF
Sbjct  887   DFGLARLLRKPKQQQQQPEGNGVGAMGSCRFMQSAAMGYAAPELACSSLRVNEKCDVYGF  946

Query  478   GMLILEIVTGRRPVEYGEDNVLILNDHVRVLLEQGNVL--------ECVDQGM-GGYPDE  326
             G+L+LE+VTGRR VEYGED+V +L D VRV LEQG             VD  + G +P+E
Sbjct  947   GVLVLELVTGRRAVEYGEDDVAVLTDQVRVALEQGAGGDDDDAAAERVVDPALRGEFPEE  1006

Query  325   EVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTP  218
             E LPVLKL +VCTSQIPS+RPSMAEVVQILQVI+ P
Sbjct  1007  EALPVLKLGVVCTSQIPSNRPSMAEVVQILQVIRAP  1042


 Score = 54.3 bits (129),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 53/102 (52%), Gaps = 0/102 (0%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G +   +    +L  L L  N  +G +P  IG C  L  + LS N   G +PE+++ L
Sbjct  232   LSGPVAAGVGALHNLKTLDLSANRFSGAVPEDIGLCPHLAAVDLSGNAFDGELPESMARL  291

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP  1511
               L  L    N+LSG++P  LG L  L  +++S N LTG LP
Sbjct  292   ASLVRLSASSNRLSGDVPAWLGGLAALQRLDLSDNALTGALP  333


 Score = 53.9 bits (128),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 48/126 (38%), Positives = 68/126 (54%), Gaps = 6/126 (5%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G++P  +    +L  L L  N+LTG +P  +G+   L+ L LS N L+ ++PE +S  
Sbjct  304   LSGDVPAWLGGLAALQRLDLSDNALTGALPDSLGDLKDLSYLGLSKNRLAFSVPEAMSGC  363

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGS-----IFQNLDSSAI  1472
              RL  L L  NQL+G IP  L  +  L  +++S N LTG LP+GS       Q LD S  
Sbjct  364   TRLAELHLRGNQLTGSIPDALFDV-GLETLDMSSNALTGVLPSGSTRLAETLQWLDLSGN  422

Query  1471  EGNDGI  1454
             +   GI
Sbjct  423   QLTGGI  428



>ref|XP_008655312.1| PREDICTED: uncharacterized protein LOC100384143 isoform X1 [Zea 
mays]
 gb|AFW83919.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=1053

 Score =   528 bits (1360),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 306/575 (53%), Positives = 396/575 (69%), Gaps = 45/575 (8%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             + L G +P D CESGSL +LQLDGNSL+G IP  IGNCSSL LLSL HN L+G IP  +S
Sbjct  475   TGLYGAVPADFCESGSLAVLQLDGNSLSGPIPDSIGNCSSLYLLSLGHNGLTGPIPAGIS  534

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGN  1463
              LK+L+IL+LE N+LSGEIPQQLG LENLLAVN+S+NRL GRLPA  +FQ+LD+SA+EGN
Sbjct  535   ELKKLEILRLEYNKLSGEIPQQLGALENLLAVNISHNRLVGRLPASGVFQSLDASALEGN  594

Query  1462  DGICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRFLsvsai  1283
              GICSPL+T PC+MN  KP+V++P  Y       +              R  RFL   + 
Sbjct  595   LGICSPLVTEPCRMNVAKPLVLDPNEYTQGGGGGDNNLETGGGGGVEAPRKRRFLMSVSA  654

Query  1282  vais-aaaiiavgvmvITMVNASVRRRISFV---------ENALESMCSSTSSR------  1151
             +    AA  I +GV+VIT+++ S RRR+            +   ES+ +++S+       
Sbjct  655   MVAIFAAVAIVLGVIVITLLSVSARRRVEAAGVGGPGHDRKEVDESIVTTSSTTTTKSSS  714

Query  1150  --------SQGMATGKLILFDTKSS---PDWASSTFESVLNKASEIGEGVFGTVYKAPLG  1004
                      + +ATGK++ F   SS    D  +   +++L+KA+EIG G  GTVY+A +G
Sbjct  715   SPPPGGKVKEKLATGKMVTFGPGSSLRSEDLVAGA-DALLSKATEIGRGALGTVYRAAVG  773

Query  1003  GEGSRVVAIKKLTSSKILQYPEDFDREVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVP  824
                 RVVA+KKL ++ +++  E+F+REVRVLGKARH NL+ LRGYYWTPQLQLL++D+  
Sbjct  774   D--GRVVAVKKLAAAHLVRSREEFEREVRVLGKARHPNLLALRGYYWTPQLQLLITDYAA  831

Query  823   LGNLESKLHEMAMAMATPPLTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILL-  647
              G+LE++LH    A    P+TW  RF+++ GTA+ LAHLH + +P ++HYN+KPSNILL 
Sbjct  832   HGSLEARLHGGGEAA---PMTWEERFRVVSGTARALAHLHQAFRPALVHYNVKPSNILLA  888

Query  646   DENLNPKISDFGLARLV--AKLDRHVM--SNRFQ----AAIGYVAPELACQSLRVNEKCD  491
             D   NP + DFGLARL+  +   R V    +RF+      +GYVAPELACQSLR N+KCD
Sbjct  889   DAECNPAVGDFGLARLLHGSGSGRQVAMAGSRFRQGGGGGMGYVAPELACQSLRANDKCD  948

Query  490   VYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGMGG---YPDEEV  320
             VYG G+LILE+VTGRR VEYG+D+V++L D VR LLE GN LECVD GMGG    P+EEV
Sbjct  949   VYGVGVLILELVTGRRAVEYGDDDVVVLTDQVRALLEHGNALECVDPGMGGRGHVPEEEV  1008

Query  319   LPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPV  215
             +PVLKL +VC SQIPS+RPSMAEVVQILQVIK PV
Sbjct  1009  VPVLKLGMVCASQIPSNRPSMAEVVQILQVIKAPV  1043


 Score = 55.8 bits (133),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 38/100 (38%), Positives = 54/100 (54%), Gaps = 0/100 (0%)
 Frame = -1

Query  1810  GEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSMLKR  1631
             G +   I    +L  L L GN   G +P  IG C  L+ + LS N   G +P++++ L  
Sbjct  239   GPVTGGIARLHNLKTLILSGNRFFGAVPADIGLCPHLSAIDLSSNAFDGHLPDSIAQLAS  298

Query  1630  LKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP  1511
             L  L    N+LSG++P  LGKL  +  V++S N LTG LP
Sbjct  299   LVYLSASGNRLSGDVPAWLGKLAAVQHVDLSDNALTGGLP  338



>gb|ACN33819.1| unknown [Zea mays]
 tpg|DAA55768.1| TPA: putative leucine-rich repeat receptor-like protein kinase 
family protein [Zea mays]
Length=1043

 Score =   528 bits (1359),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 318/574 (55%), Positives = 399/574 (70%), Gaps = 41/574 (7%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             + L G +P D+CESGSL +LQLDGNSL+G IP  IGNCSSL LLSL HN L+G IP  +S
Sbjct  475   TGLYGAMPADLCESGSLAVLQLDGNSLSGPIPDSIGNCSSLYLLSLGHNGLTGPIPAGIS  534

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGN  1463
              LK+L+IL+LE N LSGEIPQQLG LENLLAVN+S+NRL GRLPA  +FQ+LD+SA+EGN
Sbjct  535   ELKKLEILRLEYNNLSGEIPQQLGGLENLLAVNISHNRLVGRLPASGVFQSLDASALEGN  594

Query  1462  DGICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRFLsvsai  1283
              GICSPL+   C MN PKP+V++P  Y       +  +           R  RFLSVSA+
Sbjct  595   LGICSPLVAERCMMNVPKPLVLDPNEY-THGGGGDNNNMGTNGGGVGAPRKRRFLSVSAM  653

Query  1282  vaisaaaiiavgvmvITMVNASVRRRISFVEN----------------------ALESMC  1169
             VAI AA  I +GV+VIT++N S RRR                               S  
Sbjct  654   VAICAAVAIVLGVIVITLLNVSARRRAEAAGGVGPGHGQKKEVDESVVTSSSSTTKSSPA  713

Query  1168  SSTSSRSQG-MATGKLILFDTKS---SPDWASSTFESVLNKASEIGEGVFGTVYKAPLGG  1001
              +   + +G +A GK++ F   S   S D  +   +++L KA+EIG G FGTVY+AP+G 
Sbjct  714   PAPGGKGKGKLAAGKMVTFGPGSSLRSEDLVAGA-DALLGKATEIGRGAFGTVYRAPVG-  771

Query  1000  EGSRVVAIKKLTSSKILQYPEDFDREVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPL  821
                RVVA+KKL ++ +++  E+F+REVRVLGKARH NL+PL+GYYWTPQLQLL++D+   
Sbjct  772   -DGRVVAVKKLAAASMVRSREEFEREVRVLGKARHPNLLPLKGYYWTPQLQLLITDYAAR  830

Query  820   GNLESKLHEMAMAMATPPLTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILL-D  644
             G+LE++LH      A   +TW  RF+++ GTA+ LAHLHH+ +PP++HYN+KPSNI L D
Sbjct  831   GSLEARLHGGGGGEA---MTWEERFRVLSGTARALAHLHHAFRPPLVHYNVKPSNIFLAD  887

Query  643   ENLNPKISDFGLARLVA----KLDRHVMSNRF-QAAIGYVAPELACQSLRVNEKCDVYGF  479
                NP + +FGLARL+A    +    +   RF Q   GYVAPELACQSLRVNEKCD+YG 
Sbjct  888   AECNPAVGEFGLARLLADGGGRQQVAMGGGRFQQGGAGYVAPELACQSLRVNEKCDIYGL  947

Query  478   GMLILEIVTGRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGMGG-YPDEEVLPVLKL  302
             G+LILE+VTGRR VEYG+D+V++L D VR LLE GN LECVD GMGG  P+EEVLPVLKL
Sbjct  948   GVLILELVTGRRAVEYGDDDVVVLVDQVRALLEHGNALECVDPGMGGRVPEEEVLPVLKL  1007

Query  301   ALVCTSQIPSSRPSMAEVVQILQVIKTPVPNRME  200
              +VCTSQIPS+RPSMAEVVQILQVIK PV  RME
Sbjct  1008  GMVCTSQIPSNRPSMAEVVQILQVIKAPV-GRME  1040


 Score = 58.2 bits (139),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/100 (37%), Positives = 54/100 (54%), Gaps = 0/100 (0%)
 Frame = -1

Query  1810  GEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSMLKR  1631
             G + + I    +L  L L GN   G +P  IG C  L+ + LS N   G +P+++  L  
Sbjct  239   GPVTDGIARLHNLKTLSLSGNRFFGAVPADIGRCPHLSTIDLSSNAFDGHLPDSIGQLAS  298

Query  1630  LKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP  1511
             L  L    N+LSG++P  LGKL  +  +++S N LTG LP
Sbjct  299   LVYLSASGNRLSGDVPAWLGKLAAVQHLDLSDNALTGSLP  338


 Score = 54.7 bits (130),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 48/126 (38%), Positives = 71/126 (56%), Gaps = 6/126 (5%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G++P  + +  ++  L L  N+LTG++P  +G+  +L  LSLS N LSG +P ++S  
Sbjct  309   LSGDVPAWLGKLAAVQHLDLSDNALTGSLPDSLGDLKALKYLSLSRNQLSGAVPASMSGC  368

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGS-----IFQNLDSSAI  1472
              +L  L L  N LSG IP  L  +  L  ++VS N L+G LP+GS       Q+LD S  
Sbjct  369   TKLAELHLRDNNLSGSIPDALFDV-GLETLDVSSNALSGVLPSGSTRLAETLQSLDLSGN  427

Query  1471  EGNDGI  1454
             +   GI
Sbjct  428   QLTGGI  433



>ref|XP_008672259.1| PREDICTED: uncharacterized protein LOC100216746 isoform X1 [Zea 
mays]
Length=1150

 Score =   526 bits (1355),  Expect = 9e-170, Method: Compositional matrix adjust.
 Identities = 318/574 (55%), Positives = 399/574 (70%), Gaps = 41/574 (7%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             + L G +P D+CESGSL +LQLDGNSL+G IP  IGNCSSL LLSL HN L+G IP  +S
Sbjct  582   TGLYGAMPADLCESGSLAVLQLDGNSLSGPIPDSIGNCSSLYLLSLGHNGLTGPIPAGIS  641

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGN  1463
              LK+L+IL+LE N LSGEIPQQLG LENLLAVN+S+NRL GRLPA  +FQ+LD+SA+EGN
Sbjct  642   ELKKLEILRLEYNNLSGEIPQQLGGLENLLAVNISHNRLVGRLPASGVFQSLDASALEGN  701

Query  1462  DGICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRFLsvsai  1283
              GICSPL+   C MN PKP+V++P  Y       +  +           R  RFLSVSA+
Sbjct  702   LGICSPLVAERCMMNVPKPLVLDPNEY-THGGGGDNNNMGTNGGGVGAPRKRRFLSVSAM  760

Query  1282  vaisaaaiiavgvmvITMVNASVRRRISFVEN----------------------ALESMC  1169
             VAI AA  I +GV+VIT++N S RRR                               S  
Sbjct  761   VAICAAVAIVLGVIVITLLNVSARRRAEAAGGVGPGHGQKKEVDESVVTSSSSTTKSSPA  820

Query  1168  SSTSSRSQG-MATGKLILFDTKS---SPDWASSTFESVLNKASEIGEGVFGTVYKAPLGG  1001
              +   + +G +A GK++ F   S   S D  +   +++L KA+EIG G FGTVY+AP+G 
Sbjct  821   PAPGGKGKGKLAAGKMVTFGPGSSLRSEDLVAGA-DALLGKATEIGRGAFGTVYRAPVG-  878

Query  1000  EGSRVVAIKKLTSSKILQYPEDFDREVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPL  821
                RVVA+KKL ++ +++  E+F+REVRVLGKARH NL+PL+GYYWTPQLQLL++D+   
Sbjct  879   -DGRVVAVKKLAAASMVRSREEFEREVRVLGKARHPNLLPLKGYYWTPQLQLLITDYAAR  937

Query  820   GNLESKLHEMAMAMATPPLTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILL-D  644
             G+LE++LH      A   +TW  RF+++ GTA+ LAHLHH+ +PP++HYN+KPSNI L D
Sbjct  938   GSLEARLHGGGGGEA---MTWEERFRVLSGTARALAHLHHAFRPPLVHYNVKPSNIFLAD  994

Query  643   ENLNPKISDFGLARLVA----KLDRHVMSNRF-QAAIGYVAPELACQSLRVNEKCDVYGF  479
                NP + +FGLARL+A    +    +   RF Q   GYVAPELACQSLRVNEKCD+YG 
Sbjct  995   AECNPAVGEFGLARLLADGGGRQQVAMGGGRFQQGGAGYVAPELACQSLRVNEKCDIYGL  1054

Query  478   GMLILEIVTGRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGMGG-YPDEEVLPVLKL  302
             G+LILE+VTGRR VEYG+D+V++L D VR LLE GN LECVD GMGG  P+EEVLPVLKL
Sbjct  1055  GVLILELVTGRRAVEYGDDDVVVLVDQVRALLEHGNALECVDPGMGGRVPEEEVLPVLKL  1114

Query  301   ALVCTSQIPSSRPSMAEVVQILQVIKTPVPNRME  200
              +VCTSQIPS+RPSMAEVVQILQVIK PV  RME
Sbjct  1115  GMVCTSQIPSNRPSMAEVVQILQVIKAPV-GRME  1147


 Score = 58.2 bits (139),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/100 (37%), Positives = 54/100 (54%), Gaps = 0/100 (0%)
 Frame = -1

Query  1810  GEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSMLKR  1631
             G + + I    +L  L L GN   G +P  IG C  L+ + LS N   G +P+++  L  
Sbjct  346   GPVTDGIARLHNLKTLSLSGNRFFGAVPADIGRCPHLSTIDLSSNAFDGHLPDSIGQLAS  405

Query  1630  LKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP  1511
             L  L    N+LSG++P  LGKL  +  +++S N LTG LP
Sbjct  406   LVYLSASGNRLSGDVPAWLGKLAAVQHLDLSDNALTGSLP  445


 Score = 54.7 bits (130),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 48/126 (38%), Positives = 71/126 (56%), Gaps = 6/126 (5%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G++P  + +  ++  L L  N+LTG++P  +G+  +L  LSLS N LSG +P ++S  
Sbjct  416   LSGDVPAWLGKLAAVQHLDLSDNALTGSLPDSLGDLKALKYLSLSRNQLSGAVPASMSGC  475

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGS-----IFQNLDSSAI  1472
              +L  L L  N LSG IP  L  +  L  ++VS N L+G LP+GS       Q+LD S  
Sbjct  476   TKLAELHLRDNNLSGSIPDALFDV-GLETLDVSSNALSGVLPSGSTRLAETLQSLDLSGN  534

Query  1471  EGNDGI  1454
             +   GI
Sbjct  535   QLTGGI  540



>emb|CAN70282.1| hypothetical protein VITISV_023081 [Vitis vinifera]
Length=323

 Score =   488 bits (1257),  Expect = 7e-166, Method: Compositional matrix adjust.
 Identities = 234/301 (78%), Positives = 270/301 (90%), Gaps = 4/301 (1%)
 Frame = -1

Query  1096  DWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDFDREVR  917
             DW  +  E++LNKA+EIG GVFGTVYK  LGG G+R+VAIKKL +S I+QYPEDFDREVR
Sbjct  27    DWIXNP-ENLLNKAAEIGGGVFGTVYKVSLGG-GARMVAIKKLVTSNIIQYPEDFDREVR  84

Query  916   VLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAVRFKII  737
             +LGKARHQNL+ L+GYYWTPQLQLLV+D+ P G+L+++LHE      TPPL+W  RF+II
Sbjct  85    ILGKARHQNLISLKGYYWTPQLQLLVTDYAPNGSLQARLHERPPT--TPPLSWPNRFRII  142

Query  736   LGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVMSNRFQ  557
             LGTAKGLAHLHHS +PPIIHYN+KPSNILLDEN NP ISD+GLARL+ KLD+HV+S+RFQ
Sbjct  143   LGTAKGLAHLHHSFRPPIIHYNLKPSNILLDENCNPMISDYGLARLLTKLDKHVISSRFQ  202

Query  556   AAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRVLLEQ  377
             +A+GYVAPELACQSLRVNEKCD+YGFG++ILEIVTGRRPVEYGEDNV+ILNDHVRVLLEQ
Sbjct  203   SALGYVAPELACQSLRVNEKCDIYGFGVMILEIVTGRRPVEYGEDNVVILNDHVRVLLEQ  262

Query  376   GNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPVPNRMEP  197
             GNVLECVD  M  YP+EEVLPVLKLALVCTSQIPSSRP+MAEVVQILQVIKTP+P RME 
Sbjct  263   GNVLECVDPSMXEYPEEEVLPVLKLALVCTSQIPSSRPTMAEVVQILQVIKTPIPQRMEA  322

Query  196   Y  194
             +
Sbjct  323   F  323



>ref|XP_003567498.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Brachypodium distachyon]
Length=1056

 Score =   493 bits (1269),  Expect = 6e-158, Method: Compositional matrix adjust.
 Identities = 310/585 (53%), Positives = 405/585 (69%), Gaps = 52/585 (9%)
 Frame = -1

Query  1819  ALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSM  1640
              L G +P  +CESGSL +LQLDGNSL+G IP  I  CS+L LLSL HN LSG IP  +  
Sbjct  478   GLYGPVPAGLCESGSLAVLQLDGNSLSGPIPDSIRKCSALYLLSLGHNGLSGQIPAGIGE  537

Query  1639  LKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGND  1460
             LK+L+IL+LE N+LSGEIPQQLG LE+LLAVN+S+NRL GRLP+  +FQ+LD+SAI+GN 
Sbjct  538   LKKLEILRLEDNKLSGEIPQQLGGLESLLAVNISHNRLVGRLPSSGVFQSLDASAIDGNL  597

Query  1459  GICSPLLTGPCKMNAPKPIVINP--FVYGNQTdnnnggdnNEPL---ASTRNSRHHRFLs  1295
             G+CSPL+  PC+M+ PKP+V++P  + +GN + ++ G +N       A+ R  R  R LS
Sbjct  598   GVCSPLVKEPCRMSVPKPLVLDPNQYAHGNNSGDDIGTNNGGDGDGEAAPRKKR--RVLS  655

Query  1294  vsaivaisaaaiiavgvmvITMVNASVRRRISF-----VENALESMCSS---TSSRSQGM  1139
             VSA+VAI AA +I +GV+V+T++N S RRR            LES+ S+   T+  S G 
Sbjct  656   VSAMVAIGAALVIVLGVVVVTLLNVSARRRAGAGLLLPETKELESIVSASTRTTKTSTGK  715

Query  1138  A--TGKLILF----DTKSSPDWASSTFESVLNKASEIGEGVFG--TVYKAPLGGEGSRVV  983
             A  TGK++ F    ++  S D      + +L+KA+E+G G       Y+AP+G    RVV
Sbjct  716   AANTGKMVTFGPGTNSLRSEDLVGGA-DVLLSKATELGRGGSSGRASYRAPVG--DGRVV  772

Query  982   AIKK--LTSSKILQYP---------EDFDREVRVLGKARHQNLVPLRGYYWTPQLQLLVS  836
             AIKK  L +S + Q P         E FDRE RVLG ARH NL+PL+GYYWTP++QLL++
Sbjct  773   AIKKLLLANSAMDQQPSSASTNAAREVFDREARVLGAARHPNLMPLKGYYWTPRMQLLIT  832

Query  835   DFVPLGNLESKLH----EMAMAMATP-PLTWAVRFKIILGTAKGLAHLHHSCQPPIIHYN  671
             DF P G+LE++LH         +++P P+TW  RF++I GTA GLAHLHHS +PP+IHYN
Sbjct  833   DFAPHGSLEARLHGNNNNGNNGVSSPAPMTWEERFRVISGTASGLAHLHHSFRPPLIHYN  892

Query  670   IKPSNILLDENLNPKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCD  491
             +KPSNILLD   NP ISDFGLARL  +   +    +   A+GY APE+AC SLRVNEKCD
Sbjct  893   VKPSNILLDSRCNPLISDFGLARLQPETSPN---EKRGGAMGYAAPEVACGSLRVNEKCD  949

Query  490   VYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRVLLEQ-----GNVLECVDQGMGG-YPD  329
             VYGFG+++LE VTGRR VEYG+D+V +L D VR  LE      G VL+ VD  MGG +P+
Sbjct  950   VYGFGVVVLETVTGRRAVEYGDDDVAVLVDQVRSALETTTTRGGGVLDWVDPAMGGEFPE  1009

Query  328   EEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPVPNRMEPY  194
             EE +PVLKL +VCTSQ+PS+RPSMAEVVQ+L VI+ P+P  MEP+
Sbjct  1010  EEAVPVLKLGIVCTSQVPSNRPSMAEVVQVLHVIRAPLPG-MEPF  1053


 Score = 53.9 bits (128),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 51/102 (50%), Gaps = 0/102 (0%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G +   I    +L  + L GN  +G IP  IG C  L+ + LS N   G +P ++  L
Sbjct  242   LSGPVAAGIASLHNLKTVDLSGNRFSGAIPADIGLCPHLSRIDLSSNAFDGALPGSIGAL  301

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP  1511
               L       N+LSG++P   G L  L  +++S N LTG LP
Sbjct  302   SSLVFFSASGNRLSGQVPSWFGGLTALQHLDLSDNTLTGTLP  343


 Score = 52.8 bits (125),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 59/120 (49%), Gaps = 0/120 (0%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             +A  G +P  I    SL      GN L+G +P   G  ++L  L LS N L+GT+PE+L 
Sbjct  288   NAFDGALPGSIGALSSLVFFSASGNRLSGQVPSWFGGLTALQHLDLSDNTLTGTLPESLG  347

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGN  1463
              LK L  L    N+L G IP+ +     L  +++  N L+G +P       L++    GN
Sbjct  348   QLKDLGFLSFSKNKLVGSIPESMSGCTKLAELHLRGNILSGAIPEALFDLGLETLDASGN  407



>gb|AES77940.2| tyrosine kinase family protein [Medicago truncatula]
Length=641

 Score =   469 bits (1206),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 229/302 (76%), Positives = 258/302 (85%), Gaps = 4/302 (1%)
 Frame = -1

Query  1096  DWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDFDREVR  917
             +W S+  E+ LNKASEIGEGVF T++K PLG +  R VAIKKL +S ILQY EDFDREVR
Sbjct  343   NWISNP-ENSLNKASEIGEGVFRTIFKVPLGSQQGRNVAIKKLITSNILQYLEDFDREVR  401

Query  916   VLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAVRFKII  737
             +LG ARH NL+  +GYYW PQLQLL S+F P  NL+SKLHE   +  +PPL+W  RFKI+
Sbjct  402   ILGNARHPNLIASKGYYWNPQLQLLASEFAPNSNLQSKLHENLPS--SPPLSWPNRFKIL  459

Query  736   LGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVMSNRFQ  557
             LGTAKGLAHLHHS +PPIIHYNIKPSNILLDEN N KISDFGLARL+ KLD+HVMSNRFQ
Sbjct  460   LGTAKGLAHLHHSFRPPIIHYNIKPSNILLDENFNAKISDFGLARLLTKLDKHVMSNRFQ  519

Query  556   AAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRVLLEQ  377
             +A+GYVAPELACQ LRVNEKCDVYGFG++ILEIVTG+RPVEYGEDNVLILNDHVRVLLE 
Sbjct  520   SALGYVAPELACQILRVNEKCDVYGFGVMILEIVTGKRPVEYGEDNVLILNDHVRVLLEH  579

Query  376   GNVLECVDQG-MGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPVPNRME  200
             GN LECVD   M  YP++EVLPVLKLA+VCTSQIPSSRP+MAEVVQILQVIKT VP RME
Sbjct  580   GNALECVDPSLMSEYPEDEVLPVLKLAMVCTSQIPSSRPTMAEVVQILQVIKTSVPQRME  639

Query  199   PY  194
              +
Sbjct  640   VF  641


 Score =   309 bits (792),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 148/202 (73%), Positives = 174/202 (86%), Gaps = 3/202 (1%)
 Frame = -1

Query  1111  TKSSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDF  932
             ++S+ DW S+  E++LNKASEIGEGVFGTV+K PLG +  R VAIKKL +S ILQYPEDF
Sbjct  7     SQSTLDWISNP-ENLLNKASEIGEGVFGTVFKVPLGSQQGRNVAIKKLITSNILQYPEDF  65

Query  931   DREVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAV  752
             DREVR++G ARH NL+ L+GYYWTPQLQLL S+F P GNL+SKLHE   +  +PPL+W  
Sbjct  66    DREVRIIGNARHPNLIALKGYYWTPQLQLLASEFAPNGNLQSKLHEKLPS--SPPLSWPN  123

Query  751   RFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVM  572
             RFKI+LGTAKGLAHLHHS +PPIIH NIKPSNILLDEN N KISDFGLARL++KLD+HVM
Sbjct  124   RFKILLGTAKGLAHLHHSFRPPIIHCNIKPSNILLDENFNAKISDFGLARLLSKLDKHVM  183

Query  571   SNRFQAAIGYVAPELACQSLRV  506
             SNRFQ+A+GYVAPELACQSLR+
Sbjct  184   SNRFQSALGYVAPELACQSLRM  205



>ref|XP_003621722.1| Receptor-like kinase [Medicago truncatula]
Length=804

 Score =   471 bits (1212),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 234/317 (74%), Positives = 264/317 (83%), Gaps = 12/317 (4%)
 Frame = -1

Query  1096  DWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDFDREVR  917
             +W S+  E+ LNKASEIGEGVF T++K PLG +  R VAIKKL +S ILQY EDFDREVR
Sbjct  319   NWISNP-ENSLNKASEIGEGVFRTIFKVPLGSQQGRNVAIKKLITSNILQYLEDFDREVR  377

Query  916   VLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAVRFKII  737
             +LG ARH NL+  +GYYW PQLQLL S+F P  NL+SKLHE   +  +PPL+W  RFKI+
Sbjct  378   ILGNARHPNLIASKGYYWNPQLQLLASEFAPNSNLQSKLHENLPS--SPPLSWPNRFKIL  435

Query  736   LGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVMSNRFQ  557
             LGTAKGLAHLHHS +PPIIHYNIKPSNILLDEN N KISDFGLARL+ KLD+HVMSNRFQ
Sbjct  436   LGTAKGLAHLHHSFRPPIIHYNIKPSNILLDENFNAKISDFGLARLLTKLDKHVMSNRFQ  495

Query  556   AAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRVLLEQ  377
             +A+GYVAPELACQ LRVNEKCDVYGFG++ILEIVTG+RPVEYGEDNVLILNDHVRVLLE 
Sbjct  496   SALGYVAPELACQILRVNEKCDVYGFGVMILEIVTGKRPVEYGEDNVLILNDHVRVLLEH  555

Query  376   GNVLECVDQG-MGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPVPNRME  200
             GN LECVD   M  YP++EVLPVLKLA+VCTSQIPSSRP+MAEVVQILQVIKT VP RME
Sbjct  556   GNALECVDPSLMSEYPEDEVLPVLKLAMVCTSQIPSSRPTMAEVVQILQVIKTSVPQRME  615

Query  199   PY*ASASGLESGNILEF  149
                     L + NIL+F
Sbjct  616   --------LITSNILQF  624


 Score =   337 bits (864),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 163/224 (73%), Positives = 190/224 (85%), Gaps = 4/224 (2%)
 Frame = -1

Query  1111  TKSSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDF  932
             ++S+ DW S+  E++LNKASEIGEGVFGTV+K PLG +  R VAIKKL +S ILQYPEDF
Sbjct  7     SQSTLDWISNP-ENLLNKASEIGEGVFGTVFKVPLGSQQGRNVAIKKLITSNILQYPEDF  65

Query  931   DREVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAV  752
             DREVR++G ARH NL+ L+GYYWTPQLQLL S+F P GNL+SKLHE   +  +PPL+W  
Sbjct  66    DREVRIIGNARHPNLIALKGYYWTPQLQLLASEFAPNGNLQSKLHEKLPS--SPPLSWPN  123

Query  751   RFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVM  572
             RFKI+LGTAKGLAHLHHS +PPIIH NIKPSNILLDEN N KISDFGLARL++KLD+HVM
Sbjct  124   RFKILLGTAKGLAHLHHSFRPPIIHCNIKPSNILLDENFNAKISDFGLARLLSKLDKHVM  183

Query  571   SNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRP  440
             SNRFQ+A+GYVAPELACQSLRVNEKCDVYGFG+  LE+V    P
Sbjct  184   SNRFQSALGYVAPELACQSLRVNEKCDVYGFGVF-LEMVQYGNP  226


 Score = 91.7 bits (226),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = -1

Query  973  KLTSSKILQYPEDFDREVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHE  794
            +L +S ILQ+ E FD EVR+LGKARHQ+L  L+ YYWTPQLQLLVS+F P GNL+SKLHE
Sbjct  709  ELITSNILQFLEVFDNEVRILGKARHQSLTALKDYYWTPQLQLLVSEFAPNGNLQSKLHE  768


 Score = 84.7 bits (208),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 48/60 (80%), Gaps = 0/60 (0%)
 Frame = -1

Query  973  KLTSSKILQYPEDFDREVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHE  794
            +L +S ILQ+ E FD EVR+ GKA+HQ+L  L+ YYWTPQLQLLV +F P GNL+SKLHE
Sbjct  615  ELITSNILQFLEVFDTEVRIPGKAKHQSLTALKDYYWTPQLQLLVFEFAPNGNLQSKLHE  674



>ref|XP_003621710.1| Receptor-like protein kinase [Medicago truncatula]
Length=1085

 Score =   472 bits (1215),  Expect = 8e-150, Method: Compositional matrix adjust.
 Identities = 238/332 (72%), Positives = 269/332 (81%), Gaps = 19/332 (6%)
 Frame = -1

Query  1120  LFDTKSSP-------DWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTS  962
             L+  K SP       +W S+  E+ LNKASEIGEGVF T++K PLG +  R VAIKKL +
Sbjct  585   LYGLKQSPRTWFGRFNWISNP-ENSLNKASEIGEGVFRTIFKVPLGSQQGRNVAIKKLIT  643

Query  961   SKILQYPEDFDREVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMA  782
             S ILQY EDFDREVR+LG ARH NL+  +GYYW PQLQLL S+F P  NL+SKLHE   +
Sbjct  644   SNILQYLEDFDREVRILGNARHPNLIASKGYYWNPQLQLLASEFAPNSNLQSKLHENLPS  703

Query  781   MATPPLTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLAR  602
               +PPL+W  RFKI+LGTAKGLAHLHHS +PPIIHYNIKPSNILLDEN N KISDFGLAR
Sbjct  704   --SPPLSWPNRFKILLGTAKGLAHLHHSFRPPIIHYNIKPSNILLDENFNAKISDFGLAR  761

Query  601   LVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGED  422
             L+ KLD+HVMSNRFQ+A+GYVAPELACQ LRVNEKCDVYGFG++ILEIVTG+RPVEYGED
Sbjct  762   LLTKLDKHVMSNRFQSALGYVAPELACQILRVNEKCDVYGFGVMILEIVTGKRPVEYGED  821

Query  421   NVLILNDHVRVLLEQGNVLECVDQG-MGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVV  245
             NVLILNDHVRVLLE GN LECVD   M  YP++EVLPVLKLA+VCTSQIPSSRP+MAEVV
Sbjct  822   NVLILNDHVRVLLEHGNALECVDPSLMSEYPEDEVLPVLKLAMVCTSQIPSSRPTMAEVV  881

Query  244   QILQVIKTPVPNRMEPY*ASASGLESGNILEF  149
             QILQVIKT VP RME        L + NIL+F
Sbjct  882   QILQVIKTSVPQRME--------LITSNILQF  905


 Score = 91.7 bits (226),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = -1

Query  973   KLTSSKILQYPEDFDREVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHE  794
             +L +S ILQ+ E FD EVR+LGKARHQ+L  L+ YYWTPQLQLLVS+F P GNL+SKLHE
Sbjct  990   ELITSNILQFLEVFDNEVRILGKARHQSLTALKDYYWTPQLQLLVSEFAPNGNLQSKLHE  1049


 Score = 85.1 bits (209),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 48/60 (80%), Gaps = 0/60 (0%)
 Frame = -1

Query  973  KLTSSKILQYPEDFDREVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHE  794
            +L +S ILQ+ E FD EVR+ GKA+HQ+L  L+ YYWTPQLQLLV +F P GNL+SKLHE
Sbjct  896  ELITSNILQFLEVFDTEVRIPGKAKHQSLTALKDYYWTPQLQLLVFEFAPNGNLQSKLHE  955



>emb|CBI39439.3| unnamed protein product [Vitis vinifera]
Length=803

 Score =   461 bits (1187),  Expect = 9e-149, Method: Compositional matrix adjust.
 Identities = 256/421 (61%), Positives = 317/421 (75%), Gaps = 28/421 (7%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G IP DIC+SGSLGILQLDGNSLTG IP + GNCSSL LLS+SHN L+G+IP++ +ML
Sbjct  356   LFGSIPGDICDSGSLGILQLDGNSLTGPIPDEFGNCSSLYLLSMSHNELNGSIPKSFAML  415

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
             K+L+IL+LE N+LSGEIP++LG LENLLAVNVSYNRL GRLP G IFQ+LD SA++GN G
Sbjct  416   KKLEILRLEFNELSGEIPRELGSLENLLAVNVSYNRLIGRLPVGGIFQSLDQSALQGNLG  475

Query  1456  ICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRFLsvsaiva  1277
             ICSPLL GPCK+N  KP+V++P+ +G   +  N  +  E   +    RHH FLS      
Sbjct  476   ICSPLLKGPCKLNVSKPLVLDPYDFGKPINGQNRRN--ESTTTPMRFRHHMFLS------  527

Query  1276  isaaaiiavgvmvITMVNASVRRRISFVENALESMCSSTSSRSQGMATGKLILFDTKSSP  1097
                             V+A +    +           S+SSRS    TGKLILFD+++S 
Sbjct  528   ----------------VSAIIAITAAAFILIGVVSMCSSSSRSGSPPTGKLILFDSRASQ  571

Query  1096  DWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDFDREVR  917
             DW ++  E++LNKA+EIG GVFGTVYK  LGG G+R+VAIKKL +S I+QYPEDFDREVR
Sbjct  572   DWIANP-ENLLNKAAEIGGGVFGTVYKVSLGG-GARMVAIKKLVTSNIIQYPEDFDREVR  629

Query  916   VLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAVRFKII  737
             +LGKARHQNL+ L+GYYWTPQLQLLV+D+ P G+L+++LHE      TPPL+W  RF+II
Sbjct  630   ILGKARHQNLISLKGYYWTPQLQLLVTDYAPNGSLQARLHERPPT--TPPLSWPNRFRII  687

Query  736   LGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVMSNRFQ  557
             LGTAKGLAHLHHS +PPIIHYN+KPSNILLDEN NP ISD+GLARL+ KLD+HV+S+RFQ
Sbjct  688   LGTAKGLAHLHHSFRPPIIHYNLKPSNILLDENCNPMISDYGLARLLTKLDKHVISSRFQ  747

Query  556   A  554
             +
Sbjct  748   S  748


 Score = 55.5 bits (132),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 67/118 (57%), Gaps = 3/118 (3%)
 Frame = -1

Query  1810  GEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSMLKR  1631
             G+ P+ I    S+  +   GN  TG++P  +GN  SL  LSLS N L+G+IP +L    +
Sbjct  190   GDFPQWIGSMSSVEYVDFSGNGFTGSLPASMGNLKSLQFLSLSDNRLTGSIPGSLFYCPK  249

Query  1630  LKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGS--IFQNLDSSAIEGN  1463
             L +++L  N  SG IP+ L  L  L  V++S N L G +P GS  +F++L S  +  N
Sbjct  250   LSVIRLRGNGFSGSIPEGLFDL-GLDEVDLSGNELEGPIPPGSSRLFESLHSLDLSRN  306


 Score = 55.1 bits (131),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/45 (56%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = -3

Query  323  SVACFEAGFGVYFPDTFEQAFHGGSGADLAGYQDSCSKQNGTILS  189
            SVA  E G G++F DTF+QA+HGGSGAD +G+QD  S  +G++L+
Sbjct  748  SVASSEVGPGMHFSDTFKQAYHGGSGADTSGHQDPNSTTDGSLLN  792



>ref|XP_001769840.1| predicted protein [Physcomitrella patens]
 gb|EDQ65402.1| predicted protein [Physcomitrella patens]
Length=947

 Score =   441 bits (1134),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 264/537 (49%), Positives = 357/537 (66%), Gaps = 29/537 (5%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             +A+ G IP  +  +  L +L L  N L G IP Q+G+CS+L  L+L+ N L+G +P TL+
Sbjct  428   NAMYGVIPPSLGSAARLTVLDLHRNKLGGVIPFQLGSCSALAFLNLAQNLLNGPMPGTLT  487

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGN  1463
              L  L  L L  N L+G+IP     +++L  VN+S+N LTG +P    F N   S + GN
Sbjct  488   NLTSLAFLDLSSNNLTGDIPPGFENMKSLQKVNISFNHLTGPIPNSGAFSN--PSEVSGN  545

Query  1462  DGICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRFLsvsai  1283
              G+C  L+   C    PKPIV+NP    N T             S  + +    LS+SAI
Sbjct  546   PGLCGNLIGVACPPGTPKPIVLNP----NST-------------SLVHVKREIVLSISAI  588

Query  1282  vaisaaaiiavgvmvITMVNASVRRRISF-VENALESMCSSTSSRSQGMATGKLILF---  1115
             +AISAAA+IAVGV+++T++N   + R        +ES+  S S+  + ++ G+L+L+   
Sbjct  589   IAISAAAVIAVGVILVTVLNIRAQTRAQRNARRGIESVPQSPSN--EHLSLGRLVLYKLP  646

Query  1114  DTKSSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPED  935
                ++ DW + + +++LNK  EIG G FGTVY+A L      +VA+KKL  S +++  E+
Sbjct  647   QKANNQDWLAGSAQALLNKHDEIGRGGFGTVYRAIL--PDGNIVAVKKLLVSSLVKTQEE  704

Query  934   FDREVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWA  755
             F+REV +LGK  HQNLV L+GYYWT QLQLLV D+VP GNL  +LHE       PPL W 
Sbjct  705   FEREVNLLGKISHQNLVTLQGYYWTSQLQLLVYDYVPNGNLYRRLHERRDG--EPPLRWE  762

Query  754   VRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHV  575
              RFKI LGTA GL HLHH C P +IHYN+K +NILL  N   +ISD+GLA+L+  LD +V
Sbjct  763   DRFKIALGTALGLGHLHHGCHPQVIHYNLKSTNILLSHNNVVRISDYGLAKLLPALDSYV  822

Query  574   MSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHV  395
             MS++FQ+A+GY+APE AC SLR+ EKCDVYGFG+L+LE+VTGRRPVEY ED+V+IL DHV
Sbjct  823   MSSKFQSALGYMAPEFACPSLRITEKCDVYGFGVLLLELVTGRRPVEYMEDDVVILCDHV  882

Query  394   RVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIK  224
             R LLE+G  L CVD  M  YP++EVLPV+KL L+CTS +PS+RPSM EVVQIL++I+
Sbjct  883   RALLEEGRPLSCVDSHMNSYPEDEVLPVIKLGLICTSHVPSNRPSMEEVVQILELIR  939


 Score = 62.8 bits (151),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 49/106 (46%), Positives = 67/106 (63%), Gaps = 1/106 (1%)
 Frame = -1

Query  1822  SALIGEIPEDICES-GSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETL  1646
             +A+ G + ED   S  SL  L L GNSL G+IP  +G+C  LT LSL+HN LSG IP  L
Sbjct  115   NAMTGPMAEDFFTSCQSLVSLYLVGNSLNGSIPASVGSCFQLTDLSLAHNLLSGEIPGEL  174

Query  1645  SMLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPA  1508
               L  L  + L  N L+G IP +LG L++L ++++  N+LTG +PA
Sbjct  175   GQLPNLVDIDLSHNMLTGTIPAELGALKSLTSLSLMDNKLTGSIPA  220


 Score = 62.8 bits (151),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 62/118 (53%), Gaps = 4/118 (3%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G IP ++    SL  L L  N LTG+IP Q+ NC  +  + +S N+LSGT+P  L  L
Sbjct  190   LTGTIPAELGALKSLTSLSLMDNKLTGSIPAQLSNCGGMLAMDVSQNSLSGTLPPELQSL  249

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAG----SIFQNLDSSA  1475
               L +L    N L+G+ P  LG L  L  ++ + NR TG +P       + Q LD S 
Sbjct  250   TSLALLNGRNNMLTGDFPPWLGHLNRLQVLDFATNRFTGAVPTSLGQLQVLQVLDLSG  307


 Score = 56.2 bits (134),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 39/120 (33%), Positives = 65/120 (54%), Gaps = 0/120 (0%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             ++L G +P ++    SL +L    N LTG  PP +G+ + L +L  + N  +G +P +L 
Sbjct  236   NSLSGTLPPELQSLTSLALLNGRNNMLTGDFPPWLGHLNRLQVLDFATNRFTGAVPTSLG  295

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGN  1463
              L+ L++L L  N L G IP  +G    L ++++S N LTG +P   +  N+    + GN
Sbjct  296   QLQVLQVLDLSGNLLLGTIPVDIGSCMRLQSLDLSNNNLTGSIPPELLALNVQFLNVAGN  355



>ref|XP_001771841.1| predicted protein [Physcomitrella patens]
 gb|EDQ63270.1| predicted protein [Physcomitrella patens]
Length=963

 Score =   437 bits (1123),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 265/541 (49%), Positives = 352/541 (65%), Gaps = 30/541 (6%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             + L G IP  +     L +L L  N L G IP QIG+C +L  L+L+ N LSG IPE+L+
Sbjct  443   NVLDGNIPPSLGTVTRLTVLDLHHNRLGGEIPTQIGSCLALANLNLAENKLSGPIPESLT  502

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGN  1463
              L  L  L L  N L+G IPQ   K+++L  VN+S+N LTG +P    F N   S + GN
Sbjct  503   NLTSLAFLDLSSNNLTGTIPQGFEKMKSLQKVNISFNHLTGPIPTSGAFSN--PSEVLGN  560

Query  1462  DGICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRFLsvsai  1283
              G+C  L+   C   APKPIV+NP    N T                  +    LS+SAI
Sbjct  561   SGLCGTLIGVACSPGAPKPIVLNP----NSTALVQV-------------KREIVLSISAI  603

Query  1282  vaisaaaiiavgvmvITMVNASVRRRISFVENALESMCS-STSSRSQGMATGKLILFDTK  1106
             +AISAAA+IAVGV+++T++N  +R +     NA   M S S S  ++  + G L+ +   
Sbjct  604   IAISAAAVIAVGVILVTVLN--IRSQTRARRNARRGMESVSQSPSNKHFSEGSLVFYKGP  661

Query  1105  ---SSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPED  935
                ++ +W   + + + NK  EIG G FGTVY+A L       VA+KKL  + +++  E+
Sbjct  662   QKITNQNWPVGSVQGLTNKQDEIGRGGFGTVYRAVL--PKGNTVAVKKLLVASLVKTQEE  719

Query  934   FDREVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWA  755
             F+REV  LGK  H+NLV L+GYYWTPQLQLL+ D+VP GNL  +LHE       PPL W 
Sbjct  720   FEREVNPLGKISHRNLVTLQGYYWTPQLQLLLYDYVPNGNLYRRLHERRDV--EPPLQWD  777

Query  754   VRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHV  575
              RFKI LGTA GL HLHH CQP +IHY++K +NILL  N    ISD+GLARL+  LDR++
Sbjct  778   DRFKIALGTALGLGHLHHGCQPQVIHYDLKSTNILLSHNNEAHISDYGLARLLPTLDRYI  837

Query  574   MSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHV  395
             + ++FQ+A+GY+APE +C SLR+ EKCDVYGFG+L+LE+VTGRRPVEY ED+V+IL DHV
Sbjct  838   LGSKFQSALGYMAPEFSCPSLRITEKCDVYGFGVLLLELVTGRRPVEYMEDDVVILCDHV  897

Query  394   RVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPV  215
             R LLE G  L CVD  M  YP++EVLPV+KLAL+CTS +PS+RP+M EVVQIL++I+ P+
Sbjct  898   RALLEGGRPLTCVDSTMLPYPEDEVLPVIKLALICTSHVPSNRPAMEEVVQILELIR-PI  956

Query  214   P  212
             P
Sbjct  957   P  957


 Score = 59.3 bits (142),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 44/118 (37%), Positives = 61/118 (52%), Gaps = 4/118 (3%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G IP ++    SL  L L  N LTG+IP Q+ NC S+  + +S N+LSG +P  L  L
Sbjct  205   LTGTIPAELGALKSLTSLSLMDNKLTGSIPGQLSNCVSILAMDVSQNSLSGVLPPDLQSL  264

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAG----SIFQNLDSSA  1475
               L +     N +SG+ P  LG L  L  ++ + NR TG +P       + Q LD S 
Sbjct  265   TSLALFNGRNNMISGDFPTWLGSLNRLQVLDFANNRFTGAVPKSLGQLQVLQVLDLSG  322


 Score = 53.9 bits (128),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 62/106 (58%), Gaps = 1/106 (1%)
 Frame = -1

Query  1822  SALIGEIPEDICES-GSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETL  1646
             +AL G + E    +  SL  L L GN L G IPP I +C+ LT LSLSHN  SG IP   
Sbjct  130   NALTGPMAEKFFTTCQSLVSLYLGGNLLNGPIPPSIISCTQLTDLSLSHNLFSGEIPGGF  189

Query  1645  SMLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPA  1508
               LK L  +    N L+G IP +LG L++L ++++  N+LTG +P 
Sbjct  190   GQLKSLVNIDFSHNLLTGTIPAELGALKSLTSLSLMDNKLTGSIPG  235



>ref|XP_004502826.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Cicer arietinum]
Length=970

 Score =   436 bits (1122),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 266/542 (49%), Positives = 354/542 (65%), Gaps = 23/542 (4%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G IP +IC +GSL  L L+ N L G IP  I NCS+LT L LS N LSG+IP T++ L
Sbjct  446   LNGSIPWEICGAGSLKELILENNFLVGEIPTSIENCSALTTLILSKNRLSGSIPATVAKL  505

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
               L+ + L  N L G +P+QL  L NLL  N+S+N L G LPAG  F  +  S++ GN  
Sbjct  506   SNLQTVDLSFNNLIGILPKQLANLPNLLTFNLSHNNLRGELPAGGFFNTISPSSVSGNPF  565

Query  1456  ICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRFLsvsaiva  1277
             +C   +   C    PKPIV+NP    N T + +    +  +   RN      LS+SA++A
Sbjct  566   LCGSAVNKKCPTKLPKPIVLNP----NITTDPDQSSLSPTMGRKRN-----ILSISALIA  616

Query  1276  isaaaiiavgvmvITMVNASVRRRISFVENALESMCSSTSSRS--QGMATGKLILFDTKS  1103
             I AAA+I +GV+ IT++N  VR   S    AL        SRS      +GKL++F  + 
Sbjct  617   IGAAAVIVIGVISITVLNLRVRSTTSRSPVALAFSAGDEFSRSPTTDANSGKLVMFSGE-  675

Query  1102  SPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDFDRE  923
              PD++S    ++LNK  E+G G FG VY+  LG    R VAIKKLT S +++  EDF+RE
Sbjct  676   -PDFSSGA-HALLNKDCELGRGGFGAVYQTVLGD--GRSVAIKKLTVSSLVKSQEDFERE  731

Query  922   VRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAVRFK  743
             V+ LGK RHQNLV L GYYWT  LQLL+ +FV  G+L   LHE         L+W  RF 
Sbjct  732   VKKLGKVRHQNLVELEGYYWTSSLQLLIYEFVSRGSLYKHLHE---GSGENFLSWNERFN  788

Query  742   IILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVMSNR  563
             +ILGTAK LAHLHHS    IIHYNIK +N+L+D    PK+ DFGLARL+  LDR+V+S++
Sbjct  789   VILGTAKALAHLHHS---NIIHYNIKSTNVLIDSYGEPKVGDFGLARLLPMLDRYVLSSK  845

Query  562   FQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRVLL  383
              Q+A+GY+APE AC+++++ EKCDVYGFG+L+LEIVTG+RPVEY ED+V++L D VR  L
Sbjct  846   IQSALGYMAPEFACKTVKITEKCDVYGFGVLVLEIVTGKRPVEYMEDDVVVLCDMVRGAL  905

Query  382   EQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPVPNR  206
             ++G V EC+D+ + G +P EEV+PV+KL LVCTSQ+PS+RP M EVV IL++I+ P   +
Sbjct  906   DEGRVEECIDERLQGKFPVEEVIPVIKLGLVCTSQVPSNRPDMGEVVTILELIRCPSEGQ  965

Query  205   ME  200
              E
Sbjct  966   EE  967


 Score = 67.4 bits (163),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 66/105 (63%), Gaps = 1/105 (1%)
 Frame = -1

Query  1816  LIGEIPEDIC-ESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSM  1640
             L G +P+D   + GS+ ++ L GN  +G IP  +G+CS++  + LS N  SG++P+ +  
Sbjct  129   LSGVVPDDFFRQCGSMRVVSLAGNMFSGNIPSSLGSCSAIATIDLSFNQFSGSVPKEVWT  188

Query  1639  LKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAG  1505
             L  L+ L L  N L G+IPQ +  L+NL ++N++ N  +G++P G
Sbjct  189   LSGLRSLDLSDNLLEGDIPQDVTALKNLRSINLARNSFSGKIPNG  233


 Score = 57.0 bits (136),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 38/105 (36%), Positives = 56/105 (53%), Gaps = 0/105 (0%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             ++  G +P D+      G   L GN+ +G +P  IG    L  L LS N  SG +P +L 
Sbjct  248   NSFTGGLPIDLKGLVLCGYFSLRGNAFSGDVPEWIGEMKGLQTLDLSMNRFSGLVPNSLG  307

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPA  1508
              L  LK L L  N  +G +P+ +    NLLA++VS N ++G LP+
Sbjct  308   NLWSLKRLNLSANGFTGNLPESMANCTNLLALDVSQNLMSGDLPS  352


 Score = 55.1 bits (131),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 37/124 (30%), Positives = 65/124 (52%), Gaps = 6/124 (5%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G+IP+D+    +L  + L  NS +G IP   G+C  L  +    N+ +G +P  L  L
Sbjct  202   LEGDIPQDVTALKNLRSINLARNSFSGKIPNGFGSCLLLRSIDFGDNSFTGGLPIDLKGL  261

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPA--GSIFQ----NLDSSA  1475
                    L  N  SG++P+ +G+++ L  +++S NR +G +P   G+++     NL ++ 
Sbjct  262   VLCGYFSLRGNAFSGDVPEWIGEMKGLQTLDLSMNRFSGLVPNSLGNLWSLKRLNLSANG  321

Query  1474  IEGN  1463
               GN
Sbjct  322   FTGN  325



>dbj|BAF79960.1| receptor-like kinase [Marchantia polymorpha]
Length=979

 Score =   434 bits (1117),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 264/543 (49%), Positives = 361/543 (66%), Gaps = 25/543 (5%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L+G IP  +  +  + +L+L  N+ +G IP ++GN + L  L+LS NNLSG IP  L  L
Sbjct  454   LLGPIPSTLGNATQIRVLRLQRNNFSGPIPAELGNSTLLIELNLSENNLSGPIPLELGKL  513

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
               L++L L  N  SG IP+ LG L  L+ ++VS+N+L G +P   IF  ++++A E N G
Sbjct  514   ADLEMLDLSHNSFSGVIPEGLGLLTKLVVIDVSHNQLQGPIPTDGIFSQMNTTAFEQNAG  573

Query  1456  ICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRFLsvsaiva  1277
             +C   +   C    P P++I+P       D N       PL   R+ R    LSVSAI A
Sbjct  574   LCGTAVNISCT-TFPNPLIIDP------NDPNAIPGTLSPLF--RSKRSQTILSVSAITA  624

Query  1276  isaaaiiavgvmvITMVN--ASVRRRISFVENALESMCSSTSSRSQGMATGKLILFDTKS  1103
             ISAAA IA+GV+++T++N  A  RRR     N         S  +  MA GKL++F  +S
Sbjct  625   ISAAAAIALGVIMVTLLNMYAQTRRR----SNIFTIDSDPQSPSAAEMAMGKLVMFTRRS  680

Query  1102  SP---DWASSTFESVLNKASEIGEGVFGTVYKAPLG-GEGSRVVAIKKLTSSKILQYPED  935
              P   DW +S   ++LNK  EIG G FGTV+KA L  GE    VA+KKL    +++   +
Sbjct  681   DPKSDDWMASA-HAILNKDCEIGRGGFGTVFKAILAHGE---TVAVKKLMVQSLVKSQGE  736

Query  934   FDREVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWA  755
             F++ V +LG  +H NLV L+GYYWT QLQLLV D+VP GNL S+LHE       PPL+W 
Sbjct  737   FEKVVHMLGNVKHPNLVGLQGYYWTDQLQLLVYDYVPNGNLYSQLHERRED--EPPLSWR  794

Query  754   VRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHV  575
             +RF+I LGTA GLAHLHH C P +IHY++K SN+LLD+    +ISD+ LA+L+ KLD +V
Sbjct  795   LRFRIALGTALGLAHLHHGCVPSLIHYDVKSSNVLLDDEYEARISDYSLAKLLPKLDTYV  854

Query  574   MSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHV  395
             MS++ Q+A+GY+APE ACQSL++ EKCDVYGFG+L+LE+VTGRRPVEY ED+V+IL D V
Sbjct  855   MSSKMQSALGYMAPEFACQSLKITEKCDVYGFGVLLLELVTGRRPVEYMEDDVVILCDFV  914

Query  394   RVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPV  215
             R LL++G  L CVD  +  +P++EVLP++KL L+CTSQ+PS+RPSMAEVVQIL++I+  V
Sbjct  915   RALLDEGRALSCVDSKLLSFPEDEVLPIIKLGLICTSQVPSNRPSMAEVVQILELIRPLV  974

Query  214   PNR  206
              +R
Sbjct  975   ESR  977


 Score = 72.4 bits (176),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 49/124 (40%), Positives = 77/124 (62%), Gaps = 3/124 (2%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIG--NCssltllslshnnlSGTIPET  1649
             +AL G IP     +G+L  L L  N+ TGT+PP++   NC SL ++S+S N+L G IP +
Sbjct  138   NALSGSIPASFGSAGNLYALDLSNNAFTGTLPPELFSYNCQSLRIVSVSVNSLEGPIPAS  197

Query  1648  LSMLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIF-QNLDSSAI  1472
             +     ++ L    N LSG+IP  +  LE+LL +++S+N LTG++P G  F +NL S  +
Sbjct  198   IGSCFEVQSLNFSYNSLSGKIPDGIWALESLLDIDLSFNLLTGQIPVGVGFLKNLTSLRL  257

Query  1471  EGND  1460
             + N+
Sbjct  258   QSNN  261


 Score = 57.0 bits (136),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 44/131 (34%), Positives = 71/131 (54%), Gaps = 3/131 (2%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G +P ++   G L  L L+ NSL G +P Q+GN  SL   ++  N LSG++P  +  +
Sbjct  262   LSGGVPAELGNCGLLEHLVLNNNSLIGELPIQLGNLKSLVTFNVRDNFLSGSVPSWVVNM  321

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSI-FQNLDSSAIEGND  1460
               ++ L L  N  SG+IP  +G L  L ++++S N  +G +P   +  QNL   ++  N 
Sbjct  322   TFIRELNLASNGFSGQIPSFIGFLYQLSSIDLSANNFSGPVPHEMMTLQNLQYVSLSDNS  381

Query  1459  --GICSPLLTG  1433
               G+  P L+G
Sbjct  382   LTGVIPPFLSG  392


 Score = 55.5 bits (132),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 41/109 (38%), Positives = 66/109 (61%), Gaps = 6/109 (6%)
 Frame = -1

Query  1822  SALIGEIPEDI----CESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIP  1655
             +A  G +P ++    C+S  L I+ +  NSL G IP  IG+C  +  L+ S+N+LSG IP
Sbjct  162   NAFTGTLPPELFSYNCQS--LRIVSVSVNSLEGPIPASIGSCFEVQSLNFSYNSLSGKIP  219

Query  1654  ETLSMLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPA  1508
             + +  L+ L  + L  N L+G+IP  +G L+NL ++ +  N L+G +PA
Sbjct  220   DGIWALESLLDIDLSFNLLTGQIPVGVGFLKNLTSLRLQSNNLSGGVPA  268


 Score = 54.3 bits (129),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 36/104 (35%), Positives = 59/104 (57%), Gaps = 0/104 (0%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             ++LIGE+P  +    SL    +  N L+G++P  + N + +  L+L+ N  SG IP  + 
Sbjct  284   NSLIGELPIQLGNLKSLVTFNVRDNFLSGSVPSWVVNMTFIRELNLASNGFSGQIPSFIG  343

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP  1511
              L +L  + L  N  SG +P ++  L+NL  V++S N LTG +P
Sbjct  344   FLYQLSSIDLSANNFSGPVPHEMMTLQNLQYVSLSDNSLTGVIP  387


 Score = 54.3 bits (129),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 36/104 (35%), Positives = 60/104 (58%), Gaps = 2/104 (2%)
 Frame = -1

Query  1810  GEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML--  1637
             G +  ++ E   L +L +  N+L+G+IP   G+  +L  L LS+N  +GT+P  L     
Sbjct  118   GPLNGELAEFSDLKVLNVSHNALSGSIPASFGSAGNLYALDLSNNAFTGTLPPELFSYNC  177

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAG  1505
             + L+I+ + VN L G IP  +G    + ++N SYN L+G++P G
Sbjct  178   QSLRIVSVSVNSLEGPIPASIGSCFEVQSLNFSYNSLSGKIPDG  221



>ref|XP_011084816.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Sesamum indicum]
Length=972

 Score =   433 bits (1113),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 258/543 (48%), Positives = 361/543 (66%), Gaps = 26/543 (5%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G IP +I    SL  L L+ NSL G IP  IGNC+ L  L L+HN ++G+IP +L+ L
Sbjct  447   LNGSIPSEIGLLKSLNELSLEKNSLWGNIPTSIGNCAGLISLCLAHNEITGSIPASLAKL  506

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
               L ++    N+L+G IP+QL  L +L   N+S+N+L G LPAG+ F  +D S++ GN  
Sbjct  507   TYLTVVDFSFNRLTGAIPKQLANLASLQLFNISHNQLQGELPAGAFFNTIDPSSLFGNPS  566

Query  1456  ICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRN-SRHHRFLsvsaiv  1280
             +C  ++   C    PKPIV+NP    N TD         P   T++  R  + LS+SA++
Sbjct  567   LCGAVVNRSCPTVLPKPIVLNP----NSTDAT-------PSTITQSLGRGKKILSISALI  615

Query  1279  aisaaaiiavgvmvITMVNASVRRRISFVENALESMCSSTSSRSQGMA--TGKLILFDTK  1106
             AI AAA I +GV+ IT++N  VR   S    AL    +   S S      +GKL++F   
Sbjct  616   AIGAAAAIVIGVIAITVLNLRVRAATSRSAVALNFSGADDFSHSPSTDGDSGKLVMF--S  673

Query  1105  SSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDFDR  926
               PD++++T  ++LNK  E+G G FG VY+  LG    R VAIKKLT S +++  EDF+R
Sbjct  674   GDPDFSTAT-HALLNKDCELGRGGFGAVYRTILGD--GRSVAIKKLTVSSLVKSQEDFER  730

Query  925   EVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAVRF  746
             EV+ LGK  H NLV L GYYWTP LQLL+ +FV  GNL   LHE     A   L+W  RF
Sbjct  731   EVKKLGKVHHSNLVALHGYYWTPSLQLLIYEFVSGGNLYKHLHE---GSAESYLSWNERF  787

Query  745   KIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVMSN  566
              IILG AKGLAHLH   Q  +IHYN+K SNIL+D +  PK++D+GLA+L+  LDR+V+S+
Sbjct  788   NIILGAAKGLAHLH---QMNVIHYNLKSSNILIDSSGEPKVADYGLAKLLPMLDRYVLSS  844

Query  565   RFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRVL  386
             + Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE+VTG+RPVEY ED+V++L+D VR  
Sbjct  845   KIQSALGYMAPEFACKTVKITEKCDVYGFGILVLEVVTGKRPVEYMEDDVVVLSDMVRGA  904

Query  385   LEQGNVLECVD-QGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPVPN  209
             +E+G V +CVD + +G +P +E +PV+KL L+CTSQ+PS+RP MAEVV IL++I++P  +
Sbjct  905   MEEGKVEDCVDARFLGKFPVDEAIPVIKLGLICTSQVPSNRPDMAEVVNILELIRSPSES  964

Query  208   RME  200
             + E
Sbjct  965   QDE  967


 Score = 61.6 bits (148),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 44/103 (43%), Positives = 61/103 (59%), Gaps = 1/103 (1%)
 Frame = -1

Query  1810  GEIPEDI-CESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSMLK  1634
             G IP D   + GSL  + L  N  +G IP  +G+CS+L  L+LS N  SG++P  L  L 
Sbjct  132   GSIPSDFFSQCGSLRSISLAKNRFSGPIPESLGSCSTLAALNLSGNQFSGSLPFQLWSLS  191

Query  1633  RLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAG  1505
              L+ L L  N L GEIP+ +  L NL A+++  N+LTG +P G
Sbjct  192   GLRALDLSDNLLDGEIPKGIEALNNLRAISLRNNQLTGEVPEG  234


 Score = 60.8 bits (146),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 43/119 (36%), Positives = 68/119 (57%), Gaps = 0/119 (0%)
 Frame = -1

Query  1810  GEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSMLKR  1631
             G IPE +    +L  L L GN  +G++P Q+ + S L  L LS N L G IP+ +  L  
Sbjct  157   GPIPESLGSCSTLAALNLSGNQFSGSLPFQLWSLSGLRALDLSDNLLDGEIPKGIEALNN  216

Query  1630  LKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDGI  1454
             L+ + L  NQL+GE+P+ +G    L ++++S N L+G LP+     +L +  + GN+G 
Sbjct  217   LRAISLRNNQLTGEVPEGIGNCLLLRSIDLSQNLLSGGLPSTMQKLSLCNDLVLGNNGF  275


 Score = 60.8 bits (146),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 58/102 (57%), Gaps = 0/102 (0%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L GEIP+ I    +L  + L  N LTG +P  IGNC  L  + LS N LSG +P T+  L
Sbjct  203   LDGEIPKGIEALNNLRAISLRNNQLTGEVPEGIGNCLLLRSIDLSQNLLSGGLPSTMQKL  262

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP  1511
                  L L  N   GE+PQ +G + +L+ +++S N  TG++P
Sbjct  263   SLCNDLVLGNNGFIGEVPQWIGDMRSLVTLDLSENNFTGQVP  304


 Score = 56.6 bits (135),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 52/86 (60%), Gaps = 0/86 (0%)
 Frame = -1

Query  1765  LQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSMLKRLKILKLEVNQLSGEI  1586
             L L  N   G +P  IG+  SL  L LS NN +G +P++L  L+ +KI  +  N L+G +
Sbjct  268   LVLGNNGFIGEVPQWIGDMRSLVTLDLSENNFTGQVPDSLGKLRSVKIFNVSKNALTGSL  327

Query  1585  PQQLGKLENLLAVNVSYNRLTGRLPA  1508
             P+ +    NLLA ++S+N LTG LP+
Sbjct  328   PEAMSNCVNLLAFDISHNSLTGNLPS  353



>ref|XP_009406870.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Musa acuminata subsp. malaccensis]
 ref|XP_009406871.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Musa acuminata subsp. malaccensis]
Length=969

 Score =   430 bits (1106),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 266/547 (49%), Positives = 371/547 (68%), Gaps = 26/547 (5%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G IP ++  + SL  ++L+ NSLT  IP QIG+CSSL  L LS NNL+G IPETL+ L
Sbjct  442   LSGSIPLEVGLAASLREMRLEKNSLTAEIPIQIGSCSSLAYLDLSQNNLTGPIPETLANL  501

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
               L+++    NQLSG IP+QL  L +LL+ N+S+N+L+G LPAGS F  +  S++  N G
Sbjct  502   TNLQVVDFSRNQLSGTIPKQLADLPHLLSFNISHNQLSGDLPAGSFFNKIPPSSVTDNPG  561

Query  1456  ICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRF-Lsvsaiv  1280
             +C  ++   C    PKPIV+NP       ++++G  ++ P+ S  N  H +  LS+SA++
Sbjct  562   LCGSVVNLSCPGVLPKPIVLNP-------NSSSGDSSSNPVLSPSNLGHKKIILSISALI  614

Query  1279  aisaaaiiavgvmvITMVNASVRRRISFVENALESMCSSTSSRSQGMAT----GKLILFD  1112
             AI AAA+IA+GV+ IT++N  VR   S   N+   +  S    S   AT    GKL++F 
Sbjct  615   AIGAAAVIALGVITITVLNLRVRSSTS---NSAAGLALSDGYLSHSPATDANSGKLVMF-  670

Query  1111  TKSSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDF  932
                 P++++    +VLNK  E+G G FG VYK  L     R VAIKKLT S +++  +DF
Sbjct  671   AGGDPEFSAGA-HAVLNKDCELGRGGFGAVYKTVL--RDGRSVAIKKLTVSSLVKSQDDF  727

Query  931   DREVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAV  752
             ++EV+ LGK +H NLV L GYYWTP LQLL+ +FVP G+L + LHE +   A+  L+W  
Sbjct  728   EKEVKRLGKVQHPNLVALEGYYWTPSLQLLIYEFVPGGSLYNHLHECS---ASDTLSWQE  784

Query  751   RFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVM  572
             RF IILG AK LAHLHH     IIHYNIK SN+LLD +   K+ D+GLA+L+  LDR+V+
Sbjct  785   RFDIILGIAKSLAHLHH---LKIIHYNIKSSNVLLDGSGEAKVGDYGLAKLLPMLDRYVL  841

Query  571   SNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVR  392
             S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LEI+TG+RPVEY ED+V++L D VR
Sbjct  842   SSKIQSALGYMAPEFACRTVKITEKCDVYGFGVLVLEILTGKRPVEYMEDDVVLLCDMVR  901

Query  391   VLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPV  215
               LE+G V EC+D  + G +P EE +PV+KL L+CTSQ+PS+RP MAEVV IL++I+ P 
Sbjct  902   EALEEGRVEECMDGRLCGKFPLEETIPVIKLGLICTSQVPSNRPDMAEVVNILELIRCPQ  961

Query  214   PNRMEPY  194
               R E +
Sbjct  962   DGRQEEF  968


 Score = 60.1 bits (144),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 42/103 (41%), Positives = 57/103 (55%), Gaps = 0/103 (0%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G++P  +    +   L L  NS +G +P  IG  + L  L LS N  SG  P +LS L
Sbjct  251   LSGDLPYSMRNLSTCTYLSLSSNSFSGELPAWIGEMNGLETLDLSGNKFSGGFPSSLSNL  310

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPA  1508
             + LK+LKL  N  SG +P  L    +LL V++S N LTG LP+
Sbjct  311   QLLKVLKLSDNSFSGGLPDSLAACRSLLDVDLSRNTLTGNLPS  353


 Score = 59.7 bits (143),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 43/103 (42%), Positives = 64/103 (62%), Gaps = 1/103 (1%)
 Frame = -1

Query  1816  LIGEIPEDIC-ESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSM  1640
             L G IP+    +  S+  + L  NS++G IPP +G+CS+L  L+LS N LSG++P  +  
Sbjct  130   LSGTIPDGFFGQCRSIRDISLAKNSISGKIPPDVGSCSTLVSLNLSSNQLSGSLPSEIWS  189

Query  1639  LKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP  1511
             L  L+ L L  N L GEIP  + ++ NL  +++  NRLTG+LP
Sbjct  190   LNALRSLDLSDNSLVGEIPLGISRMFNLRMISLRRNRLTGQLP  232


 Score = 58.9 bits (141),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 58/105 (55%), Gaps = 0/105 (0%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             ++L+GEIP  I    +L ++ L  N LTG +P   GNC  L  L +  N LSG +P ++ 
Sbjct  201   NSLVGEIPLGISRMFNLRMISLRRNRLTGQLPNDTGNCMLLKSLDVGENQLSGDLPYSMR  260

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPA  1508
              L     L L  N  SGE+P  +G++  L  +++S N+ +G  P+
Sbjct  261   NLSTCTYLSLSSNSFSGELPAWIGEMNGLETLDLSGNKFSGGFPS  305



>ref|XP_011001391.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Populus euphratica]
Length=963

 Score =   430 bits (1105),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 264/537 (49%), Positives = 354/537 (66%), Gaps = 25/537 (5%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G IP +I  + +L  L+L+ NSL+G IP  IGNCSSL  L LSHNNL+GTIP  ++ L
Sbjct  440   LNGSIPTEIGGAFALKELRLERNSLSGKIPDSIGNCSSLMTLILSHNNLAGTIPAAIAKL  499

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
               LK + L +N L+G +P+QL  L NL++ N+S+N L G LPAG  F  +  S++ GN  
Sbjct  500   GNLKDVDLSLNSLTGSLPKQLANLPNLISFNISHNNLQGELPAGVFFNTISPSSVSGNPS  559

Query  1456  ICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRF-Lsvsaiv  1280
             +C   +   C    PKPIV+NP    + T          P +  +N  H R  LS+SA++
Sbjct  560   LCGAAVNKSCPAVLPKPIVLNPNSSSDST----------PGSLPQNPGHKRIILSISALI  609

Query  1279  aisaaaiiavgvmvITMVNASVRRRISFVENALESMCSS--TSSRSQGMATGKLILFDTK  1106
             AI AAA+I VGV+ IT++N  VR   S    AL        + S +    +GKL++F  K
Sbjct  610   AIGAAAVIVVGVIAITVLNLRVRSSTSRSAAALTLSAGDGFSDSPTTDANSGKLVMFTGK  669

Query  1105  SSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDFDR  926
               PD+++    ++LNK  E+G G FG VY+  L       VAIKKLT S +++  EDF+R
Sbjct  670   --PDFSTGA-HALLNKDCELGRGGFGAVYQTVL--RDGHPVAIKKLTVSSLVKSQEDFER  724

Query  925   EVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAVRF  746
             EV+ LGK RHQNLV L GYYWT  LQLL+ +FV  G+L   LHE +       L+W  RF
Sbjct  725   EVKKLGKIRHQNLVALEGYYWTQSLQLLIYEFVSGGSLYKHLHEGSGGHF---LSWNERF  781

Query  745   KIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVMSN  566
              IILGTAK LAHLH   Q  IIHYNIK SN+LLD +  PK+ DFGLARL+  LDR+V+S+
Sbjct  782   NIILGTAKSLAHLH---QSNIIHYNIKSSNVLLDSSGEPKVGDFGLARLLPMLDRYVLSS  838

Query  565   RFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRVL  386
             + Q+A+GY+APE AC+++++ EKCDVYGFG+L+LEIVTG+RPVEY ED+V++L D VR  
Sbjct  839   KIQSALGYMAPEFACRTVKITEKCDVYGFGVLVLEIVTGKRPVEYMEDDVVVLCDMVRGA  898

Query  385   LEQGNVLECVD-QGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTP  218
             LE+G V ECVD + MG +P +EV+PV+KL L+CT Q+PS+RP M EV+ IL +I+ P
Sbjct  899   LEEGRVEECVDGRLMGNFPADEVVPVMKLGLICTLQVPSNRPDMGEVINILDLIRCP  955


 Score = 59.3 bits (142),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 40/103 (39%), Positives = 57/103 (55%), Gaps = 0/103 (0%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G +P+ + + G    L L  N  TG +P  IG  + L  L LS N  SG +P ++  L
Sbjct  253   LSGHVPDTMQKLGLCDYLSLSSNMFTGEVPSWIGELNRLETLDLSGNRFSGQVPISIGKL  312

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPA  1508
             + LK+L L  N LSG +P+ +    NLLA++ S N L+G LP 
Sbjct  313   QLLKVLNLSANGLSGNLPESMANCGNLLALDFSQNLLSGDLPT  355


 Score = 57.0 bits (136),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 56/102 (55%), Gaps = 0/102 (0%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L GEIP+ I    +L  + L  N   G +P  IG+C  L  +  S N LSG +P+T+  L
Sbjct  205   LDGEIPKGIEVLNNLRRINLSKNRFNGEVPNGIGSCLLLRSVDFSENMLSGHVPDTMQKL  264

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP  1511
                  L L  N  +GE+P  +G+L  L  +++S NR +G++P
Sbjct  265   GLCDYLSLSSNMFTGEVPSWIGELNRLETLDLSGNRFSGQVP  306



>ref|XP_009416322.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 isoform X2 [Musa acuminata subsp. 
malaccensis]
Length=870

 Score =   427 bits (1098),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 248/537 (46%), Positives = 354/537 (66%), Gaps = 23/537 (4%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G IP ++  + SL  L+L+GNSLT  IP QIG+CSSL  L LS NNL+G+IPETL+ L
Sbjct  343   LSGRIPSEVALATSLRELRLEGNSLTREIPVQIGSCSSLAYLDLSQNNLTGSIPETLANL  402

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
               L+++    N+LSG +P+QL  L +LL+ N+S+N+L+G LPAGS F N+  S++  N G
Sbjct  403   TNLRVVDFSRNRLSGTLPKQLSDLPHLLSFNISHNQLSGGLPAGSFFNNIPPSSLTDNPG  462

Query  1456  ICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRFLsvsaiva  1277
             +C   +   C    PKPIV++P    + +          P+ S RN  H + +   + + 
Sbjct  463   LCGSTVNRSCPGVLPKPIVLDPNSSPDPSS--------NPVLSPRNLSHKKIIFSISALI  514

Query  1276  isaaaiiavgvmvITMVNASVRRRISFVENALESMCSS---TSSRSQGMATGKLILFDTK  1106
                AA +    ++ T+   + R   S   +A+E   S    + S      +GKL++F   
Sbjct  515   AIVAAAVIALGVI-TITVLNFRAHASASNSAVELALSDEYLSHSPVTDANSGKLVMF-AG  572

Query  1105  SSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDFDR  926
               P++++    +VLNK  E+G G FG VYK  L     R VAIKKLT S +++  EDF+ 
Sbjct  573   GDPEFSAGA-HAVLNKDCELGRGGFGAVYKTVL--RDGRSVAIKKLTVSSLVKSQEDFEE  629

Query  925   EVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAVRF  746
             EV+ LGK +H NLV L GYYWTP LQLL+ +FVP G+L + LHE +   A+  L+W  RF
Sbjct  630   EVKRLGKVQHPNLVALEGYYWTPSLQLLIYEFVPGGSLYNHLHECS---ASNTLSWQERF  686

Query  745   KIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVMSN  566
              IILG A+ LAHLH   Q  IIHYN+K SN+LLD +  PK+ D GLA+L+  LDR+V+S+
Sbjct  687   DIILGIARSLAHLH---QHKIIHYNLKSSNVLLDGSGEPKVGDCGLAKLLPMLDRYVLSS  743

Query  565   RFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRVL  386
             + Q+A+GY+APE ACQ++++ +KCDVYGFG+L+LEI+TG+RPVEY ED+V++L+D VR  
Sbjct  744   KIQSALGYMAPEFACQTVKITDKCDVYGFGVLVLEIMTGKRPVEYMEDDVVLLSDMVRET  803

Query  385   LEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTP  218
             L++G V EC+D+ + G +P EE +PV+KL L+CTSQ+PS+RP MAEVV IL++I+ P
Sbjct  804   LDEGKVEECMDERLCGKFPLEETIPVMKLGLICTSQVPSNRPEMAEVVNILELIRFP  860


 Score = 55.8 bits (133),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 61/105 (58%), Gaps = 0/105 (0%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             ++L+GEIP  I    +L ++ L GN LTG +P   G C  L  L +  N LSG +PE++ 
Sbjct  102   NSLVGEIPVGISRMFNLRMISLRGNRLTGQLPNDTGKCLLLKSLDVGENQLSGDLPESMR  161

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPA  1508
              L     L L  N LSGE+P  +G + +L  +++S NR +G +P+
Sbjct  162   NLSTCTYLSLSSNSLSGEVPAWIGDMNSLETLDLSRNRFSGGVPS  206


 Score = 53.9 bits (128),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 49/129 (38%), Positives = 69/129 (53%), Gaps = 6/129 (5%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G++PE +    +   L L  NSL+G +P  IG+ +SL  L LS N  SG +P +LS L
Sbjct  152   LSGDLPESMRNLSTCTYLSLSSNSLSGEVPAWIGDMNSLETLDLSRNRFSGGVPSSLSNL  211

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
             + LK+LKL  N  SG +P  L    +LL V++  N LTG LP+ +         + GN  
Sbjct  212   QFLKLLKLSDNSFSGSVPDSLAACRSLLDVDLGRNTLTGNLPSWAFETGFRQILLPGNK-  270

Query  1456  ICSPLLTGP  1430
                  L+GP
Sbjct  271   -----LSGP  274


 Score = 53.5 bits (127),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 38/89 (43%), Positives = 56/89 (63%), Gaps = 0/89 (0%)
 Frame = -1

Query  1777  SLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSMLKRLKILKLEVNQL  1598
             S+  + L  NS++G IP  +G CS+L  L+LS N LSG++P  +  L  L+ L L  N L
Sbjct  45    SIRDISLAKNSISGKIPSDVGACSTLASLNLSSNQLSGSLPGEIWSLNALRSLDLSHNSL  104

Query  1597  SGEIPQQLGKLENLLAVNVSYNRLTGRLP  1511
              GEIP  + ++ NL  +++  NRLTG+LP
Sbjct  105   VGEIPVGISRMFNLRMISLRGNRLTGQLP  133



>ref|XP_002325929.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|EEF00311.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=963

 Score =   429 bits (1104),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 263/537 (49%), Positives = 353/537 (66%), Gaps = 25/537 (5%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G IP +I  + +L  L+L+ NSL+G IP  IGNCSSL  L LS NNL+GTIP  ++ L
Sbjct  440   LNGSIPTEIGGAFALKELRLERNSLSGQIPDSIGNCSSLMTLILSQNNLAGTIPAAIAKL  499

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
               LK + L +N L+G +P+QL  L NL++ N+S+N L G LPAG  F  +  S++ GN  
Sbjct  500   GNLKDVDLSLNSLTGSLPKQLANLPNLISFNISHNNLQGELPAGVFFNTISPSSVSGNPS  559

Query  1456  ICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRF-Lsvsaiv  1280
             +C   +   C    PKPIV+NP    + T          P +  +N  H R  LS+SA++
Sbjct  560   LCGAAVNKSCPAVLPKPIVLNPNSSSDST----------PGSLPQNPGHKRIILSISALI  609

Query  1279  aisaaaiiavgvmvITMVNASVRRRISFVENALESMCSS--TSSRSQGMATGKLILFDTK  1106
             AI AAA+I VGV+ IT++N  VR   S    AL        + S +    +GKL++F  K
Sbjct  610   AIGAAAVIVVGVIAITVLNLRVRSSTSRSAAALTLSAGDGFSDSPTTDANSGKLVMFTGK  669

Query  1105  SSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDFDR  926
               PD+++    ++LNK  E+G G FG VY+  L       VAIKKLT S +++  EDF+R
Sbjct  670   --PDFSTGA-HALLNKDCELGRGGFGAVYQTVL--RDGHPVAIKKLTVSSLVKSQEDFER  724

Query  925   EVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAVRF  746
             EV+ LGK RHQNLV L GYYWT  LQLL+ +FV  G+L   LHE +       L+W  RF
Sbjct  725   EVKKLGKIRHQNLVALEGYYWTQSLQLLIYEFVSGGSLYKHLHEGSGGHF---LSWNERF  781

Query  745   KIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVMSN  566
              IILGTAK LAHLH   Q  IIHYNIK SN+LLD +  PK+ DFGLARL+  LDR+V+S+
Sbjct  782   NIILGTAKSLAHLH---QSNIIHYNIKSSNVLLDSSGEPKVGDFGLARLLPMLDRYVLSS  838

Query  565   RFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRVL  386
             + Q+A+GY+APE AC+++++ EKCDVYGFG+L+LEIVTG+RPVEY ED+V++L D VR  
Sbjct  839   KIQSALGYMAPEFACRTVKITEKCDVYGFGVLVLEIVTGKRPVEYMEDDVVVLCDMVRGA  898

Query  385   LEQGNVLECVD-QGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTP  218
             LE+G V ECVD + MG +P +EV+PV+KL L+CT Q+PS+RP M EV+ IL +I+ P
Sbjct  899   LEEGRVEECVDGRLMGNFPADEVVPVMKLGLICTLQVPSNRPDMGEVINILDLIRCP  955


 Score = 59.7 bits (143),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 41/103 (40%), Positives = 57/103 (55%), Gaps = 0/103 (0%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G IP+ + + G    L L  N  TG +P  IG  + L  L LS N  SG +P ++  L
Sbjct  253   LSGHIPDTMQKLGLCDYLSLSSNMFTGEVPNWIGELNRLETLDLSGNRFSGQVPISIGKL  312

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPA  1508
             + LK+L L  N LSG +P+ +    NLLA++ S N L+G LP 
Sbjct  313   QLLKVLNLSANGLSGNLPESMANCGNLLALDFSQNLLSGDLPT  355


 Score = 58.2 bits (139),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 56/102 (55%), Gaps = 0/102 (0%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L GEIP+ I    +L  + L  N   G +P  IG+C  L  +  S N LSG IP+T+  L
Sbjct  205   LDGEIPKGIEVLNNLRRINLSKNRFNGEVPDGIGSCLLLRSVDFSENMLSGHIPDTMQKL  264

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP  1511
                  L L  N  +GE+P  +G+L  L  +++S NR +G++P
Sbjct  265   GLCDYLSLSSNMFTGEVPNWIGELNRLETLDLSGNRFSGQVP  306



>gb|KEH35536.1| leucine-rich receptor-like kinase family protein [Medicago truncatula]
Length=989

 Score =   429 bits (1103),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 260/537 (48%), Positives = 348/537 (65%), Gaps = 24/537 (4%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G IP ++  + SL  L L+ N L G IP  I NCSSL  L LS N LSG+IP  ++ L
Sbjct  462   LNGSIPSEVGGAVSLKELSLENNFLIGKIPISIENCSSLKTLILSKNRLSGSIPSAVASL  521

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
               LK + L  N L+G +P+QL  L NL+  N+S+N L G LPAG  F  +  S++ GN  
Sbjct  522   TNLKTVDLSFNNLTGNLPKQLSNLPNLITFNLSHNNLKGELPAGGFFNTISPSSVSGNPF  581

Query  1456  ICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHR-FLsvsaiv  1280
             IC  ++   C +  PKPIV+NP  +   +          P + T    H R  LS+SA++
Sbjct  582   ICGSVVNKKCPVKLPKPIVLNPTNFSPDSG---------PGSPTPTLAHKRNILSISALI  632

Query  1279  aisaaaiiavgvmvITMVNASVRRRISFVENALESMCSSTSSRS--QGMATGKLILFDTK  1106
             AI AAA I +GV+ IT++N  VR   S    AL        SRS      +GKL++F  +
Sbjct  633   AIGAAAFIVIGVIGITVLNLRVRSTTSRSPAALAFSAGDEYSRSPTTDANSGKLVMFSGE  692

Query  1105  SSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDFDR  926
               PD++S    ++LNK  E+G G FG VY+  LG    R VAIKKLT S +++  EDF+R
Sbjct  693   --PDFSSGA-HALLNKDCELGRGGFGAVYQTVLGD--GRSVAIKKLTVSSLVKSQEDFER  747

Query  925   EVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAVRF  746
             EV+ LGK RHQNLV L GYYWT  LQLL+ +FV  G+L   LHE         L+W  RF
Sbjct  748   EVKKLGKVRHQNLVELEGYYWTSSLQLLIYEFVSRGSLYKHLHE---GSGESFLSWNERF  804

Query  745   KIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVMSN  566
              +ILGTAK L+HLHHS    IIHYNIK +NIL+D    PK+ D+GLARL+  LDR+V+S+
Sbjct  805   NVILGTAKALSHLHHS---NIIHYNIKSTNILIDSYGEPKVGDYGLARLLPMLDRYVLSS  861

Query  565   RFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRVL  386
             + Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE VTG+RPVEY ED+V++L D VR  
Sbjct  862   KIQSALGYMAPEFACKTVKITEKCDVYGFGVLVLETVTGKRPVEYMEDDVVVLCDMVRGA  921

Query  385   LEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTP  218
             L++G V EC+D+ + G +P EEV+PV+KL LVCTSQ+PS+RP M EVV IL++I+ P
Sbjct  922   LDEGRVEECIDERLQGKFPVEEVIPVIKLGLVCTSQVPSNRPEMGEVVTILELIRCP  978


 Score = 60.5 bits (145),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 39/101 (39%), Positives = 55/101 (54%), Gaps = 0/101 (0%)
 Frame = -1

Query  1810  GEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSMLKR  1631
             G +P D+ E    G   L GN+ +G +P  IG    L  L LS N  SG +P +L  +  
Sbjct  268   GSVPSDLKELVLCGYFSLHGNAFSGDVPDWIGEMKGLQTLDLSQNRFSGLVPNSLGNIWS  327

Query  1630  LKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPA  1508
             LK L L  N  +G +P+ +    NLLA++VS N L+G LP+
Sbjct  328   LKTLNLSGNGFTGNLPESMVNCTNLLALDVSQNSLSGDLPS  368


 Score = 57.8 bits (138),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 64/105 (61%), Gaps = 1/105 (1%)
 Frame = -1

Query  1816  LIGEIPEDIC-ESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSM  1640
             L G +P+D   + GS+ ++ L  N  +G +P  +G+C+++  + LS N  SG +P+ +  
Sbjct  145   LSGVVPDDFFRQCGSMRVVSLARNRFSGNVPSSLGSCAAIATIDLSFNQFSGNVPKGIWS  204

Query  1639  LKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAG  1505
             L  L+ L +  N L GE+P+ +  ++NL +++++ N  +G++P G
Sbjct  205   LSGLRSLDMSDNLLEGEVPEGVEAMKNLRSISLARNSFSGKIPDG  249


 Score = 56.2 bits (134),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 39/124 (31%), Positives = 63/124 (51%), Gaps = 6/124 (5%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L GE+PE +    +L  + L  NS +G IP   G+C  L  +    N+ SG++P  L  L
Sbjct  218   LEGEVPEGVEAMKNLRSISLARNSFSGKIPDGFGSCLLLRSIDFGDNSFSGSVPSDLKEL  277

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPA--GSIFQ----NLDSSA  1475
                    L  N  SG++P  +G+++ L  +++S NR +G +P   G+I+     NL  + 
Sbjct  278   VLCGYFSLHGNAFSGDVPDWIGEMKGLQTLDLSQNRFSGLVPNSLGNIWSLKTLNLSGNG  337

Query  1474  IEGN  1463
               GN
Sbjct  338   FTGN  341



>ref|XP_009416321.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=969

 Score =   428 bits (1101),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 248/537 (46%), Positives = 354/537 (66%), Gaps = 23/537 (4%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G IP ++  + SL  L+L+GNSLT  IP QIG+CSSL  L LS NNL+G+IPETL+ L
Sbjct  442   LSGRIPSEVALATSLRELRLEGNSLTREIPVQIGSCSSLAYLDLSQNNLTGSIPETLANL  501

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
               L+++    N+LSG +P+QL  L +LL+ N+S+N+L+G LPAGS F N+  S++  N G
Sbjct  502   TNLRVVDFSRNRLSGTLPKQLSDLPHLLSFNISHNQLSGGLPAGSFFNNIPPSSLTDNPG  561

Query  1456  ICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRFLsvsaiva  1277
             +C   +   C    PKPIV++P    + +          P+ S RN  H + +   + + 
Sbjct  562   LCGSTVNRSCPGVLPKPIVLDPNSSPDPSS--------NPVLSPRNLSHKKIIFSISALI  613

Query  1276  isaaaiiavgvmvITMVNASVRRRISFVENALESMCSS---TSSRSQGMATGKLILFDTK  1106
                AA +    ++ T+   + R   S   +A+E   S    + S      +GKL++F   
Sbjct  614   AIVAAAVIALGVI-TITVLNFRAHASASNSAVELALSDEYLSHSPVTDANSGKLVMF-AG  671

Query  1105  SSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDFDR  926
               P++++    +VLNK  E+G G FG VYK  L     R VAIKKLT S +++  EDF+ 
Sbjct  672   GDPEFSAGA-HAVLNKDCELGRGGFGAVYKTVL--RDGRSVAIKKLTVSSLVKSQEDFEE  728

Query  925   EVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAVRF  746
             EV+ LGK +H NLV L GYYWTP LQLL+ +FVP G+L + LHE +   A+  L+W  RF
Sbjct  729   EVKRLGKVQHPNLVALEGYYWTPSLQLLIYEFVPGGSLYNHLHECS---ASNTLSWQERF  785

Query  745   KIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVMSN  566
              IILG A+ LAHLH   Q  IIHYN+K SN+LLD +  PK+ D GLA+L+  LDR+V+S+
Sbjct  786   DIILGIARSLAHLH---QHKIIHYNLKSSNVLLDGSGEPKVGDCGLAKLLPMLDRYVLSS  842

Query  565   RFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRVL  386
             + Q+A+GY+APE ACQ++++ +KCDVYGFG+L+LEI+TG+RPVEY ED+V++L+D VR  
Sbjct  843   KIQSALGYMAPEFACQTVKITDKCDVYGFGVLVLEIMTGKRPVEYMEDDVVLLSDMVRET  902

Query  385   LEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTP  218
             L++G V EC+D+ + G +P EE +PV+KL L+CTSQ+PS+RP MAEVV IL++I+ P
Sbjct  903   LDEGKVEECMDERLCGKFPLEETIPVMKLGLICTSQVPSNRPEMAEVVNILELIRFP  959


 Score = 55.8 bits (133),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 61/105 (58%), Gaps = 0/105 (0%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             ++L+GEIP  I    +L ++ L GN LTG +P   G C  L  L +  N LSG +PE++ 
Sbjct  201   NSLVGEIPVGISRMFNLRMISLRGNRLTGQLPNDTGKCLLLKSLDVGENQLSGDLPESMR  260

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPA  1508
              L     L L  N LSGE+P  +G + +L  +++S NR +G +P+
Sbjct  261   NLSTCTYLSLSSNSLSGEVPAWIGDMNSLETLDLSRNRFSGGVPS  305


 Score = 55.1 bits (131),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 42/103 (41%), Positives = 62/103 (60%), Gaps = 1/103 (1%)
 Frame = -1

Query  1816  LIGEIPEDIC-ESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSM  1640
             L G IP+    +  S+  + L  NS++G IP  +G CS+L  L+LS N LSG++P  +  
Sbjct  130   LSGTIPDGFFGQCRSIRDISLAKNSISGKIPSDVGACSTLASLNLSSNQLSGSLPGEIWS  189

Query  1639  LKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP  1511
             L  L+ L L  N L GEIP  + ++ NL  +++  NRLTG+LP
Sbjct  190   LNALRSLDLSHNSLVGEIPVGISRMFNLRMISLRGNRLTGQLP  232


 Score = 54.7 bits (130),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 61/107 (57%), Gaps = 2/107 (2%)
 Frame = -1

Query  1777  SLGILQLDGNSLTGTIPPQI-GNCssltllslshnnlSGTIPETLSMLKRLKILKLEVNQ  1601
             SL  L L  N+L+GTIP    G C S+  +SL+ N++SG IP  +     L  L L  NQ
Sbjct  119   SLRTLDLSANNLSGTIPDGFFGQCRSIRDISLAKNSISGKIPSDVGACSTLASLNLSSNQ  178

Query  1600  LSGEIPQQLGKLENLLAVNVSYNRLTGRLPAG-SIFQNLDSSAIEGN  1463
             LSG +P ++  L  L ++++S+N L G +P G S   NL   ++ GN
Sbjct  179   LSGSLPGEIWSLNALRSLDLSHNSLVGEIPVGISRMFNLRMISLRGN  225


 Score = 53.9 bits (128),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 49/129 (38%), Positives = 69/129 (53%), Gaps = 6/129 (5%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G++PE +    +   L L  NSL+G +P  IG+ +SL  L LS N  SG +P +LS L
Sbjct  251   LSGDLPESMRNLSTCTYLSLSSNSLSGEVPAWIGDMNSLETLDLSRNRFSGGVPSSLSNL  310

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
             + LK+LKL  N  SG +P  L    +LL V++  N LTG LP+ +         + GN  
Sbjct  311   QFLKLLKLSDNSFSGSVPDSLAACRSLLDVDLGRNTLTGNLPSWAFETGFRQILLPGNK-  369

Query  1456  ICSPLLTGP  1430
                  L+GP
Sbjct  370   -----LSGP  373



>ref|XP_010253073.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Nelumbo nucifera]
Length=970

 Score =   426 bits (1096),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 263/543 (48%), Positives = 361/543 (66%), Gaps = 24/543 (4%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G IP +I ++ SL  L+L+ N L G IP QI  C SLT L LS NN+SG+IP TL+ L
Sbjct  446   LNGSIPSEIWDAVSLKELRLEKNFLAGKIPLQIEKCLSLTYLILSQNNISGSIPATLANL  505

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
               L+ + L +N LSG +P+QL  L +LL+ N+S+N L G LPAG  F  +  S++ GN  
Sbjct  506   TNLQTVDLSMNNLSGSLPKQLANLPHLLSFNISHNNLQGELPAGGFFNTISPSSVSGNPS  565

Query  1456  ICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRF-Lsvsaiv  1280
             +C   +   C    PKPIV+NP    N + +++G  +  P     N RH +  LS+SA++
Sbjct  566   LCGSAVNRSCPAVLPKPIVLNP----NSSSDSSGMGSFSP-----NLRHKKIILSISALI  616

Query  1279  aisaaaiiavgvmvITMVNASVRRRISFVENALESMCSSTSSRS--QGMATGKLILFDTK  1106
             AI AA +IA+GV+ +T++N  VR   S    AL        S+S      +GKL++F   
Sbjct  617   AIGAAIVIALGVIAVTVLNLRVRSSTSRSAAALTLSGGDEFSQSPITDANSGKLVMF--S  674

Query  1105  SSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDFDR  926
               PD+++    ++LNK  E+G G FG VY+  L     R VAIKKLT S +++  EDF+R
Sbjct  675   GDPDFSAGA-HALLNKDCELGRGGFGAVYRTVL--RDGRPVAIKKLTVSSLVKSQEDFER  731

Query  925   EVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAVRF  746
             EV+ LGK RH NLV L GYYWTP LQLL+S+FV  G+L   LHE A       L+W  RF
Sbjct  732   EVKKLGKIRHPNLVALEGYYWTPSLQLLISEFVSGGSLYKHLHEGAGGNW---LSWHERF  788

Query  745   KIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVMSN  566
              IILGTA+ LAHLH   Q  +IHYN+K SN+L+D N  PK+ DFGLARL+  LDR+V+S+
Sbjct  789   NIILGTARSLAHLH---QLNVIHYNLKSSNVLIDSNGEPKVGDFGLARLLPMLDRYVLSS  845

Query  565   RFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRVL  386
             + Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE+VTG+RPVEY ED+V++L D VR  
Sbjct  846   KIQSALGYMAPEFACRTVKITEKCDVYGFGVLVLEVVTGKRPVEYMEDDVVVLCDMVRGA  905

Query  385   LEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPVPN  209
             LE+G V +CVD  + G +P EE +PV+KL L+CTSQ+PS+RP+MAEVV IL++I+ P   
Sbjct  906   LEEGRVEQCVDGRLSGNFPAEEAIPVMKLGLICTSQVPSNRPNMAEVVNILELIRCPSEG  965

Query  208   RME  200
             + E
Sbjct  966   QEE  968


 Score = 58.5 bits (140),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 58/105 (55%), Gaps = 0/105 (0%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             ++L G +P+ + +      L L GN  +G +P  IG    L  L LS N  SG IP++L 
Sbjct  248   NSLSGSLPDSMRKLTMCSSLSLHGNLFSGELPAMIGEMRGLETLDLSRNIFSGGIPDSLG  307

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPA  1508
              L+ LK+L L  N  +G +P  L   +NLL ++ S N LTG LPA
Sbjct  308   NLQSLKLLNLSSNGFTGVVPDSLCNCKNLLIMDFSRNSLTGNLPA  352


 Score = 58.2 bits (139),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 42/103 (41%), Positives = 61/103 (59%), Gaps = 1/103 (1%)
 Frame = -1

Query  1816  LIGEIPEDIC-ESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSM  1640
             L G IP+D   + GSL  +    N+L+G IP  +G+CS+L  L+ S N LSG +P  +  
Sbjct  129   LSGPIPDDFFRQCGSLREMSFARNNLSGQIPQNLGSCSTLATLNFSSNQLSGPLPSGIWS  188

Query  1639  LKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP  1511
             L  L+ L L  N L G IP+ +  L NL ++N+  NR +G+LP
Sbjct  189   LNGLRSLDLSDNLLEGVIPKGMAGLYNLRSINLQKNRFSGQLP  231



>ref|XP_007136420.1| hypothetical protein PHAVU_009G043600g [Phaseolus vulgaris]
 gb|ESW08414.1| hypothetical protein PHAVU_009G043600g [Phaseolus vulgaris]
Length=954

 Score =   424 bits (1091),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 262/545 (48%), Positives = 349/545 (64%), Gaps = 25/545 (5%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             ++LIG IP  I  + SL  L L  N L G IP  I NC+ LT LSLS N LSG IP  ++
Sbjct  429   NSLIGPIPAAIGGAVSLKELVLKKNFLIGKIPMSIENCTLLTTLSLSQNWLSGPIPAAVA  488

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGN  1463
              L  L+ + L  N L+G +P+QL  L NLLA N+S+N L G LPAG  F  +  +++ GN
Sbjct  489   KLTNLQTVDLSYNNLTGNLPKQLANLANLLAFNLSHNNLQGELPAGGFFNTISPTSVSGN  548

Query  1462  DGICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRF-Lsvsa  1286
               +C   +   C    PKPIV+NP    + +          P A  +N  H R  LS+SA
Sbjct  549   PSLCGAAVNKSCPAVLPKPIVLNPNTSTDAS----------PGALPQNLGHKRIILSISA  598

Query  1285  ivaisaaaiiavgvmvITMVNASVRRRISFVENALESMCSSTSSRS--QGMATGKLILFD  1112
             ++AI AAA+I +GV+ IT++N  VR   S    AL        SRS      +GKL++F 
Sbjct  599   LIAIGAAAVIVIGVISITVLNLRVRSSTSRDAGALTFSAGDEFSRSPTTDANSGKLVMFS  658

Query  1111  TKSSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDF  932
              +  PD++S    ++LNK  E+G G FG VY+  L       VAIKKLT S +++  EDF
Sbjct  659   GE--PDFSSGA-HALLNKDCELGRGGFGAVYQTVL--RDGHSVAIKKLTVSSLVKSQEDF  713

Query  931   DREVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAV  752
             +REV+ LGK RHQNLV L GYYWTP LQLL+ ++V  G+L   LHE         L+W  
Sbjct  714   EREVKKLGKIRHQNLVELEGYYWTPSLQLLIYEYVSGGSLYKHLHE---GSGGNFLSWNE  770

Query  751   RFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVM  572
             RF +ILGTAK LAHLH   Q  IIHYNIK +N+LLD     KI DFGLARL+  LDR+V+
Sbjct  771   RFNVILGTAKALAHLH---QSNIIHYNIKSTNVLLDSYGEAKIGDFGLARLLPMLDRYVL  827

Query  571   SNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVR  392
             S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LEIVTG+RPVEY ED+V++L D VR
Sbjct  828   SSKIQSALGYMAPEFACKTVKITEKCDVYGFGILVLEIVTGKRPVEYMEDDVVVLCDMVR  887

Query  391   VLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPV  215
               LE+G V EC+D+ + G +P EE +PV+KL L+CTSQ+PS+RP M EVV IL++I+ P 
Sbjct  888   GALEEGRVEECIDERLEGKFPAEEAIPVMKLGLICTSQVPSNRPDMGEVVNILELIRCPS  947

Query  214   PNRME  200
               + E
Sbjct  948   EGQEE  952


 Score = 63.2 bits (152),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 43/118 (36%), Positives = 74/118 (63%), Gaps = 5/118 (4%)
 Frame = -1

Query  1822  SALIGEIPEDIC-ESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETL  1646
             ++L G++ +D+  + GSL  + L  N  +G+IP  +G CS+L  + LS+N  SG++P  +
Sbjct  136   NSLSGQVSDDVFRQCGSLRAVSLARNRFSGSIPSALGACSALAAIDLSNNQFSGSVPSGV  195

Query  1645  SMLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAG----SIFQNLD  1484
               L  L+ L L  N L GEIP+ +  ++NL +V+++ NRLTG +P G    S+ +++D
Sbjct  196   WSLSALRSLDLSDNLLEGEIPKGVEAMKNLRSVSLARNRLTGNVPGGFGSCSLLRSID  253


 Score = 55.1 bits (131),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 57/102 (56%), Gaps = 0/102 (0%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L GEIP+ +    +L  + L  N LTG +P   G+CS L  + L  N+ SG+IP     L
Sbjct  211   LEGEIPKGVEAMKNLRSVSLARNRLTGNVPGGFGSCSLLRSIDLGDNSFSGSIPGDFKEL  270

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP  1511
                  L L  N  SGE+P+ +G++  L  +++S N LTG++P
Sbjct  271   ALCGYLSLRGNAFSGELPEWIGEMRGLETLDLSNNGLTGQVP  312



>ref|XP_009757206.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Nicotiana sylvestris]
Length=894

 Score =   422 bits (1086),  Expect = 9e-133, Method: Compositional matrix adjust.
 Identities = 263/544 (48%), Positives = 361/544 (66%), Gaps = 27/544 (5%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G +P +I E  SL  L+L+ N+LTG IP  IG+CSSL  LSLSHN+L+G +P  L+ L
Sbjct  371   LYGTVPAEIGEVTSLKELRLEKNALTGQIPSSIGSCSSLVSLSLSHNSLTGPVPAALANL  430

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
               L+ + L  N+L+G +P+QLG L +LL+ N+S+N+L G LP+   F  +   ++  N  
Sbjct  431   TYLQNVDLSFNKLTGTLPKQLGNLGHLLSFNISHNQLQGELPSNGFFNTISPYSVLANPS  490

Query  1456  ICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHR-FLsvsaiv  1280
             +C   +   C    PKPIV+NP    N TD+        P    ++ RH +  LS+SA++
Sbjct  491   LCGAAVNRSCSTVMPKPIVLNP----NSTDS-------NPSTVPQSFRHEKKILSISALI  539

Query  1279  aisaaaiiavgvmvITMVNASVRRRISFVENALESMCSS---TSSRSQGMATGKLILFDT  1109
             AI AAA+I VGV+ IT++N  VR   S    A  +       + S S    +GKL++F  
Sbjct  540   AIGAAAVIFVGVIAITVLNIRVRSTTSRSAAAALTFSGGDDFSRSPSTDANSGKLVMF--  597

Query  1108  KSSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDFD  929
                PD+++    ++LNK  E+G G FG VY   LG   S  VAIKKLT S +++  EDF+
Sbjct  598   SGDPDFSTGA-HALLNKDCELGRGGFGAVYHTVLGDGHS--VAIKKLTVSSLVKSQEDFE  654

Query  928   REVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAVR  749
             REVR LGK RHQNLV L GYYWTP LQLL+ +FV  GNL   LHE     A   LTW  R
Sbjct  655   REVRKLGKVRHQNLVALEGYYWTPSLQLLIYEFVAGGNLFKHLHE---GSAGSLLTWNER  711

Query  748   FKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVMS  569
             F IILGTAK LAHLH   Q  IIHYN+K SNIL+D +  PK++D+GLARL+  LDR+V+S
Sbjct  712   FSIILGTAKSLAHLH---QMNIIHYNLKSSNILIDGSGEPKVADYGLARLLPMLDRYVLS  768

Query  568   NRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRV  389
             ++ Q+A+GY+APE AC+++++ EKCDVYGFG+LILE+VTG+RPVEY ED+V++L D VR 
Sbjct  769   SKIQSALGYMAPEFACKTVKITEKCDVYGFGVLILEVVTGKRPVEYMEDDVVVLCDMVRG  828

Query  388   LLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPVP  212
              LE+G + +C+D+ + G +P +E +PV+KL L+CTSQ+PS+RP MAEVV IL++I+ P  
Sbjct  829   ALEEGRIEDCIDKRLQGKFPADEAIPVMKLGLICTSQVPSNRPDMAEVVNILELIRCPSE  888

Query  211   NRME  200
              + E
Sbjct  889   GQDE  892


 Score = 63.5 bits (153),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 41/103 (40%), Positives = 68/103 (66%), Gaps = 0/103 (0%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G IP  + +  SL +L L  N+++G++P  I +C +L  L +SHNNL+GT+P+T+  L
Sbjct  299   LSGTIPTSLEKLESLKVLNLSQNAISGSLPESISSCVNLLTLDVSHNNLTGTVPKTVGQL  358

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPA  1508
             K L IL L  N+L G +P ++G++ +L  + +  N LTG++P+
Sbjct  359   KLLGILDLSENRLYGTVPAEIGEVTSLKELRLEKNALTGQIPS  401


 Score = 59.7 bits (143),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 43/105 (41%), Positives = 66/105 (63%), Gaps = 0/105 (0%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             +A  G +PE I E  SL IL    N+L+GTIP  +    SL +L+LS N +SG++PE++S
Sbjct  273   NAFAGIVPEWIGEMKSLEILDFSENNLSGTIPTSLEKLESLKVLNLSQNAISGSLPESIS  332

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPA  1508
                 L  L +  N L+G +P+ +G+L+ L  +++S NRL G +PA
Sbjct  333   SCVNLLTLDVSHNNLTGTVPKTVGQLKLLGILDLSENRLYGTVPA  377


 Score = 53.9 bits (128),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 57/107 (53%), Gaps = 1/107 (1%)
 Frame = -1

Query  1822  SALIGEIPEDICES-GSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETL  1646
             ++L G IP D  E  G L  + L  N  +G IP  + +C++L  L+LS N  SG +P  +
Sbjct  128   NSLSGPIPGDYFEKCGPLRSISLAKNKFSGEIPESLSSCATLASLNLSSNQFSGLVPSGI  187

Query  1645  SMLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAG  1505
               L  L+ L L  N L GEIP  +  L NL A+N+  N   G +P G
Sbjct  188   WSLNGLRSLDLSNNLLDGEIPAGIEGLSNLRAINLGGNHFKGEIPDG  234


 Score = 53.5 bits (127),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 44/126 (35%), Positives = 57/126 (45%), Gaps = 24/126 (19%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllsls---------------  1682
             L GEIP  I    +L  + L GN   G IP  IG C  L  + LS               
Sbjct  203   LDGEIPAGIEGLSNLRAINLGGNHFKGEIPDGIGGCWLLRSIDLSGNSFSGEPPSTMQKL  262

Query  1681  ---------hnnlSGTIPETLSMLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNR  1529
                       N  +G +PE +  +K L+IL    N LSG IP  L KLE+L  +N+S N 
Sbjct  263   SLCNEVILRRNAFAGIVPEWIGEMKSLEILDFSENNLSGTIPTSLEKLESLKVLNLSQNA  322

Query  1528  LTGRLP  1511
             ++G LP
Sbjct  323   ISGSLP  328



>ref|XP_002467905.1| hypothetical protein SORBIDRAFT_01g036160 [Sorghum bicolor]
 gb|EER94903.1| hypothetical protein SORBIDRAFT_01g036160 [Sorghum bicolor]
Length=972

 Score =   424 bits (1090),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 265/528 (50%), Positives = 361/528 (68%), Gaps = 30/528 (6%)
 Frame = -1

Query  1777  SLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSMLKRLKILKLEVNQL  1598
             SL  L+L  N LTG IP QIGNCSSL  L LSHNNL+G IPET+S L  L+I+ L  N+L
Sbjct  458   SLQELRLGKNFLTGNIPAQIGNCSSLASLDLSHNNLTGGIPETISNLTNLEIVDLSQNKL  517

Query  1597  SGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDGICSPLLTGPCKMN  1418
             +G +P+QL  L +LL  NVS+N+L+G LP GS F  +  S++  N G+C   L   C   
Sbjct  518   TGVLPKQLSNLPHLLQFNVSHNQLSGDLPPGSFFDTIPLSSVSDNPGLCGAKLNSSCPGV  577

Query  1417  APKPIVINPFVYGNQTdnnnggdnNEPLASTR----NSRHHR--FLsvsaivaisaaaii  1256
              PKPIV+NP              +++P++ T       RHH+   LS+SA+VAI AAA+I
Sbjct  578   LPKPIVLNP------------NTSSDPISPTEPVPDGGRHHKKTILSISALVAIGAAALI  625

Query  1255  avgvmvITMVNASVRRRISFVENALE-SMCSSTSSRSQGMATGKLILFDTKSSPDWASST  1079
             AVGV+ IT++N  VR   S    ALE S    + S +  M  GKL++F    +P++++ST
Sbjct  626   AVGVITITVLNLRVRAPGSHSGAALELSDGYLSQSPTTDMNAGKLVMFG-GGNPEFSAST  684

Query  1078  FESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDFDREVRVLGKAR  899
               ++LNK  E+G G FGTVYK  L     + VAIKKLT S +++   +F+REV++LGK R
Sbjct  685   -HALLNKDCELGRGGFGTVYKTTL--RDGQPVAIKKLTVSSLVKSQVEFEREVKMLGKLR  741

Query  898   HQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAVRFKIILGTAKG  719
             H+NLV L+GYYWTP LQLL+ +FV  GNL  +LHE +    T  L+W  RF I+LG A+ 
Sbjct  742   HRNLVALKGYYWTPSLQLLIYEFVSGGNLHKQLHESS---TTNCLSWKERFDIVLGIARS  798

Query  718   LAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVMSNRFQAAIGYV  539
             LAHLH   +  IIHYN+K SNILLD +   K+ D+GLA+L+  LDR+V+S++ Q+A+GY+
Sbjct  799   LAHLH---RHDIIHYNLKSSNILLDGSGEAKVGDYGLAKLLPMLDRYVLSSKVQSALGYM  855

Query  538   APELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRVLLEQGNVLEC  359
             APE AC+++++ EKCDVYGFG+LILEI+TGR PVEY ED+V++L D VR  L++G V EC
Sbjct  856   APEFACRTVKITEKCDVYGFGVLILEILTGRTPVEYMEDDVIVLCDVVRAALDEGKVEEC  915

Query  358   VDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTP  218
             VD+ + G +P EE +P++KL LVCTSQ+PS+RP M EVV IL++I+ P
Sbjct  916   VDERLCGKFPLEEAVPIMKLGLVCTSQVPSNRPDMNEVVNILELIRCP  963


 Score = 62.0 bits (149),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 41/108 (38%), Positives = 64/108 (59%), Gaps = 1/108 (1%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             +A+ G++P  I    +L  L L GN LTG++P  IG+C  L  L L  N+LSG +PE+L 
Sbjct  205   NAVTGDLPIGISRMFNLRALNLRGNRLTGSLPDDIGDCPLLRSLDLGSNSLSGDLPESLR  264

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSI  1499
              L     L L  N+ +G +P   G++ +L  +++S N+ +G +P GSI
Sbjct  265   RLSTCTYLDLSSNEFTGSVPTWFGEMGSLEILDLSGNKFSGEIP-GSI  311


 Score = 59.3 bits (142),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 62/105 (59%), Gaps = 0/105 (0%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             ++L G++PE +    +   L L  N  TG++P   G   SL +L LS N  SG IP ++ 
Sbjct  253   NSLSGDLPESLRRLSTCTYLDLSSNEFTGSVPTWFGEMGSLEILDLSGNKFSGEIPGSIG  312

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPA  1508
              L  L+ L+L  N  +G +P+ +G  ++L+ V+VS+N LTG LP+
Sbjct  313   GLMSLRELRLSGNGFTGALPESIGGCKSLMHVDVSWNSLTGALPS  357



>ref|XP_012091138.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Jatropha curcas]
 gb|KDP21644.1| hypothetical protein JCGZ_03315 [Jatropha curcas]
Length=960

 Score =   424 bits (1089),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 262/543 (48%), Positives = 353/543 (65%), Gaps = 25/543 (5%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G IP +I  + SL  L+LD NS++G IP  +GNCSSLT L LS NNL+G IP  L+ +
Sbjct  437   LNGSIPVEIGGAFSLKELRLDRNSISGQIPSSVGNCSSLTSLILSQNNLTGPIPAALAKI  496

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
               LK +    N LSG +P+QL  L NL + N+S+N+L G LPAG  F  + S ++ GN  
Sbjct  497   TTLKDVDFSFNSLSGGLPKQLANLPNLSSFNISHNQLQGELPAGGFFNTISSFSVFGNPA  556

Query  1456  ICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRF-Lsvsaiv  1280
             +C   +   C    PKPIV+NP          N   ++ P    +N  H R  LS+SA++
Sbjct  557   LCGAAVNRSCPAVLPKPIVLNP----------NSSSDSGPGELPQNIGHKRIILSISALI  606

Query  1279  aisaaaiiavgvmvITMVNASVRRRISFVENALESMCSSTSSRS--QGMATGKLILFDTK  1106
             AI AAA+I VGV+ IT++N  VR   S    AL        S S      +GKL++F   
Sbjct  607   AIGAAAVIVVGVIAITVLNLRVRSSTSRSAVALTLSAGDEFSHSPTTDANSGKLVMF--S  664

Query  1105  SSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDFDR  926
               PD+++    ++LNK  E+G G FG VY+  L       VAIKKLT S +++  EDF+R
Sbjct  665   GDPDFSTGA-HALLNKDCELGRGGFGAVYRTVL--RDGHPVAIKKLTVSSLVKSQEDFER  721

Query  925   EVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAVRF  746
             EV+ LGK RHQNLV L GYYWTP LQLL+S+FV  G+L   LHE +       L+W  RF
Sbjct  722   EVKKLGKVRHQNLVALEGYYWTPSLQLLISEFVSGGSLYKHLHEGSGGRF---LSWNERF  778

Query  745   KIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVMSN  566
              IILGTAK LAHLH   Q  IIHYNIK SN+L+D +   K+ DFGLARL+  LDR+V+S+
Sbjct  779   NIILGTAKSLAHLH---QSNIIHYNIKSSNVLIDSSGEAKVGDFGLARLLPMLDRYVLSS  835

Query  565   RFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRVL  386
             + Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE++TG+RPVEY ED+V++L D VR  
Sbjct  836   KIQSALGYMAPEFACRTVKITEKCDVYGFGVLVLEVITGKRPVEYMEDDVVVLCDMVRGA  895

Query  385   LEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPVPN  209
             LE+G V ECVD+ + G +P +E +PV+KL L+CTSQ+PS+RP M EVV IL++I+ P   
Sbjct  896   LEEGRVEECVDERLQGNFPADEAVPVMKLGLICTSQVPSNRPDMGEVVNILELIRCPSEG  955

Query  208   RME  200
             + E
Sbjct  956   QEE  958


 Score = 63.5 bits (153),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 63/107 (59%), Gaps = 1/107 (1%)
 Frame = -1

Query  1822  SALIGEIPEDI-CESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETL  1646
             ++L G I +D   + GSL  + L  N  +GTIP  + +C++L  ++ S N  SG++P  +
Sbjct  127   NSLSGSIQDDFFAQCGSLRAISLAKNKFSGTIPGSLSSCATLASINFSSNQFSGSLPSGI  186

Query  1645  SMLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAG  1505
               L  L++L L  N L GEIP+ +  L NL A+N S N+ +G+ P G
Sbjct  187   WGLNGLRLLDLSNNLLKGEIPKGIEGLNNLRAINFSKNQFSGKFPDG  233


 Score = 57.8 bits (138),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 58/102 (57%), Gaps = 0/102 (0%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L GEIP+ I    +L  +    N  +G  P  IG+C  +  +  S N++SG +PET+  L
Sbjct  202   LKGEIPKGIEGLNNLRAINFSKNQFSGKFPDGIGSCLLIRAIDFSENSISGYLPETMQKL  261

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP  1511
                  L L  N L+GE+P  +G+++ L  +++S N+ +G++P
Sbjct  262   SLCNYLSLSNNMLAGEVPNWIGEMKQLETLDLSGNKFSGQVP  303


 Score = 54.3 bits (129),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 56/105 (53%), Gaps = 0/105 (0%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             +++ G +PE + +      L L  N L G +P  IG    L  L LS N  SG +P ++ 
Sbjct  248   NSISGYLPETMQKLSLCNYLSLSNNMLAGEVPNWIGEMKQLETLDLSGNKFSGQVPNSIG  307

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPA  1508
              L+ LK+L L  N LSG +P+ +     L+A++ S N + G LPA
Sbjct  308   NLQSLKVLNLSANGLSGNLPESMANCGGLVALDFSRNSIRGDLPA  352



>gb|EPS70735.1| hypothetical protein M569_04020, partial [Genlisea aurea]
Length=954

 Score =   423 bits (1088),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 257/538 (48%), Positives = 358/538 (67%), Gaps = 15/538 (3%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G IP +I    SL  L+LD NSL+ +IP  IG+C++L  LSL+ N LSG+IP ++S L
Sbjct  428   LNGSIPSEIGMLSSLAYLRLDNNSLSNSIPASIGDCAALVSLSLARNQLSGSIPASISKL  487

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
              +L+ + L  NQL+G +P+QLG L NL   NVS+N L G LP+G+ F  ++ S++ GN  
Sbjct  488   SQLQAVDLSSNQLTGTLPKQLGDLVNLRLFNVSHNDLEGELPSGAFFNTINPSSVSGNPS  547

Query  1456  ICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRFLsvsaiva  1277
             IC  +L   C    PKP+V+NP +    T    GG ++   A T      + LS+SA++A
Sbjct  548   ICGAILNISCPAVLPKPLVLNPNLTAAITTQGGGGSSSSSSA-TSFGNGKKILSISALIA  606

Query  1276  isaaaiiavgvmvITMVNASVRRRISFVENALESMCSSTSSRSQGMA--TGKLILFDTKS  1103
             I AAA I +GV+ IT++N  VR   S     L        S SQ     +GKL++F    
Sbjct  607   IGAAASIVIGVVTITVLNLRVRAANSNSAAPLNFSGGDDYSHSQSTDGDSGKLVMF--SG  664

Query  1102  SPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDFDRE  923
              PD++++T  ++LNK  E+G G FG VY+  LG    R VAIKKLT S +++  +DF+RE
Sbjct  665   DPDFSTTT-HALLNKDCELGRGGFGAVYRTMLGD--GRPVAIKKLTVSSLVKSLQDFERE  721

Query  922   VRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAVRFK  743
             V+ LGK RH N+V L GYYWTP LQLL+ +FV  GNL   LHE +       L+W  RF 
Sbjct  722   VKKLGKVRHSNVVGLDGYYWTPSLQLLIYEFVSGGNLYKHLHEESEERRW--LSWNERFN  779

Query  742   IILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLN-PKISDFGLARLVAKLDRHVMSN  566
             IILG AKGLAHLH   +  IIHYN+K SNIL+D +    K++D+GLA L+  LDR+V+S+
Sbjct  780   IILGAAKGLAHLH---KMNIIHYNLKSSNILIDASTGEAKVADYGLAGLLPMLDRYVLSS  836

Query  565   RFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRVL  386
             + Q+A+GY+APE A +++++ EKCDVYGFG+L+LE+V+GRRPVEY ED+V++L D +R +
Sbjct  837   KIQSALGYMAPEFAVKTIKITEKCDVYGFGILVLEMVSGRRPVEYMEDDVVVLADMIRGV  896

Query  385   LEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPV  215
             +E+G V ECVD  + G +  EEV+PV+KL L+CTSQ+PS+RP MAEVV +L++IK P 
Sbjct  897   VEEGKVEECVDSRLQGKFSAEEVVPVMKLGLICTSQVPSTRPHMAEVVSMLELIKCPA  954


 Score = 58.2 bits (139),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 40/126 (32%), Positives = 59/126 (47%), Gaps = 24/126 (19%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G+IPE I    SL  + L  N  TG +P  IG C  L  + L  N+  G+ P T+  L
Sbjct  184   LEGQIPESIQHLTSLSGVNLSNNRFTGEVPDGIGRCLLLRSIDLGRNSFYGSFPSTMQKL  243

Query  1636  K------------------------RLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNR  1529
                                      +L+ L +  N++SG IP   GKL++L  +NVS+N 
Sbjct  244   SLCSSLVIGGNGFTGNVPAWIGDMTKLEYLDISANKISGSIPDSFGKLQSLKTLNVSHNG  303

Query  1528  LTGRLP  1511
             ++G +P
Sbjct  304   ISGSIP  309


 Score = 57.8 bits (138),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 36/105 (34%), Positives = 58/105 (55%), Gaps = 0/105 (0%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             ++  G  P  + +      L + GN  TG +P  IG+ + L  L +S N +SG+IP++  
Sbjct  230   NSFYGSFPSTMQKLSLCSSLVIGGNGFTGNVPAWIGDMTKLEYLDISANKISGSIPDSFG  289

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPA  1508
              L+ LK L +  N +SG IP+ +    NL+  +VS+N LT  LP+
Sbjct  290   KLQSLKTLNVSHNGISGSIPESMSNCGNLIVFDVSHNYLTSSLPS  334



>ref|XP_004984462.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Setaria italica]
Length=972

 Score =   423 bits (1087),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 267/541 (49%), Positives = 366/541 (68%), Gaps = 31/541 (6%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G IP  I    SL  L+L  NSLTG IP QIGNCS+L  L LSHNNL+G IPET++ L
Sbjct  446   LNGSIPAAIGGE-SLKELRLGKNSLTGNIPAQIGNCSALASLDLSHNNLTGAIPETIANL  504

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
               L+I+ L  N+L+G +P+QL  L +LL  N+S+N+L+G LP GS F  +  S++  N G
Sbjct  505   TSLEIVDLSRNRLTGVLPKQLSNLPHLLQFNISHNQLSGDLPPGSFFDTIPLSSVLDNPG  564

Query  1456  ICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTR----NSRHHR--FLs  1295
             +C   L   C    PKPIV+NP              +++P++ T        HH+   LS
Sbjct  565   LCGAKLNSSCPGVLPKPIVLNP------------NTSSDPISPTEPVPDGGLHHKKTILS  612

Query  1294  vsaivaisaaaiiavgvmvITMVNASVRRRISFVENALE-SMCSSTSSRSQGMATGKLIL  1118
             +SA+VAI AAA+IAVGV+ IT++N  VR   S     LE S    + S +  M  GKL++
Sbjct  613   ISALVAIGAAALIAVGVITITVLNFRVRAPGSHSAAVLELSDGYLSQSPTTDMNAGKLVM  672

Query  1117  FDTKSSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPE  938
             F    +P++++ST  ++LNK  E+G G FGTVYK  L     + VAIKKLT S +++   
Sbjct  673   FG-GGNPEFSAST-HALLNKDCELGRGGFGTVYKTTL--RDGQPVAIKKLTVSSLVKSQV  728

Query  937   DFDREVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTW  758
             +F+REV++LGK RH+NLV L+GYYWTP LQLL+ +FV  GNL  +LHE +    T  L+W
Sbjct  729   EFEREVKMLGKLRHRNLVALKGYYWTPSLQLLIYEFVSGGNLHKQLHESS---TTNCLSW  785

Query  757   AVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRH  578
               RF IILG A+ LAHLH   +  IIHYN+K SNILLD +   K+ D+GLA+L+  LDR+
Sbjct  786   KERFDIILGIARSLAHLH---RHDIIHYNLKSSNILLDGSGEAKVGDYGLAKLLPMLDRY  842

Query  577   VMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDH  398
             V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+LILEI+TGR PVEY ED+V++L D 
Sbjct  843   VLSSKVQSALGYMAPEFACRTVKITEKCDVYGFGVLILEILTGRTPVEYMEDDVIVLCDV  902

Query  397   VRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKT  221
             VR  L++G V ECVD+ + G +P EE +P++KL LVCTSQ+PS+RP M+EVV IL++I+ 
Sbjct  903   VRAALDEGKVEECVDERLCGKFPLEEAVPIMKLGLVCTSQVPSNRPDMSEVVNILELIRC  962

Query  220   P  218
             P
Sbjct  963   P  963


 Score = 63.5 bits (153),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 41/108 (38%), Positives = 65/108 (60%), Gaps = 1/108 (1%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             +A+ G++P  I    +L  L L GN LTG++P  IG+C  L  + L  N+LSG +PE+L 
Sbjct  205   NAVTGDLPIGISRMFNLRELNLRGNRLTGSLPDDIGDCPLLRSVDLGSNSLSGNLPESLR  264

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSI  1499
              L     L L  N+ +G +P   G++ +L  +++S N+L+G +P GSI
Sbjct  265   RLSTCTYLDLSSNEFTGSVPTWFGEMASLEVLDLSGNKLSGEIP-GSI  311


 Score = 58.2 bits (139),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 62/104 (60%), Gaps = 0/104 (0%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             ++L G +PE +    +   L L  N  TG++P   G  +SL +L LS N LSG IP ++ 
Sbjct  253   NSLSGNLPESLRRLSTCTYLDLSSNEFTGSVPTWFGEMASLEVLDLSGNKLSGEIPGSIG  312

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP  1511
              L  L+ L+L  N  +G +P+ +G  ++L+ V+VS+N LTG LP
Sbjct  313   GLMSLRELRLSGNGFTGALPESIGGCKSLMHVDVSWNSLTGGLP  356


 Score = 55.8 bits (133),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 39/107 (36%), Positives = 63/107 (59%), Gaps = 5/107 (5%)
 Frame = -1

Query  1822  SALIGEIPEDI---CESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPE  1652
             +A  G IPE +   C +  L  + L GN+ +G IP  +G C++L  L+LS N L+G +P 
Sbjct  132   NAFAGAIPEGLFGRCRA--LRDVSLAGNAFSGDIPRDVGACATLASLNLSSNLLAGALPS  189

Query  1651  TLSMLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP  1511
              +  L  L+ L +  N ++G++P  + ++ NL  +N+  NRLTG LP
Sbjct  190   DIWSLNALRTLDISGNAVTGDLPIGISRMFNLRELNLRGNRLTGSLP  236



>ref|XP_008456780.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Cucumis melo]
Length=964

 Score =   421 bits (1082),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 259/542 (48%), Positives = 350/542 (65%), Gaps = 23/542 (4%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G IPE +    SL  L+L+ N L G +P  +GNCSSL  L +S N L+G+IP  LS L
Sbjct  441   LNGSIPETLGGDVSLKELRLEKNLLEGAVPNSVGNCSSLVTLDVSENRLTGSIPAELSQL  500

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
               L+I+ L  N LSG +P+QL  L NLL  N+S+N L G LPAG  F  +  S++ GN  
Sbjct  501   INLQIVDLSTNNLSGALPKQLANLPNLLLFNISHNNLQGELPAGGFFNTISPSSVAGNPS  560

Query  1456  ICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRFLsvsaiva  1277
             +C  ++   C    PKPIV+NP         N+  D   P   T        LS+SA++A
Sbjct  561   LCGSIVKRSCPGVLPKPIVLNP---------NSSSDAGSPSLPTTLGHKRIILSISALIA  611

Query  1276  isaaaiiavgvmvITMVNASVRRRISFVENALESMCSSTSSRS--QGMATGKLILFDTKS  1103
             I AAA+I VGV+ IT++N  VR   +  E A+        S S      +GKL++F  + 
Sbjct  612   IGAAAVILVGVVAITVINLHVRSSANRPEAAITFSGGDDFSHSPTTDANSGKLVMFSGE-  670

Query  1102  SPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDFDRE  923
              PD+++    ++LNK  E+G G FG VY+  L       VAIKKLT S +++  E+F+RE
Sbjct  671   -PDFSTGA-HALLNKDCELGRGGFGAVYQTVL--RDGHPVAIKKLTVSSLVKSQEEFERE  726

Query  922   VRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAVRFK  743
             V+ LGK RHQNLV L GYYWTP LQLL+ +FV  G+L  +LHE    +    L+W  RF 
Sbjct  727   VKKLGKVRHQNLVALEGYYWTPSLQLLIYEFVSGGSLYKQLHE---GLGGNILSWNERFN  783

Query  742   IILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVMSNR  563
             IILGTAK LAHLH   Q  IIHYNIK SN+L+D +  PK+ DFGLARL+  LDR+V+S++
Sbjct  784   IILGTAKSLAHLH---QMNIIHYNIKSSNVLIDSSGEPKVGDFGLARLLPMLDRYVLSSK  840

Query  562   FQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRVLL  383
              Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE+VTG+RPVEY ED+V++L D VR  L
Sbjct  841   IQSALGYMAPEFACKTVKITEKCDVYGFGVLVLEVVTGKRPVEYMEDDVVVLCDMVRREL  900

Query  382   EQGNVLECVDQGMG-GYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPVPNR  206
             E+G V EC+D  +   +P EE +PV+KL L+CTSQ+PS+RP MAEVV IL++I+ P   +
Sbjct  901   EEGQVEECIDGRLQRNFPLEEAIPVVKLGLICTSQVPSNRPDMAEVVNILELIRCPSEGQ  960

Query  205   ME  200
              E
Sbjct  961   EE  962


 Score = 53.9 bits (128),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 39/110 (35%), Positives = 59/110 (54%), Gaps = 2/110 (2%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L GEI  ++    +L  + L  N  +G IP  IG+C  L  + LS N+ SG +P T+  L
Sbjct  202   LEGEIAPEVKGMNNLRAVNLGKNRFSGQIPDGIGSCLLLRSVDLSENSFSGNVPATMKKL  261

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNL  1487
                  + L  N   GE+P+ +G +E L  +++S NR +G +P  S F NL
Sbjct  262   SLCSTINLRRNLFEGEVPEWIGGMEGLEILDLSGNRFSGPIP--SSFGNL  309



>ref|XP_007011288.1| Leucine-rich repeat protein kinase family protein [Theobroma 
cacao]
 gb|EOY20098.1| Leucine-rich repeat protein kinase family protein [Theobroma 
cacao]
Length=982

 Score =   421 bits (1083),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 261/537 (49%), Positives = 348/537 (65%), Gaps = 25/537 (5%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G IP +I  + SL  L+L+ N L G IP  I NC+ L  L +S NNLSGTIP  +  L
Sbjct  459   LNGSIPMEIGGAYSLKDLRLNENFLEGKIPMSIENCTLLMSLIISQNNLSGTIPAAIGKL  518

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
               L+ + L VN L G +P+QL  L NLL+ N+S+N L G LPAG  F  +  +A+ GN  
Sbjct  519   SNLQNVDLSVNGLVGTLPKQLANLPNLLSFNISHNNLQGELPAGGFFNTISPTAVSGNPS  578

Query  1456  ICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRF-Lsvsaiv  1280
             +C   +   C    PKPIV+NP      + +++   +  P     N  H R  LS+SA++
Sbjct  579   LCGSAVNKSCPAVLPKPIVLNP-----NSSSDSISGDLPP-----NVGHKRIILSISALI  628

Query  1279  aisaaaiiavgvmvITMVNASVRRRISFVENALESMCSSTSSRS--QGMATGKLILFDTK  1106
             AI AAA+I VGV+ IT++N  VR   S    AL        SRS      +GKL++F  +
Sbjct  629   AIGAAAVIVVGVIAITVLNLRVRSSTSRSAAALTLYAGDDFSRSPTTDANSGKLVMFSGE  688

Query  1105  SSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDFDR  926
               PD+++    ++LNK  E+G G FG VY+  L     R VAIKKLT S +++  E+F+R
Sbjct  689   --PDFSTGA-HALLNKDCELGRGGFGAVYRTVL--RDGRSVAIKKLTVSSLVKSQEEFER  743

Query  925   EVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAVRF  746
             EV+ LGK RH NLV L GYYWTP LQLL+ +FV  G+L   LHE         L+W  RF
Sbjct  744   EVKKLGKIRHPNLVALEGYYWTPSLQLLIYEFVSGGSLYKHLHE---GSGGNYLSWNDRF  800

Query  745   KIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVMSN  566
              IILGTAK LAHLH   Q  IIHYNIK SN+L+D +  PK+ DFGLARL+  LDR+V+S+
Sbjct  801   SIILGTAKSLAHLH---QSNIIHYNIKSSNVLIDGSGEPKVGDFGLARLLPMLDRYVLSS  857

Query  565   RFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRVL  386
             + Q+A+GY+APE AC+++++ EKCDVYGFG+LILE+VTG+RPVEY ED+V++L D VR  
Sbjct  858   KIQSALGYMAPEFACRTVKITEKCDVYGFGILILEVVTGKRPVEYMEDDVVVLCDMVRGA  917

Query  385   LEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTP  218
             LE+G V ECVD  + G +P EE +PV+KL L+CTSQ+PS+RP M EVV IL++I+ P
Sbjct  918   LEEGRVDECVDGRLQGKFPAEEAIPVMKLGLICTSQVPSNRPDMGEVVNILELIRCP  974


 Score = 60.1 bits (144),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 41/103 (40%), Positives = 55/103 (53%), Gaps = 0/103 (0%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G +P+ + +      L L  NS  G +P  IG   SL  L  S N  SG +P ++  L
Sbjct  263   LSGSVPQTMRKLSLCSYLNLSMNSFVGEVPEWIGEMKSLETLDFSMNKFSGQVPNSIGNL  322

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPA  1508
             K LK+L    N LSG +P  +G   NLLA++ S N +TG LPA
Sbjct  323   KFLKVLNFSANGLSGSLPASMGNNVNLLALDFSQNLMTGDLPA  365


 Score = 58.5 bits (140),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 61/102 (60%), Gaps = 0/102 (0%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L GEIP+ I    +L  + L  N  +G +P  +G+C  L  + LS N LSG++P+T+  L
Sbjct  215   LEGEIPKGIEALNNLRSINLGKNRFSGQVPDGVGSCLLLRSIDLSMNLLSGSVPQTMRKL  274

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP  1511
                  L L +N   GE+P+ +G++++L  ++ S N+ +G++P
Sbjct  275   SLCSYLNLSMNSFVGEVPEWIGEMKSLETLDFSMNKFSGQVP  316



>ref|XP_011076585.1| PREDICTED: LOW QUALITY PROTEIN: probably inactive leucine-rich 
repeat receptor-like protein kinase At3g28040 [Sesamum indicum]
Length=987

 Score =   421 bits (1081),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 256/543 (47%), Positives = 357/543 (66%), Gaps = 26/543 (5%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G IP ++     L  ++L+ NSL G IP  IGNC+SL  L L+HN ++G++P +L+ L
Sbjct  462   LNGSIPSELGGLSFLDEMRLEKNSLGGEIPLSIGNCASLKSLCLAHNEITGSVPASLAKL  521

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
               L+I+ L  N+L+G +P+QL  L  L + N+S+N+L G LPAG  F  +  S++ GN  
Sbjct  522   SNLQIIDLCFNKLTGTLPKQLANLVRLQSFNISHNQLEGELPAGGFFNTISPSSVLGNPS  581

Query  1456  ICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRH-HRFLsvsaiv  1280
             +C   +   C    PKPIV+NP    N TD         P    +   H  + LS+SA++
Sbjct  582   LCGAAVNRSCPTVLPKPIVLNP----NSTDAT-------PGTVPQTFGHGKKILSISALI  630

Query  1279  aisaaaiiavgvmvITMVNASVRRRISFVENALESMCSSTSSRSQGMA--TGKLILFDTK  1106
             AI AAA I +GV+ IT++N  VR  +S    AL        S S      +GKL++F   
Sbjct  631   AIGAAAAIVIGVIAITVLNLRVRSSMSRSAVALTFSGGDDFSHSPSTDGNSGKLVMF--S  688

Query  1105  SSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDFDR  926
               PD+++   +S+LNK  E+G G FG+VY+  L  +  R +AIKKLT S +++  E+F+R
Sbjct  689   GDPDFSTGA-QSLLNKNCELGRGGFGSVYRTTL--KDGRSIAIKKLTVSSLVKSQEEFER  745

Query  925   EVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAVRF  746
             EV+ LGK RH NLV L GYYWTP LQLL+ ++VP GNL   LHE     +   L+W  RF
Sbjct  746   EVKKLGKVRHVNLVALDGYYWTPSLQLLIYEYVPGGNLYKHLHE---GSSGNYLSWNERF  802

Query  745   KIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVMSN  566
              IILG AKGLAHLH   Q  +IHYN+K SNIL+D +  PK++D GLARL+  LDR+V+S+
Sbjct  803   NIILGAAKGLAHLH---QMKVIHYNLKSSNILIDSSGEPKVADCGLARLLPMLDRYVLSS  859

Query  565   RFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRVL  386
             + Q+A+GY+APE AC+++++ EKCDVYGFG+L+LEIVTG+RPVEY ED+V++L D VR  
Sbjct  860   KIQSALGYMAPEFACKTVKITEKCDVYGFGILVLEIVTGKRPVEYMEDDVVVLCDMVRGS  919

Query  385   LEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPVPN  209
             LE+G V ECVD  + G +P EE +PV+KL L+CTSQ+PS+RP MAEVV IL++I+ P  +
Sbjct  920   LEEGKVEECVDDRLQGKFPAEEAIPVMKLGLICTSQVPSNRPDMAEVVNILELIRCPSES  979

Query  208   RME  200
             + E
Sbjct  980   QDE  982


 Score = 61.6 bits (148),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 58/102 (57%), Gaps = 0/102 (0%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L GEIP+DI    +L +++L  N  TG +P  IGNC  L  +  S N LS  +P T+  L
Sbjct  203   LEGEIPQDIEGLKNLRVIRLRNNKFTGKVPDGIGNCLLLRSIDFSQNLLSAGLPSTMQKL  262

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP  1511
                 +L L  N  + E+P+ +G++ +L  V+ S N  TG+LP
Sbjct  263   SLCNVLLLARNLFTWEMPEWIGEMRSLETVDFSENNFTGQLP  304


 Score = 58.9 bits (141),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 59/107 (55%), Gaps = 1/107 (1%)
 Frame = -1

Query  1822  SALIGEIPEDI-CESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETL  1646
             + L G I  D   + GSL  + L  N  +G IP  +G+CS+LT L+ S N   G +P  +
Sbjct  128   NGLWGSISSDFFMQCGSLRSISLARNKFSGPIPESLGSCSTLTSLNFSGNQFLGLLPSAI  187

Query  1645  SMLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAG  1505
               +  LK L L  N L GEIPQ +  L+NL  + +  N+ TG++P G
Sbjct  188   WSMPALKSLDLSDNMLEGEIPQDIEGLKNLRVIRLRNNKFTGKVPDG  234


 Score = 53.5 bits (127),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 52/87 (60%), Gaps = 0/87 (0%)
 Frame = -1

Query  1768  ILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSMLKRLKILKLEVNQLSGE  1589
             +L L  N  T  +P  IG   SL  +  S NN +G +P++L  L+ LKIL +  N L+G 
Sbjct  267   VLLLARNLFTWEMPEWIGEMRSLETVDFSENNFTGQLPDSLGKLQSLKILNVSKNALTGS  326

Query  1588  IPQQLGKLENLLAVNVSYNRLTGRLPA  1508
             +P+ +    NL+A ++S+N LTG LP+
Sbjct  327   LPETMSNCINLVAFDISHNSLTGNLPS  353



>ref|XP_003522510.2| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Glycine max]
Length=978

 Score =   420 bits (1080),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 259/543 (48%), Positives = 346/543 (64%), Gaps = 25/543 (5%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G IP +I  + SL  L L+ N L G IP  I NCS LT L LS N LSG IP  ++ L
Sbjct  455   LNGSIPWEIGGAVSLKELVLEKNFLNGKIPTSIENCSLLTTLILSQNKLSGPIPAAVAKL  514

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
               L+ + +  N L+G +P+QL  L NLL  N+S+N L G LPAG  F  +  S++ GN  
Sbjct  515   TNLQTVDVSFNNLTGALPKQLANLANLLTFNLSHNNLQGELPAGGFFNTITPSSVSGNPS  574

Query  1456  ICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRF-Lsvsaiv  1280
             +C   +   C    PKPIV+NP          N   +  P +   N  H R  LS+SA++
Sbjct  575   LCGAAVNKSCPAVLPKPIVLNP----------NTSTDTGPSSLPPNLGHKRIILSISALI  624

Query  1279  aisaaaiiavgvmvITMVNASVRRRISFVENALESMCSSTSSRS--QGMATGKLILFDTK  1106
             AI AAA+I +GV+ IT++N  VR   S    AL        S S      +GKL++F  +
Sbjct  625   AIGAAAVIVIGVISITVLNLRVRSSTSRDAAALTFSAGDEFSHSPTTDANSGKLVMFSGE  684

Query  1105  SSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDFDR  926
               PD++S    ++LNK  E+G G FG VY+  L       VAIKKLT S +++  EDF+R
Sbjct  685   --PDFSSGA-HALLNKDCELGRGGFGAVYQTVL--RDGHSVAIKKLTVSSLVKSQEDFER  739

Query  925   EVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAVRF  746
             EV+ LGK RHQNLV L GYYWTP LQLL+ +++  G+L   LHE         L+W  RF
Sbjct  740   EVKKLGKIRHQNLVELEGYYWTPSLQLLIYEYLSGGSLYKHLHE---GSGGNFLSWNERF  796

Query  745   KIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVMSN  566
              +ILGTAK LAHLHHS    IIHYNIK +N+LLD    PK+ DFGLARL+  LDR+V+S+
Sbjct  797   NVILGTAKALAHLHHS---NIIHYNIKSTNVLLDSYGEPKVGDFGLARLLPMLDRYVLSS  853

Query  565   RFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRVL  386
             + Q+A+GY+APE AC+++++ EKCDVYGFG+L+LEIVTG+RPVEY ED+V++L D VR  
Sbjct  854   KIQSALGYMAPEFACKTVKITEKCDVYGFGVLVLEIVTGKRPVEYMEDDVVVLCDMVRGA  913

Query  385   LEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPVPN  209
             LE+G V EC+D+ + G +P EE +PV+KL L+CTSQ+PS+RP M EVV IL++I+ P   
Sbjct  914   LEEGRVEECIDERLQGKFPAEEAIPVMKLGLICTSQVPSNRPDMGEVVNILELIRCPSEG  973

Query  208   RME  200
             + E
Sbjct  974   QEE  976


 Score = 67.0 bits (162),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 68/107 (64%), Gaps = 1/107 (1%)
 Frame = -1

Query  1822  SALIGEIPEDIC-ESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETL  1646
             ++L GE+ ED+  + GSL  + L  N  +G+IP  +G CS+L  + LS+N  SG++P  +
Sbjct  136   NSLSGEVSEDVFRQCGSLRTVSLARNRFSGSIPSTLGACSALAAIDLSNNQFSGSVPSRV  195

Query  1645  SMLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAG  1505
               L  L+ L L  N L GEIP+ +  ++NL +V+V+ NRLTG +P G
Sbjct  196   WSLSALRSLDLSDNLLEGEIPKGIEAMKNLRSVSVARNRLTGNVPYG  242



>ref|XP_004138394.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Cucumis sativus]
 gb|KGN45839.1| hypothetical protein Csa_6G014590 [Cucumis sativus]
Length=964

 Score =   419 bits (1078),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 259/543 (48%), Positives = 350/543 (64%), Gaps = 25/543 (5%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G IPE +    SL  L+L  N L G +P  +GNCSSL  L +S N L+G+IP  LS L
Sbjct  441   LNGSIPETLGRDVSLKELRLGKNLLEGGVPNSVGNCSSLVTLDVSENRLTGSIPAELSQL  500

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
               L+I+ L  N LSG +P+QL  L NLL  N+S+N L G LPAG  F  +  S++ GN  
Sbjct  501   INLQIVDLSTNNLSGALPKQLANLPNLLLFNISHNNLQGELPAGGFFNTISPSSVAGNPS  560

Query  1456  ICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRF-Lsvsaiv  1280
             +C  ++   C    PKPIV+NP    N + +         L       H R  LS+SA++
Sbjct  561   LCGSIVKRSCPGVLPKPIVLNP----NSSSDAGSTSLPTTLG------HKRIILSISALI  610

Query  1279  aisaaaiiavgvmvITMVNASVRRRISFVENALESMCSSTSSRS--QGMATGKLILFDTK  1106
             AI AAA+I VGV+ IT++N  VR   +  E A+        S S      +GKL++F  +
Sbjct  611   AIGAAAVILVGVVAITVINLHVRSSANRPEAAITFSGGDDFSHSPTTDANSGKLVMFSGE  670

Query  1105  SSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDFDR  926
               PD+++    ++LNK  E+G G FG VY+  L       VAIKKLT S +++  E+F+R
Sbjct  671   --PDFSTGA-HALLNKDCELGRGGFGAVYQTVL--RDGHPVAIKKLTVSSLVKSQEEFER  725

Query  925   EVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAVRF  746
             EV+ LGK RHQNLV L GYYWTP LQLL+ +FV  G+L  +LHE    +    L+W  RF
Sbjct  726   EVKKLGKVRHQNLVALEGYYWTPSLQLLIYEFVSGGSLYKQLHE---GLGGNILSWNERF  782

Query  745   KIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVMSN  566
              IILGTAK LAHLH   Q  IIHYNIK SN+L+D +  PK+ DFGLARL+  LDR+V+S+
Sbjct  783   NIILGTAKSLAHLH---QMNIIHYNIKSSNVLIDSSGEPKVGDFGLARLLPMLDRYVLSS  839

Query  565   RFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRVL  386
             + Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE+VTG+RPVEY ED+V++L D VR  
Sbjct  840   KIQSALGYMAPEFACKTVKITEKCDVYGFGVLVLEVVTGKRPVEYMEDDVVVLCDMVRRE  899

Query  385   LEQGNVLECVDQGMG-GYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPVPN  209
             LE+G V EC+D  +   +P EE +PV+KL L+CTSQ+PS+RP MAEVV IL++I+ P   
Sbjct  900   LEEGRVEECIDGRLQRNFPLEEAIPVVKLGLICTSQVPSNRPDMAEVVNILELIRCPSEG  959

Query  208   RME  200
             + E
Sbjct  960   QEE  962


 Score = 58.2 bits (139),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 60/110 (55%), Gaps = 2/110 (2%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L GEIP ++    +L  + L  N  +G IP  IG+C  L  + LS N+ SG +P T+  L
Sbjct  202   LEGEIPPEVKGMNNLRAVNLGKNRFSGQIPDGIGSCMLLRSVDLSENSFSGNVPATMKKL  261

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNL  1487
                  L L  N   GE+P+ +G +E L  +++S NR +G +P  S F NL
Sbjct  262   SLCSTLNLRRNLFQGEVPEWIGGMEGLEILDLSGNRFSGPIP--SSFGNL  309


 Score = 55.1 bits (131),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 42/103 (41%), Positives = 63/103 (61%), Gaps = 1/103 (1%)
 Frame = -1

Query  1810  GEIPEDIC-ESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSMLK  1634
             G IP+D   + GSL ++ L  N ++G IP  + +CSSL  ++LS N  SG++P  +  L 
Sbjct  131   GMIPDDFFRQCGSLRVISLANNKISGKIPESLSSCSSLAAVNLSSNQFSGSLPSGIWSLT  190

Query  1633  RLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAG  1505
              L+ L L  N L GEIP ++  + NL AVN+  NR +G++P G
Sbjct  191   GLRSLDLSDNILEGEIPPEVKGMNNLRAVNLGKNRFSGQIPDG  233



>ref|XP_002520879.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF41588.1| ATP binding protein, putative [Ricinus communis]
Length=963

 Score =   419 bits (1078),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 258/545 (47%), Positives = 353/545 (65%), Gaps = 25/545 (5%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             ++L G IP +I  + SL  L+L+ N L+G IP  +GNC+SLT + LS NNL+G IP  ++
Sbjct  438   NSLNGSIPLEIGGAFSLKELRLERNLLSGQIPSSVGNCTSLTTMILSRNNLTGLIPAAIA  497

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGN  1463
              L  LK + L  N L+G +P+QL  L NL + N+S+N+L G LPAG  F  +   ++ GN
Sbjct  498   KLTSLKDVDLSFNSLTGGLPKQLANLPNLSSFNISHNQLQGELPAGGFFNTISPYSVSGN  557

Query  1462  DGICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRF-Lsvsa  1286
               +C   +   C    PKPIV+NP          N   ++ P    ++  H R  LS+SA
Sbjct  558   PSLCGAAVNKSCPAVLPKPIVLNP----------NSSSDSAPGEIPQDIGHKRIILSISA  607

Query  1285  ivaisaaaiiavgvmvITMVNASVRRRISFVENALESMCSSTSSRS--QGMATGKLILFD  1112
             ++AI AAA+I VGV+ IT++N  VR   S    AL        S S      +GKL++F 
Sbjct  608   LIAIGAAAVIVVGVIAITVLNLRVRSSTSRSAAALTFSAGDDFSHSPTTDANSGKLVMF-  666

Query  1111  TKSSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDF  932
                 PD+++    ++LNK  E+G G FG VY+  L       VAIKKLT S +++  +DF
Sbjct  667   -SGDPDFSTGA-HALLNKDCELGRGGFGAVYRTVL--RNGHPVAIKKLTVSSLVKSQDDF  722

Query  931   DREVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAV  752
             +REV+ LGK RHQNLV L GYYWTP LQLL+ +FV  G+L   LHE +       L+W  
Sbjct  723   EREVKKLGKVRHQNLVGLEGYYWTPSLQLLIYEFVSGGSLYKHLHEGSGGHF---LSWNE  779

Query  751   RFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVM  572
             RF IILGTAK LAHLH   Q  IIHYNIK SN+LLD +  PK+ D+GLARL+  LDR+V+
Sbjct  780   RFNIILGTAKSLAHLH---QSNIIHYNIKSSNVLLDSSGEPKVGDYGLARLLPMLDRYVL  836

Query  571   SNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVR  392
             S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LEIVTG+RPVEY ED+V +L D VR
Sbjct  837   SSKIQSALGYMAPEFACRTVKITEKCDVYGFGVLVLEIVTGKRPVEYMEDDVAVLCDMVR  896

Query  391   VLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPV  215
               LE+G V EC+D  + G +P +EV+PV+KL L+CTSQ+PS+RP M EVV IL++I+ P 
Sbjct  897   GALEEGRVEECIDDRLQGNFPADEVVPVMKLGLICTSQVPSNRPDMGEVVNILELIRCPS  956

Query  214   PNRME  200
               + E
Sbjct  957   EGQDE  961


 Score = 63.2 bits (152),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 64/107 (60%), Gaps = 1/107 (1%)
 Frame = -1

Query  1822  SALIGEIPEDICES-GSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETL  1646
             ++L G IP+D  +  GSL ++ L  N  +G IP  +G+C++L  + LS N  SG++P  +
Sbjct  130   NSLSGPIPDDFFQQCGSLRVISLAKNKFSGKIPASLGSCATLASVDLSSNQFSGSLPPGI  189

Query  1645  SMLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAG  1505
               L  L+ L L  N L GEIP+ +  L NL  +N+S N+ TG +P G
Sbjct  190   WGLSGLRSLDLSNNLLEGEIPKGIEVLNNLRGINLSKNQFTGIVPDG  236


 Score = 61.2 bits (147),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 59/105 (56%), Gaps = 0/105 (0%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             ++L GE PE I +      + L  N LTG +P  IG    L  L +S N +SG IP ++ 
Sbjct  251   NSLSGEFPETIQKLSLCNFMSLSNNLLTGEVPNWIGEMKRLETLDISGNKISGQIPTSIG  310

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPA  1508
              L+ LK+L    N LSG +P+ +    +LLA+++S N + G LPA
Sbjct  311   NLQSLKVLNFSSNDLSGSLPESMANCGSLLALDLSRNSMNGDLPA  355


 Score = 59.3 bits (142),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 38/103 (37%), Positives = 61/103 (59%), Gaps = 0/103 (0%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L GEIP+ I    +L  + L  N  TG +P  IG+C  L  + LS N+LSG  PET+  L
Sbjct  205   LEGEIPKGIEVLNNLRGINLSKNQFTGIVPDGIGSCLLLRSIDLSGNSLSGEFPETIQKL  264

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPA  1508
                  + L  N L+GE+P  +G+++ L  +++S N+++G++P 
Sbjct  265   SLCNFMSLSNNLLTGEVPNWIGEMKRLETLDISGNKISGQIPT  307



>ref|NP_001239730.1| probably inactive leucine-rich repeat receptor-like protein kinase 
At3g28040-like precursor [Glycine max]
 gb|ACM89592.1| leucine-rich repeat transmembrane protein kinase [Glycine max]
 gb|KHN25807.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Glycine soja]
Length=971

 Score =   419 bits (1077),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 259/543 (48%), Positives = 345/543 (64%), Gaps = 25/543 (5%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G IP +I  + SL  L L+ N L G IP  I NCS LT L LS N LSG IP  ++ L
Sbjct  448   LNGSIPWEIGRAVSLKELVLEKNFLNGKIPSSIENCSLLTTLILSQNKLSGPIPAAVAKL  507

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
               L+ + +  N L+G +P+QL  L NLL  N+S+N L G LPAG  F  +  S++ GN  
Sbjct  508   TNLRTVDVSFNSLTGNLPKQLANLANLLTFNLSHNNLQGELPAGGFFNTISPSSVSGNPS  567

Query  1456  ICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRF-Lsvsaiv  1280
             +C   +   C    PKPIV+NP          N   +  P +   N  H R  LS+SA++
Sbjct  568   LCGAAVNKSCPAVLPKPIVLNP----------NTSTDTGPGSLPPNLGHKRIILSISALI  617

Query  1279  aisaaaiiavgvmvITMVNASVRRRISFVENALESMCSSTSSRS--QGMATGKLILFDTK  1106
             AI AAA+I +GV+ IT++N  VR        AL        SRS      +GKL++F  +
Sbjct  618   AIGAAAVIVIGVISITVLNLRVRSSTPRDAAALTFSAGDEFSRSPTTDANSGKLVMFSGE  677

Query  1105  SSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDFDR  926
               PD++S    ++LNK  E+G G FG VY+  L       VAIKKLT S +++  EDF+R
Sbjct  678   --PDFSSGA-HALLNKDCELGRGGFGAVYQTVL--RDGHSVAIKKLTVSSLVKSQEDFER  732

Query  925   EVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAVRF  746
             EV+ LGK RHQNLV L GYYWT  LQLL+ ++V  G+L   LHE         L+W  RF
Sbjct  733   EVKKLGKIRHQNLVELEGYYWTTSLQLLIYEYVSGGSLYKHLHE---GSGGNFLSWNERF  789

Query  745   KIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVMSN  566
              +ILGTAK LAHLHHS    IIHYNIK +N+LLD    PK+ DFGLARL+  LDR+V+S+
Sbjct  790   NVILGTAKALAHLHHS---NIIHYNIKSTNVLLDSYGEPKVGDFGLARLLPMLDRYVLSS  846

Query  565   RFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRVL  386
             + Q+A+GY+APE AC+++++ EKCDVYGFG+L+LEIVTG+RPVEY ED+V++L D VR  
Sbjct  847   KIQSALGYMAPEFACKTVKITEKCDVYGFGVLVLEIVTGKRPVEYMEDDVVVLCDMVRGA  906

Query  385   LEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPVPN  209
             LE+G V EC+D+ + G +P EE +PV+KL L+CTSQ+PS+RP M EVV IL++I+ P   
Sbjct  907   LEEGRVEECIDERLQGKFPAEEAIPVMKLGLICTSQVPSNRPDMGEVVNILELIRCPSEG  966

Query  208   RME  200
             + E
Sbjct  967   QEE  969


 Score = 63.9 bits (154),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 68/107 (64%), Gaps = 1/107 (1%)
 Frame = -1

Query  1822  SALIGEIPEDIC-ESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETL  1646
             ++L GE+ +D+  + GSL  + L  N  +G+IP  +G CS+L  + LS+N  SG++P  +
Sbjct  129   NSLSGEVSDDVFRQCGSLRTVSLARNRFSGSIPSTLGACSALASIDLSNNQFSGSVPSGV  188

Query  1645  SMLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAG  1505
               L  L+ L L  N L GEIP+ +  ++NL +V+++ NRLTG +P G
Sbjct  189   WSLSALRSLDLSDNLLEGEIPKGVEAMKNLRSVSMTRNRLTGNVPFG  235



>ref|XP_011095143.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Sesamum indicum]
Length=979

 Score =   419 bits (1077),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 254/543 (47%), Positives = 357/543 (66%), Gaps = 26/543 (5%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G IP +I  + SL  L+L+ N LTG IP  IGNCSSLT L LS NNLSG +P  ++ L
Sbjct  457   LSGSIPAEIGGAVSLQELRLESNFLTGAIPADIGNCSSLTSLVLSRNNLSGPVPVAIASL  516

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
               L++L L  N LSG +P++L  L +L   N S+N L G LP G  F  +  S++ GN  
Sbjct  517   SNLELLDLSFNNLSGSLPKELTNLSHLDTFNASFNHLQGELPVGGFFNTIPLSSVIGNPS  576

Query  1456  ICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRF-Lsvsaiv  1280
             +C  ++   C    PKP+V+NP         N+   N+ PL+   N RH R  LSVS++V
Sbjct  577   LCGSIVKHSCPAVHPKPLVLNP---------NSSVSNHGPLSP--NLRHKRIVLSVSSLV  625

Query  1279  aisaaaiiavgvmvITMVNASVRRRISFVENALESMCSSTSSRSQGMAT--GKLILFDTK  1106
             AI AA  IAVGV+ ++++N   R  ++    A         S S       GKL++F  +
Sbjct  626   AIGAAVFIAVGVVTVSILNMHARTSMARSAAAFTFSGGDDFSPSHDTEANYGKLVMFSGE  685

Query  1105  SSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDFDR  926
                D+ +   +S+LNK  E+G G FG VY+  L  +G R +AIKKL ++ +++  EDF+R
Sbjct  686   V--DFVTGA-QSLLNKDCELGRGGFGAVYRTEL--QGGRSIAIKKLNTTSLVKCQEDFER  740

Query  925   EVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAVRF  746
             EV+ LGK RHQNLV L GYYWTP LQLL+++++  G+L   LH+   A     LTW  RF
Sbjct  741   EVKKLGKIRHQNLVALEGYYWTPSLQLLINEYISGGSLHKHLHDRESAGC---LTWQQRF  797

Query  745   KIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVMSN  566
             KIILGTAKGLAHLH   Q  +IHYN+K +N+L+D +  PK+ DFGLARL+  LDR+++S+
Sbjct  798   KIILGTAKGLAHLH---QLNVIHYNMKSTNVLMDFSGEPKVGDFGLARLLPALDRYILSS  854

Query  565   RFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRVL  386
             + Q+A+GY+APE ACQ++++ EKCDVYGFG+L LE++TGRRPVEY ED+V++L D VR  
Sbjct  855   KIQSALGYMAPEFACQTVKITEKCDVYGFGVLTLEVLTGRRPVEYMEDDVVVLCDMVREA  914

Query  385   LEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPVPN  209
             L++G + EC+D+ + G YP EE +PV+KL L+C SQ+PS+RP M EV++IL++I+ P  +
Sbjct  915   LDEGRIEECIDKKLEGKYPMEEAIPVVKLGLICASQVPSNRPDMEEVIRILELIQCPTES  974

Query  208   RME  200
             + E
Sbjct  975   QEE  977


 Score = 53.5 bits (127),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 33/101 (33%), Positives = 53/101 (52%), Gaps = 0/101 (0%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L GEIP  I    +L  + L  N+  G +P  IGNC  L  +    N  +GT+P ++  L
Sbjct  215   LEGEIPRGIESLYNLRAINLRRNNFVGWLPENIGNCLLLKSVDFGENYFTGTLPLSMRKL  274

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRL  1514
                + L    N L+GE P  +G++ +L  +++S N  +GR+
Sbjct  275   SVCRYLDASRNLLTGEFPDWIGEMRSLEFLDLSVNNFSGRM  315



>ref|XP_009623562.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Nicotiana tomentosiformis]
Length=893

 Score =   417 bits (1071),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 258/542 (48%), Positives = 355/542 (65%), Gaps = 27/542 (5%)
 Frame = -1

Query  1810  GEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSMLKR  1631
             G +P +I    SL  L+L+ N+L G IP  IG+CSSL  LSLS N+L+G +P  L+ L  
Sbjct  372   GTVPAEIGGVTSLKELRLEKNALVGQIPSSIGSCSSLVSLSLSQNSLTGPVPAALANLTY  431

Query  1630  LKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDGIC  1451
             L+ + L  N+L+G +P+QLG L +LL+ N+S+N+L G LP+   F  +   ++  N  +C
Sbjct  432   LQNVDLSFNKLTGTLPKQLGNLGHLLSFNISHNQLQGELPSNGFFNTISPYSVLANPSLC  491

Query  1450  SPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHR-FLsvsaivai  1274
                +   C    PKPIV+NP    N TD+        P    ++ RH +  LS+SA++AI
Sbjct  492   GAAVNRSCSTVMPKPIVLNP----NSTDST-------PSTVPQSFRHEKKILSISALIAI  540

Query  1273  saaaiiavgvmvITMVNASVRRRISFVENALESMCSS---TSSRSQGMATGKLILFDTKS  1103
              AAA+I VGV+ IT++N  VR   S    A  +       + S S    +GKL++F    
Sbjct  541   GAAAVIFVGVIAITVLNIRVRSTTSLSAAAALTFSGGDDFSRSPSTDANSGKLVMF--SG  598

Query  1102  SPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDFDRE  923
              PD+++    ++LNK  E+G G FG VY   LG   S  VAIKKLT S +++  EDF+RE
Sbjct  599   DPDFSTGA-HALLNKDCELGRGGFGAVYHTVLGDGHS--VAIKKLTVSSLVKSQEDFERE  655

Query  922   VRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAVRFK  743
             VR LGKARH NLV L GYYWTP LQLL+ +FV  GNL   LHE         LTW  RF 
Sbjct  656   VRKLGKARHHNLVTLEGYYWTPSLQLLIYEFVAGGNLFKHLHE---EFGGSLLTWNERFS  712

Query  742   IILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVMSNR  563
             IILGTAK LAHLH   Q  IIHYN+K SNIL+D +  PK++D+GLARL+  LDR+V+S++
Sbjct  713   IILGTAKSLAHLH---QMNIIHYNLKSSNILIDSSGEPKVADYGLARLLPMLDRYVLSSK  769

Query  562   FQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRVLL  383
              Q+A+GY+APE AC+++++ EKCDVYGFG+LILE+VTG+RPVEY ED+V++L D VR  L
Sbjct  770   IQSALGYMAPEFACKTVKITEKCDVYGFGVLILEVVTGKRPVEYMEDDVVVLCDMVRGAL  829

Query  382   EQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPVPNR  206
             E+G + +C+D  + G +P +E +PV+KL L+CTSQ+PS+RP MAEVV IL++I+ P   +
Sbjct  830   EEGRIEDCIDTRLQGKFPADEAIPVMKLGLICTSQVPSNRPDMAEVVNILELIRCPSEGQ  889

Query  205   ME  200
              E
Sbjct  890   DE  891


 Score = 57.8 bits (138),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 64/105 (61%), Gaps = 0/105 (0%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             +A  G +PE I E  SL IL    NS +G+IP  +    SL LL++S N +SG++PE++S
Sbjct  272   NAFAGVVPEWIGELKSLEILDFSENSFSGSIPTSVEKLESLKLLNVSQNVISGSLPESIS  331

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPA  1508
                 L  L +  N L+G +P+ +G+L+ L  +++S NR  G +PA
Sbjct  332   SCVNLLTLDVSHNNLTGTVPKTVGQLKLLNILDLSENRFYGTVPA  376


 Score = 57.8 bits (138),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 37/101 (37%), Positives = 63/101 (62%), Gaps = 0/101 (0%)
 Frame = -1

Query  1810  GEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSMLKR  1631
             G IP  + +  SL +L +  N ++G++P  I +C +L  L +SHNNL+GT+P+T+  LK 
Sbjct  300   GSIPTSVEKLESLKLLNVSQNVISGSLPESISSCVNLLTLDVSHNNLTGTVPKTVGQLKL  359

Query  1630  LKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPA  1508
             L IL L  N+  G +P ++G + +L  + +  N L G++P+
Sbjct  360   LNILDLSENRFYGTVPAEIGGVTSLKELRLEKNALVGQIPS  400


 Score = 54.3 bits (129),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 40/124 (32%), Positives = 57/124 (46%), Gaps = 24/124 (19%)
 Frame = -1

Query  1810  GEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSMLKR  1631
             GE+P+ I +   L  + L GNS +G +P  +   S    + L  N  +G +PE +  LK 
Sbjct  228   GEVPDGIGDCWLLRSIDLSGNSFSGELPSTMQKLSLCNEVILRRNAFAGVVPEWIGELKS  287

Query  1630  LKILKLEVNQLSGEIPQQLGKLE------------------------NLLAVNVSYNRLT  1523
             L+IL    N  SG IP  + KLE                        NLL ++VS+N LT
Sbjct  288   LEILDFSENSFSGSIPTSVEKLESLKLLNVSQNVISGSLPESISSCVNLLTLDVSHNNLT  347

Query  1522  GRLP  1511
             G +P
Sbjct  348   GTVP  351


 Score = 54.3 bits (129),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 58/107 (54%), Gaps = 1/107 (1%)
 Frame = -1

Query  1822  SALIGEIPEDICES-GSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETL  1646
             ++L G IP D  E  G L  + L  N+ +G IP  + +C++L  L+LS N  SG +P  +
Sbjct  127   NSLSGPIPGDYFEKCGPLRSISLAKNNFSGEIPESLSSCATLASLNLSSNQFSGLVPSGI  186

Query  1645  SMLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAG  1505
               L  L+ L L  N L GEIP  +  L NL A+N+  N   G +P G
Sbjct  187   WSLNGLRSLDLSNNLLDGEIPAGIEGLSNLRAINLGGNHFKGEVPDG  233


 Score = 53.1 bits (126),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 57/126 (45%), Gaps = 24/126 (19%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllsls---------------  1682
             L GEIP  I    +L  + L GN   G +P  IG+C  L  + LS               
Sbjct  202   LDGEIPAGIEGLSNLRAINLGGNHFKGEVPDGIGDCWLLRSIDLSGNSFSGELPSTMQKL  261

Query  1681  ---------hnnlSGTIPETLSMLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNR  1529
                       N  +G +PE +  LK L+IL    N  SG IP  + KLE+L  +NVS N 
Sbjct  262   SLCNEVILRRNAFAGVVPEWIGELKSLEILDFSENSFSGSIPTSVEKLESLKLLNVSQNV  321

Query  1528  LTGRLP  1511
             ++G LP
Sbjct  322   ISGSLP  327



>ref|XP_008233886.1| PREDICTED: LOW QUALITY PROTEIN: probably inactive leucine-rich 
repeat receptor-like protein kinase At3g28040 [Prunus mume]
Length=975

 Score =   418 bits (1075),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 246/543 (45%), Positives = 342/543 (63%), Gaps = 24/543 (4%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G IP +I  + SL  L+L+ N LTG IP  IGNCSSLT L  S N L+G +P  ++ L
Sbjct  452   LSGSIPLEIGGAFSLKELRLENNLLTGKIPTSIGNCSSLTTLIASQNRLTGPVPAAMAKL  511

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
               L+ + L  N L+G +P+QL  L NLL+ N+S+N L G LPAG+ F  +  S++ GN  
Sbjct  512   TNLQNVDLSFNNLTGGLPKQLANLPNLLSFNISHNNLQGELPAGAFFNTISPSSVSGNPS  571

Query  1456  ICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRFLsvsaiva  1277
             +C   +   C    PKPIV+NP    + T          P   + N  H R +   + + 
Sbjct  572   LCGSAVNKSCPTVLPKPIVLNPNSSSDSTT---------PGTLSSNLGHRRIILSISALI  622

Query  1276  isaaaiiavgvmvI-TMVNASVRRRISFVENALESMCSSTSSRSQGMA--TGKLILFDTK  1106
               AAA + V  ++  T++N  VR   +    AL        S S      +GKL++F  +
Sbjct  623   AIAAAAVIVIGVIAITVLNLRVRSSTTHSPAALALSAGDDFSHSPTTDGNSGKLVMFSGE  682

Query  1105  SSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDFDR  926
               PD+++    ++LNK  E+G G FG VY+  L     R VAIKKLT S +++  E+F+R
Sbjct  683   --PDFSTGA-HALLNKDCELGRGGFGAVYRTVL--RDGRPVAIKKLTVSSLVKSQEEFER  737

Query  925   EVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAVRF  746
             EV+ LGK RH NLV + GYYWTP LQL++ ++V  G+L   LH+ A       L+W  RF
Sbjct  738   EVKKLGKVRHDNLVEIEGYYWTPSLQLIIYEYVSGGSLYKHLHDGAGGNF---LSWNDRF  794

Query  745   KIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVMSN  566
              IILGTAK LAHLH   Q  IIHYNIK SN+L+  +  PK+ DFGLARL+  LDR+V+S+
Sbjct  795   NIILGTAKSLAHLH---QMNIIHYNIKSSNVLIGSSGEPKVGDFGLARLLPMLDRYVLSS  851

Query  565   RFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRVL  386
             + Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE+VTG+RPVEY ED+V++L D VR  
Sbjct  852   KIQSALGYMAPEFACKTVKITEKCDVYGFGVLVLEVVTGKRPVEYMEDDVVVLCDMVRGA  911

Query  385   LEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPVPN  209
             LE+G V EC+D  + G +P EE +PV+KL L+CTSQ+PS+RP MAEVV IL++I+ P   
Sbjct  912   LEEGRVEECIDGRLQGNFPAEEAIPVMKLGLICTSQVPSNRPDMAEVVNILELIRCPSEG  971

Query  208   RME  200
             + E
Sbjct  972   QEE  974


 Score = 68.9 bits (167),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 44/103 (43%), Positives = 63/103 (61%), Gaps = 1/103 (1%)
 Frame = -1

Query  1810  GEIPEDIC-ESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSMLK  1634
             G +PED   + GSL  + L  N ++G IP  +G+C+SL  + LS N  SG++P  +  L 
Sbjct  137   GPVPEDFFRQCGSLRTISLAKNKISGKIPESLGSCASLAAIDLSLNQFSGSVPVGIWSLN  196

Query  1633  RLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAG  1505
              ++ L L  N L GEIP+ +G L NL AVN+  NR TG++P G
Sbjct  197   GIRSLDLSNNLLEGEIPKAIGGLNNLRAVNLGKNRFTGQVPDG  239


 Score = 61.6 bits (148),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 39/103 (38%), Positives = 60/103 (58%), Gaps = 0/103 (0%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L GEIP+ I    +L  + L  N  TG +P  IG+C  L  + LS N+ SG +P+T+  L
Sbjct  208   LEGEIPKAIGGLNNLRAVNLGKNRFTGQVPDGIGSCLLLRSIDLSENSFSGNLPQTMQKL  267

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPA  1508
                  L L  N  +GEIP+ +G+L++L  +++S NR  G +P+
Sbjct  268   SLCSYLNLHQNSFAGEIPEWIGELKSLETLDLSGNRFLGEVPS  310



>ref|XP_010253067.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Nelumbo nucifera]
Length=970

 Score =   417 bits (1073),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 261/544 (48%), Positives = 347/544 (64%), Gaps = 26/544 (5%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G IP +I E  SL  L+L+ N L G IP QIG C SLT L LS NN SG IP TL+ L
Sbjct  446   LNGSIPSEIGEVVSLKELRLEKNFLAGKIPFQIGKCLSLTSLILSQNNFSGPIPATLANL  505

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
               LKI+ L +N LSG +P+QL  L  LL+ N+S+N L G LPAG  F  +  S++ GN  
Sbjct  506   TNLKIVDLALNNLSGSLPKQLANLPYLLSFNISHNHLQGELPAGGFFNTISPSSVSGNPS  565

Query  1456  ICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRFLsvsaiva  1277
             +C   +   C    PKPIV+NP    + +   +   N  P            LS+SA++A
Sbjct  566   LCGSAVNRSCPAVLPKPIVLNPNSSSDSSGMGSFSPNLHP--------KKIILSISALIA  617

Query  1276  isaaaiiavgvmvITMVNASVRRRISFVENALESMCSSTSSRSQGMAT----GKLILFDT  1109
             I AA +IA+GV+ +T++N  VR   S    AL  M S     S    T    GKL++F  
Sbjct  618   IGAAVVIALGVVAVTVLNFRVRSSTSRSAAAL--MLSGVDDFSHSPTTDANSGKLVMF--  673

Query  1108  KSSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDFD  929
                PD+++    ++LNK  E+G G FG VY+  L       VAIKKLT S +++  EDF+
Sbjct  674   SGDPDFSAGA-HALLNKDCELGRGGFGAVYRTVL--RDGHPVAIKKLTVSSLVKSQEDFE  730

Query  928   REVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAVR  749
             REV+ LGK RH NLV L GYYWTP LQLL+ +F+  G+L   LHE A       L+W  R
Sbjct  731   REVKKLGKIRHPNLVALEGYYWTPSLQLLIYEFISGGSLYKHLHEGA---GGSFLSWHER  787

Query  748   FKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVMS  569
             F IILGTA+ LAHLH   Q  IIHYN+K SN+L+D    PK+ DFGLARL+  LDR+V+S
Sbjct  788   FNIILGTARSLAHLH---QLDIIHYNLKASNVLIDSTGEPKVGDFGLARLLPMLDRYVLS  844

Query  568   NRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRV  389
             ++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE+VTG+RPVEY ED+V++L D VR 
Sbjct  845   SKIQSALGYMAPEFACRTVKITEKCDVYGFGVLLLEVVTGKRPVEYMEDDVVVLCDMVRG  904

Query  388   LLEQGNVLECVDQGMGG-YPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPVP  212
              LE+G V +CVD  + G +  EE +PV+KL L+CTSQ+PS+RP MAEVV IL++I+ P  
Sbjct  905   ALEEGRVEQCVDGRLSGNFLAEEAIPVMKLGLICTSQVPSNRPDMAEVVNILELIRCPSE  964

Query  211   NRME  200
              + E
Sbjct  965   GQEE  968


 Score = 59.3 bits (142),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 57/105 (54%), Gaps = 0/105 (0%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             ++L G +P+ +        L L GN  +G +P  IG   SL  + LS N  +G IP +L 
Sbjct  248   NSLSGSLPDSMRRLTMCSSLSLHGNLFSGELPAVIGEMRSLEAVDLSGNMFAGGIPGSLG  307

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPA  1508
              L+ LK+L L  N  SG +P  L   +NLL ++ S N LTG LPA
Sbjct  308   NLQSLKLLNLSSNGFSGGVPDSLSNCKNLLIIDFSQNSLTGNLPA  352



>ref|XP_009363794.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Pyrus x bretschneideri]
 ref|XP_009363882.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Pyrus x bretschneideri]
Length=973

 Score =   417 bits (1073),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 250/543 (46%), Positives = 344/543 (63%), Gaps = 25/543 (5%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G IP++I  + SL  L+LD N LTG IP  I +CSSLT L++S N L+G +P ++S L
Sbjct  451   LNGSIPQEIGGAFSLKELRLDKNFLTGKIPTSIEHCSSLTTLTVSQNRLTGPLPASMSKL  510

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
               L+I+ L  N L+G +P+QL  L NLL+ N+S+N L G LP G+ F  +  S++ GN  
Sbjct  511   TNLQIVDLSFNNLTGGLPKQLANLPNLLSFNISHNNLQGELPTGAFFNTISPSSVSGNPS  570

Query  1456  ICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRFLsvsaiva  1277
             +C   +   C    PKPIV+NP    + T              + N  H R L   + + 
Sbjct  571   LCGSAVNKSCPGVLPKPIVLNPNSSSDSTTGEI----------SSNLGHRRILLSISSLI  620

Query  1276  isaaaiiavgvmvI-TMVNASVRRRISFVENALESMCSSTSSRS--QGMATGKLILFDTK  1106
               AAA + V  ++  T++N  VR   +    AL        SRS      +GKL++F  +
Sbjct  621   AIAAAAVIVIGVIAITVLNLRVRSPTTQSAPALAFSGGDDFSRSPTTDGNSGKLVMFSGE  680

Query  1105  SSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDFDR  926
               PD+++    ++LNK  E+G G FG VY+  L  +  R VAIKKLT S +++  E+F+R
Sbjct  681   --PDFSTGA-HALLNKDCELGRGGFGAVYRTLL--QDGRPVAIKKLTVSSLVKSQEEFER  735

Query  925   EVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAVRF  746
             EV  LGK RH NLV + GYYWTP LQL++ D+V  G+L   LH+ A       L+W  RF
Sbjct  736   EVNKLGKVRHDNLVEIEGYYWTPSLQLIIYDYVAGGSLYKHLHDGAGGNF---LSWNDRF  792

Query  745   KIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVMSN  566
              IILGTAKGLAHLH   Q  IIHYNIK SN+L+  +  PK+ DFGLARL+  LDR+V+S+
Sbjct  793   NIILGTAKGLAHLH---QMNIIHYNIKSSNVLIGCSGEPKVGDFGLARLLPMLDRYVLSS  849

Query  565   RFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRVL  386
             + Q+A+GY+APE AC+++++ EKCDVYGFG+L+LEIVTG+RPVEY ED+V++L D VR  
Sbjct  850   KIQSALGYMAPEFACKTVKITEKCDVYGFGVLVLEIVTGKRPVEYMEDDVVVLCDMVRGA  909

Query  385   LEQGNVLECVDQGMGG-YPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPVPN  209
             LE+G V ECVD  + G +P EE +PV+KL L+CTSQ+PS+RP M EVV IL +I+ P   
Sbjct  910   LEEGRVEECVDARLQGIFPAEEAIPVMKLGLICTSQVPSNRPDMGEVVNILDLIRCPSEG  969

Query  208   RME  200
             + E
Sbjct  970   QEE  972


 Score = 63.9 bits (154),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 45/116 (39%), Positives = 71/116 (61%), Gaps = 6/116 (5%)
 Frame = -1

Query  1810  GEIPEDIC-ESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSMLK  1634
             G +PE++  + GSL ++ L  N  +G IP  +G+C+SL  ++ S N  SG++P  +  L 
Sbjct  137   GGVPEELFRQCGSLRVISLAKNKFSGKIPESLGSCASLAAVNFSLNQFSGSVPAGVWSLS  196

Query  1633  RLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAG----SIFQNLDSS  1478
              L+ L L  N L GEIP+ + +L NL  VN++ NR TG+LP G    S+ +++D S
Sbjct  197   GLRSLDLSDNLLKGEIPKGI-ELNNLRGVNLARNRFTGQLPDGIGSCSLLRSIDLS  251


 Score = 61.6 bits (148),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 41/103 (40%), Positives = 63/103 (61%), Gaps = 1/103 (1%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L GEIP+ I E  +L  + L  N  TG +P  IG+CS L  + LS N+ SG +P+T+  L
Sbjct  208   LKGEIPKGI-ELNNLRGVNLARNRFTGQLPDGIGSCSLLRSIDLSENSFSGNLPQTMQKL  266

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPA  1508
                  L L  N  SGE+P+ +G++++L  +++S NR TG +P+
Sbjct  267   GLCSYLNLHQNTFSGEVPEWIGEMKSLETLDLSSNRFTGEVPS  309


 Score = 55.5 bits (132),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 54/100 (54%), Gaps = 0/100 (0%)
 Frame = -1

Query  1810  GEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSMLKR  1631
             G +P+ + + G    L L  N+ +G +P  IG   SL  L LS N  +G +P ++  L+ 
Sbjct  257   GNLPQTMQKLGLCSYLNLHQNTFSGEVPEWIGEMKSLETLDLSSNRFTGEVPSSIGNLEA  316

Query  1630  LKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP  1511
             LK+L    N  +G +P+ +    NLLA++ S N + G LP
Sbjct  317   LKVLNFSANGFTGSLPKSMAYCTNLLALDFSKNSMAGELP  356


 Score = 55.1 bits (131),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 62/106 (58%), Gaps = 1/106 (1%)
 Frame = -1

Query  1819  ALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETL-S  1643
             +L G I   + +  +L  L L  N+LTG++ P   +  +L +L LS N+ SG +PE L  
Sbjct  86    SLSGHIGRGLLQLQALRKLSLSKNNLTGSLTPNFTHIDNLRVLDLSENSFSGGVPEELFR  145

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAG  1505
                 L+++ L  N+ SG+IP+ LG   +L AVN S N+ +G +PAG
Sbjct  146   QCGSLRVISLAKNKFSGKIPESLGSCASLAAVNFSLNQFSGSVPAG  191



>ref|XP_006650049.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Oryza brachyantha]
Length=971

 Score =   417 bits (1071),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 255/536 (48%), Positives = 363/536 (68%), Gaps = 22/536 (4%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G IP  I    SL  L+L  NSLTG IP QIGNC++L  L LS+NNL+G IP T++ L
Sbjct  446   LNGSIPATI-GGVSLRELRLGKNSLTGEIPAQIGNCTALASLDLSYNNLTGAIPATIANL  504

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
               L+ + +  N+LSG +P+QL  L +L+  N+S+N+L+G LP GS F  +  S++  N G
Sbjct  505   TNLQTVDISRNKLSGGLPKQLSDLPHLVHFNISHNQLSGDLPPGSFFDTIPLSSVSDNPG  564

Query  1456  ICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHR-FLsvsaiv  1280
             +C   L   C    PKPIV+NP        +++    ++P  +    RH +  LS+SA+V
Sbjct  565   LCGAKLNSSCPGVLPKPIVLNP--------DSSLDPLSQPEPTPNGLRHKKTILSISALV  616

Query  1279  aisaaaiiavgvmvITMVNASVRRRISFVENALE-SMCSSTSSRSQGMATGKLILFDTKS  1103
             AI A  +I VGV+ IT++N  VR   S     LE S    + S +  +  GKL++F    
Sbjct  617   AIGAGVLITVGVITITVLNLRVRAPGSHSAAELELSDGYLSESPTTDVNAGKLVMFG-GG  675

Query  1102  SPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDFDRE  923
             +P++++ST  ++LNK  E+G G FGTVYK  L     + VAIKKLT S +++  ++F+RE
Sbjct  676   NPEFSAST-HALLNKDCELGRGGFGTVYKTTL--RDGQPVAIKKLTVSSLVKSQDEFERE  732

Query  922   VRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAVRFK  743
             V++LGK RH+NLV L+GYYWTP LQLL+ +FV  GNL  +LHE + A     L+W  RF 
Sbjct  733   VKMLGKLRHRNLVALKGYYWTPSLQLLIYEFVSGGNLHKQLHESSTANC---LSWKERFD  789

Query  742   IILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVMSNR  563
             I+LG A+ LAHLH   +  IIHYN+K SNILLD + + K+ D+GLA+L+  LDR+V+S++
Sbjct  790   IVLGIARSLAHLH---RHDIIHYNLKSSNILLDGSGDAKVGDYGLAKLLPMLDRYVLSSK  846

Query  562   FQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRVLL  383
              Q+A+GY+APE AC+++++ EKCDVYGFG+L+LEI+TGR PVEY ED+V++L D VR  L
Sbjct  847   VQSALGYMAPEFACRTVKITEKCDVYGFGVLVLEILTGRTPVEYMEDDVIVLCDVVRAAL  906

Query  382   EQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTP  218
             ++G V ECVD+ + G +P EE +P++KL LVCTSQ+PS+RP M+EVV IL++I+ P
Sbjct  907   DEGKVEECVDERLCGKFPLEEAVPIMKLGLVCTSQVPSNRPDMSEVVNILELIRCP  962


 Score = 58.5 bits (140),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 41/103 (40%), Positives = 60/103 (58%), Gaps = 0/103 (0%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G +PE +    +   L L  N+LTG +   +G  +SL +L LS N  SG IP ++  L
Sbjct  255   LSGNLPESLRRLSTCTYLDLSSNALTGNVATWVGEMASLEVLDLSGNKFSGEIPGSIGGL  314

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPA  1508
               LK L+L  N  +G +P+ +G  + L+ V+VS+N LTG LPA
Sbjct  315   MSLKELRLSGNGFTGGLPESIGGCKGLVHVDVSWNSLTGALPA  357


 Score = 56.2 bits (134),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 62/108 (57%), Gaps = 1/108 (1%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             +A+ G++P  +    +L  L L  N LTG +P  IG+C  L  + L  NNLSG +PE+L 
Sbjct  205   NAITGDLPVGVSRMFNLRSLNLRSNRLTGGLPDDIGDCPLLRSVDLGSNNLSGNLPESLR  264

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSI  1499
              L     L L  N L+G +   +G++ +L  +++S N+ +G +P GSI
Sbjct  265   RLSTCTYLDLSSNALTGNVATWVGEMASLEVLDLSGNKFSGEIP-GSI  311



>ref|XP_002319878.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|EEE95801.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=965

 Score =   416 bits (1070),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 261/543 (48%), Positives = 347/543 (64%), Gaps = 25/543 (5%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G IP +I  + +L  L+L+ NSL+G IP  IG CSSLT L LS NNLSGTIP  ++ L
Sbjct  442   LNGSIPMEIGGAFALKELRLERNSLSGQIPSSIGTCSSLTTLILSQNNLSGTIPVAIAKL  501

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
               L+ + +  N LSG +P+QL  L NL + N+S+N L G LPA   F  +  S + GN  
Sbjct  502   GNLQDVDVSFNSLSGTLPKQLANLPNLSSFNISHNNLQGELPASGFFNTISPSCVAGNPS  561

Query  1456  ICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRF-Lsvsaiv  1280
             +C   +   C    PKPIV+NP    + T          P +  +N  H R  LS+SA++
Sbjct  562   LCGAAVNKSCPAVLPKPIVLNPNSSSDST----------PGSLPQNLGHKRIILSISALI  611

Query  1279  aisaaaiiavgvmvITMVNASVRRRISFVENALESMCSS--TSSRSQGMATGKLILFDTK  1106
             AI AAA+I VGV+ IT++N  VR   S    AL        + S +    +GKL++F   
Sbjct  612   AIGAAAVIVVGVIAITVLNLRVRSSTSRSAAALTLSAGDGFSDSSTTDANSGKLVMFSGD  671

Query  1105  SSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDFDR  926
             +     S+   ++LNK  E+G G FG VY+  L     R VAIKKLT S +++  EDF+R
Sbjct  672   TD---FSTEAHALLNKDCELGRGGFGAVYQTVL--RDGRPVAIKKLTVSSLVKSQEDFER  726

Query  925   EVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAVRF  746
             EV+ LGK RHQNLV L GYYWTP LQLL+ +FV  G+L   LH+         L+W  RF
Sbjct  727   EVKKLGKIRHQNLVALEGYYWTPSLQLLIYEFVSGGSLYKHLHDRPGGHF---LSWNERF  783

Query  745   KIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVMSN  566
              IILGTAK LAHLH   Q  +IHYNIK  NIL+D +  PK+ DFGLARL+  LDR+V+S+
Sbjct  784   NIILGTAKSLAHLH---QSNVIHYNIKSRNILIDISGEPKVGDFGLARLLPMLDRYVLSS  840

Query  565   RFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRVL  386
             + Q+A+GY+APE AC++ ++ EKCDVYGFG+LILEIVTG+RPVEY ED+V++L D VR  
Sbjct  841   KIQSALGYMAPEFACRTAKITEKCDVYGFGVLILEIVTGKRPVEYMEDDVVVLCDMVRGA  900

Query  385   LEQGNVLECVD-QGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPVPN  209
             LE+G V ECVD + +G +P +E +PV+KL L+CTSQ+PS+RP M EVV IL +I+ P   
Sbjct  901   LEEGRVEECVDGRLLGNFPADEAVPVMKLGLICTSQVPSNRPDMGEVVNILDLIRCPSEG  960

Query  208   RME  200
             + E
Sbjct  961   QEE  963


 Score = 56.6 bits (135),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 42/125 (34%), Positives = 65/125 (52%), Gaps = 8/125 (6%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L  EIP  I    +L  + L  N   G +P  IG+C  L  +  S N LSGT+P+T+  L
Sbjct  207   LDSEIPRGIEVLNNLRNINLSKNRFNGGVPNGIGSCLLLRSVDFSENMLSGTVPDTMQNL  266

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAG-------SIFQNLDSS  1478
                  L L  N  +GE+P  +G+L  L  +++S NR +G++P          +F NL ++
Sbjct  267   GLCNYLSLSNNMFTGEVPNWIGELNRLETLDLSGNRFSGQVPTSIGNLQSLKVF-NLSAN  325

Query  1477  AIEGN  1463
             ++ GN
Sbjct  326   SLSGN  330


 Score = 56.6 bits (135),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 54/102 (53%), Gaps = 0/102 (0%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G +P+ +   G    L L  N  TG +P  IG  + L  L LS N  SG +P ++  L
Sbjct  255   LSGTVPDTMQNLGLCNYLSLSNNMFTGEVPNWIGELNRLETLDLSGNRFSGQVPTSIGNL  314

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP  1511
             + LK+  L  N LSG +P+ +    NLL ++ S N L+G LP
Sbjct  315   QSLKVFNLSANSLSGNLPESMTNCGNLLVLDCSQNLLSGDLP  356



>ref|XP_007220278.1| hypothetical protein PRUPE_ppa000889mg [Prunus persica]
 gb|EMJ21477.1| hypothetical protein PRUPE_ppa000889mg [Prunus persica]
Length=969

 Score =   416 bits (1068),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 244/543 (45%), Positives = 342/543 (63%), Gaps = 24/543 (4%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G IP +I  + SL  L+L+ N LTG IP  IGNCSSLT L  S N L+G +P  ++ L
Sbjct  446   LSGSIPLEIGGAFSLKELRLENNLLTGKIPTSIGNCSSLTTLIASQNRLNGPVPAAMAKL  505

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
               L+ + L  N L+G +P+QL  L NLL+ N+S+N L G LPAG+ F  +  S++ GN  
Sbjct  506   TNLQNVDLSFNNLTGGLPKQLANLPNLLSFNISHNNLQGELPAGAFFNTISPSSVSGNPS  565

Query  1456  ICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRFLsvsaiva  1277
             +C   +   C    PKPIV+NP    + T          P   + N  H R +   + + 
Sbjct  566   LCGSAVNKSCPTVLPKPIVLNPNSSSDSTT---------PGTLSSNLGHRRIILSISALI  616

Query  1276  isaaaiiavgvmvI-TMVNASVRRRISFVENALESMCSSTSSRSQGMA--TGKLILFDTK  1106
               AAA + V  ++  T++N  VR   +    AL        S S      +GKL++F  +
Sbjct  617   AIAAAAVIVIGVIAITVLNLRVRSSTTHSPAALALSAGDDFSHSPTTDGNSGKLVMFSGE  676

Query  1105  SSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDFDR  926
               PD+++    ++LNK  E+G G FG VY+  L     R VAIKKLT S +++  E+F+R
Sbjct  677   --PDFSTGA-HALLNKDCELGRGGFGAVYRTVL--RDGRPVAIKKLTVSSLVKSQEEFER  731

Query  925   EVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAVRF  746
             EV+ LGK +H NLV + GYYWTP LQL++ ++V  G+L   LH+ A       L+W  RF
Sbjct  732   EVKKLGKVKHDNLVEIEGYYWTPSLQLIIYEYVSGGSLYKHLHDGAGGNF---LSWNDRF  788

Query  745   KIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVMSN  566
              +ILGTAK LAHLH   Q  IIHYNIK SN+L+  +  PK+ DFGLARL+  LDR+V+S+
Sbjct  789   NVILGTAKSLAHLH---QMNIIHYNIKSSNVLIGSSGEPKVGDFGLARLLPMLDRYVLSS  845

Query  565   RFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRVL  386
             + Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE+VTG+RPVEY ED+V++L D VR  
Sbjct  846   KIQSALGYMAPEFACKTVKITEKCDVYGFGVLVLEVVTGKRPVEYMEDDVVVLCDMVRGA  905

Query  385   LEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPVPN  209
             LE+G V EC+D  + G +P EE +PV+KL L+CTSQ+PS+RP MAEVV IL++I+ P   
Sbjct  906   LEEGRVEECIDGRLQGNFPAEEAIPVMKLGLICTSQVPSNRPDMAEVVNILELIRCPSEG  965

Query  208   RME  200
             + E
Sbjct  966   QEE  968


 Score = 65.5 bits (158),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 43/103 (42%), Positives = 62/103 (60%), Gaps = 1/103 (1%)
 Frame = -1

Query  1810  GEIPEDIC-ESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSMLK  1634
             G +PED   + GSL  + L  N ++G IP  +G+C+SL  + LS N  SG++P  +  L 
Sbjct  131   GPVPEDFFRQCGSLRTISLAKNKISGKIPESLGSCASLAAIDLSLNQFSGSVPVGIWSLN  190

Query  1633  RLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAG  1505
              ++ L L  N L GEI + +G L NL AVN+  NR TG++P G
Sbjct  191   GIRSLDLSNNLLEGEISKAIGGLNNLRAVNLGKNRFTGQVPDG  233


 Score = 57.4 bits (137),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 37/103 (36%), Positives = 58/103 (56%), Gaps = 0/103 (0%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L GEI + I    +L  + L  N  TG +P  IG+C  L  + LS N+ SG +P+T+   
Sbjct  202   LEGEISKAIGGLNNLRAVNLGKNRFTGQVPDGIGSCLLLRSIDLSENSFSGNLPQTMQKF  261

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPA  1508
                  L L  N  +GEIP+ +G+L++L  +++S NR  G +P+
Sbjct  262   SLCSYLNLHQNSFAGEIPEWIGELKSLETLDLSGNRFLGEVPS  304



>ref|XP_010683484.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Beta vulgaris subsp. vulgaris]
Length=972

 Score =   414 bits (1065),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 255/541 (47%), Positives = 356/541 (66%), Gaps = 25/541 (5%)
 Frame = -1

Query  1810  GEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSMLKR  1631
             G IP +I  + +L  L+L+GN L+G IP QI NCS LT L LS NNL+G IP T++ L  
Sbjct  448   GSIPSEIGGALALRELRLEGNRLSGHIPAQIENCSFLTALILSENNLTGPIPPTIAKLVN  507

Query  1630  LKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDGIC  1451
             L+I  L  N LSG +P++L  L +L+A N+S N L G LPAG  F N+  +++  N  +C
Sbjct  508   LEIADLSHNNLSGNLPKELTGLSHLVAFNISNNNLEGELPAGGFFDNIPLTSVFNNPSLC  567

Query  1450  SPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRF-Lsvsaivai  1274
               ++   C    PKPIV+NP          N   ++E  +   N+RH +  LSVSA++AI
Sbjct  568   GSVVNQSCPAVHPKPIVLNP----------NPSTDSEDDSFPPNTRHKKLVLSVSALIAI  617

Query  1273  saaaiiavgvmvITMVNASVRRRISFVENALESMCSSTSSRSQGMAT--GKLILFDTKSS  1100
              AAA I +GV++I+++N  VR         LE       S SQ   +  GKL++F  ++ 
Sbjct  618   GAAAFIFLGVVIISLLNLHVRNSSHRSAAPLEFFGKDEFSHSQTSDSQYGKLVMFSGEA-  676

Query  1099  PDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDFDREV  920
              D+ +    ++LNK SE+G G FG VY   LG    R VAIKKL  S +++  E+F+RE+
Sbjct  677   -DFGTGA-HALLNKDSELGRGGFGVVYHTVLGD--GRSVAIKKLNISSLIKSQEEFEREM  732

Query  919   RVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAVRFKI  740
             + LGK RH NLV L GYYWTP LQLL++++VP G+L   LHE     +  PL+W  RF I
Sbjct  733   KKLGKVRHHNLVTLEGYYWTPSLQLLINEYVPGGSLFKHLHEEP---SRTPLSWHQRFNI  789

Query  739   ILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVMSNRF  560
             I+G AKGLAHLH   Q  IIHYN+K SNIL+D +   K+ DFGLARL+  LDR+++S++ 
Sbjct  790   IVGVAKGLAHLH---QIDIIHYNLKSSNILIDSSDEAKVGDFGLARLLPMLDRYILSSKI  846

Query  559   QAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRVLLE  380
             Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE+VTGR+PVEY ED+V++L + VR  LE
Sbjct  847   QSALGYMAPEFACKTVKITEKCDVYGFGILVLEVVTGRKPVEYMEDDVVVLAEMVRGALE  906

Query  379   QGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPVPNRM  203
             +G   +C+DQ + G +  EEV+PV+KL L+C SQ+PS+RP MAEVV IL++I+ P   R 
Sbjct  907   EGKSEDCIDQRLHGNFIAEEVIPVIKLGLICASQVPSNRPEMAEVVNILELIQCPSEGRD  966

Query  202   E  200
             E
Sbjct  967   E  967


 Score = 63.5 bits (153),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 37/100 (37%), Positives = 57/100 (57%), Gaps = 0/100 (0%)
 Frame = -1

Query  1810  GEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSMLKR  1631
             G+IP    E  SL ++ L  N+ +G +P  IG+C  L  ++   N+ SG IPE+L  L  
Sbjct  204   GQIPLGFGEMYSLKVISLGKNAFSGLLPEDIGSCLQLQSVNFGENSFSGVIPESLQKLNM  263

Query  1630  LKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP  1511
                + L  N LSGE+P   G +E+L  +++S N+  GR+P
Sbjct  264   CTSVSLNGNLLSGEVPDWFGHMESLENLDLSVNKFFGRIP  303


 Score = 60.8 bits (146),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 64/116 (55%), Gaps = 0/116 (0%)
 Frame = -1

Query  1810  GEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSMLKR  1631
             G IPE + +      + L+GN L+G +P   G+  SL  L LS N   G IP TL  ++ 
Sbjct  252   GVIPESLQKLNMCTSVSLNGNLLSGEVPDWFGHMESLENLDLSVNKFFGRIPFTLGNMRS  311

Query  1630  LKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGN  1463
             LK L L  N ++G +PQ L   +NLL+++VS+N L G++P       L   ++ GN
Sbjct  312   LKELNLSSNGITGGLPQSLMNCDNLLSLDVSFNLLKGKMPNWIFELGLQKFSLSGN  367



>ref|XP_008369373.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Malus domestica]
Length=973

 Score =   414 bits (1065),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 247/537 (46%), Positives = 342/537 (64%), Gaps = 25/537 (5%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G IP++I  + SL  L+L+ N LTG IP  I +CSSLT L++S N L+G +P  +S L
Sbjct  451   LNGSIPQEIGGAFSLKELRLEKNFLTGKIPTSIEHCSSLTTLTVSQNRLTGPLPAAMSKL  510

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
               L+I+ L  N L+G +P+QL  L NLL+ N+S+N L G LP G+ F  +  S++ GN  
Sbjct  511   TNLQIVDLSFNNLTGGLPKQLANLPNLLSFNISHNNLQGELPTGAFFNTISPSSVSGNPS  570

Query  1456  ICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRFLsvsaiva  1277
             +C   +   C    PKPIV+NP    + T              + N  H R L   + + 
Sbjct  571   LCGSAVNKSCPGVLPKPIVLNPNSSSDSTTGEI----------SSNLGHRRILLSISSLI  620

Query  1276  isaaaiiavgvmvI-TMVNASVRRRISFVENALESMCSSTSSRS--QGMATGKLILFDTK  1106
               AAA + V  ++  T++N  VR   +    AL        SRS      +GKL++F  +
Sbjct  621   AIAAAAVIVIGVIAITVLNLRVRSPTTQSAPALAFSGGDDFSRSPTTDGNSGKLVMFSGE  680

Query  1105  SSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDFDR  926
               PD+++    ++LNK  E+G G FG VY+  L  +  R VAIKKLT S +++  E+F+R
Sbjct  681   --PDFSTGA-HALLNKDCELGRGGFGAVYRTHL--QDGRPVAIKKLTVSSLVKSQEEFER  735

Query  925   EVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAVRF  746
             EV  LGK RH NLV + GYYWTP LQL++ D+V  G+L   LH+ A       L+W  RF
Sbjct  736   EVNKLGKVRHDNLVEIEGYYWTPSLQLIIHDYVAGGSLYKHLHDGAGGNF---LSWNDRF  792

Query  745   KIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVMSN  566
              IILGTAKGLAHLH   Q  IIHYNIK SN+L+  +  PK+ DFGLARL+  LDR+V+S+
Sbjct  793   NIILGTAKGLAHLH---QMNIIHYNIKSSNVLIGCSGEPKVGDFGLARLLPMLDRYVLSS  849

Query  565   RFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRVL  386
             + Q+A+GY+APE AC+++++ EKCDVYGFG+L+LEIVTG+RPVEY ED+V++L D VR  
Sbjct  850   KIQSALGYMAPEFACKTVKITEKCDVYGFGVLVLEIVTGKRPVEYMEDDVVVLCDMVRGA  909

Query  385   LEQGNVLECVDQGMGG-YPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTP  218
             LE+G V ECVD  + G +P EE +P++KL L+CTSQ+PS+RP M EVV IL++I+ P
Sbjct  910   LEEGRVEECVDARLQGIFPAEEAIPMMKLGLICTSQVPSNRPDMGEVVNILELIRCP  966


 Score = 63.2 bits (152),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 45/120 (38%), Positives = 73/120 (61%), Gaps = 6/120 (5%)
 Frame = -1

Query  1822  SALIGEIPEDIC-ESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETL  1646
             ++  G +PE++  + GSL ++ L  N  +G IP  +G+C+SL  ++ S N  SG+IP  +
Sbjct  133   NSFSGGVPEELFRQCGSLRVISLAKNKFSGKIPESLGSCASLAAVNFSLNQFSGSIPAGV  192

Query  1645  SMLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAG----SIFQNLDSS  1478
               L  L+ L L  N L GEIP+ + +L NL  VN++ NR TG++P G    S+ +++D S
Sbjct  193   WSLSGLRSLDLSDNLLKGEIPKGI-ELNNLRGVNLARNRFTGQVPDGIGSCSLLRSIDLS  251


 Score = 62.0 bits (149),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 41/103 (40%), Positives = 63/103 (61%), Gaps = 1/103 (1%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L GEIP+ I E  +L  + L  N  TG +P  IG+CS L  + LS N+ SG +P+T+  L
Sbjct  208   LKGEIPKGI-ELNNLRGVNLARNRFTGQVPDGIGSCSLLRSIDLSENSFSGNLPQTMQKL  266

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPA  1508
                  L L  N  SGE+P+ +G++++L  +++S NR TG +P+
Sbjct  267   GLCSYLNLHQNTFSGEVPEWIGEMKSLETLDLSSNRFTGEVPS  309


 Score = 57.4 bits (137),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 35/104 (34%), Positives = 57/104 (55%), Gaps = 0/104 (0%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             ++  G +P+ + + G    L L  N+ +G +P  IG   SL  L LS N  +G +P ++ 
Sbjct  253   NSFSGNLPQTMQKLGLCSYLNLHQNTFSGEVPEWIGEMKSLETLDLSSNRFTGEVPSSIG  312

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP  1511
              L+ LK+LK   N  +G +P+ +    NLLA++ S N + G LP
Sbjct  313   NLEALKVLKFSANGFTGSLPKSMAYCTNLLALDFSKNSMAGELP  356


 Score = 55.5 bits (132),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 62/106 (58%), Gaps = 1/106 (1%)
 Frame = -1

Query  1819  ALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETL-S  1643
             +L G I   + +  +L  L L  N+LTG++ P   +  +L +L LS N+ SG +PE L  
Sbjct  86    SLSGHIGRGLLQLQALRKLSLSKNNLTGSLTPNFTHIDNLRVLDLSENSFSGGVPEELFR  145

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAG  1505
                 L+++ L  N+ SG+IP+ LG   +L AVN S N+ +G +PAG
Sbjct  146   QCGSLRVISLAKNKFSGKIPESLGSCASLAAVNFSLNQFSGSIPAG  191



>dbj|BAK06250.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=973

 Score =   414 bits (1063),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 255/543 (47%), Positives = 357/543 (66%), Gaps = 33/543 (6%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G IP  I    S  +L L  NSLTG IP QIG+CS+L  L LSHN L+G IP  ++ L
Sbjct  445   LNGSIPSTI-GGKSFKLLSLAKNSLTGEIPSQIGDCSALASLDLSHNGLTGAIPAAIANL  503

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
               L+   L  N+L+G +P+QL  L +L+  N+S+N+L+G LP GS F  +  S++  N G
Sbjct  504   TNLESADLSRNKLTGGLPKQLSNLAHLIRFNISHNQLSGDLPPGSFFDTISLSSVSDNPG  563

Query  1456  ICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTR---NSRHHR--FLsv  1292
             +C   L   C    PKPIV+NP    N            PLA         HH+   LS+
Sbjct  564   LCGAKLNSSCPGVLPKPIVLNPDSSSN------------PLAQKEPVPGGLHHKKTILSI  611

Query  1291  saivaisaaaiiavgvmvITMVNASVRRRISFVENALESMCSSTSSRSQG----MATGKL  1124
             SA+VAI AA +IAVG++ IT++N  VR   S    A  ++  S    SQ     + TGKL
Sbjct  612   SALVAIGAAVLIAVGIITITVLNLQVRAPGSHSGGAAAALELSDGYLSQSPTTDVNTGKL  671

Query  1123  ILFDTKSSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQY  944
             ++F    +P++++ST  ++LNK  E+G G FGTVYK  L     + VAIKKLT S +++ 
Sbjct  672   VMFG-GGNPEFSAST-HALLNKDCELGRGGFGTVYKTTL--RDGQPVAIKKLTVSSLVKS  727

Query  943   PEDFDREVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPL  764
              ++F+REV++LGK RH+NLV L+GYYWTP LQLL+ +FV  GNL  +LHE + A     L
Sbjct  728   QDEFEREVKMLGKLRHRNLVALKGYYWTPSLQLLIYEFVSGGNLHKQLHESSNANY---L  784

Query  763   TWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLD  584
             +W  RF I+LG A+ LAHLH      IIHYN+K SNI+LD++   K+ D+GLA+L+  LD
Sbjct  785   SWKERFDIVLGMARSLAHLHWH---DIIHYNLKSSNIMLDDSGEAKVGDYGLAKLLPMLD  841

Query  583   RHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILN  404
             R+V+S++ Q+A+GY+APE  C+++++ EKCDVYGFG+L+LE++TGR PVEY ED+V++L 
Sbjct  842   RYVLSSKVQSALGYMAPEFTCRTVKITEKCDVYGFGVLVLEVMTGRTPVEYMEDDVIVLC  901

Query  403   DHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVI  227
             D VR  L++G V ECVD+ + G +P EE +P++KL LVCTSQ+PS+RP M+EVV IL++I
Sbjct  902   DVVRAALDEGKVEECVDEKLCGKFPLEEAVPIMKLGLVCTSQVPSNRPDMSEVVNILELI  961

Query  226   KTP  218
             + P
Sbjct  962   RCP  964


 Score = 61.6 bits (148),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 41/108 (38%), Positives = 67/108 (62%), Gaps = 1/108 (1%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             +A+ GE+P  I +  +L  L L  N LTG++P  IG+C  L  + LS N+LSG +PE+L 
Sbjct  204   NAITGELPVGISKMFNLRALNLRRNRLTGSLPDDIGDCPLLRSVDLSSNSLSGNLPESLR  263

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSI  1499
              L     L L  N+L+G +P  +G++ ++  +++S N+ +G +P GSI
Sbjct  264   RLSTCTDLDLSSNELTGNVPTWVGEMVSMETLDLSGNKFSGEIP-GSI  310


 Score = 58.5 bits (140),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/104 (38%), Positives = 59/104 (57%), Gaps = 0/104 (0%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             ++L G +PE +    +   L L  N LTG +P  +G   S+  L LS N  SG IP ++ 
Sbjct  252   NSLSGNLPESLRRLSTCTDLDLSSNELTGNVPTWVGEMVSMETLDLSGNKFSGEIPGSIG  311

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP  1511
              L  L+ L+L  N  +G +P+ +G   +L+ V+VS+N LTG LP
Sbjct  312   GLMSLRELRLSGNGFTGGLPESIGGCTSLVHVDVSWNSLTGSLP  355



>ref|XP_006842493.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Amborella trichopoda]
 gb|ERN04168.1| hypothetical protein AMTR_s00077p00091370 [Amborella trichopoda]
Length=981

 Score =   413 bits (1061),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 261/546 (48%), Positives = 354/546 (65%), Gaps = 32/546 (6%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G IP  I  + +L  L+LD N L+G IP +IG   SL  LSLS NNLSG +P +L+ L
Sbjct  448   LNGSIPLKIGAAIALTDLRLDRNFLSGGIPLEIGKLRSLGTLSLSKNNLSGPLPASLANL  507

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
               L  L L  N L+G +P QLG L +LL +N+S+N L G LP G  F  LD +++ GN  
Sbjct  508   TSLHTLDLSFNNLTGTLPHQLGNLPHLLFLNLSHNNLAGELPMGPAFNTLDPTSLSGNPS  567

Query  1456  ICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHR--FLsvsai  1283
             +C  LL   C    PKPIV+NP    N             L +T+++  H+   LS+S +
Sbjct  568   LCGALLNRSCPAVLPKPIVLNPDSTPNSPQ--------NSLPTTKSTSRHKKIILSISTL  619

Query  1282  vaisaaaiiavgvmvITMVNASVRRRISFVENAL----------ESMCSSTSSRSQGMAT  1133
             VAISAAA+IA+GV+ +T++N + R      + AL            + S  +S   G   
Sbjct  620   VAISAAALIALGVVTVTLLNMNARAH-HRADGALVLEPSRSGSGSGVGSPLTSTGSGQP-  677

Query  1132  GKLILFDTKSSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKI  953
             GKL++F   S  D++     ++L+K  E+G G FG VY+APL     R VA+KKL  S +
Sbjct  678   GKLVMF--SSDKDFSVGA-HALLDKHCELGRGGFGAVYRAPL--PDGRPVAVKKLAVSGL  732

Query  952   LQYPEDFDREVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMAT  773
             ++   +F++ VR LG+ RH NLV L GYYWTPQLQLLV ++V  G+L S+LHE       
Sbjct  733   VKSQSEFEKTVRSLGRLRHPNLVHLHGYYWTPQLQLLVYEYVGGGSLYSRLHEPGGKA--  790

Query  772   PPLTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVA  593
               LTW  RF++ILG A+GLA LH SC+P ++HYN+K SN+L+DEN   K+ DFGLARL+ 
Sbjct  791   --LTWLERFRVILGVARGLAFLHESCRPAVVHYNVKSSNVLIDENGEAKVGDFGLARLLP  848

Query  592   KLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVL  413
              LDR+V+S++ Q+A+GY+APE AC S RV+EKCDVYGFG+L LEI+TGRRPVEY ED+V+
Sbjct  849   MLDRYVLSSKIQSALGYMAPEFACGSARVSEKCDVYGFGVLTLEIITGRRPVEYTEDDVV  908

Query  412   ILNDHVRVLLEQGNVLECVDQGMG-GYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQIL  236
             IL+D VR  LE G V  CVD  MG  +P+E ++P++KLAL+C SQ+PS+RP+M EVV IL
Sbjct  909   ILSDSVRGALEGGRVGSCVDPRMGPAWPEEVLVPLVKLALICASQVPSNRPAMGEVVHIL  968

Query  235   QVIKTP  218
             +VI +P
Sbjct  969   EVIGSP  974


 Score = 58.5 bits (140),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 65/126 (52%), Gaps = 24/126 (19%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETL---  1646
             L G IP  I  S +L  + L  N ++G +P  IG C  L  +  S N+L+GT+P +L   
Sbjct  206   LTGNIPVGIGSSFNLRTVNLRKNQISGNLPEDIGKCLLLNSMDFSENSLTGTVPVSLQRL  265

Query  1645  ---------------------SMLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNR  1529
                                  SMLK L++L L  N  SGE+P  +G+L+ L ++++S N+
Sbjct  266   SLLTSLKLGKNSITGLIPSWISMLKNLEVLDLSGNMFSGEVPTSIGELKMLKSLSLSGNK  325

Query  1528  LTGRLP  1511
              TG++P
Sbjct  326   FTGQIP  331


 Score = 58.2 bits (139),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 42/119 (35%), Positives = 65/119 (55%), Gaps = 1/119 (1%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G +PEDI    +L  L L GN LTG IP  IG+  +L  ++L  N +SG +PE +   
Sbjct  182   LSGSLPEDIWSLNTLRDLDLSGNELTGNIPVGIGSSFNLRTVNLRKNQISGNLPEDIGKC  241

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAG-SIFQNLDSSAIEGN  1463
               L  +    N L+G +P  L +L  L ++ +  N +TG +P+  S+ +NL+   + GN
Sbjct  242   LLLNSMDFSENSLTGTVPVSLQRLSLLTSLKLGKNSITGLIPSWISMLKNLEVLDLSGN  300


 Score = 55.5 bits (132),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 44/123 (36%), Positives = 62/123 (50%), Gaps = 7/123 (6%)
 Frame = -1

Query  1810  GEIPEDICESGSLGILQLDGNSLTGTIPPQI-GNCssltllslshnnlSGTIPETLSMLK  1634
             G I  D+    SL  +   GN+LTG IP Q    C SL  +S + NN  G +P +L+   
Sbjct  111   GTISPDLATIQSLRAVDFSGNNLTGEIPDQFFKQCGSLRYVSFARNNFYGPVPRSLTSCS  170

Query  1633  RLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPA--GSIFQ----NLDSSAI  1472
              + +L    N LSG +P+ +  L  L  +++S N LTG +P   GS F     NL  + I
Sbjct  171   SISVLNFSSNHLSGSLPEDIWSLNTLRDLDLSGNELTGNIPVGIGSSFNLRTVNLRKNQI  230

Query  1471  EGN  1463
              GN
Sbjct  231   SGN  233


 Score = 55.1 bits (131),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 40/103 (39%), Positives = 63/103 (61%), Gaps = 1/103 (1%)
 Frame = -1

Query  1816  LIGEIPEDIC-ESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSM  1640
             L GEIP+    + GSL  +    N+  G +P  + +CSS+++L+ S N+LSG++PE +  
Sbjct  133   LTGEIPDQFFKQCGSLRYVSFARNNFYGPVPRSLTSCSSISVLNFSSNHLSGSLPEDIWS  192

Query  1639  LKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP  1511
             L  L+ L L  N+L+G IP  +G   NL  VN+  N+++G LP
Sbjct  193   LNTLRDLDLSGNELTGNIPVGIGSSFNLRTVNLRKNQISGNLP  235



>ref|XP_010938277.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Elaeis guineensis]
Length=737

 Score =   406 bits (1043),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 248/538 (46%), Positives = 352/538 (65%), Gaps = 24/538 (4%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G IP +I  + SL  L+L+ NSL+G +P QIGNCSSL+ L LS NNL+G IP TL+  
Sbjct  210   LNGSIPLEIGGAVSLKELRLEQNSLSGGVPTQIGNCSSLSTLDLSQNNLTGPIPSTLANP  269

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
               L+++ L  N+L+G IP+QL  L +LL+ N+S+N L+G +P+GS F  +  S++  N G
Sbjct  270   TELQVINLSHNRLTGTIPKQLSNLPHLLSFNISHNLLSGDIPSGSFFNTIPPSSLSDNPG  329

Query  1456  ICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRFLsvsaiva  1277
             +C  ++   C    PKPIV+         +N++   +++   S+ N  HH+ + +S    
Sbjct  330   LCGSVVNRSCPAVLPKPIVL-------NPNNSSPNPSSDSTFSSAN-LHHKKIILSISSL  381

Query  1276  isaaaiiavgvmvITMVNASVRRRISFVENA----LESMCSSTSSRSQGMATGKLILFDT  1109
             I+  A   + + VIT+   + R R S  ++A    L   C S S  +    +GKLI+F  
Sbjct  382   IAIGAAAIIALGVITITILNFRVRASASQSAPALVLSDDCLSQSPTTDA-NSGKLIMF-A  439

Query  1108  KSSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDFD  929
                P++++    ++LNK  E+G G FG VYK  L     R VAIKKLT S +++  EDF+
Sbjct  440   GGDPEFSAGA-HALLNKDCELGRGGFGAVYKTML--RDDRPVAIKKLTVSSLVKSQEDFE  496

Query  928   REVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAVR  749
             REV+ LGK +H NLV L GYYWTP LQLL+ +FV  G+L   LHE   + AT  L+W  R
Sbjct  497   REVKKLGKVQHPNLVALEGYYWTPSLQLLIFEFVLGGSLYQHLHE---SCATNILSWQER  553

Query  748   FKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVMS  569
             F IILGTAK L HLH   +  IIHYN+K SNILLD +  PKI D+GLA+L+  LD +V+S
Sbjct  554   FDIILGTAKSLEHLH---RLDIIHYNLKSSNILLDGSGEPKIGDYGLAKLLPVLDHYVLS  610

Query  568   NRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRV  389
             ++ Q+A+GY+APE AC+++++ EKCDVY FGM++LEI+ G+RPVEY ED+V++L D VR 
Sbjct  611   SKLQSALGYLAPEFACRTVKITEKCDVYAFGMVVLEIMAGKRPVEYLEDDVVVLRDIVRG  670

Query  388   LLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTP  218
              LE+G V ECVD  + G +P EE +PV+KL L+CTSQ+PS+RP M EVV +L++I+ P
Sbjct  671   ALEEGKVEECVDGRLCGKFPLEEAIPVIKLGLICTSQVPSNRPDMGEVVNMLELIRCP  728



>ref|XP_004240861.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Solanum lycopersicum]
Length=894

 Score =   410 bits (1055),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 254/538 (47%), Positives = 352/538 (65%), Gaps = 27/538 (5%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G +P +I  + SL  L LD NSLTG IP  +G CSSL  LSLSHN+L+G +PE L+ L
Sbjct  371   LYGIVPVEIGGATSLMELSLDKNSLTGEIPSSVGYCSSLVSLSLSHNSLTGPVPEALAKL  430

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
               L+ + L  N+L+G +P+QLG L +L   N+S+N+L G LP+   F  +   ++  N  
Sbjct  431   TYLQSVDLSFNKLTGVLPKQLGDLGHLSFFNISHNQLQGELPSSGFFNTISPYSVSANPS  490

Query  1456  ICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHR-FLsvsaiv  1280
             +C   +   C    PKPIV+NP    N TD+        P    ++ RH +  LS+SA++
Sbjct  491   LCGAAVNRSCSTVMPKPIVLNP----NSTDS-------SPNTVPQSIRHEKKILSISALI  539

Query  1279  aisaaaiiavgvmvITMVNASVRRRISFVENALESMCSS---TSSRSQGMATGKLILFDT  1109
             AI AAA+I VGV+ IT++N  VR        A  +       + S S    +GKL++F  
Sbjct  540   AIGAAAVIFVGVIAITVLNIRVRSAAPRSAAAALTFSGGDDFSHSPSTDANSGKLVMF--  597

Query  1108  KSSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDFD  929
                PD+++    ++LNK  E+G G FG VY+  LG      VAIKKLT S +++  EDF+
Sbjct  598   SGDPDFSTGA-HALLNKDCELGRGGFGAVYRTVLGD--GHPVAIKKLTVSSLVKSQEDFE  654

Query  928   REVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAVR  749
             REVR LGK  H NLV L GYYWTP LQLL+ +FV  GNL   LHE +       L+W  R
Sbjct  655   REVRKLGKVHHHNLVTLEGYYWTPSLQLLIYEFVAGGNLYKHLHEGSGGCF---LSWNDR  711

Query  748   FKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVMS  569
             F II+GTAK LAHLH   Q  +IHYN+K SN+L+D +  PK++D+GLARL+  LDR+V+S
Sbjct  712   FNIIIGTAKSLAHLH---QKNVIHYNLKSSNVLIDSSGEPKVADYGLARLLPMLDRYVLS  768

Query  568   NRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRV  389
             ++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE+VTG+RPVEY ED+V++L D VR 
Sbjct  769   SKIQSALGYMAPEFACKTVKITEKCDVYGFGVLVLEVVTGKRPVEYMEDDVVVLCDMVRG  828

Query  388   LLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTP  218
              LE+G V +C+D  M G +P +EV+PV+KL L+CTSQ+PS+RP M EVV IL++I+ P
Sbjct  829   ALEEGRVEDCIDARMQGKFPADEVIPVMKLGLICTSQVPSNRPDMGEVVNILELIRYP  886


 Score = 60.5 bits (145),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 43/104 (41%), Positives = 66/104 (63%), Gaps = 0/104 (0%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             +A +G +PE I E  SL IL L  N+ +G IP  IG   SL +L +S N +SG++PE+LS
Sbjct  273   NAFVGIVPEWIGEMKSLQILDLSENNFSGHIPTSIGELESLKVLKVSRNRISGSLPESLS  332

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP  1511
                +L  L +  N L+G IP+ +G+L++L  +++S N L G +P
Sbjct  333   SCVKLLELDVSHNSLAGTIPKTVGQLKSLNILDLSENLLYGIVP  376


 Score = 59.3 bits (142),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 48/126 (38%), Positives = 61/126 (48%), Gaps = 24/126 (19%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L GEIP DI    +L  L L  N   G IP +IG C  L  + LS N+LSG +P T+  L
Sbjct  203   LNGEIPVDIQGLSNLRALSLGRNKFMGEIPDEIGGCLLLRSIDLSENSLSGELPSTMQKL  262

Query  1636  ------------------------KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNR  1529
                                     K L+IL L  N  SG IP  +G+LE+L  + VS NR
Sbjct  263   SLCSEFILRRNAFVGIVPEWIGEMKSLQILDLSENNFSGHIPTSIGELESLKVLKVSRNR  322

Query  1528  LTGRLP  1511
             ++G LP
Sbjct  323   ISGSLP  328



>gb|EYU42026.1| hypothetical protein MIMGU_mgv1a000905mg [Erythranthe guttata]
Length=946

 Score =   412 bits (1058),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 243/547 (44%), Positives = 367/547 (67%), Gaps = 27/547 (5%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             ++L+G IP  I +  +  +L +  N L G+IP +IGNCSSLT L LS NNL+G I  +++
Sbjct  419   NSLVGSIPASIGQLNTTLVLDMSYNQLHGSIPVEIGNCSSLTSLVLSRNNLTGPISVSIA  478

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGN  1463
              L  L++L L  N  SG +P++L  L +L+  NVS+N L G LP G  F  +  S++ GN
Sbjct  479   TLSNLELLDLSFNNFSGSLPKELTNLSHLVTFNVSFNNLEGELPVGGFFNTITPSSVTGN  538

Query  1462  DGICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRF-Lsvsa  1286
               +C  ++   C    PKP+V+NP         N+   N+ PL+  +N RH R  LS+S+
Sbjct  539   PSLCGSIVNHSCPAVHPKPLVLNP---------NSSVSNHTPLS--QNLRHKRIVLSISS  587

Query  1285  ivaisaaaiiavgvmvITMVNASVRRRISFVENALESMCS----STSSRSQGMATGKLIL  1118
             +VAI+AA  IA+GV++++++N   R  ++   NAL    +    S S+ ++  + GKL++
Sbjct  588   LVAIAAAIFIALGVVIVSILNVKARTSMARSANALTFSGTGDDYSPSNETEANSYGKLVM  647

Query  1117  FDTKSSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPE  938
             F      D+ S    ++LNK  E+G G FG+VYK  L     R VAIKKL ++ +++  +
Sbjct  648   F--SGDVDFESGA-HALLNKNCELGRGGFGSVYKTDL--RCGRAVAIKKLNTTSLVKSRD  702

Query  937   DFDREVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTW  758
             DF+REV+ LGK +H+NLV L GYYWTP LQLL+++++  G+L   LHE+  + +   LTW
Sbjct  703   DFEREVKRLGKIKHENLVQLEGYYWTPSLQLLINEYISGGSLHKHLHEVEYSGSL--LTW  760

Query  757   AVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRH  578
               RFKII+ TAKGLAHLH   +  +IHYNIK SN++++ +   K+ DFGLA+L+  LDR+
Sbjct  761   RQRFKIIVCTAKGLAHLH---RLNLIHYNIKSSNVMIEVSGEAKVGDFGLAKLLPALDRY  817

Query  577   VMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDH  398
             ++S++ Q+A+GY+APE ACQ++++ EKCDVYGFG+LILE++TG+RPVEY ED+V++L D 
Sbjct  818   ILSSKVQSALGYMAPEFACQTVKITEKCDVYGFGVLILEVITGKRPVEYMEDDVVVLCDM  877

Query  397   VRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKT  221
             VR  L++G V EC+D+ + GGY  EE +PV+KL L+C SQ+PS+RP M EV++IL++I+ 
Sbjct  878   VREALDEGRVEECIDKKLNGGYSMEEAIPVIKLGLICASQVPSNRPDMEEVIRILELIQC  937

Query  220   PVPNRME  200
             P  ++ E
Sbjct  938   PSESQEE  944



>gb|KHG03607.1| hypothetical protein F383_26757 [Gossypium arboreum]
Length=987

 Score =   412 bits (1060),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 251/536 (47%), Positives = 347/536 (65%), Gaps = 23/536 (4%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G IP +I  + SL  L+L  N + G IP  I NC+ L  L +S NNLSG IP  +  L
Sbjct  465   LNGSIPMEIGGAYSLKDLRLKANFIEGKIPSSIENCTLLRTLIISQNNLSGPIPAEIGKL  524

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
               L+ + L  N L G +P+QL  L  LL+ N+S+N L G LPAG  F  +  +A+ GN  
Sbjct  525   SDLEYVDLSFNDLVGRLPKQLANLPRLLSFNISHNNLQGELPAGRFFNTISPTAVFGNPL  584

Query  1456  ICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRFLsvsaiva  1277
             +C   +   C    PKPIV+NP      T +++  D   P       R    LS+SA++A
Sbjct  585   LCGSTVNKSCPAVLPKPIVLNP-----NTTSDSISDELPP----NVGRKRIVLSISALIA  635

Query  1276  isaaaiiavgvmvITMVNASVRRRISFVENALESMCSSTSSRS--QGMATGKLILFDTKS  1103
             I AAA I VGV+ +T++N  V+   S     +        SRS      +GKL++F  + 
Sbjct  636   IGAAAFIVVGVIAVTVLNLRVKSSTSHSAVPIAFSAGDEFSRSPTTDANSGKLVMFSGE-  694

Query  1102  SPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDFDRE  923
              PD+++    ++LNK  E+G G FG VY+  L  +  R VAIKKL  S +++  E+F+RE
Sbjct  695   -PDFSTGA-HAMLNKDCELGRGGFGAVYRTVL--QDGRAVAIKKLAVSSLVKSQEEFERE  750

Query  922   VRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAVRFK  743
             V+ LGK RH NLV L GYYWTP LQLL+S+FV  G+L   LHE     +   L+W  RF+
Sbjct  751   VKKLGKIRHYNLVVLEGYYWTPSLQLLISEFVSGGSLHKHLHE---GSSGNYLSWHDRFR  807

Query  742   IILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVMSNR  563
             IILGTAKGLAHLH S    IIHYNIK SN+L+D +  PK++DFGLARL+  LDR+++S++
Sbjct  808   IILGTAKGLAHLHESG---IIHYNIKSSNVLIDGSGEPKVADFGLARLLPMLDRYILSSK  864

Query  562   FQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRVLL  383
              Q+A+GY+APE AC+++++ EKCDVYGFG+L++E+VTG+RPVEY ED+V++L D VR  L
Sbjct  865   IQSALGYMAPEFACRTVKITEKCDVYGFGVLVMEVVTGKRPVEYMEDDVVVLCDMVRGAL  924

Query  382   EQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTP  218
             E+G V ECVD+ + G +P EE +PV+KL L+CTSQ+PS+RP M+EVV IL++I+ P
Sbjct  925   EEGRVEECVDERLQGKFPVEEAIPVMKLGLICTSQVPSNRPDMSEVVNILELIRCP  980


 Score = 65.5 bits (158),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 65/105 (62%), Gaps = 1/105 (1%)
 Frame = -1

Query  1822  SALIGEIPEDIC-ESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETL  1646
             ++L G IP++   + GSL  + L  N  +G IP  +G+C++L  ++LS N  SG++P  +
Sbjct  146   NSLTGSIPDEFFKQCGSLRYISLANNQFSGKIPGSLGSCATLAAINLSMNRFSGSLPVGI  205

Query  1645  SMLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP  1511
               L  L+ L L  N L GEIP+ +  L NL ++N+S NR TG++P
Sbjct  206   WGLSGLRTLDLSCNMLEGEIPKGVQALNNLRSINLSNNRFTGQVP  250


 Score = 63.5 bits (153),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 60/102 (59%), Gaps = 0/102 (0%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L GEIP+ +    +L  + L  N  TG +P +IG+C  L  +  S N  SG++P+T+  L
Sbjct  221   LEGEIPKGVQALNNLRSINLSNNRFTGQVPDEIGSCLLLRSIDFSMNLFSGSVPKTMQEL  280

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP  1511
                  L L VN   GE+P+ + ++E+L  +++S N+ +G++P
Sbjct  281   SLCTYLNLSVNSFVGEVPEWISEMESLQTLDLSVNKFSGQVP  322


 Score = 57.4 bits (137),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 59/107 (55%), Gaps = 1/107 (1%)
 Frame = -1

Query  1810  GEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSMLKR  1631
             G +P+ + E      L L  NS  G +P  I    SL  L LS N  SG +P+++  LK 
Sbjct  271   GSVPKTMQELSLCTYLNLSVNSFVGEVPEWISEMESLQTLDLSVNKFSGQVPDSIGKLKF  330

Query  1630  LKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQN  1490
             LK+L    N L+G +P  +    NLLA+++S N LTG LP G IF++
Sbjct  331   LKVLNFSSNSLNGSLPASMENNMNLLALDISQNLLTGDLP-GWIFKS  376


 Score = 54.7 bits (130),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 42/106 (40%), Positives = 58/106 (55%), Gaps = 1/106 (1%)
 Frame = -1

Query  1819  ALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIP-ETLS  1643
             +L G I   + +   L  L L  N+L+GTI P +    SL  + LS N+L+G+IP E   
Sbjct  99    SLSGRIGRGLLQLEFLRKLSLANNNLSGTISPNMVKLESLIAIDLSENSLTGSIPDEFFK  158

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAG  1505
                 L+ + L  NQ SG+IP  LG    L A+N+S NR +G LP G
Sbjct  159   QCGSLRYISLANNQFSGKIPGSLGSCATLAAINLSMNRFSGSLPVG  204



>ref|XP_006358746.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Solanum tuberosum]
Length=894

 Score =   410 bits (1053),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 255/538 (47%), Positives = 352/538 (65%), Gaps = 27/538 (5%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G +P +I  + SL  L L+ NSLTG IP  IG CSSL  LSLSHN L+G +PE L+ L
Sbjct  371   LYGIVPVEIGGAKSLMELSLEKNSLTGEIPSSIGYCSSLVSLSLSHNGLTGPVPEALAKL  430

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
               L+ + L  N+L+G +P+QLG L +L   N+S+N+L G LP+   F  +   ++  N  
Sbjct  431   TYLQSVDLSFNKLTGVLPKQLGDLGHLSLFNISHNQLQGELPSNGFFNTISPYSVSANPS  490

Query  1456  ICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHR-FLsvsaiv  1280
             +C   +   C    PKPIV+NP    N TD+        P    ++ RH +  LS+SA++
Sbjct  491   LCGAAVNRSCSTVMPKPIVLNP----NSTDS-------SPNTVPQSIRHEKKILSISALI  539

Query  1279  aisaaaiiavgvmvITMVNASVRRRISFVENALESMCSS---TSSRSQGMATGKLILFDT  1109
             AI AAA+I VGV+ IT++N  VR        A  +       + S S    +GKL++F  
Sbjct  540   AIGAAAVIFVGVIAITVLNIRVRSAAPRSAAAALTFSGGDDFSHSPSTDANSGKLVMF--  597

Query  1108  KSSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDFD  929
                PD+++    ++LNK  E+G G FG VY+  LG      VAIKKLT S +++  EDF+
Sbjct  598   SGDPDFSTGA-HALLNKDCELGRGGFGAVYRTVLGD--GHPVAIKKLTVSSLVKSQEDFE  654

Query  928   REVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAVR  749
             REVR LGK RH NLV L GYYWTP LQLL+ +FV  GNL   LHE +       L+W  R
Sbjct  655   REVRKLGKVRHHNLVTLEGYYWTPSLQLLIYEFVAGGNLYKHLHEGSGGCF---LSWNER  711

Query  748   FKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVMS  569
             F IILGTAK LAHLH   Q  +IHYN+K SN+L+D +  PK++D+GLARL+  LDR+V+S
Sbjct  712   FNIILGTAKSLAHLH---QMNVIHYNLKSSNVLIDSSGEPKVADYGLARLLPMLDRYVLS  768

Query  568   NRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRV  389
             ++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE+VTG+RPVEY ED+V++L D VR 
Sbjct  769   SKIQSALGYMAPEFACKTVKITEKCDVYGFGVLVLEVVTGKRPVEYMEDDVVVLCDMVRG  828

Query  388   LLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTP  218
              LE+G V +C+D  + G +P +EV+PV+KL L+CTSQ+PS+RP M EVV IL++I+ P
Sbjct  829   ALEEGRVEDCIDARLQGKFPADEVIPVMKLGLICTSQVPSNRPDMGEVVNILELIRCP  886


 Score = 60.8 bits (146),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 67/104 (64%), Gaps = 0/104 (0%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             +A +G +P+ I E  SL IL +  N+ +G IP  IG   SL +L +S N +SG++PE+LS
Sbjct  273   NAFVGIVPKWIGEMKSLQILDVSENNFSGIIPTSIGELESLKVLKVSRNGISGSLPESLS  332

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP  1511
                +L  L +  N L+G IP+ +G+L++L  +++S NRL G +P
Sbjct  333   SCVKLLELDVSHNSLAGTIPKTVGQLKSLNILDLSENRLYGIVP  376


 Score = 54.3 bits (129),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 46/126 (37%), Positives = 61/126 (48%), Gaps = 24/126 (19%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L GEIP DI    +L  L L  N+  G IP +IG C  L  + LS N+LSG +P T+  L
Sbjct  203   LDGEIPVDIQGLSNLRALNLGRNNFKGEIPDEIGGCLLLRSIDLSENSLSGELPSTMQKL  262

Query  1636  ------------------------KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNR  1529
                                     K L+IL +  N  SG IP  +G+LE+L  + VS N 
Sbjct  263   SLCSEFILRRNAFVGIVPKWIGEMKSLQILDVSENNFSGIIPTSIGELESLKVLKVSRNG  322

Query  1528  LTGRLP  1511
             ++G LP
Sbjct  323   ISGSLP  328



>ref|XP_008244834.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Prunus mume]
Length=965

 Score =   412 bits (1058),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 241/542 (44%), Positives = 340/542 (63%), Gaps = 37/542 (7%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G IP +I    SL  L+L  N LTG IP QI  CSSLT L LS NNL+G IP +++ L
Sbjct  444   LNGSIPSEIGGVVSLKELRLQKNFLTGKIPSQIVKCSSLTSLMLSQNNLTGPIPASIANL  503

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
               L+ + L  N+ SG +P++L  L +LL  NVS+N L G LP G  F  +  S++ GN  
Sbjct  504   TNLQYVDLSFNKFSGSLPKELTNLSHLLYFNVSHNHLQGDLPLGGFFNTISPSSVSGNPS  563

Query  1456  ICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRH-HRFLsvsaiv  1280
             IC  ++   C    PKPIV+NP             +++ P+  + +  H H+ +   + +
Sbjct  564   ICGSVVNRSCTSVHPKPIVLNP-------------NSSNPIGGSSSPTHGHKIIFSISAL  610

Query  1279  aisaaaiiavgvm-vITMVNASVRRRISFVENALE------SMCSSTSSRSQGMATGKLI  1121
                 AA      +  +T++N   R  +S     LE        CS T+  + G    KL+
Sbjct  611   VAIGAAAFIAIGVIAVTVLNIHARSSVSRSAAPLELSGGEDYSCSPTTDPNYG----KLV  666

Query  1120  LFDTKSSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYP  941
             +F   +  D+ + T +++LNK  E+G G FG VY+  L     R VAIKKLT S +++  
Sbjct  667   MFSGDA--DFGAGT-QALLNKDCELGRGGFGVVYRTVL--RDGRSVAIKKLTVSSLIKSQ  721

Query  940   EDFDREVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLT  761
             EDF+REV+ LGK RH NLV L GYYWTP LQLL+ +++P G+L   LH+    +    LT
Sbjct  722   EDFEREVKGLGKIRHHNLVALEGYYWTPSLQLLIYEYIPCGSLYKNLHD---GLGKSCLT  778

Query  760   WAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDR  581
             W  RF IILG AKGLAHLH   +  IIHYN+K +N+L+D +  PK+ DFGLARL+  LDR
Sbjct  779   WRQRFNIILGMAKGLAHLH---KINIIHYNLKSTNVLIDSSGAPKVGDFGLARLLPTLDR  835

Query  580   HVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILND  401
              ++S++ Q+A+GY+APE ACQ++++ EKCDVYGFG+L+LE+VTG+RPVEY ED+V++L D
Sbjct  836   CILSSKIQSALGYMAPEFACQTVKITEKCDVYGFGILVLEVVTGKRPVEYMEDDVVVLCD  895

Query  400   HVRVLLEQGNVLECVDQG-MGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIK  224
              VR  LE+G V EC+DQ  +G +P +E +PV+KL L+C SQ+PS+RP M EV+ IL++I+
Sbjct  896   MVRGALEEGRVEECLDQKLLGNFPADEAIPVVKLGLICASQVPSNRPDMNEVINILELIQ  955

Query  223   TP  218
              P
Sbjct  956   CP  957


 Score = 55.1 bits (131),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 61/105 (58%), Gaps = 1/105 (1%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIG-NCssltllslshnnlSGTIPETLSM  1640
               G I  D+   GSL ++ L  NSL+G IP +    C SL ++S + NNL+G IP +LS+
Sbjct  103   FTGTINPDLPHLGSLQVIDLSQNSLSGPIPDEFFMQCGSLRVVSFARNNLTGQIPHSLSL  162

Query  1639  LKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAG  1505
              + L  +    NQLSG++P  +  L  L A+++S N L G +P G
Sbjct  163   CQTLVAVNFSSNQLSGKLPSGIWYLRGLQALDLSDNLLEGEVPEG  207


 Score = 55.1 bits (131),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 41/106 (39%), Positives = 62/106 (58%), Gaps = 1/106 (1%)
 Frame = -1

Query  1819  ALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSM  1640
             +L G +   +     L IL L  N+ TGTI P + +  SL ++ LS N+LSG IP+   M
Sbjct  78    SLSGHVGRGLLRLQFLQILSLANNNFTGTINPDLPHLGSLQVIDLSQNSLSGPIPDEFFM  137

Query  1639  -LKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAG  1505
                 L+++    N L+G+IP  L   + L+AVN S N+L+G+LP+G
Sbjct  138   QCGSLRVVSFARNNLTGQIPHSLSLCQTLVAVNFSSNQLSGKLPSG  183


 Score = 54.7 bits (130),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 60/105 (57%), Gaps = 1/105 (1%)
 Frame = -1

Query  1822  SALIGEIPEDI-CESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETL  1646
             ++L G IP++   + GSL ++    N+LTG IP  +  C +L  ++ S N LSG +P  +
Sbjct  125   NSLSGPIPDEFFMQCGSLRVVSFARNNLTGQIPHSLSLCQTLVAVNFSSNQLSGKLPSGI  184

Query  1645  SMLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP  1511
               L+ L+ L L  N L GE+P+ +  L +L  +N   N  +G+LP
Sbjct  185   WYLRGLQALDLSDNLLEGEVPEGMENLYDLRVINFRKNWFSGKLP  229



>gb|KJB67929.1| hypothetical protein B456_010G218400 [Gossypium raimondii]
Length=983

 Score =   412 bits (1058),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 252/536 (47%), Positives = 347/536 (65%), Gaps = 23/536 (4%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G IP +I  + SL  L+L  N + G IP  I NC+ L  L +S NNLSG IP  +  L
Sbjct  461   LNGSIPMEIGGAYSLKDLRLKANFIEGKIPSSIENCTLLRTLIISQNNLSGPIPAKIGEL  520

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
               L+ + L  N L G +P+QL  L  LL+ N+S+N L G LPAG  F  +  +A+ GN  
Sbjct  521   SNLEYVDLSFNDLVGRLPKQLANLPRLLSFNISHNNLQGELPAGGFFNTISPTAVFGNPL  580

Query  1456  ICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRFLsvsaiva  1277
             +C   +   C    PKPIV+NP      T +++  D+  P       R    LS+SA++A
Sbjct  581   LCGSTVNKSCPAVLPKPIVLNP-----NTTSDSIPDDLPP----NVGRKRIVLSISALIA  631

Query  1276  isaaaiiavgvmvITMVNASVRRRISFVENALESMCSSTSSRS--QGMATGKLILFDTKS  1103
             I AAA I VGV+ +T++N  V+         +        SRS      +GKL++F  + 
Sbjct  632   IGAAAFIVVGVIAVTVLNLRVKSSTYHSAAPIAFSAGDEFSRSPTTDANSGKLVMFSGE-  690

Query  1102  SPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDFDRE  923
              PD+++    ++LNK  E+G G FG VY+     +  R VAIKKLT S +++  E+F+RE
Sbjct  691   -PDFSTGA-HAMLNKDCELGRGGFGAVYRTV--SQDGRAVAIKKLTVSSLVKSQEEFERE  746

Query  922   VRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAVRFK  743
             V+ LGK RH NLV L GYYWTP LQLL+S+FV  G+L   LHE     +   L+W  RF+
Sbjct  747   VKKLGKLRHYNLVALEGYYWTPSLQLLISEFVSGGSLHKHLHE---GPSGNYLSWHDRFR  803

Query  742   IILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVMSNR  563
             IILGTAKGLAHLH S    IIHYNIK SNIL+D +  PK++DFGLARL+  LDR+++S++
Sbjct  804   IILGTAKGLAHLHES---NIIHYNIKSSNILIDGSGEPKVADFGLARLLPMLDRYILSSK  860

Query  562   FQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRVLL  383
              Q+A+GY+APE AC+++++ EKCDVYGFG+L++E+VTG+RPVEY ED+V+IL D VR  L
Sbjct  861   IQSALGYMAPEFACRTVKITEKCDVYGFGVLVMEVVTGKRPVEYMEDDVVILCDMVRGAL  920

Query  382   EQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTP  218
             E+G V ECVD+ + G +P EE +PV+KL L+CTSQ+PS+RP M+EVV IL++I+ P
Sbjct  921   EEGRVEECVDERLQGKFPVEEAIPVMKLGLICTSQVPSNRPDMSEVVNILELIRCP  976


 Score = 66.2 bits (160),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 64/105 (61%), Gaps = 1/105 (1%)
 Frame = -1

Query  1822  SALIGEIPEDIC-ESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETL  1646
             ++L G IP+D   + GSL  + L  N  +G IP  +G+C++L  ++LS N  SG +P  +
Sbjct  142   NSLTGSIPDDFFKQCGSLRYISLANNHFSGKIPGSLGSCATLAAINLSMNRFSGLLPVGI  201

Query  1645  SMLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP  1511
               L  L+ L L  N L GEIP+ +  L NL ++N+S NR TG++P
Sbjct  202   WGLSGLRTLDLSCNMLEGEIPEGVHALNNLRSINLSNNRFTGQVP  246


 Score = 63.9 bits (154),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 60/102 (59%), Gaps = 0/102 (0%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L GEIPE +    +L  + L  N  TG +P +IG+C  L  +  S N  SG++P+T+  L
Sbjct  217   LEGEIPEGVHALNNLRSINLSNNRFTGQVPDEIGSCLLLRSIDFSMNLFSGSVPKTMQEL  276

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP  1511
                  L L VN    E+P+ +G++E+L  +++S N+ +G++P
Sbjct  277   SLCTYLNLSVNSFVVEVPEWIGEMESLQTLDLSVNKFSGQVP  318


 Score = 57.0 bits (136),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 59/107 (55%), Gaps = 1/107 (1%)
 Frame = -1

Query  1810  GEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSMLKR  1631
             G +P+ + E      L L  NS    +P  IG   SL  L LS N  SG +P+++  LK 
Sbjct  267   GSVPKTMQELSLCTYLNLSVNSFVVEVPEWIGEMESLQTLDLSVNKFSGQVPDSIGKLKF  326

Query  1630  LKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQN  1490
             LK+L    N L+G +P  +    NLLA+++S N LTG LP G IF++
Sbjct  327   LKVLNFSSNSLNGSLPASMENNMNLLALDISQNSLTGDLP-GWIFKS  372



>ref|XP_007207150.1| hypothetical protein PRUPE_ppa000904mg [Prunus persica]
 gb|EMJ08349.1| hypothetical protein PRUPE_ppa000904mg [Prunus persica]
Length=965

 Score =   411 bits (1057),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 252/540 (47%), Positives = 346/540 (64%), Gaps = 33/540 (6%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G IP +I    SL  L+L  N LTG IP QI  CSSLT L LS NNL+G IP  ++ L
Sbjct  444   LNGSIPSEIGGVVSLKELRLQKNFLTGKIPSQIEKCSSLTSLMLSQNNLTGPIPAAIANL  503

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
               L+ + L +N+ SG +P++L  L +LL  NVS+N L G LP G  F  +  S++ GN  
Sbjct  504   SNLQYVDLSLNKFSGSLPKELTNLSHLLYFNVSHNHLQGDLPLGGFFNTISPSSVSGNPS  563

Query  1456  ICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRFLsvsaiva  1277
             +C  ++   C    PKPIV+NP                   +S+    H    S+SA+VA
Sbjct  564   LCGSVVNRSCTSVHPKPIVLNPNSSNPIGS-----------SSSPTHGHKIIFSISALVA  612

Query  1276  isaaaiiavgvmvITMVNASVRRRISFVENALE------SMCSSTSSRSQGMATGKLILF  1115
             I AAA IA+GV+ +T++N  VR  +S     LE        CS T+  + G    KL++F
Sbjct  613   IGAAAFIAIGVIAVTVLNIHVRSSVSRSAAPLELSGGEDYSCSPTTDPNYG----KLVMF  668

Query  1114  DTKSSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPED  935
                +  D+ + T +++LNK  E+G G FG VY+  L     R VAIKKLT S +++  ED
Sbjct  669   SGDA--DFGAGT-QALLNKDCELGRGGFGVVYRTVL--RDGRSVAIKKLTVSSLIKSQED  723

Query  934   FDREVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWA  755
             F+REV+ LGK RH NLV L GYYWTP LQLL+ +++P G+L   LH+    +    LTW 
Sbjct  724   FEREVKGLGKIRHHNLVALEGYYWTPSLQLLIYEYIPCGSLYKNLHD---GLGKSCLTWR  780

Query  754   VRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHV  575
              RF IILG AKGLAHLH   Q  IIHYN+K +N+L+D +  PK+ DFGLARL+  LDR +
Sbjct  781   QRFNIILGMAKGLAHLH---QINIIHYNLKSTNVLIDSSGAPKVGDFGLARLLPTLDRCI  837

Query  574   MSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHV  395
             +S++ Q+A+GY+APE ACQ++++ EKCDVYGFG+L+LE+VTG+RPVEY ED+V++L D V
Sbjct  838   LSSKIQSALGYMAPEFACQTVKITEKCDVYGFGILVLEVVTGKRPVEYMEDDVVVLCDMV  897

Query  394   RVLLEQGNVLECVDQG-MGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTP  218
             R  LE+G V EC+DQ  +G +P +E +PV+KL L+C SQ+PS+RP M EV+ IL++I+ P
Sbjct  898   RGALEEGRVEECLDQKLLGNFPADEAIPVVKLGLICASQVPSNRPDMNEVINILELIQCP  957


 Score = 56.6 bits (135),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 42/106 (40%), Positives = 63/106 (59%), Gaps = 1/106 (1%)
 Frame = -1

Query  1819  ALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSM  1640
             +L G +   +     L IL L  N+ TGTI P + +  SL ++ LS N+LSG IP+   M
Sbjct  78    SLSGHVGRGLLRLQFLQILSLANNNFTGTINPDLPHLGSLQVIDLSQNSLSGPIPDEFFM  137

Query  1639  -LKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAG  1505
                 L+++    N L+G+IPQ L   + L+AVN S N+L+G+LP+G
Sbjct  138   QCGSLRVVSFARNNLTGQIPQSLSICQTLVAVNFSSNQLSGKLPSG  183


 Score = 55.5 bits (132),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 62/105 (59%), Gaps = 1/105 (1%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIG-NCssltllslshnnlSGTIPETLSM  1640
               G I  D+   GSL ++ L  NSL+G IP +    C SL ++S + NNL+G IP++LS+
Sbjct  103   FTGTINPDLPHLGSLQVIDLSQNSLSGPIPDEFFMQCGSLRVVSFARNNLTGQIPQSLSI  162

Query  1639  LKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAG  1505
              + L  +    NQLSG++P  +  L  L A+++S N L G +P G
Sbjct  163   CQTLVAVNFSSNQLSGKLPSGIWYLRGLQALDLSDNLLEGEVPEG  207


 Score = 55.1 bits (131),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 60/105 (57%), Gaps = 1/105 (1%)
 Frame = -1

Query  1822  SALIGEIPEDI-CESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETL  1646
             ++L G IP++   + GSL ++    N+LTG IP  +  C +L  ++ S N LSG +P  +
Sbjct  125   NSLSGPIPDEFFMQCGSLRVVSFARNNLTGQIPQSLSICQTLVAVNFSSNQLSGKLPSGI  184

Query  1645  SMLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP  1511
               L+ L+ L L  N L GE+P+ +  L +L  +N   N  +G+LP
Sbjct  185   WYLRGLQALDLSDNLLEGEVPEGMENLYDLRVINFRKNWFSGKLP  229



>gb|KJB73018.1| hypothetical protein B456_011G209800 [Gossypium raimondii]
Length=975

 Score =   411 bits (1057),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 255/537 (47%), Positives = 348/537 (65%), Gaps = 25/537 (5%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G IP +I  + SL  L+L+ N L G IP  I NC+SL  L +S NNLSG IP  +  L
Sbjct  452   LNGSIPMEIGGAFSLKDLRLNANFLGGKIPTSIENCTSLYTLIISQNNLSGPIPAEIGKL  511

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
               L+ + L  N L+G +P+QL  L +LL+ N+S+N L G LPAG  F  +  +A+ GN  
Sbjct  512   NNLENVDLSYNNLAGTLPKQLANLPHLLSFNISHNNLQGELPAGGFFNTISPTAVSGNPS  571

Query  1456  ICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRF-Lsvsaiv  1280
             +C   +   C    PKPIV+NP        N++    +E   +T    H R  LS+SA++
Sbjct  572   LCGSAVNKSCPAVLPKPIVLNP--------NSSSDSISEEFPTTVG--HKRIILSISALI  621

Query  1279  aisaaaiiavgvmvITMVNASVRRRISFVENALESMCSSTSSRS--QGMATGKLILFDTK  1106
             AI AAA+I VGV+ IT++N  VR   S    AL        S S      +GKL++F  +
Sbjct  622   AIGAAAVIVVGVIAITVLNLRVRSSTSRSAAALTFSAGDDFSHSPTTDANSGKLVMFSGE  681

Query  1105  SSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDFDR  926
               PD+++    ++  K  E+G G FG VY+  L     R VAIKKLT S +++  E+F+R
Sbjct  682   --PDFSTGA-HALFTKDCELGRGGFGAVYRTVL--RDGRSVAIKKLTVSSLVKSQEEFER  736

Query  925   EVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAVRF  746
             EV+ LGK +H NLV L GYYWTP LQLL+ +FV  G+L   LHE ++      L+W  RF
Sbjct  737   EVKKLGKIQHSNLVALEGYYWTPSLQLLIYEFVSGGSLYKHLHEGSVGNY---LSWNDRF  793

Query  745   KIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVMSN  566
              IILGTAK LAHLH   Q  IIHYNIK SN+L+D +  PK+ D+GLARL+  LDR+V+S+
Sbjct  794   SIILGTAKSLAHLH---QSNIIHYNIKSSNVLIDGSGEPKLGDYGLARLLPMLDRYVLSS  850

Query  565   RFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRVL  386
             + Q+A+GY+APE AC+++++NEKCDVYGFG+L+LE+VTG+RPVEY ED+V++L D VR  
Sbjct  851   KIQSALGYMAPEFACRTVKINEKCDVYGFGVLVLEVVTGKRPVEYMEDDVVVLCDMVRGA  910

Query  385   LEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTP  218
             LE+G V ECVD  + G +P EE +PV+KL L+CTSQ+PS+RP M EVV IL++I+ P
Sbjct  911   LEEGRVEECVDGRLQGKFPAEEAIPVMKLGLICTSQVPSNRPDMGEVVNILELIRCP  967


 Score = 64.7 bits (156),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 67/107 (63%), Gaps = 1/107 (1%)
 Frame = -1

Query  1822  SALIGEIPEDIC-ESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETL  1646
             ++L G IP+D   + GSL  + L  N  +G IP  +G+C++L  ++LS N LSG++P  +
Sbjct  133   NSLSGFIPDDFFKQCGSLRSISLANNRFSGKIPVSLGSCATLADINLSWNQLSGSLPAGI  192

Query  1645  SMLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAG  1505
               L  L+ L L  N L GEIP+ +  L NL ++N+S NR TG++P G
Sbjct  193   WGLNGLRSLDLSGNLLEGEIPKGIEALNNLRSINLSKNRFTGQVPDG  239


 Score = 62.4 bits (150),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 60/102 (59%), Gaps = 0/102 (0%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L GEIP+ I    +L  + L  N  TG +P  IG+C  L  + LS N LSG++P T+  L
Sbjct  208   LEGEIPKGIEALNNLRSINLSKNRFTGQVPDGIGSCLLLRSIDLSMNLLSGSVPNTIQKL  267

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP  1511
                  L L +N   GE+P+ +G+++NL  ++ S N+ +G++P
Sbjct  268   SLCSYLNLSMNSFVGEVPEWIGEMKNLETLDFSMNKFSGQVP  309


 Score = 57.0 bits (136),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 41/108 (38%), Positives = 56/108 (52%), Gaps = 1/108 (1%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G +P  I +      L L  NS  G +P  IG   +L  L  S N  SG +PE++  L
Sbjct  256   LSGSVPNTIQKLSLCSYLNLSMNSFVGEVPEWIGEMKNLETLDFSMNKFSGQVPESIGSL  315

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQ  1493
               LK+L    N L+G +P  +    NLLA++ S N +TG LP G IF+
Sbjct  316   NLLKVLNFSANGLNGSLPASMENNVNLLALDFSQNLMTGDLP-GWIFK  362



>gb|KHG09451.1| hypothetical protein F383_09289 [Gossypium arboreum]
Length=975

 Score =   411 bits (1056),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 254/537 (47%), Positives = 350/537 (65%), Gaps = 25/537 (5%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G IP +I  + SL  L+L+ N L G IP  I NC+ L+ L +S NNLSG IP  +  L
Sbjct  452   LNGSIPMEIGGALSLKDLRLNANFLGGKIPTSIENCTLLSTLIISQNNLSGPIPAEIGKL  511

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
               L+ + L  N L+G +P+QL  L +LL+ N+S+N L G LPAG+ F  +  +A+ GN  
Sbjct  512   NNLENVDLSYNNLAGTLPKQLANLPHLLSFNISHNNLQGELPAGAFFNTISPTAVSGNPS  571

Query  1456  ICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRF-Lsvsaiv  1280
             +C   +   C    PKPIV+NP        N++    +E L +T    H R  LS+SA++
Sbjct  572   LCGSAVNKSCPAVLPKPIVLNP--------NSSSDSISEELPTTVG--HKRIILSISALI  621

Query  1279  aisaaaiiavgvmvITMVNASVRRRISFVENALESMCSSTSSRS--QGMATGKLILFDTK  1106
             AI AAA+I VGV+ IT++N  VR   S    AL        S S      +GKL++F  +
Sbjct  622   AIGAAAVIVVGVIAITVLNLRVRSSTSRSAAALTFSAGDDFSHSPTTDANSGKLVMFSGE  681

Query  1105  SSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDFDR  926
               PD+++    ++  K  E+G G FG VY+  L     R VAIKKLT S +++  E+F+R
Sbjct  682   --PDFSTGA-HALFTKDCELGRGGFGAVYRTVL--RDGRSVAIKKLTVSSLVKSQEEFER  736

Query  925   EVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAVRF  746
             EV+ LGK +H NLV L GYYWTP LQLL+ +FV  G+L   LHE ++      L+W  RF
Sbjct  737   EVKKLGKIQHSNLVALEGYYWTPSLQLLIYEFVSGGSLYKHLHEGSVGNY---LSWNDRF  793

Query  745   KIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVMSN  566
              IILGTAK LAHLH   Q  IIHYN+K SN+L+D +  PK+ D+GLARL+  LDR+V+S+
Sbjct  794   SIILGTAKSLAHLH---QSNIIHYNLKSSNVLIDGSGEPKLGDYGLARLLPMLDRYVLSS  850

Query  565   RFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRVL  386
             + Q+A+GY+APE AC+++++NEKCDVYGFG+L+LE+VTG+RPVEY ED+V++L D VR  
Sbjct  851   KIQSALGYMAPEFACRTVKINEKCDVYGFGVLVLEVVTGKRPVEYMEDDVVVLCDMVRGA  910

Query  385   LEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTP  218
             LE+G V ECVD  + G +P EE +PV+KL L+CTSQ+PS+RP M EVV IL++I+ P
Sbjct  911   LEEGRVEECVDGRLQGKFPAEEAIPVMKLGLICTSQVPSNRPDMGEVVNILELIRCP  967


 Score = 64.7 bits (156),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 67/107 (63%), Gaps = 1/107 (1%)
 Frame = -1

Query  1822  SALIGEIPEDIC-ESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETL  1646
             ++L G IP+D   + GSL  + L  N  +G IP  +G+C++L  ++LS N LSG++P  +
Sbjct  133   NSLSGFIPDDFFKQCGSLRSISLANNRFSGKIPGSLGSCATLADINLSWNQLSGSLPAGI  192

Query  1645  SMLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAG  1505
               L  L+ L L  N L GEIP+ +  L NL ++N+S NR TG++P G
Sbjct  193   WGLNGLRSLDLSGNLLEGEIPKGIEALNNLRSINLSKNRFTGQVPDG  239


 Score = 62.0 bits (149),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 60/102 (59%), Gaps = 0/102 (0%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L GEIP+ I    +L  + L  N  TG +P  IG+C  L  + LS N LSG++P T+  L
Sbjct  208   LEGEIPKGIEALNNLRSINLSKNRFTGQVPDGIGSCLLLRSIDLSLNLLSGSVPSTIQKL  267

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP  1511
                  L L +N   GE+P+ +G+++NL  ++ S N+ +G++P
Sbjct  268   SLCSYLNLSMNSFVGEVPEWIGEMKNLETLDFSMNKFSGQVP  309


 Score = 56.6 bits (135),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 41/108 (38%), Positives = 56/108 (52%), Gaps = 1/108 (1%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G +P  I +      L L  NS  G +P  IG   +L  L  S N  SG +PE++  L
Sbjct  256   LSGSVPSTIQKLSLCSYLNLSMNSFVGEVPEWIGEMKNLETLDFSMNKFSGQVPESIGSL  315

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQ  1493
             K LK+L    N L+G +P  +    NLLA++ S N + G LP G IF+
Sbjct  316   KLLKVLNFSANGLNGSLPASMENNVNLLALDFSQNLMNGDLP-GWIFK  362



>gb|EMT18823.1| Putative LRR receptor-like serine/threonine-protein kinase [Aegilops 
tauschii]
Length=973

 Score =   411 bits (1056),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 257/543 (47%), Positives = 357/543 (66%), Gaps = 33/543 (6%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G IP  I    S  +L L  NSLTG IPPQIG+CS+LT L LSHN L+G IP T++ L
Sbjct  445   LNGSIPSTI-GGKSFKVLSLAKNSLTGEIPPQIGDCSALTSLDLSHNGLTGAIPATMANL  503

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
               L+   L  N+L+G +P+QL  L +L+  N+S+N+L+G LP GS F  +  S++  N G
Sbjct  504   TNLQTADLSRNKLTGGLPKQLSNLAHLVRFNISHNQLSGDLPPGSFFDTISLSSVSDNPG  563

Query  1456  ICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTR---NSRHHR--FLsv  1292
             +C   L   C    PKPIV+NP    N            PLA         HH+   LS+
Sbjct  564   LCGAKLNSSCPGVLPKPIVLNPDSSSN------------PLAQKEPVPGGLHHKKTILSI  611

Query  1291  saivaisaaaiiavgvmvITMVNASVRRRISFVENALESMCSSTSSRSQGMAT----GKL  1124
             SA+VAI AA +IAVG++ IT++N  VR   S    A  ++  S    SQ   T    GKL
Sbjct  612   SALVAIGAAVLIAVGIITITVLNLQVRAPGSHSAAAAAALELSDGYLSQSPTTDVNAGKL  671

Query  1123  ILFDTKSSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQY  944
             ++F    +P++++ST  ++LNK  E+G G FGTVYK  L     + VAIKKLT S +++ 
Sbjct  672   VMFG-GGNPEFSAST-HALLNKDCELGRGGFGTVYKTTL--RDGQPVAIKKLTVSSLVKS  727

Query  943   PEDFDREVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPL  764
              ++F+REV++LGK RH+NLV L GYYWTP LQLL+ +FV  GNL  +LHE + A     L
Sbjct  728   QDEFEREVKMLGKLRHRNLVALMGYYWTPSLQLLIYEFVSGGNLHKQLHESSNANY---L  784

Query  763   TWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLD  584
             +W  RF I+LG A+ LAHLH   +  IIHYN+K SNI+LD +   K+ D+GLA+L+  LD
Sbjct  785   SWKERFDIVLGMARSLAHLH---RHDIIHYNLKSSNIMLDGSGEAKVGDYGLAKLLPMLD  841

Query  583   RHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILN  404
             ++V+S++ Q+A+GY+APE  C+++++ EKCDVYGFG+L+LE++TGR PVEY ED+V++L 
Sbjct  842   QYVLSSKVQSALGYMAPEFTCRTVKITEKCDVYGFGVLVLEVMTGRAPVEYMEDDVIVLC  901

Query  403   DHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVI  227
             D VR  L++G V ECVD  + G +P EE +P++KL LVCTSQ+PS+RP M+EVV IL++I
Sbjct  902   DVVRAALDEGKVEECVDGKLCGKFPLEEAVPIMKLGLVCTSQVPSNRPDMSEVVNILELI  961

Query  226   KTP  218
             + P
Sbjct  962   RCP  964


 Score = 60.8 bits (146),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 41/108 (38%), Positives = 66/108 (61%), Gaps = 1/108 (1%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             + + GE+P  I +  +L  L L  N LTG++P  IG+C  L  + LS N+LSG +PE+L 
Sbjct  204   NTITGELPVGISKMFNLRALNLRRNRLTGSLPDDIGDCPLLRSVDLSSNSLSGNLPESLR  263

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSI  1499
              L     L L  N+L+G +P  +G++ +L  +++S N+ +G +P GSI
Sbjct  264   RLSTCTDLDLSSNELTGNVPTWVGEMVSLETLDLSGNKFSGEIP-GSI  310


 Score = 58.5 bits (140),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 59/104 (57%), Gaps = 0/104 (0%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             ++L G +PE +    +   L L  N LTG +P  +G   SL  L LS N  SG IP ++ 
Sbjct  252   NSLSGNLPESLRRLSTCTDLDLSSNELTGNVPTWVGEMVSLETLDLSGNKFSGEIPGSIG  311

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP  1511
              L  L+ L+L  N  +G +P+ +G   +L+ V+VS+N LTG LP
Sbjct  312   GLMSLRELRLSGNGFTGGLPESIGGCRSLVHVDVSWNSLTGSLP  355



>gb|EEC75203.1| hypothetical protein OsI_11455 [Oryza sativa Indica Group]
Length=971

 Score =   410 bits (1054),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 254/536 (47%), Positives = 362/536 (68%), Gaps = 22/536 (4%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G IP  +    SL  L+L  NSLTG IP QIGN S+L  L LSHNNL+G IP T++ +
Sbjct  446   LNGSIPATVGGE-SLRELRLAKNSLTGEIPAQIGNLSALASLDLSHNNLTGAIPATIANI  504

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
               L+ + L  N+L+G +P+QL  L +L+  N+S+N+L+G LP GS F  +  S++  N G
Sbjct  505   TNLQTVDLSRNKLTGGLPKQLSDLPHLVRFNISHNQLSGDLPPGSFFDTIPLSSVSDNPG  564

Query  1456  ICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHR-FLsvsaiv  1280
             +C   L   C    PKPIV+NP        +++    ++P  +    RH +  LS+SA+V
Sbjct  565   LCGAKLNSSCPGVLPKPIVLNP--------DSSSDPLSQPEPTPNGLRHKKTILSISALV  616

Query  1279  aisaaaiiavgvmvITMVNASVRRRISFVENALE-SMCSSTSSRSQGMATGKLILFDTKS  1103
             AI AA +I VGV+ IT++N  VR   S     LE S    + S +  + +GKL++F    
Sbjct  617   AIGAAVLITVGVITITVLNLRVRTPGSHSAAELELSDGYLSQSPTTDVNSGKLVMFG-GG  675

Query  1102  SPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDFDRE  923
             +P++++ST  ++LNK  E+G G FGTVYK  L     + VAIKKLT S +++  ++F+RE
Sbjct  676   NPEFSAST-HALLNKDCELGRGGFGTVYKTTL--RDGQPVAIKKLTVSSLVKSQDEFERE  732

Query  922   VRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAVRFK  743
             V++LGK RH+NLV L+GYYWTP LQLL+ +FV  GNL  +LHE + A     L+W  RF 
Sbjct  733   VKMLGKLRHRNLVALKGYYWTPSLQLLIYEFVSGGNLHKQLHESSTANC---LSWKERFD  789

Query  742   IILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVMSNR  563
             I+LG A+ LAHLH      IIHYN+K SNILLD + + K+ D+GLA+L+  LDR+V+S++
Sbjct  790   IVLGIARSLAHLHRH---DIIHYNLKSSNILLDGSGDAKVGDYGLAKLLPMLDRYVLSSK  846

Query  562   FQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRVLL  383
              Q+A+GY+APE AC+++++ EKCDVYGFG+L LEI+TGR PV+Y ED+V++L D VR  L
Sbjct  847   VQSALGYMAPEFACRTVKITEKCDVYGFGVLALEILTGRTPVQYMEDDVIVLCDVVRAAL  906

Query  382   EQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTP  218
             ++G V ECVD+ + G +P EE +P++KL LVCTSQ+PS+RP M+EVV IL++I+ P
Sbjct  907   DEGKVEECVDERLCGKFPLEEAVPIMKLGLVCTSQVPSNRPDMSEVVNILELIRCP  962


 Score = 60.5 bits (145),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 40/101 (40%), Positives = 60/101 (59%), Gaps = 0/101 (0%)
 Frame = -1

Query  1810  GEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSMLKR  1631
             G +PE +    +   L L  N+LTG +P  +G  +SL  L LS N  SG IP ++  L  
Sbjct  257   GNLPESLRRLSTCTYLDLSSNALTGNVPTWVGEMASLETLDLSGNKFSGEIPGSIGGLMS  316

Query  1630  LKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPA  1508
             LK L+L  N  +G +P+ +G  ++L+ V+VS+N LTG LP+
Sbjct  317   LKELRLSGNGFTGGLPESIGGCKSLVHVDVSWNSLTGTLPS  357


 Score = 58.5 bits (140),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 63/108 (58%), Gaps = 1/108 (1%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             +A+ G++P  +    +L  L L  N L G++P  IG+C  L  + L  NN+SG +PE+L 
Sbjct  205   NAITGDLPVGVSRMFNLRSLNLRSNRLAGSLPDDIGDCPLLRSVDLGSNNISGNLPESLR  264

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSI  1499
              L     L L  N L+G +P  +G++ +L  +++S N+ +G +P GSI
Sbjct  265   RLSTCTYLDLSSNALTGNVPTWVGEMASLETLDLSGNKFSGEIP-GSI  311



>ref|XP_011010875.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 isoform X1 [Populus euphratica]
Length=965

 Score =   410 bits (1054),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 249/543 (46%), Positives = 337/543 (62%), Gaps = 25/543 (5%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G IP +I  + +L  L+L+ NSL+G IP  IG CSSLT L LS NNLSGTIP  ++ L
Sbjct  442   LNGSIPMEIGGAFALKELRLERNSLSGQIPSSIGTCSSLTTLFLSQNNLSGTIPVAIAKL  501

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
               L+ + +  N L+G +P+QL  L +L + N+S+N L G LPAG  F  +  S + GN  
Sbjct  502   GNLQDVDVSFNSLTGTLPKQLANLPSLSSFNISHNNLQGELPAGGFFNTISPSCVAGNPS  561

Query  1456  ICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRFLsvsaiva  1277
             +C   +   C    PKPIV+NP    + T          P +  +N  H R +   + + 
Sbjct  562   LCGAAVNKSCPAVLPKPIVLNPNCSSDST----------PGSLPQNLGHKRIILSISAII  611

Query  1276  isaaaiiavgvmvI-TMVNASVRRRISFVENALESMCSS--TSSRSQGMATGKLILFDTK  1106
                AA + V  ++  T++N  VR   S    AL        + S +    +GKL++F   
Sbjct  612   AIGAAAVIVVGVIAITVLNLRVRSSTSTSAAALTLSAGDGFSDSSTTDANSGKLVMFSGD  671

Query  1105  SSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDFDR  926
             +     S+   ++LNK  E+G G FG VY+  L     R VAIKKLT S +++  EDF+R
Sbjct  672   TD---FSTEAHALLNKDCELGRGGFGAVYQTVL--RDGRPVAIKKLTVSSLVKSQEDFER  726

Query  925   EVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAVRF  746
             EV+ LGK RHQNLV L GYYWTP LQLL+ +FV  G+L   LH+         L+W  RF
Sbjct  727   EVKKLGKIRHQNLVALEGYYWTPSLQLLIYEFVSGGSLYKHLHDRPGGHF---LSWNERF  783

Query  745   KIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVMSN  566
              IILGTAK LAHLH   Q  IIHYNIK  NIL+D +  PK+ DFGLARL+  LDR+V+S+
Sbjct  784   NIILGTAKSLAHLH---QSNIIHYNIKSRNILIDISGEPKVGDFGLARLLPMLDRYVLSS  840

Query  565   RFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRVL  386
             + Q+A+GY+APE AC++ ++ EKCDVYGFG+LILEIVTG+RPVEY ED+V++L D VR  
Sbjct  841   KIQSALGYMAPEFACRTAKITEKCDVYGFGVLILEIVTGKRPVEYMEDDVVVLCDMVRGA  900

Query  385   LEQGNVLECVD-QGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPVPN  209
             LE+  V ECVD + +G +P +E +PV+KL L+CTSQ+PS+RP M EVV IL +I+ P   
Sbjct  901   LEESRVEECVDGRLLGHFPADEAVPVMKLGLICTSQVPSNRPDMGEVVNILDLIRCPSEG  960

Query  208   RME  200
             + E
Sbjct  961   QEE  963


 Score = 57.8 bits (138),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 43/125 (34%), Positives = 66/125 (53%), Gaps = 8/125 (6%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L  EIP  I    +L  + L  N   G IP  IG+C  L+ +  S N LSGT+P+T+  L
Sbjct  207   LDSEIPRGIEVLNNLRNINLSKNRFNGGIPNGIGSCLLLSSVDFSENMLSGTVPDTMQNL  266

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAG-------SIFQNLDSS  1478
                  L L  N  +GE+P  +G+L  L  +++S NR +G++P          +F NL ++
Sbjct  267   GLCNYLSLSNNMFTGEVPNWIGELNRLETLDLSGNRFSGQVPTSIGNLQSLKVF-NLSAN  325

Query  1477  AIEGN  1463
             ++ GN
Sbjct  326   SLSGN  330


 Score = 56.6 bits (135),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 54/102 (53%), Gaps = 0/102 (0%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G +P+ +   G    L L  N  TG +P  IG  + L  L LS N  SG +P ++  L
Sbjct  255   LSGTVPDTMQNLGLCNYLSLSNNMFTGEVPNWIGELNRLETLDLSGNRFSGQVPTSIGNL  314

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP  1511
             + LK+  L  N LSG +P+ +    NLL ++ S N L+G LP
Sbjct  315   QSLKVFNLSANSLSGNLPESMTNCGNLLVLDFSQNLLSGDLP  356



>gb|EAZ26832.1| hypothetical protein OsJ_10748 [Oryza sativa Japonica Group]
Length=971

 Score =   410 bits (1053),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 254/536 (47%), Positives = 362/536 (68%), Gaps = 22/536 (4%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G IP  +    SL  L+L  NSLTG IP QIGN S+L  L LSHNNL+G IP T++ +
Sbjct  446   LNGSIPATVGGE-SLRELRLAKNSLTGEIPAQIGNLSALASLDLSHNNLTGAIPATIANI  504

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
               L+ + L  N+L+G +P+QL  L +L+  N+S+N+L+G LP GS F  +  S++  N G
Sbjct  505   TNLQTVDLSRNKLTGGLPKQLSDLPHLVRFNISHNQLSGDLPPGSFFDTIPLSSVSDNPG  564

Query  1456  ICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHR-FLsvsaiv  1280
             +C   L   C    PKPIV+NP        +++    ++P  +    RH +  LS+SA+V
Sbjct  565   LCGAKLNSSCPGVLPKPIVLNP--------DSSSDPLSQPEPTPNGLRHKKTILSISALV  616

Query  1279  aisaaaiiavgvmvITMVNASVRRRISFVENALE-SMCSSTSSRSQGMATGKLILFDTKS  1103
             AI AA +I VGV+ IT++N  VR   S     LE S    + S +  + +GKL++F    
Sbjct  617   AIGAAVLITVGVITITVLNLRVRTPGSHSAAELELSDGYLSQSPTTDVNSGKLVMFG-GG  675

Query  1102  SPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDFDRE  923
             +P++++ST  ++LNK  E+G G FGTVYK  L     + VAIKKLT S +++  ++F+RE
Sbjct  676   NPEFSAST-HALLNKDCELGRGGFGTVYKTTL--RDGQPVAIKKLTVSSLVKSQDEFERE  732

Query  922   VRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAVRFK  743
             V++LGK RH+NLV L+GYYWTP LQLL+ +FV  GNL  +LHE + A     L+W  RF 
Sbjct  733   VKMLGKLRHRNLVALKGYYWTPSLQLLIYEFVSGGNLHKQLHESSTANC---LSWKERFD  789

Query  742   IILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVMSNR  563
             I+LG A+ LAHLH      IIHYN+K SNILLD + + K+ D+GLA+L+  LDR+V+S++
Sbjct  790   IVLGIARSLAHLHRH---DIIHYNLKSSNILLDGSGDAKVGDYGLAKLLPMLDRYVLSSK  846

Query  562   FQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRVLL  383
              Q+A+GY+APE AC+++++ EKCDVYGFG+L LEI+TGR PV+Y ED+V++L D VR  L
Sbjct  847   VQSALGYMAPEFACRTVKITEKCDVYGFGVLALEILTGRTPVQYMEDDVIVLCDVVRAAL  906

Query  382   EQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTP  218
             ++G V ECVD+ + G +P EE +P++KL LVCTSQ+PS+RP M+EVV IL++I+ P
Sbjct  907   DEGKVEECVDERLCGKFPLEEAVPIMKLGLVCTSQVPSNRPDMSEVVNILELIRCP  962


 Score = 60.5 bits (145),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 40/101 (40%), Positives = 60/101 (59%), Gaps = 0/101 (0%)
 Frame = -1

Query  1810  GEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSMLKR  1631
             G +PE +    +   L L  N+LTG +P  +G  +SL  L LS N  SG IP ++  L  
Sbjct  257   GNLPESLRRLSTCTYLDLSSNALTGNVPTWVGEMASLETLDLSGNKFSGEIPGSIGGLMS  316

Query  1630  LKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPA  1508
             LK L+L  N  +G +P+ +G  ++L+ V+VS+N LTG LP+
Sbjct  317   LKELRLSGNGFTGGLPESIGGCKSLVHVDVSWNSLTGTLPS  357


 Score = 58.5 bits (140),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 63/108 (58%), Gaps = 1/108 (1%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             +A+ G++P  +    +L  L L  N L G++P  IG+C  L  + L  NN+SG +PE+L 
Sbjct  205   NAITGDLPVGVSRMFNLRSLNLRSNRLAGSLPDDIGDCPLLRSVDLGSNNISGNLPESLR  264

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSI  1499
              L     L L  N L+G +P  +G++ +L  +++S N+ +G +P GSI
Sbjct  265   RLSTCTYLDLSSNALTGNVPTWVGEMASLETLDLSGNKFSGEIP-GSI  311



>ref|NP_001050035.1| Os03g0335500 [Oryza sativa Japonica Group]
 gb|ABF95811.1| leucine-rich repeat transmembrane protein kinase, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF11949.1| Os03g0335500 [Oryza sativa Japonica Group]
Length=971

 Score =   410 bits (1053),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 254/536 (47%), Positives = 362/536 (68%), Gaps = 22/536 (4%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G IP  +    SL  L+L  NSLTG IP QIGN S+L  L LSHNNL+G IP T++ +
Sbjct  446   LNGSIPATVGGE-SLRELRLAKNSLTGEIPAQIGNLSALASLDLSHNNLTGAIPATIANI  504

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
               L+ + L  N+L+G +P+QL  L +L+  N+S+N+L+G LP GS F  +  S++  N G
Sbjct  505   TNLQTVDLSRNKLTGGLPKQLSDLPHLVRFNISHNQLSGDLPPGSFFDTIPLSSVSDNPG  564

Query  1456  ICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHR-FLsvsaiv  1280
             +C   L   C    PKPIV+NP        +++    ++P  +    RH +  LS+SA+V
Sbjct  565   LCGAKLNSSCPGVLPKPIVLNP--------DSSSDPLSQPEPTPNGLRHKKTILSISALV  616

Query  1279  aisaaaiiavgvmvITMVNASVRRRISFVENALE-SMCSSTSSRSQGMATGKLILFDTKS  1103
             AI AA +I VGV+ IT++N  VR   S     LE S    + S +  + +GKL++F    
Sbjct  617   AIGAAVLITVGVITITVLNLRVRTPGSHSAAELELSDGYLSQSPTTDVNSGKLVMFG-GG  675

Query  1102  SPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDFDRE  923
             +P++++ST  ++LNK  E+G G FGTVYK  L     + VAIKKLT S +++  ++F+RE
Sbjct  676   NPEFSAST-HALLNKDCELGRGGFGTVYKTTL--RDGQPVAIKKLTVSSLVKSQDEFERE  732

Query  922   VRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAVRFK  743
             V++LGK RH+NLV L+GYYWTP LQLL+ +FV  GNL  +LHE + A     L+W  RF 
Sbjct  733   VKMLGKLRHRNLVALKGYYWTPSLQLLIYEFVSGGNLHKQLHESSTANC---LSWKERFD  789

Query  742   IILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVMSNR  563
             I+LG A+ LAHLH      IIHYN+K SNILLD + + K+ D+GLA+L+  LDR+V+S++
Sbjct  790   IVLGIARSLAHLHRH---DIIHYNLKSSNILLDGSGDAKVGDYGLAKLLPMLDRYVLSSK  846

Query  562   FQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRVLL  383
              Q+A+GY+APE AC+++++ EKCDVYGFG+L LEI+TGR PV+Y ED+V++L D VR  L
Sbjct  847   VQSALGYMAPEFACRTVKITEKCDVYGFGVLALEILTGRTPVQYMEDDVIVLCDVVRAAL  906

Query  382   EQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTP  218
             ++G V ECVD+ + G +P EE +P++KL LVCTSQ+PS+RP M+EVV IL++I+ P
Sbjct  907   DEGKVEECVDERLCGKFPLEEAVPIMKLGLVCTSQVPSNRPDMSEVVNILELIRCP  962


 Score = 60.5 bits (145),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 40/101 (40%), Positives = 60/101 (59%), Gaps = 0/101 (0%)
 Frame = -1

Query  1810  GEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSMLKR  1631
             G +PE +    +   L L  N+LTG +P  +G  +SL  L LS N  SG IP ++  L  
Sbjct  257   GNLPESLRRLSTCTYLDLSSNALTGNVPTWVGEMASLETLDLSGNKFSGEIPGSIGGLMS  316

Query  1630  LKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPA  1508
             LK L+L  N  +G +P+ +G  ++L+ V+VS+N LTG LP+
Sbjct  317   LKELRLSGNGFTGGLPESIGGCKSLVHVDVSWNSLTGTLPS  357


 Score = 58.5 bits (140),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 63/108 (58%), Gaps = 1/108 (1%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             +A+ G++P  +    +L  L L  N L G++P  IG+C  L  + L  NN+SG +PE+L 
Sbjct  205   NAITGDLPVGVSRMFNLRSLNLRSNRLAGSLPDDIGDCPLLRSVDLGSNNISGNLPESLR  264

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSI  1499
              L     L L  N L+G +P  +G++ +L  +++S N+ +G +P GSI
Sbjct  265   RLSTCTYLDLSSNALTGNVPTWVGEMASLETLDLSGNKFSGEIP-GSI  311



>ref|XP_002275275.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Vitis vinifera]
Length=969

 Score =   410 bits (1053),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 261/543 (48%), Positives = 351/543 (65%), Gaps = 26/543 (5%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G IP +I  + SL  L+L  N L G IP  + NCSSLT L LSHNNLSG IP  +S L
Sbjct  447   LNGSIPLEIGGAFSLKDLRLKNNFLAGKIPVSLENCSSLTTLILSHNNLSGPIPMGISKL  506

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
               L+ + L +N+L+G +P+QL  L +L++ N+S+N+L G LPAG  F  +  S++ GN  
Sbjct  507   SNLENVDLSLNKLTGSLPKQLANLPHLISFNISHNQLQGELPAGGFFNTISPSSVSGNPS  566

Query  1456  ICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRF-Lsvsaiv  1280
             +C       C    PKPIV+NP    + T            A  R+  H +  LS+SA++
Sbjct  567   LCGSAANKSCPAVLPKPIVLNPNSSSDTTAG----------AFPRSLAHKKIILSISALI  616

Query  1279  aisaaaiiavgvmvITMVNASVRRRISFVENALESMCSSTSSRS--QGMATGKLILFDTK  1106
             AI AAA+I +GV+ IT++N  VR   S    AL        S S      +GKL++F   
Sbjct  617   AIGAAAVIVIGVIAITVLNLRVRSSASRSAAALALSGGDDYSHSPTTDANSGKLVMF--S  674

Query  1105  SSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDFDR  926
               PD++     ++LNK  E+G G FG VY+  L       VAIKKLT S +++  EDF+R
Sbjct  675   GDPDFSMGA-HALLNKDCELGRGGFGAVYRTVL--RDGHPVAIKKLTVSSLVKSQEDFER  731

Query  925   EVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAVRF  746
             EV+ LGK RHQNLV L GYYWTP LQLL+ +F+  G+L   LHE A        TW  RF
Sbjct  732   EVKKLGKIRHQNLVALEGYYWTPSLQLLIYEFISGGSLYKHLHEGAGG----NFTWNERF  787

Query  745   KIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVMSN  566
              IILGTAK LAHLH   Q  IIHYN+K SN+L+D +  PK++DFGLARL+  LDR+V+S+
Sbjct  788   NIILGTAKSLAHLH---QMSIIHYNLKSSNVLIDPSGEPKVADFGLARLLPMLDRYVLSS  844

Query  565   RFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRVL  386
             + Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE+VTG+RPVEY ED+V++L D VR  
Sbjct  845   KIQSALGYMAPEFACRTVKITEKCDVYGFGVLVLEVVTGKRPVEYMEDDVVVLCDMVRGA  904

Query  385   LEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPVPN  209
             LE+G V ECVD  + G +P EE +PV+KL L+CTSQ+PS+RP MAEVV IL++I+ P   
Sbjct  905   LEEGKVEECVDGRLQGKFPAEEAIPVMKLGLICTSQVPSNRPDMAEVVNILELIRCPSEG  964

Query  208   RME  200
             + E
Sbjct  965   QEE  967


 Score = 65.5 bits (158),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 62/107 (58%), Gaps = 1/107 (1%)
 Frame = -1

Query  1822  SALIGEIPEDIC-ESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETL  1646
             ++L G IP+D   + GSL  + L  N  +G IP  +G+CS+L  +  S N  SG +P  +
Sbjct  128   NSLSGTIPDDFFKQCGSLHAISLAKNKFSGKIPESVGSCSTLAAIDFSSNQFSGPLPSGI  187

Query  1645  SMLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAG  1505
               L  L+ L L  N L G+IP+ +  L NL A+N+S NR +G LP G
Sbjct  188   WSLNGLRSLDLSDNLLEGDIPKGIDSLYNLRAINLSKNRFSGPLPDG  234


 Score = 58.9 bits (141),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 57/105 (54%), Gaps = 0/105 (0%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             ++L G +P  + +      + L GNS  G +P  IG   SL  L LS N  SG +P ++ 
Sbjct  249   NSLSGSLPGTMQKLTLCNYMNLHGNSFEGEVPEWIGEMKSLETLDLSANKFSGRVPTSIG  308

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPA  1508
              LK LK+L   VN  SG +P+ +   E LL ++VS N L G LPA
Sbjct  309   NLKSLKVLNFSVNVFSGSLPESMINCEQLLVLDVSQNSLLGDLPA  353


 Score = 56.2 bits (134),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 60/103 (58%), Gaps = 0/103 (0%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G+IP+ I    +L  + L  N  +G +P  IG C  L L+  S N+LSG++P T+  L
Sbjct  203   LEGDIPKGIDSLYNLRAINLSKNRFSGPLPDGIGGCLLLRLIDFSENSLSGSLPGTMQKL  262

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPA  1508
                  + L  N   GE+P+ +G++++L  +++S N+ +GR+P 
Sbjct  263   TLCNYMNLHGNSFEGEVPEWIGEMKSLETLDLSANKFSGRVPT  305



>gb|EEE55595.1| hypothetical protein OsJ_03900 [Oryza sativa Japonica Group]
Length=660

 Score =   400 bits (1029),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 236/537 (44%), Positives = 345/537 (64%), Gaps = 22/537 (4%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G +P +I  + +L  L+L  NS TG IP QIGNCSSL  L LSHNNL+G+IP T+  L
Sbjct  133   LDGGVPPEIGGAVALRELRLGRNSFTGHIPSQIGNCSSLVALDLSHNNLTGSIPSTVGNL  192

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
               L+++ L  N+L+G +P +L  L +L   +VS+N L+G LP    F N+  + +  N G
Sbjct  193   TSLEVVDLSKNKLNGTLPVELSNLPSLRIFDVSHNLLSGDLPNSRFFDNIPETFLSDNQG  252

Query  1456  ICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRFLsvsaiva  1277
             +CS      C    PKPIV+NP    N          ++   +  +S HH+ + +S    
Sbjct  253   LCSSRKNNSCIAIMPKPIVLNPNSSTNP--------LSQATPTAPSSMHHKKIILSVSTL  304

Query  1276  isaaaiiavgvmvITMVNASVRRRISFVENALESMCSS---TSSRSQGMATGKLILFDTK  1106
             I+ A    + + VI +   + R R +   +A  +  S    + S     ++GKL++F  K
Sbjct  305   IAIAGGGTIIIGVIIISVLNRRARATTSRSAPATALSDDYLSQSPENDASSGKLVMFG-K  363

Query  1105  SSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDFDR  926
              SP++ S+   ++LNK  E+G G FG VYK  L     + VAIKKLT S +++  +DF+R
Sbjct  364   GSPEF-SAGGHALLNKDCELGRGGFGAVYKTVL--RDGQPVAIKKLTVSSLVKSKDDFER  420

Query  925   EVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAVRF  746
             +V++L K RH N+V LRG+YWT  LQLL+ D++P GNL   LHE     +   L+W  RF
Sbjct  421   QVKLLSKVRHHNVVALRGFYWTSSLQLLIYDYLPGGNLHKHLHECTEDNS---LSWMERF  477

Query  745   KIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVMSN  566
              IILG A+GL HLH   Q  IIHYN+K SN+LLD N  P++ D+GLA+L+  LDR+V+S+
Sbjct  478   DIILGVARGLTHLH---QRGIIHYNLKSSNVLLDSNGEPRVGDYGLAKLLPMLDRYVLSS  534

Query  565   RFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRVL  386
             + Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE++TGRRPVEY ED+V++L D VR  
Sbjct  535   KIQSALGYMAPEFACKTVKITEKCDVYGFGVLVLEVLTGRRPVEYLEDDVVVLCDLVRSA  594

Query  385   LEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTP  218
             LE+G + +C+D  + G +P EE LP++KL LVCTS++PS+RP M EVV IL+++++P
Sbjct  595   LEEGRLEDCMDPRLCGEFPMEEALPIIKLGLVCTSRVPSNRPDMGEVVNILELVRSP  651



>ref|XP_008370260.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Malus domestica]
Length=965

 Score =   409 bits (1050),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 240/538 (45%), Positives = 342/538 (64%), Gaps = 29/538 (5%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G IP++I  + SL  ++L  N L+G +P +I  CSSLT L LS NNL+G IP  L+ L
Sbjct  444   LNGSIPDEIGGAVSLKEIRLQKNFLSGKVPAEIAKCSSLTNLILSQNNLTGPIPTALANL  503

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
               L+ + L +N+ SG IP++L  L +LL  NVS+N L G LP G  F  +  S++  N  
Sbjct  504   TNLQYVDLSLNKFSGGIPKELTNLSHLLYFNVSHNHLEGELPLGGFFNTIPPSSVSDNPS  563

Query  1456  ICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRH-HRFLsvsaiv  1280
             +C   +T  C    PKPIV+NP             +++ P+  + +  H H+ +   + +
Sbjct  564   LCGSAVTRACPSVHPKPIVLNP-------------NSSNPVHGSSSPTHGHKIVFSISAL  610

Query  1279  aisaaaiiavg-vmvITMVNASVRRRISFVENALESMCSS--TSSRSQGMATGKLILFDT  1109
                 AA+     V+ IT++N  VR  +S     LE       + S +     GKL++F  
Sbjct  611   IAIGAAVFIAIGVIAITVLNMHVRSSLSRSAAPLELSGGEDYSCSPANDPNYGKLVMFSG  670

Query  1108  KSSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDFD  929
              +  D+ +   +++LNK  E+G G FG VYK  L     R VAIKKLT S +++  EDF+
Sbjct  671   DA--DFGAGX-QALLNKDCELGRGGFGVVYKTAL--RDGRSVAIKKLTVSSLIKSQEDFE  725

Query  928   REVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAVR  749
             REV+ LGK RH+NLV L GYYWTP LQL++ +++P G+L   LH+         LTW  R
Sbjct  726   REVKGLGKIRHRNLVALEGYYWTPSLQLIIYEYIPCGSLFKNLHD---GPGKTCLTWRQR  782

Query  748   FKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVMS  569
             F IILG AKGLAHLH   Q  IIHYN+K +N+L+D N  PK+ DFGLARL+  LDR ++S
Sbjct  783   FHIILGMAKGLAHLH---QMKIIHYNLKSTNVLIDSNGEPKVGDFGLARLLPTLDRCILS  839

Query  568   NRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRV  389
             ++ Q+A+GY+APE ACQ++++ EKCDVYGFG+L+LE+VTG+RPVEY ED+V++L D VR 
Sbjct  840   SKIQSALGYMAPEFACQTVKITEKCDVYGFGILVLEVVTGKRPVEYLEDDVIVLCDMVRG  899

Query  388   LLEQGNVLECVDQG-MGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTP  218
              LE+G V EC+D+  +G +P EE +PV+KL L+C SQ+PS+RP M+EV+ IL++I+ P
Sbjct  900   ALEEGRVEECLDKNLLGNFPAEEAIPVVKLGLICASQVPSNRPDMSEVINILELIQCP  957


 Score = 59.3 bits (142),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 38/101 (38%), Positives = 56/101 (55%), Gaps = 0/101 (0%)
 Frame = -1

Query  1810  GEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSMLKR  1631
             GE+PE I     L ++ L  N  +G +P   G+C  L LL  S N  SG IP ++  L  
Sbjct  202   GEVPEGIENLYDLRVINLAKNRFSGQLPGDFGSCLQLKLLDFSENLFSGRIPXSIQRLNS  261

Query  1630  LKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPA  1508
                L L+ N L+G++P  LG L+NL  ++VS N  +G +P+
Sbjct  262   CTSLSLQGNLLAGQVPNWLGDLKNLEVLDVSGNNFSGEIPS  302


 Score = 58.5 bits (140),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/113 (35%), Positives = 66/113 (58%), Gaps = 3/113 (3%)
 Frame = -1

Query  1822  SALIGEIPEDI-CESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETL  1646
             ++L G +PE+   + GSL ++    N+LTG IP  +  C +L  ++ S N +SG +P  +
Sbjct  125   NSLSGSVPEEFFMQCGSLRVVSFARNNLTGRIPESLSLCQTLVDVNFSSNRMSGKLPSGI  184

Query  1645  SMLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPA--GSIFQ  1493
               L+ L+ L L  N + GE+P+ +  L +L  +N++ NR +G+LP   GS  Q
Sbjct  185   WYLRMLQSLDLADNLVEGEVPEGIENLYDLRVINLAKNRFSGQLPGDFGSCLQ  237


 Score = 53.5 bits (127),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 46/116 (40%), Positives = 64/116 (55%), Gaps = 0/116 (0%)
 Frame = -1

Query  1810  GEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSMLKR  1631
             G IP  I    S   L L GN L G +P  +G+  +L +L +S NN SG IP +L  L+ 
Sbjct  250   GRIPXSIQRLNSCTSLSLQGNLLAGQVPNWLGDLKNLEVLDVSGNNFSGEIPSSLGNLEL  309

Query  1630  LKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGN  1463
             L+ L L  N  +G +P  L    NLLA++VS+N L G+LP+      L S ++ GN
Sbjct  310   LEXLNLSRNGFTGSLPDTLANCNNLLAIDVSHNLLAGKLPSWIFKLGLRSVSLYGN  365



>gb|EYU35201.1| hypothetical protein MIMGU_mgv1a000839mg [Erythranthe guttata]
Length=967

 Score =   409 bits (1050),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 252/536 (47%), Positives = 353/536 (66%), Gaps = 23/536 (4%)
 Frame = -1

Query  1810  GEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSMLKR  1631
             G IP DI    SL  L+L+ N L G IP  IGNC++LT LSL+HN ++G IP +L+ L  
Sbjct  432   GSIPSDIGSLASLNELRLEKNLLEGYIPLSIGNCAALTSLSLAHNEIAGPIPASLAKLNH  491

Query  1630  LKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDGIC  1451
             L+ +    N+L+G +P+QL  L +L   N+S+N+L G LPAG+ F  +D S++ GN  +C
Sbjct  492   LQTVDFSFNKLTGPLPKQLANLVSLRVFNISHNQLQGDLPAGAFFNTIDPSSVTGNPSLC  551

Query  1450  SPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRFLsvsaivais  1271
                +   C    PKPIV+NP    N T    G      L S R     + LS+SA++AI 
Sbjct  552   GSAVNTTCPTVLPKPIVLNP----NDTTPGGGTTTPTTLQS-RFGGGKKILSISALIAIG  606

Query  1270  aaaiiavgvmvITMVNASVRRRISFVENALESMCSS-----TSSRSQGMATGKLILFDTK  1106
             AAA I VGV+ IT++N  VR       +   ++  S     + S S    +GKL++F   
Sbjct  607   AAASIVVGVIAITVLNLRVRGGDRDRRHPDAALTFSGGGDFSRSPSTDGESGKLVMF--S  664

Query  1105  SSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDFDR  926
               P++++ T  ++LNK  E+G G FG VY+  LG    R VAIKKLT S +++  +DF+R
Sbjct  665   GDPEFSTGT-HALLNKDCELGRGGFGAVYRTMLGD--GRPVAIKKLTVSSLVKSQDDFER  721

Query  925   EVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAVRF  746
             EV+ L KARH+NLV L GYYWTP LQLL+ +FV  GNL   LHE +       L+W  R+
Sbjct  722   EVKKLSKARHENLVALDGYYWTPSLQLLIYEFVSGGNLYKHLHEESSGRC---LSWNERY  778

Query  745   KIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNP-KISDFGLARLVAKLDRHVMS  569
              I+LG A+GLAHLH +    IIHYN+K SNIL+DE     K++D+GLARL+  LDR+V+S
Sbjct  779   NIVLGAARGLAHLHRT---NIIHYNLKSSNILIDEGSGEIKVADYGLARLLPMLDRYVLS  835

Query  568   NRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRV  389
             ++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE++TG+RPVEY ED+V++L+D VR 
Sbjct  836   SKIQSALGYMAPEFACKTVKITEKCDVYGFGILVLEVLTGKRPVEYMEDDVVVLSDMVRG  895

Query  388   LLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIK  224
              +E+G V ECVD  M G +P EE +PV+KL L+CTSQ+PS+RP M EVV IL++I+
Sbjct  896   AVEEGRVEECVDSRMLGKFPVEEAIPVMKLGLICTSQVPSNRPDMDEVVNILEMIR  951


 Score = 58.5 bits (140),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 54/102 (53%), Gaps = 0/102 (0%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L GE+P+ I     L  + L GNS +G +P  I   S    L L  N   G + E +  +
Sbjct  210   LSGEVPDGIGNCLLLRSIDLSGNSFSGRLPSTIQKLSLCNNLVLGKNGFEGDLSEWIGEM  269

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP  1511
             + L+ L L  N LSG IP  LGKL++L  +NVS N L G LP
Sbjct  270   RSLESLDLSENGLSGRIPDSLGKLQSLKVLNVSKNALNGSLP  311



>ref|XP_009789234.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Nicotiana sylvestris]
Length=972

 Score =   409 bits (1050),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 255/547 (47%), Positives = 362/547 (66%), Gaps = 30/547 (5%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G IP ++  + SL  L+L+ N+LTG IP  IGNCS+L  +SLSHN L+G +P TL+ L
Sbjct  447   LNGSIPLELGGAYSLRELKLENNALTGEIPSSIGNCSTLVSMSLSHNGLTGPVPATLAKL  506

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
               L+ + L  N+L+G +P+QL  L +LL+ N+SYN+L G LP+G +F  +   ++  N  
Sbjct  507   TYLQNVDLSFNKLTGILPKQLVNLGHLLSFNISYNQLKGELPSGGLFNTISPYSVSANPS  566

Query  1456  ICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLAST---RNSRHHRFLsvsa  1286
             +C   +   C    PKPIV+NP    N T         E +  T         + LS+SA
Sbjct  567   LCGAAVNRSCPTVLPKPIVLNP----NST---------ESIPGTIPPTFGHEKKILSISA  613

Query  1285  ivaisaaaiiavgvmvITMVNASVRRRISFVENALESMCSS--TSSRSQGMATGKLILFD  1112
             ++AISAAA+I VGV+ IT++N  VR   S    AL        + SRS    +GKL++F 
Sbjct  614   LIAISAAAVIVVGVIAITVLNLRVRAATSRSTAALTFSGGDDFSGSRSTDANSGKLVMFS  673

Query  1111  TKSSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDF  932
              +   D+++ +  ++LNK  E+G G FG VY+  L       VAIKKLT S +++  +DF
Sbjct  674   GE--LDFSTGS-HALLNKDCELGRGGFGAVYRTVLAD--GMPVAIKKLTVSGLVKSQQDF  728

Query  931   DREVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAV  752
             ++EV+ LGK RH NLV L+GYYWTP LQLL+ +FV  GNL   +HE +       L+W  
Sbjct  729   EKEVKKLGKIRHPNLVALQGYYWTPSLQLLIYEFVAGGNLYEHIHESSSGNL---LSWNE  785

Query  751   RFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVM  572
             RF +ILGTAKGLA+LH   +  IIHYN+K SNIL+D + +PK++D+GLARL+  LDR+V+
Sbjct  786   RFNVILGTAKGLANLH---RMNIIHYNLKSSNILIDSSGDPKVADYGLARLLPMLDRYVL  842

Query  571   SNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVR  392
             S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE+VTG++PVEY ED+V++L D VR
Sbjct  843   SSKIQSALGYMAPEFACKTVKITEKCDVYGFGVLVLEVVTGKKPVEYMEDDVMVLCDIVR  902

Query  391   VLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPV  215
               LE G V ECVD  + G +P EE +PV+KL L+CTSQ+PS+RP MAEVV IL++I+ P 
Sbjct  903   GALEDGKVEECVDGRLHGKFPVEEAIPVMKLGLICTSQVPSNRPDMAEVVNILEMIRCPS  962

Query  214   PNRMEPY  194
               + EP+
Sbjct  963   EGQDEPH  969


 Score = 57.4 bits (137),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 61/104 (59%), Gaps = 0/104 (0%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             ++L GE+PE +        L L  N+  GT+P  +G   SL +L LS NN SG  P ++ 
Sbjct  249   NSLSGELPETMQMLSLCNELILKNNAFVGTVPEWVGEMKSLEILDLSMNNFSGQFPTSIG  308

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP  1511
              L+ LK+L +  N +SG +P+ +    NL+ ++VS+N LTG LP
Sbjct  309   KLQSLKLLNVSQNAISGNLPESMSNCVNLMTLDVSHNTLTGGLP  352


 Score = 55.5 bits (132),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 47/126 (37%), Positives = 63/126 (50%), Gaps = 24/126 (19%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L GEIP  I    +L  + L  N LTG  P  IG+   L  + LS N+LSG +PET+ ML
Sbjct  203   LDGEIPVGIEGMYNLRAINLRKNRLTGEFPDGIGSYLLLRSIDLSENSLSGELPETMQML  262

Query  1636  ------------------------KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNR  1529
                                     K L+IL L +N  SG+ P  +GKL++L  +NVS N 
Sbjct  263   SLCNELILKNNAFVGTVPEWVGEMKSLEILDLSMNNFSGQFPTSIGKLQSLKLLNVSQNA  322

Query  1528  LTGRLP  1511
             ++G LP
Sbjct  323   ISGNLP  328


 Score = 52.8 bits (125),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 54/105 (51%), Gaps = 1/105 (1%)
 Frame = -1

Query  1816  LIGEIPEDIC-ESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSM  1640
               G IP D   + G L  + L  N   G IP  + +C +L  L+LS N  SG +P  +  
Sbjct  130   FFGLIPGDFFRQCGPLRSVSLAKNKFLGKIPGSLSSCVALGSLNLSSNQFSGLLPSGIWS  189

Query  1639  LKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAG  1505
             L  L+ L L  N L GEIP  +  + NL A+N+  NRLTG  P G
Sbjct  190   LNGLRSLDLSDNLLDGEIPVGIEGMYNLRAINLRKNRLTGEFPDG  234



>ref|XP_008788529.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Phoenix dactylifera]
Length=968

 Score =   408 bits (1049),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 264/537 (49%), Positives = 358/537 (67%), Gaps = 21/537 (4%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G IP +I E+ SL  L L  NSLTG IP QIGNCSSL  L LS NNL+G +P T S +
Sbjct  440   LNGSIPPEIGEAVSLNELNLHKNSLTGGIPTQIGNCSSLASLILSQNNLTGPVPSTFSNI  499

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
               L+ + L  N+L+G +P+QL  L +LL+ N+S+N  +G LPAG+ F  +  S+I  N G
Sbjct  500   TNLQTIDLSHNRLTGTLPKQLSNLPHLLSFNISHNLFSGDLPAGNFFNTIPRSSISDNPG  559

Query  1456  ICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRF-Lsvsaiv  1280
             +C  ++   C+   PKPIV+NP        +N+         S  + RH +  LS+S ++
Sbjct  560   LCGSVVNRSCRAVLPKPIVLNPNSSSPNPSSNSAF-------SPGSLRHKKIILSISTLI  612

Query  1279  aisaaaiiavgvmvITMVNASVRRRISFVENALESMCSSTSSRSQGMA--TGKLILFDTK  1106
             AI AAA+IA+GV  IT++N  VR   +    A  +      SRS G    +GKL++F + 
Sbjct  613   AIGAAALIALGVFTITVLNLRVRAAAASQSAAALAFSDDYCSRSPGTEADSGKLVMF-SG  671

Query  1105  SSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDFDR  926
             + PD+++    ++LNK  E+G G FG VYK  L     R VAIKKLT S +++  EDF+R
Sbjct  672   NDPDFSAGA-HAILNKDCELGRGGFGAVYKTIL--RDGRPVAIKKLTVSSLVKSQEDFER  728

Query  925   EVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAVRF  746
             EV+ LGK RH NLV L GYYWTP LQLL+ +FV  GNL   LHE +   A+  L+W  RF
Sbjct  729   EVKKLGKVRHPNLVALEGYYWTPSLQLLIHEFVSGGNLYGNLHESS---ASNSLSWQERF  785

Query  745   KIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVMSN  566
              IILG A+GLAHLH   +  IIHYN+K SNIL+D +   K+ D+GLA L+ KLDR+V+S+
Sbjct  786   DIILGIARGLAHLH---RLNIIHYNLKSSNILIDGSGEAKVGDYGLANLLPKLDRYVLSS  842

Query  565   RFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRVL  386
             + Q+A+GY+APE AC+++++ EKCDVYGFG+L+LEI+TGRRPVEY ED+V++L D VR  
Sbjct  843   KIQSALGYMAPEFACRTVKITEKCDVYGFGVLVLEILTGRRPVEYMEDDVVVLCDVVRGA  902

Query  385   LEQGNVLECVDQGMGG-YPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTP  218
             LE+G V E VD  +GG +P EE +PVLKL L+CTSQ+PS+RP MAE V IL++I+ P
Sbjct  903   LEEGRVEESVDGRLGGKFPVEEAVPVLKLGLICTSQVPSNRPDMAEAVNILRLIRCP  959


 Score = 62.0 bits (149),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 45/103 (44%), Positives = 64/103 (62%), Gaps = 1/103 (1%)
 Frame = -1

Query  1816  LIGEIPEDIC-ESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSM  1640
             L G IP++   +  SL  + L  N+ +G IPP +G+CS+L  L+LS N LSG +P  L  
Sbjct  128   LSGSIPDEFFRQCRSLSSISLANNAFSGEIPPSVGSCSTLAELNLSSNRLSGRLPSGLWS  187

Query  1639  LKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP  1511
             L  L+ L L  N LSG+IP  + +L NL A+++  NRL+G LP
Sbjct  188   LYGLRSLDLSGNSLSGDIPMGISRLYNLRAISLRGNRLSGGLP  230


 Score = 57.4 bits (137),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 46/138 (33%), Positives = 70/138 (51%), Gaps = 10/138 (7%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             ++L G+IP  I    +L  + L GN L+G +P  IG C  L  L LS N L+G +PET+ 
Sbjct  199   NSLSGDIPMGISRLYNLRAISLRGNRLSGGLPDDIGGCLLLKSLDLSENLLTGKLPETMR  258

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAG----------SIFQ  1493
              L     L L  N  SGE+   +G+++ L  +N+S N  +G++P               Q
Sbjct  259   KLSLCSYLSLGSNSFSGEVLTWVGEMKGLETLNLSSNGFSGQVPDSIGNLQLVKRLDFSQ  318

Query  1492  NLDSSAIEGNDGICSPLL  1439
             N  + ++  + GIC  LL
Sbjct  319   NNFTGSLPQSIGICKSLL  336


 Score = 54.7 bits (130),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 40/118 (34%), Positives = 62/118 (53%), Gaps = 0/118 (0%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G++PE + +      L L  NS +G +   +G    L  L+LS N  SG +P+++  L
Sbjct  249   LTGKLPETMRKLSLCSYLSLGSNSFSGEVLTWVGEMKGLETLNLSSNGFSGQVPDSIGNL  308

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGN  1463
             + +K L    N  +G +PQ +G  ++LL V+ S N LTG LP       L S ++ GN
Sbjct  309   QLVKRLDFSQNNFTGSLPQSIGICKSLLEVDFSQNSLTGDLPTWIFELGLQSISMSGN  366


 Score = 53.1 bits (126),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 42/106 (40%), Positives = 61/106 (58%), Gaps = 1/106 (1%)
 Frame = -1

Query  1819  ALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIP-ETLS  1643
             +L G+I   + +  SL  L L  N+ +G++ P +    SL+ + LS NNLSG+IP E   
Sbjct  79    SLSGKIGRGLLQLQSLRKLSLSKNNFSGSLNPNLSQLESLSSVDLSENNLSGSIPDEFFR  138

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAG  1505
               + L  + L  N  SGEIP  +G    L  +N+S NRL+GRLP+G
Sbjct  139   QCRSLSSISLANNAFSGEIPPSVGSCSTLAELNLSSNRLSGRLPSG  184



>ref|XP_006644919.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like, partial [Oryza brachyantha]
Length=858

 Score =   405 bits (1041),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 238/539 (44%), Positives = 347/539 (64%), Gaps = 22/539 (4%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             S L G +P +I  + +L  L++  NS TG IPPQIGNCSSL  L LSHNNL+G+IP T+ 
Sbjct  329   SHLDGSVPPEIGGAVALRELRVGRNSFTGHIPPQIGNCSSLVALDLSHNNLTGSIPRTVG  388

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGN  1463
              L  L+++ L  N+LSG +P +L  L +L   +VS+N L+G LP    F N+  + +  N
Sbjct  389   NLTSLQVVDLSKNKLSGTLPLELSNLPSLRIFDVSHNLLSGDLPNSRFFDNIPENFLTDN  448

Query  1462  DGICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRFLsvsai  1283
              G+CS      C    PKPIV+NP    N          ++   +  ++ HH+ + +S  
Sbjct  449   AGLCSSRKNNSCIAGMPKPIVLNPNSSTNP--------LSQSTPTAPSNMHHKKIILSVS  500

Query  1282  vaisaaaiiavgvmvITMVNASVRRRISFVENALESMCSS---TSSRSQGMATGKLILFD  1112
               I+ A    + + VI +   + R R +   +A  +  S    + S     ++GKL++F 
Sbjct  501   TLIAIAGGGTIIIGVIIISVLNRRARATTSRSAPATALSDDYLSQSPENDASSGKLVMFG  560

Query  1111  TKSSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDF  932
              K SP++ S+   ++LNK  E+G G FG VYK  L     + VAIKKLT S +++  +DF
Sbjct  561   -KGSPEF-SAGGHALLNKDCELGRGGFGAVYKTVL--RDGQPVAIKKLTVSSLVKSKDDF  616

Query  931   DREVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAV  752
             +R+V++L K RH N+V LRG+YWT  LQLL+ D++P GNL   LHE    M    L+W  
Sbjct  617   ERQVKLLSKVRHHNVVALRGFYWTSSLQLLIYDYLPGGNLHKHLHE---CMEDNSLSWME  673

Query  751   RFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVM  572
             RF II+G A+GL +LH   Q  IIHYN+K SN+LLD N  P+I D+GLA+L+  LDR+V+
Sbjct  674   RFDIIIGVARGLTYLH---QRGIIHYNLKSSNVLLDSNGEPRIGDYGLAKLLPMLDRYVL  730

Query  571   SNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVR  392
             S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE++TGRRPVEY ED+V++L D VR
Sbjct  731   SSKIQSALGYMAPEFACKTVKITEKCDVYGFGVLVLEVLTGRRPVEYLEDDVVVLCDLVR  790

Query  391   VLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTP  218
               LE+G + +C+D  + G +P EE LP++KL LVCTSQ+PS+RP M EVV IL+++++P
Sbjct  791   SALEEGRLEDCMDPRLCGEFPMEEALPIIKLGLVCTSQVPSNRPDMGEVVNILELVRSP  849


 Score = 54.7 bits (130),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 40/118 (34%), Positives = 59/118 (50%), Gaps = 0/118 (0%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L GEIP D+ ++  L  L    N  TG +P  +   S L  L +  N L+G +P  +  +
Sbjct  140   LAGEIPADVGQAALLKSLDFGRNLFTGGLPDSLRRLSGLRFLGVGGNALAGEVPAWIGEM  199

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGN  1463
               L+ L L  N+ SG IP  + K +NL+  ++S N LTG LP       L   ++ GN
Sbjct  200   WALERLDLSENRFSGAIPDSIAKCKNLVEADLSRNALTGELPWWVFGLPLQRVSVAGN  257



>ref|XP_010067617.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Eucalyptus grandis]
 gb|KCW65785.1| hypothetical protein EUGRSUZ_G03140 [Eucalyptus grandis]
Length=972

 Score =   408 bits (1048),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 256/543 (47%), Positives = 351/543 (65%), Gaps = 25/543 (5%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G IP +I ++ SL  L+L GN L G IP  I  CS+LT L LS NNL+G IP +LS L
Sbjct  449   LSGSIPSEIGDANSLKELRLGGNKLVGIIPDSIVKCSALTTLILSQNNLNGLIPASLSKL  508

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
               L+++ L  N  +G +P+QL  L +LL  N+S+N   G LP G  F  +  S++  N  
Sbjct  509   ANLQMVDLSFNNFTGTLPKQLANLPHLLLFNISHNHFQGELPLGGFFNTILPSSVSDNPA  568

Query  1456  ICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRF-Lsvsaiv  1280
             +C   +   C    PKPIV+          N++    ++ L +T    H R  LS+SA++
Sbjct  569   LCGAAVNKSCPAVLPKPIVL--------NPNSSSDSPSDSLPATPG--HKRIILSISALI  618

Query  1279  aisaaaiiavgvmvITMVNASVRRRISFVENALESMCSSTSSRS--QGMATGKLILFDTK  1106
             AI AAA+I +GV+ IT++N  VR   S    AL        S+S      +GKL++F   
Sbjct  619   AIGAAAVIVIGVIAITVLNLRVRASTSRSAAALALSAGDDFSQSPTTDANSGKLVMF--S  676

Query  1105  SSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDFDR  926
               PD+++ T  ++L+K  E+G G FG VY+  L     R VAIKKLT S +++  ++F++
Sbjct  677   GDPDFSTGT-HALLSKDCELGRGGFGAVYRTVL--RDGRAVAIKKLTVSSLVKSQDEFEK  733

Query  925   EVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAVRF  746
             EV+ LGK RH NLV L GYYWTP LQLL+S+FV  GNL   LHE         L+W  RF
Sbjct  734   EVKKLGKIRHSNLVALEGYYWTPSLQLLISEFVSGGNLYKHLHE---GSGGNLLSWNERF  790

Query  745   KIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVMSN  566
              IILGTA+GLAHLH   Q  IIHYNIK SNIL++ +  PK++DFGLARL+  LDR+V+S+
Sbjct  791   NIILGTARGLAHLH---QMNIIHYNIKSSNILIESSGEPKVADFGLARLLPMLDRYVLSS  847

Query  565   RFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRVL  386
             + Q+A+GY+APE AC+++++ EKCDVYGFG+L LEIVTG+RPVEY ED+V++L D VR  
Sbjct  848   KIQSALGYMAPEFACRTVKITEKCDVYGFGVLALEIVTGKRPVEYMEDDVVVLCDMVRGA  907

Query  385   LEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPVPN  209
             LE+G V EC+D  + G +P EE +PV+KL L+CTSQ+PS+RP MAEVV IL++I+ P   
Sbjct  908   LEEGRVEECIDGRLQGNFPSEEAIPVMKLGLICTSQVPSNRPDMAEVVNILELIRCPSEG  967

Query  208   RME  200
             + E
Sbjct  968   QDE  970


 Score = 54.3 bits (129),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 39/107 (36%), Positives = 61/107 (57%), Gaps = 1/107 (1%)
 Frame = -1

Query  1822  SALIGEIPEDIC-ESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETL  1646
             ++L G IP++   + GSL  + L  N  +G IP  +G+CS L  + LS N LSG  P+ +
Sbjct  129   NSLSGTIPDEFFRQCGSLRSVSLASNKFSGKIPETLGSCSMLASIDLSSNMLSGVSPDNI  188

Query  1645  SMLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAG  1505
               +  L+ L L  N L G IP+ +  ++NL  V++  NR +G +P G
Sbjct  189   WTVSGLRSLDLSDNLLEGGIPEGIAGMKNLRGVSLRKNRFSGLIPDG  235



>ref|XP_003557968.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Brachypodium distachyon]
Length=970

 Score =   407 bits (1047),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 253/540 (47%), Positives = 357/540 (66%), Gaps = 30/540 (6%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G IP  I    SL +L+L  NSL G IP QIG+CS+L  L LSHN L+G IP T++ L
Sbjct  445   LNGRIPATI-GGKSLKVLRLGKNSLAGEIPVQIGDCSALASLDLSHNGLTGAIPATIANL  503

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
               L+   L  N+L+G +P+QL  L +L+  NVS+N+L+G LP GS F  +  S++  N G
Sbjct  504   TNLQTADLSRNKLTGGLPKQLSNLAHLIRFNVSHNQLSGDLPPGSFFDTIPFSSVSDNPG  563

Query  1456  ICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTR----NSRHHR-FLsv  1292
             +C   L   C    PKPIV+NP    N            PLA T       RH +  LS+
Sbjct  564   LCGSKLNSSCPGVLPKPIVLNPDSSSN------------PLAQTEPVLEGLRHKKTILSI  611

Query  1291  saivaisaaaiiavgvmvITMVNASVRRRISFVENALE-SMCSSTSSRSQGMATGKLILF  1115
             SA+VAI AA +IAVG++ IT++N  VR   S     LE S    + S +  +  GKL++F
Sbjct  612   SALVAIGAAVLIAVGIITITVLNLRVRSPASHSAPVLELSDGYLSQSPTTDVNAGKLVMF  671

Query  1114  DTKSSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPED  935
                +S ++++ST  ++LNK  E+G G FGTVYK  L     + VAIKKLT S +++  ++
Sbjct  672   GGGNS-EFSAST-HALLNKDCELGRGGFGTVYKTTL--RDGQPVAIKKLTVSSLVKSQDE  727

Query  934   FDREVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWA  755
             F+REV++LGK RH NLV L+GYYWTP LQLL+ +FV  GNL   LHE++       L+W 
Sbjct  728   FEREVKMLGKLRHHNLVALKGYYWTPSLQLLIYEFVSGGNLHKLLHELSTVSC---LSWK  784

Query  754   VRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHV  575
              RF I+LG A+ LAHLH   +  IIHYN+K SNI+L+ +   K+ D+GLA+L+  LDR+V
Sbjct  785   ERFDIVLGIARSLAHLH---RHDIIHYNLKSSNIMLNGSGEAKVGDYGLAKLLPMLDRYV  841

Query  574   MSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHV  395
             +S++ Q+A+GY+APE  C+++++ +KCDVYGFG+L+LE++TG+ PVEY ED+V++L D V
Sbjct  842   LSSKVQSALGYMAPEFTCRTVKITDKCDVYGFGVLVLEVMTGKTPVEYMEDDVIVLCDVV  901

Query  394   RVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTP  218
             R  L++G V ECVD+ + G +P EE +P++KL LVCTSQ+PS+RP M+EVV IL++I+ P
Sbjct  902   RAALDEGKVEECVDERLCGKFPLEEAVPIMKLGLVCTSQVPSNRPDMSEVVNILELIRCP  961


 Score = 67.8 bits (164),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 45/105 (43%), Positives = 65/105 (62%), Gaps = 0/105 (0%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             ++L G +PE +    S   L L  N LTGT+P  IG  +SL +L LS N  SG IPE++ 
Sbjct  252   NSLSGNLPESLRRLSSCTDLDLSSNELTGTVPTWIGEMASLEMLDLSGNKFSGEIPESIG  311

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPA  1508
              L  L+ L+L  N  +G +P+ +G+  +L+ V+VS+N LTG LPA
Sbjct  312   GLMSLRELRLSGNGFTGGLPESIGRCRSLVHVDVSWNSLTGSLPA  356


 Score = 61.6 bits (148),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 37/104 (36%), Positives = 64/104 (62%), Gaps = 0/104 (0%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             +A+ G++P  I +  +L  L L  N LTG++P  IG+C  L  ++L  N+LSG +PE+L 
Sbjct  204   NAITGDLPVGISKMFNLRALNLRSNRLTGSLPDDIGDCPLLRSVNLRSNSLSGNLPESLR  263

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP  1511
              L     L L  N+L+G +P  +G++ +L  +++S N+ +G +P
Sbjct  264   RLSSCTDLDLSSNELTGTVPTWIGEMASLEMLDLSGNKFSGEIP  307


 Score = 55.1 bits (131),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 39/124 (31%), Positives = 62/124 (50%), Gaps = 24/124 (19%)
 Frame = -1

Query  1810  GEIPEDICESGSLGILQLDGNSLTGTIP------------------------PQIGNCss  1703
             G++P D+     L  L L  N+ +G +P                        P +G C++
Sbjct  112   GDLPADLARLPDLQSLDLSSNAFSGAVPDGFFGKCHSLRDVSLANNAFSGGIPDVGGCAT  171

Query  1702  ltllslshnnlSGTIPETLSMLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLT  1523
             L  L++S N L+GT+P  +  L  L+ L L  N ++G++P  + K+ NL A+N+  NRLT
Sbjct  172   LASLNMSSNRLAGTLPGGIWSLNALRTLDLSGNAITGDLPVGISKMFNLRALNLRSNRLT  231

Query  1522  GRLP  1511
             G LP
Sbjct  232   GSLP  235



>ref|XP_009349085.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Pyrus x bretschneideri]
Length=952

 Score =   407 bits (1045),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 246/547 (45%), Positives = 337/547 (62%), Gaps = 27/547 (5%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             ++L G IP  I +   L  L L  N L GTIP  I NCSSLT L +S N L+G IP  +S
Sbjct  426   NSLAGPIPVAIGDLKVLDNLDLSENRLNGTIPTSIENCSSLTTLIVSQNRLTGPIPAAMS  485

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGN  1463
              L  L+ + L  N L+G +P+QL  L NLL+  +S+N L G LPAG+ F  +  S++ GN
Sbjct  486   KLTNLQNVDLSFNSLTGGLPKQLANLPNLLSFKISHNNLQGELPAGAFFNTISPSSVSGN  545

Query  1462  DGICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRFLsvsai  1283
               +C   +   C    PKPIV+NP    + +              + N  H R L   + 
Sbjct  546   PSLCGSAVNKSCPGVLPKPIVLNPNSSSDSSTGEI----------SSNLGHRRILLSISS  595

Query  1282  vaisaaaiiavgvmvI-TMVNASVRRRISFVENALESMCSSTSSRSQGMAT----GKLIL  1118
             +   AAA + V  ++  T++N  VR   S  + A     S     S    T    GKL++
Sbjct  596   LIAIAAAAVIVIGVIAITVLNLRVRSSSSTTQPAAALAFSGGDDFSHSPTTDGNSGKLVM  655

Query  1117  FDTKSSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPE  938
             F  +  PD+++S   ++LNK  E+G G FG VY+  L     R VAIKKLT S +++   
Sbjct  656   FSGE--PDFSTSA-HALLNKDCELGRGGFGAVYRTVL--RDGRPVAIKKLTVSSLVKSQA  710

Query  937   DFDREVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTW  758
             +F+REV+ LGK RH NLV + GYYWTP LQL++ ++V  G+L   LH+ A       L+W
Sbjct  711   EFEREVKKLGKVRHDNLVEIEGYYWTPSLQLIIYEYVAGGSLYKHLHDGAGGNF---LSW  767

Query  757   AVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRH  578
               RF IILGTAK LAHLH   Q  IIHYNIK SN+L+  +  PK+ DFGLARL+  LDR+
Sbjct  768   NDRFNIILGTAKSLAHLH---QMNIIHYNIKSSNVLIGSSGEPKVGDFGLARLLPMLDRY  824

Query  577   VMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDH  398
             V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LEIVTG+RPVEY ED+V++L D 
Sbjct  825   VLSSKIQSALGYMAPEFACKTVKITEKCDVYGFGILVLEIVTGKRPVEYMEDDVVVLCDM  884

Query  397   VRVLLEQGNVLECVDQGMGG-YPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKT  221
             VR  LE+G V ECVD  + G +P EE +PV+KL L+CTSQ+PS+RP M EVV IL++I+ 
Sbjct  885   VREALEEGRVEECVDARLQGIFPAEEAIPVMKLGLICTSQVPSNRPDMGEVVNILELIRC  944

Query  220   PVPNRME  200
             P   + E
Sbjct  945   PSEGQEE  951


 Score = 60.1 bits (144),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 38/103 (37%), Positives = 62/103 (60%), Gaps = 1/103 (1%)
 Frame = -1

Query  1810  GEIPEDIC-ESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSMLK  1634
             G++PE+   + GSL ++ L  N  +G +P  +G+C SL  ++LS N  SG++P  +  L 
Sbjct  137   GDVPEEFFRQCGSLRVISLAKNKFSGKLPESLGSCPSLASVNLSLNQFSGSVPAGVWSLS  196

Query  1633  RLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAG  1505
              ++ L L  N L G IP+ +  L NL  +N++ NR TG++P G
Sbjct  197   GIRSLDLSDNLLEGGIPKGVEGLNNLRGINLARNRFTGQVPDG  239


 Score = 55.5 bits (132),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 40/112 (36%), Positives = 63/112 (56%), Gaps = 2/112 (2%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G IP+ +    +L  + L  N  TG +P  IGN   L  + LS N+ SG +P+T+  L
Sbjct  208   LEGGIPKGVEGLNNLRGINLARNRFTGQVPDGIGNWLLLRSIDLSENSFSGNLPQTMQKL  267

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDS  1481
                  L L  N  SGE+P+ +G++++L  +++S NR +G +P  S   NL+S
Sbjct  268   GLCSYLNLHQNTFSGEVPEWIGEMKSLETLDLSSNRFSGEVP--SSIGNLES  317


 Score = 54.7 bits (130),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 53/100 (53%), Gaps = 0/100 (0%)
 Frame = -1

Query  1810  GEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSMLKR  1631
             G +P+ + + G    L L  N+ +G +P  IG   SL  L LS N  SG +P ++  L+ 
Sbjct  258   GNLPQTMQKLGLCSYLNLHQNTFSGEVPEWIGEMKSLETLDLSSNRFSGEVPSSIGNLES  317

Query  1630  LKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP  1511
             LK+L    N  +G +P+ L    NLL ++ S N + G LP
Sbjct  318   LKVLNFSANGFTGSLPKSLSYCTNLLGLDFSKNSMAGELP  357



>ref|XP_008681357.1| PREDICTED: uncharacterized protein LOC100304322 isoform X1 [Zea 
mays]
 tpg|DAA45233.1| TPA: putative leucine-rich repeat receptor-like protein kinase 
family protein [Zea mays]
Length=972

 Score =   407 bits (1046),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 260/528 (49%), Positives = 354/528 (67%), Gaps = 30/528 (6%)
 Frame = -1

Query  1777  SLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSMLKRLKILKLEVNQL  1598
             SL  L+L  N LTG IP QIGNCS+L  L LSHN+L+G IPE LS L  L+I+ L  N+L
Sbjct  458   SLKELRLGKNFLTGNIPAQIGNCSALASLDLSHNSLTGVIPEALSNLTNLEIVDLSQNKL  517

Query  1597  SGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDGICSPLLTGPCKMN  1418
             +G +P+QL  L +LL  NVS+N+L+G LP GS F  +  S +  N G+C   L   C   
Sbjct  518   TGVLPKQLSNLPHLLQFNVSHNQLSGDLPPGSFFDTIPLSCVSDNPGLCGAKLNSSCPGV  577

Query  1417  APKPIVINPFVYGNQTdnnnggdnNEPLASTR----NSRHHR--FLsvsaivaisaaaii  1256
              PKPIV+NP              +++P++ T       RHH+   LS+SA+VAI AA +I
Sbjct  578   LPKPIVLNP------------NTSSDPISPTELVPDGGRHHKKTILSISALVAIGAAVLI  625

Query  1255  avgvmvITMVNASVRRRISFVENALE-SMCSSTSSRSQGMATGKLILFDTKSSPDWASST  1079
             AVGV+ IT++N  VR   S     LE S    + S +  M  GKL++F    +P++++ST
Sbjct  626   AVGVITITVLNLRVRAPGSHSGAVLELSDGYLSQSPTTDMNAGKLVMFG-GGNPEFSAST  684

Query  1078  FESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDFDREVRVLGKAR  899
               ++LNK  E+G G FGTVYK  L     + VAIKKLT S +++   +F+REV++LGK R
Sbjct  685   -HALLNKDCELGRGGFGTVYKTTL--RDGQPVAIKKLTVSSLVKSQVEFEREVKMLGKLR  741

Query  898   HQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAVRFKIILGTAKG  719
             H+NLV L+GYYWTP LQLL+ +FV  GNL  +LHE +     P   W  RF I+LG A+ 
Sbjct  742   HRNLVALKGYYWTPSLQLLIYEFVSGGNLHKQLHESSTTNCLP---WKERFDIVLGIARS  798

Query  718   LAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVMSNRFQAAIGYV  539
             LAHLH      IIHYN+K SNILLD +   K+ D+GLA+L+  LDR+V+S++ Q+A+GY+
Sbjct  799   LAHLHRH---DIIHYNLKSSNILLDGSGEAKVGDYGLAKLLPMLDRYVLSSKVQSALGYM  855

Query  538   APELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRVLLEQGNVLEC  359
             APE AC+++++ EKCDVYGFG+LILEI+TGR PVEY ED+V++L D VR  L++G V EC
Sbjct  856   APEFACRTVKITEKCDVYGFGVLILEILTGRTPVEYMEDDVVVLCDVVRAALDEGKVEEC  915

Query  358   VDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTP  218
             VD+ + G +P EE +P++KL LVCTSQ+PS+RP M EVV IL++I+ P
Sbjct  916   VDERLCGKFPLEEAVPIMKLGLVCTSQVPSNRPDMGEVVNILELIRCP  963


 Score = 63.9 bits (154),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 41/108 (38%), Positives = 65/108 (60%), Gaps = 1/108 (1%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             +A+ G++P  +    +L  L L GN LTG++P  IG+C  L  + L  N+LSG +PE+L 
Sbjct  205   NAVTGDLPIGVSRMFNLRELNLRGNRLTGSLPDDIGDCPLLRSVDLGSNSLSGNLPESLR  264

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSI  1499
              L     L L  N+ +G +P   G++ +L  +++S NRL+G +P GSI
Sbjct  265   RLSTCTYLDLSSNEFTGSVPTWFGEMTSLEMLDLSGNRLSGEIP-GSI  311


 Score = 58.5 bits (140),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 62/104 (60%), Gaps = 0/104 (0%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             ++L G +PE +    +   L L  N  TG++P   G  +SL +L LS N LSG IP ++ 
Sbjct  253   NSLSGNLPESLRRLSTCTYLDLSSNEFTGSVPTWFGEMTSLEMLDLSGNRLSGEIPGSIG  312

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP  1511
              L  L+ L+L  N  +G +P+ +G  ++L+ V+VS+N LTG LP
Sbjct  313   ELMSLRELRLSGNGFTGALPESIGGCKSLMHVDVSWNSLTGALP  356


 Score = 52.8 bits (125),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 62/120 (52%), Gaps = 2/120 (2%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQI-GNCssltllslshnnlSGTIPETLSM  1640
             L G++P D+    +L  L L  N+  G +P  + G C SL  +SL++N  SG IP  ++ 
Sbjct  110   LSGDVPADLARLPALQTLDLSANAFAGAVPEGLFGRCRSLRDVSLANNAFSGGIPRDVAA  169

Query  1639  LKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAG-SIFQNLDSSAIEGN  1463
                L  L L  N+L G +P  +  L  L  +++S N +TG LP G S   NL    + GN
Sbjct  170   CATLASLNLSSNRLDGALPSDIWSLNALRTLDISGNAVTGDLPIGVSRMFNLRELNLRGN  229



>ref|XP_009614707.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Nicotiana tomentosiformis]
Length=980

 Score =   407 bits (1046),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 245/539 (45%), Positives = 354/539 (66%), Gaps = 30/539 (6%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G IP +I  + SL  L+L  N L+GTIP  I NCS+LT L LSHNNL+G IP  ++ L
Sbjct  458   LNGSIPHEIGSAVSLLELKLRENHLSGTIPADIANCSALTSLDLSHNNLTGPIPPEIAKL  517

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
               L+++    NQ+SG +P++L  L +L+  NVS+N L G LP G  F  +  S++ GN  
Sbjct  518   TILEVVDFSFNQISGSLPKELTNLSHLVTFNVSHNHLKGELPVGGFFNTISPSSVVGNPS  577

Query  1456  ICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNS--RHHRFLsvsai  1283
             +C  +L   C    PKP+V+NP             ++++    + NS  R    LS+S++
Sbjct  578   LCGSVLNHSCPAVHPKPLVLNP-------------NSSDSSHGSVNSLGRKRIMLSISSL  624

Query  1282  vaisaaaiiavgvmvITMVNASVRRRISFVENALESMCSSTSSRSQGMAT--GKLILFDT  1109
             +AI AA  IA+GV+V++++N  VR  ++              S S G     GKL++F  
Sbjct  625   IAIGAAVFIALGVVVVSILNLHVRSSMALSAATFTLSGGDDYSHSHGTEANLGKLVMFSG  684

Query  1108  KSSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDFD  929
              +  D+ + T +++LNK +E+G G FG VYK  LG    R VAIKKL  + +++  EDF+
Sbjct  685   DA--DFVAGT-QALLNKGNELGRGGFGAVYKTELGD--GRSVAIKKLNITSLIKSQEDFE  739

Query  928   REVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAVR  749
              E++ LG  RHQNLV L GYYWTP LQLL++++V  G+L   LHE +   +   L+W  R
Sbjct  740   SEMKSLGSIRHQNLVALEGYYWTPPLQLLINEYVSGGSLYKLLHEES---SKSSLSWQQR  796

Query  748   FKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDE-NLNPKISDFGLARLVAKLDRHVM  572
             F IIL TAKGLA+LH   Q  IIHYN+K +N+L+D+ + N K+ DFGLARL+  LDR+++
Sbjct  797   FNIILDTAKGLAYLH---QLSIIHYNMKSTNVLIDDASANAKVGDFGLARLLPVLDRYIL  853

Query  571   SNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVR  392
             S++ Q+A+GY+APE ACQ++++ EKCDVYGFG+LILE+VTG+RPVEY ED+V++L D VR
Sbjct  854   SSKIQSALGYMAPEFACQTVKITEKCDVYGFGILILEVVTGKRPVEYMEDDVVVLCDMVR  913

Query  391   VLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTP  218
               LE+G + EC+DQ + G +P EE +PV+KL L+C SQ+PS+RP M EV++IL++I+ P
Sbjct  914   GALEEGRIEECIDQRLQGNFPVEEAIPVVKLGLICASQVPSNRPDMEEVIKILELIRCP  972


 Score = 61.6 bits (148),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 40/103 (39%), Positives = 60/103 (58%), Gaps = 0/103 (0%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L GEIP+ I    SL  + L  N  TG +P  IGNC  L  + LS N LSG +PE++  L
Sbjct  215   LEGEIPKSIEGLYSLRSITLQKNKFTGWLPENIGNCVQLKSIDLSENLLSGGLPESMRRL  274

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPA  1508
                  + L  N  +GEIP  + ++++L  +++S N L+GR+P+
Sbjct  275   GLCTTMDLRSNSFNGEIPDWIAEMKSLQVLDLSANNLSGRIPS  317


 Score = 58.2 bits (139),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 56/90 (62%), Gaps = 0/90 (0%)
 Frame = -1

Query  1777  SLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSMLKRLKILKLEVNQL  1598
             SL +L L  N+L+G IP  I N  SL ++++S N L+G IPE +  L   ++L L  NQL
Sbjct  399   SLQVLDLSSNALSGEIPSAIWNIISLQVMNISRNFLTGIIPEAVGKLNATRVLDLSHNQL  458

Query  1597  SGEIPQQLGKLENLLAVNVSYNRLTGRLPA  1508
             +G IP ++G   +LL + +  N L+G +PA
Sbjct  459   NGSIPHEIGSAVSLLELKLRENHLSGTIPA  488


 Score = 54.3 bits (129),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 46/118 (39%), Positives = 63/118 (53%), Gaps = 0/118 (0%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G +PE +   G    + L  NS  G IP  I    SL +L LS NNLSG IP ++  L
Sbjct  263   LSGGLPESMRRLGLCTTMDLRSNSFNGEIPDWIAEMKSLQVLDLSANNLSGRIPSSMGDL  322

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGN  1463
               L  L L  N L G +P+ L K  NL+ +++ +N LTG LP+ +    L S ++ GN
Sbjct  323   PLLMQLNLSNNLLVGSLPRSLMKCINLVILDIGHNFLTGNLPSWAFTLGLKSISLSGN  380



>ref|XP_009362809.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Pyrus x bretschneideri]
Length=952

 Score =   406 bits (1044),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 246/547 (45%), Positives = 337/547 (62%), Gaps = 27/547 (5%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             ++L G IP  I +   L  L L  N L GTIP  I NCSSLT L +S N L+G IP  +S
Sbjct  426   NSLAGPIPVAIGDLKVLDNLDLSENRLNGTIPTSIENCSSLTTLIVSQNRLTGPIPAAMS  485

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGN  1463
              L  L+ + L  N L+G +P+QL  L NLL+  +S+N L G LPAG+ F  +  S++ GN
Sbjct  486   KLTNLQNVDLSFNSLTGGLPKQLANLPNLLSFKISHNNLQGELPAGAFFNTISPSSVSGN  545

Query  1462  DGICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRFLsvsai  1283
               +C   +   C    PKPIV+NP    + +              + N  H R L   + 
Sbjct  546   PSLCGSAVNKSCPGVLPKPIVLNPNSSSDSSTGEI----------SSNLGHRRILLSISS  595

Query  1282  vaisaaaiiavgvmvI-TMVNASVRRRISFVENALESMCSSTSSRSQGMAT----GKLIL  1118
             +   AAA + V  ++  T++N  VR   S  + A     S     S    T    GKL++
Sbjct  596   LIAIAAAAVIVIGVIAITVLNLRVRSSSSTTQPAAALAFSGGDDFSHSPTTDGNSGKLVM  655

Query  1117  FDTKSSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPE  938
             F  +  PD+++S   ++LNK  E+G G FG VY+  L     R VAIKKLT S +++   
Sbjct  656   FSGE--PDFSTSA-HALLNKDCELGRGGFGAVYRTVL--RDGRPVAIKKLTVSSLVKSQG  710

Query  937   DFDREVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTW  758
             +F+REV+ LGK RH NLV + GYYWTP LQL++ ++V  G+L   LH+ A       L+W
Sbjct  711   EFEREVKKLGKVRHDNLVEIEGYYWTPSLQLIIYEYVAGGSLYKHLHDGAGGNF---LSW  767

Query  757   AVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRH  578
               RF IILGTAK LAHLH   Q  IIHYNIK SN+L+  +  PK+ DFGLARL+  LDR+
Sbjct  768   NDRFNIILGTAKSLAHLH---QMNIIHYNIKSSNVLIGSSGEPKVGDFGLARLLPMLDRY  824

Query  577   VMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDH  398
             V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LEIVTG+RPVEY ED+V++L D 
Sbjct  825   VLSSKIQSALGYMAPEFACKTVKITEKCDVYGFGILVLEIVTGKRPVEYMEDDVVVLCDM  884

Query  397   VRVLLEQGNVLECVDQGMGG-YPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKT  221
             VR  LE+G V ECVD  + G +P EE +PV+KL L+CTSQ+PS+RP M EVV IL++I+ 
Sbjct  885   VREALEEGRVEECVDARLQGIFPAEEAIPVMKLGLICTSQVPSNRPDMGEVVNILELIRC  944

Query  220   PVPNRME  200
             P   + E
Sbjct  945   PSEGQEE  951


 Score = 60.1 bits (144),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 38/103 (37%), Positives = 62/103 (60%), Gaps = 1/103 (1%)
 Frame = -1

Query  1810  GEIPEDIC-ESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSMLK  1634
             G++PE+   + GSL ++ L  N  +G +P  +G+C SL  ++LS N  SG++P  +  L 
Sbjct  137   GDVPEEFFRQCGSLRVISLAKNKFSGKLPESLGSCPSLASVNLSLNQFSGSVPAGVWSLS  196

Query  1633  RLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAG  1505
              ++ L L  N L G IP+ +  L NL  +N++ NR TG++P G
Sbjct  197   GIRSLDLSDNLLEGGIPKGVEGLNNLRGINLARNRFTGQVPDG  239


 Score = 55.5 bits (132),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 40/112 (36%), Positives = 63/112 (56%), Gaps = 2/112 (2%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G IP+ +    +L  + L  N  TG +P  IGN   L  + LS N+ SG +P+T+  L
Sbjct  208   LEGGIPKGVEGLNNLRGINLARNRFTGQVPDGIGNWLLLRSIDLSENSFSGNLPQTMQKL  267

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDS  1481
                  L L  N  SGE+P+ +G++++L  +++S NR +G +P  S   NL+S
Sbjct  268   GLCSYLNLHQNTFSGEVPEWIGEMKSLETLDLSSNRFSGEVP--SSIGNLES  317


 Score = 54.7 bits (130),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 53/100 (53%), Gaps = 0/100 (0%)
 Frame = -1

Query  1810  GEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSMLKR  1631
             G +P+ + + G    L L  N+ +G +P  IG   SL  L LS N  SG +P ++  L+ 
Sbjct  258   GNLPQTMQKLGLCSYLNLHQNTFSGEVPEWIGEMKSLETLDLSSNRFSGEVPSSIGNLES  317

Query  1630  LKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP  1511
             LK+L    N  +G +P+ L    NLL ++ S N + G LP
Sbjct  318   LKVLNFSANGFTGSLPKSLSYCTNLLGLDFSKNSMAGELP  357



>ref|XP_004308984.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Fragaria vesca subsp. vesca]
Length=969

 Score =   406 bits (1043),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 248/543 (46%), Positives = 343/543 (63%), Gaps = 25/543 (5%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G IP +I  + +L  L+L+ N LTG IP  I NCSSLT L +S N L G IP  +  L
Sbjct  446   LSGSIPPEIGGAYALKELRLEKNFLTGKIPTSIENCSSLTTLIVSQNKLFGPIPAAVGKL  505

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
               L+ + L  N LSG +P+QL  L N+++ N+S+N L G LP+G  F  +  S++  N  
Sbjct  506   SNLQYVDLSFNNLSGALPKQLANLPNIVSFNISHNNLQGELPSGGFFNTISPSSVLANPS  565

Query  1456  ICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRF-Lsvsaiv  1280
             +C   +   C    PKPIV+NP    + +            A      H R  LS+SA++
Sbjct  566   LCGSAVNKSCPAVLPKPIVLNPNSSSDSSTG----------ALPSKFGHKRIILSISALI  615

Query  1279  aisaaaiiavgvmvITMVNASVRRRISFVENALESMCSSTSSRS--QGMATGKLILFDTK  1106
             AI AAA I +GV+ IT++N  VR   S    A+        S S      +GKL++F   
Sbjct  616   AIGAAAFIVIGVIAITVLNLRVRTSTSRPPAAITFSGGDDFSNSPTTDANSGKLVMF--S  673

Query  1105  SSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDFDR  926
               PD+++    ++LNK  E+G G FG VY+  L     R VAIKKLT S +++  E+F+R
Sbjct  674   GDPDFSTGA-HALLNKDCELGRGGFGAVYRTVL--RDGRSVAIKKLTVSSLVKSQEEFER  730

Query  925   EVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAVRF  746
             EV+ LGK RH NLV + GYYWTP LQL++ ++V  G+L   LH+ A       L+W  RF
Sbjct  731   EVKKLGKVRHDNLVEIEGYYWTPSLQLIIYEYVSGGSLYKHLHDSAGGNF---LSWNDRF  787

Query  745   KIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVMSN  566
              IILGTAK LAHLH   Q  IIHYNIK SN+L+ ++  PK+ DFGLARL+  LDR+V+S+
Sbjct  788   NIILGTAKSLAHLH---QMNIIHYNIKSSNVLISDSGEPKVGDFGLARLLPMLDRYVLSS  844

Query  565   RFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRVL  386
             + Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE+VTG+RPVEY ED+V++L D VR  
Sbjct  845   KIQSALGYMAPEFACKTVKITEKCDVYGFGVLVLEVVTGKRPVEYMEDDVVVLCDMVRGA  904

Query  385   LEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPVPN  209
             LE+G V EC+D  + G +P EE +PV+KL L+CTSQ+PS+RP M EVV IL++I+ P   
Sbjct  905   LEEGRVEECIDSRLQGSFPAEEAIPVMKLGLICTSQVPSNRPDMGEVVNILELIRCPSEG  964

Query  208   RME  200
             + E
Sbjct  965   QEE  967


 Score = 62.0 bits (149),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 39/103 (38%), Positives = 59/103 (57%), Gaps = 1/103 (1%)
 Frame = -1

Query  1810  GEIPEDIC-ESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSMLK  1634
             G +PE+   + GSL ++ L GN  +G IP  +G C+ L  + LS N  SG +P  +  L 
Sbjct  132   GSVPEEFFRQCGSLRVVSLAGNKFSGKIPESLGGCAGLATIDLSLNQFSGEVPAGVWSLN  191

Query  1633  RLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAG  1505
              ++ L L  N L GEIP+ +  L NL A+N+  N+ +G +P G
Sbjct  192   GIRSLDLSGNLLEGEIPEAIEGLNNLRAINLGRNQFSGLVPDG  234


 Score = 60.8 bits (146),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 38/103 (37%), Positives = 61/103 (59%), Gaps = 0/103 (0%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L GEIPE I    +L  + L  N  +G +P  IG+C  L  + LS N  SG +P T+  L
Sbjct  203   LEGEIPEAIEGLNNLRAINLGRNQFSGLVPDGIGSCLLLRSVDLSENGFSGNLPRTMRGL  262

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPA  1508
                  L ++ N LSGE+P+ +G++++L  +++S NR +G +P+
Sbjct  263   GLCGALNVQKNSLSGELPEWIGEMKSLETLDISSNRFSGEVPS  305


 Score = 53.1 bits (126),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 38/100 (38%), Positives = 53/100 (53%), Gaps = 0/100 (0%)
 Frame = -1

Query  1810  GEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSMLKR  1631
             G +P  +   G  G L +  NSL+G +P  IG   SL  L +S N  SG +P +L  L  
Sbjct  253   GNLPRTMRGLGLCGALNVQKNSLSGELPEWIGEMKSLETLDISSNRFSGEVPSSLGNLGA  312

Query  1630  LKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP  1511
             LK+L    N  +G +P+ L    +LLA++ S N L G LP
Sbjct  313   LKVLNFSGNGFAGSLPKSLVNCTSLLALDFSKNSLEGDLP  352



>ref|XP_010103654.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Morus notabilis]
 gb|EXB96537.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Morus notabilis]
Length=978

 Score =   406 bits (1044),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 255/543 (47%), Positives = 344/543 (63%), Gaps = 25/543 (5%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G IPE+I  + SL  L+L+ N L G IP  I NCSSLT L LS N LSG IP  ++ L
Sbjct  453   LNGSIPEEIGGAVSLKELRLEENKLEGKIPTSIENCSSLTTLVLSLNKLSGPIPAAIAKL  512

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
               L+ + L  N L+G + +QL  L NL++ N+S+N L G LPAG  F  +   ++ GN  
Sbjct  513   VNLQNVDLSFNNLTGGLRKQLANLPNLISFNISHNNLQGELPAGGFFNTISPYSVSGNPS  572

Query  1456  ICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRF-Lsvsaiv  1280
             +C   +   C    PKPIV+NP    + T          P +   N  H R  LS+SA++
Sbjct  573   LCGSAVNKSCPAVLPKPIVLNPNSSSDAT----------PGSLPSNVGHKRIILSISALI  622

Query  1279  aisaaaiiavgvmvITMVNASVRRRISFVENALESMCSSTSSRSQGMAT--GKLILFDTK  1106
             AI AAA+I +GV+ IT++N  VR   S    AL        S S    T  GKL++F   
Sbjct  623   AIGAAAVIVIGVIAITVLNLHVRTFASRSAAALTFSGGDDFSHSPTTDTNSGKLVMF--S  680

Query  1105  SSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDFDR  926
               PD+++    ++LNK  E+G G FG VY+  L       VAIKKLT S +++   +F+R
Sbjct  681   GDPDFSTGA-HALLNKDCELGRGGFGAVYRTVL--RDGNPVAIKKLTVSSLVKSQGEFER  737

Query  925   EVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAVRF  746
             EV+ LGK RHQNLV L GYYWTP LQLL+ +FV  G+L   LHE         L+W  RF
Sbjct  738   EVKKLGKVRHQNLVALEGYYWTPSLQLLIYEFVTGGSLHKHLHE---GSGGNFLSWNERF  794

Query  745   KIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVMSN  566
              IILGTAK LA+LH   Q  IIHYNIK SN+L+D +  PK+ D+GLARL+  LDR+V+S+
Sbjct  795   NIILGTAKSLAYLH---QHNIIHYNIKSSNVLIDSSGEPKVGDYGLARLLPMLDRYVLSS  851

Query  565   RFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRVL  386
             + Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE+VTG+ PVEY ED+V++L D VR  
Sbjct  852   KIQSALGYMAPEFACKTVKITEKCDVYGFGVLVLEVVTGKMPVEYMEDDVVVLCDMVRGA  911

Query  385   LEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPVPN  209
             LE+G V ECVD  + G +P EE +P +KL L+CTSQ+PS+RP M EVV IL++I+ P  +
Sbjct  912   LEEGRVEECVDARLHGKFPAEEAIPAMKLGLICTSQVPSNRPDMGEVVNILELIRCPSED  971

Query  208   RME  200
             + E
Sbjct  972   QEE  974


 Score = 67.8 bits (164),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 39/103 (38%), Positives = 64/103 (62%), Gaps = 0/103 (0%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L GEIP+ I    +L  + L  N L+GT+P  IG+C  L  + L  N+ SG++PET+  L
Sbjct  209   LEGEIPKAIQGLNNLRTINLGKNRLSGTVPDGIGSCLLLRFIDLGENSFSGSLPETMQKL  268

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPA  1508
                  L L  N  +GE+PQ +G+++NL  +++S N+ +G++P+
Sbjct  269   SLCNYLNLHGNSFAGEVPQWIGEMKNLETLDLSANKFSGQVPS  311


 Score = 64.7 bits (156),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 42/103 (41%), Positives = 62/103 (60%), Gaps = 1/103 (1%)
 Frame = -1

Query  1810  GEIPEDIC-ESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSMLK  1634
             G+IPED   + GSL +L L  N  +G IP  + +CS++  + LS N LSG++P  +  L 
Sbjct  138   GDIPEDFFRQCGSLRVLSLAKNKFSGKIPDSLSSCSTIASIDLSSNRLSGSLPSGIWSLN  197

Query  1633  RLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAG  1505
              ++ L L  N L GEIP+ +  L NL  +N+  NRL+G +P G
Sbjct  198   GIRSLDLSDNFLEGEIPKAIQGLNNLRTINLGKNRLSGTVPDG  240


 Score = 60.1 bits (144),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 54/100 (54%), Gaps = 0/100 (0%)
 Frame = -1

Query  1810  GEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSMLKR  1631
             G +PE + +      L L GNS  G +P  IG   +L  L LS N  SG +P +L  L+ 
Sbjct  259   GSLPETMQKLSLCNYLNLHGNSFAGEVPQWIGEMKNLETLDLSANKFSGQVPSSLGNLQS  318

Query  1630  LKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP  1511
             LK+L    N L+G +P+ L    NLL ++ S N +TG LP
Sbjct  319   LKVLNFYANGLTGSLPKSLASCTNLLTLDFSQNLMTGDLP  358



>ref|XP_010922754.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Elaeis guineensis]
Length=968

 Score =   406 bits (1043),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 266/538 (49%), Positives = 358/538 (67%), Gaps = 21/538 (4%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G IP +I E+ SL  L L  NSLTG IP QIGNCSSLT L LS NNL+G IP TL+ L
Sbjct  440   LNGSIPLEIGEAVSLNELNLHKNSLTGGIPTQIGNCSSLTSLILSQNNLTGPIPPTLANL  499

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
               L+ + L  N+L+G +P+QL  L +LL+ N+S+N  +G LPAG+ F  +  S+I  N G
Sbjct  500   TNLQTIDLSHNRLTGTLPKQLSNLPHLLSFNISHNLFSGDLPAGNFFDTIPPSSISDNPG  559

Query  1456  ICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRF-Lsvsaiv  1280
             +C  ++   C    PKPIV+NP        +N+         S    RH +  LS+S ++
Sbjct  560   LCGSVVNRSCPAVLPKPIVLNPNSSSPNPSSNSAF-------SPGKLRHKKIILSISTLI  612

Query  1279  aisaaaiiavgvmvITMVNASVRRRISFVENALESMCSSTSSRSQGMA--TGKLILFDTK  1106
             AI AAA+I +GV  IT++N  VR   +    A   +     S S G    +GKL++F + 
Sbjct  613   AIGAAALIMLGVFTITVLNIRVRAAATSQSAAALVLSDGYYSHSPGTEADSGKLVMF-SG  671

Query  1105  SSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDFDR  926
             + PD+++    ++LNK  E+G G FGTVYK  L     R VAIKKLT S +++  EDF+R
Sbjct  672   NDPDFSAGA-HAILNKDCELGRGGFGTVYKTIL--RDGRPVAIKKLTVSSLVKSQEDFER  728

Query  925   EVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAVRF  746
             EV+ LGK RH NLV L GYYWTP LQLL+ +FV  GNL   LHE +   A+  L+W  RF
Sbjct  729   EVKKLGKVRHPNLVTLEGYYWTPSLQLLIYEFVSGGNLYRHLHESS---ASNSLSWRERF  785

Query  745   KIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVMSN  566
              IILG A+ LAHLH   +  IIHYN+K SNIL+D +   K+ D GLA+L+  LDR+V+S+
Sbjct  786   DIILGIARSLAHLH---RLNIIHYNLKSSNILIDGSGEAKVGDAGLAKLLPMLDRYVLSS  842

Query  565   RFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRVL  386
             + Q+A+GY+APE AC+++++ EKCDVYGFG+L+LEI+TGRRPVEY ED+V++L D VR  
Sbjct  843   KIQSALGYMAPEFACRTVKITEKCDVYGFGVLVLEIITGRRPVEYMEDDVVVLCDVVRGA  902

Query  385   LEQGNVLECVDQGMGG-YPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPV  215
             LE+G V ECVD  +GG +P EE +PV+KL L+CTSQ+PS+RP MAEVV ILQ+I+ P+
Sbjct  903   LEEGRVEECVDGRLGGKFPVEEAVPVVKLGLICTSQVPSNRPDMAEVVNILQLIRCPL  960


 Score = 62.0 bits (149),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 48/138 (35%), Positives = 72/138 (52%), Gaps = 10/138 (7%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             ++L G+IP  I    +L  + L GN L+G +P  IG C  L  L LS N L+G +PETL 
Sbjct  199   NSLSGDIPMGISRLYNLRAIDLRGNRLSGGLPDDIGGCLLLKSLDLSENLLTGKLPETLQ  258

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAG----------SIFQ  1493
              L     L L  N  SGE+P  +G++++L  +N+S N  +G++P               Q
Sbjct  259   KLSICSYLSLGSNSFSGEVPTWIGEMKSLETLNLSGNGFSGQVPDSIGNLQVVKRLDFSQ  318

Query  1492  NLDSSAIEGNDGICSPLL  1439
             N  + ++  + GIC  LL
Sbjct  319   NNFTGSLPESIGICKSLL  336


 Score = 60.8 bits (146),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 44/103 (43%), Positives = 64/103 (62%), Gaps = 1/103 (1%)
 Frame = -1

Query  1816  LIGEIPEDICES-GSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSM  1640
             L G IP++  +   SL  + L  N+ +G IPP +G+CS+L  L++S N LSG +P  L  
Sbjct  128   LSGSIPDEFFQQCRSLRTILLANNAFSGEIPPGVGSCSTLAELNISSNRLSGRLPSGLWS  187

Query  1639  LKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP  1511
             L  L+ L L  N LSG+IP  + +L NL A+++  NRL+G LP
Sbjct  188   LYGLRSLDLSGNSLSGDIPMGISRLYNLRAIDLRGNRLSGGLP  230


 Score = 53.5 bits (127),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 42/106 (40%), Positives = 61/106 (58%), Gaps = 1/106 (1%)
 Frame = -1

Query  1819  ALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIP-ETLS  1643
             +L G+I   + +  SL  L L  N+ +G++ P +    SL  + LS NNLSG+IP E   
Sbjct  79    SLSGKIGRGLLQLQSLRKLSLSKNNFSGSLNPNLSRLESLWTVDLSENNLSGSIPDEFFQ  138

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAG  1505
               + L+ + L  N  SGEIP  +G    L  +N+S NRL+GRLP+G
Sbjct  139   QCRSLRTILLANNAFSGEIPPGVGSCSTLAELNISSNRLSGRLPSG  184



>ref|NP_001044651.1| Os01g0821900 [Oryza sativa Japonica Group]
 dbj|BAF06565.1| Os01g0821900, partial [Oryza sativa Japonica Group]
Length=775

 Score =   400 bits (1029),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 236/537 (44%), Positives = 345/537 (64%), Gaps = 22/537 (4%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G +P +I  + +L  L+L  NS TG IP QIGNCSSL  L LSHNNL+G+IP T+  L
Sbjct  248   LDGGVPPEIGGAVALRELRLGRNSFTGHIPSQIGNCSSLVALDLSHNNLTGSIPSTVGNL  307

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
               L+++ L  N+L+G +P +L  L +L   +VS+N L+G LP    F N+  + +  N G
Sbjct  308   TSLEVVDLSKNKLNGTLPVELSNLPSLRIFDVSHNLLSGDLPNSRFFDNIPETFLSDNQG  367

Query  1456  ICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRFLsvsaiva  1277
             +CS      C    PKPIV+NP    N          ++   +  +S HH+ + +S    
Sbjct  368   LCSSRKNNSCIAIMPKPIVLNPNSSTNP--------LSQATPTAPSSMHHKKIILSVSTL  419

Query  1276  isaaaiiavgvmvITMVNASVRRRISFVENALESMCSS---TSSRSQGMATGKLILFDTK  1106
             I+ A    + + VI +   + R R +   +A  +  S    + S     ++GKL++F  K
Sbjct  420   IAIAGGGTIIIGVIIISVLNRRARATTSRSAPATALSDDYLSQSPENDASSGKLVMFG-K  478

Query  1105  SSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDFDR  926
              SP++ S+   ++LNK  E+G G FG VYK  L     + VAIKKLT S +++  +DF+R
Sbjct  479   GSPEF-SAGGHALLNKDCELGRGGFGAVYKTVL--RDGQPVAIKKLTVSSLVKSKDDFER  535

Query  925   EVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAVRF  746
             +V++L K RH N+V LRG+YWT  LQLL+ D++P GNL   LHE     +   L+W  RF
Sbjct  536   QVKLLSKVRHHNVVALRGFYWTSSLQLLIYDYLPGGNLHKHLHECTEDNS---LSWMERF  592

Query  745   KIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVMSN  566
              IILG A+GL HLH   Q  IIHYN+K SN+LLD N  P++ D+GLA+L+  LDR+V+S+
Sbjct  593   DIILGVARGLTHLH---QRGIIHYNLKSSNVLLDSNGEPRVGDYGLAKLLPMLDRYVLSS  649

Query  565   RFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRVL  386
             + Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE++TGRRPVEY ED+V++L D VR  
Sbjct  650   KIQSALGYMAPEFACKTVKITEKCDVYGFGVLVLEVLTGRRPVEYLEDDVVVLCDLVRSA  709

Query  385   LEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTP  218
             LE+G + +C+D  + G +P EE LP++KL LVCTS++PS+RP M EVV IL+++++P
Sbjct  710   LEEGRLEDCMDPRLCGEFPMEEALPIIKLGLVCTSRVPSNRPDMGEVVNILELVRSP  766


 Score = 54.3 bits (129),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 56/102 (55%), Gaps = 0/102 (0%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G +P     S SL  + L  N L G IP  +G  + L  L + HN  +G +PE+L  L
Sbjct  33    LSGSVPGGFPGSSSLRAVDLSRNLLAGEIPADVGEAALLKSLDVGHNLFTGGLPESLRRL  92

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP  1511
               L+ L +  N L+GE+P  +G++  L  +++S NR +G +P
Sbjct  93    SALRFLGVGGNALAGEVPSWIGEMWALERLDLSGNRFSGAIP  134



>ref|XP_010931370.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Elaeis guineensis]
Length=968

 Score =   405 bits (1040),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 260/537 (48%), Positives = 362/537 (67%), Gaps = 21/537 (4%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G IP +I  + SL  L+L  NSLTG IP QI NCSSLT L LS NNL+G IP TL+ L
Sbjct  440   LNGSIPPEIGGAVSLNELRLQKNSLTGGIPTQIANCSSLTSLILSQNNLTGPIPPTLANL  499

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
               L+ + L  N+L+G +P+QL  L +L++ N+S+N  +G LPAG+ F ++  S+I  N G
Sbjct  500   TNLQTIDLSHNRLTGTLPKQLSNLPHLISFNISHNLFSGDLPAGNFFDSIPPSSISDNPG  559

Query  1456  ICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRF-Lsvsaiv  1280
             +C  ++   C    PKPIV+NP     +  +++         S  N RH +  LS+S ++
Sbjct  560   LCGSVVNRSCPAVLPKPIVLNPNSSSPKRSSDSAF-------SPGNLRHKKIILSISTLI  612

Query  1279  aisaaaiiavgvmvITMVNASVRRRISFVENALESMCSSTSSRSQGMA--TGKLILFDTK  1106
             AI AAA+IA+GV+ IT++N  VR   +    A  ++     S S G    +GKL++F + 
Sbjct  613   AIGAAAVIALGVITITVLNIRVRSSAASQSAAALALSDDYYSHSPGTEANSGKLVMF-SG  671

Query  1105  SSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDFDR  926
             + PD+++    ++LNK  E+G G FG VYK  L     R VAIKKL  S +++  EDF+R
Sbjct  672   NDPDFSAGA-HAILNKDCELGRGGFGAVYKTIL--RDGRPVAIKKLIVSSLVKSQEDFER  728

Query  925   EVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAVRF  746
             E++ LGK RH NLV L GYYWTP LQLL+ +FV  GNL   LHE +   A+  L+W  RF
Sbjct  729   EIKKLGKVRHPNLVALEGYYWTPSLQLLIYEFVSGGNLYRHLHESS---ASNLLSWQERF  785

Query  745   KIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVMSN  566
              IILG A+ LAHLH   +  IIHYN+K SNIL+D +   K+ D+GLA+L+  LDR+V+S+
Sbjct  786   DIILGIARSLAHLH---RLNIIHYNLKSSNILIDGSGEAKVGDYGLAKLLPMLDRYVLSS  842

Query  565   RFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRVL  386
             + Q+A+GY+APE AC+++++ EKCDVYGFG+L+LEI+TGRRPVEY ED+V++L D V+  
Sbjct  843   KIQSALGYMAPEFACRTVKITEKCDVYGFGVLVLEIMTGRRPVEYMEDDVVVLCDVVKGA  902

Query  385   LEQGNVLECVDQGMGG-YPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTP  218
             LE+G V ECVD  +GG +P EE +PV+KL L+CTSQ+PS+RP MAEVV+ILQ+I+ P
Sbjct  903   LEEGRVEECVDGKLGGKFPVEEAVPVMKLGLICTSQVPSNRPDMAEVVKILQLIRCP  959


 Score = 60.5 bits (145),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 57/154 (37%), Positives = 81/154 (53%), Gaps = 14/154 (9%)
 Frame = -1

Query  1816  LIGEIPEDIC-ESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSM  1640
             L G IP++   +  SL  + L  N  +G IP  +G+CS+L  L+LS N LSG +P  L  
Sbjct  128   LSGSIPDEFFRQCRSLRSVSLANNDFSGEIPLSVGSCSTLAALNLSSNRLSGRLPSGLWS  187

Query  1639  LKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP----AGSIFQNLDSSA-  1475
             L  L+ L L  N LSG+IP  + +L NL A++   NRL+GRLP       + ++LDSS  
Sbjct  188   LYGLRSLDLSGNSLSGDIPMGISRLYNLRAISFHGNRLSGRLPDDIGGCLLLKSLDSSGN  247

Query  1474  -IEG-------NDGICSPLLTGPCKMNAPKPIVI  1397
              + G       N  +CS L  G    +   P+ I
Sbjct  248   LLTGNLPETMRNLSMCSYLSLGSNSFSGEVPVWI  281


 Score = 59.7 bits (143),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 37/104 (36%), Positives = 59/104 (57%), Gaps = 0/104 (0%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             ++L G+IP  I    +L  +   GN L+G +P  IG C  L  L  S N L+G +PET+ 
Sbjct  199   NSLSGDIPMGISRLYNLRAISFHGNRLSGRLPDDIGGCLLLKSLDSSGNLLTGNLPETMR  258

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP  1511
              L     L L  N  SGE+P  +G++++L  +++S N  +G++P
Sbjct  259   NLSMCSYLSLGSNSFSGEVPVWIGEMKSLETLDLSSNGFSGQIP  302


 Score = 59.3 bits (142),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 44/119 (37%), Positives = 62/119 (52%), Gaps = 0/119 (0%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G +PE +        L L  NS +G +P  IG   SL  L LS N  SG IP+++  L
Sbjct  249   LTGNLPETMRNLSMCSYLSLGSNSFSGEVPVWIGEMKSLETLDLSSNGFSGQIPDSIGKL  308

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGND  1460
             + +K L    N L+G +P+ +G  ++L  V+ S N LTG LP       L S +I GN+
Sbjct  309   QLVKSLDFSHNGLTGSLPESIGACKSLSEVDFSQNSLTGNLPTWIFELGLQSISISGNN  367



>ref|XP_009793754.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Nicotiana sylvestris]
Length=965

 Score =   405 bits (1040),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 245/539 (45%), Positives = 354/539 (66%), Gaps = 30/539 (6%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G IP +I  + SL  L+L  N L+GTIP  I NCS+LTLL LSHNNL+G IP  +S L
Sbjct  443   LNGSIPYEIGSAVSLLELKLRENRLSGTIPADIANCSALTLLDLSHNNLTGPIPPEISKL  502

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
               L+++    NQ+SG +P++L  L +L+  NVS+N L G LP G  F  +  S++ GN  
Sbjct  503   TILEVVDFSFNQISGSLPKELTNLSHLITFNVSHNHLKGELPVGGFFNTISPSSVVGNPS  562

Query  1456  ICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNS--RHHRFLsvsai  1283
             +C  +L   C    PKP+V+NP             ++++    + NS  R    LS+S++
Sbjct  563   LCGSVLNHSCPAVHPKPLVLNP-------------NSSDSSHGSVNSLGRKRIMLSISSL  609

Query  1282  vaisaaaiiavgvmvITMVNASVRRRISFVENALESMCSSTSSRSQGMAT--GKLILFDT  1109
             +AI AA  IA+GV+V++++N  VR  ++              S S G     GKL++F  
Sbjct  610   IAIGAAVFIALGVVVVSILNLHVRSSMALSAATFTLSGGDDYSHSHGTEANLGKLVMFSG  669

Query  1108  KSSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDFD  929
              +  D+ + T +++LNK +E+G G FG VYK  LG    R +AIKKL  + +++  EDF+
Sbjct  670   DA--DFVAGT-QALLNKGNELGRGGFGAVYKTELGD--GRSLAIKKLNITSLIKSQEDFE  724

Query  928   REVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAVR  749
              E++ LG  RHQNLV L GYYWTP LQLL++++V  G+L   LHE +   +   L+W  R
Sbjct  725   SEMKSLGSIRHQNLVALEGYYWTPSLQLLINEYVSGGSLYKLLHEES---SKSSLSWQQR  781

Query  748   FKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDE-NLNPKISDFGLARLVAKLDRHVM  572
             F IIL TAKGLA+LH   Q  IIHYN+K +N+L+D+ + N K+ DFGLARL+  LDR+++
Sbjct  782   FNIILDTAKGLAYLH---QLSIIHYNMKSTNVLIDDASANAKVGDFGLARLLPVLDRYIL  838

Query  571   SNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVR  392
             S++ Q+A+GY+APE ACQ++++ EKCDVYGFG+L LE+VTG++PVEY ED+VL+L D VR
Sbjct  839   SSKIQSALGYMAPEFACQTVKITEKCDVYGFGILTLEVVTGKKPVEYMEDDVLVLCDMVR  898

Query  391   VLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTP  218
               LE+G + EC+DQ + G +P EE +PV+KL L+C SQ+PS+RP M EV++IL++I+ P
Sbjct  899   GALEEGRIEECIDQRLQGHFPVEEAIPVVKLGLICASQVPSNRPDMEEVIKILELIRCP  957


 Score = 61.2 bits (147),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 61/105 (58%), Gaps = 0/105 (0%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             + L GEIP+ I    SL  + L  N  TG +P  IGNC  L  + LS N LSG +PE++ 
Sbjct  198   NVLEGEIPKAIEGLYSLRSINLQKNKFTGWLPENIGNCVQLKSIDLSENLLSGGLPESMR  257

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPA  1508
              L     + L  N  +GEIP  + ++++L  +++S N L+GR+P+
Sbjct  258   RLGLCTTMDLRSNSFNGEIPDWIAEMKSLQVLDLSANNLSGRIPS  302


 Score = 59.3 bits (142),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 58/90 (64%), Gaps = 0/90 (0%)
 Frame = -1

Query  1777  SLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSMLKRLKILKLEVNQL  1598
             SL +L L  N+L+G IP  I N +SL ++++S N L+G IPE +  L   ++L L  NQL
Sbjct  384   SLQVLDLSSNALSGEIPSAIWNINSLEVMNISRNFLTGIIPEAVGKLNATRVLDLSHNQL  443

Query  1597  SGEIPQQLGKLENLLAVNVSYNRLTGRLPA  1508
             +G IP ++G   +LL + +  NRL+G +PA
Sbjct  444   NGSIPYEIGSAVSLLELKLRENRLSGTIPA  473


 Score = 57.4 bits (137),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 62/105 (59%), Gaps = 1/105 (1%)
 Frame = -1

Query  1822  SALIGEIPEDIC-ESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETL  1646
             ++L G +P+D   + GSL  +    N+LTG IP  + +CS+L  ++ S N LSG +P  L
Sbjct  125   NSLSGSLPDDFFRQCGSLQAVSFAKNNLTGQIPDSLTSCSTLERVNFSSNGLSGQLPSGL  184

Query  1645  SMLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP  1511
               L  L+ L +  N L GEIP+ +  L +L ++N+  N+ TG LP
Sbjct  185   WSLSSLRYLDISDNVLEGEIPKAIEGLYSLRSINLQKNKFTGWLP  229


 Score = 56.2 bits (134),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 46/118 (39%), Positives = 63/118 (53%), Gaps = 0/118 (0%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G +PE +   G    + L  NS  G IP  I    SL +L LS NNLSG IP ++  L
Sbjct  248   LSGGLPESMRRLGLCTTMDLRSNSFNGEIPDWIAEMKSLQVLDLSANNLSGRIPSSMGDL  307

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGN  1463
               L  L L  NQ  G +P+ L K  NL+ +++ +N LTG LP+ +    L S ++ GN
Sbjct  308   PLLAELNLSNNQFVGSLPRSLMKCINLVILDIGHNLLTGNLPSWAFTLGLKSISLSGN  365



>ref|XP_002990711.1| hypothetical protein SELMODRAFT_132189, partial [Selaginella 
moellendorffii]
 gb|EFJ08160.1| hypothetical protein SELMODRAFT_132189, partial [Selaginella 
moellendorffii]
Length=908

 Score =   403 bits (1036),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 258/543 (48%), Positives = 359/543 (66%), Gaps = 31/543 (6%)
 Frame = -1

Query  1810  GEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSMLKR  1631
             G IP     S SL  L+LD N+L G IP  +GNCSSL  L LS NNL+G IP  L+ L  
Sbjct  388   GYIPRSFGGSPSLETLKLDDNALVGIIPEGLGNCSSLRYLDLSQNNLTGGIPVELADLSS  447

Query  1630  LKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDGIC  1451
             L+ L L  N L+G+IP    +L+NL   NVS+N L G +P+   F  LD S+  GN  +C
Sbjct  448   LQSLDLSSNHLTGQIPTSFAQLQNLSLFNVSHNSLAGPIPSDGAFPLLDPSSFAGNAHLC  507

Query  1450  SPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRH----HRFLsvsai  1283
                L+  C    PKPIV+NP    N T         +P+ S+ + R        LSVSAI
Sbjct  508   GASLSIDCPA-IPKPIVLNP----NATTTP------DPIISSSDHRSPPSSKIVLSVSAI  556

Query  1282  vaisaaaiiavgvmvITMVN--ASVRRRISFVENALESMCSSTSSRSQGMATGKLILF--  1115
             +AISAAA+IA+G++V++++N  +  R R SF    ++S+    SS S+ +A GKL++F  
Sbjct  557   IAISAAAVIALGIVVVSLLNLRSHPRPRASFY--VVDSL--PGSSPSEDLAIGKLVMFTD  612

Query  1114  DTKSSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPED  935
             D+ S  +    T +++LNK SEIG G FGTVYKA L     R VA+KKL+   +++  ++
Sbjct  613   DSDSRDEDLLPTAQALLNKNSEIGRGGFGTVYKATLAA--GRTVAVKKLSVPGMVETQDE  670

Query  934   FDREVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWA  755
             F++ V+ LGK +H+NLV  +GYY+TP+LQLL+ DFVP GNL SKLHE ++      L W 
Sbjct  671   FEKRVQFLGKIQHENLVNFQGYYFTPKLQLLIYDFVPNGNLHSKLHEQSV------LPWE  724

Query  754   VRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHV  575
             +RFK+ LG A+GL +LHH C+P +IHYN K SN+LLD+  N ++SD+GLA+L+   DR V
Sbjct  725   LRFKVALGAAQGLCYLHHKCRPRVIHYNFKSSNVLLDDGFNARVSDYGLAKLLHSRDRFV  784

Query  574   MSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHV  395
             + N+ Q+++GY+APE  C+S +V EKCDVYGFG+++LE++TG+ PVEY E++V+IL D V
Sbjct  785   VMNKLQSSLGYLAPECGCESFKVTEKCDVYGFGVVLLELITGKPPVEYLENDVVILCDFV  844

Query  394   RVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPV  215
             R L + G  L CVD  M  YP+EEV+ ++KL LVCTS +P++RPSM EVVQIL++IK   
Sbjct  845   RSLADDGKPLLCVDPKMVVYPEEEVMTLIKLGLVCTSPVPANRPSMTEVVQILELIKPLA  904

Query  214   PNR  206
              NR
Sbjct  905   DNR  907


 Score = 65.5 bits (158),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 44/102 (43%), Positives = 58/102 (57%), Gaps = 0/102 (0%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G IP  +     LG L L  NSL+G IPP++G C  L  L LS+N LSG IP  L  L
Sbjct  164   LSGSIPAGVGSLSRLGSLDLSHNSLSGEIPPELGQCQMLVSLDLSYNLLSGEIPSFLESL  223

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP  1511
              RL++L+L  N  SG +P  +G ++ L  + +  N L G LP
Sbjct  224   SRLEVLRLPGNSFSGTLPSSIGSMKALRRLYLHNNNLQGALP  265


 Score = 63.9 bits (154),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 44/103 (43%), Positives = 63/103 (61%), Gaps = 2/103 (2%)
 Frame = -1

Query  1810  GEIPEDICE--SGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             G +P ++    S SL  + L GN L G +P  I +C SL  L  S N LSG+IP  +  L
Sbjct  116   GSVPPELFANCSKSLRYVFLSGNQLEGDLPDSIASCESLEALGASENRLSGSIPAGVGSL  175

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPA  1508
              RL  L L  N LSGEIP +LG+ + L+++++SYN L+G +P+
Sbjct  176   SRLGSLDLSHNSLSGEIPPELGQCQMLVSLDLSYNLLSGEIPS  218



>ref|XP_006486161.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Citrus sinensis]
Length=975

 Score =   405 bits (1040),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 245/543 (45%), Positives = 341/543 (63%), Gaps = 25/543 (5%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G IP +I  + SL  L+L+ N L G IP  I NCSSL  L LS NNL+G IP  ++ L
Sbjct  452   LNGSIPPEIGGAYSLKELRLERNFLAGKIPTSIENCSSLVSLILSKNNLTGPIPIAIAKL  511

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
               L+ + L  N L+G +P+QL  L +L + N+S+N L G LPAG  F  +  S++ GN  
Sbjct  512   TNLQNVDLSFNTLTGGLPKQLVNLVHLSSFNISHNHLQGELPAGGFFNTISPSSVLGNPS  571

Query  1456  ICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRFLsvsaiva  1277
             +C   +   C    PKPIV+NP      + +++   +  P     N RH R +   + + 
Sbjct  572   LCGSAVNKSCPAVLPKPIVLNP-----NSSSDSTTSSVAP-----NPRHKRIILSISAII  621

Query  1276  isaaaiiavgvmvI-TMVNASVRRRISFVENALESMCSSTSSRS--QGMATGKLILFDTK  1106
                AA + V  ++  T++N  VR   S    AL        SRS      +GKL++F   
Sbjct  622   AIGAAAVIVIGVIAITVLNLRVRSSTSRSAAALTLSAGDDFSRSPTTDANSGKLVMF--S  679

Query  1105  SSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDFDR  926
               PD+++ T  ++LNK  E+G G FG VY+  L     R VAIKKLT S +++  EDF+R
Sbjct  680   GDPDFSTGT-HALLNKDCELGRGGFGAVYRTVL--RDGRPVAIKKLTVSSLVKSQEDFER  736

Query  925   EVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAVRF  746
             EV+ LGK RH NLV L GYYWT  LQLL+ +FV  G+L   LHE +       L+W  RF
Sbjct  737   EVKKLGKVRHPNLVTLEGYYWTQSLQLLIYEFVSGGSLHKHLHEGSGGNF---LSWNERF  793

Query  745   KIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVMSN  566
              +I GTAK LAHLH   Q  IIHYNIK SN+L+D +  PK+ D+GLARL+  LDR+V+S+
Sbjct  794   NVIQGTAKSLAHLH---QSNIIHYNIKSSNVLIDGSGEPKVGDYGLARLLPMLDRYVLSS  850

Query  565   RFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRVL  386
             + Q+A+GY+APE AC+++++ +KCDVYGFG+L+LE+VTG+RPVEY ED+V++L D VR  
Sbjct  851   KIQSALGYMAPEFACRTVKITDKCDVYGFGVLVLEVVTGKRPVEYMEDDVVVLCDMVRGA  910

Query  385   LEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPVPN  209
             LE+G V EC+D+ + G +P EE +PV+KL L+CTSQ+PS+RP M EVV IL++I+ P   
Sbjct  911   LEEGRVEECIDEKLQGKFPSEEAIPVMKLGLICTSQVPSNRPDMEEVVNILELIRCPSEG  970

Query  208   RME  200
             + E
Sbjct  971   QEE  973


 Score = 64.3 bits (155),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 62/102 (61%), Gaps = 0/102 (0%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L GEIP+ +    +L ++ L  N  +G+IP  IG+CS L  +  S N+ SG +PET+  L
Sbjct  209   LEGEIPKGVESLKNLRVINLSKNMFSGSIPDGIGSCSLLRTIDFSENSFSGNLPETMQKL  268

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP  1511
                  + L  N  SGE+P+ +G+LE+L  +++S N+ +G +P
Sbjct  269   SLCNFMNLRKNLFSGEVPKWIGELESLETLDLSGNKFSGAVP  310



>ref|XP_007134722.1| hypothetical protein PHAVU_010G070400g [Phaseolus vulgaris]
 gb|ESW06716.1| hypothetical protein PHAVU_010G070400g [Phaseolus vulgaris]
Length=783

 Score =   399 bits (1026),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 245/545 (45%), Positives = 344/545 (63%), Gaps = 29/545 (5%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G IP +I  + S+  ++L  N L+G IP QI  CS LT L+LSHN L G+IP  ++ L
Sbjct  260   LNGSIPSEIEGAISVSEMRLQKNFLSGRIPAQIDKCSELTFLNLSHNKLIGSIPSAIANL  319

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
               L+ +    N+LSG +P++L  L NL + NVSYN L G LP G  F  +  S++ GN  
Sbjct  320   TNLQDVDFSWNELSGSLPKELTNLSNLFSFNVSYNHLQGELPVGGFFNTISPSSVSGNPL  379

Query  1456  ICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRFLsvsaiva  1277
             +C  ++   C    PKPIV+NP               + P +S +N  H   LS+S ++A
Sbjct  380   LCGSVVNHSCPSVHPKPIVLNP-----------NSSYSNPGSSVQNHHHKIMLSISVLIA  428

Query  1276  isaaaiiavgvmvITMVNASVRRRIS-----FVENALESMCSSTSSRSQGMATGKLILFD  1112
             I AA  I +GV+V+T++N  VR  IS     F+ +  E    S  +  +    GKL++F 
Sbjct  429   IGAAIFIVIGVVVVTVLNIHVRSSISLSAAPFIFSGGEDYSGSPGNDPK---CGKLVMF-  484

Query  1111  TKSSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDF  932
                  ++A  T  ++LNK SEIG G FG VY   L       VAIKKLT S + +  EDF
Sbjct  485   -YGDAEFADGT-HNLLNKDSEIGRGGFGVVYCTVL--RDGHYVAIKKLTVSTLTKLQEDF  540

Query  931   DREVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAV  752
             +REV++LGK +HQNLV L GYYWTP LQLL+ +++  G+L+  LH+   + +   L+W  
Sbjct  541   EREVKMLGKIKHQNLVALEGYYWTPSLQLLIYEYLARGSLQKLLHDDDDS-SKNTLSWRK  599

Query  751   RFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVM  572
             RFKIILG A+GLAHLH   Q  +IHYN+K +N+ +D +  PKI DFGL RL+  LD  V+
Sbjct  600   RFKIILGIARGLAHLH---QMELIHYNLKSTNVFIDCSDEPKIGDFGLVRLLPMLDPCVL  656

Query  571   SNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVR  392
             S++ Q+A+GY+APE AC+++++ EKCDVY FG+LILE+VTG+RPVEY ED+V++L D VR
Sbjct  657   SSKIQSALGYMAPEFACRTVKITEKCDVYSFGILILEVVTGKRPVEYMEDDVVVLCDKVR  716

Query  391   VLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPV  215
               L+ G V +CVD+ + G +  EE +PV+KL LVC SQ+PS RP MAEV+ IL++I+ P 
Sbjct  717   SALDDGKVEQCVDENLKGNFAAEEAVPVIKLGLVCASQVPSKRPDMAEVINILELIQCPS  776

Query  214   PNRME  200
               + E
Sbjct  777   EGQEE  781


 Score = 65.9 bits (159),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 47/120 (39%), Positives = 67/120 (56%), Gaps = 0/120 (0%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             ++L G +PE + +  S   L L GNS TG IP  IG   SL +L LS N  SG IP+++ 
Sbjct  63    NSLSGRLPESMQKLSSCTFLSLQGNSFTGGIPHWIGEMKSLDILDLSANRFSGWIPKSIG  122

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGN  1463
              L  L  L L  NQ++G +P+ +     LL +++S+N L G LP+      L S +I GN
Sbjct  123   NLDLLSRLNLSRNQITGNLPELMVNCIKLLTLDISHNHLAGHLPSWIFRMGLQSISISGN  182


 Score = 61.2 bits (147),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 43/111 (39%), Positives = 63/111 (57%), Gaps = 2/111 (2%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L GEIPE I     L  L+L  N  TG IP  IG+C  L ++  S N+LSG +PE++  L
Sbjct  17    LEGEIPEGIRNLIDLRELRLGRNLFTGKIPEHIGDCLLLKMVDFSGNSLSGRLPESMQKL  76

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLD  1484
                  L L+ N  +G IP  +G++++L  +++S NR +G +P      NLD
Sbjct  77    SSCTFLSLQGNSFTGGIPHWIGEMKSLDILDLSANRFSGWIPKS--IGNLD  125



>ref|XP_011010876.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 isoform X2 [Populus euphratica]
Length=941

 Score =   404 bits (1037),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 241/545 (44%), Positives = 329/545 (60%), Gaps = 25/545 (5%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             ++L+G IP    +   L +L L  N L G+IP +IG   +L  L L  N+LSG IP ++ 
Sbjct  416   NSLMGPIPGTFGDLKELDVLDLSDNKLNGSIPMEIGGAFALKELRLERNSLSGQIPSSIG  475

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGN  1463
                 L  L L  N L+G +P+QL  L +L + N+S+N L G LPAG  F  +  S + GN
Sbjct  476   TCSSLTTLFLSQNSLTGTLPKQLANLPSLSSFNISHNNLQGELPAGGFFNTISPSCVAGN  535

Query  1462  DGICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRFLsvsai  1283
               +C   +   C    PKPIV+NP    + T          P +  +N  H R +   + 
Sbjct  536   PSLCGAAVNKSCPAVLPKPIVLNPNCSSDST----------PGSLPQNLGHKRIILSISA  585

Query  1282  vaisaaaiiavgvmvI-TMVNASVRRRISFVENALESMCSS--TSSRSQGMATGKLILFD  1112
             +    AA + V  ++  T++N  VR   S    AL        + S +    +GKL++F 
Sbjct  586   IIAIGAAAVIVVGVIAITVLNLRVRSSTSTSAAALTLSAGDGFSDSSTTDANSGKLVMFS  645

Query  1111  TKSSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDF  932
               +     S+   ++LNK  E+G G FG VY+  L     R VAIKKLT S +++  EDF
Sbjct  646   GDTD---FSTEAHALLNKDCELGRGGFGAVYQTVL--RDGRPVAIKKLTVSSLVKSQEDF  700

Query  931   DREVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAV  752
             +REV+ LGK RHQNLV L GYYWTP LQLL+ +FV  G+L   LH+         L+W  
Sbjct  701   EREVKKLGKIRHQNLVALEGYYWTPSLQLLIYEFVSGGSLYKHLHDRPGGHF---LSWNE  757

Query  751   RFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVM  572
             RF IILGTAK LAHLH   Q  IIHYNIK  NIL+D +  PK+ DFGLARL+  LDR+V+
Sbjct  758   RFNIILGTAKSLAHLH---QSNIIHYNIKSRNILIDISGEPKVGDFGLARLLPMLDRYVL  814

Query  571   SNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVR  392
             S++ Q+A+GY+APE AC++ ++ EKCDVYGFG+LILEIVTG+RPVEY ED+V++L D VR
Sbjct  815   SSKIQSALGYMAPEFACRTAKITEKCDVYGFGVLILEIVTGKRPVEYMEDDVVVLCDMVR  874

Query  391   VLLEQGNVLECVD-QGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPV  215
               LE+  V ECVD + +G +P +E +PV+KL L+CTSQ+PS+RP M EVV IL +I+ P 
Sbjct  875   GALEESRVEECVDGRLLGHFPADEAVPVMKLGLICTSQVPSNRPDMGEVVNILDLIRCPS  934

Query  214   PNRME  200
               + E
Sbjct  935   EGQEE  939


 Score = 57.8 bits (138),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 43/125 (34%), Positives = 66/125 (53%), Gaps = 8/125 (6%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L  EIP  I    +L  + L  N   G IP  IG+C  L+ +  S N LSGT+P+T+  L
Sbjct  207   LDSEIPRGIEVLNNLRNINLSKNRFNGGIPNGIGSCLLLSSVDFSENMLSGTVPDTMQNL  266

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAG-------SIFQNLDSS  1478
                  L L  N  +GE+P  +G+L  L  +++S NR +G++P          +F NL ++
Sbjct  267   GLCNYLSLSNNMFTGEVPNWIGELNRLETLDLSGNRFSGQVPTSIGNLQSLKVF-NLSAN  325

Query  1477  AIEGN  1463
             ++ GN
Sbjct  326   SLSGN  330


 Score = 56.6 bits (135),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 54/102 (53%), Gaps = 0/102 (0%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G +P+ +   G    L L  N  TG +P  IG  + L  L LS N  SG +P ++  L
Sbjct  255   LSGTVPDTMQNLGLCNYLSLSNNMFTGEVPNWIGELNRLETLDLSGNRFSGQVPTSIGNL  314

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP  1511
             + LK+  L  N LSG +P+ +    NLL ++ S N L+G LP
Sbjct  315   QSLKVFNLSANSLSGNLPESMTNCGNLLVLDFSQNLLSGDLP  356



>ref|XP_006435929.1| hypothetical protein CICLE_v10030625mg [Citrus clementina]
 gb|ESR49169.1| hypothetical protein CICLE_v10030625mg [Citrus clementina]
Length=997

 Score =   404 bits (1039),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 245/543 (45%), Positives = 341/543 (63%), Gaps = 25/543 (5%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G IP +I  + SL  L+L+ N L G IP  I NCSSL  L LS NNL+G IP  ++ L
Sbjct  474   LNGSIPPEIGGAYSLKELRLERNFLAGKIPTSIENCSSLVSLILSKNNLTGPIPIAIAKL  533

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
               L+ + L  N L+G +P+QL  L +L + N+S+N L G LPAG  F  +  S++ GN  
Sbjct  534   TNLQNVDLSFNTLTGGLPKQLVNLVHLSSFNISHNHLQGELPAGGFFNTISPSSVLGNPS  593

Query  1456  ICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRFLsvsaiva  1277
             +C   +   C    PKPIV+NP      + +++   +  P     N RH R +   + + 
Sbjct  594   LCGSAVNKSCPAVLPKPIVLNP-----NSSSDSTTSSVAP-----NPRHKRIILSISAII  643

Query  1276  isaaaiiavgvmvI-TMVNASVRRRISFVENALESMCSSTSSRS--QGMATGKLILFDTK  1106
                AA + V  ++  T++N  VR   S    AL        SRS      +GKL++F   
Sbjct  644   AIGAAAVIVIGVIAITVLNLRVRSSTSRSAAALTLSAGDDFSRSPTTDANSGKLVMF--S  701

Query  1105  SSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDFDR  926
               PD+++ T  ++LNK  E+G G FG VY+  L     R VAIKKLT S +++  EDF+R
Sbjct  702   GDPDFSTGT-HALLNKDCELGRGGFGAVYRTVL--RDGRPVAIKKLTVSSLVKSQEDFER  758

Query  925   EVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAVRF  746
             EV+ LGK RH NLV L GYYWT  LQLL+ +FV  G+L   LHE +       L+W  RF
Sbjct  759   EVKKLGKVRHPNLVTLEGYYWTQSLQLLIYEFVSGGSLHKHLHEGSGGNF---LSWNERF  815

Query  745   KIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVMSN  566
              +I GTAK LAHLH   Q  IIHYNIK SN+L+D +  PK+ D+GLARL+  LDR+V+S+
Sbjct  816   NVIQGTAKSLAHLH---QSNIIHYNIKSSNVLIDGSGEPKVGDYGLARLLPMLDRYVLSS  872

Query  565   RFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRVL  386
             + Q+A+GY+APE AC+++++ +KCDVYGFG+L+LE+VTG+RPVEY ED+V++L D VR  
Sbjct  873   KIQSALGYMAPEFACRTVKITDKCDVYGFGVLVLEVVTGKRPVEYMEDDVVVLCDMVRGA  932

Query  385   LEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPVPN  209
             LE+G V EC+D+ + G +P EE +PV+KL L+CTSQ+PS+RP M EVV IL++I+ P   
Sbjct  933   LEEGRVEECIDEKLQGKFPSEEAIPVMKLGLICTSQVPSNRPDMEEVVNILELIRCPSEG  992

Query  208   RME  200
             + E
Sbjct  993   QEE  995


 Score = 64.3 bits (155),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 62/102 (61%), Gaps = 0/102 (0%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L GEIP+ +    +L ++ L  N  +G+IP  IG+CS L  +  S N+ SG +PET+  L
Sbjct  231   LEGEIPKGVESLKNLRVINLSKNMFSGSIPDGIGSCSLLRTIDFSENSFSGNLPETMQKL  290

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP  1511
                  + L  N  SGE+P+ +G+LE+L  +++S N+ +G +P
Sbjct  291   SLCNFMNLRKNLFSGEVPKWIGELESLETLDLSGNKFSGAVP  332



>ref|XP_004305081.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Fragaria vesca subsp. vesca]
 ref|XP_011466417.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Fragaria vesca subsp. vesca]
Length=956

 Score =   403 bits (1035),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 253/540 (47%), Positives = 347/540 (64%), Gaps = 34/540 (6%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G IP +I  + SL  L+L  N LTG +P QI  CSSL+ L LS NNLSG +P  ++ L
Sbjct  438   LNGSIPSEIGGAVSLKELRLHKNFLTGKLPSQIEKCSSLSSLLLSQNNLSGPVPVAIANL  497

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
               L+ + L +NQ SG +P++L  L +LL  NVSYN L G LP G  F  +  S+I GN  
Sbjct  498   TNLQYVDLSLNQFSGSLPKELTNLSHLLYFNVSYNHLQGELPVGGFFNTISPSSISGNPS  557

Query  1456  ICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRFLsvsaiva  1277
             +C  +L   C    PKPIV+NP                   +S+    H    S+SA++A
Sbjct  558   LCGSVLNLSCPAVHPKPIVLNPNSNSTGGG-----------SSSLTHGHKNVFSISALIA  606

Query  1276  isaaaiiavgvmvITMVNASVRRRISF-----VENALESMCS-STSSRSQGMATGKLILF  1115
             I AAA IA+GV+ IT++N  VR  ++      +    +  CS ST S+      GKL++F
Sbjct  607   IGAAAFIAIGVIAITVLNMHVRSSMTHSAPLPLPGGEDFSCSPSTDSK-----YGKLVMF  661

Query  1114  DTKSSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPED  935
                +  D+A+   +++LNK  E+G G FG VY+  L     R VAIKKLT S +++  ED
Sbjct  662   SGDA--DFAAGA-QALLNKDCELGRGGFGVVYRTVL--RDGRSVAIKKLTVSSLIKSQED  716

Query  934   FDREVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWA  755
             F+REV+ LGK RH NLV L GYYWTP LQLL+ +++P G+L   LH+         L+W 
Sbjct  717   FEREVKGLGKIRHHNLVTLEGYYWTPSLQLLIYEYIPCGSLYKNLHD---GPDQSGLSWR  773

Query  754   VRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHV  575
              RF IILG AKGLAHLH   Q  +IHYN+K +NIL+D +  PK+ D GLARL+  +DR +
Sbjct  774   QRFNIILGMAKGLAHLH---QMNLIHYNLKSTNILIDSSGEPKVGDSGLARLLPMVDRCI  830

Query  574   MSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHV  395
             +S++ Q+A+GY+APE ACQ++++ EKCDVYGFG+L+LE+VTG+RPVEY ED+V+IL D V
Sbjct  831   LSSKIQSALGYMAPEFACQTVKITEKCDVYGFGVLVLEVVTGKRPVEYMEDDVVILCDMV  890

Query  394   RVLLEQGNVLECVDQG-MGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTP  218
             R  LE+G V EC+D+  +G YP EE +PV+KL L+C SQ+PS+RP M+EVV IL++I+ P
Sbjct  891   RGELEEGRVEECLDRKLLGNYPAEEAIPVIKLGLICASQVPSNRPDMSEVVNILELIQCP  950


 Score = 60.1 bits (144),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 50/101 (50%), Positives = 63/101 (62%), Gaps = 0/101 (0%)
 Frame = -1

Query  1810  GEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSMLKR  1631
             G IPE I   G    L L GNSLTG +P  IG   SL +L LS NN SG IP +L  LK 
Sbjct  253   GGIPESIKRLGLCRSLSLKGNSLTGQVPAWIGELRSLGMLDLSCNNFSGGIPGSLGNLKL  312

Query  1630  LKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPA  1508
             L+ L L VN+ +G +P+ L    NLLA++VS N+L G+LP+
Sbjct  313   LEKLNLSVNEFTGSLPESLTNCFNLLALDVSRNQLVGKLPS  353


 Score = 53.1 bits (126),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 37/103 (36%), Positives = 58/103 (56%), Gaps = 0/103 (0%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L GE+ E I     L ++ L  N  +G +P  +G CS L LL  S N  SG IPE++  L
Sbjct  203   LEGEVHEGIGYLYDLRVVNLGKNRFSGWLPGDVGGCSHLKLLDFSDNLFSGGIPESIKRL  262

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPA  1508
                + L L+ N L+G++P  +G+L +L  +++S N  +G +P 
Sbjct  263   GLCRSLSLKGNSLTGQVPAWIGELRSLGMLDLSCNNFSGGIPG  305



>ref|XP_008792235.1| PREDICTED: LOW QUALITY PROTEIN: probably inactive leucine-rich 
repeat receptor-like protein kinase At3g28040 [Phoenix dactylifera]
Length=968

 Score =   403 bits (1036),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 258/537 (48%), Positives = 358/537 (67%), Gaps = 21/537 (4%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G IP +I  + SL  L+L  NSLTG IP QI NCSSLT L LS NNL+G+IP TL+ L
Sbjct  440   LNGSIPPEIGGAVSLNELRLQKNSLTGGIPSQIANCSSLTSLILSQNNLTGSIPPTLANL  499

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
               L+ + L  N+L+G +P+Q   L +L++ N+S+N  +G LPAG+ F  +  S++  N G
Sbjct  500   TNLQTIDLSRNRLTGTLPKQFSNLPHLISFNISHNLFSGDLPAGNFFDTIPHSSVSNNPG  559

Query  1456  ICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRF-Lsvsaiv  1280
             +C  ++   C    PKPIV+NP        +++         S    RH +  LS+S ++
Sbjct  560   LCGSIVNRSCPAVLPKPIVLNPNSSSPDHSSDSAF-------SPGXLRHKKIILSISTLI  612

Query  1279  aisaaaiiavgvmvITMVNASVRRRISFVENALESMCSSTSSRSQGMA--TGKLILFDTK  1106
             AI AAA+IA GV+ IT++N  VR   +    A  ++     S S G    +GKL++F + 
Sbjct  613   AIGAAAVIAXGVITITVLNIRVRSSAASQSAAPLALSDDYYSHSPGTEANSGKLVMF-SG  671

Query  1105  SSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDFDR  926
             + PD+++    ++LNK  E+G G FGTVYK  L     R +AIKKLT S +++  EDF+R
Sbjct  672   NDPDFSAGA-HAILNKDCELGRGGFGTVYKTIL--RDGRPMAIKKLTVSSLVKSQEDFER  728

Query  925   EVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAVRF  746
             EV+ LGK RH NLV L GYYWTP LQLL+ +FV  GNL   LHE +    +  L+W  RF
Sbjct  729   EVKKLGKVRHPNLVTLEGYYWTPSLQLLIYEFVSGGNLYRHLHESS---GSNLLSWQERF  785

Query  745   KIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVMSN  566
              IILG A+ LAHLH   +  IIHYN+K SNIL+D +   K+ D+GLA+L+  LDR+V+S+
Sbjct  786   DIILGIARSLAHLH---RFNIIHYNLKSSNILIDGSGEAKVGDYGLAKLLPMLDRYVLSS  842

Query  565   RFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRVL  386
             + Q+A+GY+APE AC+++++NEKCDVYGFG+L+LEI+TGRRPVEY ED+V++L D V+  
Sbjct  843   KIQSALGYMAPEFACRTVKINEKCDVYGFGVLVLEIMTGRRPVEYMEDDVVVLCDVVKGA  902

Query  385   LEQGNVLECVDQGMGG-YPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTP  218
             LE+G V ECVD  +GG +P EE +PV+KL L+CTSQ+PS+RP M EVV ILQ+I+ P
Sbjct  903   LEEGRVEECVDGKLGGKFPVEEAVPVVKLGLICTSQVPSNRPDMVEVVNILQLIRCP  959


 Score = 61.2 bits (147),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 38/104 (37%), Positives = 60/104 (58%), Gaps = 0/104 (0%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             ++L G+IP  I    +L  + L GN L+G +P  IG C  L  L L  N L+G++PETL 
Sbjct  199   NSLSGDIPMGISRLYNLRAISLHGNRLSGWLPDDIGGCLLLKSLDLGGNLLTGSLPETLQ  258

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP  1511
              L     L +  N  SG++P  +G++ +L  +N+S N  +G++P
Sbjct  259   NLSMCSYLSMGSNSFSGDVPVWIGEMRSLETLNLSSNWFSGQIP  302


 Score = 59.3 bits (142),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 44/103 (43%), Positives = 62/103 (60%), Gaps = 1/103 (1%)
 Frame = -1

Query  1816  LIGEIPEDIC-ESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSM  1640
             L G IP+    +  SL  + L  N  +G IPP +G+CS+L +L+ S N LSG +P  L  
Sbjct  128   LSGSIPDVFFRQCRSLRSISLANNDFSGEIPPSVGSCSTLAVLNFSSNQLSGRLPSGLWS  187

Query  1639  LKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP  1511
             L  L+ L L  N LSG+IP  + +L NL A+++  NRL+G LP
Sbjct  188   LYGLRSLDLSGNSLSGDIPMGISRLYNLRAISLHGNRLSGWLP  230


 Score = 58.9 bits (141),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 43/118 (36%), Positives = 62/118 (53%), Gaps = 0/118 (0%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G +PE +        L +  NS +G +P  IG   SL  L+LS N  SG IP+++  L
Sbjct  249   LTGSLPETLQNLSMCSYLSMGSNSFSGDVPVWIGEMRSLETLNLSSNWFSGQIPDSIGKL  308

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGN  1463
             + +K L    N L+G +P+ +G  ++LL V+ S N LTG LP       L   +I GN
Sbjct  309   QLVKRLDFSHNGLTGSLPESIGTCKSLLEVDFSQNSLTGNLPTWIFESGLQVISISGN  366


 Score = 58.5 bits (140),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 40/102 (39%), Positives = 60/102 (59%), Gaps = 0/102 (0%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G +P+DI     L  L L GN LTG++P  + N S  + LS+  N+ SG +P  +  +
Sbjct  225   LSGWLPDDIGGCLLLKSLDLGGNLLTGSLPETLQNLSMCSYLSMGSNSFSGDVPVWIGEM  284

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP  1511
             + L+ L L  N  SG+IP  +GKL+ +  ++ S+N LTG LP
Sbjct  285   RSLETLNLSSNWFSGQIPDSIGKLQLVKRLDFSHNGLTGSLP  326



>ref|XP_006429586.1| hypothetical protein CICLE_v10010994mg [Citrus clementina]
 gb|ESR42826.1| hypothetical protein CICLE_v10010994mg [Citrus clementina]
Length=969

 Score =   403 bits (1036),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 247/548 (45%), Positives = 353/548 (64%), Gaps = 37/548 (7%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G IP  I  + SL  L+L+ N L+G IP QI NCSSLT L LS NNL+G +P  ++ L
Sbjct  448   LNGTIPPQIGGAVSLKELKLEKNFLSGRIPSQIKNCSSLTSLILSQNNLTGPVPAAIANL  507

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
               LK + L  N LSG +P++L  L +LL+ N+S+N L G LP G  F  +  S++ GN  
Sbjct  508   SNLKYVDLSFNDLSGILPKELINLSHLLSFNISHNHLHGELPVGGFFNTISPSSVSGNPS  567

Query  1456  ICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHR--FLsvsai  1283
             +C  ++   C     KPIV+NP             +++ P     +  H R   LS+SA+
Sbjct  568   LCGSVVNRSCPAVQNKPIVLNP-------------NSSNPYTGNSSPNHRRKIVLSISAL  614

Query  1282  vaisaaaiiavgvmvITMVNASVRRRISFVENAL------ESMCSSTSSRSQGMATGKLI  1121
             +AI AAA IA+GV+ +T++N  VR  +S    AL      +  CS T   + G    KL+
Sbjct  615   IAIGAAAFIAIGVIAVTVLNIRVRSSMSRAAAALSFSGGEDYSCSPTKDPNYG----KLV  670

Query  1120  LFDTKSSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYP  941
             +F   +  ++A+    ++LNK  E+G G FG VY+  L  +  R VAIKKLT S +++  
Sbjct  671   MFSGDA--EFAAGA-NALLNKDCELGRGGFGVVYRTIL--QDGRSVAIKKLTVSGLIKSQ  725

Query  940   EDFDREVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLT  761
             EDF++E++ LGK RH NLV L GYYWTP LQLL+ +F+  G+L   LH+     +   L+
Sbjct  726   EDFEKEMKTLGKIRHHNLVALEGYYWTPSLQLLIYEFISSGSLYKHLHD---GSSRNCLS  782

Query  760   WAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDR  581
             W  RF IILG AKGLA+LHH+    IIHYN+K +N+L+D +  PK+ DFGLARL+  LDR
Sbjct  783   WRQRFNIILGMAKGLAYLHHT---NIIHYNLKSTNVLIDSSGEPKVGDFGLARLLPMLDR  839

Query  580   HVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILND  401
              ++S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE+VTG+RPVEY ED+V++L D
Sbjct  840   CILSSKIQSALGYMAPEFACRTVKITEKCDVYGFGVLVLEVVTGKRPVEYMEDDVVVLCD  899

Query  400   HVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIK  224
              VR  LE G V +CVD  + G +P +E +PV+KL L+C SQ+PS+RP M EVV IL++I+
Sbjct  900   MVRGALEDGRVEDCVDARLRGNFPADEAIPVIKLGLICASQVPSNRPDMEEVVNILELIQ  959

Query  223   TPVPNRME  200
             +P+  + E
Sbjct  960   SPLDGQEE  967


 Score = 64.7 bits (156),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 44/120 (37%), Positives = 67/120 (56%), Gaps = 0/120 (0%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             ++L G +P+ +    S   L L GNS TG +P  IG  ++L  L LS N  S  IP ++ 
Sbjct  250   NSLSGSLPDSLQRLNSCSSLSLKGNSFTGEVPDWIGKLANLESLDLSLNQFSVRIPSSIG  309

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGN  1463
              L  LK L + +NQ +G +P+ +    NLLA++VS N+LTG +P       L + ++ GN
Sbjct  310   NLVFLKELNISMNQFTGGLPESMMNCGNLLAIDVSQNKLTGNIPTWIFKMGLQTVSLSGN  369


 Score = 59.7 bits (143),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 38/103 (37%), Positives = 61/103 (59%), Gaps = 0/103 (0%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L GEI + I     L  ++L  N  +G +P  IG CS L +L    N+LSG++P++L  L
Sbjct  204   LEGEIVKGISNLYDLRAIKLGKNKFSGQLPEDIGGCSMLKVLDFGVNSLSGSLPDSLQRL  263

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPA  1508
                  L L+ N  +GE+P  +GKL NL ++++S N+ + R+P+
Sbjct  264   NSCSSLSLKGNSFTGEVPDWIGKLANLESLDLSLNQFSVRIPS  306


 Score = 54.7 bits (130),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 57/89 (64%), Gaps = 0/89 (0%)
 Frame = -1

Query  1774  LGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSMLKRLKILKLEVNQLS  1595
             L +L L  N+L+G IP  IG+ SSL LL++S N L G+IP ++  LK +++L    N L+
Sbjct  390   LQVLDLSSNALSGVIPSNIGDLSSLMLLNMSMNYLFGSIPASIGKLKAIQVLDFSDNWLN  449

Query  1594  GEIPQQLGKLENLLAVNVSYNRLTGRLPA  1508
             G IP Q+G   +L  + +  N L+GR+P+
Sbjct  450   GTIPPQIGGAVSLKELKLEKNFLSGRIPS  478



>ref|XP_009372024.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Pyrus x bretschneideri]
Length=965

 Score =   403 bits (1036),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 241/548 (44%), Positives = 342/548 (62%), Gaps = 37/548 (7%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G IP++I  + SL  L+L  N LTG +P +I  CSSLT L LS NNL+G IP  ++ L
Sbjct  444   LSGSIPDEIGGAISLKELRLQKNFLTGKVPAEIVKCSSLTNLILSRNNLTGPIPTAIANL  503

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
               L+ + L +N+ SG IP++L  L +LL  NVS+N L G LP G  F  +  S++ GN  
Sbjct  504   TNLQYVDLSLNKFSGGIPKELTNLSHLLYFNVSHNHLEGELPLGGFFNTIPPSSVLGNPS  563

Query  1456  ICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRH-HRFLsvsaiv  1280
             +C   +   C    PKPIV+NP             +++ P+  +    H H+ +   + +
Sbjct  564   LCGSAVNRACPSVHPKPIVLNP-------------NSSNPVGGSSAPTHGHKIIFSISAL  610

Query  1279  aisaaaiiavg-vmvITMVNASVRRRISFVENALE------SMCSSTSSRSQGMATGKLI  1121
                 AA+     V+ +T++N   R   S     LE        CS T+  + G    KL+
Sbjct  611   IAIGAAVFIAIGVIAVTILNMHARSSSSLSTAPLELSGGEEYSCSPTNDPNYG----KLV  666

Query  1120  LFDTKSSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYP  941
             +F   +  D+A+ T +++LNK  E+G G FG VYK  L     R VAIKKL+ S +++  
Sbjct  667   MFSGDA--DFAAGT-QALLNKDCELGRGGFGVVYKTAL--RDGRSVAIKKLSVSSLIKSQ  721

Query  940   EDFDREVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLT  761
             E F+REV+ LGK RH+NLV L GYYWTP LQL++ +++P G+L   LH+         LT
Sbjct  722   EVFEREVKGLGKIRHRNLVALEGYYWTPSLQLIIYEYIPCGSLFKNLHD---GPGKTCLT  778

Query  760   WAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDR  581
             W  RF IILG AKGLAHLH   Q  IIHYN+K +N+L+D N  PK+ D GLARL+  LDR
Sbjct  779   WRQRFHIILGMAKGLAHLH---QMNIIHYNLKSTNVLIDNNGEPKVGDIGLARLLPTLDR  835

Query  580   HVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILND  401
              ++S++ Q+A+GY+APE ACQ++++ EKCDVYGFG+L+LE+VTG+RPVEY ED+V++L D
Sbjct  836   CILSSKIQSALGYMAPEFACQTVKITEKCDVYGFGILVLEVVTGKRPVEYMEDDVIVLCD  895

Query  400   HVRVLLEQGNVLECVDQG-MGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIK  224
              VR  LE+G V EC+D+  +G +P EE +PV+KL L+C SQ+PS+RP M EV+ IL++I+
Sbjct  896   MVRGALEEGRVEECLDKNLLGNFPAEEAIPVIKLGLICASQVPSNRPDMNEVINILELIQ  955

Query  223   TPVPNRME  200
              P   + E
Sbjct  956   CPSEGQEE  963


 Score = 62.4 bits (150),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 47/116 (41%), Positives = 65/116 (56%), Gaps = 0/116 (0%)
 Frame = -1

Query  1810  GEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSMLKR  1631
             G IP+ I    S   L L GN L G +P  +G+  +L +L +S NNLSG IP +L  L+ 
Sbjct  250   GRIPDSIQSLNSCTSLSLQGNFLAGQVPNWLGDLKNLVMLDVSGNNLSGEIPSSLGNLEV  309

Query  1630  LKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGN  1463
             L+ L L  N  +G +P  L    NLLA++VS+N L G+LP+      L S  + GN
Sbjct  310   LEKLNLSRNGFTGSLPDALANCINLLAIDVSHNLLAGKLPSWIFKLGLRSVLLSGN  365


 Score = 60.8 bits (146),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 39/103 (38%), Positives = 61/103 (59%), Gaps = 0/103 (0%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G++PE +     L ++ L  N  +G +P  IG+C  L LL  S N  SG IP+++  L
Sbjct  200   LEGQVPEGMENLYDLRVINLGENRFSGQLPRNIGSCLQLKLLDFSDNLFSGRIPDSIQSL  259

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPA  1508
                  L L+ N L+G++P  LG L+NL+ ++VS N L+G +P+
Sbjct  260   NSCTSLSLQGNFLAGQVPNWLGDLKNLVMLDVSGNNLSGEIPS  302


 Score = 58.9 bits (141),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 41/113 (36%), Positives = 66/113 (58%), Gaps = 3/113 (3%)
 Frame = -1

Query  1822  SALIGEIPEDIC-ESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETL  1646
             ++L G IPE+   + GSL ++   GN+LTG IP  +  C +L  ++ S N LSG +P  +
Sbjct  125   NSLSGSIPEEFFKQCGSLRVVSFAGNNLTGRIPESLSLCQTLVEVNFSSNWLSGKLPPGI  184

Query  1645  SMLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP--AGSIFQ  1493
               L+ L+ + L  N L G++P+ +  L +L  +N+  NR +G+LP   GS  Q
Sbjct  185   WYLRMLQSIDLSDNLLEGQVPEGMENLYDLRVINLGENRFSGQLPRNIGSCLQ  237



>ref|XP_010092789.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Morus notabilis]
 gb|EXB52375.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Morus notabilis]
Length=957

 Score =   402 bits (1034),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 251/546 (46%), Positives = 351/546 (64%), Gaps = 32/546 (6%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G IP +I  + SL  L+L  N LTG IPPQI  CS LT L LS NNLSG IP  L+ L
Sbjct  435   LNGTIPSEIGGAKSLKDLRLQKNLLTGKIPPQIEKCSELTSLILSQNNLSGPIPAALANL  494

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
               L+ +    N+LSG +P++L  L  LL+ NVS+N + G LP G  F  +  S++ GN  
Sbjct  495   TNLQYVDFSFNELSGSLPKELTNLSRLLSFNVSHNHIEGELPVGGFFNTISPSSVSGNPS  554

Query  1456  ICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRFLsvsaiva  1277
             +C  ++   C    PKPIV+NP    +   +++    ++ +           LS+SA++A
Sbjct  555   LCGSVVDRSCPNVHPKPIVLNPNSSNSSGGSSSPNYGHKKI----------ILSISALIA  604

Query  1276  isaaaiiavgvmvITMVNASVRRRISFVENAL------ESMCSSTSSRSQGMATGKLILF  1115
             I AAA I +GV+ IT++N   R  +S     L      +  CS T+  + G    KL++F
Sbjct  605   IGAAAFIVIGVIAITVLNIHARSSMSRAAAPLTFSGGEDPSCSPTTDPNYG----KLVMF  660

Query  1114  DTKSSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPED  935
                +  D+ + T +++LNK  E+G G FG VY+  L     R VAIKKLT S +++  E+
Sbjct  661   SGDA--DFVAGT-QALLNKDCELGRGGFGVVYRTVL--RDGRSVAIKKLTVSSLIKSQEE  715

Query  934   FDREVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWA  755
             F+REV+ LGK RH NLV L GYYWTP LQLL+ +++P G+L   LH+    ++   LTW 
Sbjct  716   FEREVKTLGKIRHHNLVALEGYYWTPSLQLLIYEYIPSGSLYKHLHDGPDRVS---LTWR  772

Query  754   VRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHV  575
              RF IILG AKGLAHLH   Q  IIHYN+K +N+L+D +  PK+ DFGLARL+  LDR +
Sbjct  773   QRFGIILGMAKGLAHLH---QMNIIHYNLKSTNVLMDGSCEPKLGDFGLARLLPMLDRCI  829

Query  574   MSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHV  395
             +S++ Q+A+GY+APE ACQ++++ EKCDVYGFG+L+LE+VTG+RPVEY ED+V++L D V
Sbjct  830   LSSKIQSALGYMAPEFACQTVKITEKCDVYGFGVLLLEVVTGKRPVEYMEDDVVVLCDMV  889

Query  394   RVLLEQGNVLECVDQGMGG-YPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTP  218
             R  LE+G V ECVD+ + G +P EE +PV+KL L+C SQ+PS+RP M EVV IL++I+ P
Sbjct  890   RGALEEGRVEECVDERLQGIFPAEEAIPVIKLGLICASQVPSNRPDMTEVVNILELIQCP  949

Query  217   VPNRME  200
                + E
Sbjct  950   SEGQEE  955


 Score = 58.9 bits (141),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 46/115 (40%), Positives = 66/115 (57%), Gaps = 0/115 (0%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G +PE +    S   L L GNS  G +P  IG   +L +L LS NN SG IP ++  L
Sbjct  248   LSGRLPESMQRLSSCSSLSLGGNSFIGEVPEWIGELINLEVLDLSKNNFSGWIPVSIGNL  307

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAI  1472
             + L+ L L +N+ SG +P+ +    NLLA++VS+N L G LP+    Q L S ++
Sbjct  308   QLLEKLNLSMNEFSGSLPESMSNCTNLLALDVSHNLLGGSLPSWIFKQGLQSVSL  362


 Score = 56.2 bits (134),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 43/104 (41%), Positives = 59/104 (57%), Gaps = 1/104 (1%)
 Frame = -1

Query  1816  LIGEIPEDICES-GSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSM  1640
             L G+IP++  +  GSL  +   GN LTG IP  I +C SLT ++ S N LSG +P  L  
Sbjct  127   LSGQIPDEFFQQCGSLREVSFAGNGLTGQIPESISSCFSLTKVNFSSNKLSGKLPSGLWN  186

Query  1639  LKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPA  1508
             L+ L++L L  N L GEIPQ +  L  L  ++   N  +G LP 
Sbjct  187   LRGLELLDLSDNFLEGEIPQGVEILYALKTISFRKNWFSGNLPG  230


 Score = 54.3 bits (129),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 54/104 (52%), Gaps = 0/104 (0%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             + L G+IPE I    SL  +    N L+G +P  + N   L LL LS N L G IP+ + 
Sbjct  150   NGLTGQIPESISSCFSLTKVNFSSNKLSGKLPSGLWNLRGLELLDLSDNFLEGEIPQGVE  209

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP  1511
             +L  LK +    N  SG +P  +G    L  V+ S N L+GRLP
Sbjct  210   ILYALKTISFRKNWFSGNLPGDIGGCLELRFVDFSENFLSGRLP  253



>ref|XP_006481196.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Citrus sinensis]
Length=967

 Score =   403 bits (1035),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 247/548 (45%), Positives = 353/548 (64%), Gaps = 37/548 (7%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G IP  I  + SL  L+L+ N L+G IP QI NCSSLT L LS NNL+G +P  ++ L
Sbjct  446   LNGTIPPQIGGAVSLKELKLEKNFLSGRIPSQIKNCSSLTSLILSQNNLTGPVPAAIANL  505

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
               LK + L  N LSG +P++L  L +LL+ N+S+N L G LP G  F  +  S++ GN  
Sbjct  506   SNLKYVDLSFNDLSGILPKELINLSHLLSFNISHNHLHGELPVGGFFNTISPSSVSGNPS  565

Query  1456  ICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHR--FLsvsai  1283
             +C  ++   C     KPIV+NP             +++ P     +  H R   LS+SA+
Sbjct  566   LCGSVVNRSCPAVQNKPIVLNP-------------NSSNPYTGNSSPNHRRKIVLSISAL  612

Query  1282  vaisaaaiiavgvmvITMVNASVRRRISFVENAL------ESMCSSTSSRSQGMATGKLI  1121
             +AI AAA IA+GV+ +T++N  VR  +S    AL      +  CS T   + G    KL+
Sbjct  613   IAIGAAAFIAIGVIAVTVLNIRVRSSMSRAAAALSFSGGEDYSCSPTKDPNYG----KLV  668

Query  1120  LFDTKSSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYP  941
             +F   +  ++A+    ++LNK  E+G G FG VY+  L  +  R VAIKKLT S +++  
Sbjct  669   MFSGDA--EFAAGA-NALLNKDCELGRGGFGVVYRTIL--QDGRSVAIKKLTVSGLIKSQ  723

Query  940   EDFDREVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLT  761
             EDF++E++ LGK RH NLV L GYYWTP LQLL+ +F+  G+L   LH+     +   L+
Sbjct  724   EDFEKEMKTLGKIRHHNLVALEGYYWTPSLQLLIYEFISSGSLYKHLHD---GSSRNCLS  780

Query  760   WAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDR  581
             W  RF IILG AKGLA+LHH+    IIHYN+K +N+L+D +  PK+ DFGLARL+  LDR
Sbjct  781   WRQRFNIILGMAKGLAYLHHT---NIIHYNLKSTNVLIDSSGEPKVGDFGLARLLPMLDR  837

Query  580   HVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILND  401
              ++S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE+VTG+RPVEY ED+V++L D
Sbjct  838   CILSSKIQSALGYMAPEFACRTVKITEKCDVYGFGVLVLEVVTGKRPVEYMEDDVVVLCD  897

Query  400   HVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIK  224
              VR  LE G V +CVD  + G +P +E +PV+KL L+C SQ+PS+RP M EVV IL++I+
Sbjct  898   MVRGALEDGRVEDCVDARLRGNFPADEAIPVIKLGLICASQVPSNRPDMEEVVNILELIQ  957

Query  223   TPVPNRME  200
             +P+  + E
Sbjct  958   SPLDGQEE  965


 Score = 64.7 bits (156),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 44/120 (37%), Positives = 67/120 (56%), Gaps = 0/120 (0%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             ++L G +P+ +    S   L L GNS TG +P  IG  ++L  L LS N  S  IP ++ 
Sbjct  248   NSLSGSLPDSLQRLNSCSSLSLKGNSFTGEVPDWIGKLANLESLDLSLNQFSVRIPSSIG  307

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGN  1463
              L  LK L + +NQ +G +P+ +    NLLA++VS N+LTG +P       L + ++ GN
Sbjct  308   NLVFLKELNISMNQFTGGLPESMMNCGNLLAIDVSQNKLTGNIPTWIFKMGLQTVSLSGN  367


 Score = 59.3 bits (142),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 38/103 (37%), Positives = 61/103 (59%), Gaps = 0/103 (0%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L GEI + I     L  ++L  N  +G +P  IG CS L +L    N+LSG++P++L  L
Sbjct  202   LEGEIVKGISNLYDLRAIKLGKNKFSGQLPEDIGGCSMLKVLDFGVNSLSGSLPDSLQRL  261

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPA  1508
                  L L+ N  +GE+P  +GKL NL ++++S N+ + R+P+
Sbjct  262   NSCSSLSLKGNSFTGEVPDWIGKLANLESLDLSLNQFSVRIPS  304


 Score = 54.7 bits (130),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 57/89 (64%), Gaps = 0/89 (0%)
 Frame = -1

Query  1774  LGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSMLKRLKILKLEVNQLS  1595
             L +L L  N+L+G IP  IG+ SSL LL++S N L G+IP ++  LK +++L    N L+
Sbjct  388   LQVLDLSSNALSGVIPSNIGDLSSLMLLNMSMNYLFGSIPASIGKLKAIQVLDFSDNWLN  447

Query  1594  GEIPQQLGKLENLLAVNVSYNRLTGRLPA  1508
             G IP Q+G   +L  + +  N L+GR+P+
Sbjct  448   GTIPPQIGGAVSLKELKLEKNFLSGRIPS  476



>gb|KDO64103.1| hypothetical protein CISIN_1g002094mg [Citrus sinensis]
Length=967

 Score =   402 bits (1034),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 247/548 (45%), Positives = 353/548 (64%), Gaps = 37/548 (7%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G IP  I  + SL  L+L+ N L+G IP QI NCSSLT L LS NNL+G +P  ++ L
Sbjct  446   LNGTIPPQIGGAVSLKELKLEKNFLSGRIPSQIKNCSSLTSLILSQNNLTGPVPAAIANL  505

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
               LK + L  N LSG +P++L  L +LL+ N+S+N L G LP G  F  +  S++ GN  
Sbjct  506   SNLKYVDLSFNDLSGILPKELINLSHLLSFNISHNHLHGELPVGGFFNTISPSSVSGNPS  565

Query  1456  ICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHR--FLsvsai  1283
             +C  ++   C     KPIV+NP             +++ P     +  H R   LS+SA+
Sbjct  566   LCGSVVNRSCPAVQNKPIVLNP-------------NSSNPYTGNSSPNHRRKIVLSISAL  612

Query  1282  vaisaaaiiavgvmvITMVNASVRRRISFVENAL------ESMCSSTSSRSQGMATGKLI  1121
             +AI AAA IA+GV+ +T++N  VR  +S    AL      +  CS T   + G    KL+
Sbjct  613   IAIGAAAFIAIGVIAVTVLNIRVRSSMSRAAAALSFSGGEDYSCSPTKDPNYG----KLV  668

Query  1120  LFDTKSSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYP  941
             +F   +  ++A+    ++LNK  E+G G FG VY+  L  +  R VAIKKLT S +++  
Sbjct  669   MFSGDA--EFAAGA-NALLNKDCELGRGGFGVVYRTIL--QDGRSVAIKKLTVSGLIKSQ  723

Query  940   EDFDREVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLT  761
             EDF++E++ LGK RH NLV L GYYWTP LQLL+ +F+  G+L   LH+     +   L+
Sbjct  724   EDFEKEMKTLGKIRHHNLVALEGYYWTPSLQLLIYEFISSGSLYKHLHD---GSSRNCLS  780

Query  760   WAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDR  581
             W  RF IILG AKGLA+LHH+    IIHYN+K +N+L+D +  PK+ DFGLARL+  LDR
Sbjct  781   WRQRFNIILGMAKGLAYLHHT---NIIHYNLKSTNVLIDSSGEPKVGDFGLARLLPMLDR  837

Query  580   HVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILND  401
              ++S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE+VTG+RPVEY ED+V++L D
Sbjct  838   CILSSKIQSALGYMAPEFACRTVKITEKCDVYGFGVLVLEVVTGKRPVEYMEDDVVVLCD  897

Query  400   HVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIK  224
              VR  LE G V +CVD  + G +P +E +PV+KL L+C SQ+PS+RP M EVV IL++I+
Sbjct  898   MVRGALEDGRVEDCVDARLRGNFPADEAIPVIKLGLICASQVPSNRPDMEEVVNILELIQ  957

Query  223   TPVPNRME  200
             +P+  + E
Sbjct  958   SPLDGQEE  965


 Score = 68.2 bits (165),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 45/120 (38%), Positives = 68/120 (57%), Gaps = 0/120 (0%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             ++L G +P+ +    S   L L GNS TG +P  IG  ++L  L LS N  SG IP ++ 
Sbjct  248   NSLSGSLPDSLQRLNSCSSLSLKGNSFTGEVPDWIGKLANLESLDLSLNQFSGRIPSSIG  307

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGN  1463
              L  LK L + +NQ +G +P+ +    NLLA++VS N+LTG +P       L + ++ GN
Sbjct  308   NLVFLKELNISMNQFTGGLPESMMNCGNLLAIDVSQNKLTGNIPTWIFKMGLQTVSLSGN  367


 Score = 63.2 bits (152),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 39/103 (38%), Positives = 62/103 (60%), Gaps = 0/103 (0%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L GEI + I     L  ++L  N  +G +P  IG CS L +L    N+LSG++P++L  L
Sbjct  202   LEGEIVKGISNLYDLRAIKLGKNKFSGQLPEDIGGCSMLKVLDFGVNSLSGSLPDSLQRL  261

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPA  1508
                  L L+ N  +GE+P  +GKL NL ++++S N+ +GR+P+
Sbjct  262   NSCSSLSLKGNSFTGEVPDWIGKLANLESLDLSLNQFSGRIPS  304


 Score = 54.7 bits (130),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 57/89 (64%), Gaps = 0/89 (0%)
 Frame = -1

Query  1774  LGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSMLKRLKILKLEVNQLS  1595
             L +L L  N+L+G IP  IG+ SSL LL++S N L G+IP ++  LK +++L    N L+
Sbjct  388   LQVLDLSSNALSGVIPSNIGDLSSLMLLNMSMNYLFGSIPASIGKLKAIQVLDFSDNWLN  447

Query  1594  GEIPQQLGKLENLLAVNVSYNRLTGRLPA  1508
             G IP Q+G   +L  + +  N L+GR+P+
Sbjct  448   GTIPPQIGGAVSLKELKLEKNFLSGRIPS  476



>gb|EAY76307.1| hypothetical protein OsI_04242 [Oryza sativa Indica Group]
Length=947

 Score =   402 bits (1032),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 237/537 (44%), Positives = 345/537 (64%), Gaps = 22/537 (4%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G +P +I  + +L  L+L  NS TG IP QIGNCSSL  L LSHNNL+G+IP T+  L
Sbjct  420   LDGGVPPEIGGAVALRELRLGRNSFTGHIPSQIGNCSSLVALDLSHNNLTGSIPSTVGNL  479

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
               L+++ L  N+L+G +P +L  L +L   +VS+N L+G LP    F N+  + +  N G
Sbjct  480   TSLEVVDLSKNKLNGTLPVELSNLPSLRIFDVSHNLLSGDLPNSRFFDNIPETFLSDNQG  539

Query  1456  ICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRFLsvsaiva  1277
             +CS      C    PKPIV+NP    N          ++   +  +S HH+ + +S    
Sbjct  540   LCSSRKNNSCIAIMPKPIVLNPNSSTNP--------LSQATPTAPSSMHHKKIILSVSTL  591

Query  1276  isaaaiiavgvmvITMVNASVRRRISFVENALESMCSS---TSSRSQGMATGKLILFDTK  1106
             I+ A    + + VI +   + R R +   +A  +  S    + S     ++GKL++F  K
Sbjct  592   IAIAGGGTIIIGVIIISVLNRRARATTSRSAPATALSDDYLSQSPENDASSGKLVMFG-K  650

Query  1105  SSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDFDR  926
              SP++ S+   ++LNK  E+G G FG VYK  L     + VAIKKLT S +++  +DF+R
Sbjct  651   GSPEF-SAGGHALLNKDCELGRGGFGAVYKTVL--RDGQPVAIKKLTVSSLVKSKDDFER  707

Query  925   EVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAVRF  746
             +V++L K RH N+V LRG+YWT  LQLL+ D++P GNL   LHE     +   L+W  RF
Sbjct  708   QVKLLSKVRHHNVVALRGFYWTSSLQLLIYDYLPGGNLHKHLHECTEDNS---LSWMERF  764

Query  745   KIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVMSN  566
              IILG A+GL HLH   Q  IIHYN+K SN+LLD N  P++ D+GLA+L+  LDR+V+S+
Sbjct  765   DIILGVARGLTHLH---QRGIIHYNLKSSNVLLDSNGEPRVGDYGLAKLLPMLDRYVLSS  821

Query  565   RFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRVL  386
             + Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE++TGRRPVEY ED+V++L D VR  
Sbjct  822   KIQSALGYMAPEFACKTVKITEKCDVYGFGVLVLEVLTGRRPVEYLEDDVVVLCDLVRSA  881

Query  385   LEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTP  218
             LE+G + +C+D  + G +P EE LP++KL LVCTSQ+PS+RP M EVV IL+++++P
Sbjct  882   LEEGRLEDCMDPRLCGEFPMEEALPIIKLGLVCTSQVPSNRPDMGEVVNILELVRSP  938


 Score = 54.3 bits (129),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 56/102 (55%), Gaps = 0/102 (0%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G +P     S SL  + L  N L G IP  +G  + L  L + HN  +G +PE+L  L
Sbjct  205   LSGSVPGGFPGSSSLRAVDLSRNLLAGEIPADVGEAALLKSLDVGHNLFTGGLPESLRRL  264

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP  1511
               L+ L +  N L+GE+P  +G++  L  +++S NR +G +P
Sbjct  265   SALRFLGVGGNALAGEVPSWIGEMWALERLDLSGNRFSGAIP  306



>ref|XP_006341303.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Solanum tuberosum]
Length=982

 Score =   402 bits (1034),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 241/539 (45%), Positives = 354/539 (66%), Gaps = 30/539 (6%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G IP +I  + SL  L+L  N L+GTIP  I NCS+L+ L LSHNNL+G IP  ++ L
Sbjct  460   LNGSIPSEIGSAVSLLELKLRENHLSGTIPADIANCSALSSLDLSHNNLTGPIPPEIAKL  519

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
               L+++    NQ SG +P++L  L +L   NVS+N L G LP G  F  +  S++ GN  
Sbjct  520   TILEVVDFSFNQFSGSLPKELTNLSHLATFNVSHNHLKGELPVGGFFNTISPSSVVGNPS  579

Query  1456  ICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHR--FLsvsai  1283
             +C  +L   C    PKP+V+NP             ++++P  ++  S  H+   LS+S++
Sbjct  580   LCGSVLNHSCPAVHPKPLVLNP-------------NSSDPNHASVTSLGHKRIMLSISSL  626

Query  1282  vaisaaaiiavgvmvITMVNASVRRRISFVENALESMCSSTSSRSQGMAT--GKLILFDT  1109
             +AI AA  IA+GV+V++++N  VR  ++              S S G     GKL++F  
Sbjct  627   IAIGAAVFIALGVVVVSILNLHVRSSMALSAATFTLSGGDDFSHSHGTEANLGKLVMFSG  686

Query  1108  KSSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDFD  929
              +  D+   T +++LNK +E+G G FG+VYK  LG    R VAIKKL  + +++  EDF+
Sbjct  687   DA--DFVVGT-QALLNKDNELGRGGFGSVYKTELGD--GRSVAIKKLNITSLIKSQEDFE  741

Query  928   REVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAVR  749
             RE++ LG  RH+NLV L GYYWTP LQLL++++V  G+L   LHE +   +   L+W  R
Sbjct  742   REMKSLGSIRHENLVALEGYYWTPSLQLLINEYVSGGSLYKLLHEES---SKRSLSWQQR  798

Query  748   FKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDE-NLNPKISDFGLARLVAKLDRHVM  572
             F IIL TAKGLA+LH   Q  IIHYN+K +N+L+D+ + + K+ DFGLARL+  LDR+++
Sbjct  799   FNIILDTAKGLAYLH---QLNIIHYNMKSTNVLIDDGSASTKVGDFGLARLLPVLDRYIL  855

Query  571   SNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVR  392
             S++ Q+A+GY+APE ACQ++++ EKCDVYGFG+LILE+VTG+RP+EY ED+V++L D VR
Sbjct  856   SSKIQSALGYMAPEFACQTVKITEKCDVYGFGILILEVVTGKRPMEYMEDDVIVLCDMVR  915

Query  391   VLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTP  218
               LE+G + EC+D  + G +P EE +PV+KL L+C SQ+PS+RP M EV++IL++I+ P
Sbjct  916   GALEEGRIEECIDGRLQGNFPVEEAIPVVKLGLICASQVPSNRPDMEEVIKILELIRCP  974


 Score = 60.8 bits (146),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 42/90 (47%), Positives = 58/90 (64%), Gaps = 0/90 (0%)
 Frame = -1

Query  1777  SLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSMLKRLKILKLEVNQL  1598
             SL +L L  N+L+G IP  I N SSL +L++S N LSGTIPE +  L   +IL L  NQL
Sbjct  401   SLQVLDLSSNALSGEIPAAIWNISSLQVLNISRNFLSGTIPEAVGKLNATRILDLSHNQL  460

Query  1597  SGEIPQQLGKLENLLAVNVSYNRLTGRLPA  1508
             +G IP ++G   +LL + +  N L+G +PA
Sbjct  461   NGSIPSEIGSAVSLLELKLRENHLSGTIPA  490


 Score = 59.7 bits (143),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 38/101 (38%), Positives = 60/101 (59%), Gaps = 0/101 (0%)
 Frame = -1

Query  1810  GEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSMLKR  1631
             GEIP+ I    SL  + L  N  TG +P  IGNC  L  + LS N L+G +PE++  L  
Sbjct  219   GEIPKAIEGLYSLRSINLHKNKFTGWLPENIGNCVQLKSIDLSDNLLNGELPESMRRLGF  278

Query  1630  LKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPA  1508
                ++L  N L+G+IP  + ++++L  +++S N L+GR+P 
Sbjct  279   CTNMELRSNLLNGQIPDWIAEMKSLKVLDLSANNLSGRIPT  319


 Score = 53.5 bits (127),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 44/118 (37%), Positives = 65/118 (55%), Gaps = 0/118 (0%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L GE+PE +   G    ++L  N L G IP  I    SL +L LS NNLSG IP ++  +
Sbjct  265   LNGELPESMRRLGFCTNMELRSNLLNGQIPDWIAEMKSLKVLDLSANNLSGRIPTSMGDV  324

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGN  1463
               LK L L  N   G +P+ L K  +L+ +++  N LTG LP+ +    ++S ++ GN
Sbjct  325   SLLKELNLSNNYFVGSLPRSLMKCNDLVILDIGNNFLTGNLPSWTFELGVESISLSGN  382



>ref|XP_010043193.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Eucalyptus grandis]
 gb|KCW88339.1| hypothetical protein EUGRSUZ_A00726 [Eucalyptus grandis]
Length=962

 Score =   401 bits (1031),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 248/547 (45%), Positives = 354/547 (65%), Gaps = 34/547 (6%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G IP +I  + SL  L+LD N L+G IP QIG CS+LT L LS NNL+G +P  ++ L
Sbjct  440   LNGSIPPEIGVAISLKDLKLDKNFLSGNIPTQIGACSNLTSLILSQNNLTGPVPPAMANL  499

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
               L+ + L +N LSG +P++L  L  L+  N+S+N L G LP G  F  +  +++ GN  
Sbjct  500   TNLEHVDLSLNNLSGSLPKELANLSRLVYFNISHNHLEGELPVGGFFNTIPLASVSGNPS  559

Query  1456  ICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRF-Lsvsaiv  1280
             +C  ++   C    PKPIV+NP    N ++           AS+ + +H R  LS+S+++
Sbjct  560   LCGSIVNDSCPSVHPKPIVLNP----NSSNPAGA-------ASSSDHQHKRIILSISSLI  608

Query  1279  aisaaaiiavgvmvITMVNASVRRRISFVENAL------ESMCSSTSSRSQGMATGKLIL  1118
             AI AAA IA+GVM IT++N  VR  ++    AL      +  CS T+  + G    KL++
Sbjct  609   AIGAAAFIAIGVMTITLLNIHVRSSMAHSAPALTLSGGEDFSCSPTADPNYG----KLVM  664

Query  1117  FDTKSSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPE  938
             F   ++     +   ++LNK SE+G G FG VY+  L     R VAIKKLT+S +++  +
Sbjct  665   FSGDAN---FFTGAHALLNKDSELGRGGFGVVYRTVL--RDGRSVAIKKLTASGLMKSQD  719

Query  937   DFDREVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTW  758
             DF+REV+ LGK  H NLV L GYYWT  LQLL+ +FVP G+L   LH+   A     LTW
Sbjct  720   DFEREVKTLGKIWHPNLVKLEGYYWTSSLQLLIYEFVPSGSLYKHLHD---ADERNSLTW  776

Query  757   AVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRH  578
               RF IILG AKGL++LH   Q  ++HYN+K +N+LLD +   K+ DFGLARL+  LDR 
Sbjct  777   RQRFNIILGMAKGLSYLH---QMGVVHYNLKSTNVLLDGSGEAKVGDFGLARLLPMLDRC  833

Query  577   VMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDH  398
             ++S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LEI+TGRRPVEY ED+V++L D 
Sbjct  834   ILSSKIQSALGYMAPEFACRTVKITEKCDVYGFGILVLEIITGRRPVEYMEDDVVVLCDM  893

Query  397   VRVLLEQGNVLECVDQGMGG-YPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKT  221
             VR  LE+  V +C+D  +GG +P EE +PV+KL L+C SQ+PS+RP M+EVV IL++I+ 
Sbjct  894   VRGALEENKVEKCIDGSLGGSFPPEEAIPVIKLGLICASQVPSNRPEMSEVVNILELIQC  953

Query  220   PVPNRME  200
             P   + E
Sbjct  954   PSEGQEE  960


 Score = 57.0 bits (136),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 56/100 (56%), Gaps = 0/100 (0%)
 Frame = -1

Query  1810  GEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSMLKR  1631
             G +PE +   G    L + GN LTG IP  IG   +L  L LS N LSG+IP ++  ++ 
Sbjct  250   GSLPESMQRLGLCSSLDVHGNLLTGEIPDWIGELRNLKNLDLSRNELSGSIPPSIGNIQS  309

Query  1630  LKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP  1511
             LK L L  N L+G +P  +   +NL  ++VS N LTG  P
Sbjct  310   LKKLNLSTNLLTGSLPDSISNCKNLSVLDVSQNLLTGGFP  349


 Score = 55.8 bits (133),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 47/119 (39%), Positives = 67/119 (56%), Gaps = 1/119 (1%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L GEIP+ I E  +L  L L  N L+G+IPP IGN  SL  L+LS N L+G++P+++S  
Sbjct  272   LTGEIPDWIGELRNLKNLDLSRNELSGSIPPSIGNIQSLKKLNLSTNLLTGSLPDSISNC  331

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVN-VSYNRLTGRLPAGSIFQNLDSSAIEGN  1463
             K L +L +  N L+G  P +L      L+ N V  +     LPA +++ NL    I  N
Sbjct  332   KNLSVLDVSQNLLTGGFPFKLDTRGVSLSGNGVDESAEYTSLPATTLYNNLQVMDISSN  390



>emb|CDX72142.1| BnaC08g27320D [Brassica napus]
Length=936

 Score =   400 bits (1029),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 248/537 (46%), Positives = 345/537 (64%), Gaps = 21/537 (4%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G +P +   + SL  L+L+ N L GTIP  I NCSSL  L LSHN L G IP  ++ L
Sbjct  407   LNGTVPRETGGAFSLEKLRLENNMLDGTIPSSIKNCSSLQSLILSHNKLQGAIPPEMARL  466

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
               L+ + L  N+L+G +P+QL  L  L   N+S+NRL+G LPAG +F  +   ++ GN G
Sbjct  467   TNLQEVDLSFNELTGTLPKQLANLGYLHTFNISHNRLSGELPAGGLFNGISPDSVSGNQG  526

Query  1456  ICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRFLsvsaiva  1277
             IC  ++   C   +PKPIV+NP         +       PL +  + R     S+S+++A
Sbjct  527   ICGAVVNKSCPAVSPKPIVLNP-----NATFDPDSGEATPLGAVGHKRILL--SISSLIA  579

Query  1276  isaaaiiavgvmvITMVNASVRRRI---SFVENALESMCSSTSSRSQGMATGKLILFDTK  1106
             ISAAA I VGV+ IT++N  VR      S V  A       + S +    +GKL++F  +
Sbjct  580   ISAAAAIVVGVIAITVLNLRVRATTVSRSAVPIAFSGGDDFSRSPTTDSNSGKLVMFSGE  639

Query  1105  SSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDFDR  926
               PD+++ T  ++LNK  E+G G FG VY+  +  E    VAIKKLT S +++  E+F+R
Sbjct  640   --PDFSTGT-HALLNKDCELGRGGFGAVYRTVIRDE--YPVAIKKLTVSSLVKSQEEFER  694

Query  925   EVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAVRF  746
             EV+ LGK RH NLV L GYYWT  LQLL+ +F+  G+L   LHE     +T  L+W  RF
Sbjct  695   EVKKLGKLRHTNLVKLEGYYWTTSLQLLIYEFLSGGSLYKHLHEAPGGSST--LSWNDRF  752

Query  745   KIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVMSN  566
              +ILGTAK LA+LH   Q  IIHYNIK SN+LLD +  PK+ D+GLARL+  LDR+V+S+
Sbjct  753   NVILGTAKCLAYLH---QSNIIHYNIKSSNVLLDSSGEPKVGDYGLARLLPMLDRYVLSS  809

Query  565   RFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRVL  386
             + Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE+VTG++PVEY ED+V++L D VR  
Sbjct  810   KIQSALGYMAPEFACRTVKITEKCDVYGFGVLVLEVVTGKKPVEYMEDDVVVLCDMVREA  869

Query  385   LEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTP  218
             LE G   EC+D  + G +P EE + V+KL L+CTSQ+PSSRP M E V IL++I+ P
Sbjct  870   LEDGRAEECIDLRLQGKFPVEEAVAVIKLGLICTSQVPSSRPHMGEAVNILRMIRCP  926


 Score = 56.6 bits (135),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 47/133 (35%), Positives = 72/133 (54%), Gaps = 4/133 (3%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L GE    I    +L  + L  N L+G IP +IG+C  L  + LS N+LSG +P+T   L
Sbjct  184   LEGEFGTKIGRLNNLRAIDLSRNRLSGPIPSEIGSCMLLKSVDLSENSLSGNLPDTFQQL  243

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPA--GSIFQNLDSSAIEGN  1463
                  L L  N L GE+P+ +G++ +L ++++S N+ +G +P   G++ + L      GN
Sbjct  244   SLCYYLNLGKNLLEGEVPKWIGEMRSLESLDLSMNKFSGEVPVSIGNLLR-LKVLNFSGN  302

Query  1462  DGICS-PLLTGPC  1427
               I S P  TG C
Sbjct  303   GFIGSLPESTGNC  315


 Score = 56.2 bits (134),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 63/116 (54%), Gaps = 1/116 (1%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             ++L G +P+   +      L L  N L G +P  IG   SL  L LS N  SG +P ++ 
Sbjct  230   NSLSGNLPDTFQQLSLCYYLNLGKNLLEGEVPKWIGEMRSLESLDLSMNKFSGEVPVSIG  289

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSA  1475
              L RLK+L    N   G +P+  G   NL+A++VS N LTG+LP   +FQ+ +S+ 
Sbjct  290   NLLRLKVLNFSGNGFIGSLPESTGNCINLMALDVSGNSLTGKLPVW-LFQDGNSTG  344


 Score = 55.5 bits (132),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 43/106 (41%), Positives = 65/106 (61%), Gaps = 1/106 (1%)
 Frame = -1

Query  1822  SALIGEIPEDIC-ESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETL  1646
             + L G +P+    + GSL    +  N LTG IP  +G+CSSL  L+LS N  SG++P  +
Sbjct  109   NGLSGSLPDGFFRQCGSLRAFSVAENKLTGKIPVSVGSCSSLASLNLSSNGFSGSMPLGI  168

Query  1645  SMLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPA  1508
               L  L+ L L  N+L GE   ++G+L NL A+++S NRL+G +P+
Sbjct  169   WSLNTLRSLDLSRNELEGEFGTKIGRLNNLRAIDLSRNRLSGPIPS  214



>ref|XP_004246289.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Solanum lycopersicum]
Length=965

 Score =   401 bits (1030),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 243/545 (45%), Positives = 355/545 (65%), Gaps = 30/545 (6%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G IP +I  + SL  L+L  N L+GTIP  I NCSSL+ L LSHNNL+G IP  ++ L
Sbjct  443   LNGSIPNEIGSAVSLLELKLRENHLSGTIPADIANCSSLSSLDLSHNNLTGPIPPEIAKL  502

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
               L+++    NQ SG +P++L  L +L   NVS+N L G LP G  F  +  S++ GN  
Sbjct  503   TILEVVDFSFNQFSGSLPKELTNLSHLATFNVSHNHLKGELPVGGFFNTISPSSVVGNPS  562

Query  1456  ICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHR--FLsvsai  1283
             +C  +L   C    PKP+V+NP             ++++P  ++  S  H+   LS+S++
Sbjct  563   LCGSVLNHSCPAVHPKPLVLNP-------------NSSDPNHASVTSLGHKRIMLSISSL  609

Query  1282  vaisaaaiiavgvmvITMVNASVRRRISFVENALESMCSSTSSRSQGMAT--GKLILFDT  1109
             +AI AA  IA+GV+V++++N  VR  ++              S S G     GKL++F  
Sbjct  610   IAIGAAVFIALGVVVVSILNLHVRSTMALSAATFTLSGGDDFSHSHGTEANLGKLVMFSG  669

Query  1108  KSSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDFD  929
              +  D+   T +++LNK +E+G G FG VYK  LG    R VAIKKL  + +++  EDF+
Sbjct  670   DA--DFVVGT-QALLNKDNELGRGGFGAVYKTELGD--GRSVAIKKLNITSLIKSQEDFE  724

Query  928   REVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAVR  749
             RE++ LG  RH+NLV L GYYWTP LQLL++++V  G+L   LH+     +   L+W  R
Sbjct  725   REMKSLGSIRHENLVALEGYYWTPSLQLLINEYVSGGSLYKLLHD---GSSERSLSWQQR  781

Query  748   FKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDE-NLNPKISDFGLARLVAKLDRHVM  572
             F IIL TAKGLA+LH   Q  IIHYN+K +N+L+D+ + + KI DFGLARL+  LDR+++
Sbjct  782   FNIILDTAKGLAYLH---QLNIIHYNMKSTNVLIDDGSTSTKIGDFGLARLLPILDRYIL  838

Query  571   SNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVR  392
             S++ Q+A+GY+APE ACQ++++ EKCDVYGFG++ILE+VTG+RPVEY ED+V++L D VR
Sbjct  839   SSKIQSALGYMAPEFACQTVKITEKCDVYGFGIMILEVVTGKRPVEYMEDDVIVLCDMVR  898

Query  391   VLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPV  215
               LE+G + EC+D  + G +P EE +PV+KL L+C SQ+PS+RP M EV++IL++I+ P 
Sbjct  899   GALEEGRIEECIDGRLQGNFPVEEAIPVVKLGLICASQVPSNRPDMEEVIKILELIRCPS  958

Query  214   PNRME  200
              ++ E
Sbjct  959   ESQEE  963


 Score = 57.8 bits (138),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 40/90 (44%), Positives = 55/90 (61%), Gaps = 0/90 (0%)
 Frame = -1

Query  1777  SLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSMLKRLKILKLEVNQL  1598
             SL +L L  N L+G IP  I N S L +L++S N LSG IPE +  L   +IL L  NQL
Sbjct  384   SLQVLDLSSNELSGEIPAAIWNISGLQVLNISRNFLSGAIPEAVGKLNATRILDLSHNQL  443

Query  1597  SGEIPQQLGKLENLLAVNVSYNRLTGRLPA  1508
             +G IP ++G   +LL + +  N L+G +PA
Sbjct  444   NGSIPNEIGSAVSLLELKLRENHLSGTIPA  473


 Score = 57.0 bits (136),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 38/103 (37%), Positives = 59/103 (57%), Gaps = 0/103 (0%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L GEIP+ I    SL  + L  N   G +P  IGNC  L  + LS N L+G +P+++  L
Sbjct  200   LEGEIPKAIEGLYSLRSINLHKNKFAGWLPENIGNCVQLMSIDLSDNLLTGGLPQSMRRL  259

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPA  1508
                  L+L  N  +GEIP  + ++++L  +++S N L+GR+P 
Sbjct  260   GFCTNLELRSNLFNGEIPDWIAEMKSLKVLDLSANNLSGRIPT  302



>dbj|BAB85306.1| putative receptor-like protein kinase [Oryza sativa Japonica 
Group]
 dbj|BAB86487.1| putative receptor-like protein kinase [Oryza sativa Japonica 
Group]
Length=947

 Score =   400 bits (1027),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 236/537 (44%), Positives = 345/537 (64%), Gaps = 22/537 (4%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G +P +I  + +L  L+L  NS TG IP QIGNCSSL  L LSHNNL+G+IP T+  L
Sbjct  420   LDGGVPPEIGGAVALRELRLGRNSFTGHIPSQIGNCSSLVALDLSHNNLTGSIPSTVGNL  479

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
               L+++ L  N+L+G +P +L  L +L   +VS+N L+G LP    F N+  + +  N G
Sbjct  480   TSLEVVDLSKNKLNGTLPVELSNLPSLRIFDVSHNLLSGDLPNSRFFDNIPETFLSDNQG  539

Query  1456  ICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRFLsvsaiva  1277
             +CS      C    PKPIV+NP    N          ++   +  +S HH+ + +S    
Sbjct  540   LCSSRKNNSCIAIMPKPIVLNPNSSTNP--------LSQATPTAPSSMHHKKIILSVSTL  591

Query  1276  isaaaiiavgvmvITMVNASVRRRISFVENALESMCSS---TSSRSQGMATGKLILFDTK  1106
             I+ A    + + VI +   + R R +   +A  +  S    + S     ++GKL++F  K
Sbjct  592   IAIAGGGTIIIGVIIISVLNRRARATTSRSAPATALSDDYLSQSPENDASSGKLVMFG-K  650

Query  1105  SSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDFDR  926
              SP++ S+   ++LNK  E+G G FG VYK  L     + VAIKKLT S +++  +DF+R
Sbjct  651   GSPEF-SAGGHALLNKDCELGRGGFGAVYKTVL--RDGQPVAIKKLTVSSLVKSKDDFER  707

Query  925   EVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAVRF  746
             +V++L K RH N+V LRG+YWT  LQLL+ D++P GNL   LHE     +   L+W  RF
Sbjct  708   QVKLLSKVRHHNVVALRGFYWTSSLQLLIYDYLPGGNLHKHLHECTEDNS---LSWMERF  764

Query  745   KIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVMSN  566
              IILG A+GL HLH   Q  IIHYN+K SN+LLD N  P++ D+GLA+L+  LDR+V+S+
Sbjct  765   DIILGVARGLTHLH---QRGIIHYNLKSSNVLLDSNGEPRVGDYGLAKLLPMLDRYVLSS  821

Query  565   RFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRVL  386
             + Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE++TGRRPVEY ED+V++L D VR  
Sbjct  822   KIQSALGYMAPEFACKTVKITEKCDVYGFGVLVLEVLTGRRPVEYLEDDVVVLCDLVRSA  881

Query  385   LEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTP  218
             LE+G + +C+D  + G +P EE LP++KL LVCTS++PS+RP M EVV IL+++++P
Sbjct  882   LEEGRLEDCMDPRLCGEFPMEEALPIIKLGLVCTSRVPSNRPDMGEVVNILELVRSP  938


 Score = 54.3 bits (129),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 56/102 (55%), Gaps = 0/102 (0%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G +P     S SL  + L  N L G IP  +G  + L  L + HN  +G +PE+L  L
Sbjct  205   LSGSVPGGFPGSSSLRAVDLSRNLLAGEIPADVGEAALLKSLDVGHNLFTGGLPESLRRL  264

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP  1511
               L+ L +  N L+GE+P  +G++  L  +++S NR +G +P
Sbjct  265   SALRFLGVGGNALAGEVPSWIGEMWALERLDLSGNRFSGAIP  306



>gb|EMT15869.1| Putative LRR receptor-like serine/threonine-protein kinase [Aegilops 
tauschii]
Length=866

 Score =   398 bits (1022),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 242/539 (45%), Positives = 351/539 (65%), Gaps = 22/539 (4%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             + L G +P +I  + +L +L++  NSLTG IP QIG+CSSL  L LSHN+++G IP TL 
Sbjct  337   NTLTGSVPPEIGGAVALRVLRMGDNSLTGRIPAQIGSCSSLVALDLSHNDITGPIPSTLG  396

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGN  1463
              L  L+ + L  N+L+G +P +L  L +L   +VS+N L+G LP    F N+    +  N
Sbjct  397   NLTSLQAVDLSQNKLNGTLPVELSNLPSLHIFDVSHNLLSGNLPNSRFFDNIPDYFLSDN  456

Query  1462  DGICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHR--FLsvs  1289
              G+CS      C    PKPIV+NP    N    +          S+ +S+HH+   LSVS
Sbjct  457   SGLCSSRKNNSCGAVMPKPIVLNPNSSSNPLSQST--------PSSPSSKHHKKIILSVS  508

Query  1288  aivaisaaaiiavgvmvITMVNASVRRRISFVENALE-SMCSSTSSRSQGMATGKLILFD  1112
              ++AI+  A IA+GV+ +T++N  VR   S  + A+  S    + S     ++GKL++F 
Sbjct  509   TLIAIAGGAAIAIGVITVTVLNRRVRSAASHPKPAIALSDDYLSQSPENDASSGKLVMF-  567

Query  1111  TKSSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDF  932
              K SP++ S+   ++LNK  E+G G FG VYK  L     + VAIKKLT S +++  +DF
Sbjct  568   GKGSPEF-STGGHALLNKDCELGRGGFGAVYKTVL--RDGQPVAIKKLTVSSLVKSKDDF  624

Query  931   DREVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAV  752
             +R+V+VL K RH N+V LRG+YWT  LQLL+ D++P GNL   LHE         L+W  
Sbjct  625   ERQVKVLSKMRHHNIVTLRGFYWTSSLQLLIYDYLPGGNLHKHLHECTEENT---LSWME  681

Query  751   RFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVM  572
             RF II+G A+GL HLH   Q  ++HYN+K SN+LLD N  P++ D+GLA L+  LDR+V+
Sbjct  682   RFDIIIGVARGLMHLH---QHGVVHYNLKSSNVLLDSNGEPRVGDYGLASLLPMLDRYVL  738

Query  571   SNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVR  392
             S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L LEI+TGRRPVEY ED+V++L D VR
Sbjct  739   SSKIQSALGYMAPEFACKTVKITEKCDVYGFGVLALEILTGRRPVEYLEDDVVVLCDLVR  798

Query  391   VLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTP  218
               LE+G + +C+D  + G +  EE +P++KL LVCTSQ+PS+RP M EV+ IL+V+++P
Sbjct  799   SALEEGRLEDCMDPRLCGEFAMEEAIPIIKLGLVCTSQVPSNRPDMGEVLSILEVVRSP  857


 Score = 54.3 bits (129),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 39/116 (34%), Positives = 58/116 (50%), Gaps = 0/116 (0%)
 Frame = -1

Query  1810  GEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSMLKR  1631
             G IP D+ E+  L  L L  N  TG +P  +   ++L  L    N L+G +P  +  +  
Sbjct  150   GGIPADVGEAALLKSLDLGRNFFTGGLPDSLRRLTALRFLGAGSNALAGEVPAWIGEMWS  209

Query  1630  LKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGN  1463
             L+ L L  N+ +G IP  + K +NLL  ++S N LTG LP       L   ++ GN
Sbjct  210   LERLDLSGNRFAGVIPDDIAKCKNLLEADLSRNALTGELPWWVFGLPLQRVSVAGN  265



>ref|XP_010670069.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Beta vulgaris subsp. vulgaris]
Length=976

 Score =   400 bits (1029),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 253/540 (47%), Positives = 352/540 (65%), Gaps = 23/540 (4%)
 Frame = -1

Query  1810  GEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSMLKR  1631
             G IP +I  + SL  L L+ N + G IP  + +CSSL++L LSHN+L G +P  LS L  
Sbjct  455   GSIPSEIGNATSLQELILEKNFIEGIIPTSLEHCSSLSVLMLSHNSLEGPVPLALSKLVH  514

Query  1630  LKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDGIC  1451
             L+I+ L VN LSG +P+QL  L++L + N+S+N L G LP G  F  +  S++  N  +C
Sbjct  515   LQIVDLSVNDLSGTMPKQLANLQHLRSFNISHNNLQGELPGG-FFNTISPSSVSDNPSLC  573

Query  1450  SPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRFLsvsaivais  1271
                    C    PKPIV+NP    N T + + G +  P    + +     LS+S+++AI 
Sbjct  574   GSAAKRSCATVLPKPIVLNP----NSTADASSGSSLPPTFVHKKN----LLSISSLIAIG  625

Query  1270  aaaiiavgvmvITMVNASVRRRISFVENALESMCSS--TSSRSQGMATGKLILFDTKSSP  1097
             AAA+I +GV+ IT++N  VR   S    AL        ++S S    +GKL++F  +  P
Sbjct  626   AAAVIVIGVIAITVLNLRVRASASRSAAALALSNGDDFSNSPSTDANSGKLVIFSGE--P  683

Query  1096  DWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDFDREVR  917
             D+++ T  ++LNK  E+G G FG VY+  L  +  R VAIKKLT S +++  EDF+REV+
Sbjct  684   DFSTGT-HALLNKDCELGRGGFGAVYQTVL--QNGRSVAIKKLTVSSLVKSQEDFEREVK  740

Query  916   VLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAVRFKII  737
              LGK RH NLV L GYYWTP LQLL+ +FV  G L   LHE         L+W  RF II
Sbjct  741   KLGKIRHSNLVTLEGYYWTPSLQLLIYEFVSGGTLHKHLHEGG---GGNFLSWNDRFNII  797

Query  736   LGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVMSNRFQ  557
             +G AKGL+HLH   Q  +IHYN+K SNIL+D    PK+ DFGLARL+  LDR+++S++ Q
Sbjct  798   VGMAKGLSHLH---QLNVIHYNLKSSNILIDGLGEPKVGDFGLARLLPMLDRYILSSKIQ  854

Query  556   AAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRVLLEQ  377
             +A+GY+APE AC+++++ EKCDVYGFG+L+LE+VTGRRPVEY ED+V++L D VR  LE+
Sbjct  855   SALGYMAPEFACRTVKITEKCDVYGFGVLVLEVVTGRRPVEYMEDDVVVLCDMVRGALEE  914

Query  376   GNVLECVDQGMGG-YPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPVPNRME  200
             G V ECVD+ + G +P EE +PV+KL L+CTSQ+PS+RP M EVV IL++I+ P   + E
Sbjct  915   GKVEECVDERLQGRFPAEEAIPVMKLGLICTSQVPSNRPDMREVVNILELIRCPSEGQEE  974


 Score = 56.2 bits (134),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 57/102 (56%), Gaps = 0/102 (0%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G IP ++     L  +   GNSL+G++P  + N S +  L++  N+  G +PE +  +
Sbjct  233   LTGPIPNEVGGCSLLKSIDFSGNSLSGSLPITLLNLSFIGYLNVGENSFVGRVPEWIGEM  292

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP  1511
             K ++ L L  N  SG +P  +GKL +L   N+S N L+G LP
Sbjct  293   KGIENLDLSANNFSGVLPASVGKLRSLKVFNMSMNALSGSLP  334



>ref|XP_010427454.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 isoform X1 [Camelina sativa]
 ref|XP_010427455.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 isoform X2 [Camelina sativa]
Length=967

 Score =   400 bits (1028),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 239/538 (44%), Positives = 335/538 (62%), Gaps = 24/538 (4%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G IP +   + SL  L+LD N L G+IPP I NCS L  L LSHN L G+IP  L+ L
Sbjct  439   LNGTIPRETGGAVSLEELRLDNNLLDGSIPPSIKNCSPLRSLILSHNKLLGSIPRELAKL  498

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
              +L+ + +  N+L+G +P+QL  L  L   N+S+N L G LPAG IF  L  S++ GN G
Sbjct  499   TKLEEVDISFNELTGTLPKQLANLGYLHTFNMSHNHLFGELPAGGIFNGLPPSSVSGNTG  558

Query  1456  ICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRFLsvsaiva  1277
             IC  ++   C   APKPIV+NP    N T + + G+     A  +         ++   A
Sbjct  559   ICGAVVNNSCPAVAPKPIVLNP----NSTIDPSSGEVMPAGAGHKRILLSISSLIAISAA  614

Query  1276  isaaaiiavgvmvITMVNASVRRR----ISFVENALESMCSSTSSRSQGMATGKLILFDT  1109
              +    +    ++   V AS   R    ++F      S   +T S S     GKL++F  
Sbjct  615   AAIVVGVIAITVLNLRVRASTVSRSAVPLTFSGGDDFSRSPTTDSNS-----GKLVMFSG  669

Query  1108  KSSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDFD  929
             +  PD+++ T  ++LNK  E+G G FG VY+  +       VAIKKLT S +++  E+F+
Sbjct  670   E--PDFSTGT-HALLNKDCELGRGGFGAVYRTVI--RDGYPVAIKKLTVSSLVKSQEEFE  724

Query  928   REVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAVR  749
             REV+ LGK RH NLV L GYYWT  LQLL+ +F+  G+L   LHE     ++  L+W  R
Sbjct  725   REVKKLGKLRHSNLVKLEGYYWTTSLQLLIYEFLSGGSLYKHLHEAPGGSSS--LSWNDR  782

Query  748   FKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVMS  569
             F +ILGTAK LA+LH   Q  +IHYNIK SN+LLD +  PK+ D+GLARL+  LDR+V+S
Sbjct  783   FNVILGTAKCLAYLH---QSNVIHYNIKSSNVLLDSSGEPKVGDYGLARLLPMLDRYVLS  839

Query  568   NRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRV  389
             ++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE+VTG++PVEY ED+V++L D VR 
Sbjct  840   SKIQSALGYMAPEFACRTVKITEKCDVYGFGVLVLEVVTGKKPVEYMEDDVVVLCDMVRE  899

Query  388   LLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTP  218
              LE G   EC+D  + G +P EE + V+KL L+CTSQ+PSSRP M E V IL++I+ P
Sbjct  900   ALEDGRADECIDPRLQGKFPVEEAIAVIKLGLICTSQVPSSRPHMGEAVNILRMIRCP  957


 Score = 62.0 bits (149),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 63/102 (62%), Gaps = 0/102 (0%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L GE P+ I    +L  L L  N L+G IP +IG+C  L  + LS N+LSG++P+T   L
Sbjct  206   LEGEFPDKIDRLNNLRSLDLSRNRLSGPIPSEIGSCMLLKTIDLSDNSLSGSLPDTFQQL  265

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP  1511
                  L L  N L GE+P+ +G++ +L ++++S N+ +G++P
Sbjct  266   SLCYSLNLGKNALEGEVPKWIGEMRSLESLDLSMNKFSGQVP  307


 Score = 57.8 bits (138),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 68/106 (64%), Gaps = 1/106 (1%)
 Frame = -1

Query  1822  SALIGEIPEDIC-ESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETL  1646
             +AL G +P++   + GSL +L L  N LTG IP  I +CSSL  L+LS N  SG++P  +
Sbjct  131   NALSGSLPDEFFKQCGSLRVLSLAKNKLTGKIPVSISSCSSLASLNLSSNRFSGSMPSGV  190

Query  1645  SMLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPA  1508
               L  L+ L L  N+L GE P ++ +L NL ++++S NRL+G +P+
Sbjct  191   WSLNTLRSLDLSRNELEGEFPDKIDRLNNLRSLDLSRNRLSGPIPS  236


 Score = 53.9 bits (128),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 45/123 (37%), Positives = 67/123 (54%), Gaps = 3/123 (2%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             ++L G +P+   +      L L  N+L G +P  IG   SL  L LS N  SG +P+++ 
Sbjct  252   NSLSGSLPDTFQQLSLCYSLNLGKNALEGEVPKWIGEMRSLESLDLSMNKFSGQVPDSIG  311

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQN--LDSSAIE  1469
              L  LK+L    N L G +P       NLLA+++S N LTG+LP   IFQ+   D SA++
Sbjct  312   NLLALKVLNFSGNGLIGSLPDSTANCINLLALDLSGNSLTGKLPMW-IFQDGSRDVSALK  370

Query  1468  GND  1460
              ++
Sbjct  371   NDN  373



>gb|KHN40633.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Glycine soja]
Length=637

 Score =   390 bits (1003),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 247/542 (46%), Positives = 344/542 (63%), Gaps = 25/542 (5%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G IP +I  + SL  L+L  N L G IP QI  CSSLT L LSHN L+G+IP  ++ L
Sbjct  116   LNGSIPSEIEGATSLSELRLQKNFLGGRIPAQIDKCSSLTFLILSHNKLTGSIPAAIANL  175

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
               L+ + L  N+LSG +P++L  L +L + NVSYN L G LP G  F  + SS++ GN  
Sbjct  176   TNLQYVDLSWNELSGSLPKELTNLSHLFSFNVSYNHLEGELPVGGFFNTISSSSVSGNPL  235

Query  1456  ICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRFLsvsaiva  1277
             +C  ++   C    PKPIV+           N     +    S++N RH   LS+SA++A
Sbjct  236   LCGSVVNHSCPSVHPKPIVL-----------NPNSSGSNSSISSQNHRHKIILSISALIA  284

Query  1276  isaaaiiavgvmvITMVNASVRRRI--SFVENALESMCSSTSSRSQGMATGKLILFDTKS  1103
             I AAA IA+GV+ +T++N  VR  +  S    A       + S +     GKL++F   +
Sbjct  285   IGAAAFIAIGVVAVTVLNIHVRSSMEHSAAPFAFSGGEDYSCSPANDPNYGKLVMFSGDA  344

Query  1102  SPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDFDRE  923
               D+A     ++LNK SEIG G FG VY+  L       VAIKKLT S +++  EDFDRE
Sbjct  345   --DFADGA-HNLLNKESEIGRGGFGVVYRTFL--RDGHAVAIKKLTVSSLIKSQEDFDRE  399

Query  922   VRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAVRFK  743
             ++ LG  +H NLV L GYYWT  LQLL+ +++  G+L   LH+ +   +    +W  RFK
Sbjct  400   IKKLGNVKHPNLVALEGYYWTSSLQLLIYEYLSSGSLHKVLHDDS---SKNVFSWPQRFK  456

Query  742   IILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVMSNR  563
             IILG AKGLAHLH   Q  IIHYN+K +N+L+D +  PK+ DFGL +L+  LD  V+S++
Sbjct  457   IILGMAKGLAHLH---QMNIIHYNLKSTNVLIDCSGEPKVGDFGLVKLLPMLDHCVLSSK  513

Query  562   FQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRVLL  383
              Q+A+GY+APE AC+++++ EKCDVYGFG+L+LEIVTG+RPVEY ED+V++L D VR  L
Sbjct  514   VQSALGYMAPEFACRTVKITEKCDVYGFGILVLEIVTGKRPVEYMEDDVVVLCDMVRGAL  573

Query  382   EQGNVLECVD-QGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPVPNR  206
             E+G V +CVD + +G +  EE +PV+KL L+C SQ+PS+RP MAEVV IL++I+ P   +
Sbjct  574   EEGKVEQCVDGRLLGNFAAEEAIPVIKLGLICASQVPSNRPEMAEVVNILELIQCPSEGQ  633

Query  205   ME  200
              E
Sbjct  634   EE  635



>ref|XP_007134721.1| hypothetical protein PHAVU_010G070400g [Phaseolus vulgaris]
 gb|ESW06715.1| hypothetical protein PHAVU_010G070400g [Phaseolus vulgaris]
Length=982

 Score =   400 bits (1027),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 245/545 (45%), Positives = 344/545 (63%), Gaps = 29/545 (5%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G IP +I  + S+  ++L  N L+G IP QI  CS LT L+LSHN L G+IP  ++ L
Sbjct  459   LNGSIPSEIEGAISVSEMRLQKNFLSGRIPAQIDKCSELTFLNLSHNKLIGSIPSAIANL  518

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
               L+ +    N+LSG +P++L  L NL + NVSYN L G LP G  F  +  S++ GN  
Sbjct  519   TNLQDVDFSWNELSGSLPKELTNLSNLFSFNVSYNHLQGELPVGGFFNTISPSSVSGNPL  578

Query  1456  ICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRFLsvsaiva  1277
             +C  ++   C    PKPIV+NP               + P +S +N  H   LS+S ++A
Sbjct  579   LCGSVVNHSCPSVHPKPIVLNP-----------NSSYSNPGSSVQNHHHKIMLSISVLIA  627

Query  1276  isaaaiiavgvmvITMVNASVRRRIS-----FVENALESMCSSTSSRSQGMATGKLILFD  1112
             I AA  I +GV+V+T++N  VR  IS     F+ +  E    S  +  +    GKL++F 
Sbjct  628   IGAAIFIVIGVVVVTVLNIHVRSSISLSAAPFIFSGGEDYSGSPGNDPK---CGKLVMF-  683

Query  1111  TKSSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDF  932
                  ++A  T  ++LNK SEIG G FG VY   L       VAIKKLT S + +  EDF
Sbjct  684   -YGDAEFADGT-HNLLNKDSEIGRGGFGVVYCTVL--RDGHYVAIKKLTVSTLTKLQEDF  739

Query  931   DREVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAV  752
             +REV++LGK +HQNLV L GYYWTP LQLL+ +++  G+L+  LH+   + +   L+W  
Sbjct  740   EREVKMLGKIKHQNLVALEGYYWTPSLQLLIYEYLARGSLQKLLHDDDDS-SKNTLSWRK  798

Query  751   RFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVM  572
             RFKIILG A+GLAHLH   Q  +IHYN+K +N+ +D +  PKI DFGL RL+  LD  V+
Sbjct  799   RFKIILGIARGLAHLH---QMELIHYNLKSTNVFIDCSDEPKIGDFGLVRLLPMLDPCVL  855

Query  571   SNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVR  392
             S++ Q+A+GY+APE AC+++++ EKCDVY FG+LILE+VTG+RPVEY ED+V++L D VR
Sbjct  856   SSKIQSALGYMAPEFACRTVKITEKCDVYSFGILILEVVTGKRPVEYMEDDVVVLCDKVR  915

Query  391   VLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPV  215
               L+ G V +CVD+ + G +  EE +PV+KL LVC SQ+PS RP MAEV+ IL++I+ P 
Sbjct  916   SALDDGKVEQCVDENLKGNFAAEEAVPVIKLGLVCASQVPSKRPDMAEVINILELIQCPS  975

Query  214   PNRME  200
               + E
Sbjct  976   EGQEE  980


 Score = 66.2 bits (160),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 47/120 (39%), Positives = 67/120 (56%), Gaps = 0/120 (0%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             ++L G +PE + +  S   L L GNS TG IP  IG   SL +L LS N  SG IP+++ 
Sbjct  262   NSLSGRLPESMQKLSSCTFLSLQGNSFTGGIPHWIGEMKSLDILDLSANRFSGWIPKSIG  321

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGN  1463
              L  L  L L  NQ++G +P+ +     LL +++S+N L G LP+      L S +I GN
Sbjct  322   NLDLLSRLNLSRNQITGNLPELMVNCIKLLTLDISHNHLAGHLPSWIFRMGLQSISISGN  381


 Score = 61.6 bits (148),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 40/102 (39%), Positives = 60/102 (59%), Gaps = 0/102 (0%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L GEIPE I     L  L+L  N  TG IP  IG+C  L ++  S N+LSG +PE++  L
Sbjct  216   LEGEIPEGIRNLIDLRELRLGRNLFTGKIPEHIGDCLLLKMVDFSGNSLSGRLPESMQKL  275

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP  1511
                  L L+ N  +G IP  +G++++L  +++S NR +G +P
Sbjct  276   SSCTFLSLQGNSFTGGIPHWIGEMKSLDILDLSANRFSGWIP  317


 Score = 54.7 bits (130),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 37/103 (36%), Positives = 59/103 (57%), Gaps = 1/103 (1%)
 Frame = -1

Query  1816  LIGEIPEDICES-GSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSM  1640
             L G IP +I +   SL +L    N+LTG IP  + +C SL +++ S N + G +P  +  
Sbjct  143   LSGLIPNEIFQQCWSLRVLSFANNNLTGKIPDSLSSCYSLAVVNFSSNQIHGELPSGMWF  202

Query  1639  LKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP  1511
             L+RL+ + L  N L GEIP+ +  L +L  + +  N  TG++P
Sbjct  203   LRRLQSIDLSNNLLEGEIPEGIRNLIDLRELRLGRNLFTGKIP  245


 Score = 53.5 bits (127),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 39/103 (38%), Positives = 61/103 (59%), Gaps = 1/103 (1%)
 Frame = -1

Query  1810  GEIPEDICESGSLGILQLDGNSLTGTIPPQI-GNCssltllslshnnlSGTIPETLSMLK  1634
             G I  D+   G L ++ L  N+L+G IP +I   C SL +LS ++NNL+G IP++LS   
Sbjct  121   GTIAPDLLGIGDLQVVDLSENNLSGLIPNEIFQQCWSLRVLSFANNNLTGKIPDSLSSCY  180

Query  1633  RLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAG  1505
              L ++    NQ+ GE+P  +  L  L ++++S N L G +P G
Sbjct  181   SLAVVNFSSNQIHGELPSGMWFLRRLQSIDLSNNLLEGEIPEG  223



>ref|XP_009116341.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Brassica rapa]
Length=959

 Score =   399 bits (1024),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 248/537 (46%), Positives = 344/537 (64%), Gaps = 21/537 (4%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G +P++   + SL  L+L+ N L GTIP  I NCSSL  L LSHN L G IP  ++ L
Sbjct  430   LNGTVPKETGGAVSLEELRLENNMLEGTIPSSIKNCSSLQSLILSHNKLQGAIPPEMARL  489

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
               L+ + L  N L+G +P+QL  L  L   N+S+N L+G LPAG +F  +   ++ GN G
Sbjct  490   TNLQEVDLSFNDLTGTLPKQLANLGYLHTFNISHNHLSGELPAGGLFNGISPDSVSGNQG  549

Query  1456  ICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRFLsvsaiva  1277
             IC  ++   C   +PKPIV+NP         +       PL +  + R     S+S+++A
Sbjct  550   ICGAVVNKSCPAVSPKPIVLNP-----NATFDPDSGEATPLGAVGHKRILL--SISSLIA  602

Query  1276  isaaaiiavgvmvITMVNASVRRRI---SFVENALESMCSSTSSRSQGMATGKLILFDTK  1106
             ISAAA I VGV+ IT++N  VR      S V  A       + S +    +GKL++F  +
Sbjct  603   ISAAAAIVVGVIAITVLNLRVRATTVSRSAVPIAFSGGDDFSRSPTTDSNSGKLVMFSGE  662

Query  1105  SSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDFDR  926
               PD+++ T  ++LNK  E+G G FG VY+  +  E    VAIKKLT S +++  E+F+R
Sbjct  663   --PDFSTGT-HALLNKDCELGRGGFGAVYRTVIRDE--YPVAIKKLTVSSLVKSQEEFER  717

Query  925   EVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAVRF  746
             EV+ LGK RH NLV L GYYWT  LQLL+ +F+  G+L   LHE     +T  L+W  RF
Sbjct  718   EVKKLGKLRHTNLVKLEGYYWTTSLQLLIYEFLSGGSLYKHLHEAPGGSST--LSWNDRF  775

Query  745   KIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVMSN  566
              +ILGTAK LA+LH   Q  IIHYNIK SN+LLD +  PK+ D+GLARL+  LDR+V+S+
Sbjct  776   NVILGTAKCLAYLH---QSNIIHYNIKSSNVLLDSSGEPKVGDYGLARLLPMLDRYVLSS  832

Query  565   RFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRVL  386
             + Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE+VTG++PVEY ED+V++L D VR  
Sbjct  833   KIQSALGYMAPEFACRTVKITEKCDVYGFGVLVLEVVTGKKPVEYMEDDVVVLCDMVREA  892

Query  385   LEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTP  218
             LE G   ECVD  + G +P EE + V+KL L+CTSQ+PSSRP M E V IL++I+ P
Sbjct  893   LEDGRAEECVDMRLQGKFPVEEAVAVIKLGLICTSQVPSSRPHMGEAVNILRMIRCP  949


 Score = 57.8 bits (138),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 43/106 (41%), Positives = 67/106 (63%), Gaps = 1/106 (1%)
 Frame = -1

Query  1822  SALIGEIPEDIC-ESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETL  1646
             + L G +P+    + GSL +  +  N LTG IP  +G+CSSL  L+LS N  SG++P  +
Sbjct  132   NGLSGSLPDGFFRQCGSLRVFSVAENKLTGKIPVSVGSCSSLASLNLSSNRFSGSMPLGI  191

Query  1645  SMLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPA  1508
               L  L+ L L  N+L GE+  ++G+L NL A+++S NRL+G +P+
Sbjct  192   WSLNTLRSLDLSRNELEGELGTKIGRLNNLRAIDLSRNRLSGPIPS  237


 Score = 57.4 bits (137),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 49/133 (37%), Positives = 72/133 (54%), Gaps = 4/133 (3%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L GE+   I    +L  + L  N L+G IP +IG+C  L  + LS N+LSG +P+T   L
Sbjct  207   LEGELGTKIGRLNNLRAIDLSRNRLSGPIPSEIGSCMLLKSVDLSENSLSGNLPDTFQQL  266

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSI--FQNLDSSAIEGN  1463
                  L L  N L GE+P+ +G++ +L ++++S N+ +G +P GSI     L      GN
Sbjct  267   SLCYYLNLGRNLLDGEVPKWIGEMRSLESLDLSMNKFSGEVP-GSIGNLLRLKVLNFSGN  325

Query  1462  DGICS-PLLTGPC  1427
               I S P  TG C
Sbjct  326   GFIGSLPDSTGNC  338



>ref|XP_002878081.1| hypothetical protein ARALYDRAFT_907079 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54340.1| hypothetical protein ARALYDRAFT_907079 [Arabidopsis lyrata subsp. 
lyrata]
Length=964

 Score =   399 bits (1024),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 240/538 (45%), Positives = 335/538 (62%), Gaps = 24/538 (4%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G IP +   + SL  L+L+ N L G IP  I NCSSL  L LSHN L G+IP  L+ L
Sbjct  436   LSGTIPRETGGAVSLEGLRLENNLLEGNIPSSIKNCSSLRSLILSHNKLIGSIPPELAKL  495

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
              +L+ + L  N+L+G +P+QL  L  L   N+S+N L G LPAG IF  L  S++ GN G
Sbjct  496   TKLEEVDLSFNELTGTLPKQLANLGYLQTFNISHNHLFGELPAGGIFNGLSPSSVSGNPG  555

Query  1456  ICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRFLsvsaiva  1277
             IC  ++   C   +PKPIV+NP    N T +   G+   P A  +         ++   A
Sbjct  556   ICGAVVNKSCPAVSPKPIVLNP----NATFDPYSGEVVPPGAGHKRILLSISSLIAISAA  611

Query  1276  isaaaiiavgvmvITMVNASVRRR----ISFVENALESMCSSTSSRSQGMATGKLILFDT  1109
              +    +    ++   V AS   R    ++F      S   +T S S     GKL++F  
Sbjct  612   AAIVVGVIAITVLNLRVRASTVSRSAVPLTFSGGDDFSRSPTTDSNS-----GKLVMFSG  666

Query  1108  KSSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDFD  929
             +  PD+++ T  ++LNK  E+G G FG VY+  +       VAIKKLT S +++  ++F+
Sbjct  667   E--PDFSTGT-HALLNKDCELGRGGFGAVYRTVI--RDGYPVAIKKLTVSSLVKSQDEFE  721

Query  928   REVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAVR  749
             REV+ LGK RH NLV L GYYWT  LQLL+ +F+  G+L   LHE     ++  L+W  R
Sbjct  722   REVKKLGKLRHSNLVKLEGYYWTTSLQLLIYEFLSGGSLYKHLHEAPGGSSS--LSWNDR  779

Query  748   FKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVMS  569
             F IILGTAK LA+LH   Q  IIHYNIK SN+LLD + +PK+ D+GLARL+  LDR+V+S
Sbjct  780   FNIILGTAKCLAYLH---QSNIIHYNIKSSNVLLDSSGDPKVGDYGLARLLPMLDRYVLS  836

Query  568   NRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRV  389
             ++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE+VTG++PVEY ED+V++L D VR 
Sbjct  837   SKIQSALGYMAPEFACRTVKITEKCDVYGFGVLVLEVVTGKKPVEYMEDDVVVLCDMVRE  896

Query  388   LLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTP  218
              LE G   EC+D  + G +P EE + V+KL L+CTSQ+PSSRP M E V IL++I+ P
Sbjct  897   ALEDGKADECIDPRLQGKFPVEEAVAVIKLGLICTSQVPSSRPHMGEAVNILRMIRCP  954


 Score = 64.7 bits (156),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 44/106 (42%), Positives = 68/106 (64%), Gaps = 1/106 (1%)
 Frame = -1

Query  1822  SALIGEIPEDIC-ESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETL  1646
             + L G +P+    + GSL +L L  N LTG IP  I +CSSL  L+LS N+ SG++P  +
Sbjct  128   NGLSGSLPDGFFRQCGSLRVLSLAKNKLTGKIPVSISSCSSLAALNLSSNSFSGSMPLGI  187

Query  1645  SMLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPA  1508
               L  L+ L L  N+L GE P+++ +L NL ++++S NRL+G +P+
Sbjct  188   WSLNTLRSLDLSRNELEGEFPEKIDRLNNLRSLDLSRNRLSGTIPS  233


 Score = 64.7 bits (156),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 62/102 (61%), Gaps = 0/102 (0%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L GE PE I    +L  L L  N L+GTIP +IG+C  L  + LS N+LSG++P+T   L
Sbjct  203   LEGEFPEKIDRLNNLRSLDLSRNRLSGTIPSEIGSCMLLKTIDLSENSLSGSVPDTFQQL  262

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP  1511
                  L L  N L GE+P+ +G++ +L  +++S N+ +G +P
Sbjct  263   SLCYSLNLGKNGLEGEVPKWIGEMRSLEYLDLSMNKFSGHVP  304



>ref|XP_002267737.3| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Vitis vinifera]
Length=993

 Score =   399 bits (1026),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 244/536 (46%), Positives = 343/536 (64%), Gaps = 23/536 (4%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G IP +I  +  L  L+L+ N LTG IP QI  C SLT L LS N+L+G IP  ++ L
Sbjct  471   LNGSIPFEIRGAVLLKELKLEKNFLTGKIPTQIEKCKSLTSLILSQNHLTGPIPAAIANL  530

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
               ++ + L  N LSG +P++L  L +LL+ N+S+N + G LP+G  F  +  S++ GN  
Sbjct  531   TSIENVDLSFNNLSGSLPKELTNLSHLLSFNISHNNIQGELPSGGFFNTISPSSVSGNPS  590

Query  1456  ICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRFLsvsaiva  1277
             +C  ++   C    PKPIV+NP    N ++           +   N RH   LS+SA++A
Sbjct  591   LCGSVVNRSCPSVHPKPIVLNPDSSSNSSNAG---------SFPSNRRHKIILSISALIA  641

Query  1276  isaaaiiavgvmvITMVNASVRRRISFVENA--LESMCSSTSSRSQGMATGKLILFDTKS  1103
             I AA  IAVGV+ IT++N   R  +S    +  L      + S +     GKL++F   +
Sbjct  642   IGAAIFIAVGVLAITILNIHARSSMSHAAASPILSGGDDFSHSPTNDAQYGKLVMFSGDA  701

Query  1102  SPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDFDRE  923
               D+ +    ++LNK  E+G G FG VY+  L     R VAIKKLT S +++  EDF+RE
Sbjct  702   --DFVAGA-HALLNKDCELGRGGFGAVYRTIL--RDGRSVAIKKLTVSSLIKSQEDFERE  756

Query  922   VRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAVRFK  743
             V+ LGK RH NLV L GYYWT  LQLL+ +++  G+L   LHE+        L+W  RF 
Sbjct  757   VKNLGKIRHHNLVALEGYYWTSSLQLLIYEYISSGSLYKHLHEVP---GKSCLSWRERFN  813

Query  742   IILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVMSNR  563
             I+LGTAKGLAHLH   Q  IIHYN+K +NIL+D    PK+ DF LARL+  LDR+V+S++
Sbjct  814   IVLGTAKGLAHLH---QLNIIHYNLKSTNILIDSGGEPKVGDFALARLLPMLDRYVLSSK  870

Query  562   FQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRVLL  383
              Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE+VTGRRPVEY ED+V++L D VR  L
Sbjct  871   IQSALGYMAPEFACRTVKITEKCDVYGFGVLVLEVVTGRRPVEYMEDDVVVLCDMVRGAL  930

Query  382   EQGNVLECVDQGMGG-YPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTP  218
             ++G V ECVD+ + G +P +E +PV+KL L+C SQ+PS+RP M EVV IL++I+ P
Sbjct  931   DEGKVEECVDRRLQGEFPADEAIPVIKLGLICASQVPSNRPDMGEVVNILELIQCP  986


 Score = 62.0 bits (149),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 41/103 (40%), Positives = 63/103 (61%), Gaps = 1/103 (1%)
 Frame = -1

Query  1816  LIGEIPEDIC-ESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSM  1640
             L G IP++   + GSL ++ L GN L+G IP  +  C +L  ++ S N LSG +P+ +  
Sbjct  154   LSGPIPDEFFRQCGSLIVVSLAGNKLSGQIPDTLSLCKTLRGVNFSSNQLSGQLPDGIWS  213

Query  1639  LKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP  1511
             L  L+ L L  N L GEIP+ +G L +L A+N+  N+ +GR+P
Sbjct  214   LYGLRSLDLSNNFLEGEIPEGIGSLYSLRAINLGKNKFSGRIP  256


 Score = 59.7 bits (143),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 58/102 (57%), Gaps = 0/102 (0%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L GEIPE I    SL  + L  N  +G IP  IG+C  L LL LS N  SG +PE++  L
Sbjct  227   LEGEIPEGIGSLYSLRAINLGKNKFSGRIPDSIGSCLLLRLLDLSENLFSGGLPESMQRL  286

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP  1511
             +    L L  N L+GE+P  +  + NL  +++S N  +G++P
Sbjct  287   RMCNYLSLRGNLLTGEVPAWIWGMRNLGTLDLSANVFSGQIP  328


 Score = 55.1 bits (131),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 46/116 (40%), Positives = 62/116 (53%), Gaps = 0/116 (0%)
 Frame = -1

Query  1810  GEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSMLKR  1631
             G +PE +        L L GN LTG +P  I    +L  L LS N  SG IP ++  L  
Sbjct  277   GGLPESMQRLRMCNYLSLRGNLLTGEVPAWIWGMRNLGTLDLSANVFSGQIPNSIGNLLL  336

Query  1630  LKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGN  1463
             LK L L  NQ  G +P+ + K  NL+A++VS+N LTG LPA      L + ++ GN
Sbjct  337   LKELNLSSNQFGGSLPESMTKCTNLVAMDVSHNLLTGNLPAWIFSLGLQTISLAGN  392


 Score = 53.9 bits (128),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 61/105 (58%), Gaps = 1/105 (1%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQI-GNCssltllslshnnlSGTIPETLSM  1640
               G I   +    SL ++ L  N+L+G IP +    C SL ++SL+ N LSG IP+TLS+
Sbjct  130   FTGTINPSLARIASLRVIDLSENNLSGPIPDEFFRQCGSLIVVSLAGNKLSGQIPDTLSL  189

Query  1639  LKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAG  1505
              K L+ +    NQLSG++P  +  L  L ++++S N L G +P G
Sbjct  190   CKTLRGVNFSSNQLSGQLPDGIWSLYGLRSLDLSNNFLEGEIPEG  234



>ref|XP_006655414.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like, partial [Oryza brachyantha]
Length=788

 Score =   394 bits (1012),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 243/535 (45%), Positives = 340/535 (64%), Gaps = 24/535 (4%)
 Frame = -1

Query  1810  GEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSMLKR  1631
             G +P +I  + +L  L +  NSL G IP QIGNC SL  L LS N L+G IP T+  L  
Sbjct  263   GGVPPEIGGAVALRKLLMGSNSLAGIIPEQIGNCRSLIALDLSQNKLTGPIPATIGNLTS  322

Query  1630  LKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDGIC  1451
             L+++    N+L+G +P +L KL +L   NVS+N L+G LP    F N+  S I  N G+C
Sbjct  323   LQMVDFSENKLNGTLPVELSKLTSLRVFNVSHNLLSGNLPISHFFDNIPDSFILDNAGLC  382

Query  1450  SPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHR--FLsvsaiva  1277
             S      C    PKPIV NP    +           E      +S+HH+   LS+S ++A
Sbjct  383   SSQRDNSCSGIMPKPIVFNPNASSDPIS--------EVSPGAPSSQHHKKIILSISTLIA  434

Query  1276  isaaaiiavgvmvITMVNASVRRRISF--VENALESMCSSTSSRSQGMATGKLILFDTKS  1103
             I   A+I VGV+ IT++N  VR   S   V  AL     S S  ++    GKL++F  + 
Sbjct  435   IVGGALIVVGVVTITVLNRRVRTAASHSAVPTALSDDYDSQSPENEA-NPGKLVMFG-RG  492

Query  1102  SPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDFDRE  923
             SPD+ S+   ++LNK  E+G G FGTVYKA L     + VAIKKLT S +++  +DF R+
Sbjct  493   SPDF-SAGGHALLNKDCELGRGGFGTVYKAVL--RDGQPVAIKKLTVSSLVKSEDDFRRQ  549

Query  922   VRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAVRFK  743
             V++LGK +H N+V LRG+YWT  LQLL+ DFVP GNL   LHE +   A    +W  RF 
Sbjct  550   VKLLGKVQHHNIVTLRGFYWTSSLQLLIYDFVPGGNLYQHLHECS---AERSASWMERFG  606

Query  742   IILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVMSNR  563
             I++G A+ LAHLH      IIHYN+K SN+LLD N  P++ D+GL +L+  LDR+V+S++
Sbjct  607   IVIGVARALAHLHRHG---IIHYNLKSSNVLLDSNGEPRVGDYGLVKLLPMLDRYVLSSK  663

Query  562   FQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRVLL  383
              Q+A+GY+APE  C+++ V EKCDVYGFG+LILEI+TGRRPVEY ED+V++L+D VR  L
Sbjct  664   IQSALGYMAPEFTCRTVNVTEKCDVYGFGVLILEILTGRRPVEYLEDDVIVLSDVVRAAL  723

Query  382   EQGNVLECVDQGMGG-YPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKT  221
             ++G V +C+D+ + G +  EE + ++KL LVCTSQ+PS RP M EVV +L+++++
Sbjct  724   DEGRVEDCLDRRLSGEFSMEEAMLIIKLGLVCTSQVPSHRPDMGEVVSMLEMVRS  778


 Score = 55.5 bits (132),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 38/104 (37%), Positives = 54/104 (52%), Gaps = 0/104 (0%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G +P     S SL +L L  N L G IP  +G    L  L + HN  +G +PE+L  L
Sbjct  46    LSGSVPGGFPRSSSLRVLDLSRNRLEGEIPADVGEAGLLKSLDVGHNLFTGGLPESLRRL  105

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAG  1505
               L  L    N L+GE+P  +G++  L  +++S NR  G +P G
Sbjct  106   SGLSSLGAGGNALAGELPAWIGEMAALERLDLSGNRFVGSIPDG  149



>ref|XP_010525412.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Tarenaya hassleriana]
Length=965

 Score =   398 bits (1023),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 243/539 (45%), Positives = 338/539 (63%), Gaps = 27/539 (5%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G IP+DI  + SL  L+L+ N L G IP  I NCSSL  L LS NNL G +P  ++ L
Sbjct  438   LNGSIPQDIGGAVSLEELRLESNLLEGRIPSSIKNCSSLRSLILSQNNLLGPVPPEIAKL  497

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
               L+ + L  N L+G +P+QL  L NL   N+S+N++ G LP G IF  +   ++ GN  
Sbjct  498   SNLRDVDLSFNDLTGTLPKQLANLGNLHTFNISHNQICGELPTGGIFNTISPYSVSGNPA  557

Query  1456  ICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRFLsvsaiva  1277
             +C  ++   C    PKPIV+NP    + +         E L S      H+ + +S    
Sbjct  558   LCGAVVNKSCPAVLPKPIVLNPNATFDPSSG-------EALPS---GPGHKRILLSISSL  607

Query  1276  isaaaiiavgvmvITMVNASVRRRISFVENALESMCSS-----TSSRSQGMATGKLILFD  1112
             I+ +A  A+ V VI +   ++R R S +  +   +  S     + S +    +GKL++F 
Sbjct  608   IAISAAAAIVVGVIAITVLNLRVRASTITRSAAPLTFSGGDEFSQSPTTDSNSGKLVMFS  667

Query  1111  TKSSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDF  932
              +  PD+++ T  ++LNK  E+G G FG VY+  L       VAIKKLT S +++  EDF
Sbjct  668   GE--PDFSTGT-HALLNKDCELGRGGFGAVYRTVL--RDGCPVAIKKLTVSSLVKSQEDF  722

Query  931   DREVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAV  752
             +REV+ LGK RH NLV L GYYWTP LQL++ +F+  G+L   LHE   A     L+W  
Sbjct  723   EREVKKLGKLRHANLVNLEGYYWTPSLQLMIYEFLSGGSLYKHLHE---ASGGSLLSWND  779

Query  751   RFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVM  572
             RF IILGTAK LA+LH   Q  +IHYNIK SN+LLD +   K+ D+GLARL+  LDR+V+
Sbjct  780   RFNIILGTAKCLAYLH---QSNVIHYNIKSSNVLLDSSGEAKVGDYGLARLLPMLDRYVL  836

Query  571   SNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVR  392
             S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LEIVTG+RPVEY ED+V++L D VR
Sbjct  837   SSKIQSALGYMAPEFACKTVKITEKCDVYGFGVLVLEIVTGKRPVEYMEDDVVVLCDMVR  896

Query  391   VLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTP  218
               LE G   ECVD  + G +P EE +PV+KL L+CTSQ+PSSRP M EVV IL++I+ P
Sbjct  897   EALEDGRAEECVDARLQGKFPTEEAVPVIKLGLICTSQVPSSRPDMGEVVNILKMIRCP  955


 Score = 64.7 bits (156),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/104 (38%), Positives = 63/104 (61%), Gaps = 0/104 (0%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             + L GEIPE I    +L +L L  N  +G +P +IGNC  L  + LS N+LSG +P++L 
Sbjct  203   NGLEGEIPEGIDSLNNLRVLDLSRNRFSGLVPSEIGNCLLLKYVDLSENSLSGNLPDSLQ  262

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP  1511
              L     L L  N L G++P+ +G++ +L  ++ S N+ +G++P
Sbjct  263   KLNLCYFLDLGKNALEGDVPKWIGEMRSLETLDFSMNKFSGQIP  306


 Score = 55.1 bits (131),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 42/110 (38%), Positives = 58/110 (53%), Gaps = 1/110 (1%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             ++L G +P+ + +      L L  N+L G +P  IG   SL  L  S N  SG IP+++ 
Sbjct  251   NSLSGNLPDSLQKLNLCYFLDLGKNALEGDVPKWIGEMRSLETLDFSMNKFSGQIPDSIG  310

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQ  1493
              L  LK L L  N  +G +P  L    NLLA++ S N L+G LP   IFQ
Sbjct  311   NLLSLKTLNLSANGFTGGLPDPLAHCVNLLALDFSQNSLSGNLPVW-IFQ  359



>ref|XP_006290556.1| hypothetical protein CARUB_v10016642mg [Capsella rubella]
 gb|EOA23454.1| hypothetical protein CARUB_v10016642mg [Capsella rubella]
Length=966

 Score =   398 bits (1023),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 240/538 (45%), Positives = 333/538 (62%), Gaps = 24/538 (4%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G IP +   + SL  L+LD N L G IP  I  CSSL  L LSHN L GTIP  L+ L
Sbjct  438   LNGTIPRETGGAVSLEELRLDNNLLEGNIPSSIKTCSSLRSLILSHNKLVGTIPPELAKL  497

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
              +L+ + +  N+L+G +P+QL  L  L   N+S+N L G LPAG IF  L  S++ GN G
Sbjct  498   TKLEEVDISFNELTGTLPKQLANLGYLHTFNMSHNHLFGELPAGGIFNGLSPSSVSGNTG  557

Query  1456  ICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRFLsvsaiva  1277
             IC  ++   C   +PKPIV+NP    N T ++  G+   P A  +         ++   A
Sbjct  558   ICGAVVNNSCPAVSPKPIVLNP----NATFDSYSGEVLPPGAGHKRILLSISSLIAISAA  613

Query  1276  isaaaiiavgvmvITMVNASVRRR----ISFVENALESMCSSTSSRSQGMATGKLILFDT  1109
              +    +    ++   V AS   R    ++F      S   +T S S     GKL++F  
Sbjct  614   AAIVVGVIAITVLNLRVRASTVSRSAVPLTFSGGDDFSRSPTTDSNS-----GKLVMFSG  668

Query  1108  KSSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDFD  929
             +  PD+++ T  ++LNK  E+G G FG VY+  +       VAIKKLT S +++  E+F+
Sbjct  669   E--PDFSTGT-HALLNKDCELGRGGFGAVYRTVI--RDGYPVAIKKLTVSSLVKSQEEFE  723

Query  928   REVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAVR  749
             REV+ LGK RH NLV L GYYWT  LQLL+ +F+  G+L   LHE     +   L+W  R
Sbjct  724   REVKKLGKLRHSNLVKLEGYYWTTSLQLLIYEFLSGGSLYKHLHEAPGGSSL--LSWNDR  781

Query  748   FKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVMS  569
             F +ILGTAK LA+LH   Q  IIHYNIK SN+LLD +  PK+ D+GLARL+  LDR+V+S
Sbjct  782   FNVILGTAKCLAYLH---QSNIIHYNIKSSNVLLDSSGEPKVGDYGLARLLPMLDRYVLS  838

Query  568   NRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRV  389
             ++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE+VTG++PVEY ED+V++L D VR 
Sbjct  839   SKIQSALGYMAPEFACRTVKITEKCDVYGFGVLVLEVVTGKKPVEYMEDDVVVLCDMVRE  898

Query  388   LLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTP  218
              LE G   EC+D  + G +P EE + V+KL L+CTSQ+PSSRP M E V IL++I+ P
Sbjct  899   ALEDGRADECIDPRLQGKFPVEEAIAVIKLGLICTSQVPSSRPHMGEAVNILRMIRCP  956


 Score = 64.3 bits (155),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 62/102 (61%), Gaps = 0/102 (0%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L GE PE I    +L  L L  N L+G IP +IG+C  L  + LS N+LSGT+P+T   L
Sbjct  205   LEGEFPEKIDRLNNLRSLDLSRNRLSGPIPSEIGSCMLLKTIDLSDNSLSGTLPDTFQQL  264

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP  1511
                  L L  N L GE+P+ +G++ +L  +++S N+ +G++P
Sbjct  265   SLCYSLNLGKNALEGEVPKWIGEMRSLETLDLSMNKFSGQVP  306


 Score = 63.5 bits (153),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 41/93 (44%), Positives = 61/93 (66%), Gaps = 0/93 (0%)
 Frame = -1

Query  1786  ESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSMLKRLKILKLEV  1607
             + GSL +L L  N LTG IP  I +CSSL  L+LS N  SG++P  +  L  L+ L L  
Sbjct  143   QCGSLRVLSLAKNKLTGKIPVSISSCSSLAALNLSSNRFSGSMPSGIWSLNTLRSLDLSW  202

Query  1606  NQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPA  1508
             N+L GE P+++ +L NL ++++S NRL+G +P+
Sbjct  203   NELEGEFPEKIDRLNNLRSLDLSRNRLSGPIPS  235


 Score = 55.1 bits (131),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 66/123 (54%), Gaps = 3/123 (2%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             ++L G +P+   +      L L  N+L G +P  IG   SL  L LS N  SG +PE++ 
Sbjct  251   NSLSGTLPDTFQQLSLCYSLNLGKNALEGEVPKWIGEMRSLETLDLSMNKFSGQVPESIG  310

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQN--LDSSAIE  1469
              L  LK+L    N L G +P       NLLA++ S N LTG+LP   IFQ+   D SA++
Sbjct  311   NLLALKVLNFSGNGLIGSLPDSTANCINLLALDFSGNSLTGKLPMW-IFQDGSRDVSALQ  369

Query  1468  GND  1460
              ++
Sbjct  370   NDN  372



>ref|XP_010424007.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 isoform X2 [Camelina sativa]
Length=955

 Score =   397 bits (1021),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 250/544 (46%), Positives = 349/544 (64%), Gaps = 28/544 (5%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G +P +I  + SL  L L  N L+G IPPQI NCS+L  + LS N LSG IP ++  L
Sbjct  435   LNGTVPCEIGGAVSLKQLNLHRNRLSGQIPPQISNCSALNAIDLSDNELSGVIPGSIGSL  494

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
               LK + L  N LSG +P+++ KL +LL  N+S+N LTG LPAG+ F  +  SA+ GN  
Sbjct  495   SNLKYVDLSRNNLSGSLPKEIEKLSHLLTFNISHNSLTGELPAGAFFNTIPLSAVTGNPS  554

Query  1456  ICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRFLsvsaiva  1277
             +C  L+   C    PKPIV+NP    N ++  NG      +  +        LS+SA++A
Sbjct  555   LCGSLVNRSCLSVHPKPIVLNP----NSSNPTNGPALTGKIRKS-------VLSISALIA  603

Query  1276  isaaaiiavgvmvITMVNASVRRRISFVENAL---ESMCSSTSSRSQGMATGKLILFDTK  1106
             I AAA IA GV+ +T++N   R  +S    AL   E+   S S   Q    GKL++F  +
Sbjct  604   IGAAAFIAFGVVAVTLLNVHARASVSPAALALSVGETFSCSPSKDHQEF--GKLVMFSGE  661

Query  1105  SSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDFDR  926
             +   + ++  +++LNK  E+G G FG VYK  L  +  R VA+KKLT S +++  E+F+R
Sbjct  662   ADV-FDTTGADALLNKECELGRGGFGVVYKTNL--QDGRPVAVKKLTVSGLIKSQEEFER  718

Query  925   EVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAVRF  746
             E+R LGK RH NLV ++GYYWT  LQLL+ +FV  G+L   LH       +  LTW  RF
Sbjct  719   EMRKLGKLRHNNLVEMKGYYWTQSLQLLIHEFVSGGSLHRHLH----GDESVCLTWRQRF  774

Query  745   KIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAK-LDRHVMS  569
              IILG A+GLA+LH S    I HYN+K +N+L+D     K+SDFGLARL+A  LDR V+S
Sbjct  775   SIILGIARGLAYLHGS---NITHYNLKATNVLVDATGEAKVSDFGLARLLASALDRCVLS  831

Query  568   NRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRV  389
              + Q+A+GY APE AC+++++ +KCDVYGFG+L+LE+VTG+RPVEY ED+V++L + VR 
Sbjct  832   GKVQSALGYTAPEFACRTVKITDKCDVYGFGILVLEVVTGKRPVEYAEDDVVVLCETVRE  891

Query  388   LLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPVP  212
              LE+G V ECVD  + G +P EE +P +KL LVC SQ+PS+RP M EVV+IL++I+ P  
Sbjct  892   RLEEGRVEECVDPRLRGNFPAEEAIPAIKLGLVCGSQVPSNRPDMEEVVKILELIQCPPS  951

Query  211   NRME  200
             + +E
Sbjct  952   HDLE  955


 Score = 64.3 bits (155),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 48/125 (38%), Positives = 72/125 (58%), Gaps = 1/125 (1%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G +P+ + ++ S   ++L GNSL G IP  IG+ ++L  L LS NN SG +P +L  L
Sbjct  250   LSGNLPDSM-KTSSCTSVRLRGNSLAGDIPDWIGDLATLETLDLSANNFSGNVPFSLGNL  308

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
             + LK L L  N L+GE+PQ +    NL++++VS N  TG +      Q+   S   GND 
Sbjct  309   EFLKELNLSSNMLAGELPQTISNCSNLISIDVSKNSFTGDVLKWMFAQSYSLSRSAGNDT  368

Query  1456  ICSPL  1442
             + + L
Sbjct  369   LVAFL  373



>gb|AAL49790.1| unknown protein [Arabidopsis thaliana]
Length=964

 Score =   398 bits (1022),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 241/538 (45%), Positives = 335/538 (62%), Gaps = 24/538 (4%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G IP +   + SL  L+L+ N L G IP  I NCSSL  L LSHN L G+IP  L+ L
Sbjct  436   LNGMIPRETGGAVSLEELRLENNLLEGNIPSSIKNCSSLRSLILSHNKLLGSIPPELAKL  495

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
              RL+ + L  N+L+G +P+QL  L  L   N+S+N L G LPAG IF  L  S++ GN G
Sbjct  496   TRLEEVDLSFNELAGTLPKQLANLGYLHTFNISHNHLFGELPAGGIFNGLSPSSVSGNPG  555

Query  1456  ICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRFLsvsaiva  1277
             IC  ++   C   +PKPIV+NP    N T +   G+   P A  +         ++   A
Sbjct  556   ICGAVVNKSCPAISPKPIVLNP----NATFDPYNGEIVPPGAGHKRILLSISSLIAISAA  611

Query  1276  isaaaiiavgvmvITMVNASVRRR----ISFVENALESMCSSTSSRSQGMATGKLILFDT  1109
              +    +    ++   V AS   R    ++F      S   +T S S     GKL++F  
Sbjct  612   AAIVVGVIAITVLNLRVRASTVSRSAVPLTFSGGDDFSRSPTTDSNS-----GKLVMFSG  666

Query  1108  KSSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDFD  929
             +  PD+++ T  ++LNK  E+G G FG VY+  +       VAIKKLT S +++  ++F+
Sbjct  667   E--PDFSTGT-HALLNKDCELGRGGFGAVYRTVI--RDGYPVAIKKLTVSSLVKSQDEFE  721

Query  928   REVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAVR  749
             REV+ LGK RH NLV L GYYWT  LQLL+ +F+  G+L  +LHE     ++  L+W  R
Sbjct  722   REVKKLGKLRHSNLVKLEGYYWTTSLQLLIYEFLSGGSLYKQLHEAPGGNSS--LSWNDR  779

Query  748   FKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVMS  569
             F IILGTAK LA+LH   Q  IIHYNIK SN+LLD +  PK+ D+GLARL+  LDR+V+S
Sbjct  780   FNIILGTAKCLAYLH---QSNIIHYNIKSSNVLLDSSGEPKVGDYGLARLLPMLDRYVLS  836

Query  568   NRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRV  389
             ++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE+VTG++PVEY ED+V++L D VR 
Sbjct  837   SKIQSALGYMAPEFACRTVKITEKCDVYGFGVLVLEVVTGKKPVEYMEDDVVVLCDMVRE  896

Query  388   LLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTP  218
              LE G   EC+D  + G +P EE + V+KL L+CTSQ+PSSRP M E V IL++I+ P
Sbjct  897   ALEDGRADECIDPRLQGKFPVEEAVAVIKLGLICTSQVPSSRPHMGEAVNILRMIRCP  954


 Score = 65.9 bits (159),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 68/106 (64%), Gaps = 1/106 (1%)
 Frame = -1

Query  1822  SALIGEIPEDIC-ESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETL  1646
             + L G +P++   + GSL +L L  N LTG IP  I +CSSL  L+LS N  SG++P  +
Sbjct  128   NGLSGSLPDEFFRQCGSLRVLSLAKNKLTGKIPVSISSCSSLAALNLSSNGFSGSMPLGI  187

Query  1645  SMLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPA  1508
               L  L+ L L  N+L GE P+++ +L NL A+++S NRL+G +P+
Sbjct  188   WSLNTLRSLDLSRNELEGEFPEKIDRLNNLRALDLSRNRLSGPIPS  233


 Score = 62.0 bits (149),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 40/102 (39%), Positives = 61/102 (60%), Gaps = 0/102 (0%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L GE PE I    +L  L L  N L+G IP +IG+C  L  + LS N+LSG++P T   L
Sbjct  203   LEGEFPEKIDRLNNLRALDLSRNRLSGPIPSEIGSCMLLKTIDLSENSLSGSLPNTFQQL  262

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP  1511
                  L L  N L GE+P+ +G++ +L  +++S N+ +G++P
Sbjct  263   SLCYSLNLGKNALEGEVPKWIGEMRSLETLDLSMNKFSGQVP  304



>ref|NP_191196.1| leucine-rich repeat protein kinase-like protein [Arabidopsis 
thaliana]
 emb|CAB88040.1| putative protein [Arabidopsis thaliana]
 dbj|BAB85646.1| inflorescence and root apices receptor-like kinase [Arabidopsis 
thaliana]
 dbj|BAB85647.1| inflorescence and root apices receptor-like kinase [Arabidopsis 
thaliana]
 gb|ACN59335.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEE79514.1| leucine-rich repeat protein kinase-like protein [Arabidopsis 
thaliana]
Length=964

 Score =   397 bits (1021),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 241/538 (45%), Positives = 335/538 (62%), Gaps = 24/538 (4%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G IP +   + SL  L+L+ N L G IP  I NCSSL  L LSHN L G+IP  L+ L
Sbjct  436   LNGMIPRETGGAVSLEELRLENNLLEGNIPSSIKNCSSLRSLILSHNKLLGSIPPELAKL  495

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
              RL+ + L  N+L+G +P+QL  L  L   N+S+N L G LPAG IF  L  S++ GN G
Sbjct  496   TRLEEVDLSFNELAGTLPKQLANLGYLHTFNISHNHLFGELPAGGIFNGLSPSSVSGNPG  555

Query  1456  ICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRFLsvsaiva  1277
             IC  ++   C   +PKPIV+NP    N T +   G+   P A  +         ++   A
Sbjct  556   ICGAVVNKSCPAISPKPIVLNP----NATFDPYNGEIVPPGAGHKRILLSISSLIAISAA  611

Query  1276  isaaaiiavgvmvITMVNASVRRR----ISFVENALESMCSSTSSRSQGMATGKLILFDT  1109
              +    +    ++   V AS   R    ++F      S   +T S S     GKL++F  
Sbjct  612   AAIVVGVIAITVLNLRVRASTVSRSAVPLTFSGGDDFSRSPTTDSNS-----GKLVMFSG  666

Query  1108  KSSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDFD  929
             +  PD+++ T  ++LNK  E+G G FG VY+  +       VAIKKLT S +++  ++F+
Sbjct  667   E--PDFSTGT-HALLNKDCELGRGGFGAVYRTVI--RDGYPVAIKKLTVSSLVKSQDEFE  721

Query  928   REVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAVR  749
             REV+ LGK RH NLV L GYYWT  LQLL+ +F+  G+L  +LHE     ++  L+W  R
Sbjct  722   REVKKLGKLRHSNLVKLEGYYWTTSLQLLIYEFLSGGSLYKQLHEAPGGNSS--LSWNDR  779

Query  748   FKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVMS  569
             F IILGTAK LA+LH   Q  IIHYNIK SN+LLD +  PK+ D+GLARL+  LDR+V+S
Sbjct  780   FNIILGTAKCLAYLH---QSNIIHYNIKSSNVLLDSSGEPKVGDYGLARLLPMLDRYVLS  836

Query  568   NRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRV  389
             ++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE+VTG++PVEY ED+V++L D VR 
Sbjct  837   SKIQSALGYMAPEFACRTVKITEKCDVYGFGVLVLEVVTGKKPVEYMEDDVVVLCDMVRE  896

Query  388   LLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTP  218
              LE G   EC+D  + G +P EE + V+KL L+CTSQ+PSSRP M E V IL++I+ P
Sbjct  897   ALEDGRADECIDPRLQGKFPVEEAVAVIKLGLICTSQVPSSRPHMGEAVNILRMIRCP  954


 Score = 65.5 bits (158),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 68/106 (64%), Gaps = 1/106 (1%)
 Frame = -1

Query  1822  SALIGEIPEDIC-ESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETL  1646
             + L G +P++   + GSL +L L  N LTG IP  I +CSSL  L+LS N  SG++P  +
Sbjct  128   NGLSGSLPDEFFRQCGSLRVLSLAKNKLTGKIPVSISSCSSLAALNLSSNGFSGSMPLGI  187

Query  1645  SMLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPA  1508
               L  L+ L L  N+L GE P+++ +L NL A+++S NRL+G +P+
Sbjct  188   WSLNTLRSLDLSRNELEGEFPEKIDRLNNLRALDLSRNRLSGPIPS  233


 Score = 62.0 bits (149),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 40/102 (39%), Positives = 61/102 (60%), Gaps = 0/102 (0%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L GE PE I    +L  L L  N L+G IP +IG+C  L  + LS N+LSG++P T   L
Sbjct  203   LEGEFPEKIDRLNNLRALDLSRNRLSGPIPSEIGSCMLLKTIDLSENSLSGSLPNTFQQL  262

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP  1511
                  L L  N L GE+P+ +G++ +L  +++S N+ +G++P
Sbjct  263   SLCYSLNLGKNALEGEVPKWIGEMRSLETLDLSMNKFSGQVP  304



>emb|CDY27220.1| BnaA09g35820D [Brassica napus]
Length=936

 Score =   397 bits (1019),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 248/537 (46%), Positives = 342/537 (64%), Gaps = 21/537 (4%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G +P +   + SL  L+L+ N L GTIP  I NCSSL  L LSHN L G IP  ++ L
Sbjct  407   LNGTVPRETGGAVSLEELRLENNMLEGTIPSSIKNCSSLQSLILSHNKLQGAIPPEMARL  466

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
               L+ + L  N L+G +P+QL  L  L   N+S+N L+G LPAG +F  +   ++ GN G
Sbjct  467   TNLQEVDLSFNDLTGTLPKQLANLGYLHTFNISHNHLSGELPAGGLFNGISPDSVSGNQG  526

Query  1456  ICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRFLsvsaiva  1277
             IC  ++   C   +PKPIV+NP         +       PL +  + R     S+S+++A
Sbjct  527   ICGAVVNKSCPAVSPKPIVLNP-----NATFDPDSGEATPLGAVGHKRILL--SISSLIA  579

Query  1276  isaaaiiavgvmvITMVNASVRRRI---SFVENALESMCSSTSSRSQGMATGKLILFDTK  1106
             ISAAA I VGV+ IT++N  VR      S V  A       + S +    +GKL++F  +
Sbjct  580   ISAAAAIVVGVIAITVLNLRVRATTVSRSAVPIAFSGGDDFSRSPTTDSNSGKLVMFSGE  639

Query  1105  SSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDFDR  926
               PD+++ T  ++LNK  E+G G FG VY+  +  E    VAIKKLT S +++  E+F+R
Sbjct  640   --PDFSTGT-HALLNKDCELGRGGFGAVYRTVIRDE--YPVAIKKLTVSSLVKSQEEFER  694

Query  925   EVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAVRF  746
             EV+ LGK RH NLV L GYYWT  LQLL+ +F+  G+L   LHE     +T  L+W  RF
Sbjct  695   EVKKLGKLRHTNLVKLEGYYWTTSLQLLIYEFLSGGSLYKHLHEAPGGSST--LSWNDRF  752

Query  745   KIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVMSN  566
              +ILGTAK LA+LH   Q  IIHYNIK SN+LLD    PK+ D+GLARL+  LDR+V+S+
Sbjct  753   NVILGTAKCLAYLH---QSNIIHYNIKSSNVLLDSCGEPKVGDYGLARLLPMLDRYVLSS  809

Query  565   RFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRVL  386
             + Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE+VTG++PVEY ED+V++L D VR  
Sbjct  810   KIQSALGYMAPEFACRTVKITEKCDVYGFGVLVLEVVTGKKPVEYMEDDVVVLCDMVREA  869

Query  385   LEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTP  218
             LE G   ECVD  + G +P EE + V+KL L+CTSQ+PSSRP M E V IL++I+ P
Sbjct  870   LEDGRAEECVDMRLQGKFPVEEAVAVIKLGLICTSQVPSSRPHMGEAVNILRMIRCP  926


 Score = 57.8 bits (138),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 43/106 (41%), Positives = 67/106 (63%), Gaps = 1/106 (1%)
 Frame = -1

Query  1822  SALIGEIPEDIC-ESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETL  1646
             + L G +P+    + GSL +  +  N LTG IP  +G+CSSL  L+LS N  SG++P  +
Sbjct  109   NGLSGSLPDGFFRQCGSLRVFSVAENKLTGKIPVSVGSCSSLASLNLSSNRFSGSMPLGI  168

Query  1645  SMLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPA  1508
               L  L+ L L  N+L GE+  ++G+L NL A+++S NRL+G +P+
Sbjct  169   WSLNTLRSLDLSRNELEGELGTKIGRLNNLRAIDLSRNRLSGPIPS  214


 Score = 56.6 bits (135),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 49/133 (37%), Positives = 72/133 (54%), Gaps = 4/133 (3%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L GE+   I    +L  + L  N L+G IP +IG+C  L  + LS N+LSG +P+T   L
Sbjct  184   LEGELGTKIGRLNNLRAIDLSRNRLSGPIPSEIGSCMLLKSVDLSENSLSGNLPDTFQQL  243

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSI--FQNLDSSAIEGN  1463
                  L L  N L GE+P+ +G++ +L ++++S N+ +G +P GSI     L      GN
Sbjct  244   SLCYHLNLGRNLLDGEVPKWIGEMRSLESLDLSMNKFSGEVP-GSIGNLLRLKVLNFSGN  302

Query  1462  DGICS-PLLTGPC  1427
               I S P  TG C
Sbjct  303   GFIGSLPDSTGNC  315


 Score = 54.7 bits (130),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 62/116 (53%), Gaps = 1/116 (1%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             ++L G +P+   +      L L  N L G +P  IG   SL  L LS N  SG +P ++ 
Sbjct  230   NSLSGNLPDTFQQLSLCYHLNLGRNLLDGEVPKWIGEMRSLESLDLSMNKFSGEVPGSIG  289

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSA  1475
              L RLK+L    N   G +P   G   NL+A++VS N LTG+LP   +FQ+ +S+ 
Sbjct  290   NLLRLKVLNFSGNGFIGSLPDSTGNCINLMALDVSGNSLTGKLPV-WLFQDGNSTG  344



>ref|NP_001142419.1| uncharacterized protein LOC100274594 [Zea mays]
 gb|ACF88448.1| unknown [Zea mays]
Length=511

 Score =   384 bits (986),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 240/517 (46%), Positives = 336/517 (65%), Gaps = 24/517 (5%)
 Frame = -1

Query  1750  NSLTGTIPPQIGNCssltllslshnnlSGTIPETLSMLKRLKILKLEVNQLSGEIPQQLG  1571
             NSLTG IP QIGNCSSL  L  SHNNL+  IP T+  L  L+++ L  N+L+G +P +L 
Sbjct  4     NSLTGRIPAQIGNCSSLVALDFSHNNLTWPIPSTMGNLTSLQVVNLSQNKLNGTLPVELS  63

Query  1570  KLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDGICSPLLTGPCKMNAPKPIVINP  1391
              L +L   +VS+N LTG LP    F N+  S +  N G+CS      C    PKPIV+NP
Sbjct  64    NLPSLHIFDVSHNMLTGDLPHSRFFNNIPESFLVDNSGLCSSRKNDSCSAVMPKPIVLNP  123

Query  1390  FVYGNQTdnnnggdnNEPLASTRNSRHHR--FLsvsaivaisaaaiiavgvmvITMVNAS  1217
                 N +         +   S  ++ HH+   LS+S +VAI+  A IA+GV+ I+++N  
Sbjct  124   NSSSNPSW--------QATPSAPSNMHHKKIILSISTLVAIAGGAAIAIGVITISVLNRR  175

Query  1216  VRRRISFVENALESMCSS---TSSRSQGMATGKLILFDTKSSPDWASSTFESVLNKASEI  1046
             VR R +   +A  +  S    + S     ++GKL++F  K SP++ S+   ++LNK  E+
Sbjct  176   VRARAAAPRSAPATALSDDYLSQSPENDASSGKLVMFG-KGSPEF-SAGGHALLNKDCEL  233

Query  1045  GEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDFDREVRVLGKARHQNLVPLRGYY  866
             G G FG VYK  L     + VAIKKLT S +++  +DF+R+V+ L K RH N+V LRG+Y
Sbjct  234   GRGGFGAVYKTVL--RDGQPVAIKKLTVSSLVKSKDDFERQVKTLSKVRHHNIVALRGFY  291

Query  865   WTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAVRFKIILGTAKGLAHLHHSCQPP  686
             WT  LQLL+ D++P GNL   LHE         L+W  RF IILG A+GL +LH   Q  
Sbjct  292   WTSSLQLLIYDYLPGGNLHKHLHE---CNEDSLLSWMERFDIILGIARGLTYLH---QHG  345

Query  685   IIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRV  506
             IIHYN+K SN+LLD N  PK+ D+GLA+L+  LDR+V+S++ Q+A+GY+APE AC+++++
Sbjct  346   IIHYNLKSSNVLLDSNGEPKVGDYGLAKLLPMLDRYVLSSKVQSALGYMAPEFACKTVKI  405

Query  505   NEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGM-GGYPD  329
              EKCDVYGFG+L+LE +TGRRPVEY ED+V++L D VR  LE+G   +CVD  + G +P 
Sbjct  406   TEKCDVYGFGVLLLEALTGRRPVEYLEDDVVVLCDLVRGALEEGRPEDCVDPRLRGEFPM  465

Query  328   EEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTP  218
             +E LPV+KL LVCTSQ+PS+RP M EVV +L++++ P
Sbjct  466   DEALPVIKLGLVCTSQVPSNRPGMGEVVSMLELVRNP  502



>ref|XP_004241084.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Solanum lycopersicum]
Length=971

 Score =   397 bits (1020),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 253/543 (47%), Positives = 359/543 (66%), Gaps = 26/543 (5%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G IP ++  + SL  L+L+ N+LTG IP  IGNCS+L  LSLSHN L+G +P TL+ L
Sbjct  449   LNGSIPLELGGAYSLRELKLEKNALTGEIPTSIGNCSALLSLSLSHNGLTGPLPATLAKL  508

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
              +L+ + L  N+L+G +P+QL  L +L   N+S+N+L G LP+G  F  +   ++  N  
Sbjct  509   SKLQNVDLSFNKLTGILPKQLVNLGHLELFNISHNQLKGELPSGGFFNTISPYSVSANPS  568

Query  1456  ICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHR-FLsvsaiv  1280
             +C       C    PKPIV+NP    N T++        P       RH +  LS+SA++
Sbjct  569   LCGAAANRSCPTVLPKPIVLNP----NSTESI-------PGTIPPTVRHEKKILSISALI  617

Query  1279  aisaaaiiavgvmvITMVNASVRRRISFVENALESMCSSTSSRSQGMA--TGKLILFDTK  1106
             AISAAAII VGV+ IT++N  VR   S     L        S SQ     +GKL++F  +
Sbjct  618   AISAAAIIVVGVIAITVLNLRVRSATSHSAATLTFSGGDDYSPSQSTDANSGKLVMFSGE  677

Query  1105  SSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDFDR  926
                D+++ +  ++LNK  E+G G FG VY+  LG      VAIKKLT S +++   DF++
Sbjct  678   L--DFSTGS-HALLNKDCELGRGGFGAVYRTVLGD--GMPVAIKKLTVSGLVKSQVDFEK  732

Query  925   EVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAVRF  746
             EV+ LGK  H NLV L+GYYWTP LQLL+ +F+  GNL   +HE     +   L+W  RF
Sbjct  733   EVKKLGKIHHPNLVALQGYYWTPSLQLLIYEFITGGNLYQHIHE---GSSKNLLSWNERF  789

Query  745   KIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVMSN  566
              +ILGTAKGLA+LH   Q  IIHYN+K SNIL+D + +PK++D+GLARL+  LDR+V+S+
Sbjct  790   NVILGTAKGLANLH---QMNIIHYNLKSSNILIDSSGDPKVADYGLARLLPMLDRYVLSS  846

Query  565   RFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRVL  386
             + Q+A+GY+APE AC+++++ +KCDVYGFG+L+LEIVTG++PVEY ED+V++L D VR  
Sbjct  847   KIQSALGYMAPEFACKTVKITDKCDVYGFGVLVLEIVTGKKPVEYMEDDVIVLCDMVRGA  906

Query  385   LEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPVPN  209
             LE+G V ECVD+ + G +P EE +PV+KL L+CTSQ+PS+RP+MAEVV +L++I+ P   
Sbjct  907   LEEGKVEECVDKRLHGKFPAEEAIPVMKLGLICTSQVPSNRPNMAEVVNLLEMIRWPSEG  966

Query  208   RME  200
             + E
Sbjct  967   QEE  969


 Score = 57.4 bits (137),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 61/102 (60%), Gaps = 0/102 (0%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
               GE+P+ +        L L  N+L GT+P  IG   SL +L LS NN SG +P +   L
Sbjct  253   FTGELPKTMQMLSLCNELILKHNALVGTVPEWIGEMKSLEMLDLSGNNFSGQLPNSAGKL  312

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP  1511
             + LK+L +  N +SG++P+ +    NL+A++VS+N LTG LP
Sbjct  313   QSLKLLNVSRNGISGDLPKSMSSCVNLMALDVSHNSLTGDLP  354


 Score = 53.9 bits (128),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 59/102 (58%), Gaps = 0/102 (0%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L GEIP  I    +L  + L  N L G +P  IG+C  L  + LS N  +G +P+T+ ML
Sbjct  205   LDGEIPVGIEGMYNLRAINLRKNHLKGEVPDGIGSCLLLRSIDLSENYFTGELPKTMQML  264

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP  1511
                  L L+ N L G +P+ +G++++L  +++S N  +G+LP
Sbjct  265   SLCNELILKHNALVGTVPEWIGEMKSLEMLDLSGNNFSGQLP  306



>ref|XP_007033525.1| Leucine-rich receptor-like protein kinase family protein [Theobroma 
cacao]
 gb|EOY04451.1| Leucine-rich receptor-like protein kinase family protein [Theobroma 
cacao]
Length=965

 Score =   397 bits (1019),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 247/549 (45%), Positives = 349/549 (64%), Gaps = 39/549 (7%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G IP +I  + SL  L L  N L+G +P QI NCSSLT L LS NNLSG+IP  ++ L
Sbjct  444   LNGSIPSEIGGAVSLKELSLQRNFLSGKVPTQIVNCSSLTTLILSQNNLSGSIPPAIANL  503

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
               L+ + L +N L+G +P++L  L  L++ N+S+N L G LP G  F  + +S++ GN  
Sbjct  504   SNLQYVDLSLNDLTGSLPKELANLSQLMSFNISHNHLRGELPLGGFFNTIPTSSVSGNPS  563

Query  1456  ICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHR---FLsvsa  1286
             +C  ++   C    PKPIV+NP    N +D+           S+ N  HHR    LS+SA
Sbjct  564   LCGSVVNRSCPAVHPKPIVLNP----NSSDSIG--------GSSPN--HHRKKIVLSISA  609

Query  1285  ivaisaaaiiavgvmvITMVNASVRRRISFVENAL------ESMCSSTSSRSQGMATGKL  1124
             ++AI AAA I +GV+ +T++N  VR  +S     L      +  CS  +  + G    KL
Sbjct  610   LIAIGAAAFIVIGVVAVTVLNIHVRSSMSRAPATLTLSGGEDFSCSPANDPNYG----KL  665

Query  1123  ILFDTKSSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQY  944
             ++F   +  D  +    ++LNK  E+G G FG VY+  L     R VAIKKLT S +++ 
Sbjct  666   VMFSGDADFDAGA---HALLNKDCELGRGGFGVVYRTIL--RDGRSVAIKKLTVSSLIKS  720

Query  943   PEDFDREVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPL  764
              E+F+REV+ LGK RH NLV L GYYWT  LQLL+ +FV  G+L   LH+         L
Sbjct  721   QEEFEREVKKLGKIRHHNLVALEGYYWTSSLQLLIFEFVSSGSLYKHLHD---GPGRTCL  777

Query  763   TWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLD  584
             +W  RF IILGTAKGLA+LH   +  +IHYN+K +NIL+D +  PK+ DFGLARL+  LD
Sbjct  778   SWRQRFNIILGTAKGLAYLH---RMNVIHYNLKSTNILIDSSGEPKVGDFGLARLLPTLD  834

Query  583   RHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILN  404
             R ++S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE++TG+RPVEY ED+V++L+
Sbjct  835   RCILSSKIQSALGYMAPEFACKTVKITEKCDVYGFGVLVLEVITGKRPVEYMEDDVVVLS  894

Query  403   DHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVI  227
             D VR  LE G V EC+D  +   +P EE +PV+KL L+C SQ+PS+RP M EVV IL++I
Sbjct  895   DMVRGALEDGRVEECIDGSLRSNFPAEEAIPVIKLGLICASQVPSNRPDMEEVVNILELI  954

Query  226   KTPVPNRME  200
             + P   + E
Sbjct  955   QCPSDGQEE  963


 Score = 67.4 bits (163),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 51/130 (39%), Positives = 74/130 (57%), Gaps = 3/130 (2%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G +P+ +   GS   + L GNS  G +P  IG  ++L  L LS NN SG +P +L  L
Sbjct  248   LSGSLPDSMQRLGSCTSISLRGNSFRGQVPDWIGELTNLESLDLSANNFSGRVPFSLGNL  307

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
             + L+ L L +NQ +G +P+ +    NLLA++VS N LTG +P+      ++S+ I GN  
Sbjct  308   QFLRKLDLSMNQFTGALPESMANCFNLLAMDVSQNLLTGNVPSWMFKLGVNSALISGNTL  367

Query  1456  IC---SPLLT  1436
             I    SPLL 
Sbjct  368   IGKMESPLLA  377


 Score = 62.8 bits (151),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 64/105 (61%), Gaps = 1/105 (1%)
 Frame = -1

Query  1822  SALIGEIPEDI-CESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETL  1646
             ++L G IP+D   + GSLG +    N+LTG IP  + +CS+L  ++ S N +SG +P  +
Sbjct  125   NSLSGLIPDDFFAQCGSLGSVSFARNNLTGQIPDSLSSCSTLVAVNFSSNQISGQLPSGI  184

Query  1645  SMLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP  1511
               L+ L+ L +  N + G+IP+ +G L +L  ++   NR +GRLP
Sbjct  185   WFLRGLQSLDISGNLVEGDIPEGIGNLYDLRQIDFGNNRFSGRLP  229


 Score = 56.6 bits (135),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 56/100 (56%), Gaps = 0/100 (0%)
 Frame = -1

Query  1810  GEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSMLKR  1631
             G+IPE I     L  +    N  +G +P  IG+CS L  L  S N LSG++P+++  L  
Sbjct  202   GDIPEGIGNLYDLRQIDFGNNRFSGRLPEDIGSCSQLKSLDFSENYLSGSLPDSMQRLGS  261

Query  1630  LKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP  1511
                + L  N   G++P  +G+L NL ++++S N  +GR+P
Sbjct  262   CTSISLRGNSFRGQVPDWIGELTNLESLDLSANNFSGRVP  301


 Score = 55.5 bits (132),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 60/105 (57%), Gaps = 1/105 (1%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQI-GNCssltllslshnnlSGTIPETLSM  1640
             L G I  ++   GSL ++ L GNSL+G IP      C SL  +S + NNL+G IP++LS 
Sbjct  103   LTGPINSELSHIGSLKVIDLSGNSLSGLIPDDFFAQCGSLGSVSFARNNLTGQIPDSLSS  162

Query  1639  LKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAG  1505
                L  +    NQ+SG++P  +  L  L ++++S N + G +P G
Sbjct  163   CSTLVAVNFSSNQISGQLPSGIWFLRGLQSLDISGNLVEGDIPEG  207



>ref|XP_009402208.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Musa acuminata subsp. malaccensis]
Length=974

 Score =   397 bits (1019),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 246/535 (46%), Positives = 353/535 (66%), Gaps = 23/535 (4%)
 Frame = -1

Query  1810  GEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSMLKR  1631
             G IP +I ++ SL  L+L+ NSLTG IP QIGNCSSLT + LS NNL+G +P+T++ L  
Sbjct  450   GSIPLEIGKAVSLKELRLEKNSLTGEIPVQIGNCSSLTTMMLSQNNLTGPLPQTIANLTN  509

Query  1630  LKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDGIC  1451
             L  + L  N+LSG +P+QL  L +LL+ N+S+N  +G LPAG+ F  +  S++  N G+C
Sbjct  510   LHKVDLSFNRLSGNLPKQLSNLPHLLSFNISHNLFSGDLPAGNFFNAIPPSSLSDNPGLC  569

Query  1450  SPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRFLsvsaivais  1271
               ++   C    PKPIV+NP    +  + +          S++N+RH + +   + +   
Sbjct  570   GSVVNRSCPTVLPKPIVLNPNSSTSSANTS---------LSSKNTRHKKIIFSISALIAI  620

Query  1270  aaaiiavg-vmvITMVNASVRRRISFVENALESMCSS--TSSRSQGMATGKLILFDTKSS  1100
              AA++    V+ IT++N  VR        A  ++     ++S S    +GKL++F + S 
Sbjct  621   GAAVVIALGVITITILNMRVRASTDPHSAAALALSDGYYSNSPSTDANSGKLVMF-SGSD  679

Query  1099  PDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDFDREV  920
             P++ S+   ++LNK  E+G G FGTVYK  L     R V IKKLT S +++  EDF+REV
Sbjct  680   PNF-STRAHTILNKDCELGRGGFGTVYKTNL--RDGRPVVIKKLTVSSLVKSQEDFEREV  736

Query  919   RVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAVRFKI  740
             + LGK RH NLV L GYYWT  LQLL+ +FV  G+L   LHE +    + P +W  RF I
Sbjct  737   KKLGKLRHSNLVALEGYYWTQSLQLLIYEFVSGGSLYKHLHECS---TSNPFSWQERFDI  793

Query  739   ILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVMSNRF  560
             ILG A+ LA+LH   +  IIHYN+K SNIL+D +   K+ D+GLA+L+  LDR+V+S++ 
Sbjct  794   ILGIARSLAYLH---RLNIIHYNLKSSNILIDGSGEAKVGDYGLAKLLPMLDRYVLSSKI  850

Query  559   QAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRVLLE  380
             Q+A+GY+APE AC+ +++ EKCDVYGFG+L+LEI+TGRRPVEY ED+V++L D VRV LE
Sbjct  851   QSALGYMAPEFACRMVKITEKCDVYGFGVLLLEIITGRRPVEYMEDDVVVLCDVVRVALE  910

Query  379   QGNVLECVDQGMGG-YPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTP  218
             +G V E VD  +GG +P EE +PV+KL L+CTSQ+PS+RP M+EVV IL++I+ P
Sbjct  911   EGRVDELVDGRLGGKFPAEEGVPVVKLGLICTSQVPSNRPGMSEVVSILEMIRCP  965


 Score = 62.4 bits (150),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 45/103 (44%), Positives = 64/103 (62%), Gaps = 1/103 (1%)
 Frame = -1

Query  1816  LIGEIPEDIC-ESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSM  1640
             L G IP++   +  SL  L L  N+ TG IPP +G+C +L  L+LS N LSG++P+ L  
Sbjct  136   LSGVIPDEFFGQCRSLRSLSLANNAFTGHIPPSLGSCLTLAALNLSSNRLSGSLPKGLWS  195

Query  1639  LKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP  1511
             L  L+ L L  N L GEIP  + +L NL ++++  N L+GRLP
Sbjct  196   LYGLRSLDLSDNSLVGEIPGGISRLYNLRSISLRQNHLSGRLP  238


 Score = 59.7 bits (143),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 36/104 (35%), Positives = 63/104 (61%), Gaps = 0/104 (0%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             ++L+GEIP  I    +L  + L  N L+G +P  +G+C  L  L  S N L+G++P+++ 
Sbjct  207   NSLVGEIPGGISRLYNLRSISLRQNHLSGRLPDDMGSCLLLKYLDFSVNFLTGSLPDSMH  266

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP  1511
              L     L+L  N  SG++P  +G+++NL  +++S N  +GR+P
Sbjct  267   RLSMCSHLRLASNLFSGKVPTWIGEMKNLEFLDLSRNWFSGRVP  310


 Score = 54.7 bits (130),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 40/118 (34%), Positives = 63/118 (53%), Gaps = 0/118 (0%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G +P+ +        L+L  N  +G +P  IG   +L  L LS N  SG +PE++  L
Sbjct  257   LTGSLPDSMHRLSMCSHLRLASNLFSGKVPTWIGEMKNLEFLDLSRNWFSGRVPESIGKL  316

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGN  1463
             + LK L L  N+L+G +P+ +G   +L  +++S N LTG LP+      L   ++ GN
Sbjct  317   QLLKSLDLSRNRLTGGLPESIGACRSLTDLDLSDNSLTGNLPSWVFELKLQRISVFGN  374



>ref|XP_010504542.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Camelina sativa]
Length=968

 Score =   396 bits (1018),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 237/538 (44%), Positives = 333/538 (62%), Gaps = 24/538 (4%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G IP +   + SL  L+LD N L G IPP I NCS L  L LSHN L G+IP  L+ L
Sbjct  440   LNGTIPRETGGAVSLEELRLDNNLLAGNIPPSIKNCSPLRSLILSHNKLLGSIPPELAKL  499

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
              +L+ + +  N+L+G +P+QL  L  L   N+S+N L G LPAG IF  L  +++ GN G
Sbjct  500   TKLEEVDISFNELTGTLPKQLANLGYLHTFNMSHNHLFGELPAGGIFNGLSPNSVSGNPG  559

Query  1456  ICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRFLsvsaiva  1277
             IC  ++   C   APKPIV+NP    N T + + G+     A  +         ++   A
Sbjct  560   ICGAVVNNSCPAVAPKPIVLNP----NSTIDPSSGEVMPAGAGHKRILLSISSLIAISAA  615

Query  1276  isaaaiiavgvmvITMVNASVRRR----ISFVENALESMCSSTSSRSQGMATGKLILFDT  1109
              +    +    ++   V AS   R    ++F      S   +T S S     GKL++F  
Sbjct  616   AAIVVGVIAITVLNLRVRASTVSRSAVPLTFSGGDDFSRSPTTDSNS-----GKLVMFSG  670

Query  1108  KSSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDFD  929
             +  PD+++ T  ++LNK  E+G G FG VY+  +       VAIKKLT S +++  E+F+
Sbjct  671   E--PDFSTGT-HALLNKDCELGRGGFGAVYRTVI--RDGYPVAIKKLTISSLVKSQEEFE  725

Query  928   REVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAVR  749
             REV+ LGK RH NLV L GYYW   LQLL+ +F+  G+L   LHE     ++  L+W  R
Sbjct  726   REVKKLGKLRHSNLVKLEGYYWATSLQLLIYEFLSGGSLYKHLHEAPGGSSS--LSWNDR  783

Query  748   FKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVMS  569
             F +ILGTAK LA+LH   Q  +IHYNIK SN+LLD +  PK+ D+GLARL+  LDR+V+S
Sbjct  784   FNVILGTAKCLAYLH---QSNVIHYNIKSSNVLLDSSGEPKVGDYGLARLLPMLDRYVLS  840

Query  568   NRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRV  389
             ++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE+VTG++PVEY ED+V++L D VR 
Sbjct  841   SKIQSALGYMAPEFACRTVKITEKCDVYGFGVLVLEVVTGKKPVEYMEDDVVVLCDMVRE  900

Query  388   LLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTP  218
              LE G   EC+D  + G +P EE + V+KL L+CTSQ+PSSRP M E V IL++I+ P
Sbjct  901   ALEDGRADECIDPRLQGKFPVEEAIAVIKLGLICTSQVPSSRPHMGEAVNILRMIRCP  958


 Score = 63.9 bits (154),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 62/102 (61%), Gaps = 0/102 (0%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L GE PE I    +L  L L  N L+G IP +IG+C  L  + LS N+LSG++P+T   L
Sbjct  207   LEGEFPEKIDRLNNLRSLDLSRNRLSGPIPSEIGSCMLLKTIDLSDNSLSGSLPDTFQQL  266

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP  1511
                  L L  N L GE+P+ +G++ +L  +++S N+ TG++P
Sbjct  267   SLCYSLNLGKNALEGEVPKWIGEMRSLETLDLSMNKFTGQVP  308


 Score = 57.8 bits (138),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 68/106 (64%), Gaps = 1/106 (1%)
 Frame = -1

Query  1822  SALIGEIPEDIC-ESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETL  1646
             +AL G +P+    + GSL +L L  N LTG IP  I +CSSL  L+LS N  SG++P  +
Sbjct  132   NALSGSLPDGFFKQCGSLRVLSLAKNKLTGKIPVSISSCSSLASLNLSSNRFSGSMPSGI  191

Query  1645  SMLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPA  1508
               L  L+ L L  N+L GE P+++ +L NL ++++S NRL+G +P+
Sbjct  192   WSLNTLRSLDLSRNELEGEFPEKIDRLNNLRSLDLSRNRLSGPIPS  237


 Score = 54.3 bits (129),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 44/123 (36%), Positives = 67/123 (54%), Gaps = 3/123 (2%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             ++L G +P+   +      L L  N+L G +P  IG   SL  L LS N  +G +P+++ 
Sbjct  253   NSLSGSLPDTFQQLSLCYSLNLGKNALEGEVPKWIGEMRSLETLDLSMNKFTGQVPDSIG  312

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQN--LDSSAIE  1469
              L  LK+L    N L G +P       NLLA+++S N LTG+LP   IFQ+   D SA++
Sbjct  313   NLLALKVLNFSGNGLIGSLPDSTANCINLLALDISGNSLTGKLPM-LIFQDGSRDVSALK  371

Query  1468  GND  1460
              ++
Sbjct  372   NDN  374



>ref|XP_003623626.1| Receptor-like protein kinase [Medicago truncatula]
Length=948

 Score =   395 bits (1016),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 249/544 (46%), Positives = 351/544 (65%), Gaps = 29/544 (5%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G IP ++  + SLG L+L  NS+ G IP QI  CS+LT L LSHN L+G+IP  ++ L
Sbjct  426   LNGSIPFELEGAISLGELRLQKNSIGGRIPDQIAKCSALTSLDLSHNKLTGSIPGAIANL  485

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
               L+ + L  N+LSG +P++L  L NLL+ +VSYN L G LP G  F  + SS++ GN  
Sbjct  486   TNLQHVDLSWNELSGTLPKELTNLSNLLSFDVSYNHLQGELPVGGFFNTIPSSSVTGNSL  545

Query  1456  ICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLAS--TRNSRHHRFLsvsai  1283
             +C  ++   C    PKPIV+NP             +++ P +S  +   RH   LS+SA+
Sbjct  546   LCGSVVNHSCPSVHPKPIVLNP-------------NSSAPNSSVPSNYHRHKIILSISAL  592

Query  1282  vaisaaaiiavgvmvITMVNASVRRRI--SFVENALESMCSSTSSRSQGMATGKLILFDT  1109
             VAI AAA+IAVGV+ IT +N   R  +  S V  A       ++S +     GKL++F  
Sbjct  593   VAIGAAALIAVGVVAITFLNMRARSAMERSAVPFAFSGGEDYSNSPANDPNYGKLVMFSG  652

Query  1108  KSSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDFD  929
              +  D+A     ++LNK SEIG G FG VY+  L       VAIKKLT S +++  ++F+
Sbjct  653   DA--DFADGA-HNLLNKDSEIGRGGFGVVYRTFL--RDGHAVAIKKLTVSSLIKSQDEFE  707

Query  928   REVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAVR  749
             +EV+  GK RHQNLV L GYYWT  LQLL+ +++  G+L   LH+   A     L+W  R
Sbjct  708   KEVKRFGKIRHQNLVALEGYYWTSSLQLLIYEYLSSGSLHKLLHD---ANNKNVLSWRQR  764

Query  748   FKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVMS  569
             FK+ILG AKGL+HLH   +  IIHYN+K +N+L+D +   KI DFGL +L+  LD  V+S
Sbjct  765   FKVILGMAKGLSHLH---ETNIIHYNLKSTNVLIDCSGEAKIGDFGLVKLLPMLDHCVLS  821

Query  568   NRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRV  389
             ++ Q+A+GY+APE AC+++++ EKCDVYGFG+LILEIVTG+RPVEY ED+V++L D VR 
Sbjct  822   SKIQSALGYMAPEFACRTVKITEKCDVYGFGILILEIVTGKRPVEYMEDDVVVLCDMVRG  881

Query  388   LLEQGNVLECVDQG-MGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPVP  212
              LE+GNV  CVD+  +G +  EE +PV+KL L+C SQ+PS+RP M+EV+ IL++I+ P  
Sbjct  882   SLEEGNVEHCVDERLLGNFAAEEAIPVIKLGLICASQVPSNRPDMSEVINILELIQCPSE  941

Query  211   NRME  200
              + E
Sbjct  942   GQEE  945


 Score = 64.7 bits (156),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 47/116 (41%), Positives = 63/116 (54%), Gaps = 1/116 (1%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G IP+ +    S   L L GNS TG IP  IG    L  L LS N  SG IP++L  L
Sbjct  255   LSGGIPQSMQRLNSCNSLSLQGNSFTGNIPDWIGELKDLENLDLSANRFSGWIPKSLGNL  314

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIE  1469
               L+ L    NQL+G +P  +     LLA+++S N+L G LP+  IF+N +   +E
Sbjct  315   NMLQRLNFSRNQLTGNLPDSMMNCTKLLALDISNNQLNGYLPSW-IFRNGNYHGLE  369


 Score = 60.1 bits (144),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 57/102 (56%), Gaps = 0/102 (0%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L GEIPE I     +  L L  N  +G IP  IG C  L  L LS N LSG IP+++  L
Sbjct  207   LDGEIPEGIQNLYDMRELSLKKNRFSGRIPQDIGGCIVLKSLDLSGNLLSGGIPQSMQRL  266

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP  1511
                  L L+ N  +G IP  +G+L++L  +++S NR +G +P
Sbjct  267   NSCNSLSLQGNSFTGNIPDWIGELKDLENLDLSANRFSGWIP  308


 Score = 57.4 bits (137),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 36/103 (35%), Positives = 60/103 (58%), Gaps = 1/103 (1%)
 Frame = -1

Query  1816  LIGEIPEDICES-GSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSM  1640
             L G IPE   +  GSL  +    N+LTG IP  +G C++L  ++ S+N + G +P  +  
Sbjct  134   LKGTIPEGFFQQCGSLKTVNFAKNNLTGNIPVSLGTCNTLANVNFSYNQIDGKLPSEVWF  193

Query  1639  LKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP  1511
             L+ L+ L +  N L GEIP+ +  L ++  +++  NR +GR+P
Sbjct  194   LRGLQSLDVSNNLLDGEIPEGIQNLYDMRELSLKKNRFSGRIP  236


 Score = 53.9 bits (128),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 46/119 (39%), Positives = 59/119 (50%), Gaps = 5/119 (4%)
 Frame = -1

Query  1819  ALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETL-S  1643
             +L G I   +     L  L L GN+ TG I P +    SL ++  S NNL GTIPE    
Sbjct  85    SLSGHIDRGLLRLQFLQTLSLSGNNFTGFINPDLPKLGSLQVVDFSDNNLKGTIPEGFFQ  144

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIF----QNLDSS  1478
                 LK +    N L+G IP  LG    L  VN SYN++ G+LP+   F    Q+LD S
Sbjct  145   QCGSLKTVNFAKNNLTGNIPVSLGTCNTLANVNFSYNQIDGKLPSEVWFLRGLQSLDVS  203



>ref|XP_010424006.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 isoform X1 [Camelina sativa]
Length=959

 Score =   395 bits (1016),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 252/548 (46%), Positives = 351/548 (64%), Gaps = 32/548 (6%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G +P +I  + SL  L L  N L+G IPPQI NCS+L  + LS N LSG IP ++  L
Sbjct  435   LNGTVPCEIGGAVSLKQLNLHRNRLSGQIPPQISNCSALNAIDLSDNELSGVIPGSIGSL  494

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
               LK + L  N LSG +P+++ KL +LL  N+S+N LTG LPAG+ F  +  SA+ GN  
Sbjct  495   SNLKYVDLSRNNLSGSLPKEIEKLSHLLTFNISHNSLTGELPAGAFFNTIPLSAVTGNPS  554

Query  1456  ICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRFLsvsaiva  1277
             +C  L+   C    PKPIV+NP    N ++  NG      +  +        LS+SA++A
Sbjct  555   LCGSLVNRSCLSVHPKPIVLNP----NSSNPTNGPALTGKIRKS-------VLSISALIA  603

Query  1276  isaaaiiavgvmvITMVN----ASVRRRISFVENAL---ESMCSSTSSRSQGMATGKLIL  1118
             I AAA IA GV+ +T++N    ASV R  +    AL   E+   S S   Q    GKL++
Sbjct  604   IGAAAFIAFGVVAVTLLNVHARASVSRHNAAAALALSVGETFSCSPSKDHQEF--GKLVM  661

Query  1117  FDTKSSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPE  938
             F  ++   + ++  +++LNK  E+G G FG VYK  L  +  R VA+KKLT S +++  E
Sbjct  662   FSGEADV-FDTTGADALLNKECELGRGGFGVVYKTNL--QDGRPVAVKKLTVSGLIKSQE  718

Query  937   DFDREVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTW  758
             +F+RE+R LGK RH NLV ++GYYWT  LQLL+ +FV  G+L   LH       +  LTW
Sbjct  719   EFEREMRKLGKLRHNNLVEMKGYYWTQSLQLLIHEFVSGGSLHRHLH----GDESVCLTW  774

Query  757   AVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAK-LDR  581
               RF IILG A+GLA+LH S    I HYN+K +N+L+D     K+SDFGLARL+A  LDR
Sbjct  775   RQRFSIILGIARGLAYLHGS---NITHYNLKATNVLVDATGEAKVSDFGLARLLASALDR  831

Query  580   HVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILND  401
              V+S + Q+A+GY APE AC+++++ +KCDVYGFG+L+LE+VTG+RPVEY ED+V++L +
Sbjct  832   CVLSGKVQSALGYTAPEFACRTVKITDKCDVYGFGILVLEVVTGKRPVEYAEDDVVVLCE  891

Query  400   HVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIK  224
              VR  LE+G V ECVD  + G +P EE +P +KL LVC SQ+PS+RP M EVV+IL++I+
Sbjct  892   TVRERLEEGRVEECVDPRLRGNFPAEEAIPAIKLGLVCGSQVPSNRPDMEEVVKILELIQ  951

Query  223   TPVPNRME  200
              P  + +E
Sbjct  952   CPPSHDLE  959


 Score = 64.3 bits (155),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 48/125 (38%), Positives = 72/125 (58%), Gaps = 1/125 (1%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G +P+ + ++ S   ++L GNSL G IP  IG+ ++L  L LS NN SG +P +L  L
Sbjct  250   LSGNLPDSM-KTSSCTSVRLRGNSLAGDIPDWIGDLATLETLDLSANNFSGNVPFSLGNL  308

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
             + LK L L  N L+GE+PQ +    NL++++VS N  TG +      Q+   S   GND 
Sbjct  309   EFLKELNLSSNMLAGELPQTISNCSNLISIDVSKNSFTGDVLKWMFAQSYSLSRSAGNDT  368

Query  1456  ICSPL  1442
             + + L
Sbjct  369   LVAFL  373



>gb|AES79844.2| LRR receptor-like kinase family protein [Medicago truncatula]
Length=954

 Score =   395 bits (1015),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 249/544 (46%), Positives = 350/544 (64%), Gaps = 29/544 (5%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G IP ++  + SLG L+L  NS+ G IP QI  CS+LT L LSHN L+G+IP  ++ L
Sbjct  432   LNGSIPFELEGAISLGELRLQKNSIGGRIPDQIAKCSALTSLDLSHNKLTGSIPGAIANL  491

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
               L+ + L  N+LSG +P++L  L NLL+ +VSYN L G LP G  F  + SS++ GN  
Sbjct  492   TNLQHVDLSWNELSGTLPKELTNLSNLLSFDVSYNHLQGELPVGGFFNTIPSSSVTGNSL  551

Query  1456  ICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLAS--TRNSRHHRFLsvsai  1283
             +C  ++   C    PKPIV+NP             +++ P +S  +   RH   LS+SA+
Sbjct  552   LCGSVVNHSCPSVHPKPIVLNP-------------NSSAPNSSVPSNYHRHKIILSISAL  598

Query  1282  vaisaaaiiavgvmvITMVNASVRRRI--SFVENALESMCSSTSSRSQGMATGKLILFDT  1109
             VAI AAA+IAVGV+ IT +N   R  +  S V  A       ++S +     GKL++F  
Sbjct  599   VAIGAAALIAVGVVAITFLNMRARSAMERSAVPFAFSGGEDYSNSPANDPNYGKLVMF--  656

Query  1108  KSSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDFD  929
                 D+A     ++LNK SEIG G FG VY+  L       VAIKKLT S +++  ++F+
Sbjct  657   SGDADFADGA-HNLLNKDSEIGRGGFGVVYRTFL--RDGHAVAIKKLTVSSLIKSQDEFE  713

Query  928   REVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAVR  749
             +EV+  GK RHQNLV L GYYWT  LQLL+ +++  G+L   LH+   A     L+W  R
Sbjct  714   KEVKRFGKIRHQNLVALEGYYWTSSLQLLIYEYLSSGSLHKLLHD---ANNKNVLSWRQR  770

Query  748   FKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVMS  569
             FK+ILG AKGL+HLH   +  IIHYN+K +N+L+D +   KI DFGL +L+  LD  V+S
Sbjct  771   FKVILGMAKGLSHLH---ETNIIHYNLKSTNVLIDCSGEAKIGDFGLVKLLPMLDHCVLS  827

Query  568   NRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRV  389
             ++ Q+A+GY+APE AC+++++ EKCDVYGFG+LILEIVTG+RPVEY ED+V++L D VR 
Sbjct  828   SKIQSALGYMAPEFACRTVKITEKCDVYGFGILILEIVTGKRPVEYMEDDVVVLCDMVRG  887

Query  388   LLEQGNVLECVDQG-MGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPVP  212
              LE+GNV  CVD+  +G +  EE +PV+KL L+C SQ+PS+RP M+EV+ IL++I+ P  
Sbjct  888   SLEEGNVEHCVDERLLGNFAAEEAIPVIKLGLICASQVPSNRPDMSEVINILELIQCPSE  947

Query  211   NRME  200
              + E
Sbjct  948   GQEE  951


 Score = 64.3 bits (155),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 47/116 (41%), Positives = 63/116 (54%), Gaps = 1/116 (1%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G IP+ +    S   L L GNS TG IP  IG    L  L LS N  SG IP++L  L
Sbjct  261   LSGGIPQSMQRLNSCNSLSLQGNSFTGNIPDWIGELKDLENLDLSANRFSGWIPKSLGNL  320

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIE  1469
               L+ L    NQL+G +P  +     LLA+++S N+L G LP+  IF+N +   +E
Sbjct  321   NMLQRLNFSRNQLTGNLPDSMMNCTKLLALDISNNQLNGYLPSW-IFRNGNYHGLE  375


 Score = 60.1 bits (144),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 57/102 (56%), Gaps = 0/102 (0%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L GEIPE I     +  L L  N  +G IP  IG C  L  L LS N LSG IP+++  L
Sbjct  213   LDGEIPEGIQNLYDMRELSLKKNRFSGRIPQDIGGCIVLKSLDLSGNLLSGGIPQSMQRL  272

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP  1511
                  L L+ N  +G IP  +G+L++L  +++S NR +G +P
Sbjct  273   NSCNSLSLQGNSFTGNIPDWIGELKDLENLDLSANRFSGWIP  314


 Score = 57.4 bits (137),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 36/103 (35%), Positives = 60/103 (58%), Gaps = 1/103 (1%)
 Frame = -1

Query  1816  LIGEIPEDICES-GSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSM  1640
             L G IPE   +  GSL  +    N+LTG IP  +G C++L  ++ S+N + G +P  +  
Sbjct  140   LKGTIPEGFFQQCGSLKTVNFAKNNLTGNIPVSLGTCNTLANVNFSYNQIDGKLPSEVWF  199

Query  1639  LKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP  1511
             L+ L+ L +  N L GEIP+ +  L ++  +++  NR +GR+P
Sbjct  200   LRGLQSLDVSNNLLDGEIPEGIQNLYDMRELSLKKNRFSGRIP  242


 Score = 53.9 bits (128),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 46/119 (39%), Positives = 59/119 (50%), Gaps = 5/119 (4%)
 Frame = -1

Query  1819  ALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETL-S  1643
             +L G I   +     L  L L GN+ TG I P +    SL ++  S NNL GTIPE    
Sbjct  91    SLSGHIDRGLLRLQFLQTLSLSGNNFTGFINPDLPKLGSLQVVDFSDNNLKGTIPEGFFQ  150

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIF----QNLDSS  1478
                 LK +    N L+G IP  LG    L  VN SYN++ G+LP+   F    Q+LD S
Sbjct  151   QCGSLKTVNFAKNNLTGNIPVSLGTCNTLANVNFSYNQIDGKLPSEVWFLRGLQSLDVS  209



>ref|XP_006357297.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Solanum tuberosum]
Length=971

 Score =   395 bits (1016),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 251/542 (46%), Positives = 358/542 (66%), Gaps = 24/542 (4%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G IP ++  + +L  L+L+ N+LTG IP  IGNCS+L  LSLSHN L+G +P TL+ L
Sbjct  449   LNGSIPLELGGAYALRELKLEKNALTGEIPTSIGNCSALLSLSLSHNGLTGPVPATLAKL  508

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
               L+ + L  N+L+G +P+QL  L +L   N+S+N+L G LP+G  F  +   ++  N  
Sbjct  509   SNLQNVDLSFNKLTGILPKQLVNLGHLELFNISHNQLKGELPSGGFFNTISPYSVSANPS  568

Query  1456  ICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRFLsvsaiva  1277
             +C       C    PKPIV+NP    N T++  G     PL         + LS+SA++A
Sbjct  569   LCGAAANRSCPTVLPKPIVLNP----NSTESIPGTI---PLTV---GHEKKILSISALIA  618

Query  1276  isaaaiiavgvmvITMVNASVRRRISFVENALESMCSS--TSSRSQGMATGKLILFDTKS  1103
             ISAAAII VGV+ IT++N  VR   S    AL        + S S    +GKL++F  + 
Sbjct  619   ISAAAIIVVGVIAITVLNLRVRSATSHSAAALTFSGGDDYSPSHSTDANSGKLVMFSGEL  678

Query  1102  SPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDFDRE  923
               D+++ +  ++LNK  E+G G FG VY+  LG      VAIKKLT S +++   DF++E
Sbjct  679   --DFSTGS-HALLNKDCELGRGGFGAVYRTVLGD--GMPVAIKKLTVSGLVKSQVDFEKE  733

Query  922   VRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAVRFK  743
             V+ LGK  H N+V L+GYYWTP LQLL+ +F+  GNL   +HE     +   L+W  RF 
Sbjct  734   VKKLGKVHHPNVVALQGYYWTPSLQLLIYEFITGGNLYDHIHE---GSSKNMLSWNERFN  790

Query  742   IILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVMSNR  563
             +ILGTAKG+A+LH   Q  IIHYN+K SNIL+D + +PK++D+GLARL+  LDR+V+S++
Sbjct  791   VILGTAKGMANLH---QMNIIHYNLKSSNILIDSSGDPKVADYGLARLLPMLDRYVLSSK  847

Query  562   FQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRVLL  383
              Q+A+GY+APE AC+++++ +KCDVYGFG+L+LEIVTG++PVEY ED+V++L D VR  L
Sbjct  848   IQSALGYMAPEFACKTVKITDKCDVYGFGVLVLEIVTGKKPVEYMEDDVIVLCDMVRGAL  907

Query  382   EQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPVPNR  206
             E+G V ECVD+ + G +P EE +PV+KL L+CTSQ+PS+RP MAEVV IL++I+ P   +
Sbjct  908   EEGKVEECVDKRLHGKFPAEEAIPVMKLGLICTSQVPSNRPDMAEVVNILEMIRCPSEGQ  967

Query  205   ME  200
              E
Sbjct  968   EE  969


 Score = 57.0 bits (136),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 34/104 (33%), Positives = 52/104 (50%), Gaps = 24/104 (23%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             +AL+G +PE I E  SL +L L GN+ +G  P  +G                        
Sbjct  275   NALVGSVPEWIGEMKSLEMLDLSGNNFSGQFPNSVGK-----------------------  311

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP  1511
              L+ LK+L +  N +SG+ P+ +    NL+ ++VS+N LTG LP
Sbjct  312   -LQSLKLLNVSRNAISGDFPKSMSSCVNLMTLDVSHNSLTGDLP  354


 Score = 53.1 bits (126),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 55/105 (52%), Gaps = 1/105 (1%)
 Frame = -1

Query  1816  LIGEIPEDICES-GSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSM  1640
             L G IP D  E  G L  + L  N  +G +P  + +C +L  L+LS N  SG +P  +  
Sbjct  132   LFGTIPGDFFEQCGPLRSISLAKNKFSGKVPESLNSCVALGSLNLSSNQFSGLLPSGIWS  191

Query  1639  LKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAG  1505
             L  L+ L L  N L GEIP  +  + NL A+N+  N L G +P G
Sbjct  192   LNGLRSLDLSDNLLDGEIPVGIEGMYNLRAINLRKNHLKGEVPDG  236


 Score = 52.8 bits (125),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 61/126 (48%), Gaps = 24/126 (19%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L GEIP  I    +L  + L  N L G +P  IG+C  L  + LS N+ SG +P+T+ ML
Sbjct  205   LDGEIPVGIEGMYNLRAINLRKNHLKGEVPDGIGSCLLLRSIDLSENSFSGELPKTMQML  264

Query  1636  ------------------------KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNR  1529
                                     K L++L L  N  SG+ P  +GKL++L  +NVS N 
Sbjct  265   SLCNELIMKHNALVGSVPEWIGEMKSLEMLDLSGNNFSGQFPNSVGKLQSLKLLNVSRNA  324

Query  1528  LTGRLP  1511
             ++G  P
Sbjct  325   ISGDFP  330



>ref|XP_004970391.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Setaria italica]
Length=946

 Score =   393 bits (1010),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 242/539 (45%), Positives = 358/539 (66%), Gaps = 24/539 (4%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G +P +I  + +L  L++  NSLTG IP QIGNCSSL  L LSHN+L+G IP T+  L
Sbjct  417   LDGTVPPEIGGAVALRDLRMGRNSLTGGIPAQIGNCSSLVALDLSHNSLTGPIPSTMGNL  476

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
               L+++ L  N+L+G +P +L  L +L   +VS+N LTG LP    F N+  S +  N G
Sbjct  477   TSLQVVNLSQNKLNGTLPVELSNLPSLHIFDVSHNMLTGDLPNSRFFNNIPDSFVMDNSG  536

Query  1456  ICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHR--FLsvsai  1283
             +CS      C    PKPIV+          N++   +++  +S  +++HH+   LS+S +
Sbjct  537   LCSSRKNDSCSAVMPKPIVL--------NPNSSSNPSSQATSSAPSNKHHKKIILSISTL  588

Query  1282  vaisaaaiiavgvmvITMVNASVRRRISFVENALESMCSS---TSSRSQGMATGKLILFD  1112
             +AI+  A IA+GV+ I+++N  VR R +   +A  +  S    + S     ++GKL++F 
Sbjct  589   IAIAGGAAIAIGVITISVLNRRVRARAAASRSAPATALSDDYLSQSPENDASSGKLVMFG  648

Query  1111  TKSSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDF  932
              K SP++ S+   ++LNK  E+G G FG VYK  L     + VAIKKLT S +++  +DF
Sbjct  649   -KGSPEF-SAGGHALLNKDCELGRGGFGAVYKTVL--RDGQPVAIKKLTVSSLVKSKDDF  704

Query  931   DREVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAV  752
             +R+V++L K RH N+V LRG+YWT  LQLL+ D++P GNL  +LHE     +   L+W  
Sbjct  705   ERQVKMLSKVRHHNIVALRGFYWTSSLQLLIYDYLPGGNLHKQLHECTEDNS---LSWME  761

Query  751   RFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVM  572
             RF IILG A+GL +LH   Q  IIHYN+K SN+LLD N  PK+ D+GLA+L+  LDR+V+
Sbjct  762   RFDIILGVARGLTYLH---QHGIIHYNLKSSNVLLDSNGEPKVGDYGLAKLLPMLDRYVL  818

Query  571   SNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVR  392
             S++ Q+++GY+APE AC+++++ EKCDVYGFG+L+LE++TGRRPVEY ED+V++L D VR
Sbjct  819   SSKIQSSLGYMAPEFACKTVKITEKCDVYGFGVLVLEVLTGRRPVEYLEDDVVVLCDLVR  878

Query  391   VLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTP  218
               LE+G   +C+D  + G +P +E LP++KL LVCTSQ+PS+RP M EVV IL+++++P
Sbjct  879   STLEEGRPEDCIDPRLCGEFPMDEALPIIKLGLVCTSQVPSNRPDMGEVVSILELVRSP  937


 Score = 53.1 bits (126),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 59/118 (50%), Gaps = 0/118 (0%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L GEIP D+ E+  L  L    N  TG +P  +   + L  L    N L+G +P  +  +
Sbjct  226   LAGEIPADVGEAALLKSLDFGHNLFTGGLPESLRRLTGLQFLGAGGNALAGELPAWIGEM  285

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGN  1463
             + L+ L L  N+ +G+I   +   +NL+ V++S N LTG LP       L   ++ GN
Sbjct  286   RALERLDLSGNRFAGDISYTIANCKNLVEVDLSRNALTGELPWWVFGLPLQRVSVAGN  343



>ref|XP_006290555.1| hypothetical protein CARUB_v10016642mg [Capsella rubella]
 gb|EOA23453.1| hypothetical protein CARUB_v10016642mg [Capsella rubella]
Length=939

 Score =   393 bits (1010),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 235/534 (44%), Positives = 327/534 (61%), Gaps = 43/534 (8%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G IP +   + SL  L+LD N L G IP  I  CSSL  L LSHN L GTIP  L+ L
Sbjct  438   LNGTIPRETGGAVSLEELRLDNNLLEGNIPSSIKTCSSLRSLILSHNKLVGTIPPELAKL  497

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
              +L+ + +  N+L+G +P+QL  L  L   N+S+N L G LPAG IF  L  S++ GN G
Sbjct  498   TKLEEVDISFNELTGTLPKQLANLGYLHTFNMSHNHLFGELPAGGIFNGLSPSSVSGNTG  557

Query  1456  ICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRFLsvsaiva  1277
             IC  ++   C   +PKPIV+NP    N T ++        +A T  +   R         
Sbjct  558   ICGAVVNNSCPAVSPKPIVLNP----NATFDSYSAIVVGVIAITVLNLRVR---------  604

Query  1276  isaaaiiavgvmvITMVNASVRRRISFVENALESMCSSTSSRSQGMATGKLILFDTKSSP  1097
                           T+  ++V    S  ++   S  + ++S       GKL++F  +  P
Sbjct  605   ------------ASTVSRSAVPLTFSGGDDFSRSPTTDSNS-------GKLVMFSGE--P  643

Query  1096  DWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDFDREVR  917
             D+++ T  ++LNK  E+G G FG VY+  +       VAIKKLT S +++  E+F+REV+
Sbjct  644   DFSTGT-HALLNKDCELGRGGFGAVYRTVI--RDGYPVAIKKLTVSSLVKSQEEFEREVK  700

Query  916   VLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAVRFKII  737
              LGK RH NLV L GYYWT  LQLL+ +F+  G+L   LHE     +   L+W  RF +I
Sbjct  701   KLGKLRHSNLVKLEGYYWTTSLQLLIYEFLSGGSLYKHLHEAPGGSSL--LSWNDRFNVI  758

Query  736   LGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVMSNRFQ  557
             LGTAK LA+LH   Q  IIHYNIK SN+LLD +  PK+ D+GLARL+  LDR+V+S++ Q
Sbjct  759   LGTAKCLAYLH---QSNIIHYNIKSSNVLLDSSGEPKVGDYGLARLLPMLDRYVLSSKIQ  815

Query  556   AAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRVLLEQ  377
             +A+GY+APE AC+++++ EKCDVYGFG+L+LE+VTG++PVEY ED+V++L D VR  LE 
Sbjct  816   SALGYMAPEFACRTVKITEKCDVYGFGVLVLEVVTGKKPVEYMEDDVVVLCDMVREALED  875

Query  376   GNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTP  218
             G   EC+D  + G +P EE + V+KL L+CTSQ+PSSRP M E V IL++I+ P
Sbjct  876   GRADECIDPRLQGKFPVEEAIAVIKLGLICTSQVPSSRPHMGEAVNILRMIRCP  929


 Score = 64.3 bits (155),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 62/102 (61%), Gaps = 0/102 (0%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L GE PE I    +L  L L  N L+G IP +IG+C  L  + LS N+LSGT+P+T   L
Sbjct  205   LEGEFPEKIDRLNNLRSLDLSRNRLSGPIPSEIGSCMLLKTIDLSDNSLSGTLPDTFQQL  264

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP  1511
                  L L  N L GE+P+ +G++ +L  +++S N+ +G++P
Sbjct  265   SLCYSLNLGKNALEGEVPKWIGEMRSLETLDLSMNKFSGQVP  306


 Score = 63.5 bits (153),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 44/106 (42%), Positives = 67/106 (63%), Gaps = 1/106 (1%)
 Frame = -1

Query  1822  SALIGEIPEDIC-ESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETL  1646
             +AL G + +    + GSL +L L  N LTG IP  I +CSSL  L+LS N  SG++P  +
Sbjct  130   NALSGSLSDGFFRQCGSLRVLSLAKNKLTGKIPVSISSCSSLAALNLSSNRFSGSMPSGI  189

Query  1645  SMLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPA  1508
               L  L+ L L  N+L GE P+++ +L NL ++++S NRL+G +P+
Sbjct  190   WSLNTLRSLDLSWNELEGEFPEKIDRLNNLRSLDLSRNRLSGPIPS  235


 Score = 55.1 bits (131),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 66/123 (54%), Gaps = 3/123 (2%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             ++L G +P+   +      L L  N+L G +P  IG   SL  L LS N  SG +PE++ 
Sbjct  251   NSLSGTLPDTFQQLSLCYSLNLGKNALEGEVPKWIGEMRSLETLDLSMNKFSGQVPESIG  310

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQN--LDSSAIE  1469
              L  LK+L    N L G +P       NLLA++ S N LTG+LP   IFQ+   D SA++
Sbjct  311   NLLALKVLNFSGNGLIGSLPDSTANCINLLALDFSGNSLTGKLPMW-IFQDGSRDVSALQ  369

Query  1468  GND  1460
              ++
Sbjct  370   NDN  372



>ref|XP_010451924.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Camelina sativa]
Length=953

 Score =   393 bits (1010),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 250/548 (46%), Positives = 348/548 (64%), Gaps = 32/548 (6%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G +P +I  + SL  L L  N L+G IPPQI NCS+L  + LS N LSG IP ++  L
Sbjct  429   LNGTVPCEIGGAVSLKQLNLQRNRLSGHIPPQISNCSALNAIDLSDNELSGVIPGSIGSL  488

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
               LK + L  N LSG +P+ + KL +LL  N+S+N LTG LPAG+ F  +  SA+  N  
Sbjct  489   SNLKYVDLSRNNLSGSLPKDIEKLSHLLTFNISHNSLTGELPAGAFFNTIPLSAVTANPS  548

Query  1456  ICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPL-ASTRNSRHHRFLsvsaiv  1280
             +C  ++   C    PKPIV+NP        N++   N  PL    R S     LS+SA++
Sbjct  549   LCGSVVNRSCLSVHPKPIVLNP--------NSSNPTNGPPLTGKIRKS----VLSISALI  596

Query  1279  aisaaaiiavgvmvITMVNASVRRRISFVENALESMC------SSTSSRSQGMATGKLIL  1118
             AI AAA IA GV+ +T++N   R  +S   NA  ++        S S R      GKL++
Sbjct  597   AIGAAAFIAFGVVAVTLLNVHARASVS-RHNAAAALALSVGETFSCSPRKDHQEFGKLVM  655

Query  1117  FDTKSSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPE  938
             F  ++   + ++  +++LNK  E+G G FG VYK  L  +  R VA+KKLT S +++  E
Sbjct  656   FSGEADV-FDTTGADALLNKDCELGRGGFGVVYKTNL--QDGRPVAVKKLTVSGLMKSQE  712

Query  937   DFDREVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTW  758
             +F+RE+R LGK RH NLV ++GYYWT  LQLL+ +FV  G+L   LH       +  LTW
Sbjct  713   EFEREMRKLGKLRHNNLVEMKGYYWTQSLQLLIHEFVSGGSLHRHLH----GDESVCLTW  768

Query  757   AVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAK-LDR  581
               RF IILG A+GLA+LH S    I HYN+K +N+L+D     K+SDFGLARL+A  LDR
Sbjct  769   RQRFSIILGIARGLAYLHGS---NITHYNLKATNVLVDATGEAKVSDFGLARLLASALDR  825

Query  580   HVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILND  401
              V+S + Q+A+GY APE AC+++++ +KCDVYGFG+L+LE+VTG+RPVEY ED+V++L +
Sbjct  826   CVLSGKVQSALGYTAPEFACRTVKITDKCDVYGFGILVLEVVTGKRPVEYAEDDVVVLCE  885

Query  400   HVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIK  224
              VR  LE+G V ECVD  + G +P EE +P +KL LVC SQ+PS+RP M EVV+IL++I+
Sbjct  886   TVRERLEEGRVEECVDPRLRGNFPAEEAIPAIKLGLVCGSQVPSNRPDMEEVVKILELIQ  945

Query  223   TPVPNRME  200
              P  + +E
Sbjct  946   CPPSHDLE  953


 Score = 60.1 bits (144),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 44/100 (44%), Positives = 61/100 (61%), Gaps = 1/100 (1%)
 Frame = -1

Query  1816  LIGEIPEDICE-SGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSM  1640
             L G +P+ +   S S   ++L GNSL G IP  IG+ +SL  L LS NN SG +P +L  
Sbjct  250   LSGNLPDSMKTISSSCTSIRLRGNSLAGDIPDWIGDVASLETLDLSGNNFSGNVPFSLGN  309

Query  1639  LKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTG  1520
             L+ LK L L  N L+GE+PQ +    NL++++VS N  TG
Sbjct  310   LEFLKELNLSSNMLAGELPQTISNCSNLISIDVSKNSFTG  349



>ref|XP_002309183.1| hypothetical protein POPTR_0006s10910g [Populus trichocarpa]
 gb|EEE92706.1| hypothetical protein POPTR_0006s10910g [Populus trichocarpa]
Length=965

 Score =   394 bits (1011),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 233/547 (43%), Positives = 336/547 (61%), Gaps = 36/547 (7%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G IP +I  + SL  L+L+ N LTG IP QI  CSSL  L LS NNL+G IP  ++ L
Sbjct  445   LNGSIPSEIGGAISLTELRLEKNLLTGKIPTQIKKCSSLASLILSWNNLTGPIPVAVANL  504

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
               L+ + L  N+LSG +P++L  L +LL+ N+S+N L G LP G  F  +  S++ GN  
Sbjct  505   INLQYVDLSFNRLSGSLPKELTNLSHLLSFNISHNNLQGDLPLGGFFNTVSPSSVSGNPS  564

Query  1456  ICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRFLsvsaiva  1277
             +C  ++   C  +  KPIV+NP             ++++    T   RHH+ +   + + 
Sbjct  565   LCGSVVNLSCPSDHQKPIVLNP-------------NSSDSSNGTSLDRHHKIVLSISALI  611

Query  1276  isaaaiiavgvmvITMV------NASVRRRISFVENALESM-CSSTSSRSQGMATGKLIL  1118
                AA      +V  +       ++  R   +F  +  E   CS T+  + G    KL++
Sbjct  612   AIGAAACITLGVVAVIFLNIHAQSSMARSPAAFAFSGGEDFSCSPTNDPNYG----KLVM  667

Query  1117  FDTKSSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPE  938
             F   +  D+ +    ++LNK SE+G G FG VY+  L     R VAIKKLT S +++  +
Sbjct  668   FSGDA--DFVAGA-RALLNKDSELGRGGFGVVYRTIL--RDGRSVAIKKLTVSSLIKSQD  722

Query  937   DFDREVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTW  758
             +F+REV+ LGK RH NLV L GYYWTP LQLL+ ++V  G+L   LH+         L+W
Sbjct  723   EFEREVKELGKVRHHNLVALEGYYWTPTLQLLIYEYVSSGSLYKHLHD---GPDKKYLSW  779

Query  757   AVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRH  578
               RF IILG A+ LAHLHH     I+HYN+K +NIL+D++  PK+ DFGLA+L+  LDR 
Sbjct  780   RHRFNIILGMARALAHLHHM---NIVHYNLKSTNILIDDSGEPKVGDFGLAKLLPTLDRC  836

Query  577   VMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDH  398
             ++S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE+VTG+RPVEY ED+V++L D 
Sbjct  837   ILSSKIQSALGYMAPEFACRTVKITEKCDVYGFGILVLEVVTGKRPVEYMEDDVVVLCDM  896

Query  397   VRVLLEQGNVLECVDQGMGG-YPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKT  221
             VR  LE G V EC+D  +GG  P +E +PV+KL L+C SQ+PS+RP M EVV IL++I+ 
Sbjct  897   VRGALEDGRVEECIDGKLGGKVPADEAIPVIKLGLICASQVPSNRPDMEEVVNILELIQC  956

Query  220   PVPNRME  200
             P     E
Sbjct  957   PAEGHEE  963


 Score = 72.0 bits (175),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 49/120 (41%), Positives = 70/120 (58%), Gaps = 0/120 (0%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             ++L G +PE +    S   ++L GNS TG +P  IG  + L  L LS N  SG IP ++ 
Sbjct  247   NSLSGSLPESLRRLSSCATVRLGGNSFTGEVPGWIGELTDLESLDLSANRFSGRIPVSIG  306

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGN  1463
              L  LK L L +NQL+G +P+ +    NLLA++VS+NRLTG LP+      L+  +  GN
Sbjct  307   NLNVLKELNLSMNQLTGGLPESMMNCLNLLAIDVSHNRLTGNLPSWIFKSGLNRVSPSGN  366


 Score = 63.9 bits (154),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 61/102 (60%), Gaps = 0/102 (0%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L GEIPE I     L ++ L  N  TG +P  IG    L LL  S N+LSG++PE+L  L
Sbjct  201   LEGEIPEGIANLYDLRVINLKNNRFTGQLPVDIGGSQVLKLLDFSENSLSGSLPESLRRL  260

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP  1511
                  ++L  N  +GE+P  +G+L +L ++++S NR +GR+P
Sbjct  261   SSCATVRLGGNSFTGEVPGWIGELTDLESLDLSANRFSGRIP  302


 Score = 58.5 bits (140),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 61/105 (58%), Gaps = 1/105 (1%)
 Frame = -1

Query  1822  SALIGEIPEDICES-GSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETL  1646
             ++L G IP+   +  GSL  +    N LTG IP  + +C +L+L++ S N L G +P  L
Sbjct  126   NSLSGSIPDGFFQQCGSLRSVSFARNDLTGMIPGSLSSCMTLSLVNFSSNGLCGELPSGL  185

Query  1645  SMLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP  1511
               L+ L+ L L  N L GEIP+ +  L +L  +N+  NR TG+LP
Sbjct  186   WYLRGLQSLDLSDNLLEGEIPEGIANLYDLRVINLKNNRFTGQLP  230



>gb|KDP21865.1| hypothetical protein JCGZ_00652 [Jatropha curcas]
Length=638

 Score =   384 bits (986),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 246/547 (45%), Positives = 345/547 (63%), Gaps = 35/547 (6%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G IP +I  +  L  L+L+ N +TG IP QI N SSLT L LSHNNL+G +P  ++ L
Sbjct  117   LNGRIPSEIGGAVGLVELRLENNCITGKIPIQIQNFSSLTSLILSHNNLTGPVPAAIANL  176

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
               L+   L  N LS  +P++L  L NL++ N+S+N L G LP G  F  +  SA+ GN  
Sbjct  177   TNLQYADLSFNNLSQSLPKELTNLSNLVSFNISHNNLQGELPVGGFFNTISLSAVAGNPS  236

Query  1456  ICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRF-Lsvsaiv  1280
             +C  ++   C    PKPIV+            N   ++    S+ N  H +  LS+SA+V
Sbjct  237   LCGSVVNRSCPSVHPKPIVL------------NPNSSSSNNGSSLNHNHRKIALSISALV  284

Query  1279  aisaaaiiavgvmvITMVNASVRRRISFVENAL------ESMCSSTSSRSQGMATGKLIL  1118
             AI AAA IA GV+ ++++N  VR  ++    AL      +  CS T+  + G    KL++
Sbjct  285   AIGAAAFIAFGVVAVSLLNIHVRSSMAQTPVALTLSGGEDFSCSPTNDPNYG----KLVM  340

Query  1117  FDTKSSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPE  938
             F   +  D+ +    ++LNK  E+G G FG VY+  L     R VAIKKLT S +++  E
Sbjct  341   FSGDA--DFVAGA-HALLNKDCELGRGGFGIVYRTIL--RDGRSVAIKKLTVSSLIKSQE  395

Query  937   DFDREVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTW  758
             +F+REV  LGK RH NLV L GYYWTP LQLL+ +++  G+L   LH+      T  L+W
Sbjct  396   EFEREVTRLGKIRHHNLVALEGYYWTPSLQLLIYEYISSGSLYKHLHD---GPTTNCLSW  452

Query  757   AVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRH  578
               RF II G AKGLAHLHH     +IHYN+K +NIL+D++  PK+ DFGLARL+  LDR 
Sbjct  453   RQRFNIIRGIAKGLAHLHHM---NVIHYNLKSTNILIDDSGEPKVGDFGLARLLPMLDRC  509

Query  577   VMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDH  398
             ++S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE+VTG+RPVEY ED+V++L D 
Sbjct  510   ILSSKIQSALGYMAPEFACRTVKITEKCDVYGFGILVLEVVTGKRPVEYMEDDVVVLCDM  569

Query  397   VRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKT  221
             VR  LE G V EC+D  + G +P EE +PV+KL L+C SQ+PS+RP M EVV IL++I+ 
Sbjct  570   VRGALEDGRVEECIDGKLRGNFPAEEAIPVIKLGLICASQVPSNRPDMEEVVNILELIQC  629

Query  220   PVPNRME  200
             P   + E
Sbjct  630   PAEGQEE  636


 Score = 56.2 bits (134),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 45/116 (39%), Positives = 68/116 (59%), Gaps = 7/116 (6%)
 Frame = -1

Query  1774  LGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSMLKRLKILKLEVNQLS  1595
             L +L L  N L+G IP  IGN SSL +L++S N L G+IP ++  LK L++L L  N+L+
Sbjct  59    LKVLDLSSNVLSGEIPFDIGNLSSLLVLNVSRNRLFGSIPSSIGELKMLQVLDLSDNKLN  118

Query  1594  GEIPQQLGKLENLLAVNVSYNRLTGRLPAG-SIFQNLDSSAIEGNDGICSPLLTGP  1430
             G IP ++G    L+ + +  N +TG++P     F +L S  +  N+      LTGP
Sbjct  119   GRIPSEIGGAVGLVELRLENNCITGKIPIQIQNFSSLTSLILSHNN------LTGP  168



>ref|XP_002528692.1| Brassinosteroid LRR receptor kinase precursor, putative [Ricinus 
communis]
 gb|EEF33681.1| Brassinosteroid LRR receptor kinase precursor, putative [Ricinus 
communis]
Length=968

 Score =   393 bits (1009),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 249/547 (46%), Positives = 351/547 (64%), Gaps = 35/547 (6%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G IP +I  + SL  L+L+ NSLTG IP QI NCSSLT L LSHNNL+G +P  ++ L
Sbjct  447   LNGRIPSEIGGAASLVELRLEKNSLTGNIPTQIKNCSSLTSLILSHNNLTGPVPAAIANL  506

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
               L+ + L  N LSG +P++L  L  L++ N+S+N L G LP G  F  +  S++  N  
Sbjct  507   SNLEYVDLSFNNLSGSLPKELTNLSRLVSFNISHNNLHGELPLGGFFNTISPSSVSVNPS  566

Query  1456  ICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRF-Lsvsaiv  1280
             +C  ++   C    PKPIV+NP              +     S+ NS H +  LS+SA++
Sbjct  567   LCGSVVNRSCPSVHPKPIVLNP------------NSSTSAHGSSLNSNHRKIALSISALI  614

Query  1279  aisaaaiiavgvmvITMVNASVRRR-----ISFVENALESM-CSSTSSRSQGMATGKLIL  1118
             AI AAA IA+GV+ I+++N  VR       ++F  +  E   CS T+  + G    KL++
Sbjct  615   AIGAAAFIALGVIAISLLNIHVRSSMMQTPVAFTLSGGEDFSCSPTNDPNYG----KLVM  670

Query  1117  FDTKSSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPE  938
             F   +  D+ +    ++LNK  E+G G FG VY+  L     R VAIKKLT S +++  E
Sbjct  671   FSGDA--DFVAGA-HALLNKDCELGRGGFGVVYRTIL--RDGRSVAIKKLTVSSLIKSQE  725

Query  937   DFDREVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTW  758
             +F+REV+ LG+ RH NLV L GYYWTP LQLL+ +++  G L   LH+         L+W
Sbjct  726   EFEREVKRLGQIRHHNLVALEGYYWTPSLQLLIYEYISSGCLYKHLHD---GPNINCLSW  782

Query  757   AVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRH  578
               RF IILG AKGL+HLH   Q  +IHYN+K +NILLD++  PK+ DFGLARL+  LDR 
Sbjct  783   RRRFNIILGMAKGLSHLH---QMNVIHYNLKSTNILLDDSGEPKVGDFGLARLLPMLDRC  839

Query  577   VMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDH  398
             ++S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE+VTG+RPVEY ED+V++L D 
Sbjct  840   ILSSKIQSALGYMAPEFACRTVKITEKCDVYGFGILVLEVVTGKRPVEYMEDDVVVLCDM  899

Query  397   VRVLLEQGNVLECVD-QGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKT  221
             VR  LE G V ECVD + +G +P +E +PV+KL L+C SQ+PS+RP M EVV IL++I+ 
Sbjct  900   VRGALENGRVEECVDGRLLGNFPADEAIPVIKLGLICASQVPSNRPDMEEVVNILELIQC  959

Query  220   PVPNRME  200
             P   + E
Sbjct  960   PAEGQEE  966


 Score = 70.1 bits (170),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 49/120 (41%), Positives = 66/120 (55%), Gaps = 0/120 (0%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             ++L G +PE +   GS   L+L GNS  G IP  IG   +L  L LS N  SG IP ++ 
Sbjct  249   NSLSGSLPESLQRLGSCTTLRLRGNSFAGEIPGWIGELPTLESLDLSANKFSGRIPTSIG  308

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGN  1463
              L  LK L L +N L G +P+ +    NLL +++S NRL+G LP       L S +I GN
Sbjct  309   NLNTLKELNLSMNHLIGGLPESMENCANLLVLDISQNRLSGTLPTWIFKMGLHSISISGN  368


 Score = 61.6 bits (148),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 39/103 (38%), Positives = 59/103 (57%), Gaps = 0/103 (0%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G+IP  I     L  + L  N  +G +P  IG C  L +L  S N+LSG++PE+L  L
Sbjct  203   LDGQIPGGIANVYDLRAIHLQKNRFSGQLPVDIGGCVLLKMLDFSENSLSGSLPESLQRL  262

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPA  1508
                  L+L  N  +GEIP  +G+L  L ++++S N+ +GR+P 
Sbjct  263   GSCTTLRLRGNSFAGEIPGWIGELPTLESLDLSANKFSGRIPT  305


 Score = 56.6 bits (135),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 42/103 (41%), Positives = 59/103 (57%), Gaps = 1/103 (1%)
 Frame = -1

Query  1810  GEIPEDICESGSLGILQLDGNSLTGTIPPQI-GNCssltllslshnnlSGTIPETLSMLK  1634
             G I  D+ + G L ++ L  N L+G IP +    C SL  +S + NNLSG IPE+LS   
Sbjct  108   GTINPDLSQLGGLQVIDLSRNKLSGFIPDEFFKQCGSLRSVSFAKNNLSGQIPESLSWCP  167

Query  1633  RLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAG  1505
              L  +    NQLSGE+P  L  L  L ++++S N L G++P G
Sbjct  168   SLAAVNFSSNQLSGELPSGLWFLRGLQSLDLSDNLLDGQIPGG  210


 Score = 55.1 bits (131),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 36/107 (34%), Positives = 56/107 (52%), Gaps = 4/107 (4%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSG----TIPET  1649
             LIG +PE +    +L +L +  N L+GT+P  I      ++    +         ++   
Sbjct  323   LIGGLPESMENCANLLVLDISQNRLSGTLPTWIFKMGLHSISISGNRLGWSMHYPSVASL  382

Query  1648  LSMLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPA  1508
              S L+ LK+L L  N LSGEIP  +G + +LL  N+S NRL G +P+
Sbjct  383   ASSLQGLKVLDLSSNALSGEIPADIGVISSLLLFNISRNRLFGSIPS  429


 Score = 53.1 bits (126),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 47/118 (40%), Positives = 61/118 (52%), Gaps = 5/118 (4%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIP-ETLSM  1640
             L G I   +     L IL L  N+ TGTI P +     L ++ LS N LSG IP E    
Sbjct  82    LSGHIGRGLIRLQFLQILSLSNNNFTGTINPDLSQLGGLQVIDLSRNKLSGFIPDEFFKQ  141

Query  1639  LKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIF----QNLDSS  1478
                L+ +    N LSG+IP+ L    +L AVN S N+L+G LP+G  F    Q+LD S
Sbjct  142   CGSLRSVSFAKNNLSGQIPESLSWCPSLAAVNFSSNQLSGELPSGLWFLRGLQSLDLS  199



>ref|XP_010490496.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Camelina sativa]
Length=967

 Score =   392 bits (1008),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 250/548 (46%), Positives = 350/548 (64%), Gaps = 32/548 (6%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G +P +I  + SL  L L  N L+G IPPQI NCS+L  + LS N LSG IP ++  L
Sbjct  443   LNGTLPAEIGGAVSLKQLHLHRNRLSGQIPPQISNCSALNAIDLSDNELSGVIPGSIGSL  502

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
               LK + L  N LSG +P+++ KL +LL  N+S+N LTG LPAG+ F  +  SA+  N  
Sbjct  503   SNLKYVDLSRNNLSGSLPKEIEKLSHLLTFNISHNSLTGELPAGAFFNTIPLSAVTANPS  562

Query  1456  ICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRFLsvsaiva  1277
             +C  ++   C    PKPIV+NP    N ++  NG      +  +        LS+SA++A
Sbjct  563   LCGSVVNRSCLSVHPKPIVLNP----NSSNPTNGPALTGKIRKS-------VLSISALIA  611

Query  1276  isaaaiiavgvmvITMVN----ASVRRRISFVENAL---ESMCSSTSSRSQGMATGKLIL  1118
             I AAA IA GV+ +T++N    ASV R  +    AL   E+   S S   Q    GKL++
Sbjct  612   IGAAAFIAFGVVAVTLLNVHARASVSRHNAAAALALSVGETFSCSPSKDHQEF--GKLVM  669

Query  1117  FDTKSSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPE  938
             F  ++   + ++  +++LNK  E+G G FG VYK  L  +  R VA+KKLT S +++  E
Sbjct  670   FSGEADV-FDTTGADALLNKECELGRGGFGVVYKTNL--QDGRPVAVKKLTVSGLIKSQE  726

Query  937   DFDREVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTW  758
             +F+RE+R LGK RH NLV ++GYYWT  LQLL+ +FV  G+L   LH       +  LTW
Sbjct  727   EFEREMRKLGKLRHNNLVEMKGYYWTQSLQLLIHEFVSGGSLHRHLH----GDESVCLTW  782

Query  757   AVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAK-LDR  581
               RF IILG A+GLA+LH S    I HYN+K +N+L+D     K+SDFGLARL+A  LDR
Sbjct  783   RQRFSIILGIARGLAYLHGS---NITHYNLKATNVLVDATGEAKVSDFGLARLLASALDR  839

Query  580   HVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILND  401
              V+S + Q+A+GY APE AC+++++ +KCDVYGFG+L+LE+VTG+RPVEY ED+V++L +
Sbjct  840   CVLSGKVQSALGYTAPEFACRTVKITDKCDVYGFGILVLEVVTGKRPVEYAEDDVVVLCE  899

Query  400   HVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIK  224
              VR  LE+G V ECVD  + G +P EE +P +KL LVC SQ+PS+RP M EVV+IL++I+
Sbjct  900   TVRERLEEGRVEECVDPRLRGNFPAEEAIPAIKLGLVCGSQVPSNRPDMEEVVKILELIQ  959

Query  223   TPVPNRME  200
              P  + +E
Sbjct  960   CPPSHDLE  967


 Score = 57.8 bits (138),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 42/99 (42%), Positives = 60/99 (61%), Gaps = 1/99 (1%)
 Frame = -1

Query  1816  LIGEIPEDICE-SGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSM  1640
             L G +P+ +   S S   ++L GNSL G IP  IG+ ++L  L LS NN SG +P +L  
Sbjct  251   LSGNLPDSMKTISSSCTSIRLRGNSLAGDIPDWIGDVATLETLDLSGNNFSGNVPLSLGN  310

Query  1639  LKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLT  1523
             L+ LK L L  N L+GE+PQ +    NL++++VS N  T
Sbjct  311   LEFLKELNLSSNMLAGELPQTISNCSNLISIDVSKNSFT  349



>ref|XP_010412798.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Camelina sativa]
Length=1231

 Score =   397 bits (1021),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 237/538 (44%), Positives = 334/538 (62%), Gaps = 24/538 (4%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G IP +   + SL  L+LD N L   IPP I +CS+L  L LSHN L G+IP  L+ L
Sbjct  703   LNGTIPRETGGAVSLEELRLDNNLLDANIPPSIKSCSTLRSLILSHNKLLGSIPPELAKL  762

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
              +L+ + +  N+L+G +P+QL  L  L   N+S+N L G LPAG IF  L  S++ GN G
Sbjct  763   TKLEEVDISFNELTGTLPKQLANLGYLHTFNMSHNHLFGELPAGGIFNGLSPSSVSGNPG  822

Query  1456  ICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRFLsvsaiva  1277
             IC  ++   C   APKPIV+NP    N T +   G+   P A  +         ++   A
Sbjct  823   ICGAVVNNSCPAVAPKPIVLNP----NSTIDPYSGELRPPGAGHKRILLSISSLIAISAA  878

Query  1276  isaaaiiavgvmvITMVNASVRRR----ISFVENALESMCSSTSSRSQGMATGKLILFDT  1109
              +    +    ++   V AS   R    ++F      S   +T S S     GKL++F  
Sbjct  879   AAIVVGVIAITVLNLRVRASTVSRSAVPLTFSGGDDFSRSPTTDSNS-----GKLVMFSG  933

Query  1108  KSSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDFD  929
             +  PD+++ T  ++LNK  E+G G FG VY+  +       VAIKKLT S +++  E+F+
Sbjct  934   E--PDFSTGT-HALLNKDCELGRGGFGAVYRTVI--RDGYPVAIKKLTVSSLVKSQEEFE  988

Query  928   REVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAVR  749
             REV+ LGK RH NLV L GYYWT  LQLL+ +F+  G+L   LHE     ++  L+W  R
Sbjct  989   REVKKLGKLRHSNLVKLEGYYWTTSLQLLIYEFLSGGSLYKHLHEAPGGSSS--LSWNDR  1046

Query  748   FKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVMS  569
             F +ILGTAK LA+LH   Q  +IHYNIK SN+LLD +  PK+ D+GLARL+  LDR+V+S
Sbjct  1047  FNVILGTAKCLAYLH---QSNVIHYNIKSSNVLLDSSGEPKVGDYGLARLLPMLDRYVLS  1103

Query  568   NRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRV  389
             ++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE+VTG++PVEY ED+V++L D VR 
Sbjct  1104  SKIQSALGYMAPEFACRTVKITEKCDVYGFGVLVLEVVTGKKPVEYMEDDVVVLCDMVRE  1163

Query  388   LLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTP  218
              LE G   EC+D  + G +P EE + V+KL L+CTSQ+PSSRP M E V IL++++ P
Sbjct  1164  ALEDGRADECIDPRLQGKFPVEEAIAVIKLGLICTSQVPSSRPHMGEAVNILRMVRCP  1221


 Score = 57.8 bits (138),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 60/102 (59%), Gaps = 0/102 (0%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L GE P  I    +L  L L  N L+G IP +IG+C  L  + LS N+LSG++P T   L
Sbjct  470   LEGEFPVKIDRLNNLRSLDLSRNMLSGPIPSEIGSCMLLKTIDLSDNSLSGSLPVTFQQL  529

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP  1511
                  L L  N L GE+P+ +G++ +L  +++S N+ +G++P
Sbjct  530   SLCYSLNLGKNALEGEVPKWIGEMRSLETLDLSMNKFSGQVP  571


 Score = 56.2 bits (134),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 39/101 (39%), Positives = 59/101 (58%), Gaps = 0/101 (0%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L GE P  I    +L  L L  N L+G IP +IG+C  L  + LS N+LSG++P T   L
Sbjct  206   LEGEFPVKIDRLNNLRSLDLSRNMLSGPIPSEIGSCMLLKTIDLSDNSLSGSLPVTFQQL  265

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRL  1514
                  L L  N L GE+P+ +G++ +L  +++S N+ +G+L
Sbjct  266   SLCYSLNLGKNALEGEVPKWIGEMRSLETLDLSMNKFSGQL  306


 Score = 53.9 bits (128),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 44/106 (42%), Positives = 67/106 (63%), Gaps = 1/106 (1%)
 Frame = -1

Query  1822  SALIGEIPEDIC-ESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETL  1646
             +AL G +P++   + GSL +L L  N LTG IP  I +CSSL  L+LS N  SG++P  +
Sbjct  131   NALSGSLPDEFFKQCGSLRVLSLAKNKLTGKIPVSISSCSSLASLNLSSNRFSGSMPSGV  190

Query  1645  SMLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPA  1508
               L  L+ L L  N+L GE P ++ +L NL ++++S N L+G +P+
Sbjct  191   WSLNTLRSLDLSRNELEGEFPVKIDRLNNLRSLDLSRNMLSGPIPS  236


 Score = 53.1 bits (126),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 59/104 (57%), Gaps = 3/104 (3%)
 Frame = -1

Query  1765  LQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSMLKRLKILKLEVNQLSGEI  1586
             L L  N+L G +P  IG   SL  L LS N  SG +P+++  L  LK+L    N L G +
Sbjct  535   LNLGKNALEGEVPKWIGEMRSLETLDLSMNKFSGQVPDSIGNLLALKVLNFSGNGLIGSL  594

Query  1585  PQQLGKLENLLAVNVSYNRLTGRLPAGSIFQN--LDSSAIEGND  1460
             P       NLLA+++S N LTG+LP   IFQ+   D SA++ ++
Sbjct  595   PDSTANCINLLALDISGNSLTGKLPMW-IFQDGSRDVSALKNDN  637



>ref|XP_008456960.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Cucumis melo]
Length=925

 Score =   390 bits (1001),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 255/561 (45%), Positives = 346/561 (62%), Gaps = 46/561 (8%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIG------------------------NC  1709
              +G IPE I +  +L IL L GN L  TIP  IG                        +C
Sbjct  375   FVGSIPETIGDLKALSILDLSGNQLNETIPVAIGGAVSLIELKLDGNFLGGEIPFSIAHC  434

Query  1708  ssltllslshnnlSGTIPETLSMLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNR  1529
             SSLT L  SHNNL+G IP  L+ L  L+ + L  N L+G +P+QL  L NLL  N+S+N 
Sbjct  435   SSLTTLFASHNNLTGPIPAALAKLSYLQNVDLSFNNLNGTLPKQLSNLPNLLVFNISHND  494

Query  1528  LTGRLPAGSIFQNLDSSAIEGNDGICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggd  1349
               G LP G  F  +  S++ GN  +C  ++   C    PKPIV+NP      + +++   
Sbjct  495   FKGELPGGGFFNTISPSSVTGNPSLCGSVVNKSCPSVLPKPIVLNP-----NSTSDSISS  549

Query  1348  nNEPLASTRNSRHHRFLsvsaivaisaaaiiavgvmvITMVNASVRRRISFVENALESMC  1169
             +  P  S  + R+   LS+SA+VAI AAA I +GV+ IT++N  V+   S    A  ++ 
Sbjct  550   SLPP--SNNHKRNRNILSISALVAIGAAAFIIIGVISITILNLRVQSPTSSSSAAALALS  607

Query  1168  ---SSTSSRSQGMATGKLILFDTKSSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGE  998
                  ++S S    +GKL++   +   D+++    ++LNK  E+G G FG VY   L   
Sbjct  608   VGDDFSNSSSPDENSGKLVVLSGE--LDFSTGA-HALLNKDCELGRGGFGAVYHTIL--R  662

Query  997   GSRVVAIKKLTSSKILQYPEDFDREVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLG  818
                 VAIKKLT S +++  EDF+REVR  G  RHQNLV L GYYWTP LQLL+ +FV  G
Sbjct  663   DGHSVAIKKLTVSSLVKSQEDFEREVRKFGIVRHQNLVALEGYYWTPSLQLLIYEFVSRG  722

Query  817   NLESKLHEMAMAMATPPLTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDEN  638
             +L   LHE   A     L+W  RF IILG AKGLAHLH   Q   IHYNIK SNIL+D N
Sbjct  723   SLYRLLHE---ASDDNVLSWNERFDIILGAAKGLAHLH---QSNTIHYNIKSSNILIDCN  776

Query  637   LNPKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEI  458
               PK+ D+GLARL+  LDR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+LILE+
Sbjct  777   GQPKVGDYGLARLLPMLDRYVLSSKIQSALGYMAPEFACRTVKITEKCDVYGFGILILEV  836

Query  457   VTGRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQ  281
             VTG+RPVEY ED+V +L+D VR  +E+G   ECVD+ + G +P EE +PVLKL L+CTS 
Sbjct  837   VTGKRPVEYMEDDVAVLSDVVREAVEEGRAEECVDRNLRGSFPIEEAVPVLKLGLICTSH  896

Query  280   IPSSRPSMAEVVQILQVIKTP  218
             +PS+RP M E+V+IL++IK P
Sbjct  897   VPSNRPDMREMVKILEMIKCP  917


 Score = 61.2 bits (147),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 61/105 (58%), Gaps = 0/105 (0%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             +AL GEIP+ I    +L  L L  N  +G IP  IG+C  L  + LS N+ SG +P+T+ 
Sbjct  206   NALSGEIPKVIENLYNLRTLNLSKNRFSGDIPDGIGSCLLLRSIDLSENSFSGNLPQTMQ  265

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPA  1508
              L     L L  N   G+IP+ +G++++L  ++ S N  TGR+PA
Sbjct  266   KLVLCSNLILGRNLFDGDIPEWIGEMKSLETIDFSGNNFTGRIPA  310


 Score = 55.5 bits (132),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 37/103 (36%), Positives = 58/103 (56%), Gaps = 1/103 (1%)
 Frame = -1

Query  1810  GEIPEDIC-ESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSMLK  1634
             G + +D   +  SL ++ L  N+ +G IP  +  C SL  ++ S N  SG++P  +  + 
Sbjct  137   GAVSDDFFRQCRSLRVISLANNNFSGKIPDSLSFCGSLISVNFSSNRFSGSLPSGIWSIS  196

Query  1633  RLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAG  1505
              L+ L L  N LSGEIP+ +  L NL  +N+S NR +G +P G
Sbjct  197   GLRSLDLSDNALSGEIPKVIENLYNLRTLNLSKNRFSGDIPDG  239



>tpg|DAA57062.1| TPA: putative leucine-rich repeat receptor-like protein kinase 
family protein [Zea mays]
Length=949

 Score =   390 bits (1002),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 246/539 (46%), Positives = 348/539 (65%), Gaps = 24/539 (4%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G +P +I  + +L  L++  NSLTG IP QIGNCSSL  L  SHNNL+  IP T+  L
Sbjct  420   LEGTVPPEIGGAVALRDLRMGRNSLTGRIPAQIGNCSSLVALDFSHNNLTWPIPSTMGNL  479

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
               L+++ L  N+L+G +P +L  L +L   +VS+N LTG LP    F N+  S +  N G
Sbjct  480   TSLQVVNLSQNKLNGTLPVELSNLPSLHIFDVSHNMLTGDLPHSRFFNNIPESFLVDNSG  539

Query  1456  ICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHR--FLsvsai  1283
             +CS      C    PKPIV+NP    N +         +   S  ++ HH+   LS+S +
Sbjct  540   LCSSRKNDSCSAVMPKPIVLNPNSSSNPSW--------QATPSAPSNMHHKKIILSISTL  591

Query  1282  vaisaaaiiavgvmvITMVNASVRRRISFVENALESMCSS---TSSRSQGMATGKLILFD  1112
             VAI+  A IA+GV+ I+++N  VR R +   +A  +  S    + S     ++GKL++F 
Sbjct  592   VAIAGGAAIAIGVITISVLNRRVRARAAAPRSAPATALSDDYLSQSPENDASSGKLVMFG  651

Query  1111  TKSSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDF  932
              K SP++ S+   ++LNK  E+G G FG VYK  L     + VAIKKLT S +++  +DF
Sbjct  652   -KGSPEF-SAGGHALLNKDCELGRGGFGAVYKTVL--RDGQPVAIKKLTVSSLVKSKDDF  707

Query  931   DREVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAV  752
             +R+V+ L K RH N+V LRG+YWT  LQLL+ D++P GNL   LHE         L+W  
Sbjct  708   ERQVKTLSKVRHHNIVALRGFYWTSSLQLLIYDYLPGGNLHKHLHE---CNEDSLLSWME  764

Query  751   RFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVM  572
             RF IILG A+GL +LH   Q  IIHYN+K SN+LLD N  PK+ D+GLA+L+  LDR+V+
Sbjct  765   RFDIILGIARGLTYLH---QHGIIHYNLKSSNVLLDSNGEPKVGDYGLAKLLPMLDRYVL  821

Query  571   SNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVR  392
             S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE +TGRRPVEY ED+V++L D VR
Sbjct  822   SSKVQSALGYMAPEFACKTVKITEKCDVYGFGVLLLEALTGRRPVEYLEDDVVVLCDLVR  881

Query  391   VLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTP  218
               LE+G   +CVD  + G +P +E LPV+KL LVCTSQ+PS+RP M EVV +L++++ P
Sbjct  882   GALEEGRPEDCVDPRLRGEFPMDEALPVIKLGLVCTSQVPSNRPGMGEVVSMLELVRNP  940


 Score = 56.2 bits (134),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 39/118 (33%), Positives = 61/118 (52%), Gaps = 0/118 (0%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L GEIP D+ E+  L  L L  N  TG++P  +   + L  L    N L+G +P  +  +
Sbjct  229   LAGEIPADVGEAALLKSLGLGHNLFTGSLPDSLRRLAGLQFLGAGGNALAGELPAWIGEI  288

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGN  1463
             + L+ L L  N+ +G IP  +   +NL+ +++S N LTG LP       L   ++ GN
Sbjct  289   RALERLDLSGNRFAGNIPYTIANCKNLVEIDLSCNALTGDLPWWVFGLPLQRVSVAGN  346



>ref|XP_003533657.2| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Glycine max]
 gb|KHN29502.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Glycine soja]
Length=967

 Score =   390 bits (1003),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 248/545 (46%), Positives = 343/545 (63%), Gaps = 31/545 (6%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G IP +I  + SL  L+L  N L G IP QI  CSSLT L LSHN L+G+IP  ++ L
Sbjct  446   LNGSIPSEIEGATSLSELRLQKNFLGGRIPAQIDKCSSLTFLILSHNKLTGSIPAAIANL  505

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
               L+ + L  N+LSG +P++L  L +L + NVSYN L G LP G  F  +  S++ GN  
Sbjct  506   TNLQYVDLSWNELSGSLPKELTNLSHLFSFNVSYNHLEGELPVGGFFNTISFSSVSGNPL  565

Query  1456  ICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRFLsvsaiva  1277
             +C  ++   C    PKPIV+           N     +    S +N RH   LS+SA++A
Sbjct  566   LCGSVVNHSCPSVHPKPIVL-----------NPNSSGSNSSISLQNHRHKIILSISALIA  614

Query  1276  isaaaiiavgvmvITMVNASVRRRISFVENALESMCSSTSSRSQGMAT-----GKLILFD  1112
             I AAA IAVGV+ +T++N  VR   S +E+       S      G        GKL++F 
Sbjct  615   IGAAAFIAVGVVAVTVLNIHVR---SSMEHTAAPFSFSGGEDYSGSPANDPNYGKLVMFS  671

Query  1111  TKSSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDF  932
               +  D+A     ++LNK SEIG G FG VY+  L     R VAIKKLT S +++  E+F
Sbjct  672   GDA--DFADGA-HNILNKESEIGRGGFGVVYRTFL--RDGRAVAIKKLTVSSLIKSQEEF  726

Query  931   DREVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAV  752
             +RE++ LGK RH NLV L GYYWT  LQLL+ D++  G+L   LH+     +    +W  
Sbjct  727   EREIKKLGKVRHPNLVALEGYYWTSSLQLLIYDYLSSGSLHKLLHD---DNSKNVFSWPQ  783

Query  751   RFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVM  572
             RFK+ILG AKGLAHLH   Q  IIHYN+K +N+L+D +  PK+ DFGL +L+  LD  V+
Sbjct  784   RFKVILGMAKGLAHLH---QMNIIHYNLKSTNVLIDCSGEPKVGDFGLVKLLPMLDHCVL  840

Query  571   SNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVR  392
             S++ Q+A+GY+APE AC+++++ +KCDVYGFG+L+LEIVTG+RPVEY ED+V++L D VR
Sbjct  841   SSKIQSALGYMAPEFACRTVKITKKCDVYGFGILVLEIVTGKRPVEYMEDDVVVLCDMVR  900

Query  391   VLLEQGNVLECVD-QGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPV  215
               LE+G V +CVD + +G +  EE +PV+KL L+C SQ+PS+RP MAEVV IL++I+ P 
Sbjct  901   GALEEGKVEQCVDGRLLGNFAAEEAIPVIKLGLICASQVPSNRPDMAEVVNILELIQCPS  960

Query  214   PNRME  200
               + E
Sbjct  961   EGQEE  965


 Score = 59.3 bits (142),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 41/118 (35%), Positives = 64/118 (54%), Gaps = 0/118 (0%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
              + E+P+ +    S   + L GNS TG IP  IG   +L +L LS N  SG IP++L  L
Sbjct  251   FLSELPQSMQRLTSCTSISLQGNSFTGGIPEWIGELKNLEVLDLSANGFSGWIPKSLGNL  310

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGN  1463
               L  L L  N+L+G +P  +     LLA+++S+N L G +P+      + S ++ G+
Sbjct  311   DSLHRLNLSRNRLTGNMPDSMMNCTKLLALDISHNHLAGHVPSWIFKMGVQSISLSGD  368


 Score = 58.9 bits (141),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 60/104 (58%), Gaps = 1/104 (1%)
 Frame = -1

Query  1816  LIGEIPEDICES-GSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSM  1640
             L GEIPE   +  GSL  +    N+LTG IP  + +CS+L  ++ S N L G +P  +  
Sbjct  131   LSGEIPEGFFQQCGSLRTVSFAKNNLTGKIPESLSSCSNLASVNFSSNQLHGELPNGVWF  190

Query  1639  LKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPA  1508
             L+ L+ L L  N L GEIP+ +  L ++  +++  NR +GRLP 
Sbjct  191   LRGLQSLDLSDNFLEGEIPEGIQNLYDMRELSLQRNRFSGRLPG  234


 Score = 58.2 bits (139),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 46/125 (37%), Positives = 62/125 (50%), Gaps = 23/125 (18%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNC-----------------------s  1706
             L GEIPE I     +  L L  N  +G +P  IG C                       +
Sbjct  204   LEGEIPEGIQNLYDMRELSLQRNRFSGRLPGDIGGCILLKSLDLSGNFLSELPQSMQRLT  263

Query  1705  sltllslshnnlSGTIPETLSMLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRL  1526
             S T +SL  N+ +G IPE +  LK L++L L  N  SG IP+ LG L++L  +N+S NRL
Sbjct  264   SCTSISLQGNSFTGGIPEWIGELKNLEVLDLSANGFSGWIPKSLGNLDSLHRLNLSRNRL  323

Query  1525  TGRLP  1511
             TG +P
Sbjct  324   TGNMP  328



>ref|XP_004146470.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Cucumis sativus]
 gb|KGN50740.1| hypothetical protein Csa_5G222990 [Cucumis sativus]
Length=925

 Score =   389 bits (999),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 252/561 (45%), Positives = 347/561 (62%), Gaps = 46/561 (8%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIG------------------------NC  1709
              +G +P+ I +  +L IL L GN L  TIP  IG                        +C
Sbjct  375   FVGSLPKTIGDLKALSILDLSGNQLNETIPVAIGGAVSLIELKLDGNFLRGEIPFSIAHC  434

Query  1708  ssltllslshnnlSGTIPETLSMLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNR  1529
             SSLT L +SHNN++G IP  L+ L  L+ + L  N L+G +P+QL  L NLL  N+S+N 
Sbjct  435   SSLTTLFISHNNITGPIPAALAKLSYLQNVDLSFNNLNGTLPKQLSNLPNLLVFNISHNN  494

Query  1528  LTGRLPAGSIFQNLDSSAIEGNDGICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggd  1349
               G LP G  F  +  S++ GN  +C  ++   C    PKPIV+NP      + +++   
Sbjct  495   FKGELPGGGFFNTISPSSVTGNPSLCGSVVNKSCPSVLPKPIVLNP-----NSTSDSISS  549

Query  1348  nNEPLASTRNSRHHRFLsvsaivaisaaaiiavgvmvITMVNASVRRRISFVENALESMC  1169
             +  P  S  + R+   LS+SA+VAI AAA I +GV+ IT++N  V+   S    A  ++ 
Sbjct  550   SLPP--SNNHKRNRNILSISALVAIGAAAFIIIGVISITILNLRVQSPTSSSSAAALALS  607

Query  1168  ---SSTSSRSQGMATGKLILFDTKSSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGE  998
                  ++S S    +GKL++   +   D+++    ++LNK  E+G G FG VY   L   
Sbjct  608   VGDDFSNSSSPDANSGKLVVLSGE--LDFSTGA-HALLNKDCELGRGGFGAVYHTIL--R  662

Query  997   GSRVVAIKKLTSSKILQYPEDFDREVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLG  818
                 VAIKKLT S +++  EDF+REVR  G  RHQNLV L GYYWTP LQLL+ +FV  G
Sbjct  663   DGHSVAIKKLTVSSLVKSQEDFEREVRKFGIVRHQNLVALEGYYWTPSLQLLIYEFVSGG  722

Query  817   NLESKLHEMAMAMATPPLTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDEN  638
             +L   LHE   A     L+W  RF IILGTAKGLAHLH   Q   IHYNIK SNIL+D N
Sbjct  723   SLYRLLHE---ASDDNVLSWNERFDIILGTAKGLAHLH---QSNTIHYNIKSSNILIDRN  776

Query  637   LNPKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEI  458
               PK+ D+GLARL+  LDR+V+S++ Q+A+GY+APE  C+++++ EKCDVYGFG+LILE+
Sbjct  777   GQPKVGDYGLARLLPMLDRYVLSSKIQSALGYMAPEFTCRTVKITEKCDVYGFGILILEV  836

Query  457   VTGRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQ  281
             VTG+RPVEY ED+V +L+D VR  +E+G   ECVD+ + G +P EE +PVLKL L+CTS 
Sbjct  837   VTGKRPVEYMEDDVAVLSDMVREAVEEGRAEECVDRNLRGSFPMEEAVPVLKLGLICTSH  896

Query  280   IPSSRPSMAEVVQILQVIKTP  218
             +PS+RP M E+V+IL++IK P
Sbjct  897   VPSNRPDMREMVKILEMIKCP  917


 Score = 60.1 bits (144),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 61/105 (58%), Gaps = 0/105 (0%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             +AL+GEIP+ I    +L  L L  N  +G IP  IG+C  L  + LS N+ SG +P+T+ 
Sbjct  206   NALLGEIPKVIENLYNLRTLNLSKNQFSGHIPDGIGSCLLLRSIDLSENSFSGNLPQTMQ  265

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPA  1508
              L     L L  N   G++P+ +G++++L  ++ S N  TGR+P 
Sbjct  266   KLVLCSNLILGRNLFDGDVPEWVGEMKSLETLDFSRNNFTGRIPT  310



>ref|XP_006402993.1| hypothetical protein EUTSA_v10005773mg [Eutrema salsugineum]
 gb|ESQ44446.1| hypothetical protein EUTSA_v10005773mg [Eutrema salsugineum]
Length=967

 Score =   389 bits (1000),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 238/539 (44%), Positives = 339/539 (63%), Gaps = 26/539 (5%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G +P +   + SL  L+L+ N L G+IP  I NCS L  L LSHN L G +P  L+ L
Sbjct  439   LNGSVPRETGGAVSLEKLRLENNMLEGSIPSTIKNCSFLQSLILSHNKLIGAVPPELAKL  498

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
               L+ + L  N L+G +P+QL  L  L   N+S+N L+G LPAG IF  L  +++ GN G
Sbjct  499   TNLQEVDLSFNDLNGTLPKQLANLGYLHTFNISHNHLSGELPAGGIFNGLSPNSVSGNPG  558

Query  1456  ICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRFLsvsaiva  1277
             IC  ++   C   +PKPIV+NP    N T +   G+   P      S  H+ + +S    
Sbjct  559   ICGAVVNKSCPAVSPKPIVLNP----NATFDPYSGEGGPP------SPGHKRILLSISSL  608

Query  1276  isaaaiiavgvmvITMVNASVRRRISFVENALESMCSS-----TSSRSQGMATGKLILFD  1112
             I+ +A  A+ V VI +   ++R R + V  +   +  S     + S +    +GKL++F 
Sbjct  609   IAISAAAAIVVGVIAITVLNLRVRSTTVSRSAVPLTFSGGDDFSRSPTTDSNSGKLVMFS  668

Query  1111  TKSSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDF  932
              +  PD+++ T  ++LNK  E+G G FG VY+  +       VAIKKLT S +++  E+F
Sbjct  669   GE--PDFSTGT-HALLNKDCELGRGGFGAVYRTVI--RDGYPVAIKKLTVSSLVKSQEEF  723

Query  931   DREVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAV  752
             +REV+ LGK RH NLV L GYYWT  LQLL+ +F+  G+L   LHE     ++  L+W  
Sbjct  724   EREVKKLGKLRHANLVKLEGYYWTTSLQLLIYEFLSGGSLYKHLHEAPGGNSS--LSWND  781

Query  751   RFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVM  572
             RF +ILGTAK LA+LH   Q  IIHYNIK SN+LLD +  PK+ D+GLARL+  LDR+V+
Sbjct  782   RFNVILGTAKCLAYLH---QSNIIHYNIKSSNVLLDSSGEPKVGDYGLARLLPMLDRYVL  838

Query  571   SNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVR  392
             S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE+VTG++PVEY ED+V++L D VR
Sbjct  839   SSKIQSALGYMAPEFACRTVKITEKCDVYGFGVLVLEVVTGKKPVEYMEDDVVVLCDMVR  898

Query  391   VLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTP  218
               LE G   EC+D  + G +  EE + V+KL L+CTSQ+PSSRP M E V IL++I+ P
Sbjct  899   EALEDGRAEECIDPRLQGKFSAEEAVAVIKLGLICTSQVPSSRPHMGEAVNILRMIRCP  957


 Score = 61.6 bits (148),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 44/106 (42%), Positives = 66/106 (62%), Gaps = 1/106 (1%)
 Frame = -1

Query  1822  SALIGEIPEDIC-ESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETL  1646
             + L G +P+    + GSL    L  N+LTG IP  I +CSSL  L+LS N  SG++P  +
Sbjct  131   NGLSGSLPDGFFRQCGSLRAFSLAKNTLTGKIPVSISSCSSLAALNLSSNRFSGSMPLGI  190

Query  1645  SMLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPA  1508
               L  L+ L L  N+L G+ P+++ +L NL A+++S NRLTG +P+
Sbjct  191   WSLNTLRSLDLSRNELEGKFPEKIDRLYNLRALDLSRNRLTGPVPS  236


 Score = 60.5 bits (145),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 61/102 (60%), Gaps = 0/102 (0%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G+ PE I    +L  L L  N LTG +P +IG+C  L  + LS N+LSG +P+T   L
Sbjct  206   LEGKFPEKIDRLYNLRALDLSRNRLTGPVPSEIGSCMLLKTIDLSENSLSGNLPDTFQQL  265

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP  1511
                  L L  N L GE+P+ +G++ +L  +++S N+ +G++P
Sbjct  266   SLCYYLNLGNNLLEGEVPKWIGEMRSLETLDLSMNKFSGQVP  307



>ref|XP_002870895.1| hypothetical protein ARALYDRAFT_486880 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47154.1| hypothetical protein ARALYDRAFT_486880 [Arabidopsis lyrata subsp. 
lyrata]
Length=968

 Score =   389 bits (1000),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 244/540 (45%), Positives = 350/540 (65%), Gaps = 29/540 (5%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G +P +I  + SL  L L  N L+G IP QI NCS+L  ++LS N LSG IP ++  L
Sbjct  446   LNGTVPSEIGGAVSLKKLHLQRNRLSGQIPAQISNCSALNAINLSENELSGAIPGSIGSL  505

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
               L+ + L  N LSG +P+++ KL +LL  N+S+N +TG LPAG  F  +  SA+ GN  
Sbjct  506   SNLEYIDLSRNNLSGSLPKEIEKLSHLLTFNISHNSITGELPAGGFFNTIPLSAVAGNPS  565

Query  1456  ICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRFLsvsaiva  1277
             +C  ++   C    PKPIV+NP    N ++  NG      +  +        LS+SA++A
Sbjct  566   LCGSVVNRSCLSVHPKPIVLNP----NSSNPTNGPALTGQIRKS-------VLSISALIA  614

Query  1276  isaaaiiavgvmvITMVNASVRRRISFVENALESMCSS-----TSSRSQGMATGKLILFD  1112
             I AAA IA+GV+ +T++N   R  +S   NA  ++  S     + S S+    GKL++F 
Sbjct  615   IGAAAFIAIGVVAVTLLNVHARSNLS-RHNAAAALALSVGETFSCSPSKDQEFGKLVMFS  673

Query  1111  TKSSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDF  932
              ++   + ++  +++LNK  E+G G FG VYK  L  +  R VA+KKLT S +++  E+F
Sbjct  674   GEADV-FDTTGADALLNKDCELGRGGFGVVYKTNL--QDGRPVAVKKLTVSGLIKSQEEF  730

Query  931   DREVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAV  752
             +RE+R LGK RH+N+V ++GYYWT  LQLL+ +FV  G+L   LH       +  LTW  
Sbjct  731   EREMRKLGKLRHRNVVEIKGYYWTQSLQLLIHEFVSGGSLYRHLH----GDESLCLTWRQ  786

Query  751   RFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAK-LDRHV  575
             RF IILG A+GLA+LH S    I HYN+K +N+L+D     K+SDFGLARL+A  LDR V
Sbjct  787   RFSIILGIARGLAYLHSS---NITHYNLKATNVLIDATGEAKVSDFGLARLLASALDRCV  843

Query  574   MSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHV  395
             +S + Q+A+GY APE AC+++++ +KCDVYGFG+L+LE+VTG+RPVEY ED+V++L + V
Sbjct  844   LSGKVQSALGYTAPEFACRTVKITDKCDVYGFGILVLEVVTGKRPVEYAEDDVVVLCETV  903

Query  394   RVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTP  218
             R  LE+G V ECVD  + G +P EE +PV+KL LVC SQ+PS+RP M EVV+IL++I+ P
Sbjct  904   REGLEEGRVEECVDPRLRGNFPAEEAIPVIKLGLVCGSQVPSNRPEMEEVVKILELIQCP  963


 Score = 65.9 bits (159),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 60/97 (62%), Gaps = 0/97 (0%)
 Frame = -1

Query  1810  GEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSMLKR  1631
             G +P  +   GS   ++L GNSL G IP  IG+ ++L  L LS NN SGT+P +L  L+ 
Sbjct  252   GNLPASMKSLGSCRSIRLRGNSLIGEIPDWIGDVATLETLDLSANNFSGTVPSSLGNLEF  311

Query  1630  LKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTG  1520
             LK L L  N L+GE+PQ +    NL++++VS N  TG
Sbjct  312   LKELNLSANMLAGELPQTISNCSNLISIDVSKNSFTG  348


 Score = 60.1 bits (144),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 62/106 (58%), Gaps = 1/106 (1%)
 Frame = -1

Query  1822  SALIGEIPEDICES-GSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETL  1646
             ++L G IP+   E  GSL  + L  N LTG +P  +  CS+L  L+LS N LSG +P  +
Sbjct  127   NSLSGRIPDGFFEQCGSLRSVSLANNKLTGPLPVSLSYCSTLIHLNLSSNQLSGRLPRDI  186

Query  1645  SMLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPA  1508
               LK LK L L VN L G+IP  LG L +L   N+S N  +G +P+
Sbjct  187   WFLKSLKSLDLSVNFLQGDIPDGLGGLYDLRLFNLSRNWFSGDVPS  232



>gb|EEE64100.1| hypothetical protein OsJ_18931 [Oryza sativa Japonica Group]
Length=875

 Score =   387 bits (993),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 246/541 (45%), Positives = 345/541 (64%), Gaps = 32/541 (6%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G +P +I  + +L  L +  NSLTG IPPQIGNC +L  L LSHN L+G IP T+  L
Sbjct  348   LSGGVPPEIGGAAALRKLLMGSNSLTGIIPPQIGNCRNLIALDLSHNKLTGPIPATIGNL  407

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
               L+++    N+L+G +P +L KL NL   NVS+N L+G LP    F  +  S I  N G
Sbjct  408   TGLQMVDFSENKLNGTLPVELSKLANLRVFNVSHNLLSGNLPISHFFDTIPDSFILDNAG  467

Query  1456  ICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTR----NSRHHR--FLs  1295
             +CS      C    PKPIV NP              +++PL+       +S+HH+   LS
Sbjct  468   LCSSQRDNSCSGVMPKPIVFNP------------NASSDPLSEASPGAPSSQHHKKIILS  515

Query  1294  vsaivaisaaaiiavgvmvITMVNASVRRRISF--VENALESMCSSTSSRSQGMATGKLI  1121
             +S ++AI   A+I VGV+ IT++N  VR   S   V  AL     S S  ++    GKL+
Sbjct  516   ISTLIAIVGGALIIVGVVTITVLNRRVRSAASHSAVPTALSDDYDSQSPENEA-NPGKLV  574

Query  1120  LFDTKSSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYP  941
             +F  + SPD+ S+   ++LNK  E+G G FGTVYKA L     + VAIKKLT S +++  
Sbjct  575   MFG-RGSPDF-SAGGHALLNKDCELGRGGFGTVYKAVL--RDGQPVAIKKLTVSSLVKSE  630

Query  940   EDFDREVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLT  761
             ++F R+V++LGK RH N+V LRG+YWT  LQLL+ DFVP GNL   LHE +   A   ++
Sbjct  631   DEFKRQVKLLGKVRHHNVVTLRGFYWTSSLQLLIYDFVPGGNLYQHLHESS---AERSVS  687

Query  760   WAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDR  581
             W  RF II+G A+ LAHLH      IIHYN+K SN+LLD N  P++ D+GL +L+  LDR
Sbjct  688   WMERFDIIIGVARALAHLHRHG---IIHYNLKSSNVLLDSNGEPRVGDYGLVKLLPMLDR  744

Query  580   HVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILND  401
             +V+S++ Q+A+GY+APE  C+++ V EKCDVYGFG+++LEI+TGRRPVEY ED+V++L D
Sbjct  745   YVLSSKIQSALGYMAPEFTCRTVNVTEKCDVYGFGVIVLEILTGRRPVEYLEDDVVVLCD  804

Query  400   HVRVLLEQGNVLECVDQGMGG-YPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIK  224
              VR  L+ G V +C+D  + G +  EE + ++KL LVCTSQ+PS RP M EVV +L++++
Sbjct  805   VVRAALDDGRVEDCMDPRLSGEFSMEEAMLIIKLGLVCTSQVPSHRPDMGEVVSMLEMVR  864

Query  223   T  221
             +
Sbjct  865   S  865


 Score = 56.2 bits (134),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 43/119 (36%), Positives = 61/119 (51%), Gaps = 1/119 (1%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G +P     S SL +L L  N L G IP  +G    L  L + HN  +G +PE+L  L
Sbjct  132   LAGSVPGGFPRSSSLRVLDLSRNLLEGEIPADVGEAGLLKSLDVGHNLFTGELPESLRGL  191

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAG-SIFQNLDSSAIEGN  1463
               L  L    N L+GE+P  +G++  L  +++S NR  G +P G S  +NL    + GN
Sbjct  192   TGLSSLGAGGNALAGELPGWIGEMAALETLDLSGNRFVGAIPDGISGCKNLVEVDLSGN  250



>ref|XP_002323672.2| hypothetical protein POPTR_0016s14410g [Populus trichocarpa]
 gb|EEF05433.2| hypothetical protein POPTR_0016s14410g [Populus trichocarpa]
Length=965

 Score =   389 bits (999),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 231/544 (42%), Positives = 337/544 (62%), Gaps = 29/544 (5%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G IP +I  + SL  L+L+ N LTG IP QI  CSSLT L +S NNLSG IP  ++ L
Sbjct  444   LTGSIPSEIGGAVSLKELRLEMNFLTGKIPTQIKKCSSLTSLIISGNNLSGPIPVAIANL  503

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
               L+ + L  N+ SG +P++L  L +LL+ N+S+N L G LP G  F  +  S++  N  
Sbjct  504   TNLQYVDLSFNRFSGSLPKELANLSHLLSFNISHNNLKGDLPLGGFFNTISPSSVSRNPS  563

Query  1456  ICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRFLsvsaiva  1277
             +C  ++   C     KPIV+NP   G+    +              + HHR +++S    
Sbjct  564   LCGSVVNRSCPSVHQKPIVLNPNSSGSSNGTSF-------------NLHHRKIALSISAL  610

Query  1276  isaaaiiavgvmvITMVNASVRRRISFVENALESMCSS----TSSRSQGMATGKLILFDT  1109
             I+  A   + + V+ +   ++R R S   +      S     + S +     GKL++F  
Sbjct  611   IAIGAAACITLGVVAVTLLNIRARSSMARSPAAFTFSGGEDFSCSPTNDPNYGKLVMFSG  670

Query  1108  KSSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDFD  929
              +  D+ +   +++LNK SE+G G FG VY+  L     R VAIKKLT S +++  ++F+
Sbjct  671   DA--DFVAGA-QALLNKDSELGRGGFGVVYRTVL--RDGRSVAIKKLTVSSLIKSQDEFE  725

Query  928   REVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAVR  749
             REV+ LG+ RH NLV L GYYWTP LQLL+ ++V  G+L   LH+         L+W  R
Sbjct  726   REVKKLGEVRHHNLVTLEGYYWTPSLQLLIYEYVSSGSLYKHLHD---GPDKNYLSWRHR  782

Query  748   FKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVMS  569
             F IILG A+GLAHLHH     I HYN+K +NIL+D++  PK+ DFGLA+L+  LDR ++S
Sbjct  783   FNIILGMARGLAHLHHM---NITHYNLKSTNILIDDSGEPKVGDFGLAKLLPTLDRCILS  839

Query  568   NRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRV  389
             ++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE+VTG+RPVEY ED+V++L D VR 
Sbjct  840   SKIQSALGYMAPEFACRTVKITEKCDVYGFGVLVLEVVTGKRPVEYMEDDVVVLCDMVRG  899

Query  388   LLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPVP  212
              LE G V EC+D  + G +P +E +PV+KL L+C+SQ+PS+RP M EVV IL++I+ P  
Sbjct  900   ALEDGRVEECIDGRLRGNFPADEAIPVVKLGLICSSQVPSNRPDMEEVVNILELIQCPAG  959

Query  211   NRME  200
              + E
Sbjct  960   GQEE  963


 Score = 77.4 bits (189),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 53/120 (44%), Positives = 73/120 (61%), Gaps = 0/120 (0%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             +AL G +PE +    S   ++L GNS TG +P  IG  +SL  L LS N LSG IP ++ 
Sbjct  246   NALSGGLPESLQRLSSCATVRLGGNSFTGEVPGWIGELTSLESLDLSVNRLSGRIPVSIG  305

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGN  1463
              L  LK L L +NQL+G +P+ +    NLLA++VS+NRLTG LP+      L S ++ GN
Sbjct  306   NLNVLKELNLSMNQLTGGLPESMANCVNLLAIDVSHNRLTGNLPSWIFKTGLKSVSLSGN  365


 Score = 65.9 bits (159),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 43/102 (42%), Positives = 61/102 (60%), Gaps = 0/102 (0%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L GEIPE I    +L  + L  N  TG +P  IG C  L LL  S N LSG +PE+L  L
Sbjct  200   LEGEIPEGIANLYALRAINLRRNRFTGQLPVDIGGCQVLKLLDFSENALSGGLPESLQRL  259

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP  1511
                  ++L  N  +GE+P  +G+L +L ++++S NRL+GR+P
Sbjct  260   SSCATVRLGGNSFTGEVPGWIGELTSLESLDLSVNRLSGRIP  301


 Score = 58.2 bits (139),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 43/105 (41%), Positives = 60/105 (57%), Gaps = 1/105 (1%)
 Frame = -1

Query  1822  SALIGEIPEDICES-GSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETL  1646
             + L G IP+   +  GSL  +    N LTG IP  +  C SL++++ S N LSG +P  L
Sbjct  125   NGLSGSIPDGFFQQCGSLRSVSFARNDLTGMIPGSLSFCMSLSVVNFSSNGLSGELPSGL  184

Query  1645  SMLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP  1511
               L+ L+ L L  N L GEIP+ +  L  L A+N+  NR TG+LP
Sbjct  185   WYLRGLQSLDLSDNLLEGEIPEGIANLYALRAINLRRNRFTGQLP  229



>ref|NP_001055847.2| Os05g0478300 [Oryza sativa Japonica Group]
 gb|AAT01367.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF17761.2| Os05g0478300 [Oryza sativa Japonica Group]
Length=917

 Score =   387 bits (993),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 246/541 (45%), Positives = 345/541 (64%), Gaps = 32/541 (6%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G +P +I  + +L  L +  NSLTG IPPQIGNC +L  L LSHN L+G IP T+  L
Sbjct  390   LSGGVPPEIGGAAALRKLLMGSNSLTGIIPPQIGNCRNLIALDLSHNKLTGPIPATIGNL  449

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
               L+++    N+L+G +P +L KL NL   NVS+N L+G LP    F  +  S I  N G
Sbjct  450   TGLQMVDFSENKLNGTLPVELSKLANLRVFNVSHNLLSGNLPISHFFDTIPDSFILDNAG  509

Query  1456  ICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTR----NSRHHR--FLs  1295
             +CS      C    PKPIV NP              +++PL+       +S+HH+   LS
Sbjct  510   LCSSQRDNSCSGVMPKPIVFNP------------NASSDPLSEASPGAPSSQHHKKIILS  557

Query  1294  vsaivaisaaaiiavgvmvITMVNASVRRRISF--VENALESMCSSTSSRSQGMATGKLI  1121
             +S ++AI   A+I VGV+ IT++N  VR   S   V  AL     S S  ++    GKL+
Sbjct  558   ISTLIAIVGGALIIVGVVTITVLNRRVRSAASHSAVPTALSDDYDSQSPENEA-NPGKLV  616

Query  1120  LFDTKSSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYP  941
             +F  + SPD+ S+   ++LNK  E+G G FGTVYKA L     + VAIKKLT S +++  
Sbjct  617   MFG-RGSPDF-SAGGHALLNKDCELGRGGFGTVYKAVL--RDGQPVAIKKLTVSSLVKSE  672

Query  940   EDFDREVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLT  761
             ++F R+V++LGK RH N+V LRG+YWT  LQLL+ DFVP GNL   LHE +   A   ++
Sbjct  673   DEFKRQVKLLGKVRHHNVVTLRGFYWTSSLQLLIYDFVPGGNLYQHLHESS---AERSVS  729

Query  760   WAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDR  581
             W  RF II+G A+ LAHLH      IIHYN+K SN+LLD N  P++ D+GL +L+  LDR
Sbjct  730   WMERFDIIIGVARALAHLHRHG---IIHYNLKSSNVLLDSNGEPRVGDYGLVKLLPMLDR  786

Query  580   HVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILND  401
             +V+S++ Q+A+GY+APE  C+++ V EKCDVYGFG+++LEI+TGRRPVEY ED+V++L D
Sbjct  787   YVLSSKIQSALGYMAPEFTCRTVNVTEKCDVYGFGVIVLEILTGRRPVEYLEDDVVVLCD  846

Query  400   HVRVLLEQGNVLECVDQGMGG-YPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIK  224
              VR  L+ G V +C+D  + G +  EE + ++KL LVCTSQ+PS RP M EVV +L++++
Sbjct  847   VVRAALDDGRVEDCMDPRLSGEFSMEEAMLIIKLGLVCTSQVPSHRPDMGEVVSMLEMVR  906

Query  223   T  221
             +
Sbjct  907   S  907


 Score = 55.8 bits (133),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 43/119 (36%), Positives = 61/119 (51%), Gaps = 1/119 (1%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G +P     S SL +L L  N L G IP  +G    L  L + HN  +G +PE+L  L
Sbjct  174   LAGSVPGGFPRSSSLRVLDLSRNLLEGEIPADVGEAGLLKSLDVGHNLFTGELPESLRGL  233

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAG-SIFQNLDSSAIEGN  1463
               L  L    N L+GE+P  +G++  L  +++S NR  G +P G S  +NL    + GN
Sbjct  234   TGLSSLGAGGNALAGELPGWIGEMAALETLDLSGNRFVGAIPDGISGCKNLVEVDLSGN  292



>emb|CDY04822.1| BnaAnng00040D [Brassica napus]
Length=928

 Score =   386 bits (992),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 247/541 (46%), Positives = 348/541 (64%), Gaps = 30/541 (6%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G +P +I  + SL  L L  N LTG IPP I NCS+L  + LS N LSG IP ++  L
Sbjct  405   LNGTLPSEIGGAVSLKQLNLQRNHLTGHIPPLISNCSALNTIDLSENKLSGGIPGSIGSL  464

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
               L+ + L  N LSG +P+Q+ KL +L+  N+S+NR+TG LPAG  F  +  SA+ GN  
Sbjct  465   SNLQYIDLSRNNLSGSLPKQVEKLTHLVTFNISHNRITGELPAGGFFNTIPLSAVTGNPS  524

Query  1456  ICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLAS-TRNSRHHRFLsvsaiv  1280
             +C  ++   C    PKPIV+NP        N++   +  PL+   R S     LS+SA++
Sbjct  525   LCGSVVNRSCLSVHPKPIVLNP--------NSSNPASGPPLSGQIRKS----VLSISALI  572

Query  1279  aisaaaiiavgvmvITMVNASVRRRISFVEN----ALESMCSSTSSRSQGMATGKLILFD  1112
             AI AAA IA+GV+ +T++N   R  +S  +     A+    + + S S+    GKL++F 
Sbjct  573   AIGAAAFIAIGVVAVTLLNVHARSSMSRHDAGAALAMSVGETFSCSPSKDQEFGKLVMFS  632

Query  1111  TKSSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDF  932
              ++   + +    ++LNK  E+G G FG VYK  L  +  R VA+KKLT S +++  E+F
Sbjct  633   GEADV-FDTRGANALLNKDCELGRGGFGVVYKTSL--QDGRPVAVKKLTVSGLIKSQEEF  689

Query  931   DREVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAV  752
             +RE+R LGK RH+N+V ++GYYWT  LQLL+ +FV  G+L   LH          LTW  
Sbjct  690   EREMRKLGKLRHRNVVEIKGYYWTQSLQLLIHEFVSGGSLYRHLHGDECVC----LTWRQ  745

Query  751   RFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLN-PKISDFGLARLVAK-LDRH  578
             RF IILG A+GLA+LH S    I HYN+K +N+L+D      K+SDFGLARL+A  LDR 
Sbjct  746   RFSIILGIARGLAYLHGS---NITHYNLKATNVLIDAATGEAKVSDFGLARLLASALDRC  802

Query  577   VMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDH  398
             V+S + Q+A+GY APE AC+++++ EKCDVYGFG+L+LE+VTG+RPVEY ED+V++L + 
Sbjct  803   VLSGKVQSALGYTAPEFACRTVKITEKCDVYGFGILVLEVVTGKRPVEYAEDDVMVLCET  862

Query  397   VRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKT  221
             VR  LE+G V ECVD  + G +P EE +PV+KL LVC SQ+PS+RP M EVV+IL++I+ 
Sbjct  863   VREGLEEGRVEECVDARLRGDFPAEEAIPVIKLGLVCGSQVPSNRPEMEEVVKILELIQC  922

Query  220   P  218
             P
Sbjct  923   P  923


 Score = 60.1 bits (144),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 47/104 (45%), Positives = 62/104 (60%), Gaps = 1/104 (1%)
 Frame = -1

Query  1816  LIGEIPEDICES-GSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSM  1640
             L G IP+   E  GSL  + L  N LTG +P  +  CS+LT L+LS N LSG +P  LS 
Sbjct  110   LSGRIPDGFFEQCGSLRSVSLGRNRLTGPLPVSLSYCSTLTHLNLSSNQLSGRLPRELSF  169

Query  1639  LKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPA  1508
             LK LK L L  N L G++P  LG L +L  +++S N  +G LP+
Sbjct  170   LKSLKSLDLSHNFLQGDLPSDLGALYDLRHLDLSTNWFSGHLPS  213



>ref|XP_011019006.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Populus euphratica]
Length=965

 Score =   387 bits (994),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 230/547 (42%), Positives = 333/547 (61%), Gaps = 36/547 (7%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G +P +I  + SL  L+L+ N LTG IP QI  CSSLT L LS N L+G IP  ++ L
Sbjct  445   LNGSLPSEIGGAISLTELRLEKNLLTGKIPTQIKKCSSLTSLILSGNILTGPIPVAIANL  504

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
               L+ + L  N+LSG +P++L  L +LL+ N+S+N L G LP G  F  +  S++ GN  
Sbjct  505   INLQYVDLSFNRLSGSLPKELTNLSHLLSFNISHNNLQGDLPLGGFFNTIPPSSVSGNPS  564

Query  1456  ICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRFLsvsaiva  1277
             +C  ++   C  +  KPIV+NP             ++++    T    HH+ +   + + 
Sbjct  565   LCGSVVNLSCPSDHQKPIVLNP-------------NSSDSSNGTSLDHHHKIVLSISALI  611

Query  1276  isaaaiiavgvmvITMV------NASVRRRISFVENALESM-CSSTSSRSQGMATGKLIL  1118
                AA      +V  +       ++  R   +F  +  E   CS T+  +      KL++
Sbjct  612   AIGAAACITLGVVAVIFLNIHAQSSMARSPAAFAFSGGEDFSCSPTNDPNYH----KLVM  667

Query  1117  FDTKSSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPE  938
             F   +  D+ +    ++LNK SE+G G FG VY+  L     R VAIKKLT S +++Y +
Sbjct  668   FSGDA--DFVAGA-RALLNKDSELGCGGFGVVYRTIL--RDGRSVAIKKLTVSSLIKYQD  722

Query  937   DFDREVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTW  758
             +F+REV+ LGK RH NLV L GYYWTP LQLL+ ++V  G+L   LH+         L+W
Sbjct  723   EFEREVKELGKVRHHNLVALEGYYWTPTLQLLIYEYVSSGSLYKHLHD---GPDKNHLSW  779

Query  757   AVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRH  578
               RF IILG A+ LAHLHH     I+HYN+K +NIL+D++  PK+ DFGLA+L+  LDR 
Sbjct  780   RHRFNIILGMARALAHLHHM---NIVHYNLKSTNILIDDSGEPKVGDFGLAKLLPTLDRC  836

Query  577   VMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDH  398
             ++S + Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE+VTG+RPVEY ED+V++L D 
Sbjct  837   ILSRKIQSALGYMAPEFACRTVKITEKCDVYGFGILVLEVVTGKRPVEYMEDDVVVLCDM  896

Query  397   VRVLLEQGNVLECVDQGMGG-YPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKT  221
             VR  LE G V EC+D  +GG  P +E +PV+KL L+C S +PS+RP M EVV IL++I+ 
Sbjct  897   VRGALEDGRVEECIDGRLGGKVPADEAIPVIKLGLICASHVPSNRPDMEEVVNILELIQC  956

Query  220   PVPNRME  200
             P     E
Sbjct  957   PAEGHEE  963


 Score = 72.8 bits (177),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 50/120 (42%), Positives = 70/120 (58%), Gaps = 0/120 (0%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             ++L G +PE +    S   ++L GNS TG +P  IG  + L  L LS N  SG IP ++ 
Sbjct  247   NSLSGSLPESLQRLSSCATVRLGGNSFTGEVPGWIGELTDLESLDLSANRFSGRIPVSIG  306

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGN  1463
              L  LK L L +NQL+G +P+ +    NLLA++VS+NRLTG LP+      L S +  GN
Sbjct  307   NLNVLKELNLSMNQLTGGLPESMMNCLNLLAIDVSHNRLTGNLPSWIFKPGLKSVSPSGN  366


 Score = 64.7 bits (156),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 40/102 (39%), Positives = 61/102 (60%), Gaps = 0/102 (0%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L GE+PE I     L ++ L  N  TG +P  IG    L LL  S N+LSG++PE+L  L
Sbjct  201   LEGEVPEGIANMSDLRVINLKNNRFTGQLPVDIGGSQVLKLLDFSENSLSGSLPESLQRL  260

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP  1511
                  ++L  N  +GE+P  +G+L +L ++++S NR +GR+P
Sbjct  261   SSCATVRLGGNSFTGEVPGWIGELTDLESLDLSANRFSGRIP  302


 Score = 58.2 bits (139),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 61/105 (58%), Gaps = 1/105 (1%)
 Frame = -1

Query  1822  SALIGEIPEDICES-GSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETL  1646
             ++L G IP+   +  GSL  +    N LTG IP  + +C +L+L++ S N L G +P  L
Sbjct  126   NSLSGSIPDGFFQQCGSLRSVSFARNDLTGMIPGSLSSCMTLSLVNFSSNGLCGELPSGL  185

Query  1645  SMLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP  1511
               L+ L+ L L  N L GE+P+ +  + +L  +N+  NR TG+LP
Sbjct  186   WYLRGLQSLDLSDNLLEGEVPEGIANMSDLRVINLKNNRFTGQLP  230



>ref|XP_002458686.1| hypothetical protein SORBIDRAFT_03g038240 [Sorghum bicolor]
 gb|EES03806.1| hypothetical protein SORBIDRAFT_03g038240 [Sorghum bicolor]
Length=948

 Score =   387 bits (993),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 241/539 (45%), Positives = 350/539 (65%), Gaps = 24/539 (4%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G +P +I  + +L  L++  NSLTG IP QIGNCSSL  L  SHNNL G IP ++  L
Sbjct  419   LEGTVPPEIGGTVALRDLRMGRNSLTGRIPSQIGNCSSLIALDFSHNNLMGPIPSSMGNL  478

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
               L+++ L  N+L+G +P +L  L +L   +VS+N LTG LP    F N+  S +  N G
Sbjct  479   TSLQVVNLSQNKLNGTLPVELSNLPSLHIFDVSHNMLTGDLPNSRFFNNIPESFLMDNSG  538

Query  1456  ICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHR--FLsvsai  1283
             +CS      C    PKPIV+          N++   +++   S  ++ HH+   LS+S +
Sbjct  539   LCSSRKNDSCSAVMPKPIVL--------NPNSSSNPSSQATPSAPSNMHHKKIILSISTL  590

Query  1282  vaisaaaiiavgvmvITMVNASVRRRISFVENALESMCSS---TSSRSQGMATGKLILFD  1112
             +AI+  A IA+GV+ I+++N  VR R +    A  +  S    + S     ++GKL++F 
Sbjct  591   IAIAGGAAIAIGVITISVLNRRVRARAAAPRPAPVTALSDDYLSQSPENDASSGKLVMFG  650

Query  1111  TKSSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDF  932
              K SP++ S+   ++LNK  E+G G FG VYK  L     + VAIKKLT S +++  +DF
Sbjct  651   -KGSPEF-SAGGHALLNKDCELGRGGFGAVYKTVL--RDGQPVAIKKLTVSSLVKSKDDF  706

Query  931   DREVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAV  752
             +R+V+ L K RH N+V LRG+YWT  LQLL+ D++P GNL   LHE         L+W  
Sbjct  707   ERQVKTLSKVRHHNIVTLRGFYWTSSLQLLIYDYLPGGNLNKHLHECNEDNL---LSWME  763

Query  751   RFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVM  572
             RF IILG A+GL +LH   Q  +IHYN+K SN+LLD N  PK+ D+GLA+L+  LDR+V+
Sbjct  764   RFDIILGVARGLTYLH---QHGVIHYNLKSSNVLLDSNGEPKVGDYGLAKLLPMLDRYVL  820

Query  571   SNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVR  392
             S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE++TGRRPVEY ED+V++L D VR
Sbjct  821   SSKIQSALGYMAPEFACKTVKITEKCDVYGFGVLVLEVLTGRRPVEYLEDDVVVLCDLVR  880

Query  391   VLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTP  218
               LE+G   +C+D  + G +P +E LP++KL LVCTSQ+PS+RP M EVV IL+++++P
Sbjct  881   SALEEGRPEDCIDPRLCGEFPMDEALPIIKLGLVCTSQVPSNRPDMGEVVSILELVRSP  939


 Score = 55.5 bits (132),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 39/118 (33%), Positives = 59/118 (50%), Gaps = 0/118 (0%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L GEIP D+ E+  L  L    N  TG +P  +   + L  L    N L+G +PE +  +
Sbjct  228   LAGEIPADVGEAALLKSLDFGHNLFTGGLPESLRRLTGLRFLGAGGNALAGELPEWIGEM  287

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGN  1463
               L+ L    N+ +G+IP  +   +NL+ V++S N LTG LP       L   ++ GN
Sbjct  288   WALERLDFSGNRFAGDIPYTIANCKNLVEVDLSRNALTGDLPWWVFGLPLQRVSVAGN  345



>ref|XP_006279331.1| hypothetical protein CARUB_v10012717mg [Capsella rubella]
 gb|EOA12229.1| hypothetical protein CARUB_v10012717mg [Capsella rubella]
Length=967

 Score =   387 bits (994),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 243/538 (45%), Positives = 346/538 (64%), Gaps = 29/538 (5%)
 Frame = -1

Query  1810  GEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSMLKR  1631
             G +P  I  + SL  L L  N L+G IP QI NCS+L  + LS N LSG +P ++  L  
Sbjct  447   GTVPSAIGGAISLKELNLQRNRLSGQIPVQISNCSALNAIDLSENELSGEVPASIGSLSN  506

Query  1630  LKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDGIC  1451
             LK + L  N LSG +P+++ KL +LL  N+S+N +TG LPAGS F  +  SA+ GN  +C
Sbjct  507   LKYVDLSRNNLSGSLPKEIEKLLHLLTFNISHNNITGELPAGSFFNTIPLSAVTGNPSLC  566

Query  1450  SPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRFLsvsaivais  1271
               ++   C    PKPIV+NP    N ++  NG      +  +        LS+SA++AI 
Sbjct  567   GSVVNRSCLSVHPKPIVLNP----NSSNPTNGPALTGQIRKS-------VLSISALIAIG  615

Query  1270  aaaiiavgvmvITMVNASVRRRISFVENALESMCSS-----TSSRSQGMATGKLILFDTK  1106
             AAA IA+GV+ +T++N   R  +S   NA  ++  S     + S S+    GKL++F  +
Sbjct  616   AAAFIAIGVVAVTLLNVHARSSVS-RHNAATALALSVGETFSCSPSKDQEFGKLVMFSGE  674

Query  1105  SSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDFDR  926
             +   + ++  +++LNK  E+G G FG VYK  L     R VA+KKLT S +++  E+F+R
Sbjct  675   ADV-FDTTGADALLNKDCELGRGGFGVVYKTNL--HDGRPVAVKKLTVSGLIKSQEEFER  731

Query  925   EVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAVRF  746
             E+R LGK RH N+V ++GYYWT  LQLL+ +FV  G+L   LH       +  L W  RF
Sbjct  732   EMRKLGKLRHDNVVEIKGYYWTQSLQLLIHEFVSGGSLYRHLH----GDESVCLNWRQRF  787

Query  745   KIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAK-LDRHVMS  569
              IILG A+GLA+LH S    I HYN+K +N+L+D     K+SDFGLARL+A  LDR V+S
Sbjct  788   SIILGIARGLAYLHGS---NITHYNLKATNVLVDATGEAKVSDFGLARLLASALDRCVLS  844

Query  568   NRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRV  389
              + Q+A+GY APE AC+++++ +KCDVYGFG+L+LE+VTG+RPVEY ED+V++L + VR 
Sbjct  845   GKVQSALGYTAPEFACRTVKITDKCDVYGFGILVLEVVTGKRPVEYAEDDVVVLCETVRE  904

Query  388   LLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTP  218
              LE+G V ECVD  + G +P EE +PV+KL LVC SQ+PS+RP M EVV+IL++I++P
Sbjct  905   RLEEGRVEECVDPRLRGNFPAEEAIPVIKLGLVCGSQVPSNRPDMEEVVKILELIQSP  962


 Score = 58.9 bits (141),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 59/97 (61%), Gaps = 0/97 (0%)
 Frame = -1

Query  1810  GEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSMLKR  1631
             G +P+ +    S   ++L GNSL G IP  IG+ +SL  L LS NN SG +P +L  L+ 
Sbjct  251   GNLPDSLRTISSCTSVRLRGNSLAGEIPNWIGDIASLETLDLSANNFSGNVPFSLGNLEF  310

Query  1630  LKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTG  1520
             LK L L  N L+GE+PQ +    +L+++++S N  TG
Sbjct  311   LKELNLSTNMLTGELPQTISNCSSLISIDISKNSFTG  347


 Score = 55.5 bits (132),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 57/102 (56%), Gaps = 0/102 (0%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G+IP+ +     L ++ L  N  +G +P  IG CSSL  L  S N  SG +P++L  +
Sbjct  201   LQGDIPDGLAALYDLRLIDLSRNWFSGHLPSDIGRCSSLKSLDFSDNYFSGNLPDSLRTI  260

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP  1511
                  ++L  N L+GEIP  +G + +L  +++S N  +G +P
Sbjct  261   SSCTSVRLRGNSLAGEIPNWIGDIASLETLDLSANNFSGNVP  302


 Score = 53.5 bits (127),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 44/104 (42%), Positives = 59/104 (57%), Gaps = 1/104 (1%)
 Frame = -1

Query  1816  LIGEIPEDICES-GSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSM  1640
             L G IP+   E  GSL  + L  N LTG +P  +  CS+LT L+LS N LSG +   +  
Sbjct  128   LSGRIPDGFFEQCGSLRSVSLANNKLTGPLPVSLSYCSTLTHLNLSSNQLSGRLAREIWF  187

Query  1639  LKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPA  1508
             LK LK L L  N L G+IP  L  L +L  +++S N  +G LP+
Sbjct  188   LKSLKSLDLSDNFLQGDIPDGLAALYDLRLIDLSRNWFSGHLPS  231



>ref|NP_001136621.1| uncharacterized protein LOC100216746 [Zea mays]
 gb|ACF82284.1| unknown [Zea mays]
Length=437

 Score =   371 bits (952),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 228/441 (52%), Positives = 292/441 (66%), Gaps = 41/441 (9%)
 Frame = -1

Query  1423  MNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRFLsvsaivaisaaaiiavgv  1244
             MN PKP+V++P  Y       +  +           R  RFLSVSA+VAI AA  I +GV
Sbjct  2     MNVPKPLVLDPNEY-THGGGGDNNNMGTNGGGVGAPRKRRFLSVSAMVAICAAVAIVLGV  60

Query  1243  mvITMVNASVRRRISFVEN----------------------ALESMCSSTSSRSQG-MAT  1133
             +VIT++N S RRR                               S   +   + +G +A 
Sbjct  61    IVITLLNVSARRRAEAAGGVGPGHGQKKEVDESVVTSSSSTTKSSPAPAPGGKGKGKLAA  120

Query  1132  GKLILFDTKSS---PDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTS  962
             GK++ F   SS    D  +   +++L KA+EIG G FGTVY+AP+G    RVVA+KKL +
Sbjct  121   GKMVPFGPGSSLRSEDLVAGA-DALLGKATEIGRGAFGTVYRAPVGD--GRVVAVKKLAA  177

Query  961   SKILQYPEDFDREVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMA  782
             + +++  E+F+REVRVLGKARH NL+PL+GYYWTPQLQLL++D+   G+LE++LH     
Sbjct  178   ASMVRSREEFEREVRVLGKARHPNLLPLKGYYWTPQLQLLITDYAARGSLEARLHGGGGG  237

Query  781   MATPPLTWAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILL-DENLNPKISDFGLA  605
              A   +TW  RF+++ GTA+ LAHLHH+ +PP++HYN+KPSNI L D   NP + +FGLA
Sbjct  238   EA---MTWEERFRVLSGTARALAHLHHAFRPPLVHYNVKPSNIFLADAECNPAVGEFGLA  294

Query  604   RLVA----KLDRHVMSNRFQ-AAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRP  440
             RL+A    +    +   RFQ    GYVAPELACQSLRVNEKCD+YG G+LILE+VTGRR 
Sbjct  295   RLLADGGGRQQVAMGGGRFQQGGAGYVAPELACQSLRVNEKCDIYGLGVLILELVTGRRA  354

Query  439   VEYGEDNVLILNDHVRVLLEQGNVLECVDQGMGG-YPDEEVLPVLKLALVCTSQIPSSRP  263
             VEYG+D+V++L D VR LLE GN LECVD GMGG  P+EEVLPVLKL +VCTSQIPS+RP
Sbjct  355   VEYGDDDVVVLVDQVRALLEHGNALECVDPGMGGRVPEEEVLPVLKLGMVCTSQIPSNRP  414

Query  262   SMAEVVQILQVIKTPVPNRME  200
             SMAEVVQILQVIK PV  RME
Sbjct  415   SMAEVVQILQVIKAPV-GRME  434



>ref|XP_008359946.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103423634 
[Malus domestica]
Length=1756

 Score =   397 bits (1020),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 237/548 (43%), Positives = 341/548 (62%), Gaps = 37/548 (7%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G IP+++  + SL  L+L  N LTG +P +I  CSSLT L LS NNL+G IP  ++ L
Sbjct  1235  LNGSIPDEVGGAVSLKELRLQKNLLTGKVPAEIVKCSSLTNLILSQNNLTGPIPTAIANL  1294

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
               L+ + L +N+ SG IP++L  L +LL  NVS+N L G LP G  F  +  S++ GN  
Sbjct  1295  TNLZYVDLSLNKFSGGIPKELTNLSHLLYFNVSHNHLEGELPLGGFFNTIPPSSVLGNPS  1354

Query  1456  ICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRH-HRFLsvsaiv  1280
             +C   +   C    PKPIV+NP             +++ P+  + +  H H+ +   + +
Sbjct  1355  LCGSAVXRACPSVHPKPIVLNP-------------NSSNPVGGSSSPTHGHKIVFSISAL  1401

Query  1279  aisaaaiiavg-vmvITMVNASVRRRISFVENALE------SMCSSTSSRSQGMATGKLI  1121
                 AA+     V+ +T++N   +  +S     LE        CS T+  + G    KL+
Sbjct  1402  IAIGAAVFIAIGVIAVTILNMHAQSSLSRSAAPLELSGGEDYSCSPTNDPNYG----KLV  1457

Query  1120  LFDTKSSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYP  941
             +F      D+A+   +++LNK  E+G G FG VYK  L     R VAIK L+ S +++  
Sbjct  1458  MFS--GDADFAAGR-QALLNKDCELGRGGFGVVYKTALCD--GRSVAIKMLSVSGLIKSQ  1512

Query  940   EDFDREVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLT  761
             EDF+REV+ LGK RH+NLV L GYYWTP LQL++ +++P G+L   LH+         LT
Sbjct  1513  EDFEREVKGLGKIRHRNLVALEGYYWTPSLQLIIYEYIPCGSLFKNLHD---GPGKTCLT  1569

Query  760   WAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDR  581
             W  RF IILG AKGLAHLH   Q  IIHYN+K +N+L D N  PK+ D GLARL+  LDR
Sbjct  1570  WRQRFHIILGMAKGLAHLH---QMNIIHYNLKSTNVLXDNNGEPKVGDIGLARLLPTLDR  1626

Query  580   HVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILND  401
              ++S++ Q+A+GY+APE ACQ++++ EKCDVYGFG+L+LE+VTG+RPVEY ED+V++L+D
Sbjct  1627  CILSSKIQSALGYMAPEFACQTVKITEKCDVYGFGILVLEVVTGKRPVEYVEDDVIVLSD  1686

Query  400   HVRVLLEQGNVLECVDQG-MGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIK  224
              VR  L +G V EC+D+  +G +P EE +PV+KL L+C SQ+PS+RP M EV+ IL++I+
Sbjct  1687  MVRGALGEGRVEECLDKNLLGNFPAEEAIPVIKLGLICASQVPSNRPDMGEVINILELIQ  1746

Query  223   TPVPNRME  200
              P   + E
Sbjct  1747  CPSEGQEE  1754


 Score = 57.4 bits (137),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 45/111 (41%), Positives = 61/111 (55%), Gaps = 5/111 (5%)
 Frame = -1

Query  1795  DICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSMLKRLKILK  1616
             D C S     L L GN L G +P  +G+  +L +L +S NNLSG IP +L  L+ L+ L 
Sbjct  1051  DSCTS-----LSLQGNXLAGQVPNWLGDLKNLVMLDVSGNNLSGEIPSSLGNLEVLEKLN  1105

Query  1615  LEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGN  1463
             L  N  +G +P  L    NLLA++VS+N L G+LP       L S  + GN
Sbjct  1106  LSRNGFTGSLPDALANCINLLAIDVSHNLLAGKLPLWIFKLGLRSVLLSGN  1156



>ref|NP_195809.1| leucine-rich receptor-like protein kinase [Arabidopsis thaliana]
 gb|AAL11557.1|AF424563_1 AT5g01890/T20L15_160 [Arabidopsis thaliana]
 emb|CAB82759.1| putative protein [Arabidopsis thaliana]
 gb|AAO42766.1| At5g01890/T20L15_160 [Arabidopsis thaliana]
 gb|ACN59360.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AED90406.1| leucine-rich receptor-like protein kinase [Arabidopsis thaliana]
Length=967

 Score =   385 bits (989),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 243/539 (45%), Positives = 350/539 (65%), Gaps = 27/539 (5%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G +P +I  + SL  L L  N L+G IP +I NCS+L  ++LS N LSG IP ++  L
Sbjct  445   LNGTLPSEIGGAVSLKQLHLHRNRLSGQIPAKISNCSALNTINLSENELSGAIPGSIGSL  504

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
               L+ + L  N LSG +P+++ KL +LL  N+S+N +TG LPAG  F  +  SA+ GN  
Sbjct  505   SNLEYIDLSRNNLSGSLPKEIEKLSHLLTFNISHNNITGELPAGGFFNTIPLSAVTGNPS  564

Query  1456  ICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRFLsvsaiva  1277
             +C  ++   C    PKPIV+NP    N ++  NG      +  +        LS+SA++A
Sbjct  565   LCGSVVNRSCLSVHPKPIVLNP----NSSNPTNGPALTGQIRKS-------VLSISALIA  613

Query  1276  isaaaiiavgvmvITMVN----ASVRRRISFVENALESMCSSTSSRSQGMATGKLILFDT  1109
             I AAA+IA+GV+ +T++N    +SV R  +    AL    + + S S+    GKL++F  
Sbjct  614   IGAAAVIAIGVVAVTLLNVHARSSVSRHDAAAALALSVGETFSCSPSKDQEFGKLVMFSG  673

Query  1108  KSSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDFD  929
             +    + ++  +++LNK SE+G G FG VYK  L  +  R VA+KKLT S +++  E+F+
Sbjct  674   EVDV-FDTTGADALLNKDSELGRGGFGVVYKTSL--QDGRPVAVKKLTVSGLIKSQEEFE  730

Query  928   REVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAVR  749
             RE+R LGK RH+N+V ++GYYWT  LQLL+ +FV  G+L   LH       +  LTW  R
Sbjct  731   REMRKLGKLRHKNVVEIKGYYWTQSLQLLIHEFVSGGSLYRHLH----GDESVCLTWRQR  786

Query  748   FKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAK-LDRHVM  572
             F IILG A+GLA LH S    I HYN+K +N+L+D     K+SDFGLARL+A  LDR V+
Sbjct  787   FSIILGIARGLAFLHSS---NITHYNMKATNVLIDAAGEAKVSDFGLARLLASALDRCVL  843

Query  571   SNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVR  392
             S + Q+A+GY APE AC+++++ ++CDVYGFG+L+LE+VTG+RPVEY ED+V++L + VR
Sbjct  844   SGKVQSALGYTAPEFACRTVKITDRCDVYGFGILVLEVVTGKRPVEYAEDDVVVLCETVR  903

Query  391   VLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTP  218
               LE+G V ECVD  + G +P EE +PV+KL LVC SQ+PS+RP M EVV+IL++I+ P
Sbjct  904   EGLEEGRVEECVDPRLRGNFPAEEAIPVIKLGLVCGSQVPSNRPEMEEVVKILELIQCP  962


 Score = 67.4 bits (163),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 62/97 (64%), Gaps = 0/97 (0%)
 Frame = -1

Query  1810  GEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSMLKR  1631
             G +P+ +   GS   ++L GNSL G IP  IG+ ++L +L LS NN +GT+P +L  L+ 
Sbjct  251   GNLPDSMKSLGSCSSIRLRGNSLIGEIPDWIGDIATLEILDLSANNFTGTVPFSLGNLEF  310

Query  1630  LKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTG  1520
             LK L L  N L+GE+PQ L    NL++++VS N  TG
Sbjct  311   LKDLNLSANMLAGELPQTLSNCSNLISIDVSKNSFTG  347


 Score = 59.7 bits (143),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 46/104 (44%), Positives = 61/104 (59%), Gaps = 1/104 (1%)
 Frame = -1

Query  1816  LIGEIPEDICES-GSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSM  1640
             L G IP+   E  GSL  + L  N LTG+IP  +  CS+LT L+LS N LSG +P  +  
Sbjct  128   LSGRIPDGFFEQCGSLRSVSLANNKLTGSIPVSLSYCSTLTHLNLSSNQLSGRLPRDIWF  187

Query  1639  LKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPA  1508
             LK LK L    N L G+IP  LG L +L  +N+S N  +G +P+
Sbjct  188   LKSLKSLDFSHNFLQGDIPDGLGGLYDLRHINLSRNWFSGDVPS  231


 Score = 53.9 bits (128),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 62/105 (59%), Gaps = 1/105 (1%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQI-GNCssltllslshnnlSGTIPETLSM  1640
             L G +  +    GSL ++   GN+L+G IP      C SL  +SL++N L+G+IP +LS 
Sbjct  104   LTGTLNPEFPHLGSLQVVDFSGNNLSGRIPDGFFEQCGSLRSVSLANNKLTGSIPVSLSY  163

Query  1639  LKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAG  1505
                L  L L  NQLSG +P+ +  L++L +++ S+N L G +P G
Sbjct  164   CSTLTHLNLSSNQLSGRLPRDIWFLKSLKSLDFSHNFLQGDIPDG  208



>ref|XP_004492560.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Cicer arietinum]
Length=958

 Score =   385 bits (989),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 249/544 (46%), Positives = 342/544 (63%), Gaps = 32/544 (6%)
 Frame = -1

Query  1810  GEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSMLKR  1631
             G IP +I  + SL  L+L  N L G IP QI  CSSLT L LSHN L+G+IP +++ L  
Sbjct  437   GSIPFEIEGAISLSELRLQKNFLGGRIPAQIAKCSSLTSLVLSHNKLTGSIPASIANLTN  496

Query  1630  LKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDGIC  1451
             L+ + L  N+LSG +P++L  L NL + NVSYN L G LP G  F  + SS++ GN  +C
Sbjct  497   LQHVDLSWNELSGSLPKELTNLSNLSSFNVSYNHLQGELPVGGFFNTISSSSVTGNSLLC  556

Query  1450  SPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRFLsvsaivais  1271
               ++   C    PKPIV+           N     +    S++  RH   LS+SA++AI 
Sbjct  557   GSVVNHSCPSVHPKPIVL-----------NPNSSGSNSSVSSQYHRHKIILSISALIAIG  605

Query  1270  aaaiiavgvmvITMVNASVRRRISFVENALESMCSSTSSRSQGMA------TGKLILFDT  1109
             AAA IAVGV+ IT++N  VR   S +E  L +  + +     G +       GKL++F  
Sbjct  606   AAASIAVGVVAITVLNMRVR---SAMEQRLATPFAFSGGEDYGNSPANDPNYGKLVMFSG  662

Query  1108  KSSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDFD  929
              +  D+A     ++LNK SEIG G FG VY+  L       VAIKKL  S +++  E+F+
Sbjct  663   DA--DFADGA-HNLLNKESEIGRGGFGVVYRTFL--RDGHAVAIKKLIVSSLIKSQEEFE  717

Query  928   REVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAVR  749
             +EV+  GK RHQNLV L GYYWT  LQLL+ +F+  G+L   LH          L+W  R
Sbjct  718   KEVKRFGKIRHQNLVALEGYYWTSSLQLLIYEFLSRGSLHKLLHGDNNKNV---LSWRQR  774

Query  748   FKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVMS  569
             FKIILG AKGL+HLH   Q  IIHYN+K +N+L+  +  PKI DFGL +L+  LD  V+S
Sbjct  775   FKIILGMAKGLSHLH---QMNIIHYNLKSTNVLIHSSDEPKIGDFGLVKLLPMLDHCVLS  831

Query  568   NRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRV  389
             ++ Q+A+GY+APE AC+++++ EKCDVYGFG+LILEIVTG+RPVEY ED+V++L D VR 
Sbjct  832   SKIQSALGYMAPEFACRTVKITEKCDVYGFGILILEIVTGKRPVEYMEDDVVVLCDMVRG  891

Query  388   LLEQGNVLECVDQG-MGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPVP  212
              LE+G V ECVD+  +G +  EE +PV+KL L+C SQ+PS+RP M EV+ IL++I+ P  
Sbjct  892   ALEEGKVEECVDERLLGNFAAEEAIPVIKLGLICASQVPSNRPDMDEVINILELIQCPSE  951

Query  211   NRME  200
              + E
Sbjct  952   GQEE  955


 Score = 70.9 bits (172),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 49/119 (41%), Positives = 65/119 (55%), Gaps = 0/119 (0%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G IP  +    S   L L GNSLTG IP  IG    L  L LS N  SG IP++L  L
Sbjct  255   LSGGIPNSMQRLSSCNSLSLQGNSLTGNIPDWIGELKDLEKLDLSSNRFSGLIPKSLGNL  314

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGND  1460
               L+IL    NQL G +P  +     LLA+++S+N+L G LP+ +    L S ++ GN+
Sbjct  315   DMLQILNFSRNQLVGNVPDSMINCSKLLAIDISHNQLFGHLPSWTFRIGLQSLSLSGNN  373


 Score = 60.1 bits (144),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 45/111 (41%), Positives = 60/111 (54%), Gaps = 2/111 (2%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L GEIPE I     +  L L  N  +G IP  IG C  L  L LS N LSG IP ++  L
Sbjct  207   LEGEIPEGIQNLYDMRELSLKKNRFSGRIPEDIGGCIVLKSLDLSGNFLSGGIPNSMQRL  266

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLD  1484
                  L L+ N L+G IP  +G+L++L  +++S NR +G +P      NLD
Sbjct  267   SSCNSLSLQGNSLTGNIPDWIGELKDLEKLDLSSNRFSGLIPKS--LGNLD  315


 Score = 59.7 bits (143),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 39/103 (38%), Positives = 61/103 (59%), Gaps = 1/103 (1%)
 Frame = -1

Query  1816  LIGEIPEDICES-GSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSM  1640
             L G IPE+  +  GSL  +    N+LTG IP  IG+C++LT ++ S N + G  P  +  
Sbjct  134   LQGTIPEEFFQQCGSLRTVSFAKNNLTGKIPDSIGSCATLTNVNFSSNQIYGEFPSGVWF  193

Query  1639  LKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP  1511
             L+ L+ L L  N L GEIP+ +  L ++  +++  NR +GR+P
Sbjct  194   LRGLQSLDLSNNLLEGEIPEGIQNLYDMRELSLKKNRFSGRIP  236



>gb|KFK24685.1| hypothetical protein AALP_AA8G011600 [Arabis alpina]
Length=976

 Score =   385 bits (989),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 240/543 (44%), Positives = 350/543 (64%), Gaps = 32/543 (6%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G +P +I  + SL  L L  N ++G IP QI NCS+L  + LS N LSG IP ++  L
Sbjct  451   LNGTVPSEIGGALSLKQLNLQRNRISGQIPSQISNCSALKAIDLSDNELSGGIPGSIGSL  510

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
               L+ + L  N+LSG +P+++ KL +L+  N+S+N +TG LPAG  F  +  SA++GN  
Sbjct  511   SNLEYMDLSRNKLSGSLPKEMEKLSHLVTFNISHNSITGELPAGGFFNTIPLSAVDGNPS  570

Query  1456  ICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHR-FLsvsaiv  1280
             +C  ++   C    PKPIV+NP    N ++  N           +NS+  +  LS+SA++
Sbjct  571   LCGSVVNRSCLSFHPKPIVLNP----NSSNPAN--------GPAQNSQIRKSVLSISALI  618

Query  1279  aisaaaiiavgvmvITMVNASVRRRISFVENALESMCSSTS-------SRSQGMATGKLI  1121
             AI AAA IA+GV+ +T++N   R  +S  + A  +   + S       S S+    GKL+
Sbjct  619   AIGAAAFIAIGVVAVTLLNVHARSSVSRQDAAAAAAALAMSVGETFSCSPSKDQEFGKLV  678

Query  1120  LFDTKSSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYP  941
             +F  ++   + ++   ++LNK  E+G G FG VY+  L     R VA+KKLT + +++  
Sbjct  679   MFSGEADV-FDTTGANALLNKDCELGRGGFGVVYRTNL--HDGRPVAVKKLTVAGLIKSQ  735

Query  940   EDFDREVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLT  761
             E+F+RE+R LGK RH+N+V ++GYYWT  LQLL+ +FV  G+L   LH       +  LT
Sbjct  736   EEFEREMRKLGKLRHRNVVEIKGYYWTHSLQLLIHEFVSGGSLHRHLH----GDESICLT  791

Query  760   WAVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAK-LD  584
             W  RF IILG A+GLA+LH S    I HYN+K +N+L+D     K+SDFGLARL+A  LD
Sbjct  792   WRQRFSIILGIARGLAYLHSS---NITHYNLKATNVLIDATGEAKVSDFGLARLLASALD  848

Query  583   RHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILN  404
             R V+S + Q+A+GY APE AC+++++ +KCDVYGFG+L+LE+VTG+RPVEY ED+V++L 
Sbjct  849   RCVLSGKVQSALGYTAPEFACRTVKITDKCDVYGFGILVLEVVTGKRPVEYAEDDVVVLC  908

Query  403   DHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVI  227
             + VR  LE+G V ECVD  + G +P EE +PV+KL LVC SQ+PS+RP M EVV+IL++I
Sbjct  909   ETVREGLEEGRVEECVDGRLRGNFPAEEAIPVIKLGLVCGSQVPSNRPDMEEVVKILELI  968

Query  226   KTP  218
             + P
Sbjct  969   QCP  971


 Score = 57.0 bits (136),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 61/105 (58%), Gaps = 1/105 (1%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQ-IGNCssltllslshnnlSGTIPETLSM  1640
             L G +  +    GSL +L   GN+L+G IP      C SL  +S ++N L+G++P +LS 
Sbjct  109   LTGTLNPEFPHLGSLQVLDFSGNNLSGRIPDAFFQQCGSLRSVSFANNKLTGSLPVSLSY  168

Query  1639  LKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAG  1505
                L  L L  NQLSG  P++L  L++L ++++S N L G LP G
Sbjct  169   CSTLTHLNLSTNQLSGRFPRELWFLKSLTSLDLSDNFLQGELPDG  213


 Score = 52.8 bits (125),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 58/104 (56%), Gaps = 1/104 (1%)
 Frame = -1

Query  1816  LIGEIPEDICES-GSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSM  1640
             L G IP+   +  GSL  +    N LTG++P  +  CS+LT L+LS N LSG  P  L  
Sbjct  133   LSGRIPDAFFQQCGSLRSVSFANNKLTGSLPVSLSYCSTLTHLNLSTNQLSGRFPRELWF  192

Query  1639  LKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPA  1508
             LK L  L L  N L GE+P  +G L +L  ++ S N  +G +P+
Sbjct  193   LKSLTSLDLSDNFLQGELPDGVGGLYDLREIDFSKNWFSGHVPS  236



>ref|XP_011002596.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Populus euphratica]
Length=965

 Score =   385 bits (988),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 229/544 (42%), Positives = 336/544 (62%), Gaps = 29/544 (5%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G IP +I  + SL  L+L+ N L+G IP  I  CSSLT L +S NNLSG IP  ++ L
Sbjct  444   LTGSIPSEIGGAVSLKELRLEMNFLSGKIPTLIKKCSSLTSLIISGNNLSGPIPVAIANL  503

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
               L+ + L  N+ SG +P++L  L +LL+ N+S+N L G LP G  F  +  S++ GN  
Sbjct  504   TNLQYVDLSFNRFSGSLPKELVNLSHLLSFNISHNNLKGDLPLGGFFNTISPSSVSGNPS  563

Query  1456  ICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRFLsvsaiva  1277
             +C  ++   C     KPIV+NP   G+    +              + HHR +++S    
Sbjct  564   LCGSVVNRSCPSVHQKPIVLNPNSSGSSNGTSF-------------NLHHRKIALSISAL  610

Query  1276  isaaaiiavgvmvITMVNASVRRRISFVENALESMCSS----TSSRSQGMATGKLILFDT  1109
             I+  A   + + V+ +   ++R R S   +      S     + S +     GKL++F  
Sbjct  611   IAIGAAACITLGVVAVTLLNIRARSSMARSPAAFTFSGGEDFSCSPTNDPNYGKLVMFSG  670

Query  1108  KSSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDFD  929
              +  D+ +   +++LNK SE+G G FG VY+  L     R VAIKKLT S +++  ++F+
Sbjct  671   DA--DFVAGA-QALLNKDSELGRGGFGVVYRTIL--RDGRSVAIKKLTVSSLIKSQDEFE  725

Query  928   REVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAVR  749
             REV+ LG+ RH NLV L GYYWTP LQLL+ ++   G+L   LH+         L+W  R
Sbjct  726   REVKKLGEVRHHNLVTLEGYYWTPSLQLLIYEYASSGSLYKHLHD---GPDKNYLSWRHR  782

Query  748   FKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVMS  569
             F IILG A+GLAHLHH     I HYN+K +NIL+D++  PK+ DFGLA+L+  LDR ++S
Sbjct  783   FNIILGMARGLAHLHHM---NITHYNLKSTNILIDDSGEPKVGDFGLAKLLPTLDRCILS  839

Query  568   NRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRV  389
             ++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE+VTG+RPVEY ED+V++L D VR 
Sbjct  840   SKIQSALGYMAPEFACRTVKITEKCDVYGFGVLVLEVVTGKRPVEYMEDDVVVLCDMVRG  899

Query  388   LLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPVP  212
              LE G V EC+D  + G +P +E +PV+KL L+C+SQ+PS+RP M EVV IL++I+ P  
Sbjct  900   ALEDGRVEECIDGRLRGNFPADEAIPVVKLGLICSSQVPSNRPDMEEVVNILELIQCPAG  959

Query  211   NRME  200
              + E
Sbjct  960   GQEE  963


 Score = 74.7 bits (182),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 51/120 (43%), Positives = 72/120 (60%), Gaps = 0/120 (0%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             +AL G +PE +    S   ++L GNS TG +P  IG  +SL  L LS N  SG IP ++ 
Sbjct  246   NALSGGLPESLQRLSSCATVRLGGNSFTGEVPGWIGQLTSLESLDLSVNRFSGRIPVSIG  305

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGN  1463
              L  LK L L +NQL+G +P+ +    +LLA++VS+NRLTG LP+      L S ++ GN
Sbjct  306   NLNVLKELNLSMNQLAGGLPESMENCVDLLAIDVSHNRLTGNLPSWIFKTGLKSVSLSGN  365


 Score = 65.1 bits (157),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 42/102 (41%), Positives = 60/102 (59%), Gaps = 0/102 (0%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L GEIPE I    +L  + L  N  TG +P  IG C  L LL  S N LSG +PE+L  L
Sbjct  200   LEGEIPEGIANLYALRAINLRRNRFTGQLPVDIGGCQVLKLLDFSENALSGGLPESLQRL  259

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP  1511
                  ++L  N  +GE+P  +G+L +L ++++S NR +GR+P
Sbjct  260   SSCATVRLGGNSFTGEVPGWIGQLTSLESLDLSVNRFSGRIP  301


 Score = 57.8 bits (138),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 62/105 (59%), Gaps = 1/105 (1%)
 Frame = -1

Query  1822  SALIGEIPEDICES-GSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETL  1646
             ++L G IP+   +  GSL  +    N LTG IP  +  C+SL++++ S N LSG +P  L
Sbjct  125   NSLSGSIPDGFFQQCGSLRSVSFARNDLTGMIPGSLSFCTSLSVVNFSSNGLSGELPSGL  184

Query  1645  SMLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP  1511
               L+ ++ L L  N L GEIP+ +  L  L A+N+  NR TG+LP
Sbjct  185   WYLRGIQSLDLSDNLLEGEIPEGIANLYALRAINLRRNRFTGQLP  229



>gb|KFK34877.1| Leucine-rich repeat protein kinase family protein [Arabis alpina]
Length=964

 Score =   384 bits (987),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 238/539 (44%), Positives = 334/539 (62%), Gaps = 27/539 (5%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G IP +   + SL  L+L+ N L G IP  I NCSSL  L LSHN L G IP  ++ L
Sbjct  437   LNGTIPRETGGAVSLEELRLENNGLQGNIPSSIKNCSSLRSLILSHNKLIGVIPPEMAKL  496

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
               L+ + L  N L+G +P+ L  L  L   N+S+N L+G LPAG IF  L   ++ GN G
Sbjct  497   TNLQEVDLSFNDLNGTLPKPLANLGYLRTFNISHNHLSGELPAGGIFNGLSPYSVYGNPG  556

Query  1456  ICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRFLsvsaiva  1277
             IC  ++   C   +PKPIV+NP    N T +++G            S H R L   + + 
Sbjct  557   ICGAVVNKSCPAVSPKPIVLNP----NATFDSSGEVLPP------GSGHKRILLSISSLI  606

Query  1276  isaaaiiavgvmvITMVNASVRRRISFVENALESMCSS-----TSSRSQGMATGKLILFD  1112
               +AA   V  ++   V  ++R R S V  +   +  S     + S +    +GKL++F 
Sbjct  607   AISAAAAIVVGVIAITV-LNLRVRASTVSRSAVPLTFSGGDDFSRSPTTDSNSGKLVMFS  665

Query  1111  TKSSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDF  932
              +  PD+++ T  ++LNK  E+G G FG VY+  +       VAIKKLT S +++  E+F
Sbjct  666   GE--PDFSTGT-HALLNKDCELGRGGFGAVYRTVI--RDGYPVAIKKLTVSSLVKSQEEF  720

Query  931   DREVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAV  752
             +REV+ LGK RH NLV L GYYWT  LQLL+ +F+  G+L   LHE     ++  L+W  
Sbjct  721   EREVKKLGKLRHTNLVKLEGYYWTTSLQLLIYEFLSGGSLYKHLHEAPGGSSS--LSWND  778

Query  751   RFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVM  572
             RF +ILGTAK LA+LH   Q  IIHYNIK SN+LLD +   K+ D+GLARL+  LDR+V+
Sbjct  779   RFNVILGTAKCLAYLH---QSNIIHYNIKSSNVLLDSSGEAKVGDYGLARLLPMLDRYVL  835

Query  571   SNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVR  392
             S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE+VTG++PVEY ED+V++L D VR
Sbjct  836   SSKIQSALGYMAPEFACRTVKITEKCDVYGFGVLVLEVVTGKKPVEYMEDDVVVLCDMVR  895

Query  391   VLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTP  218
               LE G   EC+D  + G +P EE + V+KL L+CTSQ+PSSRP M E V IL++I+ P
Sbjct  896   EALEDGRAEECIDPRLQGKFPVEEAVAVIKLGLICTSQVPSSRPHMGEAVNILRMIRCP  954


 Score = 65.5 bits (158),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 44/106 (42%), Positives = 64/106 (60%), Gaps = 1/106 (1%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L GE PE I    +L  L L  N L+G IP +IG+C  L  + LS N+LSG +PET   L
Sbjct  204   LEGEFPEKIDRLNNLRALDLSRNRLSGPIPSEIGSCLLLKSVDLSENSLSGNLPETFQQL  263

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSI  1499
                  L L  N+L GE+P+ +G++ +L  +++S N+ +G +P GSI
Sbjct  264   TLCYYLNLGENELEGEVPKWIGEMRSLETLDLSMNKFSGHVP-GSI  308


 Score = 60.8 bits (146),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 42/106 (40%), Positives = 65/106 (61%), Gaps = 1/106 (1%)
 Frame = -1

Query  1822  SALIGEIPEDIC-ESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETL  1646
             + L G +P+    + GSL +  L  N L G IP  I +CSSL  L+LS N  SG++P  +
Sbjct  129   NGLSGSLPDGFFRQCGSLRVFSLAKNELMGKIPVSISSCSSLAALNLSSNRFSGSMPLGI  188

Query  1645  SMLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPA  1508
               +  L+ L L  N+L GE P+++ +L NL A+++S NRL+G +P+
Sbjct  189   WSMNTLRSLDLSRNELEGEFPEKIDRLNNLRALDLSRNRLSGPIPS  234



>ref|XP_010232495.1| PREDICTED: LOW QUALITY PROTEIN: probably inactive leucine-rich 
repeat receptor-like protein kinase At3g28040 [Brachypodium 
distachyon]
Length=947

 Score =   384 bits (985),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 238/537 (44%), Positives = 348/537 (65%), Gaps = 22/537 (4%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G +P +I  + +L  L++  NSLTG IP QIG+C SL  L  SHN  +G+IP  L  L
Sbjct  420   LNGSMPPEIGGAVALRELRMGRNSLTGRIPAQIGSCRSLVALDFSHNEFTGSIPSALGNL  479

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
               L+++ L  N+L+G +P +L  L +L   +VS+N L+G LP    F N+ +  +  N G
Sbjct  480   TSLQVVNLSQNKLNGTLPVELSNLPSLHIFDVSHNSLSGGLPKSRFFDNIPAYFLSDNSG  539

Query  1456  ICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHR--FLsvsai  1283
             +CS      C    PKPIV+NP    N          ++   S+ +S HH+   LSVS +
Sbjct  540   LCSSRKNNSCSTVMPKPIVLNPNSSLNP--------LSQATPSSPSSMHHKKIILSVSTL  591

Query  1282  vaisaaaiiavgvmvITMVNASVRRRISFVENALE-SMCSSTSSRSQGMATGKLILFDTK  1106
             +AI+  A IA+GV+ +T++N  VR   S  + A+  S    + S     ++GKL++F  K
Sbjct  592   IAIAGGAAIAIGVITVTVLNRRVRAAASRSKPAIALSDDYLSQSPENDASSGKLVMFG-K  650

Query  1105  SSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDFDR  926
              SP++ S+   ++LNK  E+G G FG VYK  L     + VAIKKLT S +++  +DF+R
Sbjct  651   GSPEF-SAGGHALLNKDCELGRGGFGAVYKTVL--RDGQPVAIKKLTVSSLVKSRDDFER  707

Query  925   EVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAVRF  746
             +V++L K RH N+V LRG+YWT  LQLL+ D++P GNL   LHE     +   L+W  RF
Sbjct  708   QVKLLSKVRHHNIVTLRGFYWTSSLQLLIYDYLPGGNLHKHLHECTEENS---LSWMERF  764

Query  745   KIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVMSN  566
              II+G A+GL HLH   Q  ++HYN+K SN+LLD N  P++ D+GLA+L+  LDR+V+S+
Sbjct  765   DIIIGVARGLMHLH---QHGVVHYNLKSSNVLLDSNGEPRVGDYGLAKLLPMLDRYVLSS  821

Query  565   RFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRVL  386
             + Q+A+GY+APE  C+++++ EKCDVYGFG+L LEI+TGRRPVEY ED+V++L D VR  
Sbjct  822   KIQSALGYMAPEFTCKTVKITEKCDVYGFGVLALEILTGRRPVEYLEDDVVVLCDVVRSA  881

Query  385   LEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTP  218
             LE+  + +C+DQ + G +P EE +P++KL LVCTSQ+PS+RP M EVV IL++++ P
Sbjct  882   LEEDRLEDCMDQRLCGEFPMEEAIPIIKLGLVCTSQVPSNRPDMGEVVSILELVRNP  938


 Score = 55.5 bits (132),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 40/116 (34%), Positives = 58/116 (50%), Gaps = 0/116 (0%)
 Frame = -1

Query  1810  GEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSMLKR  1631
             GEIP DI E+  L  L L  N  TG +P  +   S L  L +  N L G +P  +  +  
Sbjct  231   GEIPADIGEAALLKSLDLGRNFFTGGLPDSLRRLSGLRFLGVGSNALVGEVPAWIGEMWA  290

Query  1630  LKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGN  1463
             L+ L L  N+ +G IP  +   +N++  ++S N LTG LP       L S ++ GN
Sbjct  291   LERLDLSGNRFTGAIPDDIANCKNMVEADLSRNALTGELPWWVFGLPLQSVSVAGN  346



>ref|XP_007140080.1| hypothetical protein PHAVU_008G082500g [Phaseolus vulgaris]
 gb|ESW12074.1| hypothetical protein PHAVU_008G082500g [Phaseolus vulgaris]
Length=968

 Score =   384 bits (985),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 241/534 (45%), Positives = 339/534 (63%), Gaps = 25/534 (5%)
 Frame = -1

Query  1810  GEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSMLKR  1631
             G IP +I  + SL  L+L  N L G IP QI  CSSLT L LSHN L+G+IP  ++ L  
Sbjct  449   GSIPSEIEGAISLRELRLQKNFLGGRIPAQIDKCSSLTFLILSHNKLTGSIPPAIANLSN  508

Query  1630  LKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDGIC  1451
             L+ + L  NQLSG +P++L  L +L + NVSYN L G LP G  F  + SS++  N  +C
Sbjct  509   LQYVDLSRNQLSGSLPKELTNLSHLFSFNVSYNHLEGELPVGGFFNTISSSSVSDNPLLC  568

Query  1450  SPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRFLsvsaivais  1271
               ++   C    PKPIV+           N     +    S++  RH   LS+SA++AI 
Sbjct  569   GSVVNHSCPSVHPKPIVL-----------NPNSSGSNSSISSQTHRHKIILSISALIAIG  617

Query  1270  aaaiiavgvmvITMVNASVRRRISFV--ENALESMCSSTSSRSQGMATGKLILFDTKSSP  1097
             AAA IA+GV+ +T++N  VR  +  +    AL      + S +     GKL++F   +  
Sbjct  618   AAAFIAIGVVAVTVLNIHVRSAMERMPATFALSGGEDYSGSPANDPNYGKLVMFSGDA--  675

Query  1096  DWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDFDREVR  917
             D+A     ++LNK SEIG G FG VY+  L       VAIKKLT S +++  EDF++E++
Sbjct  676   DFADGA-HNLLNKESEIGRGGFGVVYRTFL--RDGHAVAIKKLTVSSLIKSQEDFEKEIK  732

Query  916   VLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAVRFKII  737
              LGK RH NLV L GYYWT  LQLL+ +++  G+L   LH+     +    +W  RFKII
Sbjct  733   KLGKIRHSNLVALEGYYWTSSLQLLIYEYLSTGSLHKLLHD---DNSKNVFSWPQRFKII  789

Query  736   LGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVMSNRFQ  557
              G AKGLAHLH   Q  IIHYN+K +N+L+D +  PK+ DFGL +L+  LD  V+S++ Q
Sbjct  790   YGMAKGLAHLH---QMNIIHYNLKSTNVLIDCSGEPKVGDFGLVKLLPMLDHCVLSSKIQ  846

Query  556   AAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRVLLEQ  377
             +A+GY+APE AC+++++ EKCD+YGFG+L+LE+VTG+RPVEY ED+V++L D VR  LE+
Sbjct  847   SALGYMAPEFACRTVKITEKCDIYGFGILVLEVVTGKRPVEYMEDDVVVLCDMVRGALEE  906

Query  376   GNVLECVD-QGMGGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTP  218
             G V +CVD + +G +  EE +PV+KL L+C SQ+PS+RP MAEVV IL++I+ P
Sbjct  907   GKVEQCVDGRLLGNFAAEEAIPVIKLGLICASQVPSNRPDMAEVVNILELIQCP  960


 Score = 63.9 bits (154),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 65/118 (55%), Gaps = 0/118 (0%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L GE+P+ +    S   L L GNS TG IP  IG   +L +L LS N+ SG IP++L  L
Sbjct  252   LSGELPQSMQRLTSCTSLSLQGNSFTGGIPDWIGELKNLDMLDLSANSFSGWIPKSLGNL  311

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGN  1463
               L  L L  NQL+G +P  +     LL +++S+N L G +P+      + S ++ GN
Sbjct  312   DSLHRLNLSRNQLTGNLPDSMLNCTKLLTLDISHNHLAGHVPSWIFKMGVQSISLSGN  369


 Score = 60.1 bits (144),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 60/104 (58%), Gaps = 1/104 (1%)
 Frame = -1

Query  1816  LIGEIPEDICES-GSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSM  1640
             L GEIPE   +  GSL  +    N+LTG IP  + +CS+L  ++ S N L G +P  +  
Sbjct  131   LSGEIPEGFFQQCGSLRTVSFAKNNLTGKIPESLSSCSNLATVNFSSNQLHGELPNGVWF  190

Query  1639  LKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPA  1508
             L+ L+ L L  N L GEIP+ +  L ++  +++  NR +GRLP 
Sbjct  191   LRGLQSLDLSDNMLEGEIPEGIQNLYDMRELSLQRNRFSGRLPG  234


 Score = 56.6 bits (135),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 60/112 (54%), Gaps = 2/112 (2%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L GEIPE I     +  L L  N  +G +P  IG C  L  L LS N LSG +P+++  L
Sbjct  204   LEGEIPEGIQNLYDMRELSLQRNRFSGRLPGDIGGCLLLKSLDLSGNFLSGELPQSMQRL  263

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDS  1481
                  L L+ N  +G IP  +G+L+NL  +++S N  +G +P      NLDS
Sbjct  264   TSCTSLSLQGNSFTGGIPDWIGELKNLDMLDLSANSFSGWIPKS--LGNLDS  313



>ref|XP_011019007.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Populus euphratica]
Length=965

 Score =   383 bits (984),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 229/547 (42%), Positives = 332/547 (61%), Gaps = 36/547 (7%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G +P +I  + SL  L+L+ N LTG IP QI  CSSLT L LS N L+G IP  ++ L
Sbjct  445   LNGSLPSEIGGAISLTELRLEKNLLTGKIPTQIKKCSSLTSLILSGNILTGPIPVAIANL  504

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
               L+ + L  N+LSG +P++L  L +LL+ N+S+N L G LP G  F  +  S++ GN  
Sbjct  505   INLQYVDLSFNRLSGSLPKELTNLSHLLSFNISHNNLQGDLPLGGFFNTIPPSSVSGNPS  564

Query  1456  ICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRFLsvsaiva  1277
             +C  ++   C  +  KPIV+NP             ++++    T    HH+ +   + + 
Sbjct  565   LCGSVVNLSCPSDHQKPIVLNP-------------NSSDSSNGTSLDHHHKIVLSISALI  611

Query  1276  isaaaiiavgvmvITMV------NASVRRRISFVENALESM-CSSTSSRSQGMATGKLIL  1118
                AA      +V  +       ++  R   +F  +  E   CS T+  +      KL++
Sbjct  612   AIGAAACITLGVVAVIFLNIHAQSSMARSPAAFAFSGGEDFSCSPTNDPNYH----KLVM  667

Query  1117  FDTKSSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPE  938
             F   +  D+ +    ++LNK SE+G G FG VY+  L     R VAIKKLT S +++  +
Sbjct  668   FSGDA--DFVAGA-RALLNKDSELGCGGFGVVYRTIL--RDGRSVAIKKLTVSSLIKSQD  722

Query  937   DFDREVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTW  758
             +F+REV+ LGK RH NLV L GYYWTP LQLL+ ++V  G+L   LH+         L+W
Sbjct  723   EFEREVKELGKVRHHNLVALEGYYWTPTLQLLIYEYVSSGSLYKHLHD---GPDKNHLSW  779

Query  757   AVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRH  578
               RF IILG A+ LAHLHH     I+HYN+K +NIL+D++  PK+ DFGLA+L+  LDR 
Sbjct  780   RHRFNIILGMARALAHLHHM---NIVHYNLKSTNILIDDSGEPKVGDFGLAKLLPTLDRC  836

Query  577   VMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDH  398
             ++S + Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE+VTG+RPVEY ED+V++L D 
Sbjct  837   ILSRKIQSALGYMAPEFACRTVKITEKCDVYGFGILVLEVVTGKRPVEYMEDDVVVLCDM  896

Query  397   VRVLLEQGNVLECVDQGMGG-YPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKT  221
             VR  LE G V EC+D  +GG  P +E +PV+KL L+C S +PS+RP M EVV IL++I+ 
Sbjct  897   VRGALEDGRVEECIDGRLGGKVPADEAIPVIKLGLICASHVPSNRPDMEEVVNILELIQC  956

Query  220   PVPNRME  200
             P     E
Sbjct  957   PAEGHEE  963


 Score = 72.8 bits (177),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 50/120 (42%), Positives = 70/120 (58%), Gaps = 0/120 (0%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             ++L G +PE +    S   ++L GNS TG +P  IG  + L  L LS N  SG IP ++ 
Sbjct  247   NSLSGSLPESLQRLSSCATVRLGGNSFTGEVPGWIGELTDLESLDLSANRFSGRIPVSIG  306

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGN  1463
              L  LK L L +NQL+G +P+ +    NLLA++VS+NRLTG LP+      L S +  GN
Sbjct  307   NLNVLKELNLSMNQLTGGLPESMMNCLNLLAIDVSHNRLTGNLPSWIFKPGLKSVSPSGN  366


 Score = 64.7 bits (156),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 40/102 (39%), Positives = 61/102 (60%), Gaps = 0/102 (0%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L GE+PE I     L ++ L  N  TG +P  IG    L LL  S N+LSG++PE+L  L
Sbjct  201   LEGEVPEGIANMSDLRVINLKNNRFTGQLPVDIGGSQVLKLLDFSENSLSGSLPESLQRL  260

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP  1511
                  ++L  N  +GE+P  +G+L +L ++++S NR +GR+P
Sbjct  261   SSCATVRLGGNSFTGEVPGWIGELTDLESLDLSANRFSGRIP  302


 Score = 57.8 bits (138),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 61/105 (58%), Gaps = 1/105 (1%)
 Frame = -1

Query  1822  SALIGEIPEDICES-GSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETL  1646
             ++L G IP+   +  GSL  +    N LTG IP  + +C +L+L++ S N L G +P  L
Sbjct  126   NSLSGSIPDGFFQQCGSLRSVSFARNDLTGMIPGSLSSCMTLSLVNFSSNGLCGELPSGL  185

Query  1645  SMLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP  1511
               L+ L+ L L  N L GE+P+ +  + +L  +N+  NR TG+LP
Sbjct  186   WYLRGLQSLDLSDNLLEGEVPEGIANMSDLRVINLKNNRFTGQLP  230



>ref|XP_012091046.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Jatropha curcas]
Length=973

 Score =   383 bits (984),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 246/547 (45%), Positives = 345/547 (63%), Gaps = 35/547 (6%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G IP +I  +  L  L+L+ N +TG IP QI N SSLT L LSHNNL+G +P  ++ L
Sbjct  452   LNGRIPSEIGGAVGLVELRLENNCITGKIPIQIQNFSSLTSLILSHNNLTGPVPAAIANL  511

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
               L+   L  N LS  +P++L  L NL++ N+S+N L G LP G  F  +  SA+ GN  
Sbjct  512   TNLQYADLSFNNLSQSLPKELTNLSNLVSFNISHNNLQGELPVGGFFNTISLSAVAGNPS  571

Query  1456  ICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRF-Lsvsaiv  1280
             +C  ++   C    PKPIV+            N   ++    S+ N  H +  LS+SA+V
Sbjct  572   LCGSVVNRSCPSVHPKPIVL------------NPNSSSSNNGSSLNHNHRKIALSISALV  619

Query  1279  aisaaaiiavgvmvITMVNASVRRRISFVENAL------ESMCSSTSSRSQGMATGKLIL  1118
             AI AAA IA GV+ ++++N  VR  ++    AL      +  CS T+  + G    KL++
Sbjct  620   AIGAAAFIAFGVVAVSLLNIHVRSSMAQTPVALTLSGGEDFSCSPTNDPNYG----KLVM  675

Query  1117  FDTKSSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPE  938
             F   +  D+ +    ++LNK  E+G G FG VY+  L     R VAIKKLT S +++  E
Sbjct  676   FSGDA--DFVAGA-HALLNKDCELGRGGFGIVYRTIL--RDGRSVAIKKLTVSSLIKSQE  730

Query  937   DFDREVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTW  758
             +F+REV  LGK RH NLV L GYYWTP LQLL+ +++  G+L   LH+      T  L+W
Sbjct  731   EFEREVTRLGKIRHHNLVALEGYYWTPSLQLLIYEYISSGSLYKHLHD---GPTTNCLSW  787

Query  757   AVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRH  578
               RF II G AKGLAHLHH     +IHYN+K +NIL+D++  PK+ DFGLARL+  LDR 
Sbjct  788   RQRFNIIRGIAKGLAHLHHM---NVIHYNLKSTNILIDDSGEPKVGDFGLARLLPMLDRC  844

Query  577   VMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDH  398
             ++S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE+VTG+RPVEY ED+V++L D 
Sbjct  845   ILSSKIQSALGYMAPEFACRTVKITEKCDVYGFGILVLEVVTGKRPVEYMEDDVVVLCDM  904

Query  397   VRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKT  221
             VR  LE G V EC+D  + G +P EE +PV+KL L+C SQ+PS+RP M EVV IL++I+ 
Sbjct  905   VRGALEDGRVEECIDGKLRGNFPAEEAIPVIKLGLICASQVPSNRPDMEEVVNILELIQC  964

Query  220   PVPNRME  200
             P   + E
Sbjct  965   PAEGQEE  971


 Score = 63.9 bits (154),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 42/103 (41%), Positives = 59/103 (57%), Gaps = 0/103 (0%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L GEIPE I     L  + L  N  +G +P  IG C  L +L  S N+LSG +PE+L  L
Sbjct  208   LEGEIPEGIANLYDLIAINLQKNKFSGELPVDIGGCVLLKILDFSENSLSGNLPESLRRL  267

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPA  1508
             +    L+L  N  +GE+P  +G+L NL  +++S N   GR+PA
Sbjct  268   RSCTSLRLRGNLFAGEVPAWIGELTNLERLDLSANNFLGRVPA  310


 Score = 58.2 bits (139),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 47/120 (39%), Positives = 67/120 (56%), Gaps = 0/120 (0%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             ++L G +PE +    S   L+L GN   G +P  IG  ++L  L LS NN  G +P ++ 
Sbjct  254   NSLSGNLPESLRRLRSCTSLRLRGNLFAGEVPAWIGELTNLERLDLSANNFLGRVPASIG  313

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGN  1463
              L  LK L L VN L+G +P+ +    NLL ++VS NRLTG LP   +   L S ++ GN
Sbjct  314   NLNLLKELNLSVNHLTGGLPESMANCPNLLVLDVSQNRLTGNLPPWVVKTGLKSISLSGN  373


 Score = 55.8 bits (133),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 40/103 (39%), Positives = 61/103 (59%), Gaps = 1/103 (1%)
 Frame = -1

Query  1816  LIGEIPEDIC-ESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSM  1640
             L G IP+    + GSL  +    N+L+G IP  +  C++L  ++LS N LSG +P  L  
Sbjct  135   LSGIIPDGFFKQCGSLRSVSFARNNLSGQIPESLSWCTTLAAINLSSNKLSGELPSGLWF  194

Query  1639  LKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP  1511
             L+ L+ L L  N L GEIP+ +  L +L+A+N+  N+ +G LP
Sbjct  195   LRGLQSLDLSDNLLEGEIPEGIANLYDLIAINLQKNKFSGELP  237


 Score = 55.5 bits (132),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 42/103 (41%), Positives = 59/103 (57%), Gaps = 1/103 (1%)
 Frame = -1

Query  1810  GEIPEDICESGSLGILQLDGNSLTGTIPPQI-GNCssltllslshnnlSGTIPETLSMLK  1634
             G I  D+ + G L ++ L  N+L+G IP      C SL  +S + NNLSG IPE+LS   
Sbjct  113   GNINPDLAQLGGLQVIDLSHNNLSGIIPDGFFKQCGSLRSVSFARNNLSGQIPESLSWCT  172

Query  1633  RLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAG  1505
              L  + L  N+LSGE+P  L  L  L ++++S N L G +P G
Sbjct  173   TLAAINLSSNKLSGELPSGLWFLRGLQSLDLSDNLLEGEIPEG  215


 Score = 55.5 bits (132),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 45/116 (39%), Positives = 68/116 (59%), Gaps = 7/116 (6%)
 Frame = -1

Query  1774  LGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSMLKRLKILKLEVNQLS  1595
             L +L L  N L+G IP  IGN SSL +L++S N L G+IP ++  LK L++L L  N+L+
Sbjct  394   LKVLDLSSNVLSGEIPFDIGNLSSLLVLNVSRNRLFGSIPSSIGELKMLQVLDLSDNKLN  453

Query  1594  GEIPQQLGKLENLLAVNVSYNRLTGRLPAG-SIFQNLDSSAIEGNDGICSPLLTGP  1430
             G IP ++G    L+ + +  N +TG++P     F +L S  +  N+      LTGP
Sbjct  454   GRIPSEIGGAVGLVELRLENNCITGKIPIQIQNFSSLTSLILSHNN------LTGP  503



>ref|XP_004137674.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Cucumis sativus]
 gb|KGN58686.1| hypothetical protein Csa_3G728030 [Cucumis sativus]
Length=959

 Score =   382 bits (981),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 238/538 (44%), Positives = 342/538 (64%), Gaps = 29/538 (5%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G IP +I  + SL  L+L+ N LTG IP +IG C  LT L LSHNNL+G+IP  ++ L
Sbjct  438   LSGSIPAEIGGAISLKELRLEKNFLTGEIPVKIGKCPLLTSLILSHNNLTGSIPAAVANL  497

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
               L  + L  N+LSG +P++L  L +LL+ N+S+N L G LP G  F  +   +I  N  
Sbjct  498   SNLVDVDLSFNKLSGSLPKELTNLSHLLSFNISHNHLEGELPVGGFFNAISPLSISHNPS  557

Query  1456  ICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRFLsvsaiva  1277
             +C  ++   C    PKPIV+NP    N +D N         + + N  H   LS+S+I+A
Sbjct  558   LCGAVVNRSCPSVHPKPIVLNP----NSSDANGN-------SPSHNHHHEIILSISSIIA  606

Query  1276  isaaaiiavgvmvITMVNASVR----RRISFVENALESMCSSTSSRSQGMATGKLILFDT  1109
             I AA+ I +GV+ +T++N   R    R  + V +  E    S  + S     GKL++F  
Sbjct  607   IGAASFILLGVVAVTILNIRARSSQSRSAALVLSVREDFSCSPKTNSD---YGKLVMFSG  663

Query  1108  KSSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDFD  929
              +     +   +++LNK  E+G G FG VYK  L      +VAIKKLT + +++  EDF+
Sbjct  664   DAEFVVGA---QALLNKDCELGRGGFGVVYKTVL--RDGYLVAIKKLTVTSLIKSREDFE  718

Query  928   REVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAVR  749
              EV+ LG+ RH NLV L GYYWT  LQLL+ ++VP G+L   LH+         L+W  R
Sbjct  719   SEVKKLGQIRHHNLVALEGYYWTTSLQLLIYEYVPNGSLYKHLHDRTGDNYC--LSWRQR  776

Query  748   FKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVMS  569
             FKI+LG AKGLA+LHH+    IIHYN+K +N+L+D +  PK+ D+GLA L+  LDR ++S
Sbjct  777   FKIVLGMAKGLAYLHHN---NIIHYNLKSTNVLIDSSGKPKVGDYGLAMLLPMLDRCILS  833

Query  568   NRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRV  389
             ++ Q+A+GY+APE AC+++ + EKCDVYGFG+L+LE+VTG+RPVEY ED+V++L D VRV
Sbjct  834   SKIQSALGYMAPEFACKTVTITEKCDVYGFGILVLEVVTGKRPVEYMEDDVIVLCDMVRV  893

Query  388   LLEQGNVLECVDQGMG-GYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTP  218
              L++G V  CVD+ +   +  EE +PV+KL L+C SQ+PS+RP M EVV IL++I++P
Sbjct  894   ALDEGTVERCVDERLQLNFRVEEAIPVMKLGLICASQVPSNRPDMNEVVNILELIQSP  951


 Score = 64.3 bits (155),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 41/103 (40%), Positives = 60/103 (58%), Gaps = 0/103 (0%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G+IP  I     L  + L  N L+G +P  IG C  L  L  S N LSG +PE++ ML
Sbjct  200   LEGQIPTGIQNLYDLRFVSLHKNRLSGKLPEDIGGCLLLKSLDFSENILSGGLPESMQML  259

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPA  1508
                  L L  N L+GE+P+ +G+L+NL  +++S N  +G+LP+
Sbjct  260   SSCTYLNLRGNFLTGEVPRWIGELKNLDTLDLSANNFSGQLPS  302


 Score = 59.7 bits (143),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 58/102 (57%), Gaps = 0/102 (0%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G +PE +    S   L L GN LTG +P  IG   +L  L LS NN SG +P ++  L
Sbjct  248   LSGGLPESMQMLSSCTYLNLRGNFLTGEVPRWIGELKNLDTLDLSANNFSGQLPSSIGNL  307

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP  1511
             + LK   +  N L+  +P+ +    NLL+++ S+NRLTG LP
Sbjct  308   QFLKKFNVSTNYLTRNLPESMENCNNLLSIDASHNRLTGNLP  349


 Score = 58.9 bits (141),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 44/105 (42%), Positives = 65/105 (62%), Gaps = 1/105 (1%)
 Frame = -1

Query  1822  SALIGEIPEDI-CESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETL  1646
             ++L G IPE +  + GS+ +L    N+L G IP  + +C SL LL+ S N+LSGT+P  L
Sbjct  125   NSLSGPIPEQLFLQCGSIRVLSFARNNLIGNIPQSLTSCFSLELLNFSSNHLSGTLPSGL  184

Query  1645  SMLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP  1511
               L+ L+ L L  N L G+IP  +  L +L  V++  NRL+G+LP
Sbjct  185   WYLRELQSLDLSDNLLEGQIPTGIQNLYDLRFVSLHKNRLSGKLP  229


 Score = 53.9 bits (128),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 42/109 (39%), Positives = 63/109 (58%), Gaps = 3/109 (3%)
 Frame = -1

Query  1810  GEIPEDICESGSLGILQLDGNSLTGTIPPQIG-NCssltllslshnnlSGTIPETLSMLK  1634
             G I   +   G+L ++ L  NSL+G IP Q+   C S+ +LS + NNL G IP++L+   
Sbjct  105   GTINSALSHLGNLQVIDLSDNSLSGPIPEQLFLQCGSIRVLSFARNNLIGNIPQSLTSCF  164

Query  1633  RLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNL  1487
              L++L    N LSG +P  L  L  L ++++S N L G++P G   QNL
Sbjct  165   SLELLNFSSNHLSGTLPSGLWYLRELQSLDLSDNLLEGQIPTG--IQNL  211



>ref|XP_008442319.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Cucumis melo]
Length=958

 Score =   381 bits (978),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 238/538 (44%), Positives = 342/538 (64%), Gaps = 30/538 (6%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G IP +I  + SL  L+L+ N LTG IP +IG CS LT L LSHNNL+G+IP  ++ L
Sbjct  438   LNGSIPAEIGGAISLKELRLEKNFLTGEIPVKIGKCSFLTSLILSHNNLTGSIPAAIANL  497

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
               L  + L  N+LSG +P++L  L +LL+ N+S+N L G LP G  F  +   +I  N  
Sbjct  498   SNLVDVDLSFNKLSGSLPKELTNLSHLLSFNISHNHLEGELPVGGFFNAISPLSISHNPS  557

Query  1456  ICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRFLsvsaiva  1277
             +C  ++   C    PKPIV+NP    N +D N         + + N  H   LS+S+I+A
Sbjct  558   LCGAVVNRSCPSVHPKPIVLNP----NSSDANGN-------SPSHNHHHEIILSISSIIA  606

Query  1276  isaaaiiavgvmvITMVNASVR----RRISFVENALESMCSSTSSRSQGMATGKLILFDT  1109
             I AA+ I +GV+ +T++N   R    R  + V +  E    S  +       GKL++F  
Sbjct  607   IGAASFILLGVVAVTILNIRARSSQSRSAALVLSVREDFSCSPKTNPD---YGKLVMFSG  663

Query  1108  KSSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDFD  929
              +     +   +++LNK  E+G G FG VYK  L      +VAIKKLT + +++  EDF+
Sbjct  664   DAEFVVGA---QALLNKDCELGRGGFGVVYKTVL--RDGCLVAIKKLTVTSLIKSREDFE  718

Query  928   REVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAVR  749
              EV+ LG+ RH NLV L GYYWT  LQLL+ ++VP G+L   LH+         L+W  R
Sbjct  719   SEVKKLGQIRHHNLVALEGYYWTTSLQLLIYEYVPNGSLYKHLHDRT---GDDCLSWRQR  775

Query  748   FKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVMS  569
             FKI+LG AKGLA+LHH+    IIHYN+K +N+L+D +  PK+ D+GLA L+  LDR ++S
Sbjct  776   FKIVLGMAKGLAYLHHN---NIIHYNLKSTNVLIDSSGKPKVGDYGLAMLLPMLDRCILS  832

Query  568   NRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRV  389
             ++ Q+A+GY+APE AC+++ + EKCDVYGFG+L+LE+VTG+RPVEY ED+V++L D VRV
Sbjct  833   SKIQSALGYMAPEFACKTVTITEKCDVYGFGILVLEVVTGKRPVEYMEDDVIVLCDMVRV  892

Query  388   LLEQGNVLECVDQGMG-GYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTP  218
              L++G V  CVD+ +   +  EE +PV+KL L+C SQ+PS+RP M EVV IL++I++P
Sbjct  893   ALDEGTVERCVDERLQLNFRVEEAIPVMKLGLICASQVPSNRPDMNEVVNILELIQSP  950


 Score = 65.5 bits (158),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 41/103 (40%), Positives = 59/103 (57%), Gaps = 0/103 (0%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G+IP  I     L  + L  N L+G +P  IG C  L  L  S N LSG +PE++ ML
Sbjct  200   LEGQIPNGIQNLYDLRFVSLHKNRLSGKLPEDIGGCLLLKSLDFSENILSGGLPESMQML  259

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPA  1508
                  L L  N L+GE+P  +G+L+NL  +++S N  +G+LP+
Sbjct  260   SSCTYLNLRGNSLTGEVPHWIGELKNLDTLDLSANNFSGQLPS  302


 Score = 59.7 bits (143),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 57/102 (56%), Gaps = 0/102 (0%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G +PE +    S   L L GNSLTG +P  IG   +L  L LS NN SG +P ++  L
Sbjct  248   LSGGLPESMQMLSSCTYLNLRGNSLTGEVPHWIGELKNLDTLDLSANNFSGQLPSSIGNL  307

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP  1511
             + LK   +  N L+  +P+ +    NLL+ + S+N LTG LP
Sbjct  308   QFLKKFNVSTNYLTRNLPESMANCNNLLSFDASHNHLTGNLP  349


 Score = 58.9 bits (141),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 43/103 (42%), Positives = 62/103 (60%), Gaps = 1/103 (1%)
 Frame = -1

Query  1816  LIGEIPEDICES-GSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSM  1640
             L G IPE + +  GS+ +L    NSL G IP  + +C SL +L+ S N+LSGT+P  L  
Sbjct  127   LSGPIPEQLFQQCGSIRVLSFARNSLIGNIPQSLTSCFSLEVLNFSSNHLSGTLPSGLWY  186

Query  1639  LKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP  1511
             L+ L+ L    N L G+IP  +  L +L  V++  NRL+G+LP
Sbjct  187   LRELQSLDFSDNLLEGQIPNGIQNLYDLRFVSLHKNRLSGKLP  229



>ref|XP_006398567.1| hypothetical protein EUTSA_v10012579mg [Eutrema salsugineum]
 gb|ESQ40020.1| hypothetical protein EUTSA_v10012579mg [Eutrema salsugineum]
Length=972

 Score =   380 bits (976),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 243/542 (45%), Positives = 345/542 (64%), Gaps = 30/542 (6%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G +P ++  + SL  L L  N LTG IP QI NCS+L  + LS N LSG IP ++  L
Sbjct  447   LNGTLPSEMGGAVSLKKLYLQRNRLTGQIPAQISNCSALNAIDLSENKLSGGIPGSIGSL  506

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
               L  L L  N LSG +P+++ KL +L+  N+S+N +TG LP+G  F  +  SA+ GN  
Sbjct  507   SNLDYLDLSRNNLSGSLPKEIEKLSHLVTFNISHNSITGELPSGGFFNTIPLSAVTGNPS  566

Query  1456  ICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRFLsvsaiva  1277
             +C  ++   C    PKPIV+NP        N++   N  PL+          LS+SA++A
Sbjct  567   LCGSVVNRSCLSVHPKPIVLNP--------NSSNPANAPPLSG---QIRKSVLSISALIA  615

Query  1276  isaaaiiavgvmvITMVNASVRRRISFVENALESMCSSTS-------SRSQGMATGKLIL  1118
             I AAA IA+GV+ +T++N   R  +S  + A  +   + S       S S+    GKL++
Sbjct  616   IGAAAFIAIGVVAVTLLNVHARSSLSRHDAAAAAAALAFSVGETFSCSPSKDQEFGKLVM  675

Query  1117  FDTKSSPDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPE  938
             F  ++   + ++   ++LNK  E+G G FG VYK  L  +  R VA+KKLT S +++  E
Sbjct  676   FSGEADV-FDTTGANALLNKDCELGRGGFGVVYKTHL--QDGRPVAVKKLTVSGLIKSQE  732

Query  937   DFDREVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTW  758
             +F+RE+R LGK RH+N+V ++GYYWT  LQLL+ +FV  G+L   LH       +  LTW
Sbjct  733   EFEREMRKLGKLRHRNVVEIKGYYWTQSLQLLIHEFVSGGSLYRHLH----GDESICLTW  788

Query  757   AVRFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAK-LDR  581
               RF IILG A+GLA+LH S    I HYN+K +N+L+D     K+SDFGLA L+A  LDR
Sbjct  789   RQRFSIILGIARGLAYLHGS---NITHYNLKSTNVLIDATGEAKVSDFGLAGLLASTLDR  845

Query  580   HVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILND  401
              V+S + Q+A+GY APE AC+++++ EKCDVYGFG+L+LE+VTG+RPVEY ED+V++L +
Sbjct  846   CVLSGKVQSALGYTAPEFACRTVKITEKCDVYGFGILVLEVVTGKRPVEYAEDDVVVLCE  905

Query  400   HVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIK  224
              VR  LE+G V ECVD  + G +P EE +PV+KL LVC SQ+PS+RP M EVV+IL++I+
Sbjct  906   TVREGLEEGRVEECVDGRLRGNFPAEEAIPVIKLGLVCGSQVPSNRPEMEEVVKILELIQ  965

Query  223   TP  218
              P
Sbjct  966   CP  967


 Score = 67.0 bits (162),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 60/97 (62%), Gaps = 0/97 (0%)
 Frame = -1

Query  1810  GEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSMLKR  1631
             G +P  +   GS   ++L GNSL G IP  IG  +SL  L LS NN SG +P +L  L+ 
Sbjct  253   GSLPNSMKTLGSCTTIRLRGNSLIGEIPDWIGEMASLETLDLSANNFSGNVPLSLGNLEF  312

Query  1630  LKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTG  1520
             LK+L L  N L+GEIPQ +    NL++++VS N LTG
Sbjct  313   LKVLNLSTNMLAGEIPQTISNCSNLISIDVSKNSLTG  349


 Score = 55.8 bits (133),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 44/104 (42%), Positives = 60/104 (58%), Gaps = 1/104 (1%)
 Frame = -1

Query  1816  LIGEIPEDICES-GSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSM  1640
             L G IP+   E  GSL  + L  N LTG +P  +  CS+LT L+LS N +SG +P  +  
Sbjct  130   LSGRIPDGFFEQCGSLRSVSLANNQLTGPLPVSLSYCSTLTHLNLSSNQISGRLPREIWF  189

Query  1639  LKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPA  1508
             LK LK L L VN L G +P  +G L +L   N+S N  +G +P+
Sbjct  190   LKSLKSLDLSVNFLQGLLPDGIGGLYDLREFNLSKNWFSGDIPS  233



>ref|XP_003516434.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like isoform X1 [Glycine max]
 ref|XP_006573410.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like isoform X2 [Glycine max]
Length=969

 Score =   380 bits (976),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 241/539 (45%), Positives = 337/539 (63%), Gaps = 30/539 (6%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G IP ++  + SL  ++L  N L G IP QI  CS LT L+LSHN L G+IP  ++ L
Sbjct  450   LNGSIPSEVEGAISLSEMRLQKNFLGGRIPAQIEKCSELTFLNLSHNKLIGSIPSAIANL  509

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
               L+      N+LSG +P++L  L NL + NVSYNRL G LP G  F  +   ++ GN  
Sbjct  510   TNLQYADFSWNELSGSLPKELTNLSNLFSFNVSYNRLQGELPVGGFFNTISPLSVSGNPL  569

Query  1456  ICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRFLsvsaiva  1277
             +C  ++   C    PKPIV+           N     +   +S +N+ H   LS+S I+A
Sbjct  570   LCGSVVNHSCPSVHPKPIVL-----------NPNSSYSNSGSSLQNNHHKMMLSISVIIA  618

Query  1276  isaaaiiavgvmvITMVNASVRRRISFVENALESMCSSTSSRSQGMAT----GKLILFDT  1109
             I AA  I +GV+V+T++N  +  R S + +A   + S     S   A     GKL++F  
Sbjct  619   IGAAIFIVIGVVVVTVLN--IHARSSMLSSAAPFVFSGGEDYSGSPANDPNYGKLVMFSG  676

Query  1108  KSS-PDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDF  932
              +   D A     ++LNK SEIG G FG VY   L       VAIKKLT S + +  EDF
Sbjct  677   DAEFVDGA----HNILNKDSEIGRGGFGVVYCTVL--RDGHCVAIKKLTVSTLTKSQEDF  730

Query  931   DREVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAV  752
             +REV++LGK +HQNLV L GYYWTP LQLL+ +++  G+L+  LH+   +     L+W  
Sbjct  731   EREVKMLGKIKHQNLVALEGYYWTPSLQLLIYEYLARGSLQKLLHDDDSSKNL--LSWRQ  788

Query  751   RFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVM  572
             RFKIILG AKGLA+LH   Q  +IHYN+K +N+ +D +  PKI DFGL RL+  LD  V+
Sbjct  789   RFKIILGMAKGLAYLH---QMELIHYNLKSTNVFIDCSDEPKIGDFGLVRLLPMLDHCVL  845

Query  571   SNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVR  392
             S++ Q+A+GY+APE AC+++++ EKCD+Y FG+LILE+VTG+RPVEY ED+V++L D VR
Sbjct  846   SSKIQSALGYMAPEFACRTVKITEKCDIYSFGILILEVVTGKRPVEYMEDDVVVLCDKVR  905

Query  391   VLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTP  218
               L+ G V +CVD+ + G +  EE +PV+KL LVC SQ+PS+RP MAEV+ IL++I+ P
Sbjct  906   SALDDGKVEQCVDEKLKGNFAAEEAIPVIKLGLVCASQVPSNRPDMAEVINILELIQCP  964


 Score = 63.9 bits (154),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 45/120 (38%), Positives = 67/120 (56%), Gaps = 0/120 (0%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             +++ G +PE + +  S   L L GNS TG IP  IG   SL +L LS N  SG IP+++ 
Sbjct  253   NSISGRLPESMQKLTSCTFLSLQGNSFTGGIPHWIGEMKSLEVLDLSANRFSGWIPKSIG  312

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGN  1463
              L  L  L L  NQ++G +P+ +     LL +++S+N L G LP+      L S ++ GN
Sbjct  313   NLDLLSRLNLSRNQITGNLPELMVNCIKLLTLDISHNHLAGHLPSWIFRMGLQSVSLSGN  372


 Score = 62.8 bits (151),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 60/102 (59%), Gaps = 0/102 (0%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L GEIPE I     L  L+L  N  TG +P  IG+C  L L+  S N++SG +PE++  L
Sbjct  207   LEGEIPEGIQNLIDLRELRLGSNHFTGRVPEHIGDCLLLKLVDFSDNSISGRLPESMQKL  266

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP  1511
                  L L+ N  +G IP  +G++++L  +++S NR +G +P
Sbjct  267   TSCTFLSLQGNSFTGGIPHWIGEMKSLEVLDLSANRFSGWIP  308


 Score = 53.9 bits (128),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 42/109 (39%), Positives = 62/109 (57%), Gaps = 3/109 (3%)
 Frame = -1

Query  1810  GEIPEDICESGSLGILQLDGNSLTGTIPPQI-GNCssltllslshnnlSGTIPETLSMLK  1634
             G I  D+   G L ++ L  N+L G IP  I   C SL ++S ++NNL+G IP++LS   
Sbjct  112   GTIAPDLLSIGDLQVVDLSENNLYGPIPDGIFQQCWSLRVVSFANNNLTGKIPDSLSSCY  171

Query  1633  RLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNL  1487
              L ++    NQL GE+P  +  L  L ++++S N L G +P G   QNL
Sbjct  172   SLAVVNFSSNQLHGELPSGMWFLRGLQSIDLSNNFLEGEIPEG--IQNL  218


 Score = 52.8 bits (125),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 37/103 (36%), Positives = 58/103 (56%), Gaps = 1/103 (1%)
 Frame = -1

Query  1816  LIGEIPEDICES-GSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSM  1640
             L G IP+ I +   SL ++    N+LTG IP  + +C SL +++ S N L G +P  +  
Sbjct  134   LYGPIPDGIFQQCWSLRVVSFANNNLTGKIPDSLSSCYSLAVVNFSSNQLHGELPSGMWF  193

Query  1639  LKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP  1511
             L+ L+ + L  N L GEIP+ +  L +L  + +  N  TGR+P
Sbjct  194   LRGLQSIDLSNNFLEGEIPEGIQNLIDLRELRLGSNHFTGRVP  236



>gb|KHN11868.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Glycine soja]
Length=969

 Score =   380 bits (976),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 241/539 (45%), Positives = 337/539 (63%), Gaps = 30/539 (6%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L G IP ++  + SL  ++L  N L G IP QI  CS LT L+LSHN L G+IP  ++ L
Sbjct  450   LNGSIPSEVEGAISLSEMRLQKNFLGGRIPAQIEKCSELTFLNLSHNKLIGSIPSAIANL  509

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGNDG  1457
               L+      N+LSG +P++L  L NL + NVSYNRL G LP G  F  +   ++ GN  
Sbjct  510   TNLQYADFSWNELSGSLPKELTNLSNLFSFNVSYNRLQGELPVGGFFNTISPLSVSGNPL  569

Query  1456  ICSPLLTGPCKMNAPKPIVINPFVYGNQTdnnnggdnNEPLASTRNSRHHRFLsvsaiva  1277
             +C  ++   C    PKPIV+           N     +   +S +N+ H   LS+S I+A
Sbjct  570   LCGSVVNHSCPSVHPKPIVL-----------NPNSSYSNSGSSLQNNHHKMMLSISVIIA  618

Query  1276  isaaaiiavgvmvITMVNASVRRRISFVENALESMCSSTSSRSQGMAT----GKLILFDT  1109
             I AA  I +GV+V+T++N  +  R S + +A   + S     S   A     GKL++F  
Sbjct  619   IGAAIFIVIGVVVVTVLN--IHARSSMLSSAAPFVFSGGEDYSGSPANDPNYGKLVMFSG  676

Query  1108  KSS-PDWASSTFESVLNKASEIGEGVFGTVYKAPLGGEGSRVVAIKKLTSSKILQYPEDF  932
              +   D A     ++LNK SEIG G FG VY   L       VAIKKLT S + +  EDF
Sbjct  677   DAEFVDGA----HNILNKDSEIGRGGFGVVYCTVL--RDGHCVAIKKLTVSTLTKSQEDF  730

Query  931   DREVRVLGKARHQNLVPLRGYYWTPQLQLLVSDFVPLGNLESKLHEMAMAMATPPLTWAV  752
             +REV++LGK +HQNLV L GYYWTP LQLL+ +++  G+L+  LH+   +     L+W  
Sbjct  731   EREVKMLGKIKHQNLVALEGYYWTPSLQLLIYEYLARGSLQKLLHDDDSSKNL--LSWRQ  788

Query  751   RFKIILGTAKGLAHLHHSCQPPIIHYNIKPSNILLDENLNPKISDFGLARLVAKLDRHVM  572
             RFKIILG AKGLA+LH   Q  +IHYN+K +N+ +D +  PKI DFGL RL+  LD  V+
Sbjct  789   RFKIILGMAKGLAYLH---QMELIHYNLKSTNVFIDCSDEPKIGDFGLVRLLPMLDHCVL  845

Query  571   SNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVR  392
             S++ Q+A+GY+APE AC+++++ EKCD+Y FG+LILE+VTG+RPVEY ED+V++L D VR
Sbjct  846   SSKIQSALGYMAPEFACRTVKITEKCDIYSFGILILEVVTGKRPVEYMEDDVVVLCDKVR  905

Query  391   VLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTP  218
               L+ G V +CVD+ + G +  EE +PV+KL LVC SQ+PS+RP MAEV+ IL++I+ P
Sbjct  906   SALDDGKVEQCVDEKLKGNFAAEEAIPVIKLGLVCASQVPSNRPDMAEVINILELIQCP  964


 Score = 63.9 bits (154),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 45/120 (38%), Positives = 67/120 (56%), Gaps = 0/120 (0%)
 Frame = -1

Query  1822  SALIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLS  1643
             +++ G +PE + +  S   L L GNS TG IP  IG   SL +L LS N  SG IP+++ 
Sbjct  253   NSISGRLPESMQKLTSCTFLSLQGNSFTGGIPHWIGEMKSLEVLDLSANRFSGWIPKSIG  312

Query  1642  MLKRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLPAGSIFQNLDSSAIEGN  1463
              L  L  L L  NQ++G +P+ +     LL +++S+N L G LP+      L S ++ GN
Sbjct  313   NLDLLSRLNLSRNQITGNLPELMVNCIKLLTLDISHNHLAGHLPSWIFRMGLQSVSLSGN  372


 Score = 62.8 bits (151),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 60/102 (59%), Gaps = 0/102 (0%)
 Frame = -1

Query  1816  LIGEIPEDICESGSLGILQLDGNSLTGTIPPQIGNCssltllslshnnlSGTIPETLSML  1637
             L GEIPE I     L  L+L  N  TG +P  IG+C  L L+  S N++SG +PE++  L
Sbjct  207   LEGEIPEGIQNLIDLRELRLGSNHFTGRVPEHIGDCLLLKLVDFSDNSISGRLPESMQKL  266

Query  1636  KRLKILKLEVNQLSGEIPQQLGKLENLLAVNVSYNRLTGRLP  1511
                  L L+ N  +G IP  +G++++L  +++S NR +G +P
Sbjct  267   TSCTFLSLQGNSFTGGIPHWIGEMKSLEVLDLSANRFSGWIP  308


 Score = 53.1 bits (126),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 41/109 (38%), Positives = 62/109 (57