BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig10980

Length=725
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_012086772.1|  PREDICTED: probable inactive receptor kinase...    286   2e-88   Jatropha curcas
ref|XP_002509916.1|  ATP binding protein, putative                      280   4e-87   
gb|KHN16761.1|  Putative inactive receptor kinase                       273   1e-86   Glycine soja [wild soybean]
ref|XP_004511532.1|  PREDICTED: probable inactive receptor kinase...    271   8e-86   Cicer arietinum [garbanzo]
gb|KEH21182.1|  LRR receptor-like kinase                                277   4e-85   Medicago truncatula
ref|XP_006343895.1|  PREDICTED: probable inactive receptor kinase...    277   4e-85   Solanum tuberosum [potatoes]
ref|XP_004245544.1|  PREDICTED: probable inactive receptor kinase...    277   7e-85   Solanum lycopersicum
ref|XP_011080874.1|  PREDICTED: probable inactive receptor kinase...    275   3e-84   Sesamum indicum [beniseed]
ref|XP_008239079.1|  PREDICTED: probable inactive receptor kinase...    275   3e-84   Prunus mume [ume]
ref|XP_007040424.1|  Leucine-rich repeat protein kinase family pr...    274   4e-84   
ref|XP_009629119.1|  PREDICTED: probable inactive receptor kinase...    275   4e-84   
ref|XP_009799943.1|  PREDICTED: probable inactive receptor kinase...    275   5e-84   Nicotiana sylvestris
ref|XP_010104998.1|  putative inactive receptor kinase                  274   7e-84   Morus notabilis
ref|XP_007210296.1|  hypothetical protein PRUPE_ppa002579mg             274   1e-83   Prunus persica
ref|XP_002299495.1|  leucine-rich repeat transmembrane protein ki...    273   2e-83   Populus trichocarpa [western balsam poplar]
ref|XP_006584744.1|  PREDICTED: probable inactive receptor kinase...    272   5e-83   Glycine max [soybeans]
ref|XP_004300851.1|  PREDICTED: probable inactive receptor kinase...    271   6e-83   Fragaria vesca subsp. vesca
ref|XP_006580544.1|  PREDICTED: probable inactive receptor kinase...    270   1e-82   Glycine max [soybeans]
ref|XP_003611028.1|  Probably inactive receptor-like protein kinase     270   1e-82   Medicago truncatula
ref|XP_002303623.1|  leucine-rich repeat transmembrane protein ki...    270   2e-82   Populus trichocarpa [western balsam poplar]
ref|XP_006439412.1|  hypothetical protein CICLE_v10019314mg             270   2e-82   Citrus clementina [clementine]
gb|KDO76442.1|  hypothetical protein CISIN_1g006922mg                   270   2e-82   Citrus sinensis [apfelsine]
ref|XP_004503646.1|  PREDICTED: probable inactive receptor kinase...    270   3e-82   Cicer arietinum [garbanzo]
ref|XP_006476438.1|  PREDICTED: probable inactive receptor kinase...    270   3e-82   Citrus sinensis [apfelsine]
ref|XP_004511531.1|  PREDICTED: probable inactive receptor kinase...    269   3e-82   Cicer arietinum [garbanzo]
gb|AFK45382.1|  unknown                                                 269   3e-82   Medicago truncatula
ref|XP_004143879.1|  PREDICTED: probable inactive receptor kinase...    269   4e-82   Cucumis sativus [cucumbers]
ref|XP_008437363.1|  PREDICTED: probable inactive receptor kinase...    269   4e-82   
ref|XP_009336254.1|  PREDICTED: probable inactive receptor kinase...    270   5e-82   Pyrus x bretschneideri [bai li]
ref|XP_011022559.1|  PREDICTED: probable inactive receptor kinase...    268   7e-82   Populus euphratica
ref|XP_007160136.1|  hypothetical protein PHAVU_002G295600g             269   7e-82   Phaseolus vulgaris [French bean]
ref|XP_011026938.1|  PREDICTED: probable inactive receptor kinase...    268   8e-82   Populus euphratica
gb|KJB19053.1|  hypothetical protein B456_003G082600                    268   9e-82   Gossypium raimondii
gb|KHN25658.1|  Putative inactive receptor kinase                       262   1e-81   Glycine soja [wild soybean]
ref|XP_011026937.1|  PREDICTED: probable inactive receptor kinase...    268   1e-81   Populus euphratica
ref|XP_008392458.1|  PREDICTED: probable inactive receptor kinase...    267   3e-81   
emb|CDP12117.1|  unnamed protein product                                267   4e-81   Coffea canephora [robusta coffee]
ref|XP_010658906.1|  PREDICTED: probable inactive receptor kinase...    266   8e-81   Vitis vinifera
ref|XP_006590496.1|  PREDICTED: probable inactive receptor kinase...    263   3e-80   Glycine max [soybeans]
ref|XP_010251541.1|  PREDICTED: probable inactive receptor kinase...    264   4e-80   
ref|XP_009352353.1|  PREDICTED: probable inactive receptor kinase...    264   4e-80   Pyrus x bretschneideri [bai li]
emb|CDY03526.1|  BnaC01g15560D                                          252   7e-80   
ref|XP_007158557.1|  hypothetical protein PHAVU_002G162400g             262   9e-80   Phaseolus vulgaris [French bean]
ref|XP_003516715.2|  PREDICTED: probable inactive receptor kinase...    262   3e-79   Glycine max [soybeans]
ref|XP_010538821.1|  PREDICTED: probable inactive receptor kinase...    260   1e-78   Tarenaya hassleriana [spider flower]
ref|XP_011073578.1|  PREDICTED: probable inactive receptor kinase...    260   1e-78   Sesamum indicum [beniseed]
ref|XP_011001936.1|  PREDICTED: probable inactive receptor kinase...    260   1e-78   Populus euphratica
ref|XP_011001931.1|  PREDICTED: probable inactive receptor kinase...    260   1e-78   Populus euphratica
ref|XP_009628885.1|  PREDICTED: probable inactive receptor kinase...    257   1e-77   Nicotiana tomentosiformis
ref|XP_006374322.1|  hypothetical protein POPTR_0015s06040g             257   3e-77   Populus trichocarpa [western balsam poplar]
gb|EYU23390.1|  hypothetical protein MIMGU_mgv1a003016mg                256   3e-77   Erythranthe guttata [common monkey flower]
ref|XP_002317741.1|  hypothetical protein POPTR_0012s01230g             256   4e-77   Populus trichocarpa [western balsam poplar]
ref|XP_012090129.1|  PREDICTED: probable inactive receptor kinase...    255   1e-76   Jatropha curcas
ref|XP_009380537.1|  PREDICTED: probable inactive receptor kinase...    255   1e-76   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002513601.1|  ATP binding protein, putative                      254   1e-76   Ricinus communis
ref|XP_011007941.1|  PREDICTED: probable inactive receptor kinase...    255   1e-76   Populus euphratica
ref|XP_009796898.1|  PREDICTED: probable inactive receptor kinase...    254   2e-76   Nicotiana sylvestris
ref|XP_010055829.1|  PREDICTED: probable inactive receptor kinase...    254   2e-76   Eucalyptus grandis [rose gum]
ref|XP_007038934.1|  Leucine-rich repeat protein kinase family pr...    254   2e-76   
ref|XP_010541406.1|  PREDICTED: probable inactive receptor kinase...    253   4e-76   Tarenaya hassleriana [spider flower]
ref|XP_009137388.1|  PREDICTED: probable inactive receptor kinase...    253   5e-76   Brassica rapa
ref|XP_006413522.1|  hypothetical protein EUTSA_v10024674mg             253   8e-76   Eutrema salsugineum [saltwater cress]
ref|XP_010676354.1|  PREDICTED: probable inactive receptor kinase...    252   1e-75   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004502606.1|  PREDICTED: probable inactive receptor kinase...    250   4e-75   
ref|XP_009137362.1|  PREDICTED: probable inactive receptor kinase...    250   5e-75   Brassica rapa
ref|XP_004502605.1|  PREDICTED: probable inactive receptor kinase...    250   6e-75   Cicer arietinum [garbanzo]
ref|XP_010915719.1|  PREDICTED: probable inactive receptor kinase...    250   9e-75   
emb|CDY47625.1|  BnaA01g13400D                                          251   1e-74   Brassica napus [oilseed rape]
ref|XP_010053173.1|  PREDICTED: probable inactive receptor kinase...    250   1e-74   Eucalyptus grandis [rose gum]
ref|XP_009409433.1|  PREDICTED: probable inactive receptor kinase...    250   1e-74   
ref|XP_010448663.1|  PREDICTED: probable inactive receptor kinase...    249   1e-74   Camelina sativa [gold-of-pleasure]
ref|XP_010433865.1|  PREDICTED: probable inactive receptor kinase...    249   2e-74   Camelina sativa [gold-of-pleasure]
gb|KEH35437.1|  receptor-like kinase                                    241   2e-74   Medicago truncatula
ref|NP_194105.1|  Leucine-rich repeat protein kinase family protein     249   3e-74   Arabidopsis thaliana [mouse-ear cress]
gb|KJB52632.1|  hypothetical protein B456_008G271600                    248   5e-74   Gossypium raimondii
ref|XP_008234792.1|  PREDICTED: probable inactive receptor kinase...    248   8e-74   
ref|XP_007220432.1|  hypothetical protein PRUPE_ppa002831mg             247   9e-74   Prunus persica
emb|CDX94213.1|  BnaC07g38470D                                          247   1e-73   
ref|XP_002869766.1|  hypothetical protein ARALYDRAFT_914223             247   1e-73   Arabidopsis lyrata subsp. lyrata
emb|CDP05105.1|  unnamed protein product                                246   2e-73   Coffea canephora [robusta coffee]
gb|KHG27491.1|  hypothetical protein F383_14041                         246   2e-73   Gossypium arboreum [tree cotton]
ref|XP_010662595.1|  PREDICTED: probable inactive receptor kinase...    246   2e-73   Vitis vinifera
ref|XP_008793541.1|  PREDICTED: probable inactive receptor kinase...    246   3e-73   Phoenix dactylifera
ref|XP_011076041.1|  PREDICTED: probable inactive receptor kinase...    246   3e-73   Sesamum indicum [beniseed]
ref|XP_008793397.1|  PREDICTED: probable inactive receptor kinase...    246   4e-73   Phoenix dactylifera
ref|XP_006283316.1|  hypothetical protein CARUB_v10004355mg             244   1e-72   
gb|EPS60741.1|  hypothetical protein M569_14060                         243   1e-72   Genlisea aurea
emb|CBI22555.3|  unnamed protein product                                245   1e-72   Vitis vinifera
ref|XP_006350601.1|  PREDICTED: probable inactive receptor kinase...    244   1e-72   Solanum tuberosum [potatoes]
ref|XP_010925785.1|  PREDICTED: probable inactive receptor kinase...    244   2e-72   
ref|XP_006283317.1|  hypothetical protein CARUB_v10004355mg             244   2e-72   
ref|XP_008794990.1|  PREDICTED: probable inactive receptor kinase...    244   3e-72   Phoenix dactylifera
gb|KDO56147.1|  hypothetical protein CISIN_1g007167mg                   243   4e-72   Citrus sinensis [apfelsine]
gb|ACC91242.1|  leucine-rich repeat transmembrane protein kinase        243   5e-72   Arabidopsis halleri
ref|XP_006490586.1|  PREDICTED: probable inactive receptor kinase...    241   2e-71   Citrus sinensis [apfelsine]
gb|KHN09234.1|  Putative inactive receptor kinase                       234   2e-71   Glycine soja [wild soybean]
ref|XP_010059849.1|  PREDICTED: probable inactive receptor kinase...    241   5e-71   Eucalyptus grandis [rose gum]
gb|KHN23405.1|  Putative inactive receptor kinase                       240   5e-71   Glycine soja [wild soybean]
ref|XP_008376682.1|  PREDICTED: probable inactive receptor kinase...    239   7e-71   Malus domestica [apple tree]
ref|XP_009413825.1|  PREDICTED: probable inactive receptor kinase...    239   1e-70   Musa acuminata subsp. malaccensis [pisang utan]
gb|AES72427.2|  LRR receptor-like kinase                                238   1e-70   Medicago truncatula
ref|XP_003526687.1|  PREDICTED: probable inactive receptor kinase...    239   2e-70   Glycine max [soybeans]
ref|XP_003522551.1|  PREDICTED: probable inactive receptor kinase...    239   2e-70   Glycine max [soybeans]
gb|KHN44239.1|  Putative inactive receptor kinase                       238   2e-70   Glycine soja [wild soybean]
ref|XP_006422104.1|  hypothetical protein CICLE_v10004549mg             238   3e-70   
ref|XP_009399835.1|  PREDICTED: probable inactive receptor kinase...    238   4e-70   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009399834.1|  PREDICTED: probable inactive receptor kinase...    238   5e-70   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010097875.1|  putative inactive receptor kinase                  237   7e-70   
ref|XP_008380496.1|  PREDICTED: probable inactive receptor kinase...    236   2e-69   
ref|XP_009375580.1|  PREDICTED: probable inactive receptor kinase...    235   3e-69   Pyrus x bretschneideri [bai li]
ref|XP_009352112.1|  PREDICTED: probable inactive receptor kinase...    235   3e-69   Pyrus x bretschneideri [bai li]
gb|EYU25187.1|  hypothetical protein MIMGU_mgv1a002923mg                235   4e-69   Erythranthe guttata [common monkey flower]
ref|XP_003602176.1|  Leucine-rich repeat receptor-like protein ki...    239   5e-69   
ref|XP_010445167.1|  PREDICTED: probable inactive receptor kinase...    235   2e-68   
ref|XP_004308019.1|  PREDICTED: probable inactive receptor kinase...    234   2e-68   Fragaria vesca subsp. vesca
gb|KHN08297.1|  Putative inactive receptor kinase                       233   2e-68   Glycine soja [wild soybean]
ref|XP_007137558.1|  hypothetical protein PHAVU_009G136800g             232   6e-68   Phaseolus vulgaris [French bean]
ref|XP_006596280.1|  PREDICTED: probable inactive receptor kinase...    230   2e-67   Glycine max [soybeans]
ref|XP_011084477.1|  PREDICTED: LOW QUALITY PROTEIN: probable ina...    229   6e-67   Sesamum indicum [beniseed]
ref|XP_010035197.1|  PREDICTED: probable inactive receptor kinase...    228   1e-66   Eucalyptus grandis [rose gum]
ref|XP_007141021.1|  hypothetical protein PHAVU_008G160700g             227   3e-66   Phaseolus vulgaris [French bean]
ref|XP_004145918.2|  PREDICTED: probable inactive receptor kinase...    224   9e-65   Cucumis sativus [cucumbers]
ref|XP_008437572.1|  PREDICTED: probable inactive receptor kinase...    223   2e-64   Cucumis melo [Oriental melon]
ref|XP_009357339.1|  PREDICTED: probable inactive receptor kinase...    223   2e-64   
ref|XP_009368693.1|  PREDICTED: probable inactive receptor kinase...    223   2e-64   Pyrus x bretschneideri [bai li]
ref|XP_004498388.1|  PREDICTED: probable inactive receptor kinase...    221   4e-64   Cicer arietinum [garbanzo]
ref|NP_001042446.1|  Os01g0223600                                       218   6e-64   
emb|CDY10964.1|  BnaA03g46230D                                          207   1e-63   Brassica napus [oilseed rape]
ref|XP_011651421.1|  PREDICTED: probable inactive receptor kinase...    220   2e-63   Cucumis sativus [cucumbers]
ref|XP_006645650.1|  PREDICTED: probable inactive receptor kinase...    220   2e-63   
emb|CBI34446.3|  unnamed protein product                                213   2e-63   Vitis vinifera
ref|XP_008439323.1|  PREDICTED: probable inactive receptor kinase...    219   5e-63   Cucumis melo [Oriental melon]
gb|KHN24722.1|  Putative inactive receptor kinase                       210   1e-62   Glycine soja [wild soybean]
gb|KEH40435.1|  LRR receptor-like kinase                                216   2e-62   Medicago truncatula
gb|EYU36892.1|  hypothetical protein MIMGU_mgv1a0177021mg               206   2e-62   Erythranthe guttata [common monkey flower]
gb|EMT08914.1|  Putative inactive receptor kinase                       213   3e-62   
dbj|BAA94519.1|  putative receptor-like kinase                          217   3e-62   Oryza sativa Japonica Group [Japonica rice]
gb|KHN40997.1|  Putative inactive receptor kinase                       203   7e-61   Glycine soja [wild soybean]
gb|KHN30614.1|  Putative inactive receptor kinase                       203   8e-61   Glycine soja [wild soybean]
gb|KEH34523.1|  LRR receptor-like kinase                                213   8e-61   Medicago truncatula
ref|XP_003600547.1|  Leucine-rich repeat receptor-like protein ki...    213   1e-60   
ref|XP_003565740.1|  PREDICTED: probable inactive receptor kinase...    213   1e-60   Brachypodium distachyon [annual false brome]
emb|CDP04037.1|  unnamed protein product                                203   1e-60   Coffea canephora [robusta coffee]
dbj|BAJ94608.1|  predicted protein                                      212   2e-60   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004500388.1|  PREDICTED: probable inactive receptor kinase...    212   2e-60   
ref|XP_002454913.1|  hypothetical protein SORBIDRAFT_03g001310          210   3e-60   
ref|XP_007146903.1|  hypothetical protein PHAVU_006G080200g             211   6e-60   Phaseolus vulgaris [French bean]
gb|EPS62971.1|  hypothetical protein M569_11816                         209   8e-60   Genlisea aurea
emb|CDP13882.1|  unnamed protein product                                210   1e-59   Coffea canephora [robusta coffee]
gb|KJB52637.1|  hypothetical protein B456_008G271600                    209   1e-59   Gossypium raimondii
ref|XP_003537367.2|  PREDICTED: probable inactive receptor kinase...    210   2e-59   
ref|XP_006591269.1|  PREDICTED: probable inactive receptor kinase...    210   2e-59   Glycine max [soybeans]
gb|KHN18649.1|  Putative inactive receptor kinase                       207   4e-59   Glycine soja [wild soybean]
ref|XP_002533837.1|  Nodulation receptor kinase precursor, putative     208   4e-59   
ref|XP_011084790.1|  PREDICTED: probable inactive receptor kinase...    208   5e-59   Sesamum indicum [beniseed]
ref|XP_006602052.1|  PREDICTED: probable inactive receptor kinase...    207   9e-59   Glycine max [soybeans]
ref|XP_003553192.2|  PREDICTED: probable inactive receptor kinase...    207   9e-59   Glycine max [soybeans]
ref|XP_006602050.1|  PREDICTED: probable inactive receptor kinase...    208   1e-58   Glycine max [soybeans]
ref|XP_006602049.1|  PREDICTED: probable inactive receptor kinase...    208   1e-58   Glycine max [soybeans]
ref|XP_012077868.1|  PREDICTED: probable inactive receptor kinase...    207   1e-58   Jatropha curcas
ref|XP_004967473.1|  PREDICTED: probable inactive receptor kinase...    207   2e-58   Setaria italica
ref|XP_007033487.1|  Leucine-rich repeat protein kinase family pr...    206   3e-58   
ref|XP_010094441.1|  putative inactive receptor kinase                  206   4e-58   Morus notabilis
ref|XP_007017100.1|  Leucine-rich repeat protein kinase family pr...    206   6e-58   
ref|XP_010252005.1|  PREDICTED: probable inactive receptor kinase...    206   7e-58   Nelumbo nucifera [Indian lotus]
gb|KDO54914.1|  hypothetical protein CISIN_1g005693mg                   205   7e-58   Citrus sinensis [apfelsine]
ref|XP_006432052.1|  hypothetical protein CICLE_v10000513mg             205   8e-58   Citrus clementina [clementine]
ref|XP_010541472.1|  PREDICTED: probable inactive receptor kinase...    204   1e-57   Tarenaya hassleriana [spider flower]
ref|XP_004294716.1|  PREDICTED: probable inactive receptor kinase...    204   1e-57   Fragaria vesca subsp. vesca
ref|XP_003519295.1|  PREDICTED: probable inactive receptor kinase...    204   1e-57   Glycine max [soybeans]
ref|XP_008384658.1|  PREDICTED: probable inactive receptor kinase...    204   1e-57   
ref|XP_009355011.1|  PREDICTED: probable inactive receptor kinase...    204   1e-57   
ref|XP_010541471.1|  PREDICTED: probable inactive receptor kinase...    204   1e-57   
gb|KDO54912.1|  hypothetical protein CISIN_1g005693mg                   205   1e-57   Citrus sinensis [apfelsine]
ref|XP_006432053.1|  hypothetical protein CICLE_v10000513mg             205   1e-57   Citrus clementina [clementine]
gb|KDO54913.1|  hypothetical protein CISIN_1g005693mg                   205   2e-57   Citrus sinensis [apfelsine]
ref|XP_003544939.1|  PREDICTED: probable inactive receptor kinase...    204   2e-57   
ref|XP_007208318.1|  hypothetical protein PRUPE_ppa002781mg             204   2e-57   
ref|XP_007142022.1|  hypothetical protein PHAVU_008G245900g             204   2e-57   Phaseolus vulgaris [French bean]
ref|XP_008239856.1|  PREDICTED: probable inactive receptor kinase...    204   2e-57   Prunus mume [ume]
ref|XP_010244554.1|  PREDICTED: probable inactive receptor kinase...    203   3e-57   Nelumbo nucifera [Indian lotus]
ref|XP_012091018.1|  PREDICTED: probable inactive receptor kinase...    203   3e-57   Jatropha curcas
gb|ERN04237.1|  hypothetical protein AMTR_s00077p00144570               192   4e-57   Amborella trichopoda
gb|KJB20517.1|  hypothetical protein B456_003G153000                    203   6e-57   Gossypium raimondii
ref|XP_008673506.1|  PREDICTED: probable inactive receptor kinase...    202   8e-57   Zea mays [maize]
ref|XP_008673504.1|  PREDICTED: probable inactive receptor kinase...    202   9e-57   Zea mays [maize]
gb|KHG05843.1|  hypothetical protein F383_32232                         202   9e-57   Gossypium arboreum [tree cotton]
ref|XP_009374410.1|  PREDICTED: probable inactive receptor kinase...    202   1e-56   Pyrus x bretschneideri [bai li]
ref|XP_010931391.1|  PREDICTED: probable inactive receptor kinase...    202   1e-56   Elaeis guineensis
ref|XP_011041763.1|  PREDICTED: probable inactive receptor kinase...    199   1e-56   Populus euphratica
ref|XP_009772876.1|  PREDICTED: probable inactive receptor kinase...    201   2e-56   Nicotiana sylvestris
gb|ACN57520.1|  At2g26730-like protein                                  190   2e-56   Capsella rubella
gb|ACN57533.1|  At2g26730-like protein                                  189   3e-56   Capsella grandiflora
ref|XP_009758202.1|  PREDICTED: probable inactive receptor kinase...    201   3e-56   Nicotiana sylvestris
ref|XP_009592168.1|  PREDICTED: probable inactive receptor kinase...    201   4e-56   Nicotiana tomentosiformis
gb|ACN57540.1|  At2g26730-like protein                                  189   4e-56   Capsella grandiflora
tpg|DAA52804.1|  TPA: putative leucine-rich repeat receptor-like ...    201   4e-56   
ref|XP_009590190.1|  PREDICTED: probable inactive receptor kinase...    200   4e-56   Nicotiana tomentosiformis
ref|XP_008456255.1|  PREDICTED: probable inactive receptor kinase...    200   5e-56   
ref|XP_011080640.1|  PREDICTED: probable inactive receptor kinase...    200   5e-56   Sesamum indicum [beniseed]
ref|XP_004139930.1|  PREDICTED: probable inactive receptor kinase...    199   8e-56   Cucumis sativus [cucumbers]
emb|CBI15804.3|  unnamed protein product                                199   8e-56   Vitis vinifera
gb|ACN57547.1|  At2g26730-like protein                                  188   9e-56   Capsella grandiflora
ref|XP_009607538.1|  PREDICTED: probable inactive receptor kinase...    200   9e-56   Nicotiana tomentosiformis
ref|XP_002276162.3|  PREDICTED: probable inactive receptor kinase...    199   9e-56   Vitis vinifera
ref|XP_003616055.1|  Leucine-rich repeat receptor-like protein ki...    199   1e-55   Medicago truncatula
gb|ACN30771.1|  unknown                                                 199   1e-55   Zea mays [maize]
ref|XP_011041759.1|  PREDICTED: probable inactive receptor kinase...    199   1e-55   Populus euphratica
ref|XP_002325632.1|  putative plant disease resistance family pro...    199   2e-55   Populus trichocarpa [western balsam poplar]
ref|NP_001168844.1|  uncharacterized LOC100382649 precursor             199   2e-55   Zea mays [maize]
ref|XP_009406050.1|  PREDICTED: probable inactive receptor kinase...    199   2e-55   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002319979.1|  putative plant disease resistance family pro...    198   3e-55   Populus trichocarpa [western balsam poplar]
ref|XP_002528709.1|  Nodulation receptor kinase precursor, putative     198   3e-55   Ricinus communis
gb|ABK93951.1|  unknown                                                 192   3e-55   Populus trichocarpa [western balsam poplar]
gb|ABR17070.1|  unknown                                                 191   3e-55   Picea sitchensis
ref|XP_011011771.1|  PREDICTED: probable inactive receptor kinase...    197   4e-55   Populus euphratica
ref|XP_004490727.1|  PREDICTED: probable inactive receptor kinase...    198   4e-55   Cicer arietinum [garbanzo]
ref|XP_011089538.1|  PREDICTED: probable inactive receptor kinase...    197   4e-55   
ref|XP_011089537.1|  PREDICTED: probable inactive receptor kinase...    197   4e-55   Sesamum indicum [beniseed]
gb|ACN57550.1|  At2g26730-like protein                                  186   4e-55   Capsella grandiflora
emb|CDP03386.1|  unnamed protein product                                198   5e-55   Coffea canephora [robusta coffee]
ref|XP_006356869.1|  PREDICTED: probable inactive receptor kinase...    197   5e-55   Solanum tuberosum [potatoes]
ref|XP_008803002.1|  PREDICTED: probable inactive receptor kinase...    197   5e-55   Phoenix dactylifera
ref|XP_009798129.1|  PREDICTED: probable inactive receptor kinase...    197   6e-55   Nicotiana sylvestris
ref|XP_006435961.1|  hypothetical protein CICLE_v10030941mg             197   6e-55   Citrus clementina [clementine]
ref|XP_006435960.1|  hypothetical protein CICLE_v10030941mg             197   6e-55   Citrus clementina [clementine]
ref|XP_010323112.1|  PREDICTED: probable inactive receptor kinase...    197   7e-55   
ref|XP_008355739.1|  PREDICTED: probable inactive receptor kinase...    197   8e-55   
gb|KDO67579.1|  hypothetical protein CISIN_1g006886mg                   196   9e-55   Citrus sinensis [apfelsine]
ref|XP_009760496.1|  PREDICTED: probable inactive receptor kinase...    197   9e-55   Nicotiana sylvestris
ref|XP_008788112.1|  PREDICTED: probable inactive receptor kinase...    196   1e-54   Phoenix dactylifera
ref|XP_009760490.1|  PREDICTED: probable inactive receptor kinase...    197   2e-54   Nicotiana sylvestris
emb|CDY02808.1|  BnaC02g10810D                                          191   2e-54   
ref|XP_004236305.1|  PREDICTED: probable inactive receptor kinase...    196   2e-54   Solanum lycopersicum
ref|XP_006280146.1|  hypothetical protein CARUB_v10026045mg             196   2e-54   
ref|XP_006358156.1|  PREDICTED: probable inactive receptor kinase...    196   2e-54   Solanum tuberosum [potatoes]
ref|XP_009410507.1|  PREDICTED: probable inactive receptor kinase...    195   3e-54   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDO64166.1|  hypothetical protein CISIN_1g006747mg                   195   3e-54   Citrus sinensis [apfelsine]
ref|XP_006429632.1|  hypothetical protein CICLE_v10011280mg             195   3e-54   Citrus clementina [clementine]
ref|XP_010999642.1|  PREDICTED: probable inactive receptor kinase...    195   3e-54   Populus euphratica
ref|XP_010922781.1|  PREDICTED: probable inactive receptor kinase...    195   4e-54   
ref|XP_010999638.1|  PREDICTED: probable inactive receptor kinase...    195   4e-54   Populus euphratica
ref|XP_010999639.1|  PREDICTED: probable inactive receptor kinase...    195   4e-54   Populus euphratica
ref|XP_002324958.1|  leucine-rich repeat transmembrane protein ki...    194   5e-54   
ref|XP_009386109.1|  PREDICTED: probable inactive receptor kinase...    194   5e-54   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010098027.1|  putative inactive receptor kinase                  195   5e-54   
ref|XP_004246956.1|  PREDICTED: probable inactive receptor kinase...    194   6e-54   Solanum lycopersicum
ref|XP_010483401.1|  PREDICTED: probable inactive receptor kinase...    194   6e-54   
ref|XP_006351444.1|  PREDICTED: probable inactive receptor kinase...    195   6e-54   Solanum tuberosum [potatoes]
ref|XP_011009200.1|  PREDICTED: probable inactive receptor kinase...    194   7e-54   Populus euphratica
ref|XP_010683445.1|  PREDICTED: probable inactive receptor kinase...    194   7e-54   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010683449.1|  PREDICTED: probable inactive receptor kinase...    194   8e-54   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009597502.1|  PREDICTED: probable inactive receptor kinase...    194   8e-54   Nicotiana tomentosiformis
ref|XP_009767272.1|  PREDICTED: probable inactive receptor kinase...    194   9e-54   Nicotiana sylvestris
ref|XP_009132067.1|  PREDICTED: probable inactive receptor kinase...    194   1e-53   Brassica rapa
emb|CDY58565.1|  BnaC03g12450D                                          194   1e-53   Brassica napus [oilseed rape]
ref|XP_006374053.1|  leucine-rich repeat transmembrane protein ki...    193   1e-53   
ref|XP_008463277.1|  PREDICTED: probable inactive receptor kinase...    193   1e-53   Cucumis melo [Oriental melon]
ref|XP_004235218.1|  PREDICTED: probable inactive receptor kinase...    193   1e-53   Solanum lycopersicum
gb|KJB29842.1|  hypothetical protein B456_005G120900                    193   2e-53   Gossypium raimondii
ref|XP_010453493.1|  PREDICTED: probable inactive receptor kinase...    193   2e-53   Camelina sativa [gold-of-pleasure]
ref|XP_010443551.1|  PREDICTED: probable inactive receptor kinase...    193   2e-53   Camelina sativa [gold-of-pleasure]
ref|XP_009370892.1|  PREDICTED: probable inactive receptor kinase...    193   2e-53   Pyrus x bretschneideri [bai li]
gb|KJB54134.1|  hypothetical protein B456_009G022300                    193   2e-53   Gossypium raimondii
ref|XP_004142674.1|  PREDICTED: probable inactive receptor kinase...    192   2e-53   Cucumis sativus [cucumbers]
ref|XP_010533192.1|  PREDICTED: probable inactive receptor kinase...    193   2e-53   Tarenaya hassleriana [spider flower]
ref|XP_010473057.1|  PREDICTED: probable inactive receptor kinase...    193   2e-53   Camelina sativa [gold-of-pleasure]
ref|XP_010417819.1|  PREDICTED: probable inactive receptor kinase...    193   3e-53   Camelina sativa [gold-of-pleasure]
ref|XP_011095165.1|  PREDICTED: probable inactive receptor kinase...    192   3e-53   Sesamum indicum [beniseed]
gb|KJB71491.1|  hypothetical protein B456_011G125200                    192   3e-53   Gossypium raimondii
ref|XP_009614171.1|  PREDICTED: probable inactive receptor kinase...    192   3e-53   Nicotiana tomentosiformis
ref|XP_002864562.1|  predicted protein                                  192   3e-53   Arabidopsis lyrata subsp. lyrata
ref|XP_007013302.1|  Leucine-rich repeat protein kinase family pr...    192   3e-53   
ref|XP_006371315.1|  putative plant disease resistance family pro...    192   4e-53   
ref|XP_006475765.1|  PREDICTED: probable inactive receptor kinase...    192   4e-53   Citrus sinensis [apfelsine]
gb|KHG17391.1|  hypothetical protein F383_22576                         192   4e-53   Gossypium arboreum [tree cotton]
ref|XP_011622690.1|  PREDICTED: probable inactive receptor kinase...    192   4e-53   Amborella trichopoda
ref|XP_007207849.1|  hypothetical protein PRUPE_ppa022997mg             192   4e-53   
ref|XP_010098956.1|  putative inactive receptor kinase                  192   4e-53   Morus notabilis
ref|XP_009782917.1|  PREDICTED: probable inactive receptor kinase...    192   5e-53   
ref|XP_006451034.1|  hypothetical protein CICLE_v10007694mg             192   5e-53   
ref|XP_010671535.1|  PREDICTED: probable inactive receptor kinase...    192   5e-53   
ref|XP_002281635.1|  PREDICTED: probable inactive receptor kinase...    192   5e-53   
ref|XP_006371316.1|  hypothetical protein POPTR_0019s09010g             192   6e-53   
ref|XP_008244615.1|  PREDICTED: probable inactive receptor kinase...    191   6e-53   
gb|KHG24076.1|  hypothetical protein F383_10304                         192   6e-53   
ref|XP_006293818.1|  hypothetical protein CARUB_v10022800mg             191   9e-53   
ref|XP_011001675.1|  PREDICTED: probable inactive receptor kinase...    191   9e-53   
ref|XP_002529343.1|  Nodulation receptor kinase precursor, putative     191   9e-53   
ref|XP_011001671.1|  PREDICTED: probable inactive receptor kinase...    191   9e-53   
ref|XP_006397367.1|  hypothetical protein EUTSA_v10022498mg             191   1e-52   
ref|XP_011001674.1|  PREDICTED: probable inactive receptor kinase...    191   1e-52   
ref|NP_180241.1|  leucine-rich repeat protein kinase family protein     191   1e-52   
gb|AAK92807.1|  putative receptor protein kinase                        191   1e-52   
ref|XP_010047774.1|  PREDICTED: probable inactive receptor kinase...    191   1e-52   
emb|CDY32713.1|  BnaA02g07750D                                          191   1e-52   
ref|XP_002879005.1|  hypothetical protein ARALYDRAFT_481544             191   1e-52   
emb|CDY48185.1|  BnaA04g15490D                                          191   1e-52   
ref|XP_004139332.1|  PREDICTED: probable inactive receptor kinase...    191   1e-52   
ref|XP_009103556.1|  PREDICTED: LOW QUALITY PROTEIN: probable ina...    191   2e-52   
ref|XP_009140749.1|  PREDICTED: probable inactive receptor kinase...    191   2e-52   
ref|NP_200638.1|  leucine-rich repeat protein kinase family protein     191   2e-52   
gb|KHG18372.1|  hypothetical protein F383_03411                         190   2e-52   
gb|KJB64834.1|  hypothetical protein B456_010G067400                    190   2e-52   
ref|XP_009384331.1|  PREDICTED: probable inactive receptor kinase...    190   2e-52   
ref|XP_002870624.1|  kinase family protein                              184   2e-52   
ref|XP_004302522.1|  PREDICTED: probable inactive receptor kinase...    190   2e-52   
ref|XP_008458016.1|  PREDICTED: probable inactive receptor kinase...    190   2e-52   
emb|CDX71488.1|  BnaC04g17230D                                          191   2e-52   
ref|XP_009374078.1|  PREDICTED: probable inactive receptor kinase...    189   3e-52   
ref|XP_009126766.1|  PREDICTED: probable inactive receptor kinase...    190   3e-52   
ref|XP_008244579.1|  PREDICTED: probable inactive receptor kinase...    190   3e-52   
ref|XP_004149854.1|  PREDICTED: probable inactive receptor kinase...    190   3e-52   
ref|XP_009607078.1|  PREDICTED: probable inactive receptor kinase...    189   3e-52   
ref|XP_008463343.1|  PREDICTED: probable inactive receptor kinase...    190   3e-52   
ref|XP_008242698.1|  PREDICTED: probable inactive receptor kinase...    190   3e-52   
ref|XP_010557581.1|  PREDICTED: probable inactive receptor kinase...    190   4e-52   
emb|CAN80590.1|  hypothetical protein VITISV_040789                     189   4e-52   
ref|XP_010688116.1|  PREDICTED: probable inactive receptor kinase...    189   4e-52   
ref|XP_007204237.1|  hypothetical protein PRUPE_ppa002548mg             189   5e-52   
ref|XP_010653700.1|  PREDICTED: probable inactive receptor kinase...    189   5e-52   
ref|XP_008386031.1|  PREDICTED: probable inactive receptor kinase...    189   6e-52   
ref|XP_008343962.1|  PREDICTED: probable inactive receptor kinase...    189   6e-52   
ref|XP_012078693.1|  PREDICTED: probable inactive receptor kinase...    189   7e-52   
ref|XP_010653698.1|  PREDICTED: probable inactive receptor kinase...    189   7e-52   
gb|ACZ98536.1|  protein kinase                                          189   7e-52   
ref|XP_009393622.1|  PREDICTED: probable inactive receptor kinase...    189   7e-52   
gb|ACA61611.1|  hypothetical protein AP2_E06.2                          189   7e-52   
ref|XP_004287382.1|  PREDICTED: probable inactive receptor kinase...    189   7e-52   
gb|KHF99691.1|  hypothetical protein F383_18108                         188   8e-52   
ref|XP_010670041.1|  PREDICTED: probable inactive receptor kinase...    188   9e-52   
ref|XP_009337799.1|  PREDICTED: probable inactive receptor kinase...    188   9e-52   
ref|XP_007011393.1|  Leucine-rich repeat protein kinase family pr...    188   9e-52   
emb|CDY54343.1|  BnaC03g14930D                                          188   9e-52   
ref|XP_007011392.1|  Leucine-rich repeat protein kinase family pr...    188   1e-51   
gb|AFK38063.1|  unknown                                                 176   1e-51   
ref|XP_009363779.1|  PREDICTED: probable inactive receptor kinase...    188   1e-51   
ref|XP_002865969.1|  hypothetical protein ARALYDRAFT_357577             187   1e-51   
gb|EPS74415.1|  hypothetical protein M569_00340                         187   2e-51   
ref|XP_006401105.1|  hypothetical protein EUTSA_v10012925mg             187   2e-51   
gb|KHN00038.1|  Putative inactive receptor kinase                       178   2e-51   
ref|XP_009371417.1|  PREDICTED: probable inactive receptor kinase...    187   2e-51   
gb|EEE55588.1|  hypothetical protein OsJ_03884                          179   2e-51   
gb|KHN37771.1|  Putative inactive receptor kinase                       180   2e-51   
emb|CDY04464.1|  BnaA07g12900D                                          187   2e-51   
gb|KJB67957.1|  hypothetical protein B456_010G219700                    187   3e-51   
ref|XP_006658137.1|  PREDICTED: probable inactive receptor kinase...    187   3e-51   
ref|XP_010043603.1|  PREDICTED: probable inactive receptor kinase...    187   3e-51   
gb|EAZ05160.1|  hypothetical protein OsI_27356                          187   3e-51   
gb|EAY91619.1|  hypothetical protein OsI_13254                          177   3e-51   
ref|XP_008234182.1|  PREDICTED: probable inactive receptor kinase...    186   3e-51   
ref|XP_011084098.1|  PREDICTED: probable inactive receptor kinase...    187   4e-51   
gb|KFK26952.1|  hypothetical protein AALP_AA8G314900                    184   5e-51   
ref|XP_004958707.1|  PREDICTED: probable inactive receptor kinase...    186   5e-51   
ref|XP_010031063.1|  PREDICTED: probable inactive receptor kinase...    186   5e-51   
gb|KCW50324.1|  hypothetical protein EUGRSUZ_J00100                     186   5e-51   
ref|NP_001051064.1|  Os03g0712400                                       177   5e-51   
emb|CDY47068.1|  BnaA03g12300D                                          186   5e-51   
ref|XP_006280204.1|  hypothetical protein CARUB_v10026109mg             186   6e-51   
ref|XP_003526789.1|  PREDICTED: probable inactive receptor kinase...    186   6e-51   
ref|NP_001060650.1|  Os07g0681100                                       186   6e-51   
ref|XP_008366817.1|  PREDICTED: probable inactive receptor kinase...    186   6e-51   
ref|XP_008388375.1|  PREDICTED: probable inactive receptor kinase...    186   6e-51   
ref|XP_009362770.1|  PREDICTED: probable inactive receptor kinase...    186   6e-51   
ref|XP_002463400.1|  hypothetical protein SORBIDRAFT_02g043090          186   7e-51   
ref|XP_010249925.1|  PREDICTED: probable inactive receptor kinase...    186   8e-51   
gb|KJB27114.1|  hypothetical protein B456_004G278900                    186   8e-51   
ref|XP_006579204.1|  PREDICTED: probable inactive receptor kinase...    182   9e-51   
gb|KJB07168.1|  hypothetical protein B456_001G003200                    185   1e-50   
dbj|BAE99195.1|  receptor protein kinase like protein                   185   1e-50   
ref|XP_010553544.1|  PREDICTED: probably inactive receptor-like p...    180   1e-50   
ref|NP_200144.1|  putative inactive receptor kinase                     185   1e-50   
ref|XP_007220535.1|  hypothetical protein PRUPE_ppa002812mg             185   1e-50   
gb|KFK32479.1|  hypothetical protein AALP_AA6G247800                    185   2e-50   
gb|EPS73425.1|  hypothetical protein M569_01324                         184   2e-50   
ref|XP_002960794.1|  hypothetical protein SELMODRAFT_74002              185   2e-50   
gb|KHN48152.1|  Putative inactive receptor kinase                       176   2e-50   
ref|NP_001169737.1|  uncharacterized LOC100383618 precursor             184   2e-50   
gb|EYU23030.1|  hypothetical protein MIMGU_mgv1a002522mg                184   3e-50   
gb|KHN40012.1|  Putative inactive receptor kinase                       174   3e-50   
ref|XP_010442890.1|  PREDICTED: probable inactive receptor kinase...    184   3e-50   
ref|XP_009132484.1|  PREDICTED: probable inactive receptor kinase...    183   4e-50   
ref|XP_010445702.1|  PREDICTED: probable inactive receptor kinase...    184   4e-50   
gb|KHN25793.1|  Putative inactive receptor kinase                       184   4e-50   
ref|XP_010482722.1|  PREDICTED: probable inactive receptor kinase...    183   5e-50   
ref|XP_004970381.1|  PREDICTED: probable inactive receptor kinase...    183   5e-50   
ref|XP_006284079.1|  hypothetical protein CARUB_v10005208mg             177   8e-50   
ref|XP_010109178.1|  putative inactive receptor kinase                  182   1e-49   
gb|EYU24506.1|  hypothetical protein MIMGU_mgv1a0087053mg               176   1e-49   
gb|EMT17815.1|  Putative inactive receptor kinase                       182   1e-49   
gb|EPS63924.1|  hypothetical protein M569_10855                         182   1e-49   
ref|XP_006587908.1|  PREDICTED: probable inactive receptor kinase...    182   1e-49   
gb|AEW08175.1|  hypothetical protein 2_2125_01                          171   1e-49   
gb|EEC75189.1|  hypothetical protein OsI_11426                          180   2e-49   
ref|XP_006650037.1|  PREDICTED: probable inactive receptor kinase...    182   2e-49   
ref|XP_008376328.1|  PREDICTED: probable inactive receptor kinase...    182   2e-49   
gb|EEE59802.1|  hypothetical protein OsJ_12326                          177   2e-49   
ref|NP_974867.1|  probably inactive receptor-like protein kinase        176   3e-49   
ref|XP_009362808.1|  PREDICTED: LOW QUALITY PROTEIN: probable ina...    180   3e-49   
ref|XP_004508557.1|  PREDICTED: probable inactive receptor kinase...    181   4e-49   
ref|XP_010543666.1|  PREDICTED: probable leucine-rich repeat rece...    181   4e-49   
ref|NP_198983.2|  probably inactive receptor-like protein kinase        176   5e-49   
ref|NP_001050019.1|  Os03g0332900                                       180   7e-49   
ref|XP_010254253.1|  PREDICTED: probable inactive receptor kinase...    181   7e-49   
gb|KHN35064.1|  Putative inactive receptor kinase                       179   7e-49   
ref|XP_010543665.1|  PREDICTED: probable leucine-rich repeat rece...    181   7e-49   
ref|XP_007154939.1|  hypothetical protein PHAVU_003G159700g             180   8e-49   
emb|CDX88667.1|  BnaA03g09820D                                          180   1e-48   
gb|EYU42048.1|  hypothetical protein MIMGU_mgv1a003031mg                179   1e-48   
ref|XP_003609204.1|  hypothetical protein MTR_4g113100                  180   1e-48   
ref|XP_006401720.1|  hypothetical protein EUTSA_v10013013mg             179   1e-48   
ref|XP_008381374.1|  PREDICTED: probable inactive receptor kinase...    171   1e-48   
dbj|BAB62593.1|  putative receptor-like protein kinase                  180   1e-48   
ref|XP_010322111.1|  PREDICTED: probable inactive receptor kinase...    179   2e-48   
ref|XP_003527143.1|  PREDICTED: probable inactive receptor kinase...    179   2e-48   
ref|XP_006357316.1|  PREDICTED: probable inactive receptor kinase...    179   2e-48   
ref|XP_004241083.1|  PREDICTED: probable inactive receptor kinase...    179   2e-48   
dbj|BAH57151.1|  AT3G08680                                              171   2e-48   
ref|XP_012091108.1|  PREDICTED: probable inactive receptor kinase...    179   2e-48   
gb|KEH35517.1|  receptor-like kinase                                    179   2e-48   
ref|XP_009395807.1|  PREDICTED: probable inactive receptor kinase...    179   3e-48   
gb|EYU35188.1|  hypothetical protein MIMGU_mgv1a002709mg                179   3e-48   
ref|XP_007140053.1|  hypothetical protein PHAVU_008G080500g             178   4e-48   
ref|XP_010938046.1|  PREDICTED: probable inactive receptor kinase...    178   4e-48   
ref|XP_006644911.1|  PREDICTED: probable inactive receptor kinase...    178   4e-48   
ref|XP_008813233.1|  PREDICTED: probable inactive receptor kinase...    178   4e-48   
ref|XP_002456542.1|  hypothetical protein SORBIDRAFT_03g038110          178   4e-48   
ref|XP_010921194.1|  PREDICTED: probable inactive receptor kinase...    173   4e-48   
ref|XP_004145847.1|  PREDICTED: probable inactive receptor kinase...    178   5e-48   
gb|EMT12910.1|  Putative inactive receptor kinase                       178   5e-48   
gb|KEH23299.1|  LRR receptor-like kinase                                178   5e-48   
ref|XP_006654545.1|  PREDICTED: probable inactive receptor kinase...    178   5e-48   
gb|KHN40609.1|  Putative inactive receptor kinase                       177   5e-48   
ref|XP_010938045.1|  PREDICTED: probable inactive receptor kinase...    178   6e-48   
gb|EYU30898.1|  hypothetical protein MIMGU_mgv1a003238mg                177   7e-48   
ref|XP_008457025.1|  PREDICTED: probable inactive receptor kinase...    177   7e-48   
ref|XP_003631134.1|  Atypical receptor-like kinase MARK                 178   7e-48   
gb|AET05610.2|  LRR receptor-like kinase                                178   7e-48   
ref|XP_006826909.1|  PREDICTED: probable inactive receptor kinase...    177   7e-48   
ref|XP_010271320.1|  PREDICTED: probable inactive receptor kinase...    178   7e-48   
ref|XP_003557981.1|  PREDICTED: probable inactive receptor kinase...    177   8e-48   
ref|XP_004502808.1|  PREDICTED: probable inactive receptor kinase...    177   8e-48   
ref|XP_004308997.1|  PREDICTED: probable inactive receptor kinase...    177   9e-48   
ref|XP_006602721.1|  PREDICTED: probable inactive receptor kinase...    177   1e-47   
ref|XP_004492584.1|  PREDICTED: probable inactive receptor kinase...    177   1e-47   
ref|XP_009112893.1|  PREDICTED: putative inactive receptor-like p...    172   1e-47   
gb|ACU19868.1|  unknown                                                 170   1e-47   
ref|NP_001168214.1|  uncharacterized protein LOC100381972               169   1e-47   
dbj|BAJ93317.1|  predicted protein                                      177   1e-47   
ref|XP_003518282.1|  PREDICTED: probable inactive receptor kinase...    177   2e-47   
gb|EMT09037.1|  Putative inactive receptor kinase                       176   2e-47   
dbj|BAK07296.1|  predicted protein                                      176   2e-47   
ref|XP_008388374.1|  PREDICTED: probable inactive receptor kinase...    176   2e-47   
ref|XP_009112815.1|  PREDICTED: putative inactive receptor-like p...    176   2e-47   
ref|XP_010447792.1|  PREDICTED: probably inactive receptor-like p...    171   3e-47   
ref|XP_003523287.1|  PREDICTED: probable inactive receptor kinase...    176   3e-47   
gb|KJB83149.1|  hypothetical protein B456_013G231600                    166   3e-47   
gb|AAK18840.1|AC082645_10  putative receptor kinase                     176   3e-47   
ref|XP_002972265.1|  hypothetical protein SELMODRAFT_267563             175   3e-47   
ref|XP_009391668.1|  PREDICTED: probable inactive receptor kinase...    176   3e-47   
ref|XP_010550530.1|  PREDICTED: inactive leucine-rich repeat rece...    176   4e-47   
emb|CDY35028.1|  BnaC06g13580D                                          167   4e-47   
ref|XP_003568238.1|  PREDICTED: probable inactive receptor kinase...    176   4e-47   
ref|XP_002984179.1|  hypothetical protein SELMODRAFT_156455             175   5e-47   
ref|XP_006651742.1|  PREDICTED: probable inactive receptor kinase...    175   6e-47   
ref|XP_008810158.1|  PREDICTED: probable inactive receptor kinase...    174   6e-47   
ref|XP_004137511.1|  PREDICTED: probable inactive receptor kinase...    175   6e-47   
ref|XP_008810859.1|  PREDICTED: probable inactive receptor kinase...    175   7e-47   
ref|XP_010436116.1|  PREDICTED: probably inactive receptor-like p...    169   8e-47   
ref|XP_008466324.1|  PREDICTED: probable inactive receptor kinase...    175   8e-47   
ref|XP_009122125.1|  PREDICTED: probable leucine-rich repeat rece...    174   8e-47   
ref|XP_004961732.1|  PREDICTED: probable inactive receptor kinase...    174   9e-47   
ref|XP_007136405.1|  hypothetical protein PHAVU_009G042300g             174   9e-47   
emb|CDX98821.1|  BnaC09g50140D                                          174   1e-46   
ref|XP_003564492.1|  PREDICTED: probable inactive receptor kinase...    174   1e-46   
ref|XP_008810858.1|  PREDICTED: probable inactive receptor kinase...    174   1e-46   
ref|XP_006289209.1|  hypothetical protein CARUB_v10002657mg             174   1e-46   
gb|KFK24939.1|  hypothetical protein AALP_AA8G045400                    174   1e-46   
gb|KHN10529.1|  Putative inactive receptor kinase                       172   1e-46   
emb|CDY34407.1|  BnaA09g11490D                                          169   1e-46   
ref|XP_003562443.1|  PREDICTED: probable inactive receptor kinase...    174   2e-46   
ref|NP_001130388.1|  uncharacterized LOC100191484 precursor             174   2e-46   
ref|XP_010555780.1|  PREDICTED: probable inactive receptor kinase...    173   2e-46   
gb|ACL52878.1|  unknown                                                 165   3e-46   
ref|XP_003544853.1|  PREDICTED: probable inactive receptor kinase...    173   3e-46   
ref|NP_196135.1|  putative leucine-rich repeat receptor-like prot...    173   3e-46   
ref|XP_009417661.1|  PREDICTED: probable inactive receptor kinase...    173   3e-46   
ref|XP_010441332.1|  PREDICTED: probably inactive receptor-like p...    168   3e-46   
ref|XP_010921193.1|  PREDICTED: probable inactive receptor kinase...    172   4e-46   
emb|CDY08366.1|  BnaC09g12300D                                          172   4e-46   
gb|KHN43642.1|  Putative inactive receptor kinase                       170   5e-46   
gb|KHN00136.1|  Putative inactive receptor kinase                       172   5e-46   
ref|XP_007141331.1|  hypothetical protein PHAVU_008G186900g             172   5e-46   
gb|EPS62777.1|  hypothetical protein M569_12011                         172   6e-46   
ref|XP_010268752.1|  PREDICTED: probable inactive receptor kinase...    172   6e-46   
ref|XP_006398978.1|  hypothetical protein EUTSA_v10012946mg             172   6e-46   
ref|XP_010463311.1|  PREDICTED: LOW QUALITY PROTEIN: probable ina...    172   6e-46   
ref|XP_008649769.1|  PREDICTED: probable inactive receptor kinase...    172   6e-46   
ref|XP_010916205.1|  PREDICTED: probable inactive receptor kinase...    172   7e-46   
gb|ACR38562.1|  unknown                                                 166   8e-46   



>ref|XP_012086772.1| PREDICTED: probable inactive receptor kinase At4g23740 [Jatropha 
curcas]
 gb|KDP25339.1| hypothetical protein JCGZ_20495 [Jatropha curcas]
Length=627

 Score =   286 bits (731),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 137/161 (85%), Positives = 148/161 (92%), Gaps = 1/161 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIKSSNIFLNS+ YGCVSD+GLSAIMS LAPP++RAAGYRAPEV DTRKAA PSDVYSF
Sbjct  451  GNIKSSNIFLNSRHYGCVSDLGLSAIMSQLAPPISRAAGYRAPEVTDTRKAAQPSDVYSF  510

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GV+LLELLTGKSP+HTT GDEIIHLVRWVHSVVREEWTAEVFDV+L++ P+IEEEMVEML
Sbjct  511  GVVLLELLTGKSPIHTTGGDEIIHLVRWVHSVVREEWTAEVFDVELMRFPNIEEEMVEML  570

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCEN  242
            QIALSCVVRMPDQRPKM +VVKMIE VRR D  ENR S EN
Sbjct  571  QIALSCVVRMPDQRPKMQDVVKMIENVRRVD-TENRPSSEN  610



>ref|XP_002509916.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF51303.1| ATP binding protein, putative [Ricinus communis]
Length=536

 Score =   280 bits (715),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 133/161 (83%), Positives = 147/161 (91%), Gaps = 1/161 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIKSSNIFLNS+QYGCVSD+GLS IMS LA P++RAAGYRAPEV DTRKA  P+DVYSF
Sbjct  359  GNIKSSNIFLNSRQYGCVSDLGLSTIMSPLAAPISRAAGYRAPEVTDTRKAGQPADVYSF  418

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GV+LLELLTGKSP+HTT GDEIIHLVRWVHSVVREEWTAEVFDV+L++ P+IEEEMVEML
Sbjct  419  GVVLLELLTGKSPIHTTGGDEIIHLVRWVHSVVREEWTAEVFDVELMRFPNIEEEMVEML  478

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCEN  242
            QIALSCVVR+PDQRPKMP+VVKMIE VRR D  +NR S EN
Sbjct  479  QIALSCVVRIPDQRPKMPDVVKMIESVRRID-TDNRPSSEN  518



>gb|KHN16761.1| Putative inactive receptor kinase [Glycine soja]
Length=369

 Score =   273 bits (699),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 132/169 (78%), Positives = 147/169 (87%), Gaps = 1/169 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIK SNIFLNSKQYGCVSD+GL+ I SSLA P++RAAGYRAPEV DTRKAA PSDVYSF
Sbjct  183  GNIKCSNIFLNSKQYGCVSDLGLATISSSLALPISRAAGYRAPEVTDTRKAAQPSDVYSF  242

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GV+LLELLTGKSP+HTT GDEIIHLVRWVHSVVREEWTAEVFD++L++ P+IEEEMVEML
Sbjct  243  GVVLLELLTGKSPIHTTGGDEIIHLVRWVHSVVREEWTAEVFDLELMRYPNIEEEMVEML  302

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASRLSPS  218
            QIA+SCVVRMPDQRPKM EVVKMIE VR+ D  +   S  N A +L  S
Sbjct  303  QIAMSCVVRMPDQRPKMSEVVKMIENVRQTD-AQTHSSSGNQAEQLKFS  350



>ref|XP_004511532.1| PREDICTED: probable inactive receptor kinase At4g23740-like isoform 
X2 [Cicer arietinum]
Length=356

 Score =   271 bits (692),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 129/173 (75%), Positives = 148/173 (86%), Gaps = 1/173 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GN+KSSNIFLN+KQYGCVSD+GL+ IMSS+  PV+RAAGYRAPEV DTRKA   SDVYSF
Sbjct  176  GNVKSSNIFLNTKQYGCVSDLGLATIMSSVTQPVSRAAGYRAPEVTDTRKATQASDVYSF  235

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GV+LLELLTGKSP+HTT GDEIIHLVRWVHSVVREEWTAEVFD++L++ P+IEEEMVEML
Sbjct  236  GVVLLELLTGKSPIHTTRGDEIIHLVRWVHSVVREEWTAEVFDLELMRCPNIEEEMVEML  295

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASRLSPSSIEQ  206
            QIA+SCVVRM DQRPKM E+V MIE VR+ D +ENR S EN A   +  +  Q
Sbjct  296  QIAMSCVVRMHDQRPKMSEIVSMIENVRQID-IENRPSSENQAESETQHTFSQ  347



>gb|KEH21182.1| LRR receptor-like kinase [Medicago truncatula]
Length=639

 Score =   277 bits (709),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 132/171 (77%), Positives = 152/171 (89%), Gaps = 1/171 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIKSSNIFLN+KQYGCVSD+GL+ I +SLA P++RAAGYRAPEV DTRKAA PSDVYSF
Sbjct  449  GNIKSSNIFLNTKQYGCVSDLGLATISTSLALPISRAAGYRAPEVTDTRKAAQPSDVYSF  508

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GV+LLELLTGKSP+HTT GDEIIHLVRWVHSVVREEWTAEVFD++L++ P+IEEEMVEML
Sbjct  509  GVVLLELLTGKSPIHTTGGDEIIHLVRWVHSVVREEWTAEVFDLELMRYPNIEEEMVEML  568

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCEN-GASRLSPSS  215
            QIA+SCVVRMPDQRPKM EVVKMIE VR+ D+ + + S EN G  +LS  +
Sbjct  569  QIAMSCVVRMPDQRPKMSEVVKMIENVRQIDNTQTQPSSENQGGVKLSSQT  619



>ref|XP_006343895.1| PREDICTED: probable inactive receptor kinase At4g23740-like [Solanum 
tuberosum]
Length=642

 Score =   277 bits (709),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 136/168 (81%), Positives = 147/168 (88%), Gaps = 1/168 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GN+KSSNIFLNSKQYGCVSDVGLS IMSSLA PVARAAG+RAPEV DTRKA  PSDVYSF
Sbjct  461  GNVKSSNIFLNSKQYGCVSDVGLSTIMSSLAHPVARAAGFRAPEVTDTRKATQPSDVYSF  520

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GVLLLELLTGKSP+HTT+GDE+IHLVRWVHSVVREEWTAEVFD++LL+ P+IEEEMVEML
Sbjct  521  GVLLLELLTGKSPIHTTNGDEVIHLVRWVHSVVREEWTAEVFDLQLLRYPNIEEEMVEML  580

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASRLSP  221
            QIA+SCVVRM DQRPKM EVVKMIE VR    LEN  S E  A   +P
Sbjct  581  QIAMSCVVRMSDQRPKMFEVVKMIENVRPTS-LENEHSSEGKAETSTP  627



>ref|XP_004245544.1| PREDICTED: probable inactive receptor kinase At4g23740 [Solanum 
lycopersicum]
Length=642

 Score =   277 bits (708),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 136/168 (81%), Positives = 148/168 (88%), Gaps = 1/168 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GN+KSSNIFLNSKQYGCVSDVGLS IMSSLA PVARAAG+RAPEV DTRKA  PSDVYSF
Sbjct  461  GNVKSSNIFLNSKQYGCVSDVGLSTIMSSLAHPVARAAGFRAPEVTDTRKATQPSDVYSF  520

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GVLLLELLTGKSP+HTT+GDE+IHLVRWVHSVVREEWTAEVFD++LL+ P+IEEEMVEML
Sbjct  521  GVLLLELLTGKSPIHTTNGDEVIHLVRWVHSVVREEWTAEVFDLELLRYPNIEEEMVEML  580

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASRLSP  221
            QIA+SCVVRM DQRPKM EVVKMIE VR    LEN+ S E  A   +P
Sbjct  581  QIAMSCVVRMSDQRPKMFEVVKMIENVRPTS-LENQLSSEGKAETSTP  627



>ref|XP_011080874.1| PREDICTED: probable inactive receptor kinase At4g23740 [Sesamum 
indicum]
Length=631

 Score =   275 bits (703),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 132/168 (79%), Positives = 148/168 (88%), Gaps = 2/168 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GN+KSSNIFLNS+Q+GCVSD+GLS IMSSLAPP+ARAAGYRAPEV DTRKA  PSDVYSF
Sbjct  458  GNVKSSNIFLNSRQFGCVSDLGLSTIMSSLAPPIARAAGYRAPEVTDTRKATQPSDVYSF  517

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GV+LLELLTGKSPVHTT+GDEI+HLVRWVHSVVREEWTAEVFDV+LL+ PDIEEE+VEML
Sbjct  518  GVILLELLTGKSPVHTTNGDEIVHLVRWVHSVVREEWTAEVFDVELLRYPDIEEELVEML  577

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASRLSP  221
            QIA++CVVRM DQRPKM EVVKMIE VR  +   NR S E  +   +P
Sbjct  578  QIAMACVVRMSDQRPKMSEVVKMIENVRLAE--TNRTSSEVKSENSTP  623



>ref|XP_008239079.1| PREDICTED: probable inactive receptor kinase At4g23740 [Prunus 
mume]
 ref|XP_008239080.1| PREDICTED: probable inactive receptor kinase At4g23740 [Prunus 
mume]
Length=629

 Score =   275 bits (703),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 129/168 (77%), Positives = 151/168 (90%), Gaps = 1/168 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GN+K+SNIF+NS+QYGCVSDVGL+ IMSSLAPP++RAAGYRAPEV DTRKA   +DVYSF
Sbjct  451  GNVKASNIFVNSQQYGCVSDVGLATIMSSLAPPISRAAGYRAPEVTDTRKAGQAADVYSF  510

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GV+LLELLTGKSP+HTT+GDEI+HLVRWVHSVVREEWTAEVFD++L++  +IEEEMVEML
Sbjct  511  GVVLLELLTGKSPIHTTAGDEIVHLVRWVHSVVREEWTAEVFDIELMRYLNIEEEMVEML  570

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASRLSP  221
            QIA+SCVVRMPDQRPKM +VVKMIE VRRND+ ENR S  N +   +P
Sbjct  571  QIAMSCVVRMPDQRPKMLDVVKMIESVRRNDN-ENRPSSGNRSESSTP  617



>ref|XP_007040424.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma 
cacao]
 ref|XP_007040425.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma 
cacao]
 ref|XP_007040426.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY24925.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY24926.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY24927.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma 
cacao]
Length=626

 Score =   274 bits (701),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 130/168 (77%), Positives = 149/168 (89%), Gaps = 1/168 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIKSSNIFLNS+QYGCVSD+GLS IMS LAPP++RAAGYRAPEV DTRKA  PSDVYSF
Sbjct  451  GNIKSSNIFLNSEQYGCVSDLGLSTIMSPLAPPISRAAGYRAPEVTDTRKAMQPSDVYSF  510

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GV+LLELLTGKSP+HTT GDEI+HLVRWVHSVVREEWTAEVFD++L++ P+IEEEMVEML
Sbjct  511  GVVLLELLTGKSPIHTTGGDEIVHLVRWVHSVVREEWTAEVFDIELMRYPNIEEEMVEML  570

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASRLSP  221
            QIA++CVVRMPDQRPKMPE+VKM+E VR  +  ENR S  N +   +P
Sbjct  571  QIAMTCVVRMPDQRPKMPELVKMLENVRHIES-ENRPSSGNRSESSTP  617



>ref|XP_009629119.1| PREDICTED: probable inactive receptor kinase At4g23740 [Nicotiana 
tomentosiformis]
Length=648

 Score =   275 bits (702),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 134/168 (80%), Positives = 148/168 (88%), Gaps = 1/168 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GN+KSSNIFLNSKQYGCVSDVGLS+IMSSLA PVARAAG+RAPE+ DTRKA  PSDVYSF
Sbjct  468  GNVKSSNIFLNSKQYGCVSDVGLSSIMSSLAHPVARAAGFRAPEITDTRKATQPSDVYSF  527

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GVLLLELLTGKSP+HTT+GDEIIHLVRWVHSVVREEWTAEVFD++LL+ P+IEEEMVEML
Sbjct  528  GVLLLELLTGKSPIHTTNGDEIIHLVRWVHSVVREEWTAEVFDLELLRYPNIEEEMVEML  587

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASRLSP  221
            QIA+SCVVRM DQRPKM EVVKMIE VR    L+N+ S E      +P
Sbjct  588  QIAMSCVVRMADQRPKMSEVVKMIENVRPTG-LDNQLSSEGKTENSTP  634



>ref|XP_009799943.1| PREDICTED: probable inactive receptor kinase At4g23740 [Nicotiana 
sylvestris]
Length=649

 Score =   275 bits (702),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 135/168 (80%), Positives = 148/168 (88%), Gaps = 1/168 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GN+KSSNIFLNSKQYGCVSDVGLS+IMSSLA PVARAAG+RAPE+ DTRKA  PSDVYS+
Sbjct  469  GNVKSSNIFLNSKQYGCVSDVGLSSIMSSLAHPVARAAGFRAPEITDTRKATQPSDVYSY  528

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GVLLLELLTGKSPVHTT+GDEIIHLVRWVHSVVREEWTAEVFD++LL+ P+IEEEMVEML
Sbjct  529  GVLLLELLTGKSPVHTTNGDEIIHLVRWVHSVVREEWTAEVFDLELLRYPNIEEEMVEML  588

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASRLSP  221
            QIA+SCVVRM DQRPKM EVVKMIE VR    LEN+ S E      +P
Sbjct  589  QIAMSCVVRMADQRPKMSEVVKMIENVRPTG-LENQFSSEGRTENSTP  635



>ref|XP_010104998.1| putative inactive receptor kinase [Morus notabilis]
 gb|EXC02955.1| putative inactive receptor kinase [Morus notabilis]
Length=646

 Score =   274 bits (701),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 125/152 (82%), Positives = 145/152 (95%), Gaps = 0/152 (0%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIK+SNIFLNS+Q+GCVSDVGL++IMSSLAPP++RAAGYRAPEV DTRKAA PSD+YSF
Sbjct  466  GNIKASNIFLNSRQFGCVSDVGLASIMSSLAPPISRAAGYRAPEVTDTRKAAQPSDIYSF  525

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GV+LLELLTGKSP+HTT+GDEIIHLVRWVHSVVREEWT EVFD++L++ P+IEEEMVEML
Sbjct  526  GVVLLELLTGKSPIHTTAGDEIIHLVRWVHSVVREEWTDEVFDIELMRYPNIEEEMVEML  585

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDH  269
            QIA++CVVRMPDQRPKM +VVKMIE VRR D+
Sbjct  586  QIAMACVVRMPDQRPKMSDVVKMIENVRRIDN  617



>ref|XP_007210296.1| hypothetical protein PRUPE_ppa002579mg [Prunus persica]
 gb|EMJ11495.1| hypothetical protein PRUPE_ppa002579mg [Prunus persica]
Length=656

 Score =   274 bits (700),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 129/168 (77%), Positives = 151/168 (90%), Gaps = 1/168 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GN+K+SNIF+NS+QYGCVSDVGL+ IMSSLAPP++RAAGYRAPEV DTRKA   +DVYSF
Sbjct  478  GNVKASNIFVNSQQYGCVSDVGLATIMSSLAPPISRAAGYRAPEVTDTRKAGQAADVYSF  537

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GV+LLELLTGKSP+HTT+GDEI+HLVRWVHSVVREEWTAEVFD++L++  +IEEEMVEML
Sbjct  538  GVVLLELLTGKSPIHTTAGDEIVHLVRWVHSVVREEWTAEVFDIELMRYLNIEEEMVEML  597

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASRLSP  221
            QIA+SCVVRMPDQRPKM +VVKMIE VRRND+ ENR S  N +   +P
Sbjct  598  QIAMSCVVRMPDQRPKMLDVVKMIESVRRNDN-ENRPSSGNRSESSTP  644



>ref|XP_002299495.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|EEE84300.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=626

 Score =   273 bits (697),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 130/168 (77%), Positives = 149/168 (89%), Gaps = 1/168 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIKSSNIFLNS+QYGCVSD+GL+ I S LAPP+ARAAGYRAPEV DTRKAA PSDVYSF
Sbjct  451  GNIKSSNIFLNSQQYGCVSDLGLATITSPLAPPIARAAGYRAPEVADTRKAAQPSDVYSF  510

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GV+LLELLTGKSP+HTT GDEIIHLVRWVHSVVREEWTAEVFDV+L++ P+IEEEMVEML
Sbjct  511  GVVLLELLTGKSPIHTTGGDEIIHLVRWVHSVVREEWTAEVFDVELMRYPNIEEEMVEML  570

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASRLSP  221
            QIA+SCV RMPD+RPKM +VV+MIE VR+ D  EN +S +N +   +P
Sbjct  571  QIAMSCVARMPDKRPKMTDVVRMIENVRQMD-TENHQSPQNRSESSTP  617



>ref|XP_006584744.1| PREDICTED: probable inactive receptor kinase At4g23740-like isoform 
X1 [Glycine max]
 ref|XP_006584745.1| PREDICTED: probable inactive receptor kinase At4g23740-like isoform 
X2 [Glycine max]
 ref|XP_006584746.1| PREDICTED: probable inactive receptor kinase At4g23740-like isoform 
X3 [Glycine max]
 ref|XP_006584747.1| PREDICTED: probable inactive receptor kinase At4g23740-like isoform 
X4 [Glycine max]
 ref|XP_006584748.1| PREDICTED: probable inactive receptor kinase At4g23740-like isoform 
X5 [Glycine max]
 ref|XP_006584749.1| PREDICTED: probable inactive receptor kinase At4g23740-like isoform 
X6 [Glycine max]
 ref|XP_006584750.1| PREDICTED: probable inactive receptor kinase At4g23740-like isoform 
X7 [Glycine max]
 ref|XP_006584751.1| PREDICTED: probable inactive receptor kinase At4g23740-like isoform 
X8 [Glycine max]
Length=638

 Score =   272 bits (695),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 131/166 (79%), Positives = 146/166 (88%), Gaps = 1/166 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIK SNIFLNSKQYGCVSD+GL+ I SSLA P++RAAGYRAPEV DTRKAA PSDVYSF
Sbjct  452  GNIKCSNIFLNSKQYGCVSDLGLATISSSLALPISRAAGYRAPEVTDTRKAAQPSDVYSF  511

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GV+LLELLTGKSP+HTT GDEIIHLVRWVHSVVREEWTAEVFD++L++ P+IEEEMVEML
Sbjct  512  GVVLLELLTGKSPIHTTGGDEIIHLVRWVHSVVREEWTAEVFDLELMRYPNIEEEMVEML  571

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASRL  227
            QIA+SCVVRMPDQRPKM EVVKMIE VR+ D  +   S  N A +L
Sbjct  572  QIAMSCVVRMPDQRPKMSEVVKMIENVRQTD-AQTHSSSGNQAEQL  616



>ref|XP_004300851.1| PREDICTED: probable inactive receptor kinase At4g23740 [Fragaria 
vesca subsp. vesca]
Length=635

 Score =   271 bits (694),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 126/168 (75%), Positives = 150/168 (89%), Gaps = 1/168 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GN+K+SNIFLN++QYGCVSD+GL+ IMSSLA P++RA+GYRAPEV DTRKAA P+DVYSF
Sbjct  450  GNVKASNIFLNTQQYGCVSDIGLTTIMSSLAAPISRASGYRAPEVTDTRKAAQPADVYSF  509

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GV+LLELLTGKSP+HTT+GDEI+HLVRWVHSVVREEWTAEVFD++L++ P IEEEMVEML
Sbjct  510  GVMLLELLTGKSPIHTTAGDEIVHLVRWVHSVVREEWTAEVFDLELMRYPGIEEEMVEML  569

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASRLSP  221
            QIA+SCV RMPDQRPKM +VVKMIE VR  D+ +NR S EN +   +P
Sbjct  570  QIAMSCVARMPDQRPKMLDVVKMIENVRHMDN-DNRPSSENRSESSTP  616



>ref|XP_006580544.1| PREDICTED: probable inactive receptor kinase At4g23740-like isoform 
X1 [Glycine max]
 ref|XP_006580545.1| PREDICTED: probable inactive receptor kinase At4g23740-like isoform 
X2 [Glycine max]
 gb|KHM99924.1| Putative inactive receptor kinase [Glycine soja]
Length=615

 Score =   270 bits (691),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 127/151 (84%), Positives = 141/151 (93%), Gaps = 0/151 (0%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIKSSNIFLN+KQYGCVSD+GL+ I SSLA P++RAAGYRAPEV DTRKAA PSDVYSF
Sbjct  452  GNIKSSNIFLNTKQYGCVSDLGLATISSSLALPISRAAGYRAPEVTDTRKAAQPSDVYSF  511

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GV+LLELLTGKSP+HTT GDEIIHLVRWVHSVVREEWTAEVFD++L++ P+IEEEMVEML
Sbjct  512  GVVLLELLTGKSPIHTTGGDEIIHLVRWVHSVVREEWTAEVFDLELMRYPNIEEEMVEML  571

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRND  272
            QIA+SCVVRMPDQRPKM EVVKMIE VR+ D
Sbjct  572  QIAMSCVVRMPDQRPKMSEVVKMIENVRQID  602



>ref|XP_003611028.1| Probably inactive receptor-like protein kinase [Medicago truncatula]
 gb|AES93986.1| LRR receptor-like kinase [Medicago truncatula]
Length=610

 Score =   270 bits (690),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 127/173 (73%), Positives = 148/173 (86%), Gaps = 1/173 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GN+KSSNIFLN+KQYGCVSD+GL+ IMSS+  P++RA+GYRAPEV DTRKA  PSDVYSF
Sbjct  426  GNVKSSNIFLNTKQYGCVSDLGLATIMSSVVQPISRASGYRAPEVTDTRKATQPSDVYSF  485

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GV+LLELLTGKSP+HTT GDEI+HLVRWVHSVVREEWTAEVFD++L++ P+IEEEMVEML
Sbjct  486  GVVLLELLTGKSPIHTTRGDEIVHLVRWVHSVVREEWTAEVFDLELMRCPNIEEEMVEML  545

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASRLSPSSIEQ  206
            QIA+SC  RMPDQRP M E+VKMIE VR+ D +ENR S EN A   +   I Q
Sbjct  546  QIAMSCATRMPDQRPMMSEIVKMIENVRQLD-IENRPSSENQAESAAQHQISQ  597



>ref|XP_002303623.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|EEE78602.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=626

 Score =   270 bits (690),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 131/168 (78%), Positives = 147/168 (88%), Gaps = 1/168 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIKSSNIFLNS+ YGCVSD+GL  I SSLAPP+ARAAGYRAPEV DTRKAA PSD+YSF
Sbjct  451  GNIKSSNIFLNSRCYGCVSDLGLVTITSSLAPPIARAAGYRAPEVADTRKAAQPSDIYSF  510

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GV+LLELLTGKSP+HTT  DEIIHLVRWVHSVVREEWTAEVFDV+L++ P+IEEEMVEML
Sbjct  511  GVVLLELLTGKSPIHTTGSDEIIHLVRWVHSVVREEWTAEVFDVELMRYPNIEEEMVEML  570

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASRLSP  221
            QIA+SCVVRMPDQRPKM EVVKMIE VR+ D  EN +  E+ +   +P
Sbjct  571  QIAMSCVVRMPDQRPKMTEVVKMIENVRQID-TENHQPSESRSESSTP  617



>ref|XP_006439412.1| hypothetical protein CICLE_v10019314mg [Citrus clementina]
 gb|ESR52652.1| hypothetical protein CICLE_v10019314mg [Citrus clementina]
Length=625

 Score =   270 bits (690),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 128/168 (76%), Positives = 148/168 (88%), Gaps = 1/168 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIKSSNIFLNS+QYGCVSD+GL+ I S+LAP +ARAAGYRAPEV D+RKA   SDVYSF
Sbjct  451  GNIKSSNIFLNSQQYGCVSDLGLTTITSALAPVIARAAGYRAPEVTDSRKATQASDVYSF  510

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GV+LLE+LTGKSP+HTT GDE++HLVRWVHSVVREEWTAEVFDV+LL+ P+IEEEMVEML
Sbjct  511  GVVLLEILTGKSPIHTTGGDELVHLVRWVHSVVREEWTAEVFDVELLRYPNIEEEMVEML  570

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASRLSP  221
            QIA+SCVVRMPDQRPKMP+VV++IE VR ND  ENR S  N +   +P
Sbjct  571  QIAMSCVVRMPDQRPKMPDVVRVIENVRPNDS-ENRPSSGNKSESSTP  617



>gb|KDO76442.1| hypothetical protein CISIN_1g006922mg [Citrus sinensis]
Length=625

 Score =   270 bits (689),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 128/168 (76%), Positives = 148/168 (88%), Gaps = 1/168 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIKSSNIFLNS+QYGCVSD+GL+ I S+LAP +ARAAGYRAPEV D+RKA   SDVYSF
Sbjct  451  GNIKSSNIFLNSQQYGCVSDLGLTTITSALAPVIARAAGYRAPEVTDSRKATQASDVYSF  510

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GV+LLE+LTGKSP+HTT GDE++HLVRWVHSVVREEWTAEVFDV+LL+ P+IEEEMVEML
Sbjct  511  GVVLLEILTGKSPIHTTGGDELVHLVRWVHSVVREEWTAEVFDVELLRYPNIEEEMVEML  570

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASRLSP  221
            QIA+SCVVRMPDQRPKMP+VV++IE VR ND  ENR S  N +   +P
Sbjct  571  QIAMSCVVRMPDQRPKMPDVVRVIENVRPNDS-ENRPSSGNKSESSTP  617



>ref|XP_004503646.1| PREDICTED: probable inactive receptor kinase At4g23740-like [Cicer 
arietinum]
Length=645

 Score =   270 bits (690),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 131/168 (78%), Positives = 148/168 (88%), Gaps = 1/168 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIKSSNIFLN+KQYGCVSD+GL+ I SSL  P++RAAGYRAPEV DTRKAA PSDVYSF
Sbjct  455  GNIKSSNIFLNTKQYGCVSDLGLATISSSLPLPISRAAGYRAPEVTDTRKAAQPSDVYSF  514

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GV+LLELLTGKSP+HTT GDEIIHLVRWVHSVVREEWTAEVFD++L++ P+IEEEMVEML
Sbjct  515  GVVLLELLTGKSPIHTTGGDEIIHLVRWVHSVVREEWTAEVFDLELMRFPNIEEEMVEML  574

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGAS-RLS  224
            QIA+SCVVRMPDQRPK+ EVVKMIE VR+ D    + S +N A  RLS
Sbjct  575  QIAMSCVVRMPDQRPKISEVVKMIENVRQIDAQTQQSSDQNQAGLRLS  622



>ref|XP_006476438.1| PREDICTED: probable inactive receptor kinase At4g23740-like [Citrus 
sinensis]
Length=625

 Score =   270 bits (689),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 128/168 (76%), Positives = 148/168 (88%), Gaps = 1/168 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIKSSNIFLNS+QYGCVSD+GL+ I S+LAP +ARAAGYRAPEV D+RKA   SDVYSF
Sbjct  451  GNIKSSNIFLNSQQYGCVSDLGLTTITSALAPVIARAAGYRAPEVTDSRKATQASDVYSF  510

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GV+LLE+LTGKSP+HTT GDE++HLVRWVHSVVREEWTAEVFDV+LL+ P+IEEEMVEML
Sbjct  511  GVVLLEILTGKSPIHTTGGDELVHLVRWVHSVVREEWTAEVFDVELLRYPNIEEEMVEML  570

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASRLSP  221
            QIA+SCVVRMPDQRPKMP+VV++IE VR ND  ENR S  N +   +P
Sbjct  571  QIAMSCVVRMPDQRPKMPDVVRVIENVRPNDS-ENRPSSGNKSESSTP  617



>ref|XP_004511531.1| PREDICTED: probable inactive receptor kinase At4g23740-like isoform 
X1 [Cicer arietinum]
Length=607

 Score =   269 bits (687),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 129/173 (75%), Positives = 148/173 (86%), Gaps = 1/173 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GN+KSSNIFLN+KQYGCVSD+GL+ IMSS+  PV+RAAGYRAPEV DTRKA   SDVYSF
Sbjct  427  GNVKSSNIFLNTKQYGCVSDLGLATIMSSVTQPVSRAAGYRAPEVTDTRKATQASDVYSF  486

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GV+LLELLTGKSP+HTT GDEIIHLVRWVHSVVREEWTAEVFD++L++ P+IEEEMVEML
Sbjct  487  GVVLLELLTGKSPIHTTRGDEIIHLVRWVHSVVREEWTAEVFDLELMRCPNIEEEMVEML  546

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASRLSPSSIEQ  206
            QIA+SCVVRM DQRPKM E+V MIE VR+ D +ENR S EN A   +  +  Q
Sbjct  547  QIAMSCVVRMHDQRPKMSEIVSMIENVRQID-IENRPSSENQAESETQHTFSQ  598



>gb|AFK45382.1| unknown [Medicago truncatula]
Length=610

 Score =   269 bits (687),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 126/173 (73%), Positives = 148/173 (86%), Gaps = 1/173 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GN+KSSNIFLN+KQYGCVSD+GL+ IMSS+  P++RA+GYRAPEV DTRKA  PSDVYSF
Sbjct  426  GNVKSSNIFLNTKQYGCVSDLGLATIMSSVVQPISRASGYRAPEVTDTRKATQPSDVYSF  485

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GV+LLELLTGKSP+HTT GDEI+HLVRWVHSVVREEWTAEVFD++L++ P+IEEEMVEML
Sbjct  486  GVVLLELLTGKSPIHTTRGDEIVHLVRWVHSVVREEWTAEVFDLELMRCPNIEEEMVEML  545

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASRLSPSSIEQ  206
            QIA+SC  RMPDQRP M E+VKMIE VR+ D +ENR + EN A   +   I Q
Sbjct  546  QIAMSCATRMPDQRPMMSEIVKMIENVRQLD-IENRPTSENQAESAAQHQISQ  597



>ref|XP_004143879.1| PREDICTED: probable inactive receptor kinase At4g23740 [Cucumis 
sativus]
 ref|XP_011654708.1| PREDICTED: probable inactive receptor kinase At4g23740 [Cucumis 
sativus]
 ref|XP_011654709.1| PREDICTED: probable inactive receptor kinase At4g23740 [Cucumis 
sativus]
 gb|KGN50039.1| hypothetical protein Csa_5G151550 [Cucumis sativus]
Length=628

 Score =   269 bits (688),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 128/176 (73%), Positives = 150/176 (85%), Gaps = 1/176 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GN+KSSNIFLNS+QYGCVSD+GL+ I SSL+PP++RAAGYRAPEV DTRKA   SDV+SF
Sbjct  451  GNVKSSNIFLNSQQYGCVSDLGLATITSSLSPPISRAAGYRAPEVTDTRKATQASDVFSF  510

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GV+LLELLTGKSP+H T G+EI+HLVRWVHSVVREEWTAEVFDV+L++ P+IEEEMVEML
Sbjct  511  GVVLLELLTGKSPIHATGGEEIVHLVRWVHSVVREEWTAEVFDVELMRYPNIEEEMVEML  570

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASRLSPSSIEQECS  197
            QIALSCV R+PDQRPKMPE+VKMIE VR  +  ENR S     S + P ++E E S
Sbjct  571  QIALSCVARIPDQRPKMPEIVKMIENVRPMEA-ENRPSTNQLESSMLPQAVETENS  625



>ref|XP_008437363.1| PREDICTED: probable inactive receptor kinase At4g23740 [Cucumis 
melo]
 ref|XP_008437364.1| PREDICTED: probable inactive receptor kinase At4g23740 [Cucumis 
melo]
 ref|XP_008437365.1| PREDICTED: probable inactive receptor kinase At4g23740 [Cucumis 
melo]
 ref|XP_008437367.1| PREDICTED: probable inactive receptor kinase At4g23740 [Cucumis 
melo]
Length=628

 Score =   269 bits (688),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 128/176 (73%), Positives = 150/176 (85%), Gaps = 1/176 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GN+KSSNIFLNS+QYGCVSD+GL+ I SSL+PP++RAAGYRAPEV DTRKA   SDV+SF
Sbjct  451  GNVKSSNIFLNSQQYGCVSDLGLATITSSLSPPISRAAGYRAPEVTDTRKATQASDVFSF  510

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GV+LLELLTGKSP+H T G+EI+HLVRWVHSVVREEWTAEVFDV+L++ P+IEEEMVEML
Sbjct  511  GVVLLELLTGKSPIHATGGEEIVHLVRWVHSVVREEWTAEVFDVELMRYPNIEEEMVEML  570

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASRLSPSSIEQECS  197
            QIALSCV R+PDQRPKMPE+VKMIE VR  +  ENR S     S + P ++E E S
Sbjct  571  QIALSCVARIPDQRPKMPEIVKMIENVRPMEA-ENRPSTNQLESSMLPQAVETENS  625



>ref|XP_009336254.1| PREDICTED: probable inactive receptor kinase At4g23740 [Pyrus 
x bretschneideri]
Length=654

 Score =   270 bits (689),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 125/168 (74%), Positives = 151/168 (90%), Gaps = 1/168 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GN+K+SNIF+N++QYGCVSDVGL+ IMSSLAPP++RAAGYRAPEV DTRK+  P+DVYSF
Sbjct  476  GNVKASNIFVNTQQYGCVSDVGLATIMSSLAPPISRAAGYRAPEVTDTRKSGQPADVYSF  535

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GV+LLELLTGKSP+HTT+GDEI+HLVRWVHSVVREEWTAEVFD++L++  +IEEEMVEML
Sbjct  536  GVVLLELLTGKSPIHTTAGDEIVHLVRWVHSVVREEWTAEVFDIELMRYLNIEEEMVEML  595

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASRLSP  221
            QIA+SCVVRMPDQRPKM +VVKMIE VR+ D+ +NR S  N +   +P
Sbjct  596  QIAMSCVVRMPDQRPKMLDVVKMIESVRQADN-DNRPSSGNRSESSTP  642



>ref|XP_011022559.1| PREDICTED: probable inactive receptor kinase At4g23740 [Populus 
euphratica]
Length=622

 Score =   268 bits (686),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 133/174 (76%), Positives = 150/174 (86%), Gaps = 3/174 (2%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIKSSNIFLNS+ YGCVSD+GL  I SSLAPP+ARAAGYRAPE+ DTRKAA PSD+YSF
Sbjct  451  GNIKSSNIFLNSQCYGCVSDLGLVTITSSLAPPIARAAGYRAPEIADTRKAAQPSDIYSF  510

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GV+LLELLTGKSP+HTT  DEIIHLVRWVHSVVREEWTAEVFDV+L++ P+IEEEMVEML
Sbjct  511  GVVLLELLTGKSPIHTTGSDEIIHLVRWVHSVVREEWTAEVFDVELMRYPNIEEEMVEML  570

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASRLSPSSIEQE  203
            QIA+SCVVRMPDQRPKM EVVKMIE VR+ D  EN +  E  +S   P  +E+E
Sbjct  571  QIAMSCVVRMPDQRPKMTEVVKMIENVRQIDP-ENHQPSE--SSTPPPLLVERE  621



>ref|XP_007160136.1| hypothetical protein PHAVU_002G295600g [Phaseolus vulgaris]
 gb|ESW32130.1| hypothetical protein PHAVU_002G295600g [Phaseolus vulgaris]
Length=637

 Score =   269 bits (687),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 132/166 (80%), Positives = 146/166 (88%), Gaps = 1/166 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIKSSNIFLNSKQYG VSD+GL+ I SSLA P++RAAGYRAPEV DTRKAA PSDVYSF
Sbjct  451  GNIKSSNIFLNSKQYGSVSDLGLATISSSLALPISRAAGYRAPEVTDTRKAAQPSDVYSF  510

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GV+LLELLTGKSP+HTT GDEIIHLVRWVHSVVREEWTAEVFD++L++ P+IEEEMVEML
Sbjct  511  GVVLLELLTGKSPIHTTGGDEIIHLVRWVHSVVREEWTAEVFDLELMRYPNIEEEMVEML  570

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASRL  227
            QIA+SCVVRMPDQRPKM EVVKMIE VR+ D  E   S  N A +L
Sbjct  571  QIAMSCVVRMPDQRPKMSEVVKMIENVRQIDG-EPYSSSGNQAEQL  615



>ref|XP_011026938.1| PREDICTED: probable inactive receptor kinase At4g23740 isoform 
X2 [Populus euphratica]
 ref|XP_011026939.1| PREDICTED: probable inactive receptor kinase At4g23740 isoform 
X2 [Populus euphratica]
Length=626

 Score =   268 bits (686),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 128/168 (76%), Positives = 147/168 (88%), Gaps = 1/168 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIKSSNIFLNS+QYGCVSD+GL+ I S L PP+ARAAGYRAPEV DTRKAA PSDVYSF
Sbjct  451  GNIKSSNIFLNSQQYGCVSDLGLATITSPLTPPIARAAGYRAPEVADTRKAAQPSDVYSF  510

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GV+LLELLTGKSP+HTT GDEIIHLVRWVHSVVREEWTAEVFDV+L++ P+IEEEMVEML
Sbjct  511  GVVLLELLTGKSPIHTTGGDEIIHLVRWVHSVVREEWTAEVFDVELMRYPNIEEEMVEML  570

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASRLSP  221
            QIA+SCV RMPD+RPKM +VV MIE VR+ D  EN ++ +N +   +P
Sbjct  571  QIAMSCVARMPDKRPKMTDVVIMIENVRQMD-TENHQTPQNRSESSTP  617



>gb|KJB19053.1| hypothetical protein B456_003G082600 [Gossypium raimondii]
 gb|KJB19054.1| hypothetical protein B456_003G082600 [Gossypium raimondii]
Length=630

 Score =   268 bits (686),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 127/168 (76%), Positives = 148/168 (88%), Gaps = 1/168 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIKSSNIF+NS+QYG VSD+GLS IM +LAPP++RAAGYRAPEV DTRKA  PSDVYSF
Sbjct  451  GNIKSSNIFVNSQQYGSVSDLGLSTIMGALAPPISRAAGYRAPEVTDTRKAMQPSDVYSF  510

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GV+LLELLTGKSP+HTT GDEIIHLVRWVHSVVREEWTAEVFD++L++ P+IEEEMVEML
Sbjct  511  GVVLLELLTGKSPIHTTGGDEIIHLVRWVHSVVREEWTAEVFDIELMRYPNIEEEMVEML  570

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASRLSP  221
            QIA++CVVRMPDQRPKM ++VKMIE VR  +  ENR+S  N +   +P
Sbjct  571  QIAMTCVVRMPDQRPKMADLVKMIENVRAIES-ENRQSSGNRSESSTP  617



>gb|KHN25658.1| Putative inactive receptor kinase [Glycine soja]
Length=425

 Score =   262 bits (670),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNI+SSNIFLNSKQYGCVSD+GL+ IMSS+A P++RAAGYRAPEV DTRKA  PSDVYSF
Sbjct  251  GNIRSSNIFLNSKQYGCVSDLGLATIMSSVAIPISRAAGYRAPEVTDTRKATQPSDVYSF  310

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GV+LLELLTGKSPV+TT  DEI+HLVRWVHSVVREEWTAEVFD++L++ P+IEEEMVEML
Sbjct  311  GVVLLELLTGKSPVYTTGSDEIVHLVRWVHSVVREEWTAEVFDLELIRYPNIEEEMVEML  370

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRS  251
            QIA+SCVVR+PDQRPKM E+VKMIE VR+ + + N+ S
Sbjct  371  QIAMSCVVRVPDQRPKMLELVKMIENVRQIEIVVNQPS  408



>ref|XP_011026937.1| PREDICTED: probable inactive receptor kinase At4g23740 isoform 
X1 [Populus euphratica]
Length=652

 Score =   268 bits (686),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 128/168 (76%), Positives = 147/168 (88%), Gaps = 1/168 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIKSSNIFLNS+QYGCVSD+GL+ I S L PP+ARAAGYRAPEV DTRKAA PSDVYSF
Sbjct  477  GNIKSSNIFLNSQQYGCVSDLGLATITSPLTPPIARAAGYRAPEVADTRKAAQPSDVYSF  536

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GV+LLELLTGKSP+HTT GDEIIHLVRWVHSVVREEWTAEVFDV+L++ P+IEEEMVEML
Sbjct  537  GVVLLELLTGKSPIHTTGGDEIIHLVRWVHSVVREEWTAEVFDVELMRYPNIEEEMVEML  596

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASRLSP  221
            QIA+SCV RMPD+RPKM +VV MIE VR+ D  EN ++ +N +   +P
Sbjct  597  QIAMSCVARMPDKRPKMTDVVIMIENVRQMD-TENHQTPQNRSESSTP  643



>ref|XP_008392458.1| PREDICTED: probable inactive receptor kinase At4g23740 [Malus 
domestica]
Length=629

 Score =   267 bits (682),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 125/171 (73%), Positives = 149/171 (87%), Gaps = 1/171 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GN+K+SNIF+N +QYGCVSDVGL+ I SSLAPP++RAAGYRAPEV DTRK+  P+DVYSF
Sbjct  451  GNVKASNIFVNMQQYGCVSDVGLATITSSLAPPISRAAGYRAPEVTDTRKSGQPADVYSF  510

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GV+LLELLTGKSP+HTT+GDEIIHLVRWVHSVVREEWTAEVFD++L++   IEEEMVEML
Sbjct  511  GVVLLELLTGKSPIHTTAGDEIIHLVRWVHSVVREEWTAEVFDLELMRYLYIEEEMVEML  570

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASRLSPSSI  212
            QIA+SCV RMPDQRPKM +V KMIE VRR D+ +NR S EN +   +P+ +
Sbjct  571  QIAMSCVARMPDQRPKMLDVAKMIENVRRADN-DNRTSSENRSESSTPAPV  620



>emb|CDP12117.1| unnamed protein product [Coffea canephora]
Length=635

 Score =   267 bits (682),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 129/170 (76%), Positives = 147/170 (86%), Gaps = 3/170 (2%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GN+KSSNIFLNS+QYGCVSD+GLS +MSSLA P+ARAAGYRAPEV+DTRKA   SDVYSF
Sbjct  456  GNVKSSNIFLNSRQYGCVSDLGLSTVMSSLALPIARAAGYRAPEVMDTRKATQSSDVYSF  515

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GV+LLELLTGKSP+HTTSGDEI+HLVRWVHSVVREEWTAEVFD++LL+ P+IEEE+VEML
Sbjct  516  GVMLLELLTGKSPIHTTSGDEIVHLVRWVHSVVREEWTAEVFDLELLRYPNIEEELVEML  575

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCE--NGASRLSP  221
            QIA++CVVRMPDQRPKM EV KMI  VR    + NR S E   G S  +P
Sbjct  576  QIAMACVVRMPDQRPKMSEVAKMIANVRPT-AIRNRSSGELKTGNSSQTP  624



>ref|XP_010658906.1| PREDICTED: probable inactive receptor kinase At4g23740 [Vitis 
vinifera]
 ref|XP_010658908.1| PREDICTED: probable inactive receptor kinase At4g23740 [Vitis 
vinifera]
 ref|XP_010658911.1| PREDICTED: probable inactive receptor kinase At4g23740 [Vitis 
vinifera]
 ref|XP_010658915.1| PREDICTED: probable inactive receptor kinase At4g23740 [Vitis 
vinifera]
Length=628

 Score =   266 bits (679),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 123/168 (73%), Positives = 146/168 (87%), Gaps = 1/168 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIKSSNIFLN++ YGCVSD+GL+ +MS LAPP++RAAGYRAPEV DTRKA+  SDVYSF
Sbjct  449  GNIKSSNIFLNARGYGCVSDLGLTTVMSPLAPPISRAAGYRAPEVTDTRKASQSSDVYSF  508

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GV+LLELLTGKSP+H T GDE+IHLVRWVHSVVREEWTAEVFDV+L++ P+IEEEMVEML
Sbjct  509  GVVLLELLTGKSPIHATGGDEVIHLVRWVHSVVREEWTAEVFDVELMRYPNIEEEMVEML  568

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASRLSP  221
            QIA+ CV+RMPDQRPKMP+VV++IE VR  D  +NR S E  +   +P
Sbjct  569  QIAMGCVIRMPDQRPKMPDVVRLIENVRHTD-TDNRSSFETRSEGSTP  615



>ref|XP_006590496.1| PREDICTED: probable inactive receptor kinase At4g23740-like [Glycine 
max]
Length=589

 Score =   263 bits (673),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNI+SSNIFLNSKQYGCVSD+GL+ IMSS+A P++RAAGYRAPEV DTRKA  PSDVYSF
Sbjct  415  GNIRSSNIFLNSKQYGCVSDLGLATIMSSVAIPISRAAGYRAPEVTDTRKATQPSDVYSF  474

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GV+LLELLTGKSPV+TT  DEI+HLVRWVHSVVREEWTAEVFD++L++ P+IEEEMVEML
Sbjct  475  GVVLLELLTGKSPVYTTGADEIVHLVRWVHSVVREEWTAEVFDLELIRYPNIEEEMVEML  534

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRS  251
            QIA+SCVVR+PDQRPKM E+VKMIE VR+ + + N+ S
Sbjct  535  QIAMSCVVRLPDQRPKMLELVKMIESVRQIEIVVNQPS  572



>ref|XP_010251541.1| PREDICTED: probable inactive receptor kinase At4g23740 [Nelumbo 
nucifera]
 ref|XP_010251542.1| PREDICTED: probable inactive receptor kinase At4g23740 [Nelumbo 
nucifera]
 ref|XP_010251543.1| PREDICTED: probable inactive receptor kinase At4g23740 [Nelumbo 
nucifera]
Length=636

 Score =   264 bits (675),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 123/169 (73%), Positives = 149/169 (88%), Gaps = 1/169 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIKSSNIFLNS+ YGCVSD+GL+A+MS +APP++RAAGYRAPEV+DTRKA   SDVYS+
Sbjct  451  GNIKSSNIFLNSQNYGCVSDLGLAALMSPVAPPISRAAGYRAPEVLDTRKATQASDVYSY  510

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GVLLLELLTGKSPVH T GDE++HLVRWVHSVVREEWTAEVFDV+L++ P+IEEEMV ML
Sbjct  511  GVLLLELLTGKSPVHATGGDEVVHLVRWVHSVVREEWTAEVFDVELMRYPNIEEEMVGML  570

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASRLSPS  218
            QIA++CVVRMP+QRPKMP+VVKM+E +RR D   +R+S E  +   +P+
Sbjct  571  QIAMACVVRMPEQRPKMPDVVKMLEDIRRLDT-GDRQSTETKSESSTPT  618



>ref|XP_009352353.1| PREDICTED: probable inactive receptor kinase At4g23740 [Pyrus 
x bretschneideri]
 ref|XP_009352354.1| PREDICTED: probable inactive receptor kinase At4g23740 [Pyrus 
x bretschneideri]
Length=629

 Score =   264 bits (675),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 124/168 (74%), Positives = 147/168 (88%), Gaps = 1/168 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GN+K+SNIF+N++QYGCVSDVGL+ I SSLAPP++RAAGYRAPEV DTRK+  P+DVYSF
Sbjct  451  GNVKASNIFVNTQQYGCVSDVGLATITSSLAPPISRAAGYRAPEVTDTRKSGQPADVYSF  510

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GV+LLELLTGKSP+HTT+GDEIIHLVRWVHSVVREEWTAEVFD++L++   IEEEMVEML
Sbjct  511  GVVLLELLTGKSPIHTTAGDEIIHLVRWVHSVVREEWTAEVFDLELMRYLYIEEEMVEML  570

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASRLSP  221
            QIA+SCV RMPDQRPKM +V KMIE VRR D+ +NR   EN +   +P
Sbjct  571  QIAMSCVARMPDQRPKMLDVAKMIENVRRADN-DNRPCSENRSESSTP  617



>emb|CDY03526.1| BnaC01g15560D [Brassica napus]
Length=256

 Score =   252 bits (644),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 123/170 (72%), Positives = 147/170 (86%), Gaps = 3/170 (2%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIKSSNIFLNS++ GCVSD+GL+A+MS+LAPP++R AGYRAPEV DTRK++  SDVYSF
Sbjct  82   GNIKSSNIFLNSERNGCVSDLGLTAVMSALAPPISRQAGYRAPEVTDTRKSSQLSDVYSF  141

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GV+LLELLTGKSP+HTT+GDEIIHLVRWVHSVVREEWTAEVFDV+LL+  +IEEEMVEML
Sbjct  142  GVVLLELLTGKSPIHTTAGDEIIHLVRWVHSVVREEWTAEVFDVELLRYTNIEEEMVEML  201

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGV-RRNDHL--ENRRSCENGASRLS  224
            QIA+SCVV+ PDQRPKM ++V++IE V  R   L  + +   ENGAS  S
Sbjct  202  QIAMSCVVKAPDQRPKMSDLVRLIESVGNRQASLGPDPKPKSENGASETS  251



>ref|XP_007158557.1| hypothetical protein PHAVU_002G162400g [Phaseolus vulgaris]
 gb|ESW30551.1| hypothetical protein PHAVU_002G162400g [Phaseolus vulgaris]
Length=590

 Score =   262 bits (669),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 125/164 (76%), Positives = 147/164 (90%), Gaps = 1/164 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNI+SSNIF+N+KQYGCVSD+GL+ IMSS+  P++RAAGYRAPEV DTRKA  P+DVYSF
Sbjct  413  GNIRSSNIFVNTKQYGCVSDLGLATIMSSVPIPISRAAGYRAPEVTDTRKATQPADVYSF  472

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GV+LLELLTGKSPV+TT GDEI+HLVRWVHSVVREEWTAEVFD++L++ P+IEEEMVEML
Sbjct  473  GVVLLELLTGKSPVYTTGGDEIVHLVRWVHSVVREEWTAEVFDLELIRYPNIEEEMVEML  532

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRR-SCENGA  236
            QIA+SCVVR PDQRPKM EVVKMIE VR+ D + N++ S EN A
Sbjct  533  QIAMSCVVRDPDQRPKMSEVVKMIENVRQIDTVVNQQASSENQA  576



>ref|XP_003516715.2| PREDICTED: probable inactive receptor kinase At4g23740-like [Glycine 
max]
Length=635

 Score =   262 bits (669),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNI+SSNIFLNSKQYGCVSD+GL+ IMSS+A P++RAAGYRAPEV DTRKA  PSDVYSF
Sbjct  461  GNIRSSNIFLNSKQYGCVSDLGLATIMSSVAIPISRAAGYRAPEVTDTRKATQPSDVYSF  520

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GV+LLELLTGKSPV+TT  DEI+HLVRWVHSVVREEWTAEVFD++L++ P+IEEEMVEML
Sbjct  521  GVVLLELLTGKSPVYTTGSDEIVHLVRWVHSVVREEWTAEVFDLELIRYPNIEEEMVEML  580

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRS  251
            QIA+SCVVR+PDQRPKM E+VKMIE VR+ + + N+ S
Sbjct  581  QIAMSCVVRVPDQRPKMLELVKMIENVRQIEIVVNQPS  618



>ref|XP_010538821.1| PREDICTED: probable inactive receptor kinase At4g23740 [Tarenaya 
hassleriana]
 ref|XP_010538822.1| PREDICTED: probable inactive receptor kinase At4g23740 [Tarenaya 
hassleriana]
Length=616

 Score =   260 bits (664),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 122/163 (75%), Positives = 142/163 (87%), Gaps = 0/163 (0%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIKSSNIFLNS+  GCVSD+GLSA+MS L PP++R AGYRAPEV DTRK++  SDVYSF
Sbjct  452  GNIKSSNIFLNSQLDGCVSDLGLSAVMSPLTPPISRQAGYRAPEVTDTRKSSQASDVYSF  511

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GV+LLELLTGKSP+HTT+GDEIIHLVRWVHSVVREEWTAEVFD++LLK PDIEEEMVEML
Sbjct  512  GVVLLELLTGKSPIHTTAGDEIIHLVRWVHSVVREEWTAEVFDIELLKYPDIEEEMVEML  571

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGA  236
            QIA+SCVVR+PDQRPKM ++V+++E VRR     +  S   GA
Sbjct  572  QIAMSCVVRVPDQRPKMSDLVRLLENVRRKPDRGSESSTPTGA  614



>ref|XP_011073578.1| PREDICTED: probable inactive receptor kinase At4g23740 [Sesamum 
indicum]
Length=631

 Score =   260 bits (665),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 119/148 (80%), Positives = 136/148 (92%), Gaps = 0/148 (0%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GN+KSSN+FLN  Q+GCVSD GLSA+MS+LA P+ARAAGYRAPEV DTRK+  PSDVYSF
Sbjct  458  GNVKSSNVFLNPHQFGCVSDPGLSAVMSALALPIARAAGYRAPEVTDTRKSTQPSDVYSF  517

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GV+LLELLTGKSP+H T+GDE+IHLVRWVHSVVREEWTAEVFDV+LL+ P+IEEE+VEML
Sbjct  518  GVILLELLTGKSPIHMTNGDEVIHLVRWVHSVVREEWTAEVFDVELLRYPNIEEELVEML  577

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVR  281
            QI +SCVVRMPDQRPKM EVVKM+E VR
Sbjct  578  QIGMSCVVRMPDQRPKMSEVVKMVENVR  605



>ref|XP_011001936.1| PREDICTED: probable inactive receptor kinase At4g23740 [Populus 
euphratica]
 ref|XP_011001938.1| PREDICTED: probable inactive receptor kinase At4g23740 [Populus 
euphratica]
Length=634

 Score =   260 bits (664),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 118/149 (79%), Positives = 138/149 (93%), Gaps = 0/149 (0%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIKSSNIFLNS+ YGCVSD+GL+++MS + PPV RAAGYRAPEV DTRKA H SDVYS+
Sbjct  451  GNIKSSNIFLNSQGYGCVSDIGLASLMSPMPPPVMRAAGYRAPEVTDTRKATHASDVYSY  510

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GVLLLELLTGKSP+HTT GDE++HLVRWV+SVVREEWTAEVFD++LL+ P+IEEEMVEML
Sbjct  511  GVLLLELLTGKSPMHTTGGDEVVHLVRWVNSVVREEWTAEVFDLELLRYPNIEEEMVEML  570

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRR  278
            QI LSCVVRMP+QRPKMP+VVKM+E +R+
Sbjct  571  QIGLSCVVRMPEQRPKMPDVVKMVEEIRQ  599



>ref|XP_011001931.1| PREDICTED: probable inactive receptor kinase At4g23740 [Populus 
euphratica]
 ref|XP_011001932.1| PREDICTED: probable inactive receptor kinase At4g23740 [Populus 
euphratica]
 ref|XP_011001933.1| PREDICTED: probable inactive receptor kinase At4g23740 [Populus 
euphratica]
Length=634

 Score =   260 bits (664),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 118/149 (79%), Positives = 138/149 (93%), Gaps = 0/149 (0%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIKSSNIFLNS+ YGCVSD+GL+++MS + PPV RAAGYRAPEV DTRKA H SDVYS+
Sbjct  451  GNIKSSNIFLNSQGYGCVSDIGLASLMSPMPPPVMRAAGYRAPEVTDTRKATHASDVYSY  510

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GVLLLELLTGKSP+HTT GDE++HLVRWV+SVVREEWTAEVFD++LL+ P+IEEEMVEML
Sbjct  511  GVLLLELLTGKSPMHTTGGDEVVHLVRWVNSVVREEWTAEVFDLELLRYPNIEEEMVEML  570

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRR  278
            QI LSCVVRMP+QRPKMP+VVKM+E +R+
Sbjct  571  QIGLSCVVRMPEQRPKMPDVVKMVEEIRQ  599



>ref|XP_009628885.1| PREDICTED: probable inactive receptor kinase At4g23740 [Nicotiana 
tomentosiformis]
 ref|XP_009628886.1| PREDICTED: probable inactive receptor kinase At4g23740 [Nicotiana 
tomentosiformis]
Length=625

 Score =   257 bits (657),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 123/172 (72%), Positives = 140/172 (81%), Gaps = 1/172 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIKSSNIFLNS  +GC+SD+GL+ IMS L PPV RAAGY+ PEV D+RK +  SDVYSF
Sbjct  447  GNIKSSNIFLNSHGFGCISDLGLATIMSPLVPPVMRAAGYQPPEVTDSRKVSQASDVYSF  506

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GVLLLELLTGKSP+H T  +E++HLVRWVHSVVREEWTAEVFDV+LLK P+IEEEMVEML
Sbjct  507  GVLLLELLTGKSPIHATGTNEVVHLVRWVHSVVREEWTAEVFDVELLKYPNIEEEMVEML  566

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASRLSPSSIE  209
            QI LSCV RMPDQRPKMP+VVKM+EGVRR +    R S E     L+P   E
Sbjct  567  QIGLSCVARMPDQRPKMPQVVKMVEGVRRVN-TGTRPSSEGSTPNLTPPMTE  617



>ref|XP_006374322.1| hypothetical protein POPTR_0015s06040g [Populus trichocarpa]
 gb|ERP52119.1| hypothetical protein POPTR_0015s06040g [Populus trichocarpa]
Length=634

 Score =   257 bits (656),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 115/149 (77%), Positives = 138/149 (93%), Gaps = 0/149 (0%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIKSSNIFLNS+ YGCVSD+GL+++MS + PP+ RAAGYRAPEV D+RKAAH SDVYS+
Sbjct  451  GNIKSSNIFLNSQGYGCVSDIGLASLMSPVPPPMMRAAGYRAPEVTDSRKAAHASDVYSY  510

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GVLLLELLTGKSP+H T GDE++HLVRWV+SVVREEWTAEVFD++LL+ P+IEEEMVEML
Sbjct  511  GVLLLELLTGKSPMHATGGDEVVHLVRWVNSVVREEWTAEVFDLELLRYPNIEEEMVEML  570

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRR  278
            QI ++CVVRMP+QRPKMP+VVKM+E +RR
Sbjct  571  QIGMACVVRMPEQRPKMPDVVKMVEEIRR  599



>gb|EYU23390.1| hypothetical protein MIMGU_mgv1a003016mg [Erythranthe guttata]
Length=615

 Score =   256 bits (654),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 120/150 (80%), Positives = 137/150 (91%), Gaps = 1/150 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIKSSN+FLNS+Q GC+SD+ LSAIMS+LAPPVARAAGYRAPEVVDTRKA  PSDVYSF
Sbjct  454  GNIKSSNVFLNSRQLGCISDIALSAIMSALAPPVARAAGYRAPEVVDTRKATQPSDVYSF  513

Query  544  GVLLLELLTGKSPVHT-TSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEM  368
            GV+LLELLTGKSPVHT   GDEI++LVRWVHSVVREEWTAEVFDV+LL+ P+IEEE+VEM
Sbjct  514  GVILLELLTGKSPVHTINGGDEIVNLVRWVHSVVREEWTAEVFDVELLRCPNIEEELVEM  573

Query  367  LQIALSCVVRMPDQRPKMPEVVKMIEGVRR  278
            LQIA+ CVVR  D+RPKM +V +MIEGVR+
Sbjct  574  LQIAMGCVVRAADRRPKMADVARMIEGVRK  603



>ref|XP_002317741.1| hypothetical protein POPTR_0012s01230g [Populus trichocarpa]
 gb|EEE95961.1| hypothetical protein POPTR_0012s01230g [Populus trichocarpa]
Length=633

 Score =   256 bits (655),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 116/149 (78%), Positives = 137/149 (92%), Gaps = 0/149 (0%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIKSSNIFLNS+ +GCVSD+GL+++MS + PPV RAAGYRAPEV DTRKA H SDVYS+
Sbjct  451  GNIKSSNIFLNSQGHGCVSDIGLASLMSPMPPPVMRAAGYRAPEVTDTRKATHASDVYSY  510

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GV LLELLTGKSP+HTT GDE++HLVRWV+SVVREEWTAEVFD++LL+ P+IEEEMVEML
Sbjct  511  GVFLLELLTGKSPMHTTGGDEVVHLVRWVNSVVREEWTAEVFDLELLRYPNIEEEMVEML  570

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRR  278
            QI LSCVVRMP+QRPKMP+VVKM+E +R+
Sbjct  571  QIGLSCVVRMPEQRPKMPDVVKMVEEIRQ  599



>ref|XP_012090129.1| PREDICTED: probable inactive receptor kinase At4g23740 [Jatropha 
curcas]
 gb|KDP22183.1| hypothetical protein JCGZ_26014 [Jatropha curcas]
Length=632

 Score =   255 bits (651),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 115/149 (77%), Positives = 135/149 (91%), Gaps = 0/149 (0%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIKSSNIFLNS+ YGC+SD+GL+ +MS +  PV RAAGYRAPEV D+RKA H SDVYSF
Sbjct  450  GNIKSSNIFLNSEGYGCISDMGLATLMSPMPAPVMRAAGYRAPEVTDSRKATHASDVYSF  509

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GVLLLELLTGKSP+H+  GDE++HLVRWVHSVVREEWTAEVFDV+LL+ P+IEEEMVEML
Sbjct  510  GVLLLELLTGKSPIHSAGGDEVVHLVRWVHSVVREEWTAEVFDVELLRYPNIEEEMVEML  569

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRR  278
            QI ++CVVRMP+QRPKMP+VVKM+E +RR
Sbjct  570  QIGMNCVVRMPEQRPKMPDVVKMVEEIRR  598



>ref|XP_009380537.1| PREDICTED: probable inactive receptor kinase At4g23740 [Musa 
acuminata subsp. malaccensis]
Length=639

 Score =   255 bits (652),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 118/152 (78%), Positives = 139/152 (91%), Gaps = 1/152 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIKSSN+FLN++QYGCVSD+GL +I++ + PPV+R+AGYRAPEVVDTRKA+  SD YSF
Sbjct  459  GNIKSSNVFLNNQQYGCVSDLGLPSIINPMVPPVSRSAGYRAPEVVDTRKASQASDAYSF  518

Query  544  GVLLLELLTGKSPVHTTSG-DEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEM  368
            GVLLLELLTGKSP+    G DE+IHLVRWVHSVVREEWTAEVFDV+L++ P+IEEEMVEM
Sbjct  519  GVLLLELLTGKSPIQIVGGGDEVIHLVRWVHSVVREEWTAEVFDVELMRYPNIEEEMVEM  578

Query  367  LQIALSCVVRMPDQRPKMPEVVKMIEGVRRND  272
            LQIA+SCVVRMPD+RPKMPEVV+MIEG+RR D
Sbjct  579  LQIAMSCVVRMPDRRPKMPEVVRMIEGMRRFD  610



>ref|XP_002513601.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF49004.1| ATP binding protein, putative [Ricinus communis]
Length=621

 Score =   254 bits (650),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 116/149 (78%), Positives = 134/149 (90%), Gaps = 0/149 (0%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIK+SNIFLNS+ YGC+SDVGL+ +MSS+ PPV RAAGYRAPEV DTRKA H SDVYSF
Sbjct  450  GNIKASNIFLNSEGYGCISDVGLATLMSSMPPPVMRAAGYRAPEVTDTRKATHASDVYSF  509

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GVLLLELLTGKSP H T GDE++HLVRWVHSVVREEWTAEVFDV+LL+ P+IEEEMVEML
Sbjct  510  GVLLLELLTGKSPTHATGGDEVVHLVRWVHSVVREEWTAEVFDVELLRYPNIEEEMVEML  569

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRR  278
            QI ++CV RMP+QRPKM +VV+M+E VR+
Sbjct  570  QIGMNCVTRMPEQRPKMLDVVRMVEEVRQ  598



>ref|XP_011007941.1| PREDICTED: probable inactive receptor kinase At4g23740 [Populus 
euphratica]
 ref|XP_011007942.1| PREDICTED: probable inactive receptor kinase At4g23740 [Populus 
euphratica]
Length=634

 Score =   255 bits (651),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 118/161 (73%), Positives = 143/161 (89%), Gaps = 1/161 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIKSSNIFLNS+ YGCVSD+GL+ +MS + PP+ RAAGYRAPEV D+RKAAH SDVYS+
Sbjct  451  GNIKSSNIFLNSQGYGCVSDIGLATLMSPVPPPMMRAAGYRAPEVTDSRKAAHASDVYSY  510

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GVLLLELLTGKSP+H T GDE++HLVRWV+SVVREEWTAEVFD++LL+ P+IEEEMVEML
Sbjct  511  GVLLLELLTGKSPMHATGGDEVVHLVRWVNSVVREEWTAEVFDLELLRYPNIEEEMVEML  570

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCEN  242
            QI ++CV+RMP+QRPKMP+VVKM+E +RR    E+R S E+
Sbjct  571  QIGMACVMRMPEQRPKMPDVVKMVEEIRRLS-TEDRPSTES  610



>ref|XP_009796898.1| PREDICTED: probable inactive receptor kinase At4g23740 [Nicotiana 
sylvestris]
 ref|XP_009796899.1| PREDICTED: probable inactive receptor kinase At4g23740 [Nicotiana 
sylvestris]
 ref|XP_009796900.1| PREDICTED: probable inactive receptor kinase At4g23740 [Nicotiana 
sylvestris]
Length=625

 Score =   254 bits (649),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 121/172 (70%), Positives = 140/172 (81%), Gaps = 1/172 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIKSSNIFLNS+ +GC+SD+GL+ IMS L PPV RAAGY+ PEV D+RK +  SDVYSF
Sbjct  447  GNIKSSNIFLNSQGFGCISDLGLATIMSPLVPPVMRAAGYQPPEVTDSRKVSQASDVYSF  506

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GVLLLELLTGKSP+H T  +E++HLVRWVHSVVREEWTAEVFDV+LLK P+IEEEMVEML
Sbjct  507  GVLLLELLTGKSPIHATGTNEVVHLVRWVHSVVREEWTAEVFDVELLKYPNIEEEMVEML  566

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASRLSPSSIE  209
            QI L+CV RMPDQRPKM +VVKM+EGVRR +    R S E     L+P   E
Sbjct  567  QIGLTCVARMPDQRPKMSQVVKMVEGVRRVN-TGTRPSSEGSTPNLTPPMTE  617



>ref|XP_010055829.1| PREDICTED: probable inactive receptor kinase At4g23740 [Eucalyptus 
grandis]
 ref|XP_010055830.1| PREDICTED: probable inactive receptor kinase At4g23740 [Eucalyptus 
grandis]
 ref|XP_010055831.1| PREDICTED: probable inactive receptor kinase At4g23740 [Eucalyptus 
grandis]
 ref|XP_010055832.1| PREDICTED: probable inactive receptor kinase At4g23740 [Eucalyptus 
grandis]
 gb|KCW72378.1| hypothetical protein EUGRSUZ_E00832 [Eucalyptus grandis]
 gb|KCW72379.1| hypothetical protein EUGRSUZ_E00832 [Eucalyptus grandis]
 gb|KCW72380.1| hypothetical protein EUGRSUZ_E00832 [Eucalyptus grandis]
Length=634

 Score =   254 bits (649),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 116/148 (78%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GN+KSSNI +N +QYGCVSD+GL+A+MSSLAPP++RAAGYRAPEV DTRKA  PSDVYSF
Sbjct  455  GNVKSSNILINPQQYGCVSDLGLAAVMSSLAPPISRAAGYRAPEVTDTRKAGQPSDVYSF  514

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GV+LLELLTGKSPVH T   E++HLVRWVHSVVREEWTAEVFDV+L++ P+IEEE+VEML
Sbjct  515  GVVLLELLTGKSPVHATGYGEMVHLVRWVHSVVREEWTAEVFDVELMRYPNIEEELVEML  574

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVR  281
            QIA++CVVRMPDQRPKM +V KMIE VR
Sbjct  575  QIAMACVVRMPDQRPKMADVAKMIENVR  602



>ref|XP_007038934.1| Leucine-rich repeat protein kinase family protein [Theobroma 
cacao]
 gb|EOY23435.1| Leucine-rich repeat protein kinase family protein [Theobroma 
cacao]
Length=630

 Score =   254 bits (649),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 115/149 (77%), Positives = 135/149 (91%), Gaps = 0/149 (0%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIK+SNIFLNS+ YGCVSD+GL+A+MS + PPV RAAGYRAPEV DTRKA   SDVYSF
Sbjct  447  GNIKASNIFLNSEGYGCVSDIGLAAVMSPMPPPVMRAAGYRAPEVADTRKATQASDVYSF  506

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GVLLLE+LTGKSP+H T G+EI+HLVRWVHSVVREEWTAEVFDV+LL+ P+IEEEMVEML
Sbjct  507  GVLLLEILTGKSPIHATGGEEIVHLVRWVHSVVREEWTAEVFDVELLRYPNIEEEMVEML  566

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRR  278
            QI +SCVVRMP+QRPKM ++V+M+E +RR
Sbjct  567  QIGMSCVVRMPEQRPKMSDLVRMVEEIRR  595



>ref|XP_010541406.1| PREDICTED: probable inactive receptor kinase At4g23740 [Tarenaya 
hassleriana]
Length=621

 Score =   253 bits (647),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 116/148 (78%), Positives = 137/148 (93%), Gaps = 0/148 (0%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIKSSNIFLNS+  GCVSD+GLSA+ S LAPP++R AGYRAPEV DTRK++  SDVYSF
Sbjct  456  GNIKSSNIFLNSQGSGCVSDLGLSAVTSPLAPPISRQAGYRAPEVTDTRKSSQASDVYSF  515

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GV+LLELLTGKSP+HTT+GDEIIHLVRWVHSVVREEWTAEVFD++LLK P+IEEEMVEML
Sbjct  516  GVVLLELLTGKSPIHTTAGDEIIHLVRWVHSVVREEWTAEVFDIELLKYPNIEEEMVEML  575

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVR  281
            Q+A+SCVVR+PD+RPKM ++V++IE VR
Sbjct  576  QLAMSCVVRIPDRRPKMSDLVRLIESVR  603



>ref|XP_009137388.1| PREDICTED: probable inactive receptor kinase At4g23740 [Brassica 
rapa]
Length=616

 Score =   253 bits (646),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 118/157 (75%), Positives = 142/157 (90%), Gaps = 1/157 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIKSSNIFLNS++YGCVSD+GL+A+MS+LAPP++R AGYRAPEV DTRK++  SDVYSF
Sbjct  446  GNIKSSNIFLNSERYGCVSDLGLTAVMSALAPPISRQAGYRAPEVTDTRKSSQLSDVYSF  505

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GV+LLELLTGKSP+HTT+GDEIIHLVRWVHSVVREEWTAEVFDV+LL+  +IEEEMVEML
Sbjct  506  GVVLLELLTGKSPIHTTAGDEIIHLVRWVHSVVREEWTAEVFDVELLRYTNIEEEMVEML  565

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGV-RRNDHLENR  257
            QIA+SCVV+ PDQRPKM ++V+++E V  R   LE +
Sbjct  566  QIAMSCVVKAPDQRPKMSDLVRLVESVGNRRASLETK  602



>ref|XP_006413522.1| hypothetical protein EUTSA_v10024674mg [Eutrema salsugineum]
 gb|ESQ54975.1| hypothetical protein EUTSA_v10024674mg [Eutrema salsugineum]
Length=630

 Score =   253 bits (645),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 122/172 (71%), Positives = 147/172 (85%), Gaps = 2/172 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIKSSNIFLNS++ GCVSD+GL+A+MS LAPP++R AGYRAPEV DTRK++  SDVYSF
Sbjct  456  GNIKSSNIFLNSERNGCVSDLGLTAVMSPLAPPISRQAGYRAPEVTDTRKSSQLSDVYSF  515

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GV+LLELLTGKSP+HTT+GDEIIHLVRWVHSVVREEWTAEVFD++LL+  +IEEEMVEML
Sbjct  516  GVVLLELLTGKSPIHTTAGDEIIHLVRWVHSVVREEWTAEVFDIELLRYTNIEEEMVEML  575

Query  364  QIALSCVVRMPDQRPKMPEVVKMIE--GVRRNDHLENRRSCENGASRLSPSS  215
            QIA+SCVV+ PDQRP+M ++V+++E  G RR   LE +   EN AS  S  S
Sbjct  576  QIAMSCVVKAPDQRPRMSDLVRLMENVGNRRAASLEPKPKSENEASETSTPS  627



>ref|XP_010676354.1| PREDICTED: probable inactive receptor kinase At4g23740 [Beta 
vulgaris subsp. vulgaris]
Length=617

 Score =   252 bits (643),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 114/148 (77%), Positives = 134/148 (91%), Gaps = 0/148 (0%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNI+SSNIFLNS +YGCVSD GL+++MS LAPP++RAAGYRAPEV DTRKA   SDVYSF
Sbjct  452  GNIRSSNIFLNSLKYGCVSDFGLASVMSPLAPPISRAAGYRAPEVTDTRKATQASDVYSF  511

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GV LLELLTGKSPVHTT GDE++HLVRWVHSVVREEWTAEVFD+++L+ P +EEEMVEML
Sbjct  512  GVFLLELLTGKSPVHTTGGDELVHLVRWVHSVVREEWTAEVFDLEILRFPHVEEEMVEML  571

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVR  281
            QIAL+CV R+ DQRP+MP+++KMIE VR
Sbjct  572  QIALTCVARVADQRPRMPDLLKMIEEVR  599



>ref|XP_004502606.1| PREDICTED: probable inactive receptor kinase At4g23740-like isoform 
X2 [Cicer arietinum]
Length=597

 Score =   250 bits (638),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 118/172 (69%), Positives = 140/172 (81%), Gaps = 3/172 (2%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIK+SNIFLNS+ YGCVSD+GL+ +MS +  P  RA GYRAPEV DTRKA H SDVYSF
Sbjct  427  GNIKASNIFLNSQGYGCVSDIGLATLMSPIPSPGTRATGYRAPEVTDTRKATHSSDVYSF  486

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GVLLLELLTGKSP++TT G++++ LVRWV+SVVREEWTAEVFDV+LLK P+IEEEMVEML
Sbjct  487  GVLLLELLTGKSPIYTTEGEQVVQLVRWVNSVVREEWTAEVFDVELLKYPNIEEEMVEML  546

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASRLSPSSIE  209
            QI ++C  RMPDQRPKM EVV+M+EG+RR    ENR S     S  S  +I+
Sbjct  547  QIGMACAARMPDQRPKMDEVVRMMEGIRRT---ENRPSSTESRSEASTPTID  595



>ref|XP_009137362.1| PREDICTED: probable inactive receptor kinase At4g23740 [Brassica 
rapa]
Length=628

 Score =   250 bits (639),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 123/170 (72%), Positives = 146/170 (86%), Gaps = 3/170 (2%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIKSSNIFLNS++ GCVSD+GL+A+MS+LAPP++R AGYRAPEV DTRK++  SDVYSF
Sbjct  454  GNIKSSNIFLNSERNGCVSDLGLTAVMSALAPPISRQAGYRAPEVTDTRKSSQLSDVYSF  513

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GV+LLELLTGKSP+HTT+GDEIIHLVRWVHSVVREEWTAEVFDV+LL+  +IEEEMVEML
Sbjct  514  GVVLLELLTGKSPIHTTAGDEIIHLVRWVHSVVREEWTAEVFDVELLRYTNIEEEMVEML  573

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGV-RRNDHL--ENRRSCENGASRLS  224
            QIA+SCVV+ PDQRPKM ++V++IE V  R   L  E +   EN AS  S
Sbjct  574  QIAMSCVVKAPDQRPKMSDLVRLIESVGNRQASLGPEPKPKSENEASETS  623



>ref|XP_004502605.1| PREDICTED: probable inactive receptor kinase At4g23740-like isoform 
X1 [Cicer arietinum]
Length=621

 Score =   250 bits (639),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 118/172 (69%), Positives = 140/172 (81%), Gaps = 3/172 (2%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIK+SNIFLNS+ YGCVSD+GL+ +MS +  P  RA GYRAPEV DTRKA H SDVYSF
Sbjct  451  GNIKASNIFLNSQGYGCVSDIGLATLMSPIPSPGTRATGYRAPEVTDTRKATHSSDVYSF  510

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GVLLLELLTGKSP++TT G++++ LVRWV+SVVREEWTAEVFDV+LLK P+IEEEMVEML
Sbjct  511  GVLLLELLTGKSPIYTTEGEQVVQLVRWVNSVVREEWTAEVFDVELLKYPNIEEEMVEML  570

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASRLSPSSIE  209
            QI ++C  RMPDQRPKM EVV+M+EG+RR    ENR S     S  S  +I+
Sbjct  571  QIGMACAARMPDQRPKMDEVVRMMEGIRRT---ENRPSSTESRSEASTPTID  619



>ref|XP_010915719.1| PREDICTED: probable inactive receptor kinase At4g23740 [Elaeis 
guineensis]
 ref|XP_010915720.1| PREDICTED: probable inactive receptor kinase At4g23740 [Elaeis 
guineensis]
 ref|XP_010915721.1| PREDICTED: probable inactive receptor kinase At4g23740 [Elaeis 
guineensis]
Length=640

 Score =   250 bits (638),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 116/161 (72%), Positives = 138/161 (86%), Gaps = 1/161 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIKSSN FLN++QYGC+SD+GL+++M+ + PPV+R AGYRAPEVVD RK    SDVYSF
Sbjct  464  GNIKSSNAFLNNQQYGCISDLGLTSLMNPMVPPVSRTAGYRAPEVVDLRKTTQASDVYSF  523

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GVL+LELLTGKSP+  T GDE++HLVRWV SVVREEWTAEVFDV+L++ P+IEEEMVEML
Sbjct  524  GVLMLELLTGKSPIQITGGDEVVHLVRWVQSVVREEWTAEVFDVELMRYPNIEEEMVEML  583

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCEN  242
            QIA++CVVRMP+QRPKM EVV+MIE VRR D   NR S E 
Sbjct  584  QIAMTCVVRMPEQRPKMSEVVRMIEDVRRFDT-GNRPSSEG  623



>emb|CDY47625.1| BnaA01g13400D [Brassica napus]
Length=662

 Score =   251 bits (640),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 123/170 (72%), Positives = 146/170 (86%), Gaps = 3/170 (2%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIKSSNIFLNS++ GCVSD+GL+A+MS+LAPP++R AGYRAPEV DTRK++  SDVYSF
Sbjct  488  GNIKSSNIFLNSERNGCVSDLGLTAVMSALAPPISRQAGYRAPEVTDTRKSSQLSDVYSF  547

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GV+LLELLTGKSP+HTT+GDEIIHLVRWVHSVVREEWTAEVFDV+LL+  +IEEEMVEML
Sbjct  548  GVVLLELLTGKSPIHTTAGDEIIHLVRWVHSVVREEWTAEVFDVELLRYTNIEEEMVEML  607

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGV-RRNDHL--ENRRSCENGASRLS  224
            QIA+SCVV+ PDQRPKM ++V++IE V  R   L  E +   EN AS  S
Sbjct  608  QIAMSCVVKAPDQRPKMSDLVRLIESVGNRQASLGPEPKPKSENEASETS  657



>ref|XP_010053173.1| PREDICTED: probable inactive receptor kinase At4g23740 [Eucalyptus 
grandis]
 ref|XP_010053174.1| PREDICTED: probable inactive receptor kinase At4g23740 [Eucalyptus 
grandis]
 gb|KCW77437.1| hypothetical protein EUGRSUZ_D01777 [Eucalyptus grandis]
Length=634

 Score =   250 bits (638),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 115/165 (70%), Positives = 140/165 (85%), Gaps = 7/165 (4%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIKSSNIFLN++ YGC+SD+GL+ +MS LA P++RA GYRAPEV DTRKA  PSDVYSF
Sbjct  452  GNIKSSNIFLNAEGYGCISDLGLATVMSGLAAPISRATGYRAPEVTDTRKATQPSDVYSF  511

Query  544  GVLLLELLTGKSPVHTTSG-------DEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIE  386
            GV+LLELLTGKSP+H T+        DEI+HLVRWVHSVVREEWTAEVFD++L++ P+IE
Sbjct  512  GVVLLELLTGKSPIHGTTSGSGGGGGDEIMHLVRWVHSVVREEWTAEVFDIELMRYPNIE  571

Query  385  EEMVEMLQIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRS  251
            EEMVEMLQIA+SCV R+PDQRPKMP++VK+IE VR + H +  +S
Sbjct  572  EEMVEMLQIAMSCVARLPDQRPKMPDLVKLIENVRSSSHTQENKS  616



>ref|XP_009409433.1| PREDICTED: probable inactive receptor kinase At4g23740 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009409434.1| PREDICTED: probable inactive receptor kinase At4g23740 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009409435.1| PREDICTED: probable inactive receptor kinase At4g23740 [Musa 
acuminata subsp. malaccensis]
Length=644

 Score =   250 bits (638),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 119/161 (74%), Positives = 142/161 (88%), Gaps = 2/161 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIKSSN+FL+++QYGCV+D+GL +I++ + PPV+R AGYRAPEVVDTRKA+  SDVYSF
Sbjct  464  GNIKSSNVFLSNQQYGCVADLGLPSIINPMVPPVSRTAGYRAPEVVDTRKASQASDVYSF  523

Query  544  GVLLLELLTGKSPVHTTSG-DEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEM  368
            GVLLLELLTGKSP+    G DE+IHLVRWVHSVVREEWTAEVFDV+L++ P+IEEEMVEM
Sbjct  524  GVLLLELLTGKSPIRVVGGGDEVIHLVRWVHSVVREEWTAEVFDVELMRYPNIEEEMVEM  583

Query  367  LQIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCE  245
            LQIA++CV RMP++RPKMPEVV+MIEGVRR D   NR S E
Sbjct  584  LQIAMNCVSRMPERRPKMPEVVRMIEGVRRFDS-GNRPSTE  623



>ref|XP_010448663.1| PREDICTED: probable inactive receptor kinase At4g23740 [Camelina 
sativa]
 ref|XP_010448664.1| PREDICTED: probable inactive receptor kinase At4g23740 [Camelina 
sativa]
Length=641

 Score =   249 bits (637),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 124/176 (70%), Positives = 149/176 (85%), Gaps = 5/176 (3%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIKSSNIFLNS++ GCVSD+GL+A+MS LAPP++R AGYRAPEV DTRK++  SDVYSF
Sbjct  466  GNIKSSNIFLNSERSGCVSDLGLTAVMSPLAPPISRQAGYRAPEVTDTRKSSQLSDVYSF  525

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GV+LLELLTGKSP+HTT+GDEIIHLVRWVHSVVREEWTAEVFD++LL+  +IEEEMVEML
Sbjct  526  GVVLLELLTGKSPIHTTAGDEIIHLVRWVHSVVREEWTAEVFDIELLRYANIEEEMVEML  585

Query  364  QIALSCVVRMPDQRPKMPEVVKMIE--GVRRNDHL--ENRRSCENGASRLS-PSSI  212
            QIA+SCVV+  DQRPKM ++V++IE  G RR   +  E++   EN AS  S PS I
Sbjct  586  QIAMSCVVKAADQRPKMSDLVRLIENVGNRRTSSIEPESKPKSENEASEASTPSEI  641



>ref|XP_010433865.1| PREDICTED: probable inactive receptor kinase At4g23740 [Camelina 
sativa]
 ref|XP_010433866.1| PREDICTED: probable inactive receptor kinase At4g23740 [Camelina 
sativa]
Length=639

 Score =   249 bits (636),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 124/176 (70%), Positives = 149/176 (85%), Gaps = 5/176 (3%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIKSSNIFLNS++ GCVSD+GL+A+MS LAPP++R AGYRAPEV DTRK++  SDVYSF
Sbjct  464  GNIKSSNIFLNSERSGCVSDLGLTAVMSPLAPPISRQAGYRAPEVTDTRKSSQLSDVYSF  523

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GV+LLELLTGKSP+HTT+GDEIIHLVRWVHSVVREEWTAEVFD++LL+  +IEEEMVEML
Sbjct  524  GVVLLELLTGKSPIHTTAGDEIIHLVRWVHSVVREEWTAEVFDIELLRYANIEEEMVEML  583

Query  364  QIALSCVVRMPDQRPKMPEVVKMIE--GVRRNDHL--ENRRSCENGASRLS-PSSI  212
            QIA+SCVV+  DQRPKM ++V++IE  G RR   +  E++   EN AS  S PS I
Sbjct  584  QIAMSCVVKAADQRPKMSDLVRLIENVGNRRTSSIEPESKPKSENEASEASTPSEI  639



>gb|KEH35437.1| receptor-like kinase [Medicago truncatula]
Length=347

 Score =   241 bits (615),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 114/171 (67%), Positives = 136/171 (80%), Gaps = 4/171 (2%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIK+SNIFLNS+ YGCVSD+GL  +MSS+    ARA GYRAPEV+DTRKA H SDVYSF
Sbjct  181  GNIKASNIFLNSQGYGCVSDIGLVTLMSSIPSQGARATGYRAPEVIDTRKATHSSDVYSF  240

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GVLLLELLTGK PV++T G++ +HLVRWV SVVREEWTAEVFD +LL+   IEEEMVEML
Sbjct  241  GVLLLELLTGKPPVYSTEGEQAVHLVRWVKSVVREEWTAEVFDTELLRYSSIEEEMVEML  300

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASRLSPSSI  212
            QI ++C  RMPDQRPKM EVV+M+EG+R     ENR S     S++S  ++
Sbjct  301  QIGMACAARMPDQRPKMAEVVRMMEGIRH----ENRPSSTESGSQVSTPTV  347



>ref|NP_194105.1| Leucine-rich repeat protein kinase family protein [Arabidopsis 
thaliana]
 sp|Q9SUQ3.1|Y4374_ARATH RecName: Full=Probable inactive receptor kinase At4g23740; Flags: 
Precursor [Arabidopsis thaliana]
 emb|CAA23040.1| putative receptor kinase [Arabidopsis thaliana]
 emb|CAB81292.1| putative receptor kinase [Arabidopsis thaliana]
 dbj|BAC42978.1| putative receptor kinase [Arabidopsis thaliana]
 gb|AAP40406.1| putative leucine-rich repeat transmembrane protein kinase [Arabidopsis 
thaliana]
 gb|ACN59347.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEE84800.1| Leucine-rich repeat protein kinase family protein [Arabidopsis 
thaliana]
Length=638

 Score =   249 bits (635),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 125/177 (71%), Positives = 147/177 (83%), Gaps = 6/177 (3%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIKSSNIFLNS+  GCVSD+GL+A+MS LAPP++R AGYRAPEV DTRK++  SDVYSF
Sbjct  462  GNIKSSNIFLNSESNGCVSDLGLTAVMSPLAPPISRQAGYRAPEVTDTRKSSQLSDVYSF  521

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GV+LLELLTGKSP+HTT+GDEIIHLVRWVHSVVREEWTAEVFD++LL+  +IEEEMVEML
Sbjct  522  GVVLLELLTGKSPIHTTAGDEIIHLVRWVHSVVREEWTAEVFDIELLRYTNIEEEMVEML  581

Query  364  QIALSCVVRMPDQRPKMPEVVKMIE--GVRRND---HLENRRSCENGASRLS-PSSI  212
            QIA+SCVV+  DQRPKM ++V++IE  G RR       E +   ENGAS  S PS I
Sbjct  582  QIAMSCVVKAADQRPKMSDLVRLIENVGNRRTSIEPEPELKPKSENGASETSTPSEI  638



>gb|KJB52632.1| hypothetical protein B456_008G271600 [Gossypium raimondii]
 gb|KJB52633.1| hypothetical protein B456_008G271600 [Gossypium raimondii]
 gb|KJB52634.1| hypothetical protein B456_008G271600 [Gossypium raimondii]
 gb|KJB52638.1| hypothetical protein B456_008G271600 [Gossypium raimondii]
 gb|KJB52639.1| hypothetical protein B456_008G271600 [Gossypium raimondii]
Length=634

 Score =   248 bits (633),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 119/179 (66%), Positives = 142/179 (79%), Gaps = 3/179 (2%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIK+SNIFLNS++YGCVSD+GL+A+MS +  PV RAAGYRAPEV DTRKA   SDVYSF
Sbjct  450  GNIKASNIFLNSERYGCVSDIGLAAVMSPMPLPVMRAAGYRAPEVTDTRKATQASDVYSF  509

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GV LLELLTGKSP+H T G+EI+HLVRWVHSVVREEWTAEVFDV+LL+ P+IEEEMVEML
Sbjct  510  GVFLLELLTGKSPIHATGGEEIVHLVRWVHSVVREEWTAEVFDVELLRYPNIEEEMVEML  569

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRR---NDHLENRRSCENGASRLSPSSIEQECS  197
            QIA+SCV R+ +QRPKM  +VKM+E +RR    + L      E  AS   P ++ +  S
Sbjct  570  QIAMSCVARVAEQRPKMAGLVKMVEEIRRVNNGNQLSFEAKSETSASTSIPHAVAETAS  628



>ref|XP_008234792.1| PREDICTED: probable inactive receptor kinase At4g23740 [Prunus 
mume]
 ref|XP_008234793.1| PREDICTED: probable inactive receptor kinase At4g23740 [Prunus 
mume]
 ref|XP_008234794.1| PREDICTED: probable inactive receptor kinase At4g23740 [Prunus 
mume]
Length=629

 Score =   248 bits (632),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 110/149 (74%), Positives = 133/149 (89%), Gaps = 0/149 (0%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIK+SNIFLNS+ YGCV D+GL+ +MS + PP ARA GYR+PEV DTRK++H SDVYSF
Sbjct  448  GNIKASNIFLNSQGYGCVCDIGLATLMSPMPPPAARAGGYRSPEVTDTRKSSHASDVYSF  507

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GVL+LELLTGKSP+HTT G+E+IHLVRWV+SVVREEWTAEVFDV+LL+ P+IEEEMVEML
Sbjct  508  GVLILELLTGKSPIHTTGGEEVIHLVRWVNSVVREEWTAEVFDVELLRYPNIEEEMVEML  567

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRR  278
            QI +SCV RMP+QRP MP+VVK +E +R+
Sbjct  568  QIGMSCVARMPEQRPSMPDVVKRVEEIRQ  596



>ref|XP_007220432.1| hypothetical protein PRUPE_ppa002831mg [Prunus persica]
 ref|XP_007220433.1| hypothetical protein PRUPE_ppa002831mg [Prunus persica]
 gb|EMJ21631.1| hypothetical protein PRUPE_ppa002831mg [Prunus persica]
 gb|EMJ21632.1| hypothetical protein PRUPE_ppa002831mg [Prunus persica]
Length=629

 Score =   247 bits (631),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 110/149 (74%), Positives = 133/149 (89%), Gaps = 0/149 (0%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIK+SNIFLNS+ YGCV D+GL+ +MS + PP ARA GYR+PEV DTRK++H SDVYSF
Sbjct  448  GNIKASNIFLNSQGYGCVCDIGLATLMSPMPPPAARAGGYRSPEVTDTRKSSHASDVYSF  507

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GVL+LELLTGKSP+HTT G+E+IHLVRWV+SVVREEWTAEVFDV+LL+ P+IEEEMVEML
Sbjct  508  GVLILELLTGKSPIHTTGGEEVIHLVRWVNSVVREEWTAEVFDVELLRYPNIEEEMVEML  567

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRR  278
            QI +SCV RMP+QRP MP+VVK +E +R+
Sbjct  568  QIGMSCVARMPEQRPSMPDVVKRVEEIRQ  596



>emb|CDX94213.1| BnaC07g38470D [Brassica napus]
Length=615

 Score =   247 bits (630),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 116/157 (74%), Positives = 141/157 (90%), Gaps = 1/157 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIKSSNIFLNS++ GCVSD+GL+A+MS+LAPP++R AGYRAPEV DTRK++  SDVYSF
Sbjct  445  GNIKSSNIFLNSEREGCVSDLGLTAVMSALAPPISRQAGYRAPEVTDTRKSSQLSDVYSF  504

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GV+LLELLTGKSP+HTT+GDEIIHLVRWVHSVVREEWTAEVFDV+LL+  +IEEEMVEML
Sbjct  505  GVVLLELLTGKSPIHTTAGDEIIHLVRWVHSVVREEWTAEVFDVELLRYTNIEEEMVEML  564

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGV-RRNDHLENR  257
            QIA+SCVV+ PDQRPK+ ++V+++E V  R   LE +
Sbjct  565  QIAMSCVVKAPDQRPKISDLVRLMESVGNRRASLETK  601



>ref|XP_002869766.1| hypothetical protein ARALYDRAFT_914223 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46025.1| hypothetical protein ARALYDRAFT_914223 [Arabidopsis lyrata subsp. 
lyrata]
Length=637

 Score =   247 bits (630),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 125/185 (68%), Positives = 147/185 (79%), Gaps = 20/185 (11%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIKSSNIFLNS+  GCVSD+GL+A+MS LAPP++R AGYRAPEV DTRK++  SDVYSF
Sbjct  459  GNIKSSNIFLNSENNGCVSDLGLTAVMSPLAPPISRQAGYRAPEVTDTRKSSQLSDVYSF  518

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GV+LLELLTGKSP+HTT+GDEIIHLVRWVHSVVREEWTAEVFD++LL+  +IEEEMVEML
Sbjct  519  GVVLLELLTGKSPIHTTAGDEIIHLVRWVHSVVREEWTAEVFDIELLRYTNIEEEMVEML  578

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRS-------------CENGASRLS  224
            QIA+SCVV+  DQRPKM ++V++IE V       NRR+              ENGAS  S
Sbjct  579  QIAMSCVVKAADQRPKMSDLVRLIENV------GNRRTSIEPEPEPELKPKSENGASETS  632

Query  223  -PSSI  212
             PS I
Sbjct  633  TPSEI  637



>emb|CDP05105.1| unnamed protein product [Coffea canephora]
Length=630

 Score =   246 bits (629),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 109/149 (73%), Positives = 134/149 (90%), Gaps = 0/149 (0%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GN+K+SNIFLNS+QYGCVSD+GL+ +++ +APPV R AGYRAPEV D+RK +  SDVYSF
Sbjct  447  GNMKASNIFLNSQQYGCVSDLGLATLITPIAPPVMRTAGYRAPEVTDSRKVSQASDVYSF  506

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GVLLLELLTGKSP+H T GDE+IHLVRWV+SVVREEWTAEVFDV+LL+ P+IEEEMVEML
Sbjct  507  GVLLLELLTGKSPIHATGGDEVIHLVRWVNSVVREEWTAEVFDVELLRFPNIEEEMVEML  566

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRR  278
            +I ++CV RMP+QRPKM +V+KM+E +RR
Sbjct  567  RIGMTCVARMPEQRPKMSDVLKMVEDMRR  595



>gb|KHG27491.1| hypothetical protein F383_14041 [Gossypium arboreum]
Length=634

 Score =   246 bits (629),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 119/179 (66%), Positives = 142/179 (79%), Gaps = 3/179 (2%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIK+SNIFLNS++YGCVSD+GL+A+MS +  PV RAAGYRAPEV DTRKA   SDVYSF
Sbjct  450  GNIKASNIFLNSERYGCVSDIGLAAVMSPMPLPVMRAAGYRAPEVTDTRKATQASDVYSF  509

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GV LLELLTGKSP+H T G+EI+HLVRWVHSVVREEWTAEVFDV+LL+ P+IEEEMVEML
Sbjct  510  GVFLLELLTGKSPIHATGGEEIVHLVRWVHSVVREEWTAEVFDVELLRYPNIEEEMVEML  569

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRR---NDHLENRRSCENGASRLSPSSIEQECS  197
            QIA+SCV R+ +QRPKM  +VKM+E +RR    + L      E  AS   P ++ +  S
Sbjct  570  QIAMSCVARVVEQRPKMAGLVKMVEEIRRVNNGNQLSFETKSEASASTSIPHAVAETTS  628



>ref|XP_010662595.1| PREDICTED: probable inactive receptor kinase At4g23740 [Vitis 
vinifera]
 ref|XP_010662596.1| PREDICTED: probable inactive receptor kinase At4g23740 [Vitis 
vinifera]
 ref|XP_010662597.1| PREDICTED: probable inactive receptor kinase At4g23740 [Vitis 
vinifera]
 ref|XP_010662598.1| PREDICTED: probable inactive receptor kinase At4g23740 [Vitis 
vinifera]
Length=628

 Score =   246 bits (628),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 115/160 (72%), Positives = 138/160 (86%), Gaps = 1/160 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIK+SNIFLNS++YGCVSD+GL  +M+    P+ RAAGYRAPEV DTRKA+  SDVYSF
Sbjct  445  GNIKASNIFLNSRRYGCVSDLGLGTLMTPTPMPMTRAAGYRAPEVTDTRKASQASDVYSF  504

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GVLLLELLTGKSP+H T GDE+IHLVRWV+SVVREEWTAEVFDV+LL+ P+IEEEMVEML
Sbjct  505  GVLLLELLTGKSPIHNTGGDEVIHLVRWVNSVVREEWTAEVFDVELLRYPNIEEEMVEML  564

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCE  245
            QI ++CVV+MP+QRPKM EVVKM+E +++ +   NR S E
Sbjct  565  QIGMNCVVKMPEQRPKMAEVVKMMESIQQVN-TGNRPSSE  603



>ref|XP_008793541.1| PREDICTED: probable inactive receptor kinase At4g23740 isoform 
X2 [Phoenix dactylifera]
Length=626

 Score =   246 bits (627),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 116/161 (72%), Positives = 138/161 (86%), Gaps = 2/161 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIKSSN+FLNS+QYGCVSD+GL+++M+ + PPV+R AGYRAPEVVD RKA   SDVYSF
Sbjct  460  GNIKSSNVFLNSQQYGCVSDLGLTSLMNPMIPPVSRTAGYRAPEVVDLRKATQASDVYSF  519

Query  544  GVLLLELLTGKSPVHTTSG-DEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEM  368
            GVL+LELLTGKSP+    G DE++HLVRWVHSVVREEWTAEVFDV+L++ P+IEEEMVEM
Sbjct  520  GVLVLELLTGKSPIQIKGGGDEVVHLVRWVHSVVREEWTAEVFDVELMRYPNIEEEMVEM  579

Query  367  LQIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCE  245
            LQIA++C  RMPDQRP+M EVV+M+E VRR D   NR S E
Sbjct  580  LQIAMTCAARMPDQRPRMTEVVRMLEDVRRFD-TGNRPSSE  619



>ref|XP_011076041.1| PREDICTED: probable inactive receptor kinase At4g23740 [Sesamum 
indicum]
 ref|XP_011076042.1| PREDICTED: probable inactive receptor kinase At4g23740 [Sesamum 
indicum]
 ref|XP_011076043.1| PREDICTED: probable inactive receptor kinase At4g23740 [Sesamum 
indicum]
 ref|XP_011076044.1| PREDICTED: probable inactive receptor kinase At4g23740 [Sesamum 
indicum]
Length=627

 Score =   246 bits (627),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 112/151 (74%), Positives = 133/151 (88%), Gaps = 0/151 (0%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIK+SNIFLNS+ +GCVSD+GL+ +MS +APPV R AGYRAPE+ DTRK + PSDVYSF
Sbjct  445  GNIKASNIFLNSQLHGCVSDLGLATLMSPIAPPVMRTAGYRAPEITDTRKVSQPSDVYSF  504

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GVLLLELLTGKSPVH + G+E+IHLVRWVHSVVREEWT EVFDV+LL+ P+IEEEMV ML
Sbjct  505  GVLLLELLTGKSPVHASGGEEVIHLVRWVHSVVREEWTGEVFDVELLRYPNIEEEMVAML  564

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRND  272
            QI LSCV RMP+QRPK+ EVVKM+E +R ++
Sbjct  565  QIGLSCVARMPEQRPKIGEVVKMLEEIRSSN  595



>ref|XP_008793397.1| PREDICTED: probable inactive receptor kinase At4g23740 isoform 
X1 [Phoenix dactylifera]
 ref|XP_008793471.1| PREDICTED: probable inactive receptor kinase At4g23740 isoform 
X1 [Phoenix dactylifera]
Length=637

 Score =   246 bits (627),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 116/161 (72%), Positives = 138/161 (86%), Gaps = 2/161 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIKSSN+FLNS+QYGCVSD+GL+++M+ + PPV+R AGYRAPEVVD RKA   SDVYSF
Sbjct  460  GNIKSSNVFLNSQQYGCVSDLGLTSLMNPMIPPVSRTAGYRAPEVVDLRKATQASDVYSF  519

Query  544  GVLLLELLTGKSPVHTTSG-DEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEM  368
            GVL+LELLTGKSP+    G DE++HLVRWVHSVVREEWTAEVFDV+L++ P+IEEEMVEM
Sbjct  520  GVLVLELLTGKSPIQIKGGGDEVVHLVRWVHSVVREEWTAEVFDVELMRYPNIEEEMVEM  579

Query  367  LQIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCE  245
            LQIA++C  RMPDQRP+M EVV+M+E VRR D   NR S E
Sbjct  580  LQIAMTCAARMPDQRPRMTEVVRMLEDVRRFD-TGNRPSSE  619



>ref|XP_006283316.1| hypothetical protein CARUB_v10004355mg [Capsella rubella]
 gb|EOA16214.1| hypothetical protein CARUB_v10004355mg [Capsella rubella]
Length=598

 Score =   244 bits (622),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 122/175 (70%), Positives = 145/175 (83%), Gaps = 4/175 (2%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIKSSNIFLN +  GCVSD+GL+A+MS LAPP++R AGYRAPEV DTRK++  SDVYSF
Sbjct  424  GNIKSSNIFLNLEHSGCVSDLGLTAVMSPLAPPISRQAGYRAPEVTDTRKSSQLSDVYSF  483

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GV+LLELLTGKSP+HTT+GDEIIHLVRWVHSVVREEWTAEVFD++LL+  +IEEEMVEML
Sbjct  484  GVVLLELLTGKSPIHTTAGDEIIHLVRWVHSVVREEWTAEVFDIELLRYANIEEEMVEML  543

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGV---RRNDHLENRRSCENGASRLS-PSSI  212
            QIA+SCVV+  DQRPKM ++V++IE V   R +   E +   EN AS  S PS I
Sbjct  544  QIAMSCVVKSADQRPKMSDLVRLIENVGNRRTSIDPEPKPKSENEASETSTPSEI  598



>gb|EPS60741.1| hypothetical protein M569_14060 [Genlisea aurea]
Length=589

 Score =   243 bits (621),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 113/145 (78%), Positives = 131/145 (90%), Gaps = 0/145 (0%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GN+K SNIFLN K +GCVSD+GLS IM SL+P VARA+GYRAPEV DTR+A   SDVYSF
Sbjct  425  GNLKLSNIFLNPKSFGCVSDLGLSTIMGSLSPSVARASGYRAPEVTDTRRATQASDVYSF  484

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GV+LLELLTGKSPV TT G+E++HLVRWVHSVVREEWTAEVFDV+LL++P +EEE+VEML
Sbjct  485  GVVLLELLTGKSPVVTTGGEEMVHLVRWVHSVVREEWTAEVFDVELLRVPGVEEELVEML  544

Query  364  QIALSCVVRMPDQRPKMPEVVKMIE  290
            QIAL+CVVR P++RPKMPEVVKMIE
Sbjct  545  QIALACVVRAPEKRPKMPEVVKMIE  569



>emb|CBI22555.3| unnamed protein product [Vitis vinifera]
Length=660

 Score =   245 bits (625),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 115/160 (72%), Positives = 138/160 (86%), Gaps = 1/160 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIK+SNIFLNS++YGCVSD+GL  +M+    P+ RAAGYRAPEV DTRKA+  SDVYSF
Sbjct  445  GNIKASNIFLNSRRYGCVSDLGLGTLMTPTPMPMTRAAGYRAPEVTDTRKASQASDVYSF  504

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GVLLLELLTGKSP+H T GDE+IHLVRWV+SVVREEWTAEVFDV+LL+ P+IEEEMVEML
Sbjct  505  GVLLLELLTGKSPIHNTGGDEVIHLVRWVNSVVREEWTAEVFDVELLRYPNIEEEMVEML  564

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCE  245
            QI ++CVV+MP+QRPKM EVVKM+E +++ +   NR S E
Sbjct  565  QIGMNCVVKMPEQRPKMAEVVKMMESIQQVN-TGNRPSSE  603



>ref|XP_006350601.1| PREDICTED: probable inactive receptor kinase At4g23740-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006350602.1| PREDICTED: probable inactive receptor kinase At4g23740-like isoform 
X2 [Solanum tuberosum]
 ref|XP_006350603.1| PREDICTED: probable inactive receptor kinase At4g23740-like isoform 
X3 [Solanum tuberosum]
Length=629

 Score =   244 bits (623),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 115/172 (67%), Positives = 137/172 (80%), Gaps = 1/172 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIKSSNIFLNS+ +GC+SD+GL+ IM  +A P+ RAAGY+ PEV D+RK +  +DVYSF
Sbjct  451  GNIKSSNIFLNSQGFGCISDLGLATIMGPIATPIVRAAGYQPPEVTDSRKVSQTTDVYSF  510

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GVL+LELLTGKSP H T   +I+HLVRWVHSVVREEWTAEVFDV+LL+ P+IEEEMVEML
Sbjct  511  GVLILELLTGKSPTHATGTSDIVHLVRWVHSVVREEWTAEVFDVELLRYPNIEEEMVEML  570

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASRLSPSSIE  209
            QI L+CV RMP+QRPKM EVVKM+EGVRR +    R S E     L+P   E
Sbjct  571  QIGLTCVSRMPEQRPKMTEVVKMVEGVRRVN-TGTRTSTEASTPNLTPPMTE  621



>ref|XP_010925785.1| PREDICTED: probable inactive receptor kinase At4g23740 [Elaeis 
guineensis]
 ref|XP_010925786.1| PREDICTED: probable inactive receptor kinase At4g23740 [Elaeis 
guineensis]
Length=641

 Score =   244 bits (623),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 116/161 (72%), Positives = 138/161 (86%), Gaps = 2/161 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIKSSN+FLN++QYGCVSD+GL+++M+   PPV+R AGYRAPEVVD RKA   SDVYSF
Sbjct  464  GNIKSSNVFLNNRQYGCVSDLGLTSLMNPTIPPVSRTAGYRAPEVVDLRKATQASDVYSF  523

Query  544  GVLLLELLTGKSPVHTTSG-DEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEM  368
            GVL+LELLTGKSP+    G DE+IHLVRWVHSVVREEWTAEVFD++L++ P+IEEEMVEM
Sbjct  524  GVLMLELLTGKSPIQIKGGGDEVIHLVRWVHSVVREEWTAEVFDLELMRYPNIEEEMVEM  583

Query  367  LQIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCE  245
            LQIA++CV RMP+QRP+M EVV+MIE VRR D   NR S E
Sbjct  584  LQIAMTCVARMPEQRPRMTEVVRMIEDVRRFD-TGNRPSSE  623



>ref|XP_006283317.1| hypothetical protein CARUB_v10004355mg [Capsella rubella]
 gb|EOA16215.1| hypothetical protein CARUB_v10004355mg [Capsella rubella]
Length=635

 Score =   244 bits (622),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 122/175 (70%), Positives = 145/175 (83%), Gaps = 4/175 (2%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIKSSNIFLN +  GCVSD+GL+A+MS LAPP++R AGYRAPEV DTRK++  SDVYSF
Sbjct  461  GNIKSSNIFLNLEHSGCVSDLGLTAVMSPLAPPISRQAGYRAPEVTDTRKSSQLSDVYSF  520

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GV+LLELLTGKSP+HTT+GDEIIHLVRWVHSVVREEWTAEVFD++LL+  +IEEEMVEML
Sbjct  521  GVVLLELLTGKSPIHTTAGDEIIHLVRWVHSVVREEWTAEVFDIELLRYANIEEEMVEML  580

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGV---RRNDHLENRRSCENGASRLS-PSSI  212
            QIA+SCVV+  DQRPKM ++V++IE V   R +   E +   EN AS  S PS I
Sbjct  581  QIAMSCVVKSADQRPKMSDLVRLIENVGNRRTSIDPEPKPKSENEASETSTPSEI  635



>ref|XP_008794990.1| PREDICTED: probable inactive receptor kinase At4g23740 [Phoenix 
dactylifera]
 ref|XP_008794991.1| PREDICTED: probable inactive receptor kinase At4g23740 [Phoenix 
dactylifera]
Length=642

 Score =   244 bits (622),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 116/162 (72%), Positives = 140/162 (86%), Gaps = 2/162 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIKSSN+FLN++QYGCVSD+GL+++M+ + PPV+R AGYRAPEVVD RKA+  SDVYSF
Sbjct  465  GNIKSSNVFLNNQQYGCVSDLGLASLMNPMIPPVSRTAGYRAPEVVDLRKASQASDVYSF  524

Query  544  GVLLLELLTGKSPVHTTSG-DEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEM  368
            GVL+LELLTGKSP+    G DE++HLVRWV SVVREEWTAEVFDV+L++ P+IEEE+VEM
Sbjct  525  GVLVLELLTGKSPIQIIGGGDEVVHLVRWVQSVVREEWTAEVFDVELMRYPNIEEELVEM  584

Query  367  LQIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCEN  242
            LQIA++CVVRMP+QRPKM EVV+MIE VRR D   NR S E 
Sbjct  585  LQIAMTCVVRMPEQRPKMSEVVRMIEDVRRFD-TGNRPSSEG  625



>gb|KDO56147.1| hypothetical protein CISIN_1g007167mg [Citrus sinensis]
Length=615

 Score =   243 bits (619),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 117/180 (65%), Positives = 144/180 (80%), Gaps = 5/180 (3%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            G IK+SNIFLNS+ + CVSD+GL+A+MS + PP  RAAGYRAPEV DTRKA   SDV+SF
Sbjct  427  GGIKASNIFLNSQGHVCVSDIGLAALMSPMPPPAMRAAGYRAPEVTDTRKATQASDVFSF  486

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GVLLLELLTGKSP+H T GDE++HLVRWV+SVVREEWTAEVFDV+LL+ P+IEEEMVEML
Sbjct  487  GVLLLELLTGKSPIHATGGDEVVHLVRWVNSVVREEWTAEVFDVELLRYPNIEEEMVEML  546

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCEN----GASRLSPSSIEQECS  197
            Q+ ++CVVRMP++RPKM +V+KM+E +RR    EN  S EN     +S  +P + E   S
Sbjct  547  QVGMACVVRMPEERPKMADVLKMVEDIRR-VKAENPPSTENRSEISSSAATPKATETASS  605



>gb|ACC91242.1| leucine-rich repeat transmembrane protein kinase [Arabidopsis 
halleri]
Length=636

 Score =   243 bits (619),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 125/178 (70%), Positives = 147/178 (83%), Gaps = 7/178 (4%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIKSSNIFLNS+  GCVSD+GL+A+MS LAPP++R AGYRAPEV DTRK++  SDVYSF
Sbjct  459  GNIKSSNIFLNSENNGCVSDLGLTAVMSPLAPPISRQAGYRAPEVTDTRKSSQLSDVYSF  518

Query  544  GVLLLELLTGKSPVHTTSG-DEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEM  368
            GV+LLELLTGKSP+HTT+G DEIIHLVRWVHSVVREEWTAEVFD++LL+  +IEEEMVEM
Sbjct  519  GVVLLELLTGKSPIHTTAGRDEIIHLVRWVHSVVREEWTAEVFDIELLRYTNIEEEMVEM  578

Query  367  LQIALSCVVRMPDQRPKMPEVVKMIE--GVRRND---HLENRRSCENGASRLS-PSSI  212
            LQIA+SCVV+  DQRPKM ++V++IE  G RR       E +   ENGAS  S PS I
Sbjct  579  LQIAMSCVVKAADQRPKMSDLVRLIETVGNRRTSIEPEPELKPKSENGASESSTPSEI  636



>ref|XP_006490586.1| PREDICTED: probable inactive receptor kinase At4g23740-like [Citrus 
sinensis]
Length=619

 Score =   241 bits (615),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 116/180 (64%), Positives = 144/180 (80%), Gaps = 5/180 (3%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            G IK+SNIFLNS+ + CVSD+GL+A+MS + PP  RAAGYRAPEV DTRKA   SDV+SF
Sbjct  431  GGIKASNIFLNSQGHVCVSDIGLAALMSPMPPPAMRAAGYRAPEVTDTRKATQASDVFSF  490

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GVLLLELLTGKSP+H T GDE++HLVRWV+SVVREEWTAEVFDV+LL+ P+IEEEMVEML
Sbjct  491  GVLLLELLTGKSPIHATGGDEVVHLVRWVNSVVREEWTAEVFDVELLRYPNIEEEMVEML  550

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCEN----GASRLSPSSIEQECS  197
            Q+ ++CVVRMP++RPKM +V+KM+E ++R    EN  S EN     +S  +P + E   S
Sbjct  551  QVGMACVVRMPEERPKMADVLKMVEDIQR-VKAENPPSTENRSEISSSAATPKATETASS  609



>gb|KHN09234.1| Putative inactive receptor kinase [Glycine soja]
Length=361

 Score =   234 bits (596),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 111/169 (66%), Positives = 137/169 (81%), Gaps = 4/169 (2%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIK+SNIFLNSK YGC+SD+GL+A+M+    P  RA GYRAPE  DTRKA   SDVYSF
Sbjct  184  GNIKASNIFLNSKGYGCLSDIGLAALMN----PALRATGYRAPEATDTRKAIPASDVYSF  239

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GVLLLELLTG+SP+H   GDE++HLVRWV+SVVREEWTAEVFDV LL+ P+IEEEMVEML
Sbjct  240  GVLLLELLTGRSPLHAKGGDEVVHLVRWVNSVVREEWTAEVFDVDLLRYPNIEEEMVEML  299

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASRLSPS  218
            QI ++CVVR+PDQRP++ EVV+M+E + R  + ENR   E+ +   +P+
Sbjct  300  QIGMACVVRVPDQRPQIGEVVRMVEEIGRVINTENRSPTESRSEGSTPT  348



>ref|XP_010059849.1| PREDICTED: probable inactive receptor kinase At4g23740 [Eucalyptus 
grandis]
 ref|XP_010059857.1| PREDICTED: probable inactive receptor kinase At4g23740 [Eucalyptus 
grandis]
 ref|XP_010059865.1| PREDICTED: probable inactive receptor kinase At4g23740 [Eucalyptus 
grandis]
 gb|KCW90565.1| hypothetical protein EUGRSUZ_A02671 [Eucalyptus grandis]
Length=665

 Score =   241 bits (614),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 110/161 (68%), Positives = 136/161 (84%), Gaps = 1/161 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GN+K+SN+FLN K YGC+SD+GL+ I++ + P   RAAGYRAPEV+DTRK    SDVYSF
Sbjct  451  GNLKASNVFLNEKGYGCISDIGLATIINPIPPTSTRAAGYRAPEVIDTRKVFQASDVYSF  510

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GVLLLELLTGKSP+H+T+G+E IHLVRWV SVVREEWTAEVFDV+LL+ P+IEEEMVEML
Sbjct  511  GVLLLELLTGKSPLHSTNGNESIHLVRWVQSVVREEWTAEVFDVQLLRYPNIEEEMVEML  570

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCEN  242
            ++ ++CVV+ P+QRPKMPEVVK++E +RR     NR S EN
Sbjct  571  KVGMACVVKRPEQRPKMPEVVKLLEDIRRGSS-ANRPSSEN  610



>gb|KHN23405.1| Putative inactive receptor kinase [Glycine soja]
Length=633

 Score =   240 bits (612),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 107/149 (72%), Positives = 131/149 (88%), Gaps = 0/149 (0%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIK+SNIFLNS+ YGC+SD+GL+ +MS +  P  RA GYRAPEV DTRKA H SDVYSF
Sbjct  453  GNIKASNIFLNSQGYGCISDIGLATLMSPIPMPAMRATGYRAPEVTDTRKATHASDVYSF  512

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GVLLLELLTGKSP+++T G++++HLVRWV+SVVREEWTAEVFDV+LL+ P+IEEEMV ML
Sbjct  513  GVLLLELLTGKSPINSTEGEQVVHLVRWVNSVVREEWTAEVFDVELLRYPNIEEEMVVML  572

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRR  278
            QI ++C  R+PDQRPKMP+VV+MIE +RR
Sbjct  573  QIGMACAARIPDQRPKMPDVVRMIEEIRR  601



>ref|XP_008376682.1| PREDICTED: probable inactive receptor kinase At4g23740 [Malus 
domestica]
Length=629

 Score =   239 bits (611),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 110/149 (74%), Positives = 128/149 (86%), Gaps = 0/149 (0%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIK+SNIFLNS+ YGCV DVGL  +MS + PP  R  GYRAPEV DTRK+   SDVYSF
Sbjct  448  GNIKASNIFLNSQGYGCVCDVGLPTLMSPIPPPAVRTGGYRAPEVTDTRKSTPASDVYSF  507

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GVL+LELLTGKSP+HTT G+E+IHLVRWV+SVVREEWTAEVFDV+LLK P+IEEEMVEML
Sbjct  508  GVLILELLTGKSPIHTTDGEEVIHLVRWVNSVVREEWTAEVFDVELLKYPNIEEEMVEML  567

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRR  278
            QI +SCV RMP+QRPKM +VVK +E +R+
Sbjct  568  QIGMSCVARMPEQRPKMQDVVKRVEEIRQ  596



>ref|XP_009413825.1| PREDICTED: probable inactive receptor kinase At4g23740 [Musa 
acuminata subsp. malaccensis]
Length=632

 Score =   239 bits (609),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 115/164 (70%), Positives = 139/164 (85%), Gaps = 5/164 (3%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIKSSN+FLN + YGCVSD+GL ++++ + P ++R AGYRAPEVVDTRKA+ PSDVYSF
Sbjct  447  GNIKSSNVFLNDQHYGCVSDLGLPSLINPMLPRLSRTAGYRAPEVVDTRKASQPSDVYSF  506

Query  544  GVLLLELLTGKSPVHTTSG----DEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEM  377
            GVL+LELLTGKSP+  T G    DE++HLVRWVHSV+REEWTAEVFDV+LL+ P+IEEEM
Sbjct  507  GVLILELLTGKSPIQITGGGGGGDEVVHLVRWVHSVLREEWTAEVFDVELLRYPNIEEEM  566

Query  376  VEMLQIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCE  245
            VEMLQIA++CV R P++RPK+PEVV MIEGVRR D   NR S E
Sbjct  567  VEMLQIAMNCVARKPERRPKIPEVVGMIEGVRRFDS-GNRSSTE  609



>gb|AES72427.2| LRR receptor-like kinase [Medicago truncatula]
Length=616

 Score =   238 bits (608),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 115/171 (67%), Positives = 137/171 (80%), Gaps = 4/171 (2%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIK+SNIFLNS  YGCVSD GL+ +MSS+  P  RA+GYRAPEV DTRKA H SDVYSF
Sbjct  447  GNIKASNIFLNSHGYGCVSDTGLAVLMSSVPSPGTRASGYRAPEVTDTRKAVHSSDVYSF  506

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GVLLLELLTGKSP+++  G++ IHLVRWV+SVVREEWTAEVFDV+LL+  +IEEEMVEML
Sbjct  507  GVLLLELLTGKSPIYSLEGEQNIHLVRWVNSVVREEWTAEVFDVELLRYSNIEEEMVEML  566

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASRLSPSSI  212
            QI ++C  RMPDQRPKM EVV+M+EG+R     ENR S     S +S  ++
Sbjct  567  QIGMACAARMPDQRPKMSEVVRMVEGIRP----ENRPSSTESRSEVSTPTV  613



>ref|XP_003526687.1| PREDICTED: probable inactive receptor kinase At4g23740-like [Glycine 
max]
Length=633

 Score =   239 bits (609),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 106/149 (71%), Positives = 131/149 (88%), Gaps = 0/149 (0%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIK+SNIFLNS+ YGC+SD+GL+ +MS +  P  RA GYRAPEV DTRKA H SDVYSF
Sbjct  453  GNIKASNIFLNSQGYGCISDIGLATLMSPIPMPAMRATGYRAPEVTDTRKATHASDVYSF  512

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GVLLLELLTGKSP+++T G++++HLVRWV+SVVREEWTAEVFDV+LL+ P+IEEEMV ML
Sbjct  513  GVLLLELLTGKSPINSTEGEQVVHLVRWVNSVVREEWTAEVFDVELLRYPNIEEEMVVML  572

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRR  278
            QI ++C  R+PDQRPKMP++V+MIE +RR
Sbjct  573  QIGMACAARIPDQRPKMPDLVRMIEEIRR  601



>ref|XP_003522551.1| PREDICTED: probable inactive receptor kinase At4g23740-like [Glycine 
max]
Length=633

 Score =   239 bits (609),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 105/149 (70%), Positives = 129/149 (87%), Gaps = 0/149 (0%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GN+K+SNIF NS+ YGC+SD+GL+ +MS +  P  RA GYRAPEV DTRKA H SDVYSF
Sbjct  453  GNLKASNIFFNSQGYGCISDIGLATLMSPIPMPAMRATGYRAPEVTDTRKATHASDVYSF  512

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GVLLLELLTGKSP++ T G++++HLVRWV+SVVREEWTAEVFDV+LL+ P+IEEEMV ML
Sbjct  513  GVLLLELLTGKSPINNTEGEQVVHLVRWVNSVVREEWTAEVFDVQLLRYPNIEEEMVGML  572

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRR  278
            QI ++C  R+PDQRPKMP+VV+MIE +RR
Sbjct  573  QIGMACAARIPDQRPKMPDVVRMIEEIRR  601



>gb|KHN44239.1| Putative inactive receptor kinase [Glycine soja]
Length=633

 Score =   238 bits (608),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 105/149 (70%), Positives = 129/149 (87%), Gaps = 0/149 (0%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GN+K+SNIF NS+ YGC+SD+GL+ +MS +  P  RA GYRAPEV DTRKA H SDVYSF
Sbjct  453  GNLKASNIFFNSQGYGCISDIGLATLMSPIPMPAMRATGYRAPEVTDTRKATHASDVYSF  512

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GVLLLELLTGKSP++ T G++++HLVRWV+SVVREEWTAEVFDV+LL+ P+IEEEMV ML
Sbjct  513  GVLLLELLTGKSPINNTEGEQVVHLVRWVNSVVREEWTAEVFDVQLLRYPNIEEEMVVML  572

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRR  278
            QI ++C  R+PDQRPKMP+VV+MIE +RR
Sbjct  573  QIGMACAARIPDQRPKMPDVVRMIEEIRR  601



>ref|XP_006422104.1| hypothetical protein CICLE_v10004549mg [Citrus clementina]
 gb|ESR35344.1| hypothetical protein CICLE_v10004549mg [Citrus clementina]
Length=626

 Score =   238 bits (607),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 107/149 (72%), Positives = 132/149 (89%), Gaps = 0/149 (0%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            G IK+SNIFLNS+ + CVSD+GL+A+MS + PP  RAAGYRAPEV DTRKA   SDV+SF
Sbjct  431  GGIKASNIFLNSQGHVCVSDIGLAALMSPMPPPAMRAAGYRAPEVTDTRKATQASDVFSF  490

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GVLLLELLTGKSP+H T GDE++HLVRWV+SVVREEWTAEVFDV+LL+ P+IEEEMVEML
Sbjct  491  GVLLLELLTGKSPIHATGGDEVVHLVRWVNSVVREEWTAEVFDVELLRYPNIEEEMVEML  550

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRR  278
            Q+ ++CVVRMP++RPKM +V+KM+E ++R
Sbjct  551  QVGMACVVRMPEERPKMADVLKMVEDIQR  579



>ref|XP_009399835.1| PREDICTED: probable inactive receptor kinase At4g23740 isoform 
X2 [Musa acuminata subsp. malaccensis]
 ref|XP_009399836.1| PREDICTED: probable inactive receptor kinase At4g23740 isoform 
X3 [Musa acuminata subsp. malaccensis]
Length=651

 Score =   238 bits (607),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 115/173 (66%), Positives = 144/173 (83%), Gaps = 2/173 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIKSSN+FLN++QYGCVSD+GL +I++ +AP V R  GYRAPEV DT+KA+  SDVYSF
Sbjct  456  GNIKSSNVFLNNQQYGCVSDLGLPSIINPMAPLVPRTVGYRAPEVTDTKKASQASDVYSF  515

Query  544  GVLLLELLTGKSPVHTT-SGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEM  368
            GV++LELLTGKSPV    SGDE+IHLVRWV SVVREEWTAEVFDV+L++ P+IEEEMVEM
Sbjct  516  GVVMLELLTGKSPVPIVGSGDEVIHLVRWVQSVVREEWTAEVFDVELMRYPNIEEEMVEM  575

Query  367  LQIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASRLSPSSIE  209
            LQIA++CV R+P++RPKM +VV+MIEGVRR D   NR S E  +   +P+ ++
Sbjct  576  LQIAMNCVARVPERRPKMAQVVRMIEGVRRFDS-GNRPSTEARSEGSTPTPVQ  627



>ref|XP_009399834.1| PREDICTED: probable inactive receptor kinase At4g23740 isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=666

 Score =   238 bits (607),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 115/173 (66%), Positives = 144/173 (83%), Gaps = 2/173 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIKSSN+FLN++QYGCVSD+GL +I++ +AP V R  GYRAPEV DT+KA+  SDVYSF
Sbjct  456  GNIKSSNVFLNNQQYGCVSDLGLPSIINPMAPLVPRTVGYRAPEVTDTKKASQASDVYSF  515

Query  544  GVLLLELLTGKSPVHTT-SGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEM  368
            GV++LELLTGKSPV    SGDE+IHLVRWV SVVREEWTAEVFDV+L++ P+IEEEMVEM
Sbjct  516  GVVMLELLTGKSPVPIVGSGDEVIHLVRWVQSVVREEWTAEVFDVELMRYPNIEEEMVEM  575

Query  367  LQIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASRLSPSSIE  209
            LQIA++CV R+P++RPKM +VV+MIEGVRR D   NR S E  +   +P+ ++
Sbjct  576  LQIAMNCVARVPERRPKMAQVVRMIEGVRRFDS-GNRPSTEARSEGSTPTPVQ  627



>ref|XP_010097875.1| putative inactive receptor kinase [Morus notabilis]
 gb|EXB72472.1| putative inactive receptor kinase [Morus notabilis]
Length=640

 Score =   237 bits (605),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 112/167 (67%), Positives = 139/167 (83%), Gaps = 1/167 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIK+SNIFLNS+ YGCV+D GL  +M+S+ PPV RAAGYRAPEV DTRKA H +DVYSF
Sbjct  454  GNIKASNIFLNSQGYGCVADTGLVTLMNSMPPPVVRAAGYRAPEVTDTRKATHAADVYSF  513

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GVLLLELLTGKSPVH T  +E++HLVRWV++VVREEWTAEVFDV+LL+ P+IEEEMVEML
Sbjct  514  GVLLLELLTGKSPVHATGTEEVVHLVRWVNAVVREEWTAEVFDVQLLRYPNIEEEMVEML  573

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASRLS  224
            Q+ +SCV R+P++RPK+ +VVK +E VR+ +   NR S +   S +S
Sbjct  574  QLGMSCVARIPEKRPKINDVVKSLEEVRQFNS-GNRPSSDVTKSEIS  619



>ref|XP_008380496.1| PREDICTED: probable inactive receptor kinase At4g23740 [Malus 
domestica]
 ref|XP_008380504.1| PREDICTED: probable inactive receptor kinase At4g23740 [Malus 
domestica]
 ref|XP_008362797.1| PREDICTED: probable inactive receptor kinase At4g23740 [Malus 
domestica]
 ref|XP_008362798.1| PREDICTED: probable inactive receptor kinase At4g23740 [Malus 
domestica]
Length=624

 Score =   236 bits (601),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 107/149 (72%), Positives = 127/149 (85%), Gaps = 0/149 (0%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIK+SNIFLNS+ YGCV DVGL  +M    PP AR  GYRAPEV DTRK++  SDVYSF
Sbjct  443  GNIKASNIFLNSQGYGCVCDVGLPTLMGPTPPPAARTGGYRAPEVKDTRKSSPASDVYSF  502

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GVLLLELLTGKSP+HT  G+E++HLVRWV+SVVREEWTAEVFDV+LL+ P+IEEEMVEML
Sbjct  503  GVLLLELLTGKSPIHTIXGEEVVHLVRWVNSVVREEWTAEVFDVELLRYPNIEEEMVEML  562

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRR  278
            QI +SCV RMP+QRP MP++VK +E +R+
Sbjct  563  QIGMSCVARMPEQRPNMPDLVKRVEEIRQ  591



>ref|XP_009375580.1| PREDICTED: probable inactive receptor kinase At4g23740 [Pyrus 
x bretschneideri]
 ref|XP_009375581.1| PREDICTED: probable inactive receptor kinase At4g23740 [Pyrus 
x bretschneideri]
Length=624

 Score =   235 bits (600),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 106/149 (71%), Positives = 127/149 (85%), Gaps = 0/149 (0%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIK+SNIFLNS+ YGCV D GL  +M  + PP AR  GYRAPEV DTRK++  SDVYSF
Sbjct  443  GNIKASNIFLNSQGYGCVCDAGLPTLMGPMPPPAARTGGYRAPEVKDTRKSSPASDVYSF  502

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GVLLLELLTGKSP+HT  G+E++HLVRWV+SVVREEWTAEVFDV+LL+ P+IEEEMVEML
Sbjct  503  GVLLLELLTGKSPIHTIGGEEVVHLVRWVNSVVREEWTAEVFDVELLRYPNIEEEMVEML  562

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRR  278
            QI +SCV RMP+QRP MP++VK +E +R+
Sbjct  563  QIGMSCVARMPEQRPNMPDLVKRVEEIRQ  591



>ref|XP_009352112.1| PREDICTED: probable inactive receptor kinase At4g23740 [Pyrus 
x bretschneideri]
Length=623

 Score =   235 bits (600),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 106/149 (71%), Positives = 127/149 (85%), Gaps = 0/149 (0%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIK+SNIFLNS+ YGCV D GL  +M  + PP AR  GYRAPEV DTRK++  SDVYSF
Sbjct  443  GNIKASNIFLNSQGYGCVCDAGLPTLMGPMPPPAARTGGYRAPEVKDTRKSSPASDVYSF  502

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GVLLLELLTGKSP+HT  G+E++HLVRWV+SVVREEWTAEVFDV+LL+ P+IEEEMVEML
Sbjct  503  GVLLLELLTGKSPIHTIGGEEVVHLVRWVNSVVREEWTAEVFDVELLRYPNIEEEMVEML  562

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRR  278
            QI +SCV RMP+QRP MP++VK +E +R+
Sbjct  563  QIGMSCVARMPEQRPNMPDLVKRVEEIRQ  591



>gb|EYU25187.1| hypothetical protein MIMGU_mgv1a002923mg [Erythranthe guttata]
Length=625

 Score =   235 bits (599),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 105/148 (71%), Positives = 125/148 (84%), Gaps = 0/148 (0%)
 Frame = -2

Query  721  NIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFG  542
            NIK+SNIF+N + YGCVSD+GL+ +   ++PP+ R AGYRAPEV DTRK +  SDVYSFG
Sbjct  449  NIKASNIFINPQNYGCVSDLGLATLTCPVSPPLMRTAGYRAPEVTDTRKVSQASDVYSFG  508

Query  541  VLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQ  362
            V LLELLTGKSPV  T G+E+IHLVRWVHSVVREEWT EVFDV+LL+ P+IEEEMV MLQ
Sbjct  509  VFLLELLTGKSPVQATGGEEVIHLVRWVHSVVREEWTGEVFDVELLRYPNIEEEMVAMLQ  568

Query  361  IALSCVVRMPDQRPKMPEVVKMIEGVRR  278
            I LSCV RMP+QRPK+ +VVKM+EG+R 
Sbjct  569  IGLSCVARMPEQRPKIGDVVKMVEGIRN  596



>ref|XP_003602176.1| Leucine-rich repeat receptor-like protein kinase [Medicago truncatula]
Length=1088

 Score =   239 bits (611),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 114/171 (67%), Positives = 136/171 (80%), Gaps = 4/171 (2%)
 Frame = -2

Query  724   GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
             GNIK+SNIFLNS+ YGCVSD+GL  +MSS+    ARA GYRAPEV+DTRKA H SDVYSF
Sbjct  922   GNIKASNIFLNSQGYGCVSDIGLVTLMSSIPSQGARATGYRAPEVIDTRKATHSSDVYSF  981

Query  544   GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
             GVLLLELLTGK PV++T G++ +HLVRWV SVVREEWTAEVFD +LL+   IEEEMVEML
Sbjct  982   GVLLLELLTGKPPVYSTEGEQAVHLVRWVKSVVREEWTAEVFDTELLRYSSIEEEMVEML  1041

Query  364   QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASRLSPSSI  212
             QI ++C  RMPDQRPKM EVV+M+EG+R     ENR S     S++S  ++
Sbjct  1042  QIGMACAARMPDQRPKMAEVVRMMEGIRH----ENRPSSTESGSQVSTPTV  1088


 Score =   239 bits (609),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 115/171 (67%), Positives = 137/171 (80%), Gaps = 4/171 (2%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIK+SNIFLNS  YGCVSD GL+ +MSS+  P  RA+GYRAPEV DTRKA H SDVYSF
Sbjct  482  GNIKASNIFLNSHGYGCVSDTGLAVLMSSVPSPGTRASGYRAPEVTDTRKAVHSSDVYSF  541

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GVLLLELLTGKSP+++  G++ IHLVRWV+SVVREEWTAEVFDV+LL+  +IEEEMVEML
Sbjct  542  GVLLLELLTGKSPIYSLEGEQNIHLVRWVNSVVREEWTAEVFDVELLRYSNIEEEMVEML  601

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASRLSPSSI  212
            QI ++C  RMPDQRPKM EVV+M+EG+R     ENR S     S +S  ++
Sbjct  602  QIGMACAARMPDQRPKMSEVVRMVEGIRP----ENRPSSTESRSEVSTPTV  648



>ref|XP_010445167.1| PREDICTED: probable inactive receptor kinase At4g23740 [Camelina 
sativa]
Length=739

 Score =   235 bits (600),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 108/137 (79%), Positives = 127/137 (93%), Gaps = 0/137 (0%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIKSSNIFLNS++ GCVSD+GL+A+MS LAPP++R AGYRAPEV DTRK++  SDVYSF
Sbjct  464  GNIKSSNIFLNSERSGCVSDLGLTAVMSPLAPPISRQAGYRAPEVTDTRKSSQLSDVYSF  523

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GV+LLELLTGKSP+HTT+GDEIIHLVRWVHSVVREEWTAEVFD++LL+  +IEEEMVEML
Sbjct  524  GVVLLELLTGKSPIHTTAGDEIIHLVRWVHSVVREEWTAEVFDIELLRYANIEEEMVEML  583

Query  364  QIALSCVVRMPDQRPKM  314
            QIA+SCVV+  DQRPK+
Sbjct  584  QIAMSCVVKAADQRPKI  600


 Score =   190 bits (482),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 96/138 (70%), Positives = 114/138 (83%), Gaps = 4/138 (3%)
 Frame = -2

Query  613  AGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEW  434
            AGYRAPEV DTRK++  SDVYSFGV+LLELLTGKSP+HTT+GDEIIHLVRWVHSVVREEW
Sbjct  602  AGYRAPEVTDTRKSSQLSDVYSFGVVLLELLTGKSPIHTTAGDEIIHLVRWVHSVVREEW  661

Query  433  TAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRMPDQRPKMPEVVKMIEGV---RRNDHLE  263
            TAEVFD++LL+  +IEEEMVEMLQIA+SCVV+  DQRPKM ++V++IE V   R +   E
Sbjct  662  TAEVFDIELLRYANIEEEMVEMLQIAMSCVVKAADQRPKMSDLVRLIENVGNRRTSIEPE  721

Query  262  NRRSCENGASRLS-PSSI  212
            ++   EN AS  S PS I
Sbjct  722  SKPKSENEASEGSTPSEI  739



>ref|XP_004308019.1| PREDICTED: probable inactive receptor kinase At4g23740 [Fragaria 
vesca subsp. vesca]
Length=699

 Score =   234 bits (598),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 108/149 (72%), Positives = 127/149 (85%), Gaps = 0/149 (0%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIK+SN+FLN +  GCVSDVGL  +MS + PP  R  GYRAPEV DTRK+   SDVYSF
Sbjct  450  GNIKASNVFLNPQGSGCVSDVGLPTLMSPMPPPAVRNGGYRAPEVTDTRKSTPASDVYSF  509

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GVLLLELLTGKSP+HTT G+E+IHLVRWV+SVVREEWTAEVFDV+LL+ P+IEEEMVEML
Sbjct  510  GVLLLELLTGKSPIHTTGGEEVIHLVRWVNSVVREEWTAEVFDVELLRYPNIEEEMVEML  569

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRR  278
            QI +SCV RMP+QRPKM +VVK +E +R+
Sbjct  570  QIGMSCVARMPEQRPKMMDVVKKVEEIRQ  598



>gb|KHN08297.1| Putative inactive receptor kinase [Glycine soja]
Length=610

 Score =   233 bits (593),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 110/168 (65%), Positives = 134/168 (80%), Gaps = 4/168 (2%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIK+SNIFLNS+ YGC+SD+GL+ +M+    P  RA GYRAPE  DTRK    SDVYSF
Sbjct  433  GNIKASNIFLNSQGYGCLSDIGLATLMN----PALRATGYRAPEATDTRKTLPASDVYSF  488

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GVLLLELLTG+SP+H   GDE++HLVRWV+SVVREEWTAEVFDV L + P+IEEEMVEML
Sbjct  489  GVLLLELLTGRSPLHAKGGDEVVHLVRWVNSVVREEWTAEVFDVDLQRYPNIEEEMVEML  548

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASRLSP  221
            QI ++CVVR PDQRPK+ EVV+M+E +RR  + ENR S E+ +   +P
Sbjct  549  QIGMACVVRTPDQRPKIGEVVRMVEEIRRLINTENRSSTESRSEGSTP  596



>ref|XP_007137558.1| hypothetical protein PHAVU_009G136800g [Phaseolus vulgaris]
 ref|XP_007137559.1| hypothetical protein PHAVU_009G136800g [Phaseolus vulgaris]
 ref|XP_007137560.1| hypothetical protein PHAVU_009G136800g [Phaseolus vulgaris]
 gb|ESW09552.1| hypothetical protein PHAVU_009G136800g [Phaseolus vulgaris]
 gb|ESW09553.1| hypothetical protein PHAVU_009G136800g [Phaseolus vulgaris]
 gb|ESW09554.1| hypothetical protein PHAVU_009G136800g [Phaseolus vulgaris]
Length=626

 Score =   232 bits (591),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 103/149 (69%), Positives = 128/149 (86%), Gaps = 0/149 (0%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIK+SNIFLN + YGC+SD+GL+ +MS +  P  R  GYRAPE+ DTRKA   SDVYSF
Sbjct  446  GNIKASNIFLNVQGYGCISDIGLATLMSPVPVPAMRTTGYRAPEITDTRKATQASDVYSF  505

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GVLLLELLTGKSP+++T G++++HLVRWV+SVVREEWTAEVFDV+LL+  +IEEEMV ML
Sbjct  506  GVLLLELLTGKSPINSTEGEQVVHLVRWVNSVVREEWTAEVFDVELLRYANIEEEMVGML  565

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRR  278
            QI ++C VR+PDQRPKMP+VVKM+E +RR
Sbjct  566  QIGMACAVRIPDQRPKMPDVVKMVEEIRR  594



>ref|XP_006596280.1| PREDICTED: probable inactive receptor kinase At4g23740-like isoform 
X1 [Glycine max]
 ref|XP_006596281.1| PREDICTED: probable inactive receptor kinase At4g23740-like isoform 
X2 [Glycine max]
Length=623

 Score =   230 bits (586),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 109/168 (65%), Positives = 133/168 (79%), Gaps = 4/168 (2%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIK+SNIFLNS+ YGC+SD+GL+ +M+    P  RA GYRAPE  DTRK    SDVYSF
Sbjct  446  GNIKASNIFLNSQGYGCLSDIGLATLMN----PALRATGYRAPEATDTRKTLPASDVYSF  501

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GVLLLELLTG+SP+H   GDE++ LVRWV+SVVREEWTAEVFDV L + P+IEEEMVEML
Sbjct  502  GVLLLELLTGRSPLHAKGGDEVVQLVRWVNSVVREEWTAEVFDVDLQRYPNIEEEMVEML  561

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASRLSP  221
            QI ++CVVR PDQRPK+ EVV+M+E +RR  + ENR S E+ +   +P
Sbjct  562  QIGMACVVRTPDQRPKIGEVVRMVEEIRRLINTENRSSTESRSEGSTP  609



>ref|XP_011084477.1| PREDICTED: LOW QUALITY PROTEIN: probable inactive receptor kinase 
At4g23740 [Sesamum indicum]
Length=631

 Score =   229 bits (584),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 103/148 (70%), Positives = 126/148 (85%), Gaps = 0/148 (0%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GN+K+SNIFLNSKQYGCVSD+GL+ +M+ +AP + R  GYRAPEV DTRK +  SD+YSF
Sbjct  449  GNLKASNIFLNSKQYGCVSDLGLATLMNPIAPRLTRTPGYRAPEVTDTRKPSQASDIYSF  508

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GV++LELLTGKSPVH +  +E+IHLVRWV SVVREEWT EVFDV+LL+ P+IEEEMV ML
Sbjct  509  GVVILELLTGKSPVHASGREEVIHLVRWVQSVVREEWTGEVFDVELLRYPNIEEEMVAML  568

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVR  281
            QI +SCV RMP QRPK+ +VVKM+E +R
Sbjct  569  QIGMSCVARMPGQRPKIGDVVKMLEEIR  596



>ref|XP_010035197.1| PREDICTED: probable inactive receptor kinase At4g23740 [Eucalyptus 
grandis]
 gb|KCW46492.1| hypothetical protein EUGRSUZ_K00318 [Eucalyptus grandis]
Length=633

 Score =   228 bits (582),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 102/149 (68%), Positives = 127/149 (85%), Gaps = 0/149 (0%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIKSSNIFLNS+ +GCVSDV L+ +M+ +  P+ R +GYRAPE+ D+RK    SDVY F
Sbjct  451  GNIKSSNIFLNSEGFGCVSDVALAPLMNQIPLPLMRISGYRAPEITDSRKPTQASDVYGF  510

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GVLLLELLTGKSP+H TSGDE++HLVRWV SVVREEWTAEVFD+ LL+ P+IEEEMVEML
Sbjct  511  GVLLLELLTGKSPMHATSGDEMVHLVRWVSSVVREEWTAEVFDMVLLRFPNIEEEMVEML  570

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRR  278
            QI ++CV RMP+QRP+MP+V++ +E +RR
Sbjct  571  QIGMACVARMPEQRPRMPDVLRKVEEIRR  599



>ref|XP_007141021.1| hypothetical protein PHAVU_008G160700g [Phaseolus vulgaris]
 ref|XP_007141022.1| hypothetical protein PHAVU_008G160700g [Phaseolus vulgaris]
 gb|ESW13015.1| hypothetical protein PHAVU_008G160700g [Phaseolus vulgaris]
 gb|ESW13016.1| hypothetical protein PHAVU_008G160700g [Phaseolus vulgaris]
Length=623

 Score =   227 bits (579),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 111/174 (64%), Positives = 138/174 (79%), Gaps = 7/174 (4%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIKSSNIFLN + YGC+SD+GL+ +M+    P  R  GYRAPE  DTRK+   SDVYSF
Sbjct  447  GNIKSSNIFLNPRGYGCLSDIGLATLMN----PAMRTTGYRAPEATDTRKSVPASDVYSF  502

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GVLLLELLTG+ P+H   G+E++HLVRWV+SVVREEWTAEVFDV+LL+ P+IEEEMVEML
Sbjct  503  GVLLLELLTGRFPLHAKGGEEVVHLVRWVNSVVREEWTAEVFDVELLRYPNIEEEMVEML  562

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGA--SRLSPSSIE  209
            QI ++CVVR PDQRPK+ EVV+M+E +R+ +  ENR S E+ +  S  +P SIE
Sbjct  563  QIGMACVVRTPDQRPKIGEVVRMVEEIRKVN-TENRSSTESRSEGSTPTPHSIE  615



>ref|XP_004145918.2| PREDICTED: probable inactive receptor kinase At4g23740 [Cucumis 
sativus]
 gb|KGN49888.1| hypothetical protein Csa_5G139660 [Cucumis sativus]
Length=649

 Score =   224 bits (570),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 103/152 (68%), Positives = 127/152 (84%), Gaps = 3/152 (2%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIK+SN+FLNS  YGCV+D G++A+M+ +APP  R+AGYRAPE+ D+RKA+  SD YSF
Sbjct  457  GNIKASNVFLNSHGYGCVTDAGVAALMNLMAPPATRSAGYRAPELKDSRKASQASDTYSF  516

Query  544  GVLLLELLTGKSPVHT---TSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMV  374
            GV+LLELLTGK P+HT     GD+IIHLVRWV++VVREEWTAEVFDV+LL+ P+IEEEM+
Sbjct  517  GVVLLELLTGKFPLHTKGGNGGDQIIHLVRWVNAVVREEWTAEVFDVELLRYPNIEEEML  576

Query  373  EMLQIALSCVVRMPDQRPKMPEVVKMIEGVRR  278
            E LQIALSCV R+PD RP M +V   +EGVRR
Sbjct  577  ETLQIALSCVGRVPDDRPAMADVAARLEGVRR  608



>ref|XP_008437572.1| PREDICTED: probable inactive receptor kinase At4g23740 [Cucumis 
melo]
Length=650

 Score =   223 bits (569),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 103/152 (68%), Positives = 126/152 (83%), Gaps = 3/152 (2%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIK+SN+FLNS  YGCVSD G++A+M+ + PP  R+AGYRAPE+ D+RKA+  SD YSF
Sbjct  457  GNIKASNVFLNSHGYGCVSDAGVAALMNLMTPPATRSAGYRAPELKDSRKASQASDTYSF  516

Query  544  GVLLLELLTGKSPVHT---TSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMV  374
            GV+LLELLTGK P+HT     GD+IIHLVRWV++VVREEWTAEVFDV+LL+ P+IEEEM+
Sbjct  517  GVVLLELLTGKFPLHTKGGNGGDQIIHLVRWVNAVVREEWTAEVFDVELLRYPNIEEEML  576

Query  373  EMLQIALSCVVRMPDQRPKMPEVVKMIEGVRR  278
            E LQIALSCV R+PD RP M +V   +EGVRR
Sbjct  577  ETLQIALSCVGRVPDDRPAMADVAARLEGVRR  608



>ref|XP_009357339.1| PREDICTED: probable inactive receptor kinase At4g23740 [Pyrus 
x bretschneideri]
Length=627

 Score =   223 bits (567),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 107/149 (72%), Positives = 128/149 (86%), Gaps = 0/149 (0%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIK+SNIFLNS+ YGCV DVGL  +MS + PP  R  GYRAPEV DTRK+   SD+YSF
Sbjct  446  GNIKASNIFLNSQGYGCVCDVGLPPLMSPMPPPAVRTGGYRAPEVTDTRKSTPASDIYSF  505

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GVL+LELLTGKSP+HT+ G+E++HLVRWV+SVVREEWTAEVFDV+LLK P+IEEEMVEML
Sbjct  506  GVLILELLTGKSPIHTSGGEEVVHLVRWVNSVVREEWTAEVFDVELLKYPNIEEEMVEML  565

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRR  278
            QI +SCV RMP+QRPKM +VVK +E +R+
Sbjct  566  QIGMSCVARMPEQRPKMQDVVKRVEEIRQ  594



>ref|XP_009368693.1| PREDICTED: probable inactive receptor kinase At4g23740 [Pyrus 
x bretschneideri]
 ref|XP_009368694.1| PREDICTED: probable inactive receptor kinase At4g23740 [Pyrus 
x bretschneideri]
Length=630

 Score =   223 bits (567),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 107/149 (72%), Positives = 128/149 (86%), Gaps = 0/149 (0%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIK+SNIFLNS+ YGCV DVGL  +MS + PP  R  GYRAPEV DTRK+   SD+YSF
Sbjct  449  GNIKASNIFLNSQGYGCVCDVGLPPLMSPMPPPAVRTGGYRAPEVTDTRKSTPASDIYSF  508

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GVL+LELLTGKSP+HT+ G+E++HLVRWV+SVVREEWTAEVFDV+LLK P+IEEEMVEML
Sbjct  509  GVLILELLTGKSPIHTSGGEEVVHLVRWVNSVVREEWTAEVFDVELLKYPNIEEEMVEML  568

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRR  278
            QI +SCV RMP+QRPKM +VVK +E +R+
Sbjct  569  QIGMSCVARMPEQRPKMQDVVKRVEEIRQ  597



>ref|XP_004498388.1| PREDICTED: probable inactive receptor kinase At4g23740-like [Cicer 
arietinum]
Length=627

 Score =   221 bits (564),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 107/169 (63%), Positives = 132/169 (78%), Gaps = 3/169 (2%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIK+SNIFLNS+ YGC+SD+GL+ + S + PP  R  GY APEV D RKA   SDVYSF
Sbjct  449  GNIKASNIFLNSQGYGCISDIGLTTMTSPITPPTLRTTGYLAPEVTDARKATPASDVYSF  508

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GVLLLELLTGKSP+     +E++HLVRWV+SVVREEWTAEVFDV+LL+ P+IEEEMVEML
Sbjct  509  GVLLLELLTGKSPL--LGSEEVVHLVRWVNSVVREEWTAEVFDVELLRYPNIEEEMVEML  566

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASRLSPS  218
            QI ++CVV + DQRP M EVVKM+EG+ R +   NR S E+ +   +P+
Sbjct  567  QIGMACVVMIQDQRPNMDEVVKMVEGISRVNS-GNRPSTESRSENSTPT  614



>ref|NP_001042446.1| Os01g0223600 [Oryza sativa Japonica Group]
 dbj|BAF04360.1| Os01g0223600, partial [Oryza sativa Japonica Group]
Length=492

 Score =   218 bits (556),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 100/152 (66%), Positives = 130/152 (86%), Gaps = 2/152 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIK+SN+FLN++QYGCVSD+GL+++M+ +    +R+ GY APEV D+RKA+  SDVYSF
Sbjct  315  GNIKASNVFLNNQQYGCVSDLGLASLMNPITAR-SRSLGYCAPEVTDSRKASQCSDVYSF  373

Query  544  GVLLLELLTGKSPVH-TTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEM  368
            GV +LELLTG+SPV  T  G+E++HLVRWV SVVREEWTAEVFDV+L++ P+IEEEMVEM
Sbjct  374  GVFILELLTGRSPVQITGGGNEVVHLVRWVQSVVREEWTAEVFDVELMRYPNIEEEMVEM  433

Query  367  LQIALSCVVRMPDQRPKMPEVVKMIEGVRRND  272
            LQIA++CV R P++RPKM +VV+M+E VRR D
Sbjct  434  LQIAMACVSRTPERRPKMSDVVRMLEDVRRTD  465



>emb|CDY10964.1| BnaA03g46230D [Brassica napus]
Length=145

 Score =   207 bits (526),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 97/131 (74%), Positives = 116/131 (89%), Gaps = 1/131 (1%)
 Frame = -2

Query  646  MSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFGVLLLELLTGKSPVHTTSGDEIIHLV  467
            MS+LAPP++R AGYRAPEV DTRK++  SDVYSFGV+LLELLTGKSP+HTT+GDEIIHLV
Sbjct  1    MSALAPPISRQAGYRAPEVTDTRKSSQLSDVYSFGVVLLELLTGKSPIHTTAGDEIIHLV  60

Query  466  RWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQIALSCVVRMPDQRPKMPEVVKMIEG  287
            RWVHSVVREEWTAEVFDV+LL+  +IEEEMVEMLQIA+SCVV+ PDQRPKM ++V+++E 
Sbjct  61   RWVHSVVREEWTAEVFDVELLRYTNIEEEMVEMLQIAMSCVVKAPDQRPKMSDLVRLVES  120

Query  286  V-RRNDHLENR  257
            V  R   LE +
Sbjct  121  VGNRRASLETK  131



>ref|XP_011651421.1| PREDICTED: probable inactive receptor kinase At4g23740 [Cucumis 
sativus]
 gb|KGN57874.1| hypothetical protein Csa_3G358620 [Cucumis sativus]
Length=630

 Score =   220 bits (560),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 100/149 (67%), Positives = 127/149 (85%), Gaps = 0/149 (0%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GN+++SNIFLNSK YGCVSDVGL+ +M+S+  P  R  GYRAPE+ DTR+A+  +DVYSF
Sbjct  451  GNVRASNIFLNSKGYGCVSDVGLAGLMNSIPLPATRTPGYRAPELTDTRRASEAADVYSF  510

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GV+LLELLTGKSP+H    +E+++LVRWV+SVVREEWTAEVFDV+LL+ P+IEEEMVEML
Sbjct  511  GVVLLELLTGKSPIHVEGCNEVVNLVRWVNSVVREEWTAEVFDVELLRYPNIEEEMVEML  570

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRR  278
            QI LSCV +MP+QRPKM +++  IE VR+
Sbjct  571  QIGLSCVAKMPEQRPKMIDLMLRIEQVRQ  599



>ref|XP_006645650.1| PREDICTED: probable inactive receptor kinase At4g23740-like [Oryza 
brachyantha]
Length=655

 Score =   220 bits (561),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 104/152 (68%), Positives = 131/152 (86%), Gaps = 2/152 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIK+SNIFLNS+QYGCVSD+GL+++M+ +    +R+ GY APEV D+RKA+  SDVYSF
Sbjct  478  GNIKASNIFLNSQQYGCVSDLGLASLMNPITA-RSRSLGYCAPEVTDSRKASQCSDVYSF  536

Query  544  GVLLLELLTGKSPVH-TTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEM  368
            GV +LELLTG+SPV  T  G+E++HLVRWV SVVREEWTAEVFDV+L++ P+IEEEMVEM
Sbjct  537  GVFVLELLTGRSPVQITGGGNEVVHLVRWVQSVVREEWTAEVFDVELMRYPNIEEEMVEM  596

Query  367  LQIALSCVVRMPDQRPKMPEVVKMIEGVRRND  272
            LQIA++CV R P++RPKMP+VV+MIE VRR D
Sbjct  597  LQIAMTCVSRTPERRPKMPDVVRMIEEVRRID  628



>emb|CBI34446.3| unnamed protein product [Vitis vinifera]
Length=336

 Score =   213 bits (541),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 104/168 (62%), Positives = 126/168 (75%), Gaps = 24/168 (14%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIKSSNIFLN++ YGCVSD+GL+ +MS LAPP++RAA                      
Sbjct  180  GNIKSSNIFLNARGYGCVSDLGLTTVMSPLAPPISRAA----------------------  217

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
             V+LLELLTGKSP+H T GDE+IHLVRWVHSVVREEWTAEVFDV+L++ P+IEEEMVEML
Sbjct  218  -VVLLELLTGKSPIHATGGDEVIHLVRWVHSVVREEWTAEVFDVELMRYPNIEEEMVEML  276

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASRLSP  221
            QIA+ CV+RMPDQRPKMP+VV++IE VR  D  +NR S E  +   +P
Sbjct  277  QIAMGCVIRMPDQRPKMPDVVRLIENVRHTD-TDNRSSFETRSEGSTP  323



>ref|XP_008439323.1| PREDICTED: probable inactive receptor kinase At4g23740 [Cucumis 
melo]
 ref|XP_008439324.1| PREDICTED: probable inactive receptor kinase At4g23740 [Cucumis 
melo]
Length=631

 Score =   219 bits (557),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 99/149 (66%), Positives = 125/149 (84%), Gaps = 0/149 (0%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GN+++SNIFLNSK YGCVSDVGL+ +M+S+  P  R  GYRAPE+ DTR+ +  +DVYSF
Sbjct  452  GNVRASNIFLNSKGYGCVSDVGLAGLMNSIPLPATRTPGYRAPELTDTRRVSEAADVYSF  511

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GV+LLELLTGKSP+H    +E+++LVRWV+SVVREEWTAEVFDV+LL+ P+IEEEMVEML
Sbjct  512  GVVLLELLTGKSPIHVEGCNEVVNLVRWVNSVVREEWTAEVFDVELLRYPNIEEEMVEML  571

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRR  278
            QI LSCV +MP+QRPKM ++   IE VR+
Sbjct  572  QIGLSCVAKMPEQRPKMIDLTSRIEQVRQ  600



>gb|KHN24722.1| Putative inactive receptor kinase, partial [Glycine soja]
Length=327

 Score =   210 bits (535),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 102/167 (61%), Positives = 131/167 (78%), Gaps = 2/167 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIKSSN+ LN    GC+SD GL+ +M+  A P +RAAGYRAPEV++TRK +H SDVYSF
Sbjct  158  GNIKSSNVLLNQDNDGCISDFGLAPLMNVPATP-SRAAGYRAPEVIETRKHSHKSDVYSF  216

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GVLLLE+LTGK+P+ +   D+++ L RWV SVVREEWTAEVFDV+L++  +IEEEMV+ML
Sbjct  217  GVLLLEMLTGKAPLQSPGRDDMVDLPRWVQSVVREEWTAEVFDVELMRYQNIEEEMVQML  276

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASRLS  224
            QIA++CV +MPD RP M E V+MIE +R++D  ENR S E   S+ S
Sbjct  277  QIAMACVAKMPDMRPSMDEAVRMIEEIRQSDS-ENRPSSEENKSKDS  322



>gb|KEH40435.1| LRR receptor-like kinase [Medicago truncatula]
Length=584

 Score =   216 bits (551),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 106/169 (63%), Positives = 138/169 (82%), Gaps = 5/169 (3%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIK+SNIFLNSK YGC+SD+GL+ +++S   P  RAAGY APEV +TRK+   SDVYSF
Sbjct  414  GNIKASNIFLNSKGYGCISDIGLATMITSPISP--RAAGYLAPEVTETRKSTPASDVYSF  471

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GVLLLELLTGKSP+H   G+E++HLVRWV+SVVREEWT+EVFD+ LL+ P+IEEEMVEML
Sbjct  472  GVLLLELLTGKSPLH--GGEEVVHLVRWVNSVVREEWTSEVFDLVLLRYPNIEEEMVEML  529

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASRLSPS  218
            QI ++CVVR+ D+RPKM EVV+++E +R+ +   NR S E+ +   +P+
Sbjct  530  QIGMACVVRLHDERPKMDEVVRLVEEIRKVNS-GNRTSTESRSECSTPT  577



>gb|EYU36892.1| hypothetical protein MIMGU_mgv1a0177021mg, partial [Erythranthe 
guttata]
Length=208

 Score =   206 bits (523),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 103/167 (62%), Positives = 128/167 (77%), Gaps = 2/167 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIKSSN+ LN    GCVSD GL+ +M+  A   +R+AGYRAPEVV+TRK  H SDVYSF
Sbjct  39   GNIKSSNVLLNQDLEGCVSDFGLAPLMNHPAT-TSRSAGYRAPEVVETRKHTHKSDVYSF  97

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GV+LLE+LTGK P  + + D+II L RWV SVVREEWTAEVFDV+L++  +IEEEMV+ML
Sbjct  98   GVILLEMLTGKQPTSSPARDDIIDLPRWVQSVVREEWTAEVFDVELMRFQNIEEEMVQML  157

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASRLS  224
            QIA++CV + PD RP M EVV+MIE VR++D  ENR S +   S+ S
Sbjct  158  QIAMACVAKAPDMRPNMDEVVRMIEEVRQSDS-ENRPSSDENKSKDS  203



>gb|EMT08914.1| Putative inactive receptor kinase [Aegilops tauschii]
Length=448

 Score =   213 bits (542),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 100/152 (66%), Positives = 127/152 (84%), Gaps = 2/152 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIK+SN+FLNS+QYGC+SD+GL+ +M+ +    +R+ GY APE+ DTRK+   SDVYSF
Sbjct  271  GNIKASNVFLNSQQYGCISDLGLAPLMNPITAR-SRSLGYCAPEITDTRKSTQCSDVYSF  329

Query  544  GVLLLELLTGKSPVHTTSG-DEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEM  368
            GV +LELLTGKSPV  T G +E++HLVRWV SVVREEWTAEVFD +L++ P+IEEEMVEM
Sbjct  330  GVFVLELLTGKSPVQVTGGGNEVVHLVRWVQSVVREEWTAEVFDGELMRYPNIEEEMVEM  389

Query  367  LQIALSCVVRMPDQRPKMPEVVKMIEGVRRND  272
            LQIA++CV R P++RPKM ++VKMIE V RND
Sbjct  390  LQIAMACVSRNPERRPKMLDMVKMIEEVGRND  421



>dbj|BAA94519.1| putative receptor-like kinase [Oryza sativa Japonica Group]
 dbj|BAB07903.1| putative receptor-like kinase [Oryza sativa Japonica Group]
 gb|EEC70208.1| hypothetical protein OsI_00955 [Oryza sativa Indica Group]
Length=641

 Score =   217 bits (552),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 100/152 (66%), Positives = 130/152 (86%), Gaps = 2/152 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIK+SN+FLN++QYGCVSD+GL+++M+ +    +R+ GY APEV D+RKA+  SDVYSF
Sbjct  464  GNIKASNVFLNNQQYGCVSDLGLASLMNPITAR-SRSLGYCAPEVTDSRKASQCSDVYSF  522

Query  544  GVLLLELLTGKSPVH-TTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEM  368
            GV +LELLTG+SPV  T  G+E++HLVRWV SVVREEWTAEVFDV+L++ P+IEEEMVEM
Sbjct  523  GVFILELLTGRSPVQITGGGNEVVHLVRWVQSVVREEWTAEVFDVELMRYPNIEEEMVEM  582

Query  367  LQIALSCVVRMPDQRPKMPEVVKMIEGVRRND  272
            LQIA++CV R P++RPKM +VV+M+E VRR D
Sbjct  583  LQIAMACVSRTPERRPKMSDVVRMLEDVRRTD  614



>gb|KHN40997.1| Putative inactive receptor kinase [Glycine soja]
Length=253

 Score =   203 bits (517),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 99/165 (60%), Positives = 128/165 (78%), Gaps = 2/165 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GN+KSSN+ LN    GC+SD GL+ +M+  A P +RAAGYRAPEV++TRK  H SDVYSF
Sbjct  83   GNVKSSNVLLNHDNDGCISDFGLTPLMNVPATP-SRAAGYRAPEVIETRKHTHKSDVYSF  141

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            G+LLLE+LTGK+P  +   D+++ L RWV SVVREEWTAEVFDV+L++  +IEEEMV+ML
Sbjct  142  GILLLEMLTGKAPQQSPGRDDMVDLPRWVQSVVREEWTAEVFDVELMRYQNIEEEMVQML  201

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASR  230
            QIA++CV ++PD RP M EVV+MIE +R +D  ENR S E   S+
Sbjct  202  QIAMACVAKVPDMRPSMDEVVRMIEEIRLSDS-ENRPSSEENRSK  245



>gb|KHN30614.1| Putative inactive receptor kinase [Glycine soja]
Length=253

 Score =   203 bits (517),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 99/165 (60%), Positives = 128/165 (78%), Gaps = 2/165 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GN+KSSN+ LN    GC+SD GL+ +M+  + P +RAAGYRAPEV++TRK  H SDVYSF
Sbjct  83   GNVKSSNVLLNQDNDGCISDFGLTPLMNVPSTP-SRAAGYRAPEVIETRKHTHKSDVYSF  141

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GVLLLE+LTGK+P  +   D+++ L RWV SVVREEWTAEVFDV+L++  +IEEEMV+ML
Sbjct  142  GVLLLEMLTGKAPQQSPGRDDMVDLPRWVQSVVREEWTAEVFDVELMRYQNIEEEMVQML  201

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASR  230
            QIA++CV ++PD RP M EVV+MIE +R +D  ENR S E   S+
Sbjct  202  QIAMACVAKVPDMRPSMEEVVRMIEEIRLSDS-ENRPSSEENRSK  245



>gb|KEH34523.1| LRR receptor-like kinase [Medicago truncatula]
Length=650

 Score =   213 bits (543),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 103/165 (62%), Positives = 132/165 (80%), Gaps = 2/165 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIKSSN+ LN    GC+SD GL+++M+  A P +RAAGYRAPEV++TRK +H SDVYSF
Sbjct  481  GNIKSSNVLLNQDNDGCISDFGLASLMNVPANP-SRAAGYRAPEVIETRKHSHKSDVYSF  539

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GVLLLE+LTGK+P+ +   D+++ L RWV SVVREEWTAEVFDV+L++  +IEEEMV+ML
Sbjct  540  GVLLLEMLTGKAPLQSPGRDDMVDLPRWVQSVVREEWTAEVFDVELMRYQNIEEEMVQML  599

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASR  230
            QIA++CV +MPD RP M EVVKMIE +R++D  ENR S E   S+
Sbjct  600  QIAMACVAKMPDMRPNMDEVVKMIEEIRQSDS-ENRPSSEENKSK  643



>ref|XP_003600547.1| Leucine-rich repeat receptor-like protein kinase [Medicago truncatula]
 gb|AES70798.1| LRR receptor-like kinase [Medicago truncatula]
Length=660

 Score =   213 bits (542),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 103/165 (62%), Positives = 132/165 (80%), Gaps = 2/165 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIKSSN+ LN    GC+SD GL+++M+  A P +RAAGYRAPEV++TRK +H SDVYSF
Sbjct  491  GNIKSSNVLLNQDNDGCISDFGLASLMNVPANP-SRAAGYRAPEVIETRKHSHKSDVYSF  549

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GVLLLE+LTGK+P+ +   D+++ L RWV SVVREEWTAEVFDV+L++  +IEEEMV+ML
Sbjct  550  GVLLLEMLTGKAPLQSPGRDDMVDLPRWVQSVVREEWTAEVFDVELMRYQNIEEEMVQML  609

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASR  230
            QIA++CV +MPD RP M EVVKMIE +R++D  ENR S E   S+
Sbjct  610  QIAMACVAKMPDMRPNMDEVVKMIEEIRQSDS-ENRPSSEENKSK  653



>ref|XP_003565740.1| PREDICTED: probable inactive receptor kinase At4g23740 [Brachypodium 
distachyon]
Length=637

 Score =   213 bits (541),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 98/152 (64%), Positives = 128/152 (84%), Gaps = 2/152 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIK+SN+FLNS+QYGC+SD+GL+++M+ +    +R+ GY APE+ DTRK+   SDVYSF
Sbjct  460  GNIKASNVFLNSQQYGCISDLGLASLMNPITA-RSRSLGYCAPEITDTRKSTQCSDVYSF  518

Query  544  GVLLLELLTGKSPVH-TTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEM  368
            GV +LELLTGKSPV  T  G+E++HLVRWV SVVREEWTAEVFD +L++ P+IEEEMVEM
Sbjct  519  GVFILELLTGKSPVQITGGGNEVVHLVRWVQSVVREEWTAEVFDGELMRYPNIEEEMVEM  578

Query  367  LQIALSCVVRMPDQRPKMPEVVKMIEGVRRND  272
            LQIA++CV R P++RPKM ++V+M+E V RND
Sbjct  579  LQIAMACVSRTPERRPKMSDMVRMLEEVGRND  610



>emb|CDP04037.1| unnamed protein product [Coffea canephora]
Length=252

 Score =   203 bits (516),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 101/167 (60%), Positives = 129/167 (77%), Gaps = 2/167 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GN+KSSN+ LN    GCVSD+GL+ +M+  A   +R AGYRAPEV++TRK  H SDVYSF
Sbjct  83   GNVKSSNVLLNQDLDGCVSDLGLAPLMNFPAT-RSRQAGYRAPEVMETRKHTHKSDVYSF  141

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GVLLLE+LTGK P+ +   D+++ L RWV SVVREEWTAEVFDV+L++  +IEEEMV+ML
Sbjct  142  GVLLLEMLTGKQPIQSPGRDDMVDLPRWVQSVVREEWTAEVFDVELMRFQNIEEEMVQML  201

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASRLS  224
            QIA++CV ++PD RP M EVV+MIE VR++D  ENR S E   S+ S
Sbjct  202  QIAMACVAKVPDMRPNMDEVVRMIEEVRQSDS-ENRPSSEENKSKDS  247



>dbj|BAJ94608.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ86409.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=637

 Score =   212 bits (540),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 100/152 (66%), Positives = 127/152 (84%), Gaps = 2/152 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIK+SN+FLNS+QYGC++D+GL+ +M+ +    +R+ GY APEV DTRK+   SDVYSF
Sbjct  460  GNIKASNVFLNSQQYGCIADLGLAPLMNPITAR-SRSLGYCAPEVTDTRKSTQSSDVYSF  518

Query  544  GVLLLELLTGKSPVHTTSG-DEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEM  368
            GV +LELLTGKSPV  T G +E++HLVRWV SVVREEWTAEVFD +L++ P+IEEEMVEM
Sbjct  519  GVFVLELLTGKSPVQVTGGGNEVVHLVRWVQSVVREEWTAEVFDGELMRYPNIEEEMVEM  578

Query  367  LQIALSCVVRMPDQRPKMPEVVKMIEGVRRND  272
            LQIA++CV R P++RPKM ++VKMIE V RND
Sbjct  579  LQIAMACVSRNPERRPKMVDMVKMIEEVGRND  610



>ref|XP_004500388.1| PREDICTED: probable inactive receptor kinase At5g58300-like [Cicer 
arietinum]
Length=647

 Score =   212 bits (540),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 103/165 (62%), Positives = 131/165 (79%), Gaps = 2/165 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIKSSN+ LN    GC+SD GL+A+M+  A P +RAAGYRAPEV++TRK +H SDVYSF
Sbjct  478  GNIKSSNVLLNQDNDGCISDFGLAALMNVPATP-SRAAGYRAPEVIETRKHSHKSDVYSF  536

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GVLLLE+LTGK+P+ +   D+++ L RWV SVVREEWTAEVFDV+L++  +IEEEMV+ML
Sbjct  537  GVLLLEMLTGKAPLQSPGRDDMVDLPRWVQSVVREEWTAEVFDVELMRYQNIEEEMVQML  596

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASR  230
            QIA++CV +MPD RP M EVV+MIE +R +D  ENR S E   S+
Sbjct  597  QIAMACVAKMPDMRPSMDEVVRMIEEIRLSDS-ENRPSSEENKSK  640



>ref|XP_002454913.1| hypothetical protein SORBIDRAFT_03g001310 [Sorghum bicolor]
 gb|EES00033.1| hypothetical protein SORBIDRAFT_03g001310 [Sorghum bicolor]
Length=560

 Score =   210 bits (535),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 99/152 (65%), Positives = 126/152 (83%), Gaps = 2/152 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIK+SN+F+N  +YGC+SD+GL+ +M+ +    +R+ GY APEV DTRKA+  SDVYSF
Sbjct  379  GNIKASNVFINKHEYGCISDLGLALLMNPITAR-SRSLGYCAPEVADTRKASQSSDVYSF  437

Query  544  GVLLLELLTGKSPVH-TTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEM  368
            GV +LELLTGKSPV  T  G+E++HLVRWV SVVREEWTAEVFD +LL+ P+IEEEMVEM
Sbjct  438  GVFILELLTGKSPVQITGGGNEVVHLVRWVQSVVREEWTAEVFDGELLRYPNIEEEMVEM  497

Query  367  LQIALSCVVRMPDQRPKMPEVVKMIEGVRRND  272
            LQIA++CV R P++RPKM +VV+ IE VRR+D
Sbjct  498  LQIAMACVSRTPERRPKMADVVRTIEEVRRSD  529



>ref|XP_007146903.1| hypothetical protein PHAVU_006G080200g [Phaseolus vulgaris]
 gb|ESW18897.1| hypothetical protein PHAVU_006G080200g [Phaseolus vulgaris]
Length=657

 Score =   211 bits (537),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 102/165 (62%), Positives = 132/165 (80%), Gaps = 2/165 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIKSSN+ LN    GC+SD GL+++M+  A P +RAAGYRAPEVV+TRK +H SDVYSF
Sbjct  488  GNIKSSNVLLNQDNDGCISDFGLASLMNVPATP-SRAAGYRAPEVVETRKHSHKSDVYSF  546

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GVLLLE+LTGK+P+ +   D+++ L RWV SVVREEWTAEVFDV+L++  +IEEEMV+ML
Sbjct  547  GVLLLEMLTGKAPLQSPGRDDMVDLPRWVQSVVREEWTAEVFDVELMRYQNIEEEMVQML  606

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASR  230
            QIA++CV +MPD RP M EVV++IE +R++D  ENR S E   S+
Sbjct  607  QIAMACVAKMPDMRPSMDEVVRLIEEIRQSDS-ENRPSSEENKSK  650



>gb|EPS62971.1| hypothetical protein M569_11816, partial [Genlisea aurea]
Length=566

 Score =   209 bits (532),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 100/151 (66%), Positives = 125/151 (83%), Gaps = 3/151 (2%)
 Frame = -2

Query  724  GNIKSSNIFLN-SKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYS  548
            GN+K SN+FLN   + GC+SD+GL+ +M SL+P  AR+AG+RAPE+ DTR+A  PSDVYS
Sbjct  416  GNLKLSNVFLNPDTKLGCISDIGLATVMPSLSPSAARSAGHRAPEIADTRRATQPSDVYS  475

Query  547  FGVLLLELLTGKSPV-HTTSGD-EIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMV  374
            FGV+LLELLT KSPV H   GD E++HLVRWVH+VV+EEWTAEVFDV+LL + ++EEE+V
Sbjct  476  FGVILLELLTAKSPVVHAAGGDDEVVHLVRWVHAVVQEEWTAEVFDVELLGMGNVEEELV  535

Query  373  EMLQIALSCVVRMPDQRPKMPEVVKMIEGVR  281
            E LQIAL+CV   P+QRPKM EVV+MIE VR
Sbjct  536  ETLQIALACVATAPEQRPKMAEVVRMIEDVR  566



>emb|CDP13882.1| unnamed protein product [Coffea canephora]
Length=639

 Score =   210 bits (534),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 102/167 (61%), Positives = 132/167 (79%), Gaps = 2/167 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIKSSN+ LN +Q GC++D GL+ +M+SL     R  GY APEV++TRKA   SDVYSF
Sbjct  470  GNIKSSNVLLNKEQDGCITDFGLNPVMNSLGVKT-RGIGYHAPEVIETRKATQKSDVYSF  528

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GVLLLE+LTGKSP+H++  D++I L RWV SVVREEWTAEVFDV+L+K  ++EEEMV+ML
Sbjct  529  GVLLLEMLTGKSPIHSSGHDDVIDLPRWVRSVVREEWTAEVFDVELMKYQNVEEEMVQML  588

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASRLS  224
            QIALSCV + PD RP M EVV+++E +R+++ LENR S E+  S+ S
Sbjct  589  QIALSCVAKAPDMRPSMDEVVRLMEDIRQSE-LENRPSSEDNRSKGS  634



>gb|KJB52637.1| hypothetical protein B456_008G271600 [Gossypium raimondii]
Length=620

 Score =   209 bits (533),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 106/179 (59%), Positives = 128/179 (72%), Gaps = 17/179 (9%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIK+SNIFLNS++YGCVSD+GL+A+MS +  PV RAAGYRAPEV DTRKA   SDVYSF
Sbjct  450  GNIKASNIFLNSERYGCVSDIGLAAVMSPMPLPVMRAAGYRAPEVTDTRKATQASDVYSF  509

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GV LLELLTGKSP+H T G+EI              WTAEVFDV+LL+ P+IEEEMVEML
Sbjct  510  GVFLLELLTGKSPIHATGGEEI--------------WTAEVFDVELLRYPNIEEEMVEML  555

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRR---NDHLENRRSCENGASRLSPSSIEQECS  197
            QIA+SCV R+ +QRPKM  +VKM+E +RR    + L      E  AS   P ++ +  S
Sbjct  556  QIAMSCVARVAEQRPKMAGLVKMVEEIRRVNNGNQLSFEAKSETSASTSIPHAVAETAS  614



>ref|XP_003537367.2| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X1 [Glycine max]
 ref|XP_006591268.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X2 [Glycine max]
Length=671

 Score =   210 bits (534),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 101/165 (61%), Positives = 130/165 (79%), Gaps = 2/165 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIKSSN+ LN    GC+SD GL+ +M+  A P +RAAGYRAPEV++TRK +H SDVYSF
Sbjct  502  GNIKSSNVLLNQDNDGCISDFGLAPLMNVPATP-SRAAGYRAPEVIETRKHSHKSDVYSF  560

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GVLLLE+LTGK+P+ +   D+++ L RWV SVVREEWTAEVFDV+L++  +IEEEMV+ML
Sbjct  561  GVLLLEMLTGKAPLQSPGRDDMVDLPRWVQSVVREEWTAEVFDVELMRYQNIEEEMVQML  620

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASR  230
            QIA++CV +MPD RP M E V+MIE +R++D  ENR S E   S+
Sbjct  621  QIAMACVAKMPDMRPSMDEAVRMIEEIRQSDS-ENRPSSEENKSK  664



>ref|XP_006591269.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X3 [Glycine max]
Length=670

 Score =   210 bits (534),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 101/165 (61%), Positives = 130/165 (79%), Gaps = 2/165 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIKSSN+ LN    GC+SD GL+ +M+  A P +RAAGYRAPEV++TRK +H SDVYSF
Sbjct  501  GNIKSSNVLLNQDNDGCISDFGLAPLMNVPATP-SRAAGYRAPEVIETRKHSHKSDVYSF  559

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GVLLLE+LTGK+P+ +   D+++ L RWV SVVREEWTAEVFDV+L++  +IEEEMV+ML
Sbjct  560  GVLLLEMLTGKAPLQSPGRDDMVDLPRWVQSVVREEWTAEVFDVELMRYQNIEEEMVQML  619

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASR  230
            QIA++CV +MPD RP M E V+MIE +R++D  ENR S E   S+
Sbjct  620  QIAMACVAKMPDMRPSMDEAVRMIEEIRQSDS-ENRPSSEENKSK  663



>gb|KHN18649.1| Putative inactive receptor kinase [Glycine soja]
Length=585

 Score =   207 bits (528),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 100/165 (61%), Positives = 129/165 (78%), Gaps = 2/165 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIKSSN+ LN    GC+SD GL+ +M+  A P +R AGYRAPEV++ RK +H SDVYSF
Sbjct  419  GNIKSSNVLLNQDNDGCISDFGLAPLMNVPATP-SRTAGYRAPEVIEARKHSHKSDVYSF  477

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GVLLLE+LTGK+P+ +   D+++ L RWV SVVREEWTAEVFDV+L++  +IEEEMV+ML
Sbjct  478  GVLLLEMLTGKAPLQSPGRDDMVDLPRWVQSVVREEWTAEVFDVELMRYQNIEEEMVQML  537

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASR  230
            QIA++CV +MPD RP M EVV+MIE +R++D  ENR S E   S+
Sbjct  538  QIAMACVAKMPDMRPSMDEVVRMIEEIRQSDS-ENRPSSEENKSK  581



>ref|XP_002533837.1| Nodulation receptor kinase precursor, putative [Ricinus communis]
 gb|EEF28551.1| Nodulation receptor kinase precursor, putative [Ricinus communis]
Length=635

 Score =   208 bits (530),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 100/165 (61%), Positives = 130/165 (79%), Gaps = 2/165 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIKSSN+ LN    GC+SD GL+ +M+  A P +R+AGYRAPEV++TRK  H SDVYSF
Sbjct  466  GNIKSSNVLLNQDHDGCISDFGLTPLMNVPATP-SRSAGYRAPEVIETRKHTHKSDVYSF  524

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GVLLLE+LTGK+P+ + S D+++ L RWV SVVREEWTAEVFDV+L++  +IEEEMV+ML
Sbjct  525  GVLLLEMLTGKAPLQSPSRDDMVDLPRWVQSVVREEWTAEVFDVELMRYQNIEEEMVQML  584

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASR  230
            QI ++CV ++PD RP M EVV+MIE +R++D  ENR S E   S+
Sbjct  585  QIGMACVAKVPDMRPNMDEVVRMIEEIRQSDS-ENRPSSEENKSK  628



>ref|XP_011084790.1| PREDICTED: probable inactive receptor kinase At5g58300 [Sesamum 
indicum]
 ref|XP_011084791.1| PREDICTED: probable inactive receptor kinase At5g58300 [Sesamum 
indicum]
 ref|XP_011084792.1| PREDICTED: probable inactive receptor kinase At5g58300 [Sesamum 
indicum]
 ref|XP_011084793.1| PREDICTED: probable inactive receptor kinase At5g58300 [Sesamum 
indicum]
 ref|XP_011084794.1| PREDICTED: probable inactive receptor kinase At5g58300 [Sesamum 
indicum]
 ref|XP_011084795.1| PREDICTED: probable inactive receptor kinase At5g58300 [Sesamum 
indicum]
 ref|XP_011084796.1| PREDICTED: probable inactive receptor kinase At5g58300 [Sesamum 
indicum]
 ref|XP_011084797.1| PREDICTED: probable inactive receptor kinase At5g58300 [Sesamum 
indicum]
 ref|XP_011084800.1| PREDICTED: probable inactive receptor kinase At5g58300 [Sesamum 
indicum]
Length=635

 Score =   208 bits (530),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 103/165 (62%), Positives = 131/165 (79%), Gaps = 2/165 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIKSSNI LN+   GCVSD GLS +M+ + P   R AGYRAPEV++TRK +  +DVYSF
Sbjct  466  GNIKSSNILLNASLDGCVSDFGLSPMMNYI-PIKYRVAGYRAPEVIETRKVSQKADVYSF  524

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GV+LLE+LTGKSP+  T  D+++ L RWV SVVREEWTAEVFDV+L+K  +IEEEMV+ML
Sbjct  525  GVVLLEMLTGKSPIQYTGYDDVVDLPRWVRSVVREEWTAEVFDVELMKYQNIEEEMVQML  584

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASR  230
            QIAL+CV ++PD RP M EVV+MIE +R+++ LENR S E+  S+
Sbjct  585  QIALACVAKVPDMRPSMDEVVRMIEDIRQSE-LENRPSSEDNRSK  628



>ref|XP_006602052.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X5 [Glycine max]
Length=640

 Score =   207 bits (528),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 100/165 (61%), Positives = 129/165 (78%), Gaps = 2/165 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIKSSN+ LN    GC+SD GL+ +M+  A P +R AGYRAPEV++ RK +H SDVYSF
Sbjct  474  GNIKSSNVLLNQDNDGCISDFGLAPLMNVPATP-SRTAGYRAPEVIEARKHSHKSDVYSF  532

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GVLLLE+LTGK+P+ +   D+++ L RWV SVVREEWTAEVFDV+L++  +IEEEMV+ML
Sbjct  533  GVLLLEMLTGKAPLQSPGRDDMVDLPRWVQSVVREEWTAEVFDVELMRYQNIEEEMVQML  592

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASR  230
            QIA++CV +MPD RP M EVV+MIE +R++D  ENR S E   S+
Sbjct  593  QIAMACVAKMPDMRPSMDEVVRMIEEIRQSDS-ENRPSSEENKSK  636



>ref|XP_003553192.2| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X1 [Glycine max]
 ref|XP_006602051.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X4 [Glycine max]
Length=654

 Score =   207 bits (528),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 100/165 (61%), Positives = 129/165 (78%), Gaps = 2/165 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIKSSN+ LN    GC+SD GL+ +M+  A P +R AGYRAPEV++ RK +H SDVYSF
Sbjct  488  GNIKSSNVLLNQDNDGCISDFGLAPLMNVPATP-SRTAGYRAPEVIEARKHSHKSDVYSF  546

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GVLLLE+LTGK+P+ +   D+++ L RWV SVVREEWTAEVFDV+L++  +IEEEMV+ML
Sbjct  547  GVLLLEMLTGKAPLQSPGRDDMVDLPRWVQSVVREEWTAEVFDVELMRYQNIEEEMVQML  606

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASR  230
            QIA++CV +MPD RP M EVV+MIE +R++D  ENR S E   S+
Sbjct  607  QIAMACVAKMPDMRPSMDEVVRMIEEIRQSDS-ENRPSSEENKSK  650



>ref|XP_006602050.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X3 [Glycine max]
Length=667

 Score =   208 bits (529),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 100/165 (61%), Positives = 129/165 (78%), Gaps = 2/165 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIKSSN+ LN    GC+SD GL+ +M+  A P +R AGYRAPEV++ RK +H SDVYSF
Sbjct  501  GNIKSSNVLLNQDNDGCISDFGLAPLMNVPATP-SRTAGYRAPEVIEARKHSHKSDVYSF  559

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GVLLLE+LTGK+P+ +   D+++ L RWV SVVREEWTAEVFDV+L++  +IEEEMV+ML
Sbjct  560  GVLLLEMLTGKAPLQSPGRDDMVDLPRWVQSVVREEWTAEVFDVELMRYQNIEEEMVQML  619

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASR  230
            QIA++CV +MPD RP M EVV+MIE +R++D  ENR S E   S+
Sbjct  620  QIAMACVAKMPDMRPSMDEVVRMIEEIRQSDS-ENRPSSEENKSK  663



>ref|XP_006602049.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X2 [Glycine max]
Length=668

 Score =   208 bits (529),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 100/165 (61%), Positives = 129/165 (78%), Gaps = 2/165 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIKSSN+ LN    GC+SD GL+ +M+  A P +R AGYRAPEV++ RK +H SDVYSF
Sbjct  502  GNIKSSNVLLNQDNDGCISDFGLAPLMNVPATP-SRTAGYRAPEVIEARKHSHKSDVYSF  560

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GVLLLE+LTGK+P+ +   D+++ L RWV SVVREEWTAEVFDV+L++  +IEEEMV+ML
Sbjct  561  GVLLLEMLTGKAPLQSPGRDDMVDLPRWVQSVVREEWTAEVFDVELMRYQNIEEEMVQML  620

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASR  230
            QIA++CV +MPD RP M EVV+MIE +R++D  ENR S E   S+
Sbjct  621  QIAMACVAKMPDMRPSMDEVVRMIEEIRQSDS-ENRPSSEENKSK  664



>ref|XP_012077868.1| PREDICTED: probable inactive receptor kinase At5g58300 [Jatropha 
curcas]
 ref|XP_012077874.1| PREDICTED: probable inactive receptor kinase At5g58300 [Jatropha 
curcas]
 ref|XP_012077878.1| PREDICTED: probable inactive receptor kinase At5g58300 [Jatropha 
curcas]
 ref|XP_012077884.1| PREDICTED: probable inactive receptor kinase At5g58300 [Jatropha 
curcas]
 ref|XP_012077889.1| PREDICTED: probable inactive receptor kinase At5g58300 [Jatropha 
curcas]
 gb|KDP45679.1| hypothetical protein JCGZ_17286 [Jatropha curcas]
Length=634

 Score =   207 bits (527),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 99/165 (60%), Positives = 131/165 (79%), Gaps = 2/165 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIKSSN+ LN +  GC+SD GL+ +M+  A P +R+AGYRAPEV++TRK  H SDVYSF
Sbjct  465  GNIKSSNVLLNQEHDGCISDFGLTPLMNVPATP-SRSAGYRAPEVIETRKHTHKSDVYSF  523

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GVLLLE+LTGK+P+ + + D+++ L RWV SVVREEWTAEVFDV+L++  +IEEEMV+ML
Sbjct  524  GVLLLEMLTGKAPLQSPARDDMVDLPRWVQSVVREEWTAEVFDVELMRYQNIEEEMVQML  583

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASR  230
            QI ++CV ++PD RP M EVV+MIE +R++D  ENR S E   S+
Sbjct  584  QIGMACVAKVPDMRPNMDEVVRMIEEIRQSDS-ENRPSSEENKSK  627



>ref|XP_004967473.1| PREDICTED: probable inactive receptor kinase At4g23740-like [Setaria 
italica]
Length=649

 Score =   207 bits (527),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 97/152 (64%), Positives = 123/152 (81%), Gaps = 2/152 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIK+SN+F+N   +GC+SD+GL+ +M+ +    +R+ GY APEV DTRKA+  SDVYSF
Sbjct  469  GNIKASNVFINRHDFGCISDLGLAQLMNPITAR-SRSLGYCAPEVTDTRKASQASDVYSF  527

Query  544  GVLLLELLTGKSPVH-TTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEM  368
            GV +LELLTGKSPV  T  G+E +HLVRWV SVVREEWTAEVFD +LL+ P+IEEEMVEM
Sbjct  528  GVFILELLTGKSPVQITGGGNEFVHLVRWVQSVVREEWTAEVFDGELLRYPNIEEEMVEM  587

Query  367  LQIALSCVVRMPDQRPKMPEVVKMIEGVRRND  272
            LQIA++CV R P++RP+M +VV+ IE VRR D
Sbjct  588  LQIAMACVSRTPERRPRMADVVRTIEEVRRGD  619



>ref|XP_007033487.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma 
cacao]
 ref|XP_007033488.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY04413.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY04414.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma 
cacao]
Length=639

 Score =   206 bits (524),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 100/167 (60%), Positives = 131/167 (78%), Gaps = 2/167 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIKSSN+ LN   +GC+SD GL+++MS  A P +R+AGYRAPEV++TRK    SDVYSF
Sbjct  470  GNIKSSNVLLNQDLHGCISDFGLTSLMSFPAVP-SRSAGYRAPEVIETRKFTQKSDVYSF  528

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GVLLLE+LTGKSPV  +  ++++ L RWV SVVREEWTAEVFDV+L+K  ++EEE+V+ML
Sbjct  529  GVLLLEMLTGKSPVQLSGHEDVVDLPRWVQSVVREEWTAEVFDVELMKYQNVEEELVQML  588

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASRLS  224
            QIA++CV R+PD RP M EV +M+E +R +D  ENR S E+  S+ S
Sbjct  589  QIAMTCVARLPDMRPTMEEVTRMMEEIRPSDS-ENRPSSEDNRSKGS  634



>ref|XP_010094441.1| putative inactive receptor kinase [Morus notabilis]
 gb|EXB56022.1| putative inactive receptor kinase [Morus notabilis]
Length=634

 Score =   206 bits (523),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 96/165 (58%), Positives = 131/165 (79%), Gaps = 2/165 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GN+K+SN+ LN    GC+SD GL+ +M++ A P +R+ GYRAPEV++TRK  H SDVYSF
Sbjct  465  GNVKASNVLLNQDLDGCISDFGLTPLMNAHATP-SRSVGYRAPEVIETRKYTHKSDVYSF  523

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GVLLLE+LTGK+P+ +   D+++ L RWVHSVVREEWTAEVFD++L++  +IEEEMV+ML
Sbjct  524  GVLLLEMLTGKAPLQSPGRDDMVDLPRWVHSVVREEWTAEVFDIELMRYQNIEEEMVQML  583

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASR  230
            QIA++CV ++PD RP M +VV+MIE +R++D  ENR S E   S+
Sbjct  584  QIAMACVTKVPDMRPSMEQVVRMIEEIRQSDS-ENRPSSEENKSK  627



>ref|XP_007017100.1| Leucine-rich repeat protein kinase family protein [Theobroma 
cacao]
 gb|EOY34719.1| Leucine-rich repeat protein kinase family protein [Theobroma 
cacao]
Length=671

 Score =   206 bits (523),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 99/165 (60%), Positives = 129/165 (78%), Gaps = 2/165 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GN+KSSN+ LN    GC+SD+GL+ +M+    P +R AGYRAPEV++TRK  H SDVYSF
Sbjct  502  GNVKSSNVLLNQDHDGCISDLGLTPLMNVPVTP-SRTAGYRAPEVIETRKHTHKSDVYSF  560

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GVLLLE+LTGK+P+ +   D+++ L RWV SVVREEWTAEVFDV+L++  +IEEEMV+ML
Sbjct  561  GVLLLEMLTGKAPLQSPGRDDMVDLPRWVQSVVREEWTAEVFDVELMRFQNIEEEMVQML  620

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASR  230
            QIA++CV ++PD RP M EVV+MIE VR++D  ENR S E   S+
Sbjct  621  QIAMACVAKVPDMRPNMDEVVRMIEEVRQSDS-ENRPSSEENKSK  664



>ref|XP_010252005.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nelumbo 
nucifera]
 ref|XP_010252006.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nelumbo 
nucifera]
 ref|XP_010252007.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nelumbo 
nucifera]
 ref|XP_010252008.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nelumbo 
nucifera]
 ref|XP_010252009.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nelumbo 
nucifera]
 ref|XP_010252010.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nelumbo 
nucifera]
 ref|XP_010252011.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nelumbo 
nucifera]
Length=676

 Score =   206 bits (523),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 100/165 (61%), Positives = 128/165 (78%), Gaps = 2/165 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIKSSN+ LN  Q GC+SD GL  +M+    P +R+ GYRAPEV++TRK    SDVYSF
Sbjct  507  GNIKSSNVLLNQDQDGCISDFGLVPLMNFPVTP-SRSVGYRAPEVIETRKPTQKSDVYSF  565

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GVLLLELLTGK+P+ +   D+++ L RWV SVVREEWTAEVFDV+L++  +IEEEMV+ML
Sbjct  566  GVLLLELLTGKAPLQSPGHDDVVDLPRWVQSVVREEWTAEVFDVELMRYQNIEEEMVQML  625

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASR  230
            QIA++CV ++PD RPKM EVV+MIE +R++D  ENR S E   S+
Sbjct  626  QIAMACVAKVPDMRPKMEEVVRMIEEIRQSDS-ENRPSSEENKSK  669



>gb|KDO54914.1| hypothetical protein CISIN_1g005693mg [Citrus sinensis]
 gb|KDO54915.1| hypothetical protein CISIN_1g005693mg [Citrus sinensis]
Length=635

 Score =   205 bits (521),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 98/165 (59%), Positives = 131/165 (79%), Gaps = 2/165 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIK+SN+ +N    GC+SD GL+ +M+  A P +R+AGYRAPEV++TRK +H SDVYSF
Sbjct  466  GNIKASNVLINQDLDGCISDFGLTPLMNVPATP-SRSAGYRAPEVIETRKHSHKSDVYSF  524

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GVLLLE+LTGK+P+ + + D+++ L RWV SVVREEWTAEVFDV+L++  +IEEEMV+ML
Sbjct  525  GVLLLEMLTGKAPLQSPTRDDMVDLPRWVQSVVREEWTAEVFDVELMRFQNIEEEMVQML  584

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASR  230
            QI ++CV ++PD RP M EVV+MIE VR++D  ENR S E   S+
Sbjct  585  QIGMACVAKVPDMRPNMDEVVRMIEEVRQSDS-ENRPSSEENKSK  628



>ref|XP_006432052.1| hypothetical protein CICLE_v10000513mg [Citrus clementina]
 ref|XP_006464957.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X2 [Citrus sinensis]
 ref|XP_006464958.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X3 [Citrus sinensis]
 gb|ESR45292.1| hypothetical protein CICLE_v10000513mg [Citrus clementina]
Length=635

 Score =   205 bits (521),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 98/165 (59%), Positives = 131/165 (79%), Gaps = 2/165 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIK+SN+ +N    GC+SD GL+ +M+  A P +R+AGYRAPEV++TRK +H SDVYSF
Sbjct  466  GNIKASNVLINQDLDGCISDFGLTPLMNVPATP-SRSAGYRAPEVIETRKHSHKSDVYSF  524

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GVLLLE+LTGK+P+ + + D+++ L RWV SVVREEWTAEVFDV+L++  +IEEEMV+ML
Sbjct  525  GVLLLEMLTGKAPLQSPTRDDMVDLPRWVQSVVREEWTAEVFDVELMRFQNIEEEMVQML  584

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASR  230
            QI ++CV ++PD RP M EVV+MIE VR++D  ENR S E   S+
Sbjct  585  QIGMACVAKVPDMRPNMDEVVRMIEEVRQSDS-ENRPSSEENKSK  628



>ref|XP_010541472.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Tarenaya hassleriana]
 ref|XP_010541473.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Tarenaya hassleriana]
Length=628

 Score =   204 bits (520),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 97/161 (60%), Positives = 128/161 (80%), Gaps = 4/161 (2%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIKSSN+ +N +  GC+SD GL+++M   A P  RAAGYRAPEV +TRK  H SDVYSF
Sbjct  464  GNIKSSNVLINQETDGCISDSGLTSLM---AMPTTRAAGYRAPEVTETRKQTHKSDVYSF  520

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GVLLLE+LTGK+P+ + S D+++ L RWV SVVREEWT+EVFDV+L++  +IEEEMV+ML
Sbjct  521  GVLLLEMLTGKAPIQSPSRDDMVDLPRWVQSVVREEWTSEVFDVELMRFQNIEEEMVQML  580

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCEN  242
            Q+A++CV R+PD RP M +VV+MIE +R +D  +NR S E+
Sbjct  581  QVAMACVARLPDMRPDMDQVVRMIEEIRLSDS-DNRPSSED  620



>ref|XP_004294716.1| PREDICTED: probable inactive receptor kinase At5g58300 [Fragaria 
vesca subsp. vesca]
Length=630

 Score =   204 bits (520),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 97/166 (58%), Positives = 132/166 (80%), Gaps = 3/166 (2%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIKS+N+ L+    GC+SDVGL+ +M+   P  +R+AGYRAPEV++TRK +H SDVYSF
Sbjct  463  GNIKSTNVLLSQDLDGCISDVGLTPLMN--VPATSRSAGYRAPEVIETRKHSHKSDVYSF  520

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GV+LLE+LTGK+P+ +   D+++ L RWV SVVREEWTAEVFDV+L++  +IEEEMV+ML
Sbjct  521  GVVLLEMLTGKAPLQSPGRDDMVDLPRWVQSVVREEWTAEVFDVELMRYQNIEEEMVQML  580

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASRL  227
            QIA++CV ++PD RP M EVV+MIE +R++D  ENR S E+  S +
Sbjct  581  QIAMACVAKVPDMRPNMEEVVRMIEDIRQSDS-ENRPSSEDNKSNV  625



>ref|XP_003519295.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X1 [Glycine max]
 ref|XP_006575457.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X2 [Glycine max]
 ref|XP_006575458.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X3 [Glycine max]
Length=654

 Score =   204 bits (520),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 99/165 (60%), Positives = 128/165 (78%), Gaps = 2/165 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GN+KSSN+ LN    GC+SD GL+ +M+  A P +RAAGYRAPEV++TRK  H SDVYSF
Sbjct  484  GNVKSSNVLLNHDNDGCISDFGLTPLMNVPATP-SRAAGYRAPEVIETRKHTHKSDVYSF  542

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            G+LLLE+LTGK+P  +   D+++ L RWV SVVREEWTAEVFDV+L++  +IEEEMV+ML
Sbjct  543  GILLLEMLTGKAPQQSPGRDDMVDLPRWVQSVVREEWTAEVFDVELMRYQNIEEEMVQML  602

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASR  230
            QIA++CV ++PD RP M EVV+MIE +R +D  ENR S E   S+
Sbjct  603  QIAMACVAKVPDMRPSMDEVVRMIEEIRLSDS-ENRPSSEENRSK  646



>ref|XP_008384658.1| PREDICTED: probable inactive receptor kinase At5g58300 [Malus 
domestica]
Length=634

 Score =   204 bits (520),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 97/165 (59%), Positives = 131/165 (79%), Gaps = 3/165 (2%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIKS+N+ L+    GC+SDVGL+ +M+   P  AR+AGYRAPEV++TR+ +H SDVYSF
Sbjct  466  GNIKSTNVLLSQDLNGCISDVGLTPLMN--VPATARSAGYRAPEVIETRRHSHKSDVYSF  523

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GV+LLE+LTGK+P+ +   D+++ L RWV SVVREEWTAEVFDV+L++  +IEEEMV+ML
Sbjct  524  GVVLLEMLTGKAPLQSPGRDDMVDLPRWVQSVVREEWTAEVFDVELMRYQNIEEEMVQML  583

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASR  230
            QIA++CV ++PD RP M EVV+MIE +R++D  ENR S E   S+
Sbjct  584  QIAMACVAKVPDMRPSMEEVVRMIEEIRQSDS-ENRPSSEENKSK  627



>ref|XP_009355011.1| PREDICTED: probable inactive receptor kinase At5g58300 [Pyrus 
x bretschneideri]
 ref|XP_009355020.1| PREDICTED: probable inactive receptor kinase At5g58300 [Pyrus 
x bretschneideri]
Length=623

 Score =   204 bits (519),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 97/160 (61%), Positives = 130/160 (81%), Gaps = 3/160 (2%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIKS+N+ L+    GC+SDVGL+ +M+   P  AR+AGYRAPEV++TRK +H SDVYSF
Sbjct  465  GNIKSTNVLLSQDLDGCISDVGLTPLMN--VPATARSAGYRAPEVIETRKHSHKSDVYSF  522

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GV+LLE+LTGK+P+ +   D+++ L RWV SVVREEWTAEVFDV+L++  +IEEEMV+ML
Sbjct  523  GVVLLEMLTGKAPLQSPGRDDMVDLPRWVQSVVREEWTAEVFDVELMRYQNIEEEMVQML  582

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCE  245
            QIA++CV ++PD RP M EVV+MIE +R++D  ENR+S E
Sbjct  583  QIAMACVAKVPDMRPTMEEVVRMIEEIRQSDS-ENRQSSE  621



>ref|XP_010541471.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Tarenaya hassleriana]
Length=652

 Score =   204 bits (520),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 97/161 (60%), Positives = 128/161 (80%), Gaps = 4/161 (2%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIKSSN+ +N +  GC+SD GL+++M   A P  RAAGYRAPEV +TRK  H SDVYSF
Sbjct  488  GNIKSSNVLINQETDGCISDSGLTSLM---AMPTTRAAGYRAPEVTETRKQTHKSDVYSF  544

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GVLLLE+LTGK+P+ + S D+++ L RWV SVVREEWT+EVFDV+L++  +IEEEMV+ML
Sbjct  545  GVLLLEMLTGKAPIQSPSRDDMVDLPRWVQSVVREEWTSEVFDVELMRFQNIEEEMVQML  604

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCEN  242
            Q+A++CV R+PD RP M +VV+MIE +R +D  +NR S E+
Sbjct  605  QVAMACVARLPDMRPDMDQVVRMIEEIRLSDS-DNRPSSED  644



>gb|KDO54912.1| hypothetical protein CISIN_1g005693mg [Citrus sinensis]
Length=672

 Score =   205 bits (521),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 98/165 (59%), Positives = 131/165 (79%), Gaps = 2/165 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIK+SN+ +N    GC+SD GL+ +M+  A P +R+AGYRAPEV++TRK +H SDVYSF
Sbjct  503  GNIKASNVLINQDLDGCISDFGLTPLMNVPATP-SRSAGYRAPEVIETRKHSHKSDVYSF  561

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GVLLLE+LTGK+P+ + + D+++ L RWV SVVREEWTAEVFDV+L++  +IEEEMV+ML
Sbjct  562  GVLLLEMLTGKAPLQSPTRDDMVDLPRWVQSVVREEWTAEVFDVELMRFQNIEEEMVQML  621

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASR  230
            QI ++CV ++PD RP M EVV+MIE VR++D  ENR S E   S+
Sbjct  622  QIGMACVAKVPDMRPNMDEVVRMIEEVRQSDS-ENRPSSEENKSK  665



>ref|XP_006432053.1| hypothetical protein CICLE_v10000513mg [Citrus clementina]
 ref|XP_006464956.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X1 [Citrus sinensis]
 gb|ESR45293.1| hypothetical protein CICLE_v10000513mg [Citrus clementina]
Length=672

 Score =   205 bits (521),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 98/165 (59%), Positives = 131/165 (79%), Gaps = 2/165 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIK+SN+ +N    GC+SD GL+ +M+  A P +R+AGYRAPEV++TRK +H SDVYSF
Sbjct  503  GNIKASNVLINQDLDGCISDFGLTPLMNVPATP-SRSAGYRAPEVIETRKHSHKSDVYSF  561

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GVLLLE+LTGK+P+ + + D+++ L RWV SVVREEWTAEVFDV+L++  +IEEEMV+ML
Sbjct  562  GVLLLEMLTGKAPLQSPTRDDMVDLPRWVQSVVREEWTAEVFDVELMRFQNIEEEMVQML  621

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASR  230
            QI ++CV ++PD RP M EVV+MIE VR++D  ENR S E   S+
Sbjct  622  QIGMACVAKVPDMRPNMDEVVRMIEEVRQSDS-ENRPSSEENKSK  665



>gb|KDO54913.1| hypothetical protein CISIN_1g005693mg [Citrus sinensis]
Length=682

 Score =   205 bits (521),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 98/165 (59%), Positives = 131/165 (79%), Gaps = 2/165 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIK+SN+ +N    GC+SD GL+ +M+  A P +R+AGYRAPEV++TRK +H SDVYSF
Sbjct  513  GNIKASNVLINQDLDGCISDFGLTPLMNVPATP-SRSAGYRAPEVIETRKHSHKSDVYSF  571

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GVLLLE+LTGK+P+ + + D+++ L RWV SVVREEWTAEVFDV+L++  +IEEEMV+ML
Sbjct  572  GVLLLEMLTGKAPLQSPTRDDMVDLPRWVQSVVREEWTAEVFDVELMRFQNIEEEMVQML  631

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASR  230
            QI ++CV ++PD RP M EVV+MIE VR++D  ENR S E   S+
Sbjct  632  QIGMACVAKVPDMRPNMDEVVRMIEEVRQSDS-ENRPSSEENKSK  675



>ref|XP_003544939.1| PREDICTED: probable inactive receptor kinase At5g58300-like [Glycine 
max]
Length=656

 Score =   204 bits (520),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 99/165 (60%), Positives = 128/165 (78%), Gaps = 2/165 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GN+KSSN+ LN    GC+SD GL+ +M+  + P +RAAGYRAPEV++TRK  H SDVYSF
Sbjct  486  GNVKSSNVLLNQDNDGCISDFGLTPLMNVPSTP-SRAAGYRAPEVIETRKHTHKSDVYSF  544

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GVLLLE+LTGK+P  +   D+++ L RWV SVVREEWTAEVFDV+L++  +IEEEMV+ML
Sbjct  545  GVLLLEMLTGKAPQQSPGRDDMVDLPRWVQSVVREEWTAEVFDVELMRYQNIEEEMVQML  604

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASR  230
            QIA++CV ++PD RP M EVV+MIE +R +D  ENR S E   S+
Sbjct  605  QIAMACVAKVPDMRPSMEEVVRMIEEIRLSDS-ENRPSSEENRSK  648



>ref|XP_007208318.1| hypothetical protein PRUPE_ppa002781mg [Prunus persica]
 gb|EMJ09517.1| hypothetical protein PRUPE_ppa002781mg [Prunus persica]
Length=634

 Score =   204 bits (518),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 97/165 (59%), Positives = 130/165 (79%), Gaps = 3/165 (2%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIKS+N+ L+    GC+SDVGL+ +M+   P   R+AGYRAPEV++TRK +H SDVYSF
Sbjct  466  GNIKSTNVLLSQDLDGCISDVGLTPLMN--VPATTRSAGYRAPEVIETRKHSHKSDVYSF  523

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GV+LLE+LTGK+P+ +   D+++ L RWV SVVREEWTAEVFDV+L++  +IEEEMV+ML
Sbjct  524  GVVLLEMLTGKAPLQSPGRDDMVDLPRWVQSVVREEWTAEVFDVELMRYQNIEEEMVQML  583

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASR  230
            QIA++CV ++PD RP M EVV+MIE +R++D  ENR S E   S+
Sbjct  584  QIAMACVAKVPDMRPNMEEVVRMIEEIRQSDS-ENRPSSEENKSK  627



>ref|XP_007142022.1| hypothetical protein PHAVU_008G245900g [Phaseolus vulgaris]
 ref|XP_007142023.1| hypothetical protein PHAVU_008G245900g [Phaseolus vulgaris]
 gb|ESW14016.1| hypothetical protein PHAVU_008G245900g [Phaseolus vulgaris]
 gb|ESW14017.1| hypothetical protein PHAVU_008G245900g [Phaseolus vulgaris]
Length=655

 Score =   204 bits (519),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 99/165 (60%), Positives = 128/165 (78%), Gaps = 2/165 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GN+KSSN+ LN    GC+SD GL+ +M+  A P +RAAGYRAPEV++TRK +H SDVYSF
Sbjct  485  GNVKSSNVLLNQDNDGCISDFGLTPLMNVPATP-SRAAGYRAPEVIETRKHSHKSDVYSF  543

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GVLLLE+LTGK+P  +   D+++ L RWV SVVREEWTAEVFDV+L++  +IEEEMV+ML
Sbjct  544  GVLLLEMLTGKAPQQSPGRDDMVDLPRWVQSVVREEWTAEVFDVELMRYQNIEEEMVQML  603

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASR  230
            QIA++CV ++PD RP M EV +MIE +R +D  ENR S E   S+
Sbjct  604  QIAMACVAKVPDMRPTMEEVARMIEEIRLSDS-ENRPSSEENRSK  647



>ref|XP_008239856.1| PREDICTED: probable inactive receptor kinase At5g58300 [Prunus 
mume]
Length=634

 Score =   204 bits (518),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 97/165 (59%), Positives = 130/165 (79%), Gaps = 3/165 (2%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIKS+N+ L+    GC+SDVGL+ +M+   P   R+AGYRAPEV++TRK +H SDVYSF
Sbjct  466  GNIKSTNVLLSQDLDGCISDVGLTPLMN--VPATTRSAGYRAPEVIETRKHSHKSDVYSF  523

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GV+LLE+LTGK+P+ +   D+++ L RWV SVVREEWTAEVFDV+L++  +IEEEMV+ML
Sbjct  524  GVVLLEMLTGKAPLQSPGRDDMVDLPRWVQSVVREEWTAEVFDVELMRYQNIEEEMVQML  583

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASR  230
            QIA++CV ++PD RP M EVV+MIE +R++D  ENR S E   S+
Sbjct  584  QIAMACVAKVPDMRPNMEEVVRMIEEIRQSDS-ENRPSSEENKSK  627



>ref|XP_010244554.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nelumbo 
nucifera]
 ref|XP_010244555.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nelumbo 
nucifera]
 ref|XP_010244556.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nelumbo 
nucifera]
 ref|XP_010244557.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nelumbo 
nucifera]
 ref|XP_010244558.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nelumbo 
nucifera]
Length=642

 Score =   203 bits (517),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 99/165 (60%), Positives = 129/165 (78%), Gaps = 2/165 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIKSSN+ L   Q GC+SD GL+++M+    P +R+ GYRAPEV++TRK    SDVYSF
Sbjct  473  GNIKSSNVLLTQDQDGCISDFGLASLMNFPVIP-SRSVGYRAPEVIETRKPTQKSDVYSF  531

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GVLLLELLTGK+P+ +   D+++ L RWV SVVREEWTAEVFDV+L++  +IEEEMV+ML
Sbjct  532  GVLLLELLTGKAPLQSPGHDDVVDLPRWVQSVVREEWTAEVFDVELMRYQNIEEEMVQML  591

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASR  230
            QIA++CV ++PD RPKM EVV+MIE +R++D  ENR S E   S+
Sbjct  592  QIAMACVAKVPDVRPKMEEVVRMIEEIRQSDS-ENRPSSEENKSK  635



>ref|XP_012091018.1| PREDICTED: probable inactive receptor kinase At3g08680 [Jatropha 
curcas]
 ref|XP_012091019.1| PREDICTED: probable inactive receptor kinase At3g08680 [Jatropha 
curcas]
 gb|KDP21848.1| hypothetical protein JCGZ_00635 [Jatropha curcas]
Length=657

 Score =   203 bits (517),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 103/164 (63%), Positives = 126/164 (77%), Gaps = 2/164 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIKSSN+ L     G +SD GL+ IMS  + P AR+AGYRAPEV++TRK+   SDVYSF
Sbjct  491  GNIKSSNLLLTQDLRGRISDFGLTPIMSYPSVP-ARSAGYRAPEVIETRKSTQKSDVYSF  549

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GVLLLE+LTGK+PV +T  DE++ L RWV SVVREEWTAEVFDV+L++  +IEEEMV+ML
Sbjct  550  GVLLLEMLTGKAPVQSTGQDEVVDLPRWVQSVVREEWTAEVFDVELMRYQNIEEEMVQML  609

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGAS  233
            QIA+SCV R+PD RP M EVV+MIE +R  D + N  S EN  S
Sbjct  610  QIAMSCVARVPDTRPTMNEVVRMIEEIRPTDSV-NHTSEENTES  652



>gb|ERN04237.1| hypothetical protein AMTR_s00077p00144570 [Amborella trichopoda]
Length=219

 Score =   192 bits (489),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 103/173 (60%), Positives = 126/173 (73%), Gaps = 7/173 (4%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAP-PVARAAGYRAPEVVDTRKAAHPSDVYS  548
            GNIKSSNI L  +    VSD GL+ +MS  AP P  RA GYRAPE ++TR+A   SDVYS
Sbjct  43   GNIKSSNILLTPELEPLVSDFGLAPLMSPPAPGPHPRAPGYRAPETLETRRATQKSDVYS  102

Query  547  FGVLLLELLTGKSPVHTT-----SGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEE  383
            FGVLLLELLTGKSP           ++I  L RWV SVVREEWTAEVFDV+L++  +IEE
Sbjct  103  FGVLLLELLTGKSPAQAHQAQAQGSEDIADLPRWVQSVVREEWTAEVFDVELMRYQNIEE  162

Query  382  EMVEMLQIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASRLS  224
            EMV+MLQ+A++CV R+PD RPKM EVVKM+E V+++D  ENR S E+  S+ S
Sbjct  163  EMVQMLQVAMACVARVPDLRPKMSEVVKMVEDVKQSDS-ENRPSSEDNRSKDS  214



>gb|KJB20517.1| hypothetical protein B456_003G153000 [Gossypium raimondii]
 gb|KJB20518.1| hypothetical protein B456_003G153000 [Gossypium raimondii]
 gb|KJB20520.1| hypothetical protein B456_003G153000 [Gossypium raimondii]
 gb|KJB20521.1| hypothetical protein B456_003G153000 [Gossypium raimondii]
Length=657

 Score =   203 bits (516),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 98/165 (59%), Positives = 130/165 (79%), Gaps = 2/165 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIKSSN+ +N +  GC+SD+GL+ +M+  A P +R+ GYRAPEV++TRK  H SDVYSF
Sbjct  488  GNIKSSNVLINQEHDGCISDLGLTPLMNVPATP-SRSVGYRAPEVIETRKHTHKSDVYSF  546

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GVLLLE+LTGK+P+ +   D+++ L RWV SVVREEWTAEVFDV+L++  +IEEEMV+ML
Sbjct  547  GVLLLEMLTGKAPLQSPRRDDMVDLPRWVQSVVREEWTAEVFDVELMRFQNIEEEMVQML  606

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASR  230
            QIA++CV ++ D RP M EVV+MIE VR++D  ENR S E   S+
Sbjct  607  QIAMACVAKVADMRPNMDEVVRMIEEVRQSDS-ENRPSSEENKSK  650



>ref|XP_008673506.1| PREDICTED: probable inactive receptor kinase At4g23740 isoform 
X4 [Zea mays]
Length=657

 Score =   202 bits (515),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 99/155 (64%), Positives = 123/155 (79%), Gaps = 9/155 (6%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVA---RAAGYRAPEVVDTRKAAHPSDV  554
            GNIK+SN+F+N   YGC+SD+GL+     LA P+A   R+ GY APEV DTRKA+  SDV
Sbjct  474  GNIKASNVFVNRDGYGCISDLGLA----QLANPIAARSRSLGYCAPEVADTRKASQASDV  529

Query  553  YSFGVLLLELLTGKSPVHTTSG--DEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEE  380
            YS GVL+LELLTG+SPV  + G   E++HLVRWV SVVREEWTAEVFD  LL++PDIEEE
Sbjct  530  YSLGVLVLELLTGRSPVQVSGGRGSEVVHLVRWVQSVVREEWTAEVFDGALLRVPDIEEE  589

Query  379  MVEMLQIALSCVVRMPDQRPKMPEVVKMIEGVRRN  275
            MVEMLQIA++CV R PD+RPK+ +VV+ +E VRR+
Sbjct  590  MVEMLQIAMACVSRTPDRRPKVADVVRTVEEVRRS  624



>ref|XP_008673504.1| PREDICTED: probable inactive receptor kinase At4g23740 isoform 
X3 [Zea mays]
 ref|XP_008673505.1| PREDICTED: probable inactive receptor kinase At4g23740 isoform 
X3 [Zea mays]
Length=665

 Score =   202 bits (515),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 99/155 (64%), Positives = 123/155 (79%), Gaps = 9/155 (6%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVA---RAAGYRAPEVVDTRKAAHPSDV  554
            GNIK+SN+F+N   YGC+SD+GL+     LA P+A   R+ GY APEV DTRKA+  SDV
Sbjct  482  GNIKASNVFVNRDGYGCISDLGLA----QLANPIAARSRSLGYCAPEVADTRKASQASDV  537

Query  553  YSFGVLLLELLTGKSPVHTTSG--DEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEE  380
            YS GVL+LELLTG+SPV  + G   E++HLVRWV SVVREEWTAEVFD  LL++PDIEEE
Sbjct  538  YSLGVLVLELLTGRSPVQVSGGRGSEVVHLVRWVQSVVREEWTAEVFDGALLRVPDIEEE  597

Query  379  MVEMLQIALSCVVRMPDQRPKMPEVVKMIEGVRRN  275
            MVEMLQIA++CV R PD+RPK+ +VV+ +E VRR+
Sbjct  598  MVEMLQIAMACVSRTPDRRPKVADVVRTVEEVRRS  632



>gb|KHG05843.1| hypothetical protein F383_32232 [Gossypium arboreum]
Length=659

 Score =   202 bits (514),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 98/165 (59%), Positives = 129/165 (78%), Gaps = 2/165 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIKSSN+ +N +  GC+SD+GL+ +M+  A P +R  GYRAPEV++TRK  H SDVYSF
Sbjct  490  GNIKSSNVLINQEHDGCISDLGLTPLMNVPATP-SRTVGYRAPEVIETRKHTHKSDVYSF  548

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GVLLLE+LTGK+P+ +   D+++ L RWV SVVREEWTAEVFDV+L++  +IEEEMV+ML
Sbjct  549  GVLLLEMLTGKAPLQSPRRDDMVDLPRWVQSVVREEWTAEVFDVELMRFQNIEEEMVQML  608

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASR  230
            QIA++CV ++ D RP M EVV+MIE VR++D  ENR S E   S+
Sbjct  609  QIAMACVAKVADMRPNMDEVVRMIEEVRQSDS-ENRPSSEENKSK  652



>ref|XP_009374410.1| PREDICTED: probable inactive receptor kinase At5g58300 [Pyrus 
x bretschneideri]
Length=634

 Score =   202 bits (513),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 98/167 (59%), Positives = 132/167 (79%), Gaps = 3/167 (2%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIKS+N+ L+    GC+SDVGL+ +M+  A   AR+AGYRAPEV++TR+ +H SDVYSF
Sbjct  466  GNIKSTNVLLSQDLNGCISDVGLTPLMNVSA--TARSAGYRAPEVIETRRHSHKSDVYSF  523

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GV+LLE+LTGK+P+ +   D+++ L RWV SVVREEWTAEVFDV+L++  +IEEEMV+ML
Sbjct  524  GVVLLEMLTGKAPLQSPGRDDMVDLPRWVQSVVREEWTAEVFDVELMRYQNIEEEMVQML  583

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASRLS  224
            QIA++CV ++PD RP M EVV+MIE +R++D  ENR S E   S+ S
Sbjct  584  QIAMACVAKVPDMRPSMEEVVRMIEEIRQSDS-ENRPSSEENKSKHS  629



>ref|XP_010931391.1| PREDICTED: probable inactive receptor kinase At5g58300 [Elaeis 
guineensis]
 ref|XP_010931392.1| PREDICTED: probable inactive receptor kinase At5g58300 [Elaeis 
guineensis]
 ref|XP_010931393.1| PREDICTED: probable inactive receptor kinase At5g58300 [Elaeis 
guineensis]
Length=636

 Score =   202 bits (513),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 97/163 (60%), Positives = 125/163 (77%), Gaps = 1/163 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIK+SN+ L      CVSD GL+ +M++ A P     GYRAPEV++TRK+   SDVYSF
Sbjct  467  GNIKASNVLLTQDLEACVSDFGLAPLMNTHATPSRVVVGYRAPEVIETRKSTQRSDVYSF  526

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GVLLLE+LTGK+P+ +   D+++ L RWV SVVREEWTAEVFDV+L++  +IEEEMV+ML
Sbjct  527  GVLLLEMLTGKAPLQSPGRDDVVDLPRWVQSVVREEWTAEVFDVELMRYQNIEEEMVQML  586

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGA  236
            QIA++CV R PDQRP+M EV++MIE VR +D  ENR+S E  A
Sbjct  587  QIAMACVARAPDQRPRMEEVIRMIEEVRHSDS-ENRQSSEEKA  628



>ref|XP_011041763.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Populus euphratica]
Length=510

 Score =   199 bits (506),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 96/167 (57%), Positives = 129/167 (77%), Gaps = 2/167 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIKS+N+ L+    GC+SD GL+ +M+  A   +R+AGYRAPEV++TRK  H SDVYSF
Sbjct  341  GNIKSTNVLLSQDHDGCISDFGLTPLMNVPAT-SSRSAGYRAPEVIETRKHTHKSDVYSF  399

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GV+LLE+LTGK+P+ +   D+++ L RWV SVVREEWTAEVFDV+L++  +IEEEMV+ML
Sbjct  400  GVVLLEMLTGKAPIQSPGRDDMVDLPRWVQSVVREEWTAEVFDVELMRYQNIEEEMVQML  459

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASRLS  224
            QI ++CV ++PD RP M EVV+MIE +R++D  ENR S E   S+ S
Sbjct  460  QIGMTCVAKVPDMRPNMEEVVRMIEEIRQSDS-ENRPSSEENKSKDS  505



>ref|XP_009772876.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nicotiana 
sylvestris]
Length=648

 Score =   201 bits (512),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 100/170 (59%), Positives = 130/170 (76%), Gaps = 3/170 (2%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNI+SSN+ L     GC+SDVGL+ +M S   P +R+AGYRAPEV++TRK    SDVYSF
Sbjct  479  GNIRSSNVLLTHDNSGCISDVGLTPLMGSPTIP-SRSAGYRAPEVIETRKCTQKSDVYSF  537

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GVLLLELLTGK+PV     DE++ L RWV SVVREEWTAEVFD +L+K  +IE+EMV+ML
Sbjct  538  GVLLLELLTGKAPVQPPGHDEVVDLPRWVQSVVREEWTAEVFDAELIKFQNIEDEMVQML  597

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASRLSPSS  215
            QIA++CV ++P+ RP M +VV+MIE ++++D   NR S E+  SR SP+S
Sbjct  598  QIAMTCVAKVPETRPDMNQVVQMIEDIQQSDS-GNRPSSEDNKSR-SPTS  645



>gb|ACN57520.1| At2g26730-like protein, partial [Capsella rubella]
 gb|ACN57521.1| At2g26730-like protein, partial [Capsella rubella]
 gb|ACN57522.1| At2g26730-like protein, partial [Capsella rubella]
 gb|ACN57523.1| At2g26730-like protein, partial [Capsella rubella]
 gb|ACN57524.1| At2g26730-like protein, partial [Capsella rubella]
 gb|ACN57525.1| At2g26730-like protein, partial [Capsella rubella]
 gb|ACN57526.1| At2g26730-like protein, partial [Capsella rubella]
 gb|ACN57527.1| At2g26730-like protein, partial [Capsella rubella]
 gb|ACN57528.1| At2g26730-like protein, partial [Capsella rubella]
 gb|ACN57529.1| At2g26730-like protein, partial [Capsella rubella]
 gb|ACN57530.1| At2g26730-like protein, partial [Capsella rubella]
 gb|ACN57531.1| At2g26730-like protein, partial [Capsella rubella]
 gb|ACN57532.1| At2g26730-like protein, partial [Capsella rubella]
 gb|ACN57534.1| At2g26730-like protein, partial [Capsella grandiflora]
 gb|ACN57536.1| At2g26730-like protein, partial [Capsella grandiflora]
 gb|ACN57539.1| At2g26730-like protein, partial [Capsella grandiflora]
Length=187

 Score =   190 bits (482),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 95/151 (63%), Positives = 118/151 (78%), Gaps = 1/151 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIK+SNI L+  Q  CVSD GL+ + S+ +PP  R AGY APEV++TRK    SDVYSF
Sbjct  16   GNIKASNILLHPNQDTCVSDYGLNQLFSNSSPP-NRLAGYHAPEVLETRKVTFKSDVYSF  74

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GVLLLELLTGKSP   + G+E I L RWV SVVREEWTAEVFDV+L++  +IEEEMV++L
Sbjct  75   GVLLLELLTGKSPNQASLGEEGIDLPRWVLSVVREEWTAEVFDVELMRYHNIEEEMVQLL  134

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRND  272
            QIA++CV  +PDQRP M EV++MIE V R++
Sbjct  135  QIAMTCVSTVPDQRPVMQEVLRMIEDVNRSE  165



>gb|ACN57533.1| At2g26730-like protein, partial [Capsella grandiflora]
 gb|ACN57535.1| At2g26730-like protein, partial [Capsella grandiflora]
 gb|ACN57537.1| At2g26730-like protein, partial [Capsella grandiflora]
 gb|ACN57538.1| At2g26730-like protein, partial [Capsella grandiflora]
 gb|ACN57541.1| At2g26730-like protein, partial [Capsella grandiflora]
 gb|ACN57542.1| At2g26730-like protein, partial [Capsella grandiflora]
 gb|ACN57543.1| At2g26730-like protein, partial [Capsella grandiflora]
 gb|ACN57545.1| At2g26730-like protein, partial [Capsella grandiflora]
 gb|ACN57546.1| At2g26730-like protein, partial [Capsella grandiflora]
 gb|ACN57548.1| At2g26730-like protein, partial [Capsella grandiflora]
Length=187

 Score =   189 bits (481),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 94/151 (62%), Positives = 118/151 (78%), Gaps = 1/151 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIK+SNI L+  Q  C+SD GL+ + S+ +PP  R AGY APEV++TRK    SDVYSF
Sbjct  16   GNIKASNILLHPNQDTCISDYGLNQLFSNSSPP-NRLAGYHAPEVLETRKVTFKSDVYSF  74

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GVLLLELLTGKSP   + G+E I L RWV SVVREEWTAEVFDV+L++  +IEEEMV++L
Sbjct  75   GVLLLELLTGKSPNQASLGEEGIDLPRWVLSVVREEWTAEVFDVELMRYHNIEEEMVQLL  134

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRND  272
            QIA++CV  +PDQRP M EV++MIE V R++
Sbjct  135  QIAMTCVSTVPDQRPVMQEVLRMIEDVNRSE  165



>ref|XP_009758202.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nicotiana 
sylvestris]
Length=652

 Score =   201 bits (510),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 99/165 (60%), Positives = 126/165 (76%), Gaps = 2/165 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIKSSN+ LN     CVSD GL+ +M+  A P +R  GYRAPEV++TRK  H SDVYSF
Sbjct  483  GNIKSSNVLLNQDMEACVSDFGLAPVMNFPAAP-SRHPGYRAPEVIETRKHTHKSDVYSF  541

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GVL+LE+LTGK P+ +   D+++ L RWV SVVREEWTAEVFDV+L++  +IEEEMV+ML
Sbjct  542  GVLMLEMLTGKQPIQSPGRDDMVDLPRWVQSVVREEWTAEVFDVELMRFQNIEEEMVQML  601

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASR  230
            QIA++CV R+PD RP M EVV+MIE VR++D  +NR S E   S+
Sbjct  602  QIAMACVGRVPDMRPTMDEVVRMIEEVRQSDS-DNRPSSEENKSK  645



>ref|XP_009592168.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nicotiana 
tomentosiformis]
Length=652

 Score =   201 bits (510),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 99/165 (60%), Positives = 126/165 (76%), Gaps = 2/165 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIKSSN+ LN     CVSD GL+ +M+  A P +R  GYRAPEV++TRK  H SDVYSF
Sbjct  483  GNIKSSNVLLNQDMEACVSDFGLAPVMNFPAAP-SRHPGYRAPEVIETRKHTHKSDVYSF  541

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GVL+LE+LTGK P+ +   D+++ L RWV SVVREEWTAEVFDV+L++  +IEEEMV+ML
Sbjct  542  GVLMLEMLTGKQPIQSPGRDDMVDLPRWVQSVVREEWTAEVFDVELMRFQNIEEEMVQML  601

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASR  230
            QIA++CV R+PD RP M EVV+MIE VR++D  +NR S E   S+
Sbjct  602  QIAMACVGRVPDMRPTMDEVVRMIEEVRQSDS-DNRPSSEENKSK  645



>gb|ACN57540.1| At2g26730-like protein, partial [Capsella grandiflora]
 gb|ACN57544.1| At2g26730-like protein, partial [Capsella grandiflora]
Length=187

 Score =   189 bits (480),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 96/163 (59%), Positives = 124/163 (76%), Gaps = 3/163 (2%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIK+SNI L   Q  C+SD GL+ + S+ +PP  R AGY APEV++TRK    SDVYSF
Sbjct  16   GNIKASNILLXPNQDTCISDYGLNQLFSNSSPP-NRLAGYHAPEVLETRKVTFKSDVYSF  74

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GVLLLELLTGKSP   + G+E I L RWV SVVREEWTAEVFDV+L++  +IEEEMV++L
Sbjct  75   GVLLLELLTGKSPNQASLGEEGIDLPRWVLSVVREEWTAEVFDVELMRYHNIEEEMVQLL  134

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLEN--RRSCEN  242
            QIA++CV  +PDQRP M EV++MIE V R++  ++  R+S ++
Sbjct  135  QIAMTCVSTVPDQRPVMQEVLRMIEDVNRSETTDDGLRQSSDD  177



>tpg|DAA52804.1| TPA: putative leucine-rich repeat receptor-like protein kinase 
family protein [Zea mays]
Length=782

 Score =   201 bits (512),  Expect = 4e-56, Method: Composition-based stats.
 Identities = 99/155 (64%), Positives = 123/155 (79%), Gaps = 9/155 (6%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVA---RAAGYRAPEVVDTRKAAHPSDV  554
            GNIK+SN+F+N   YGC+SD+GL+     LA P+A   R+ GY APEV DTRKA+  SDV
Sbjct  599  GNIKASNVFVNRDGYGCISDLGLA----QLANPIAARSRSLGYCAPEVADTRKASQASDV  654

Query  553  YSFGVLLLELLTGKSPVHTTSG--DEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEE  380
            YS GVL+LELLTG+SPV  + G   E++HLVRWV SVVREEWTAEVFD  LL++PDIEEE
Sbjct  655  YSLGVLVLELLTGRSPVQVSGGRGSEVVHLVRWVQSVVREEWTAEVFDGALLRVPDIEEE  714

Query  379  MVEMLQIALSCVVRMPDQRPKMPEVVKMIEGVRRN  275
            MVEMLQIA++CV R PD+RPK+ +VV+ +E VRR+
Sbjct  715  MVEMLQIAMACVSRTPDRRPKVADVVRTVEEVRRS  749



>ref|XP_009590190.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nicotiana 
tomentosiformis]
 ref|XP_009590191.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nicotiana 
tomentosiformis]
Length=645

 Score =   200 bits (509),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 99/170 (58%), Positives = 130/170 (76%), Gaps = 3/170 (2%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNI+SSN+ L     GC+SDVGL+ +M S   P +R+AGYRAPEV++TRK    SDVYSF
Sbjct  476  GNIRSSNVLLTHDNSGCISDVGLTPLMGSPTIP-SRSAGYRAPEVIETRKCTQKSDVYSF  534

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GVLLLELLTGK+PV     DE++ L RWV SVVREEWTAEVFD +L+K  +I++EMV+ML
Sbjct  535  GVLLLELLTGKAPVQPPGHDEVVDLPRWVQSVVREEWTAEVFDAELIKFQNIQDEMVQML  594

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASRLSPSS  215
            QIA++CV ++P+ RP M +VV+MIE ++++D   NR S E+  SR SP+S
Sbjct  595  QIAMACVAKVPETRPDMNQVVQMIEDIQQSDS-GNRPSSEDNKSR-SPTS  642



>ref|XP_008456255.1| PREDICTED: probable inactive receptor kinase At5g58300 [Cucumis 
melo]
 ref|XP_008456256.1| PREDICTED: probable inactive receptor kinase At5g58300 [Cucumis 
melo]
Length=630

 Score =   200 bits (508),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 97/165 (59%), Positives = 126/165 (76%), Gaps = 4/165 (2%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIK+SN+ L  +   CVSD GL+ +M+    P +R AGYRAPEV++ RK  H SDVYSF
Sbjct  463  GNIKASNVLLIQEINACVSDFGLTPLMNV---PTSRTAGYRAPEVIEARKHTHKSDVYSF  519

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GVLLLE+LTGK+P+ +   DE++ L RWV SVVREEWTAEVFDV+L++  +IEEEMV+ML
Sbjct  520  GVLLLEMLTGKAPLQSPGRDEMVDLPRWVQSVVREEWTAEVFDVELMRYQNIEEEMVQML  579

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASR  230
            QIA++CV ++PD RP M EVV+MIE +R++D  ENR S E   S+
Sbjct  580  QIAMTCVAKLPDMRPNMDEVVRMIEEIRQSDS-ENRPSSEENKSK  623



>ref|XP_011080640.1| PREDICTED: probable inactive receptor kinase At5g58300 [Sesamum 
indicum]
Length=640

 Score =   200 bits (509),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 99/165 (60%), Positives = 125/165 (76%), Gaps = 2/165 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIKSSN+ LN     CVSD GL+ +M+S A   +R  GYRAPEV++TRK  H SDVYSF
Sbjct  477  GNIKSSNVLLNQDVEACVSDFGLAPLMNSPASS-SRHTGYRAPEVIETRKHTHKSDVYSF  535

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GV+LLE+LTGK P+ +   D+I+ L RWV SVVREEWTAEVFD++L++  +IEEEMV+ML
Sbjct  536  GVMLLEMLTGKQPIQSPGRDDIVDLPRWVQSVVREEWTAEVFDIELMRFQNIEEEMVQML  595

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASR  230
            QIA++CV ++PD RP M EVV+MIE VR +D  ENR S E   S+
Sbjct  596  QIAMACVAKVPDARPNMDEVVRMIEEVRPSDS-ENRPSSEENKSK  639



>ref|XP_004139930.1| PREDICTED: probable inactive receptor kinase At5g58300 [Cucumis 
sativus]
 ref|XP_011656965.1| PREDICTED: probable inactive receptor kinase At5g58300 [Cucumis 
sativus]
 gb|KGN46766.1| hypothetical protein Csa_6G133750 [Cucumis sativus]
Length=630

 Score =   199 bits (507),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 97/165 (59%), Positives = 125/165 (76%), Gaps = 4/165 (2%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIK+SN+ L      CVSD GL+ +M+    P +R AGYRAPEV++ RK  H SDVYSF
Sbjct  463  GNIKASNVLLIQDVNACVSDFGLTPLMNV---PTSRTAGYRAPEVIEARKHTHKSDVYSF  519

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GVLLLE+LTGK+P+ +   DE++ L RWV SVVREEWTAEVFDV+L++  +IEEEMV+ML
Sbjct  520  GVLLLEMLTGKAPLQSPGRDEMVDLPRWVQSVVREEWTAEVFDVELMRYQNIEEEMVQML  579

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASR  230
            QIA++CV ++PD RP M EVV+MIE +R++D  ENR S E   S+
Sbjct  580  QIAMTCVAKLPDMRPNMDEVVRMIEEIRQSDS-ENRPSSEENKSK  623



>emb|CBI15804.3| unnamed protein product [Vitis vinifera]
Length=656

 Score =   199 bits (507),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 96/165 (58%), Positives = 128/165 (78%), Gaps = 2/165 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIKSSN+ LN    GC+SD GL+ +M+  A   +R AGYRAPEV+++RK  H SDVYSF
Sbjct  487  GNIKSSNVLLNQDFEGCISDFGLTPLMNFPATS-SRNAGYRAPEVIESRKHTHKSDVYSF  545

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GVLLLE+LTGK+P+ +   D+++ L RWV SVVREEWTAEVFD++L++  +IEEEMV+ML
Sbjct  546  GVLLLEMLTGKAPLQSPGRDDMVDLPRWVQSVVREEWTAEVFDIELMRYQNIEEEMVQML  605

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASR  230
            Q+A++CV ++PD RP M EVV+MIE +R++D  ENR S E   S+
Sbjct  606  QLAMACVAKVPDMRPSMDEVVRMIEEIRQSDS-ENRPSSEENKSK  649



>gb|ACN57547.1| At2g26730-like protein, partial [Capsella grandiflora]
 gb|ACN57549.1| At2g26730-like protein, partial [Capsella grandiflora]
 gb|ACN57551.1| At2g26730-like protein, partial [Capsella grandiflora]
Length=187

 Score =   188 bits (477),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 94/151 (62%), Positives = 117/151 (77%), Gaps = 1/151 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIK+SNI L+  Q  C SD GL+ + S+ +PP  R AGY APEV++TRK    SDVYSF
Sbjct  16   GNIKASNILLHPNQDTCXSDYGLNQLFSNSSPP-NRLAGYHAPEVLETRKVTFKSDVYSF  74

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GVLLLELLTGKSP   + G+E I L RWV SVVREEWTAEVFDV+L++  +IEEEMV++L
Sbjct  75   GVLLLELLTGKSPNQASLGEEGIDLPRWVLSVVREEWTAEVFDVELMRYHNIEEEMVQLL  134

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRND  272
            QIA++CV  +PDQRP M EV++MIE V R++
Sbjct  135  QIAMTCVSTVPDQRPVMQEVLRMIEDVNRSE  165



>ref|XP_009607538.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nicotiana 
tomentosiformis]
 ref|XP_009607539.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nicotiana 
tomentosiformis]
 ref|XP_009607540.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nicotiana 
tomentosiformis]
 ref|XP_009607541.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nicotiana 
tomentosiformis]
Length=690

 Score =   200 bits (508),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 100/165 (61%), Positives = 124/165 (75%), Gaps = 2/165 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIKSSNI L   Q GC+SD GL+ +M+ + P   R AGYRAPEV++TRK    SDVYSF
Sbjct  515  GNIKSSNILLTRDQDGCISDFGLTPLMNYI-PFKYRCAGYRAPEVIETRKGTQKSDVYSF  573

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GVLLLE+LT KSP+  +  DE++ L RWV SVVREEWTAEVFDV+LLK  +IEEEMV+ML
Sbjct  574  GVLLLEMLTAKSPIPLSGHDEVVDLPRWVRSVVREEWTAEVFDVELLKYQNIEEEMVQML  633

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASR  230
            QI L+CV ++PD RP M EVV+MIE +R+ +  E R S E+  S+
Sbjct  634  QIGLACVAKVPDMRPSMGEVVRMIEDIRQPEG-ETRPSSEDNRSK  677



>ref|XP_002276162.3| PREDICTED: probable inactive receptor kinase At5g58300 [Vitis 
vinifera]
Length=666

 Score =   199 bits (507),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 96/165 (58%), Positives = 128/165 (78%), Gaps = 2/165 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIKSSN+ LN    GC+SD GL+ +M+  A   +R AGYRAPEV+++RK  H SDVYSF
Sbjct  497  GNIKSSNVLLNQDFEGCISDFGLTPLMNFPATS-SRNAGYRAPEVIESRKHTHKSDVYSF  555

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GVLLLE+LTGK+P+ +   D+++ L RWV SVVREEWTAEVFD++L++  +IEEEMV+ML
Sbjct  556  GVLLLEMLTGKAPLQSPGRDDMVDLPRWVQSVVREEWTAEVFDIELMRYQNIEEEMVQML  615

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASR  230
            Q+A++CV ++PD RP M EVV+MIE +R++D  ENR S E   S+
Sbjct  616  QLAMACVAKVPDMRPSMDEVVRMIEEIRQSDS-ENRPSSEENKSK  659



>ref|XP_003616055.1| Leucine-rich repeat receptor-like protein kinase [Medicago truncatula]
 gb|AES99013.1| receptor-like kinase [Medicago truncatula]
Length=651

 Score =   199 bits (506),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 95/165 (58%), Positives = 127/165 (77%), Gaps = 2/165 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GN+KSSN+ LN    GC+SD GL+ +M+  A P +R  GYRAPEV++TRK  H SDVYSF
Sbjct  482  GNVKSSNVLLNQDNDGCISDFGLTPLMNIPATP-SRTMGYRAPEVIETRKHTHKSDVYSF  540

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GVLLLE+LTGK+P  +   D+++ L RWV SVVREEWTAEVFDV+L++  +IEEEMV+ML
Sbjct  541  GVLLLEMLTGKAPQQSPVRDDMVDLPRWVRSVVREEWTAEVFDVELMRYQNIEEEMVQML  600

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASR  230
            QI ++CV ++PD RP M EVV+MIE +R++D  +NR S ++  S+
Sbjct  601  QIGMTCVAKVPDMRPNMEEVVRMIEEIRQSDS-DNRPSSDDNKSK  644



>gb|ACN30771.1| unknown [Zea mays]
Length=639

 Score =   199 bits (505),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 97/154 (63%), Positives = 124/154 (81%), Gaps = 9/154 (6%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPV---ARAAGYRAPEVVDTRKAAHPSDV  554
            GNIK+SN+F+N  + GCVSD GL+++M+    PV   +R+ GY APEV DTRKA+  SDV
Sbjct  449  GNIKASNVFINKHERGCVSDHGLASLMN----PVTVRSRSLGYCAPEVADTRKASQSSDV  504

Query  553  YSFGVLLLELLTGKSPVHTTSGD--EIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEE  380
            YSFGV +LELLTGKSPV  T G+  +++HLVRWV SVVREEWTAEVFD +LL+ P+IEEE
Sbjct  505  YSFGVFVLELLTGKSPVQITGGNGGDVVHLVRWVQSVVREEWTAEVFDGELLRYPNIEEE  564

Query  379  MVEMLQIALSCVVRMPDQRPKMPEVVKMIEGVRR  278
            MVEMLQ+A++CV R P++RP+M +VV+ IE VRR
Sbjct  565  MVEMLQVAMACVSRSPERRPRMADVVRTIEEVRR  598



>ref|XP_011041759.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Populus euphratica]
 ref|XP_011041760.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Populus euphratica]
 ref|XP_011041761.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Populus euphratica]
 ref|XP_011041762.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Populus euphratica]
Length=636

 Score =   199 bits (505),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 95/165 (58%), Positives = 128/165 (78%), Gaps = 2/165 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIKS+N+ L+    GC+SD GL+ +M+  A   +R+AGYRAPEV++TRK  H SDVYSF
Sbjct  467  GNIKSTNVLLSQDHDGCISDFGLTPLMNVPAT-SSRSAGYRAPEVIETRKHTHKSDVYSF  525

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GV+LLE+LTGK+P+ +   D+++ L RWV SVVREEWTAEVFDV+L++  +IEEEMV+ML
Sbjct  526  GVVLLEMLTGKAPIQSPGRDDMVDLPRWVQSVVREEWTAEVFDVELMRYQNIEEEMVQML  585

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASR  230
            QI ++CV ++PD RP M EVV+MIE +R++D  ENR S E   S+
Sbjct  586  QIGMTCVAKVPDMRPNMEEVVRMIEEIRQSDS-ENRPSSEENKSK  629



>ref|XP_002325632.1| putative plant disease resistance family protein [Populus trichocarpa]
 gb|EEF00014.1| putative plant disease resistance family protein [Populus trichocarpa]
Length=636

 Score =   199 bits (505),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 95/165 (58%), Positives = 128/165 (78%), Gaps = 2/165 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIKS+N+ L+    GC+SD GL+ +M+  A   +R+AGYRAPEV++TRK  H SDVYSF
Sbjct  467  GNIKSTNVLLSQDHDGCISDFGLTPLMNVPATS-SRSAGYRAPEVIETRKHTHKSDVYSF  525

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GV+LLE+LTGK+P+ +   D+++ L RWV SVVREEWTAEVFDV+L++  +IEEEMV+ML
Sbjct  526  GVVLLEMLTGKAPIQSPGRDDMVDLPRWVQSVVREEWTAEVFDVELMRYQNIEEEMVQML  585

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASR  230
            QI ++CV ++PD RP M EVV+MIE +R++D  ENR S E   S+
Sbjct  586  QIGMTCVAKVPDMRPNMEEVVRMIEEIRQSDS-ENRPSSEENKSK  629



>ref|NP_001168844.1| uncharacterized LOC100382649 precursor [Zea mays]
 gb|ACN30844.1| unknown [Zea mays]
 gb|AFW80439.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=672

 Score =   199 bits (506),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 97/154 (63%), Positives = 124/154 (81%), Gaps = 9/154 (6%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPV---ARAAGYRAPEVVDTRKAAHPSDV  554
            GNIK+SN+F+N  + GCVSD GL+++M+    PV   +R+ GY APEV DTRKA+  SDV
Sbjct  482  GNIKASNVFINKHERGCVSDHGLASLMN----PVTVRSRSLGYCAPEVADTRKASQSSDV  537

Query  553  YSFGVLLLELLTGKSPVHTTSGD--EIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEE  380
            YSFGV +LELLTGKSPV  T G+  +++HLVRWV SVVREEWTAEVFD +LL+ P+IEEE
Sbjct  538  YSFGVFVLELLTGKSPVQITGGNGGDVVHLVRWVQSVVREEWTAEVFDGELLRYPNIEEE  597

Query  379  MVEMLQIALSCVVRMPDQRPKMPEVVKMIEGVRR  278
            MVEMLQ+A++CV R P++RP+M +VV+ IE VRR
Sbjct  598  MVEMLQVAMACVSRSPERRPRMADVVRTIEEVRR  631



>ref|XP_009406050.1| PREDICTED: probable inactive receptor kinase At5g58300 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009406051.1| PREDICTED: probable inactive receptor kinase At5g58300 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009406052.1| PREDICTED: probable inactive receptor kinase At5g58300 [Musa 
acuminata subsp. malaccensis]
Length=631

 Score =   199 bits (505),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 97/161 (60%), Positives = 126/161 (78%), Gaps = 2/161 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIKSSN+ L  +   CVS+ GL+ +MSS A P +R  GYRAPEV++ RK+   SDVYSF
Sbjct  463  GNIKSSNVLLTQELDACVSEFGLAPLMSSAATP-SRVVGYRAPEVIEHRKSTQKSDVYSF  521

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GV LLELLTGKSP  +   D+++ L RWV SVVREEWTAEVFDV+L++ P+IEE+MV+ML
Sbjct  522  GVFLLELLTGKSPFQSPGRDDVVDLPRWVQSVVREEWTAEVFDVELMRYPNIEEDMVQML  581

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCEN  242
            Q+A+ CVVR+ +QRPKM +VV+MIE V+R++  ENR S E+
Sbjct  582  QVAMQCVVRVAEQRPKMEDVVRMIEDVQRSNS-ENRPSSED  621



>ref|XP_002319979.1| putative plant disease resistance family protein [Populus trichocarpa]
 gb|EEE95902.1| putative plant disease resistance family protein [Populus trichocarpa]
Length=635

 Score =   198 bits (503),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 95/165 (58%), Positives = 128/165 (78%), Gaps = 2/165 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIKSSN+ L+    GC+SD GL+ +M+  A   +R+AGYRAPEV++T K +H SDVYSF
Sbjct  466  GNIKSSNVLLSQDHDGCISDFGLTPLMNVPASS-SRSAGYRAPEVIETSKHSHKSDVYSF  524

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GV+LLE+LTGK+P+ +   D+++ L RWV SVVREEWTAEVFDV+L++  +IEEEMV+ML
Sbjct  525  GVILLEMLTGKAPIQSPRRDDMVDLPRWVQSVVREEWTAEVFDVELMRYQNIEEEMVQML  584

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASR  230
            QI ++CV ++PD RP M EVV+MIE +R++D  ENR S E   S+
Sbjct  585  QIGMTCVAKVPDMRPNMEEVVRMIEEIRQSDS-ENRPSSEGNKSK  628



>ref|XP_002528709.1| Nodulation receptor kinase precursor, putative [Ricinus communis]
 gb|EEF33698.1| Nodulation receptor kinase precursor, putative [Ricinus communis]
Length=633

 Score =   198 bits (503),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 100/164 (61%), Positives = 122/164 (74%), Gaps = 1/164 (1%)
 Frame = -2

Query  721  NIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSFG  542
            NIKSSN+ +     G VSD GL+ IMS  A P +R AGYRAPEV++TRK    SDVYSFG
Sbjct  467  NIKSSNVLITQDLCGSVSDFGLTPIMSYPAVP-SRTAGYRAPEVIETRKPTQKSDVYSFG  525

Query  541  VLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEMLQ  362
            VLLLE+LTGK+PV +T  D+++ L RWV SVVREEWTAEVFD++LLK  +IEEEMV+MLQ
Sbjct  526  VLLLEMLTGKAPVQSTGQDDVVDLPRWVQSVVREEWTAEVFDLELLKYQNIEEEMVQMLQ  585

Query  361  IALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASR  230
            IA++CV R+PD RP M EVV+MIE +R  D L +  S E   S 
Sbjct  586  IAMACVARVPDMRPTMDEVVRMIEEIRVPDSLNHPSSEEYKGSN  629



>gb|ABK93951.1| unknown [Populus trichocarpa]
Length=351

 Score =   192 bits (487),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 95/168 (57%), Positives = 126/168 (75%), Gaps = 2/168 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIK+SN+ L     GC+SDVGL+ +M+     + R  GYRAPEV++TRKA+  SDVYSF
Sbjct  186  GNIKASNVLLTPDLDGCISDVGLAPLMN-FPTTMYRTIGYRAPEVIETRKASQKSDVYSF  244

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GVLLLE+LTGK+P+     D ++ L RWV SVVREEWTAEVFDV+L++  +IEEEMV+ML
Sbjct  245  GVLLLEMLTGKAPLQVPGHDSVVDLPRWVRSVVREEWTAEVFDVELVRHQNIEEEMVQML  304

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASRLSP  221
            QIAL+CV + PD RPKM EVV+MIE ++ +D  +NR S +  ++  +P
Sbjct  305  QIALACVAKAPDMRPKMDEVVRMIEEIQHSDS-KNRSSSDAESNVQTP  351



>gb|ABR17070.1| unknown [Picea sitchensis]
Length=340

 Score =   191 bits (486),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 97/167 (58%), Positives = 122/167 (73%), Gaps = 1/167 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIKSSN+ L +   GCVSD GL  + S+ A    R AGYRAPEV++TRK    SDVYSF
Sbjct  154  GNIKSSNVLLTTDLDGCVSDFGLVPLFSAAAA-ANRIAGYRAPEVIETRKVTQKSDVYSF  212

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GVLLLELLTGK+P   +  DE I L RWV SVVREEWTAEVFDV+L++  +IEEEMV++L
Sbjct  213  GVLLLELLTGKAPNQASLNDEGIDLPRWVQSVVREEWTAEVFDVELMRYQNIEEEMVQLL  272

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASRLS  224
            QIA++CV  +PDQRP+M +VVKMIE +R+ +  +  R   +  S+ S
Sbjct  273  QIAMACVAAVPDQRPRMQDVVKMIEDMRQFETDDGNRQSSDDKSKES  319



>ref|XP_011011771.1| PREDICTED: probable inactive receptor kinase At5g58300 [Populus 
euphratica]
 ref|XP_011011772.1| PREDICTED: probable inactive receptor kinase At5g58300 [Populus 
euphratica]
 ref|XP_011011773.1| PREDICTED: probable inactive receptor kinase At5g58300 [Populus 
euphratica]
 ref|XP_011011774.1| PREDICTED: probable inactive receptor kinase At5g58300 [Populus 
euphratica]
 ref|XP_011011775.1| PREDICTED: probable inactive receptor kinase At5g58300 [Populus 
euphratica]
Length=635

 Score =   197 bits (502),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 95/165 (58%), Positives = 128/165 (78%), Gaps = 2/165 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIKSSN+ L+    GC+SD GL+ +M+  A   +R+AGYRAPEV++T K +H SDVYSF
Sbjct  466  GNIKSSNVLLSQDHDGCISDFGLTPLMNVPASS-SRSAGYRAPEVIETSKHSHKSDVYSF  524

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GV+LLE+LTGK+P+ +   D+++ L RWV SVVREEWTAEVFDV+L++  +IEEEMV+ML
Sbjct  525  GVILLEMLTGKAPIQSPRRDDMVDLPRWVQSVVREEWTAEVFDVELMRYQNIEEEMVQML  584

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASR  230
            QI ++CV ++PD RP M EVV+MIE +R++D  ENR S E   S+
Sbjct  585  QIGMTCVAKVPDMRPNMEEVVRMIEEIRQSDS-ENRPSSEGNKSK  628



>ref|XP_004490727.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X1 [Cicer arietinum]
 ref|XP_004490728.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X2 [Cicer arietinum]
Length=653

 Score =   198 bits (503),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 95/165 (58%), Positives = 125/165 (76%), Gaps = 2/165 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GN+KSSN+ LN     C+SD GL+  M+  A P +RA GYRAPEV++TRK  H SDVYSF
Sbjct  484  GNVKSSNVLLNQDNDSCISDFGLTPFMNVPATP-SRAIGYRAPEVIETRKHTHKSDVYSF  542

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GVLLLE+LTGK+P  +   D+++ L RWV SVVREEWTAEVFDV+L++  +IEEEMV+ML
Sbjct  543  GVLLLEMLTGKAPQQSPVRDDMVDLPRWVQSVVREEWTAEVFDVELMRYQNIEEEMVQML  602

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASR  230
            QI ++CV ++PD RP M EVV+MIE +R++D  +NR S +   S+
Sbjct  603  QIGMACVAKVPDMRPNMEEVVRMIEEIRQSDS-DNRPSSDENKSK  646



>ref|XP_011089538.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Sesamum indicum]
 ref|XP_011089539.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Sesamum indicum]
Length=636

 Score =   197 bits (502),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 98/165 (59%), Positives = 128/165 (78%), Gaps = 2/165 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIKSSN+ LN    GCVSD GL+ +M+  +   +R AGYRAPEV++TRK  H SDVYSF
Sbjct  467  GNIKSSNVLLNQDLDGCVSDFGLAPLMNHPSTS-SRHAGYRAPEVMETRKHTHKSDVYSF  525

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GV+LLE+LTGK P+ + S ++I+ L RWV SVVREEWTAEVFDV+L++  +IEEEMV+ML
Sbjct  526  GVILLEMLTGKQPIQSPSREDIVDLPRWVQSVVREEWTAEVFDVELMRFQNIEEEMVQML  585

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASR  230
            QIA++CV ++PD RP + EVV+MIE VR++D  ENR S +   S+
Sbjct  586  QIAMACVAKVPDMRPSIDEVVRMIEEVRQSDS-ENRPSSDENKSK  629



>ref|XP_011089537.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Sesamum indicum]
Length=655

 Score =   197 bits (502),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 98/165 (59%), Positives = 128/165 (78%), Gaps = 2/165 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIKSSN+ LN    GCVSD GL+ +M+  +   +R AGYRAPEV++TRK  H SDVYSF
Sbjct  486  GNIKSSNVLLNQDLDGCVSDFGLAPLMNHPSTS-SRHAGYRAPEVMETRKHTHKSDVYSF  544

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GV+LLE+LTGK P+ + S ++I+ L RWV SVVREEWTAEVFDV+L++  +IEEEMV+ML
Sbjct  545  GVILLEMLTGKQPIQSPSREDIVDLPRWVQSVVREEWTAEVFDVELMRFQNIEEEMVQML  604

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASR  230
            QIA++CV ++PD RP + EVV+MIE VR++D  ENR S +   S+
Sbjct  605  QIAMACVAKVPDMRPSIDEVVRMIEEVRQSDS-ENRPSSDENKSK  648



>gb|ACN57550.1| At2g26730-like protein, partial [Capsella grandiflora]
Length=187

 Score =   186 bits (473),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 93/151 (62%), Positives = 116/151 (77%), Gaps = 1/151 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIK+SNI L+  Q  C  D GL+ + S+ +PP  R AGY APEV++TRK    SDVYSF
Sbjct  16   GNIKASNILLHPNQDTCXXDYGLNQLFSNSSPP-NRLAGYHAPEVLETRKVTFKSDVYSF  74

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GVLLLELLTGKSP   + G+E I L RWV SVVREEWTAEVFDV+L++  +IEEEMV++L
Sbjct  75   GVLLLELLTGKSPNQASLGEEGIDLPRWVLSVVREEWTAEVFDVELMRYHNIEEEMVQLL  134

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRND  272
            QIA++CV  +PDQRP M EV++MIE V R++
Sbjct  135  QIAMTCVSTVPDQRPVMQEVLRMIEDVNRSE  165



>emb|CDP03386.1| unnamed protein product [Coffea canephora]
Length=674

 Score =   198 bits (503),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 99/175 (57%), Positives = 127/175 (73%), Gaps = 1/175 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSK-QYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYS  548
            GNIKSSN+ L  + Q  CVSD GL+A+ S+ +PP  R AGYRAPEV++TR+    SDVYS
Sbjct  490  GNIKSSNVLLKQENQDACVSDYGLNALFSNSSPPNHRVAGYRAPEVLETRRVTFKSDVYS  549

Query  547  FGVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEM  368
            FGVLLLELLTGK+P   + G+E I L RWV SVVREEWTAEVFDV+L++  ++EEEMV++
Sbjct  550  FGVLLLELLTGKAPNQASLGEEGIDLPRWVQSVVREEWTAEVFDVELMRYHNVEEEMVQL  609

Query  367  LQIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASRLSPSSIEQE  203
            LQI ++CV  +PDQRP M EVV+MIE + R +  +  R   +  S+ S S   QE
Sbjct  610  LQIGMACVATVPDQRPAMQEVVRMIEDMNRGETDDGLRQSSDDPSKGSDSHTPQE  664



>ref|XP_006356869.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006356870.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X2 [Solanum tuberosum]
Length=653

 Score =   197 bits (502),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 99/170 (58%), Positives = 128/170 (75%), Gaps = 3/170 (2%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIKSSN+ L     GC+SDVGL+ +M     P +++AGYRAPEV++T+K    SDVYSF
Sbjct  484  GNIKSSNVLLTHDNNGCISDVGLTPLMGFPTIP-SKSAGYRAPEVIETKKCTQKSDVYSF  542

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GVLLLELLTGK+PV     DE++ L RWV SVVREEWTAEVFDV+L+K  +IE+EMV+ML
Sbjct  543  GVLLLELLTGKAPVQPPGHDEVVDLPRWVQSVVREEWTAEVFDVELIKFQNIEDEMVQML  602

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASRLSPSS  215
            QIA++CV  +P+ RP M +VV+MIE +++ D   NR S E+  SR SP+S
Sbjct  603  QIAMTCVANVPETRPDMSQVVQMIEDIQQIDS-GNRPSSEDNKSR-SPTS  650



>ref|XP_008803002.1| PREDICTED: probable inactive receptor kinase At5g58300 [Phoenix 
dactylifera]
 ref|XP_008803003.1| PREDICTED: probable inactive receptor kinase At5g58300 [Phoenix 
dactylifera]
 ref|XP_008803004.1| PREDICTED: probable inactive receptor kinase At5g58300 [Phoenix 
dactylifera]
 ref|XP_008803005.1| PREDICTED: probable inactive receptor kinase At5g58300 [Phoenix 
dactylifera]
 ref|XP_008803006.1| PREDICTED: probable inactive receptor kinase At5g58300 [Phoenix 
dactylifera]
Length=635

 Score =   197 bits (501),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 95/160 (59%), Positives = 122/160 (76%), Gaps = 1/160 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIK+SN+ L      CVSD GL+ +M++ A P     GYRAPEV++TRK+   SDVYSF
Sbjct  467  GNIKASNVLLTQDLEACVSDFGLAPLMNTHATPSRIVVGYRAPEVIETRKSTQKSDVYSF  526

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GVLLLE+LTGK+P+ +   D+++ L RWV SVVREEWTAEVFDV+L++  +IEEEMV+ML
Sbjct  527  GVLLLEMLTGKAPLQSPGRDDVVDLPRWVQSVVREEWTAEVFDVELMRYQNIEEEMVQML  586

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCE  245
            QIA++CV R PDQRP+M EV++MIE VR +D   NR S E
Sbjct  587  QIAMACVARAPDQRPRMEEVIRMIEEVRHSDS-GNRPSSE  625



>ref|XP_009798129.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nicotiana 
sylvestris]
 ref|XP_009798130.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nicotiana 
sylvestris]
 ref|XP_009798131.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nicotiana 
sylvestris]
Length=625

 Score =   197 bits (500),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 97/160 (61%), Positives = 123/160 (77%), Gaps = 2/160 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIKSSN+ L      CVSD GL+ IM+  A P  R  GYRAPEV++TRK +H SDVYSF
Sbjct  466  GNIKSSNVLLKQDLEACVSDFGLAPIMNFPAAPT-RYPGYRAPEVIETRKHSHKSDVYSF  524

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GVLLLE+LTGK P+ +   D+++ L RWV SV++EEWT+EVFDV L++  +IEEEMV+ML
Sbjct  525  GVLLLEMLTGKQPMQSPGRDDMVDLPRWVQSVLKEEWTSEVFDVDLMRFQNIEEEMVQML  584

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCE  245
            QIA++CV ++PD RP M EVVKMIE VR++D  ENR+S E
Sbjct  585  QIAMACVAKVPDMRPNMEEVVKMIEEVRQSDS-ENRQSSE  623



>ref|XP_006435961.1| hypothetical protein CICLE_v10030941mg [Citrus clementina]
 ref|XP_006486131.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X2 [Citrus sinensis]
 ref|XP_006486132.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X3 [Citrus sinensis]
 gb|ESR49201.1| hypothetical protein CICLE_v10030941mg [Citrus clementina]
Length=627

 Score =   197 bits (500),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 96/158 (61%), Positives = 123/158 (78%), Gaps = 2/158 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIKSSN+ L     GC+SDVGL+ +++       R  GYRAPEV +TRKA+  SDVYSF
Sbjct  462  GNIKSSNVLLTQDLNGCISDVGLAHLIN-FPTTATRTIGYRAPEVTETRKASQKSDVYSF  520

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GVLLLE+LTGK+P+  +  D+++ L RWV SVVREEWTAEVFDV+LLK  D+EEEMV+ML
Sbjct  521  GVLLLEMLTGKAPLQHSGHDDVVDLPRWVRSVVREEWTAEVFDVELLKYQDVEEEMVQML  580

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRS  251
            QIALSCV ++PD RPKM +VV+MIE +++ + L+NR S
Sbjct  581  QIALSCVAKVPDSRPKMDDVVRMIEQIQQPE-LKNRAS  617



>ref|XP_006435960.1| hypothetical protein CICLE_v10030941mg [Citrus clementina]
 ref|XP_006486130.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X1 [Citrus sinensis]
 gb|ESR49200.1| hypothetical protein CICLE_v10030941mg [Citrus clementina]
Length=638

 Score =   197 bits (501),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 96/158 (61%), Positives = 123/158 (78%), Gaps = 2/158 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIKSSN+ L     GC+SDVGL+ +++       R  GYRAPEV +TRKA+  SDVYSF
Sbjct  473  GNIKSSNVLLTQDLNGCISDVGLAHLIN-FPTTATRTIGYRAPEVTETRKASQKSDVYSF  531

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GVLLLE+LTGK+P+  +  D+++ L RWV SVVREEWTAEVFDV+LLK  D+EEEMV+ML
Sbjct  532  GVLLLEMLTGKAPLQHSGHDDVVDLPRWVRSVVREEWTAEVFDVELLKYQDVEEEMVQML  591

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRS  251
            QIALSCV ++PD RPKM +VV+MIE +++ + L+NR S
Sbjct  592  QIALSCVAKVPDSRPKMDDVVRMIEQIQQPE-LKNRAS  628



>ref|XP_010323112.1| PREDICTED: probable inactive receptor kinase At5g58300 [Solanum 
lycopersicum]
Length=627

 Score =   197 bits (500),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 96/160 (60%), Positives = 124/160 (78%), Gaps = 2/160 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIKSSN+ L      C+SD GL+ IM+  A P +R  GYRAPEV+++RK +H SDVYSF
Sbjct  468  GNIKSSNVLLKQDMEACISDFGLAPIMNFPAAP-SRYPGYRAPEVIESRKHSHKSDVYSF  526

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GVLLLE+LTGK P+ +   D+++ L RWV SVVREEWT+EVFDV L++  +IEEEMV+ML
Sbjct  527  GVLLLEMLTGKQPMQSPGRDDMVDLPRWVQSVVREEWTSEVFDVDLMRFQNIEEEMVQML  586

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCE  245
            QIA++CVV++PD RP M EVV+MIE VR+++  ENR S E
Sbjct  587  QIAMACVVKVPDMRPNMEEVVRMIEDVRQSNS-ENRHSSE  625



>ref|XP_008355739.1| PREDICTED: probable inactive receptor kinase At5g58300 [Malus 
domestica]
Length=639

 Score =   197 bits (500),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 95/165 (58%), Positives = 127/165 (77%), Gaps = 2/165 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIKSSN+ L    YG +SD GL+ +M+    P +R+ GYRAPEV++T+K+   SDVYSF
Sbjct  461  GNIKSSNVLLTQDLYGSISDFGLALLMNLTTIP-SRSVGYRAPEVIETKKSFQKSDVYSF  519

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GV+LLE+LTGK+PV ++  D+++ L RWV SVVREEWTAEVFDV+L+K  +IEEE+V+ML
Sbjct  520  GVMLLEMLTGKAPVQSSGRDDVVDLPRWVQSVVREEWTAEVFDVELMKYQNIEEELVQML  579

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASR  230
            QIA++CV R+PD RP M EVV+MIE +R  D  ENR S ++  S+
Sbjct  580  QIAMTCVARVPDMRPTMEEVVRMIEEIRPPDS-ENRPSSDDNKSK  623



>gb|KDO67579.1| hypothetical protein CISIN_1g006886mg [Citrus sinensis]
 gb|KDO67580.1| hypothetical protein CISIN_1g006886mg [Citrus sinensis]
Length=627

 Score =   196 bits (499),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 96/158 (61%), Positives = 122/158 (77%), Gaps = 2/158 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIKSSN+ L     GC+SDVGL+ +++       R  GYRAPEV +TRKA+  SDVYSF
Sbjct  462  GNIKSSNVLLTQDLNGCISDVGLAHLIN-FPTTATRTIGYRAPEVTETRKASQKSDVYSF  520

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GVLLLE+LTGK+P+  +  D+++ L RWV SVVREEWTAEVFDV+LLK  D+EEEMV+ML
Sbjct  521  GVLLLEMLTGKAPLQHSGHDDVVDLPRWVRSVVREEWTAEVFDVELLKYQDVEEEMVQML  580

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRS  251
            QIALSCV ++PD RPKM +VV+MIE +++ + L NR S
Sbjct  581  QIALSCVAKVPDSRPKMDDVVRMIEQIQQPE-LRNRAS  617



>ref|XP_009760496.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Nicotiana sylvestris]
 ref|XP_009760502.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Nicotiana sylvestris]
 ref|XP_009760506.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Nicotiana sylvestris]
Length=646

 Score =   197 bits (500),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 98/165 (59%), Positives = 123/165 (75%), Gaps = 2/165 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIKSSN+ L   Q GC+SD GL+ +M+ + P   R AGYRAPEV++TRK    SDVYSF
Sbjct  478  GNIKSSNVLLTRDQDGCISDFGLTPLMNYI-PFKYRCAGYRAPEVIETRKGTQKSDVYSF  536

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GVLLLE+LT KSP+  +  DE++ L RWV SVVREEWTAEVFDV+LLK  +IEEEMV+ML
Sbjct  537  GVLLLEMLTAKSPIPLSGHDEVVDLPRWVRSVVREEWTAEVFDVELLKYQNIEEEMVQML  596

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASR  230
            QI L+CV ++PD RP M +VV+MIE +R+    E R S E+  S+
Sbjct  597  QIGLACVAKVPDMRPSMGQVVRMIEEIRQPQG-ETRPSSEDSRSK  640



>ref|XP_008788112.1| PREDICTED: probable inactive receptor kinase At5g58300 [Phoenix 
dactylifera]
Length=636

 Score =   196 bits (498),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 94/160 (59%), Positives = 121/160 (76%), Gaps = 1/160 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIK+SN+ L      C+SD GL+ +M++ A P     GYRAPEV++TRK    SDVYSF
Sbjct  467  GNIKASNVLLTQDLEACISDFGLAPLMNTHATPSRVVVGYRAPEVIETRKYTQKSDVYSF  526

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GVLLLE+LTGK+P+ +   D++  L RWV SVVREEWTAEVFDV+L++  +IEEEMV+ML
Sbjct  527  GVLLLEMLTGKAPLQSPGRDDVADLPRWVQSVVREEWTAEVFDVELMRYRNIEEEMVQML  586

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCE  245
            QIA++CV R PDQRP+M EV++MI+ VR +D  ENR S E
Sbjct  587  QIAMACVARAPDQRPRMEEVIRMIDEVRHSDS-ENRASSE  625



>ref|XP_009760490.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Nicotiana sylvestris]
Length=717

 Score =   197 bits (500),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 98/165 (59%), Positives = 123/165 (75%), Gaps = 2/165 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIKSSN+ L   Q GC+SD GL+ +M+ + P   R AGYRAPEV++TRK    SDVYSF
Sbjct  549  GNIKSSNVLLTRDQDGCISDFGLTPLMNYI-PFKYRCAGYRAPEVIETRKGTQKSDVYSF  607

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GVLLLE+LT KSP+  +  DE++ L RWV SVVREEWTAEVFDV+LLK  +IEEEMV+ML
Sbjct  608  GVLLLEMLTAKSPIPLSGHDEVVDLPRWVRSVVREEWTAEVFDVELLKYQNIEEEMVQML  667

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASR  230
            QI L+CV ++PD RP M +VV+MIE +R+    E R S E+  S+
Sbjct  668  QIGLACVAKVPDMRPSMGQVVRMIEEIRQPQG-ETRPSSEDSRSK  711



>emb|CDY02808.1| BnaC02g10810D [Brassica napus]
Length=421

 Score =   191 bits (486),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 92/163 (56%), Positives = 127/163 (78%), Gaps = 1/163 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIKSSN+ +  +   CVSD GL+++M+    P+ R AGYRAPEV++TRK  H SDVYSF
Sbjct  249  GNIKSSNMIMKQESDVCVSDYGLTSLMAVPVTPM-RGAGYRAPEVIETRKHTHKSDVYSF  307

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GVL+LE+LTGKSPV + S ++++ L RWV SVVREEWT+EVFDV+L+K+ +IEEEMV+ML
Sbjct  308  GVLILEMLTGKSPVQSPSREDMVDLPRWVQSVVREEWTSEVFDVELMKVQNIEEEMVQML  367

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGA  236
            QIA++CV ++ + RP M +VV+MIE +R +D  E R S ++ +
Sbjct  368  QIAMACVAQVAEVRPSMDDVVRMIEEIRVSDSSETRPSSDDNS  410



>ref|XP_004236305.1| PREDICTED: probable inactive receptor kinase At2g26730 [Solanum 
lycopersicum]
Length=659

 Score =   196 bits (497),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 98/175 (56%), Positives = 124/175 (71%), Gaps = 1/175 (1%)
 Frame = -2

Query  724  GNIKSSNIFL-NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYS  548
            GNIK+SN+ L    Q  CVSD GL+ + S+ AP   R AGYRAPEV++TRK  + SDVYS
Sbjct  475  GNIKASNVLLKQDNQDACVSDYGLNPLFSTSAPVNHRVAGYRAPEVLETRKVTYKSDVYS  534

Query  547  FGVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEM  368
            FGVL+LELLTGK+P   + G+E I L RWV SVVREEWTAEVFDV+L++  ++EEEMV++
Sbjct  535  FGVLMLELLTGKAPNQASLGEEGIDLPRWVQSVVREEWTAEVFDVELMRYHNVEEEMVQL  594

Query  367  LQIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASRLSPSSIEQE  203
            LQI ++CV  MPDQRP M EVV+MIE + R D  +  R   +  S+ S     QE
Sbjct  595  LQIGMACVATMPDQRPAMTEVVRMIEEMNRGDTDDGLRQSSDDPSKGSEGQTPQE  649



>ref|XP_006280146.1| hypothetical protein CARUB_v10026045mg [Capsella rubella]
 gb|EOA13044.1| hypothetical protein CARUB_v10026045mg [Capsella rubella]
Length=658

 Score =   196 bits (497),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 92/163 (56%), Positives = 125/163 (77%), Gaps = 1/163 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIKSSN+ +     GC+SD GLS +M+    P+ R AGYRAPEV++TRK  H SD+YSF
Sbjct  484  GNIKSSNVIMKQDSDGCISDFGLSPLMAVPIAPM-RGAGYRAPEVIETRKHTHKSDIYSF  542

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GVL+LE+LTGKSPV + S D+++ L RWV SVVREEWT+EVFDV+L++  +IEEEMV+ML
Sbjct  543  GVLILEMLTGKSPVQSPSRDDMVDLPRWVQSVVREEWTSEVFDVELMRFQNIEEEMVQML  602

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGA  236
            QIA++CV +MP+ RP M ++V+MIE +R +D    R S ++ +
Sbjct  603  QIAMACVAQMPEVRPTMDDIVRMIEEIRVSDSETTRPSSDDNS  645



>ref|XP_006358156.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006358157.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X2 [Solanum tuberosum]
Length=635

 Score =   196 bits (497),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 98/165 (59%), Positives = 124/165 (75%), Gaps = 2/165 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIKSSN+ L     GC+SD GL+ +M+ ++    R AGYRAPEV++TRK    SDVYSF
Sbjct  465  GNIKSSNVLLTRDLDGCISDFGLTPLMNYISYKY-RCAGYRAPEVIETRKGTQKSDVYSF  523

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GVLLLE+LTGKSP+  +  DE++ L RWV SVVREEWTAEVFDV+LLK  +IEEEMV+ML
Sbjct  524  GVLLLEMLTGKSPLPLSGQDEVVDLPRWVRSVVREEWTAEVFDVELLKYQNIEEEMVQML  583

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASR  230
            QI L+CV ++PD RP M EVV+MIE +R+ +  E R S E+  S+
Sbjct  584  QIGLACVAKVPDMRPAMGEVVRMIEEIRQPEG-ETRPSSEDSRSK  627



>ref|XP_009410507.1| PREDICTED: probable inactive receptor kinase At5g58300 [Musa 
acuminata subsp. malaccensis]
Length=627

 Score =   195 bits (496),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 95/160 (59%), Positives = 121/160 (76%), Gaps = 1/160 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            G+IKS+NI L  +   CV D GL+ +M+S A P     GYRAPEV++TRK    SDVYSF
Sbjct  466  GDIKSNNILLTQELDACVCDYGLAPLMNSAATPSRIVVGYRAPEVIETRKYTQKSDVYSF  525

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GVLLLE+LTGK+P+ +   D++  L RWV SVVREEWTAEVFDV+L++ P IEEEMV+ML
Sbjct  526  GVLLLEMLTGKAPLQSPGRDDVADLPRWVQSVVREEWTAEVFDVELMRYPHIEEEMVQML  585

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCE  245
            QIA++CV + PDQRPKM EV++MIE ++ +D  ENR S E
Sbjct  586  QIAMACVSKAPDQRPKMEEVIRMIEDIQHSDS-ENRPSSE  624



>gb|KDO64166.1| hypothetical protein CISIN_1g006747mg [Citrus sinensis]
Length=632

 Score =   195 bits (496),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 93/161 (58%), Positives = 126/161 (78%), Gaps = 2/161 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIKSSN+ L+    GC+SD GL+ +M++   P +R+AGYRAPEV++T+K    SDVYSF
Sbjct  464  GNIKSSNVLLSQDLQGCISDFGLTPLMNTPTVP-SRSAGYRAPEVIETKKPTQKSDVYSF  522

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GVLLLE+LTGK+P+     ++++ L RWV SVVREEWT+EVFDV+L++  +IEEEMV+ML
Sbjct  523  GVLLLEMLTGKAPIQAPGHEDVVDLPRWVQSVVREEWTSEVFDVELMRYENIEEEMVQML  582

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCEN  242
            QIA+SCV ++PD RP M EVV+MIE +R +D  EN+ S E+
Sbjct  583  QIAMSCVAKVPDMRPTMEEVVRMIEDIRPSDS-ENQPSSED  622



>ref|XP_006429632.1| hypothetical protein CICLE_v10011280mg [Citrus clementina]
 ref|XP_006481232.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X1 [Citrus sinensis]
 ref|XP_006481233.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X2 [Citrus sinensis]
 ref|XP_006481234.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X3 [Citrus sinensis]
 gb|ESR42872.1| hypothetical protein CICLE_v10011280mg [Citrus clementina]
Length=632

 Score =   195 bits (496),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 93/161 (58%), Positives = 126/161 (78%), Gaps = 2/161 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIKSSN+ L+    GC+SD GL+ +M++   P +R+AGYRAPEV++T+K    SDVYSF
Sbjct  464  GNIKSSNVLLSQDLQGCISDFGLTPLMNTPTVP-SRSAGYRAPEVIETKKPTQKSDVYSF  522

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GVLLLE+LTGK+P+     ++++ L RWV SVVREEWT+EVFDV+L++  +IEEEMV+ML
Sbjct  523  GVLLLEMLTGKAPIQAPGHEDVVDLPRWVQSVVREEWTSEVFDVELMRYENIEEEMVQML  582

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCEN  242
            QIA+SCV ++PD RP M EVV+MIE +R +D  EN+ S E+
Sbjct  583  QIAMSCVAKVPDMRPTMEEVVRMIEDIRPSDS-ENQPSSED  622



>ref|XP_010999642.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X3 [Populus euphratica]
Length=630

 Score =   195 bits (495),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 96/160 (60%), Positives = 123/160 (77%), Gaps = 2/160 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIKSSN+ L S   GC+SDVGL+ +M+     + R  GYRAPEV++TRKA+  SDVYSF
Sbjct  465  GNIKSSNVILTSDLDGCISDVGLAPLMN-FPTTMYRTIGYRAPEVIETRKASQKSDVYSF  523

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GVLLLE+LTGK+P+     D ++ L RWV SVVREEWTAEVFDV+L++  +IEEEMV+ML
Sbjct  524  GVLLLEMLTGKAPLQVPGHDSVVDLPRWVRSVVREEWTAEVFDVELVRHQNIEEEMVQML  583

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCE  245
            QIAL+CV + PD RPKM EVV+MIE ++ +D  +NR S +
Sbjct  584  QIALACVAKAPDMRPKMDEVVRMIEEIQHSDS-KNRSSSD  622



>ref|XP_010922781.1| PREDICTED: probable inactive receptor kinase At5g58300 [Elaeis 
guineensis]
 ref|XP_010922782.1| PREDICTED: probable inactive receptor kinase At5g58300 [Elaeis 
guineensis]
 ref|XP_010922783.1| PREDICTED: probable inactive receptor kinase At5g58300 [Elaeis 
guineensis]
 ref|XP_010922784.1| PREDICTED: probable inactive receptor kinase At5g58300 [Elaeis 
guineensis]
 ref|XP_010922785.1| PREDICTED: probable inactive receptor kinase At5g58300 [Elaeis 
guineensis]
 ref|XP_010922786.1| PREDICTED: probable inactive receptor kinase At5g58300 [Elaeis 
guineensis]
Length=635

 Score =   195 bits (495),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 95/160 (59%), Positives = 121/160 (76%), Gaps = 1/160 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIK+SN+ L      CVSD GL+ +M+  A P     GYRAPEV++TRK+   SDVYSF
Sbjct  467  GNIKASNVLLTQDLEACVSDFGLAPLMNIHATPSRVVVGYRAPEVIETRKSTQKSDVYSF  526

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GVLLLE+LTGK+P+ +   D+++ L RWV SVVREEWTAEVFDV+L++  +IEEEMV+ML
Sbjct  527  GVLLLEMLTGKAPLQSPGRDDVVDLPRWVQSVVREEWTAEVFDVELMRYQNIEEEMVQML  586

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCE  245
            QIA++CV R PDQRP M +V++MIE VR +D  ENR S E
Sbjct  587  QIAMACVARAPDQRPIMEDVIRMIEEVRHSDS-ENRPSSE  625



>ref|XP_010999638.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Populus euphratica]
Length=656

 Score =   195 bits (495),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 96/160 (60%), Positives = 123/160 (77%), Gaps = 2/160 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIKSSN+ L S   GC+SDVGL+ +M+     + R  GYRAPEV++TRKA+  SDVYSF
Sbjct  491  GNIKSSNVILTSDLDGCISDVGLAPLMN-FPTTMYRTIGYRAPEVIETRKASQKSDVYSF  549

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GVLLLE+LTGK+P+     D ++ L RWV SVVREEWTAEVFDV+L++  +IEEEMV+ML
Sbjct  550  GVLLLEMLTGKAPLQVPGHDSVVDLPRWVRSVVREEWTAEVFDVELVRHQNIEEEMVQML  609

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCE  245
            QIAL+CV + PD RPKM EVV+MIE ++ +D  +NR S +
Sbjct  610  QIALACVAKAPDMRPKMDEVVRMIEEIQHSDS-KNRSSSD  648



>ref|XP_010999639.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Populus euphratica]
 ref|XP_010999640.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Populus euphratica]
 ref|XP_010999641.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Populus euphratica]
Length=655

 Score =   195 bits (495),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 96/160 (60%), Positives = 123/160 (77%), Gaps = 2/160 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIKSSN+ L S   GC+SDVGL+ +M+     + R  GYRAPEV++TRKA+  SDVYSF
Sbjct  490  GNIKSSNVILTSDLDGCISDVGLAPLMN-FPTTMYRTIGYRAPEVIETRKASQKSDVYSF  548

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GVLLLE+LTGK+P+     D ++ L RWV SVVREEWTAEVFDV+L++  +IEEEMV+ML
Sbjct  549  GVLLLEMLTGKAPLQVPGHDSVVDLPRWVRSVVREEWTAEVFDVELVRHQNIEEEMVQML  608

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCE  245
            QIAL+CV + PD RPKM EVV+MIE ++ +D  +NR S +
Sbjct  609  QIALACVAKAPDMRPKMDEVVRMIEEIQHSDS-KNRSSSD  647



>ref|XP_002324958.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|EEF03523.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=621

 Score =   194 bits (494),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 99/169 (59%), Positives = 122/169 (72%), Gaps = 1/169 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIKSSNI L      CVSD GL+ +  +  PP +R AGYRAPEVV+TRK    SDVYSF
Sbjct  438  GNIKSSNILLRPDNDACVSDYGLNPLFGTSTPP-SRVAGYRAPEVVETRKVTFKSDVYSF  496

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GVLLLELLTGK+P   + G+E I L RWV SVVREEWTAEVFDV+L++  +IEEEMV++L
Sbjct  497  GVLLLELLTGKAPNQASLGEEGIDLPRWVQSVVREEWTAEVFDVELMRYHNIEEEMVQLL  556

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASRLSPS  218
            QIA++CV  +PDQRP M EVV+MIE + R +  +  R   +  S+ S S
Sbjct  557  QIAMACVSTVPDQRPAMQEVVRMIEDMNRGETDDGLRQSSDDPSKGSES  605



>ref|XP_009386109.1| PREDICTED: probable inactive receptor kinase At5g58300 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009386110.1| PREDICTED: probable inactive receptor kinase At5g58300 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009386111.1| PREDICTED: probable inactive receptor kinase At5g58300 [Musa 
acuminata subsp. malaccensis]
Length=633

 Score =   194 bits (494),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 95/165 (58%), Positives = 125/165 (76%), Gaps = 2/165 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIKS+N+ L  +   CVS+ GL+ +M+  A P +R  GYRAPEV++ +K+   SDVYSF
Sbjct  464  GNIKSANVLLTQELSACVSEFGLALLMNCAATP-SRIMGYRAPEVLEQQKSTEKSDVYSF  522

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GV LLELLTGKSPV T   DE++ L RWV SVVREEWTAEVFDV+L+K P+IEE+MV+ML
Sbjct  523  GVFLLELLTGKSPVQTPGHDEVVDLPRWVQSVVREEWTAEVFDVELMKYPNIEEDMVQML  582

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASR  230
             +A+ CV R+PD+RP M +VV+MIE VR ++  E+R S E G ++
Sbjct  583  HVAMQCVARVPDRRPTMEDVVRMIEDVRHSNS-ESRPSSEEGKAK  626



>ref|XP_010098027.1| putative inactive receptor kinase [Morus notabilis]
 gb|EXB74410.1| putative inactive receptor kinase [Morus notabilis]
Length=711

 Score =   195 bits (496),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 96/165 (58%), Positives = 128/165 (78%), Gaps = 2/165 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIKSSN+ L+    GC+SD GL+ +M+  A P +R+ GYRAPEV++TRK +  SDVYSF
Sbjct  542  GNIKSSNVLLSQDLSGCISDFGLAPLMNFPAIP-SRSIGYRAPEVIETRKFSQKSDVYSF  600

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GV+LLE+LTGK+PV +   D++  L RWV SVVREEWTAEVFDV+L+K  +IEEE+V+ML
Sbjct  601  GVILLEMLTGKAPVQSPGRDDVADLPRWVQSVVREEWTAEVFDVELMKYQNIEEELVQML  660

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASR  230
            QIA++CV ++PD RP M EVV+MIE +R +D  E+R S E+  S+
Sbjct  661  QIAMACVAKVPDMRPTMEEVVRMIEEIRPSDS-ESRPSPEDNKSK  704



>ref|XP_004246956.1| PREDICTED: probable inactive receptor kinase At5g58300 [Solanum 
lycopersicum]
Length=633

 Score =   194 bits (494),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 97/170 (57%), Positives = 126/170 (74%), Gaps = 3/170 (2%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIKSSN+ L     GC+SDVGL+ +M     P +R+AGYRAPEV++T+K    SDVYSF
Sbjct  464  GNIKSSNVLLTQDNSGCISDVGLTPLMGFPTIP-SRSAGYRAPEVIETKKCTQKSDVYSF  522

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GVLLLELLTGK+PV     DE++ L RWV SVVREEWTAEVFD +L+K  + E+EMV+ML
Sbjct  523  GVLLLELLTGKAPVQPPGHDEVVDLPRWVQSVVREEWTAEVFDTELIKFQNNEDEMVQML  582

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASRLSPSS  215
            QIA++CV  +P+ RP M ++V+MIE +++ D   NR S E+  SR SP+S
Sbjct  583  QIAMACVANVPETRPGMSQIVQMIEDIQQIDS-GNRPSSEDNKSR-SPTS  630



>ref|XP_010483401.1| PREDICTED: probable inactive receptor kinase At5g58300 [Camelina 
sativa]
 ref|XP_010483402.1| PREDICTED: probable inactive receptor kinase At5g58300 [Camelina 
sativa]
 ref|XP_010483403.1| PREDICTED: probable inactive receptor kinase At5g58300 [Camelina 
sativa]
 ref|XP_010483404.1| PREDICTED: probable inactive receptor kinase At5g58300 [Camelina 
sativa]
 ref|XP_010483406.1| PREDICTED: probable inactive receptor kinase At5g58300 [Camelina 
sativa]
 ref|XP_010483407.1| PREDICTED: probable inactive receptor kinase At5g58300 [Camelina 
sativa]
 ref|XP_010483408.1| PREDICTED: probable inactive receptor kinase At5g58300 [Camelina 
sativa]
Length=656

 Score =   194 bits (494),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 93/165 (56%), Positives = 126/165 (76%), Gaps = 5/165 (3%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVA--RAAGYRAPEVVDTRKAAHPSDVY  551
            GNIKSSN+ +  +   C+SD GL+ +M   A P+A  R AGYRAPEV++TRK  H +DVY
Sbjct  482  GNIKSSNVIMKQETDACISDFGLTPLM---AVPIAPMRGAGYRAPEVIETRKHTHKTDVY  538

Query  550  SFGVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVE  371
            SFGVL+LE+LTGKSP+ + S D+++ L RWV SVVREEWT+EVFDV+L++  +IEEEMV+
Sbjct  539  SFGVLILEMLTGKSPIQSPSRDDMVDLPRWVQSVVREEWTSEVFDVELMRFQNIEEEMVQ  598

Query  370  MLQIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGA  236
            MLQIA++CV +MPD RP M +VV+MIE +R +D    R S ++ +
Sbjct  599  MLQIAMACVAQMPDVRPTMDDVVRMIEEIRVSDSETTRPSSDDNS  643



>ref|XP_006351444.1| PREDICTED: probable inactive receptor kinase At2g26730-like [Solanum 
tuberosum]
Length=659

 Score =   195 bits (495),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 98/175 (56%), Positives = 123/175 (70%), Gaps = 1/175 (1%)
 Frame = -2

Query  724  GNIKSSNIFL-NSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYS  548
            GNIK+SN+ L    Q  CVSD GL+ + S+ AP   R AGYRAPEV++TRK  + SDVYS
Sbjct  475  GNIKASNVLLKQDNQDACVSDYGLNPLFSTSAPVNHRVAGYRAPEVLETRKVTYKSDVYS  534

Query  547  FGVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEM  368
            FGVL+LELLTGK+P   + G+E I L RWV SVVREEWTAEVFDV+L++  ++EEEMV++
Sbjct  535  FGVLMLELLTGKAPNQASLGEEGIDLPRWVQSVVREEWTAEVFDVELMRYHNVEEEMVQL  594

Query  367  LQIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASRLSPSSIEQE  203
            LQI ++CV  MPDQRP M EVVKMIE +   D  +  R   +  S+ S     QE
Sbjct  595  LQIGMACVATMPDQRPAMTEVVKMIEEMNHGDTDDGLRQSSDDPSKGSEGQTPQE  649



>ref|XP_011009200.1| PREDICTED: probable inactive receptor kinase At2g26730 [Populus 
euphratica]
Length=653

 Score =   194 bits (494),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 99/169 (59%), Positives = 123/169 (73%), Gaps = 1/169 (1%)
 Frame = -2

Query  724  GNIKSSNIFLNSKQYGCVSDVGLSAIMSSLAPPVARAAGYRAPEVVDTRKAAHPSDVYSF  545
            GNIKSSNI L  +   CVSD GL+ +  +  PP +R AGYRAPEVV+TRK    SDVYSF
Sbjct  470  GNIKSSNILLRPEHDACVSDYGLNPLFGTSTPP-SRVAGYRAPEVVETRKVTFKSDVYSF  528

Query  544  GVLLLELLTGKSPVHTTSGDEIIHLVRWVHSVVREEWTAEVFDVKLLKIPDIEEEMVEML  365
            GVLLLELLTGK+P   + G+E I L RWV SVVREEWTAEVFDV+L++  +IEEEMV++L
Sbjct  529  GVLLLELLTGKAPNQASLGEEGIDLPRWVQSVVREEWTAEVFDVELMRYHNIEEEMVQLL  588

Query  364  QIALSCVVRMPDQRPKMPEVVKMIEGVRRNDHLENRRSCENGASRLSPS  218
            QIA++CV  +PDQRP M EVV+MIE + R +  +  R   +  S+ S S
Sbjct  589  QIAMACVSTVPDQRPAMEEVVRMIEDMNRGETDDGLRQSSDDPSKGSES  637



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1337034311616