BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig10964

Length=732
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009787198.1|  PREDICTED: transcriptional corepressor LEUNI...    308   9e-95   Nicotiana sylvestris
ref|XP_009624260.1|  PREDICTED: transcriptional corepressor LEUNI...    308   9e-95   
ref|XP_009787196.1|  PREDICTED: transcriptional corepressor LEUNI...    308   1e-94   Nicotiana sylvestris
ref|XP_009624257.1|  PREDICTED: transcriptional corepressor LEUNI...    308   1e-94   Nicotiana tomentosiformis
ref|XP_009624258.1|  PREDICTED: transcriptional corepressor LEUNI...    308   1e-94   
ref|XP_009787197.1|  PREDICTED: transcriptional corepressor LEUNI...    308   1e-94   Nicotiana sylvestris
ref|XP_011081899.1|  PREDICTED: transcriptional corepressor LEUNIG      308   2e-94   Sesamum indicum [beniseed]
emb|CBI20987.3|  unnamed protein product                                304   2e-94   Vitis vinifera
ref|XP_010322742.1|  PREDICTED: transcriptional corepressor LEUNI...    305   2e-93   Solanum lycopersicum
ref|XP_006353652.1|  PREDICTED: transcriptional corepressor LEUNI...    305   2e-93   Solanum tuberosum [potatoes]
ref|XP_006353653.1|  PREDICTED: transcriptional corepressor LEUNI...    305   2e-93   Solanum tuberosum [potatoes]
ref|XP_010322743.1|  PREDICTED: transcriptional corepressor LEUNI...    305   2e-93   Solanum lycopersicum
ref|XP_006353651.1|  PREDICTED: transcriptional corepressor LEUNI...    305   3e-93   Solanum tuberosum [potatoes]
ref|XP_004241804.1|  PREDICTED: transcriptional corepressor LEUNI...    305   3e-93   Solanum lycopersicum
ref|XP_010322740.1|  PREDICTED: transcriptional corepressor LEUNI...    305   3e-93   Solanum lycopersicum
ref|XP_010322741.1|  PREDICTED: transcriptional corepressor LEUNI...    305   3e-93   Solanum lycopersicum
ref|XP_006353650.1|  PREDICTED: transcriptional corepressor LEUNI...    305   3e-93   Solanum tuberosum [potatoes]
ref|XP_010648611.1|  PREDICTED: transcriptional corepressor LEUNI...    304   6e-93   Vitis vinifera
ref|XP_002284900.1|  PREDICTED: transcriptional corepressor LEUNI...    303   8e-93   Vitis vinifera
ref|XP_002284925.2|  PREDICTED: transcriptional corepressor LEUNI...    288   2e-92   Vitis vinifera
gb|EYU21923.1|  hypothetical protein MIMGU_mgv1a000972mg                302   4e-92   Erythranthe guttata [common monkey flower]
emb|CBI20989.3|  unnamed protein product                                287   4e-92   Vitis vinifera
ref|XP_011459234.1|  PREDICTED: transcriptional corepressor LEUNI...    299   4e-91   Fragaria vesca subsp. vesca
emb|CAF18245.1|  STYLOSA protein                                        299   5e-91   Antirrhinum majus [garden snapdragon]
ref|XP_004291496.1|  PREDICTED: transcriptional corepressor LEUNI...    298   5e-91   Fragaria vesca subsp. vesca
ref|XP_003544623.1|  PREDICTED: transcriptional corepressor LEUNI...    298   5e-91   Glycine max [soybeans]
ref|XP_006596119.1|  PREDICTED: transcriptional corepressor LEUNI...    298   6e-91   Glycine max [soybeans]
ref|XP_003544622.1|  PREDICTED: transcriptional corepressor LEUNI...    298   7e-91   Glycine max [soybeans]
ref|XP_004498639.1|  PREDICTED: transcriptional corepressor LEUNI...    298   1e-90   Cicer arietinum [garbanzo]
ref|XP_004498638.1|  PREDICTED: transcriptional corepressor LEUNI...    297   1e-90   Cicer arietinum [garbanzo]
ref|XP_012078638.1|  PREDICTED: transcriptional corepressor LEUNI...    283   2e-90   Jatropha curcas
ref|XP_010254246.1|  PREDICTED: transcriptional corepressor LEUNI...    297   2e-90   Nelumbo nucifera [Indian lotus]
ref|XP_010254245.1|  PREDICTED: transcriptional corepressor LEUNI...    296   3e-90   Nelumbo nucifera [Indian lotus]
gb|KDO79602.1|  hypothetical protein CISIN_1g002471mg                   289   3e-90   Citrus sinensis [apfelsine]
ref|XP_002309593.2|  LEUNIG family protein                              296   4e-90   
ref|XP_010254244.1|  PREDICTED: transcriptional corepressor LEUNI...    296   4e-90   Nelumbo nucifera [Indian lotus]
ref|XP_010254243.1|  PREDICTED: transcriptional corepressor LEUNI...    296   4e-90   Nelumbo nucifera [Indian lotus]
ref|XP_010254242.1|  PREDICTED: transcriptional corepressor LEUNI...    296   4e-90   Nelumbo nucifera [Indian lotus]
ref|XP_008394022.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    296   5e-90   
ref|XP_012078639.1|  PREDICTED: transcriptional corepressor LEUNI...    296   5e-90   Jatropha curcas
ref|XP_012078642.1|  PREDICTED: transcriptional corepressor LEUNI...    296   5e-90   Jatropha curcas
ref|XP_007013777.1|  LisH dimerization motif,WD40/YVTN repeat-lik...    296   7e-90   
ref|XP_002515595.1|  WD-repeat protein, putative                        291   1e-89   
ref|XP_007013778.1|  LisH dimerization motif,WD40/YVTN repeat-lik...    295   1e-89   Theobroma cacao [chocolate]
ref|XP_009372956.1|  PREDICTED: transcriptional corepressor LEUNI...    293   1e-89   
ref|XP_009377499.1|  PREDICTED: transcriptional corepressor LEUNI...    295   1e-89   Pyrus x bretschneideri [bai li]
ref|XP_008359611.1|  PREDICTED: transcriptional corepressor LEUNI...    295   1e-89   
ref|XP_008359610.1|  PREDICTED: transcriptional corepressor LEUNI...    295   1e-89   
ref|XP_008359608.1|  PREDICTED: transcriptional corepressor LEUNI...    294   2e-89   
ref|XP_008359609.1|  PREDICTED: transcriptional corepressor LEUNI...    294   2e-89   
ref|XP_008359612.1|  PREDICTED: transcriptional corepressor LEUNI...    294   2e-89   
ref|XP_009377496.1|  PREDICTED: transcriptional corepressor LEUNI...    294   2e-89   Pyrus x bretschneideri [bai li]
ref|XP_011019744.1|  PREDICTED: transcriptional corepressor LEUNI...    293   2e-89   Populus euphratica
ref|XP_010112086.1|  Transcriptional corepressor LEUNIG                 295   2e-89   Morus notabilis
ref|XP_009372954.1|  PREDICTED: transcriptional corepressor LEUNI...    294   3e-89   Pyrus x bretschneideri [bai li]
ref|XP_011019743.1|  PREDICTED: transcriptional corepressor LEUNI...    293   3e-89   Populus euphratica
ref|XP_011019742.1|  PREDICTED: transcriptional corepressor LEUNI...    293   3e-89   Populus euphratica
ref|XP_009367963.1|  PREDICTED: transcriptional corepressor LEUNI...    281   3e-89   Pyrus x bretschneideri [bai li]
ref|XP_003588695.1|  Transcriptional corepressor LEUNIG                 293   4e-89   Medicago truncatula
ref|XP_009372950.1|  PREDICTED: transcriptional corepressor LEUNI...    293   5e-89   Pyrus x bretschneideri [bai li]
ref|XP_009372951.1|  PREDICTED: transcriptional corepressor LEUNI...    293   5e-89   Pyrus x bretschneideri [bai li]
ref|XP_009372955.1|  PREDICTED: transcriptional corepressor LEUNI...    293   5e-89   Pyrus x bretschneideri [bai li]
gb|KEH39820.1|  transcriptional corepressor leunig-like protein         293   5e-89   Medicago truncatula
ref|XP_009367962.1|  PREDICTED: transcriptional corepressor LEUNI...    281   6e-89   Pyrus x bretschneideri [bai li]
ref|XP_007161251.1|  hypothetical protein PHAVU_001G054700g             293   7e-89   Phaseolus vulgaris [French bean]
ref|XP_007225318.1|  hypothetical protein PRUPE_ppa001131mg             286   1e-88   
gb|KDO79600.1|  hypothetical protein CISIN_1g002471mg                   290   2e-88   Citrus sinensis [apfelsine]
ref|XP_008352162.1|  PREDICTED: transcriptional corepressor LEUNI...    279   3e-88   
ref|XP_008219869.1|  PREDICTED: transcriptional corepressor LEUNI...    291   3e-88   Prunus mume [ume]
ref|XP_010526195.1|  PREDICTED: transcriptional corepressor LEUNI...    290   3e-88   Tarenaya hassleriana [spider flower]
ref|XP_008219868.1|  PREDICTED: transcriptional corepressor LEUNI...    291   3e-88   Prunus mume [ume]
ref|XP_008219867.1|  PREDICTED: transcriptional corepressor LEUNI...    291   4e-88   Prunus mume [ume]
ref|XP_007013780.1|  LisH dimerization motif,WD40/YVTN repeat-lik...    291   4e-88   
ref|XP_006450544.1|  hypothetical protein CICLE_v10007390mg             290   1e-87   Citrus clementina [clementine]
ref|XP_006476206.1|  PREDICTED: transcriptional corepressor LEUNI...    290   1e-87   Citrus sinensis [apfelsine]
ref|XP_006450543.1|  hypothetical protein CICLE_v10007390mg             290   2e-87   
gb|KDO79598.1|  hypothetical protein CISIN_1g002471mg                   289   2e-87   Citrus sinensis [apfelsine]
gb|KDO79597.1|  hypothetical protein CISIN_1g002471mg                   289   2e-87   Citrus sinensis [apfelsine]
gb|KDO79596.1|  hypothetical protein CISIN_1g002471mg                   289   2e-87   Citrus sinensis [apfelsine]
ref|XP_010526194.1|  PREDICTED: transcriptional corepressor LEUNI...    289   2e-87   Tarenaya hassleriana [spider flower]
ref|XP_003550163.1|  PREDICTED: transcriptional corepressor LEUNI...    289   2e-87   
ref|XP_003550164.1|  PREDICTED: transcriptional corepressor LEUNI...    288   4e-87   
ref|XP_010548472.1|  PREDICTED: transcriptional corepressor LEUNI...    288   5e-87   Tarenaya hassleriana [spider flower]
ref|XP_010249918.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    288   6e-87   
ref|XP_010548471.1|  PREDICTED: transcriptional corepressor LEUNI...    288   6e-87   Tarenaya hassleriana [spider flower]
ref|XP_010526192.1|  PREDICTED: transcriptional corepressor LEUNI...    288   6e-87   
ref|XP_010548470.1|  PREDICTED: transcriptional corepressor LEUNI...    288   7e-87   Tarenaya hassleriana [spider flower]
ref|XP_010526193.1|  PREDICTED: transcriptional corepressor LEUNI...    288   8e-87   
ref|XP_007225321.1|  hypothetical protein PRUPE_ppa001131mg             286   1e-86   
ref|XP_007225320.1|  hypothetical protein PRUPE_ppa001131mg             286   2e-86   
ref|XP_007225322.1|  hypothetical protein PRUPE_ppa001131mg             286   2e-86   
ref|XP_011026513.1|  PREDICTED: transcriptional corepressor LEUNI...    286   3e-86   Populus euphratica
ref|XP_011026514.1|  PREDICTED: transcriptional corepressor LEUNI...    286   4e-86   Populus euphratica
ref|XP_011026512.1|  PREDICTED: transcriptional corepressor LEUNI...    286   4e-86   Populus euphratica
ref|XP_011026511.1|  PREDICTED: transcriptional corepressor LEUNI...    286   5e-86   Populus euphratica
gb|KDP32298.1|  hypothetical protein JCGZ_13223                         285   7e-86   Jatropha curcas
ref|XP_009377500.1|  PREDICTED: transcriptional corepressor LEUNI...    283   8e-86   
ref|XP_004501292.1|  PREDICTED: transcriptional corepressor LEUNI...    284   1e-85   Cicer arietinum [garbanzo]
ref|XP_004501290.1|  PREDICTED: transcriptional corepressor LEUNI...    284   1e-85   Cicer arietinum [garbanzo]
ref|XP_004501291.1|  PREDICTED: transcriptional corepressor LEUNI...    284   1e-85   Cicer arietinum [garbanzo]
ref|XP_009377497.1|  PREDICTED: transcriptional corepressor LEUNI...    284   1e-85   
ref|XP_009377494.1|  PREDICTED: transcriptional corepressor LEUNI...    284   2e-85   
ref|XP_009377498.1|  PREDICTED: transcriptional corepressor LEUNI...    284   2e-85   
ref|XP_012089282.1|  PREDICTED: transcriptional corepressor LEUNI...    267   2e-85   
ref|XP_012089280.1|  PREDICTED: transcriptional corepressor LEUNI...    267   4e-85   Jatropha curcas
ref|XP_010049010.1|  PREDICTED: transcriptional corepressor LEUNI...    267   4e-85   Eucalyptus grandis [rose gum]
ref|XP_006371728.1|  LEUNIG family protein                              283   4e-85   
ref|XP_010049009.1|  PREDICTED: transcriptional corepressor LEUNI...    268   4e-85   
ref|XP_003522634.1|  PREDICTED: transcriptional corepressor LEUNI...    283   5e-85   Glycine max [soybeans]
gb|KFK29865.1|  hypothetical protein AALP_AA7G189100                    283   5e-85   Arabis alpina [alpine rockcress]
ref|XP_003522633.1|  PREDICTED: transcriptional corepressor LEUNI...    282   6e-85   Glycine max [soybeans]
ref|XP_006578171.1|  PREDICTED: transcriptional corepressor LEUNI...    282   8e-85   Glycine max [soybeans]
ref|XP_010049007.1|  PREDICTED: transcriptional corepressor LEUNI...    267   1e-84   
emb|CDX72364.1|  BnaC07g43860D                                          277   2e-84   
ref|XP_009138136.1|  PREDICTED: transcriptional corepressor LEUNI...    281   3e-84   Brassica rapa
emb|CDY13494.1|  BnaA03g52120D                                          280   4e-84   Brassica napus [oilseed rape]
ref|XP_006581384.1|  PREDICTED: transcriptional corepressor LEUNI...    280   5e-84   Glycine max [soybeans]
gb|KJB83302.1|  hypothetical protein B456_013G240700                    280   6e-84   Gossypium raimondii
ref|XP_010670737.1|  PREDICTED: transcriptional corepressor LEUNIG      280   6e-84   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB83312.1|  hypothetical protein B456_013G240700                    280   6e-84   Gossypium raimondii
gb|KJB83300.1|  hypothetical protein B456_013G240700                    280   7e-84   Gossypium raimondii
ref|XP_006581383.1|  PREDICTED: transcriptional corepressor LEUNI...    279   8e-84   Glycine max [soybeans]
ref|XP_010914979.1|  PREDICTED: transcriptional corepressor LEUNI...    277   8e-84   
ref|XP_003526430.1|  PREDICTED: transcriptional corepressor LEUNI...    279   9e-84   Glycine max [soybeans]
gb|KJB83314.1|  hypothetical protein B456_013G240700                    280   9e-84   Gossypium raimondii
gb|KJB83304.1|  hypothetical protein B456_013G240700                    280   1e-83   Gossypium raimondii
emb|CDY23331.1|  BnaA08g12150D                                          278   2e-83   Brassica napus [oilseed rape]
emb|CDY51674.1|  BnaC03g67130D                                          278   3e-83   Brassica napus [oilseed rape]
ref|XP_006412457.1|  hypothetical protein EUTSA_v10024343mg             278   3e-83   Eutrema salsugineum [saltwater cress]
ref|XP_010915881.1|  PREDICTED: transcriptional corepressor LEUNI...    277   4e-83   Elaeis guineensis
ref|XP_010915804.1|  PREDICTED: transcriptional corepressor LEUNI...    277   4e-83   
ref|XP_009108869.1|  PREDICTED: transcriptional corepressor LEUNIG      277   5e-83   Brassica rapa
ref|XP_010915729.1|  PREDICTED: transcriptional corepressor LEUNI...    277   5e-83   Elaeis guineensis
ref|XP_010915657.1|  PREDICTED: transcriptional corepressor LEUNI...    277   6e-83   Elaeis guineensis
ref|XP_010447372.1|  PREDICTED: transcriptional corepressor LEUNIG      275   3e-82   Camelina sativa [gold-of-pleasure]
gb|KJB83301.1|  hypothetical protein B456_013G240700                    275   3e-82   Gossypium raimondii
gb|KJB83303.1|  hypothetical protein B456_013G240700                    275   3e-82   Gossypium raimondii
ref|XP_010432701.1|  PREDICTED: transcriptional corepressor LEUNI...    275   3e-82   Camelina sativa [gold-of-pleasure]
ref|XP_008811606.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    275   4e-82   
gb|KCW81465.1|  hypothetical protein EUGRSUZ_C028381                    275   5e-82   Eucalyptus grandis [rose gum]
gb|KJB83305.1|  hypothetical protein B456_013G240700                    275   5e-82   Gossypium raimondii
ref|XP_010049005.1|  PREDICTED: transcriptional corepressor LEUNIG      274   7e-82   
emb|CAB43692.1|  putative protein                                       274   7e-82   Arabidopsis thaliana [mouse-ear cress]
ref|NP_567896.1|  transcriptional corepressor LEUNIG                    274   7e-82   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007137062.1|  hypothetical protein PHAVU_009G096600g             275   7e-82   Phaseolus vulgaris [French bean]
gb|AAG32022.1|AF277458_1  LEUNIG                                        274   8e-82   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007137063.1|  hypothetical protein PHAVU_009G096600g             275   8e-82   Phaseolus vulgaris [French bean]
ref|XP_002869264.1|  hypothetical protein ARALYDRAFT_491464             274   9e-82   
ref|NP_001190891.1|  transcriptional corepressor LEUNIG                 274   1e-81   Arabidopsis thaliana [mouse-ear cress]
gb|KCW81467.1|  hypothetical protein EUGRSUZ_C028381                    272   4e-81   Eucalyptus grandis [rose gum]
ref|XP_009407640.1|  PREDICTED: transcriptional corepressor LEUNI...    270   4e-81   
gb|AES73711.2|  transcriptional corepressor leunig-like protein         271   6e-81   Medicago truncatula
gb|KEH35932.1|  transcriptional corepressor leunig-like protein         271   6e-81   Medicago truncatula
ref|XP_007221603.1|  hypothetical protein PRUPE_ppa026892mg             259   1e-80   
gb|EPS73524.1|  hypothetical protein M569_01232                         257   2e-80   Genlisea aurea
ref|XP_009125844.1|  PREDICTED: transcriptional corepressor LEUNI...    271   2e-80   Brassica rapa
ref|XP_003603460.1|  NAD(P)H-quinone oxidoreductase subunit             271   2e-80   
ref|XP_009125860.1|  PREDICTED: transcriptional corepressor LEUNI...    270   2e-80   Brassica rapa
ref|XP_009125852.1|  PREDICTED: transcriptional corepressor LEUNI...    270   2e-80   Brassica rapa
emb|CDX75254.1|  BnaA01g04480D                                          271   3e-80   
ref|XP_009407639.1|  PREDICTED: transcriptional corepressor LEUNI...    269   3e-80   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009407638.1|  PREDICTED: transcriptional corepressor LEUNI...    269   3e-80   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX68860.1|  BnaC01g05930D                                          269   4e-80   
gb|KCW81469.1|  hypothetical protein EUGRSUZ_C028381                    269   4e-80   Eucalyptus grandis [rose gum]
ref|XP_002514368.1|  WD-repeat protein, putative                        261   6e-80   
gb|KCW81471.1|  hypothetical protein EUGRSUZ_C028381                    269   7e-80   Eucalyptus grandis [rose gum]
ref|XP_002969651.1|  hypothetical protein SELMODRAFT_410492             267   8e-80   Selaginella moellendorffii
gb|KFK29867.1|  hypothetical protein AALP_AA7G189300                    256   1e-79   Arabis alpina [alpine rockcress]
ref|XP_002970913.1|  hypothetical protein SELMODRAFT_94317              267   2e-79   
gb|KFK29866.1|  hypothetical protein AALP_AA7G189300                    256   2e-79   Arabis alpina [alpine rockcress]
gb|KJB64522.1|  hypothetical protein B456_010G053000                    266   9e-79   Gossypium raimondii
gb|KJB64525.1|  hypothetical protein B456_010G053000                    266   1e-78   Gossypium raimondii
gb|KJB64523.1|  hypothetical protein B456_010G053000                    266   1e-78   Gossypium raimondii
ref|XP_008445143.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    265   2e-78   
ref|XP_002531278.1|  WD-repeat protein, putative                        250   5e-78   
ref|XP_010925120.1|  PREDICTED: transcriptional corepressor LEUNI...    263   6e-78   Elaeis guineensis
ref|XP_010925121.1|  PREDICTED: transcriptional corepressor LEUNI...    263   7e-78   Elaeis guineensis
ref|XP_008394021.1|  PREDICTED: transcriptional corepressor LEUNI...    249   2e-77   
gb|KGN62903.1|  hypothetical protein Csa_2G379340                       261   3e-77   Cucumis sativus [cucumbers]
gb|KHN08101.1|  Transcriptional corepressor LEUNIG                      261   4e-77   Glycine soja [wild soybean]
ref|XP_004138746.1|  PREDICTED: transcriptional corepressor LEUNI...    261   5e-77   Cucumis sativus [cucumbers]
ref|XP_004138745.1|  PREDICTED: transcriptional corepressor LEUNI...    260   7e-77   Cucumis sativus [cucumbers]
gb|KHN16498.1|  Transcriptional corepressor LEUNIG                      258   4e-76   Glycine soja [wild soybean]
ref|XP_002962710.1|  hypothetical protein SELMODRAFT_79275              258   6e-76   
ref|XP_002980381.1|  hypothetical protein SELMODRAFT_112245             258   6e-76   
ref|XP_012078690.1|  PREDICTED: transcriptional corepressor LEUNI...    255   3e-75   Jatropha curcas
gb|KJB83315.1|  hypothetical protein B456_013G240700                    254   1e-74   Gossypium raimondii
ref|XP_009405109.1|  PREDICTED: transcriptional corepressor LEUNI...    253   3e-74   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009405103.1|  PREDICTED: transcriptional corepressor LEUNI...    253   3e-74   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009405115.1|  PREDICTED: transcriptional corepressor LEUNI...    253   3e-74   
ref|XP_011621570.1|  PREDICTED: transcriptional corepressor LEUNI...    251   6e-74   Amborella trichopoda
ref|XP_008390143.1|  PREDICTED: transcriptional corepressor LEUNI...    243   6e-74   
ref|XP_006838727.1|  PREDICTED: transcriptional corepressor LEUNI...    251   1e-73   Amborella trichopoda
gb|KDO80405.1|  hypothetical protein CISIN_1g003177mg                   242   2e-72   Citrus sinensis [apfelsine]
ref|XP_009371420.1|  PREDICTED: transcriptional corepressor LEUNI...    247   3e-72   
ref|XP_009371419.1|  PREDICTED: transcriptional corepressor LEUNI...    247   4e-72   Pyrus x bretschneideri [bai li]
gb|KHG05392.1|  Transcriptional corepressor LEUNIG -like protein        245   5e-72   Gossypium arboreum [tree cotton]
ref|XP_010533194.1|  PREDICTED: transcriptional corepressor LEUNI...    246   6e-72   
ref|XP_010656383.1|  PREDICTED: transcriptional corepressor LEUNI...    246   6e-72   Vitis vinifera
ref|XP_010656382.1|  PREDICTED: transcriptional corepressor LEUNI...    246   6e-72   Vitis vinifera
gb|KDO80395.1|  hypothetical protein CISIN_1g003177mg                   246   7e-72   Citrus sinensis [apfelsine]
ref|XP_010245981.1|  PREDICTED: transcriptional corepressor LEUNI...    244   2e-71   Nelumbo nucifera [Indian lotus]
ref|XP_010245980.1|  PREDICTED: transcriptional corepressor LEUNI...    244   2e-71   Nelumbo nucifera [Indian lotus]
ref|XP_010245978.1|  PREDICTED: transcriptional corepressor LEUNI...    244   2e-71   Nelumbo nucifera [Indian lotus]
ref|XP_007013296.1|  LisH dimerization motif,WD40/YVTN repeat-lik...    245   2e-71   
ref|XP_010245979.1|  PREDICTED: transcriptional corepressor LEUNI...    244   2e-71   Nelumbo nucifera [Indian lotus]
gb|KHN15508.1|  Transcriptional corepressor LEUNIG                      244   3e-71   Glycine soja [wild soybean]
ref|XP_008337347.1|  PREDICTED: transcriptional corepressor LEUNI...    244   6e-71   
ref|XP_008337351.1|  PREDICTED: transcriptional corepressor LEUNI...    244   6e-71   
ref|XP_008337350.1|  PREDICTED: transcriptional corepressor LEUNI...    244   6e-71   
gb|KDO80404.1|  hypothetical protein CISIN_1g003177mg                   242   7e-71   Citrus sinensis [apfelsine]
ref|XP_011628153.1|  PREDICTED: transcriptional corepressor LEUNIG      243   8e-71   Amborella trichopoda
ref|XP_008386053.1|  PREDICTED: transcriptional corepressor LEUNI...    243   8e-71   
ref|XP_008337349.1|  PREDICTED: transcriptional corepressor LEUNI...    243   8e-71   
gb|KDO80403.1|  hypothetical protein CISIN_1g003177mg                   242   8e-71   Citrus sinensis [apfelsine]
ref|XP_008386062.1|  PREDICTED: transcriptional corepressor LEUNI...    243   8e-71   
gb|ERN18907.1|  hypothetical protein AMTR_s00067p00167320               243   9e-71   Amborella trichopoda
ref|XP_009403020.1|  PREDICTED: transcriptional corepressor LEUNI...    243   9e-71   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACZ98534.1|  LisH-SSDP-WD40                                          243   1e-70   Malus domestica [apple tree]
ref|XP_009403018.1|  PREDICTED: transcriptional corepressor LEUNI...    243   1e-70   
ref|XP_008386048.1|  PREDICTED: transcriptional corepressor LEUNI...    243   1e-70   
ref|XP_009374058.1|  PREDICTED: transcriptional corepressor LEUNI...    243   1e-70   
ref|XP_006451037.1|  hypothetical protein CICLE_v10007449mg             242   2e-70   Citrus clementina [clementine]
ref|XP_009372971.1|  PREDICTED: transcriptional corepressor LEUNI...    226   2e-70   
gb|KDO80396.1|  hypothetical protein CISIN_1g003177mg                   242   2e-70   Citrus sinensis [apfelsine]
ref|XP_006475763.1|  PREDICTED: transcriptional corepressor LEUNI...    241   3e-70   Citrus sinensis [apfelsine]
ref|XP_006475762.1|  PREDICTED: transcriptional corepressor LEUNI...    241   3e-70   Citrus sinensis [apfelsine]
ref|XP_009387170.1|  PREDICTED: transcriptional corepressor LEUNI...    242   4e-70   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010264093.1|  PREDICTED: transcriptional corepressor LEUNI...    239   2e-69   Nelumbo nucifera [Indian lotus]
ref|XP_007204646.1|  hypothetical protein PRUPE_ppa001612mg             237   9e-69   
gb|KHG11579.1|  Transcriptional corepressor LEUNIG -like protein        235   4e-68   Gossypium arboreum [tree cotton]
ref|XP_010541891.1|  PREDICTED: transcriptional corepressor LEUNI...    233   4e-68   Tarenaya hassleriana [spider flower]
gb|ACN37000.1|  unknown                                                 225   6e-68   Zea mays [maize]
ref|XP_002518113.1|  WD-repeat protein, putative                        234   6e-68   
ref|NP_001042184.1|  Os01g0177100                                       235   7e-68   
ref|XP_004517072.1|  PREDICTED: transcriptional corepressor LEUNI...    234   7e-68   
dbj|BAD67819.1|  putative transcriptional corepressor LEUNIG            235   7e-68   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004517070.1|  PREDICTED: transcriptional corepressor LEUNI...    234   7e-68   Cicer arietinum [garbanzo]
ref|XP_004517071.1|  PREDICTED: transcriptional corepressor LEUNI...    234   7e-68   
ref|XP_004517073.1|  PREDICTED: transcriptional corepressor LEUNI...    234   7e-68   Cicer arietinum [garbanzo]
ref|XP_004517069.1|  PREDICTED: transcriptional corepressor LEUNI...    234   7e-68   
ref|XP_004517067.1|  PREDICTED: transcriptional corepressor LEUNI...    234   7e-68   Cicer arietinum [garbanzo]
ref|XP_010541890.1|  PREDICTED: transcriptional corepressor LEUNI...    234   8e-68   Tarenaya hassleriana [spider flower]
ref|XP_008796439.1|  PREDICTED: transcriptional corepressor LEUNI...    232   9e-68   
ref|XP_008242693.1|  PREDICTED: transcriptional corepressor LEUNI...    235   9e-68   Prunus mume [ume]
ref|XP_008242692.1|  PREDICTED: transcriptional corepressor LEUNI...    235   9e-68   Prunus mume [ume]
ref|XP_010541888.1|  PREDICTED: transcriptional corepressor LEUNI...    234   1e-67   Tarenaya hassleriana [spider flower]
ref|XP_008785188.1|  PREDICTED: transcriptional corepressor LEUNI...    234   2e-67   
ref|XP_008785186.1|  PREDICTED: transcriptional corepressor LEUNI...    233   2e-67   
ref|XP_008785183.1|  PREDICTED: transcriptional corepressor LEUNI...    233   2e-67   
gb|KHG28610.1|  Transcriptional corepressor LEUNIG -like protein        234   2e-67   Gossypium arboreum [tree cotton]
ref|XP_010541889.1|  PREDICTED: transcriptional corepressor LEUNI...    233   2e-67   Tarenaya hassleriana [spider flower]
gb|KJB64845.1|  hypothetical protein B456_010G067800                    233   3e-67   Gossypium raimondii
gb|KJB64850.1|  hypothetical protein B456_010G067800                    233   3e-67   Gossypium raimondii
gb|KJB64846.1|  hypothetical protein B456_010G067800                    233   3e-67   Gossypium raimondii
ref|XP_006420880.1|  hypothetical protein CICLE_v10004358mg             228   3e-67   
gb|KJB64849.1|  hypothetical protein B456_010G067800                    233   5e-67   Gossypium raimondii
gb|EEC74226.1|  hypothetical protein OsI_09411                          231   1e-66   Oryza sativa Indica Group [Indian rice]
ref|XP_012071160.1|  PREDICTED: transcriptional corepressor LEUNIG      231   1e-66   Jatropha curcas
ref|XP_003570372.1|  PREDICTED: transcriptional corepressor LEUNIG      231   1e-66   Brachypodium distachyon [annual false brome]
ref|XP_008802409.1|  PREDICTED: transcriptional corepressor LEUNI...    231   2e-66   Phoenix dactylifera
gb|AFW73990.1|  hypothetical protein ZEAMMB73_066038                    226   2e-66   
ref|XP_004954333.1|  PREDICTED: transcriptional corepressor LEUNI...    231   2e-66   
ref|XP_008802406.1|  PREDICTED: transcriptional corepressor LEUNI...    231   2e-66   Phoenix dactylifera
emb|CAE03368.2|  OSJNBb0065L13.11                                       230   4e-66   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006420877.1|  hypothetical protein CICLE_v10004358mg             229   4e-66   
ref|NP_001048487.1|  Os02g0813800                                       229   4e-66   
ref|XP_006420876.1|  hypothetical protein CICLE_v10004358mg             229   5e-66   
ref|XP_002454764.1|  hypothetical protein SORBIDRAFT_04g036910          229   7e-66   Sorghum bicolor [broomcorn]
ref|XP_006493704.1|  PREDICTED: transcriptional corepressor LEUNI...    228   9e-66   
ref|XP_006493701.1|  PREDICTED: transcriptional corepressor LEUNI...    228   1e-65   Citrus sinensis [apfelsine]
gb|EEC77619.1|  hypothetical protein OsI_16603                          229   1e-65   Oryza sativa Indica Group [Indian rice]
ref|XP_010934265.1|  PREDICTED: transcriptional corepressor LEUNI...    228   1e-65   Elaeis guineensis
ref|XP_010934267.1|  PREDICTED: transcriptional corepressor LEUNI...    228   1e-65   Elaeis guineensis
ref|XP_006652501.1|  PREDICTED: transcriptional corepressor LEUNI...    228   1e-65   Oryza brachyantha
ref|XP_012074267.1|  PREDICTED: transcriptional corepressor LEUNI...    223   2e-65   
ref|XP_006385922.1|  hypothetical protein POPTR_0003s17700g             227   3e-65   Populus trichocarpa [western balsam poplar]
ref|XP_006643822.1|  PREDICTED: transcriptional corepressor LEUNI...    228   4e-65   Oryza brachyantha
ref|XP_008643802.1|  PREDICTED: LOC100285175 isoform X1                 227   5e-65   Zea mays [maize]
ref|XP_003590232.1|  Transcriptional corepressor LEUNIG                 226   6e-65   
ref|XP_003607636.1|  Transcriptional corepressor LEUNIG                 226   6e-65   
ref|XP_008789440.1|  PREDICTED: transcriptional corepressor LEUNIG      226   6e-65   
ref|XP_003607635.1|  Transcriptional corepressor LEUNIG                 226   6e-65   
ref|XP_011656566.1|  PREDICTED: transcriptional corepressor LEUNI...    225   7e-65   
gb|AFW83210.1|  hypothetical protein ZEAMMB73_733859                    219   8e-65   
gb|KGN65390.1|  hypothetical protein Csa_1G403660                       225   9e-65   
ref|XP_002299273.1|  hypothetical protein POPTR_0001s14560g             226   1e-64   
ref|XP_006368907.1|  hypothetical protein POPTR_0001s14560g             225   1e-64   
ref|NP_001151541.1|  LOC100285175                                       225   2e-64   
ref|XP_008224605.1|  PREDICTED: transcriptional corepressor LEUNIG      225   2e-64   
ref|XP_010936002.1|  PREDICTED: transcriptional corepressor LEUNI...    224   3e-64   
ref|XP_006588998.1|  PREDICTED: transcriptional corepressor LEUNI...    224   3e-64   
ref|XP_006588999.1|  PREDICTED: transcriptional corepressor LEUNI...    224   3e-64   
ref|XP_006588996.1|  PREDICTED: transcriptional corepressor LEUNI...    224   3e-64   
ref|XP_010936000.1|  PREDICTED: transcriptional corepressor LEUNI...    224   3e-64   
ref|XP_006588997.1|  PREDICTED: transcriptional corepressor LEUNI...    224   3e-64   
ref|XP_010936003.1|  PREDICTED: transcriptional corepressor LEUNI...    224   3e-64   
ref|XP_011020662.1|  PREDICTED: transcriptional corepressor LEUNI...    224   3e-64   
ref|XP_007221910.1|  hypothetical protein PRUPE_ppa001706mg             224   4e-64   
ref|XP_009385699.1|  PREDICTED: transcriptional corepressor LEUNI...    224   5e-64   
gb|AFW83211.1|  hypothetical protein ZEAMMB73_733859                    220   5e-64   
ref|XP_010522422.1|  PREDICTED: transcriptional corepressor LEUNI...    223   8e-64   
emb|CDP04843.1|  unnamed protein product                                213   8e-64   
ref|XP_010522421.1|  PREDICTED: transcriptional corepressor LEUNI...    223   9e-64   
gb|EMS54829.1|  Transcriptional corepressor LEUNIG                      224   1e-63   
ref|XP_010232007.1|  PREDICTED: transcriptional corepressor LEUNI...    224   1e-63   
ref|NP_001137120.1|  uncharacterized protein LOC100217300               206   2e-63   
ref|XP_009382685.1|  PREDICTED: transcriptional corepressor LEUNI...    222   3e-63   
ref|XP_009382681.1|  PREDICTED: transcriptional corepressor LEUNI...    222   3e-63   
gb|ACN34826.1|  unknown                                                 221   4e-63   
ref|XP_011458499.1|  PREDICTED: transcriptional corepressor LEUNI...    221   8e-63   
ref|XP_004287384.1|  PREDICTED: transcriptional corepressor LEUNI...    221   8e-63   
gb|EPS68633.1|  hypothetical protein M569_06134                         221   8e-63   
ref|XP_008463346.1|  PREDICTED: transcriptional corepressor LEUNI...    219   9e-63   
ref|XP_008654518.1|  PREDICTED: uncharacterized protein LOC100217...    221   1e-62   
gb|KJB72103.1|  hypothetical protein B456_011G159400                    219   2e-62   
gb|KJB72102.1|  hypothetical protein B456_011G159400                    219   2e-62   
ref|XP_009374610.1|  PREDICTED: transcriptional corepressor LEUNI...    219   2e-62   
ref|XP_009374609.1|  PREDICTED: transcriptional corepressor LEUNI...    219   3e-62   
ref|XP_007145511.1|  hypothetical protein PHAVU_007G244700g             219   3e-62   
ref|XP_009400486.1|  PREDICTED: transcriptional corepressor LEUNI...    219   4e-62   
dbj|BAK05188.1|  predicted protein                                      219   4e-62   
gb|AEB38247.1|  LEUNIG                                                  203   5e-62   
gb|AEB38252.1|  LEUNIG                                                  203   5e-62   
ref|XP_004296628.1|  PREDICTED: transcriptional corepressor LEUNIG      218   7e-62   
dbj|BAK08332.1|  predicted protein                                      218   9e-62   
emb|CDM81840.1|  unnamed protein product                                218   1e-61   
ref|XP_010069048.1|  PREDICTED: transcriptional corepressor LEUNIG      217   2e-61   
gb|AEB38227.1|  LEUNIG                                                  202   2e-61   
gb|AEB38235.1|  LEUNIG                                                  202   2e-61   
gb|AEB38264.1|  LEUNIG                                                  202   2e-61   
gb|AHZ31532.1|  WD-40 repeat family protein                             200   3e-61   
ref|XP_010940732.1|  PREDICTED: transcriptional corepressor LEUNI...    216   3e-61   
ref|XP_010940734.1|  PREDICTED: transcriptional corepressor LEUNI...    216   3e-61   
ref|XP_010940733.1|  PREDICTED: transcriptional corepressor LEUNI...    216   3e-61   
gb|ABQ42123.1|  WD-40 repeat family protein (LEUNIG)                    200   3e-61   
dbj|BAE98454.1|  hypothetical protein                                   204   3e-61   
emb|CDP04841.1|  unnamed protein product                                209   3e-61   
ref|XP_010940736.1|  PREDICTED: transcriptional corepressor LEUNI...    216   3e-61   
ref|XP_010940735.1|  PREDICTED: transcriptional corepressor LEUNI...    216   3e-61   
gb|KHG01358.1|  Transcriptional corepressor LEUNIG -like protein        216   4e-61   
ref|XP_006602530.1|  PREDICTED: transcriptional corepressor LEUNI...    215   4e-61   
gb|KHN09543.1|  Transcriptional corepressor LEUNIG                      215   5e-61   
ref|XP_003552134.1|  PREDICTED: transcriptional corepressor LEUNI...    215   5e-61   
ref|XP_008380581.1|  PREDICTED: transcriptional corepressor LEUNI...    215   6e-61   
ref|XP_006602529.1|  PREDICTED: transcriptional corepressor LEUNI...    215   6e-61   
ref|XP_002458130.1|  hypothetical protein SORBIDRAFT_03g027390          214   6e-61   
gb|AHZ31527.1|  WD-40 repeat family protein                             199   6e-61   
gb|ABQ42121.1|  WD-40 repeat family protein (LEUNIG)                    199   6e-61   
ref|XP_008380580.1|  PREDICTED: transcriptional corepressor LEUNI...    215   6e-61   
gb|ACS68698.1|  transcriptional corepressor LEUNIG                      199   7e-61   
ref|XP_008380582.1|  PREDICTED: transcriptional corepressor LEUNI...    215   7e-61   
ref|XP_008438370.1|  PREDICTED: transcriptional corepressor LEUNI...    214   9e-61   
gb|AHZ31529.1|  WD-40 repeat family protein                             198   1e-60   
gb|AEB38257.1|  LEUNIG                                                  200   1e-60   
gb|ABQ42122.1|  WD-40 repeat family protein (LEUNIG)                    198   1e-60   
ref|XP_008438369.1|  PREDICTED: transcriptional corepressor LEUNI...    214   1e-60   
ref|XP_011650880.1|  PREDICTED: transcriptional corepressor LEUNI...    214   1e-60   
ref|XP_010230532.1|  PREDICTED: transcriptional corepressor LEUNI...    215   1e-60   
ref|XP_011650879.1|  PREDICTED: transcriptional corepressor LEUNI...    214   1e-60   
ref|XP_004969116.1|  PREDICTED: transcriptional corepressor LEUNI...    215   1e-60   
gb|EMS61864.1|  Transcriptional corepressor LEUNIG                      214   2e-60   
ref|XP_009143945.1|  PREDICTED: transcriptional corepressor LEUNI...    214   2e-60   
ref|XP_009143947.1|  PREDICTED: transcriptional corepressor LEUNI...    214   2e-60   
ref|XP_004242402.1|  PREDICTED: transcriptional corepressor LEUNI...    213   3e-60   
ref|XP_010688121.1|  PREDICTED: transcriptional corepressor LEUNI...    213   3e-60   
ref|XP_011629207.1|  PREDICTED: transcriptional corepressor LEUNI...    214   3e-60   
ref|XP_006829639.1|  PREDICTED: transcriptional corepressor LEUNI...    214   3e-60   
ref|XP_011629206.1|  PREDICTED: transcriptional corepressor LEUNI...    214   3e-60   
ref|XP_006352696.1|  PREDICTED: transcriptional corepressor LEUNI...    213   3e-60   
ref|XP_010688120.1|  PREDICTED: transcriptional corepressor LEUNI...    213   4e-60   
ref|XP_009372953.1|  PREDICTED: transcriptional corepressor LEUNI...    214   4e-60   
ref|XP_011629208.1|  PREDICTED: transcriptional corepressor LEUNI...    213   4e-60   
ref|XP_002458129.1|  hypothetical protein SORBIDRAFT_03g027380          213   7e-60   
ref|XP_004969118.1|  PREDICTED: transcriptional corepressor LEUNI...    212   8e-60   
ref|XP_006586253.1|  PREDICTED: transcriptional corepressor LEUNI...    212   9e-60   
ref|XP_009132865.1|  PREDICTED: transcriptional corepressor LEUNI...    211   1e-59   
ref|XP_009132864.1|  PREDICTED: transcriptional corepressor LEUNI...    211   2e-59   
gb|KJB30138.1|  hypothetical protein B456_005G131200                    211   2e-59   
gb|KJB30144.1|  hypothetical protein B456_005G131200                    211   2e-59   
ref|XP_004969117.1|  PREDICTED: transcriptional corepressor LEUNI...    212   2e-59   
gb|KJB30139.1|  hypothetical protein B456_005G131200                    211   2e-59   
gb|KJB30141.1|  hypothetical protein B456_005G131200                    211   2e-59   
gb|KHN45807.1|  Transcriptional corepressor LEUNIG                      202   2e-59   
gb|AHZ31531.1|  WD-40 repeat family protein                             195   2e-59   
gb|KJB64847.1|  hypothetical protein B456_010G067800                    211   3e-59   
tpg|DAA58907.1|  TPA: hypothetical protein ZEAMMB73_625314              204   3e-59   
ref|XP_012085119.1|  PREDICTED: transcriptional corepressor LEUNI...    209   7e-59   
ref|XP_006479292.1|  PREDICTED: transcriptional corepressor LEUNI...    209   7e-59   
ref|XP_006575161.1|  PREDICTED: transcriptional corepressor LEUNI...    209   7e-59   
ref|XP_002301780.1|  WD-40 repeat family protein                        209   8e-59   
ref|XP_006479291.1|  PREDICTED: transcriptional corepressor LEUNI...    209   8e-59   
gb|KDO65918.1|  hypothetical protein CISIN_1g047260mg                   209   8e-59   
ref|XP_006479287.1|  PREDICTED: transcriptional corepressor LEUNI...    209   8e-59   
ref|XP_006443612.1|  hypothetical protein CICLE_v10023309mg             209   8e-59   
ref|XP_006479286.1|  PREDICTED: transcriptional corepressor LEUNI...    209   8e-59   
ref|XP_006479288.1|  PREDICTED: transcriptional corepressor LEUNI...    209   9e-59   
ref|XP_003518997.1|  PREDICTED: transcriptional corepressor LEUNI...    209   9e-59   
ref|XP_006575159.1|  PREDICTED: transcriptional corepressor LEUNI...    209   9e-59   
ref|XP_007049791.1|  WD-repeat protein isoform 2                        209   9e-59   
ref|XP_006575160.1|  PREDICTED: transcriptional corepressor LEUNI...    209   9e-59   
ref|XP_006575158.1|  PREDICTED: transcriptional corepressor LEUNI...    209   9e-59   
gb|KHG13588.1|  Transcriptional corepressor LEUNIG -like protein        208   9e-59   
ref|XP_011080189.1|  PREDICTED: transcriptional corepressor LEUNI...    209   9e-59   
ref|XP_007049790.1|  WD-repeat protein isoform 1                        209   1e-58   
ref|XP_006644351.1|  PREDICTED: transcriptional corepressor LEUNI...    209   1e-58   
ref|XP_002266172.1|  PREDICTED: transcriptional corepressor LEUNI...    209   1e-58   
ref|XP_010652506.1|  PREDICTED: transcriptional corepressor LEUNI...    209   1e-58   
emb|CDP03866.1|  unnamed protein product                                209   1e-58   
emb|CAN73936.1|  hypothetical protein VITISV_026282                     208   2e-58   
ref|XP_009763485.1|  PREDICTED: transcriptional corepressor LEUNI...    202   2e-58   
ref|XP_012085117.1|  PREDICTED: transcriptional corepressor LEUNI...    208   2e-58   
ref|XP_006295571.1|  hypothetical protein CARUB_v10024675mg             208   3e-58   
gb|KJB42456.1|  hypothetical protein B456_007G154000                    207   3e-58   
gb|KJB42455.1|  hypothetical protein B456_007G154000                    207   3e-58   
gb|KHN07186.1|  Transcriptional corepressor LEUNIG                      207   4e-58   
ref|XP_007034391.1|  LEUNIG_homolog isoform 1                           207   4e-58   
ref|XP_011046456.1|  PREDICTED: transcriptional corepressor LEUNI...    193   4e-58   
gb|EYU46334.1|  hypothetical protein MIMGU_mgv1a001624mg                207   5e-58   
ref|XP_008235491.1|  PREDICTED: transcriptional corepressor LEUNI...    206   5e-58   
ref|XP_008673195.1|  PREDICTED: hypothetical protein isoform X8         207   7e-58   
ref|XP_004968403.1|  PREDICTED: transcriptional corepressor LEUNI...    207   7e-58   
gb|KHG03492.1|  Transcriptional corepressor LEUNIG -like protein        206   8e-58   
ref|XP_008673192.1|  PREDICTED: hypothetical protein isoform X5         207   8e-58   
ref|XP_008673193.1|  PREDICTED: hypothetical protein isoform X6         207   9e-58   
ref|XP_008673196.1|  PREDICTED: hypothetical protein isoform X9         207   9e-58   
emb|CDX84727.1|  BnaA03g15030D                                          209   1e-57   
tpg|DAA58910.1|  TPA: hypothetical protein ZEAMMB73_487398              206   1e-57   
ref|NP_565749.1|  WD40 repeat protein MUCILAGE-MODIFIED 1               206   1e-57   
ref|XP_010049943.1|  PREDICTED: transcriptional corepressor LEUNI...    203   1e-57   
ref|NP_001031466.2|  WD40 repeat protein MUCILAGE-MODIFIED 1            206   1e-57   
ref|NP_001169538.1|  hypothetical protein                               206   1e-57   
ref|XP_008673194.1|  PREDICTED: hypothetical protein isoform X7         206   1e-57   
ref|XP_008673188.1|  PREDICTED: hypothetical protein isoform X1         206   1e-57   
ref|XP_008673190.1|  PREDICTED: hypothetical protein isoform X3         206   1e-57   
ref|XP_008673189.1|  PREDICTED: hypothetical protein isoform X2         206   1e-57   
ref|XP_008673191.1|  PREDICTED: hypothetical protein isoform X4         206   1e-57   
ref|NP_001189659.1|  WD40 repeat protein MUCILAGE-MODIFIED 1            206   1e-57   
ref|XP_008235489.1|  PREDICTED: transcriptional corepressor LEUNI...    206   1e-57   
ref|XP_011083129.1|  PREDICTED: transcriptional corepressor LEUNI...    206   1e-57   
dbj|BAD52824.1|  LEUNIG-like                                            202   2e-57   
gb|KJB10968.1|  hypothetical protein B456_001G234100                    205   2e-57   
emb|CDX79469.1|  BnaC03g18050D                                          208   2e-57   
gb|KJB10964.1|  hypothetical protein B456_001G234100                    205   2e-57   
ref|XP_007225319.1|  hypothetical protein PRUPE_ppa001131mg             206   3e-57   
gb|KHN15134.1|  Transcriptional corepressor LEUNIG                      205   3e-57   
gb|KHG14548.1|  Transcriptional corepressor LEUNIG -like protein        205   3e-57   
emb|CAN78118.1|  hypothetical protein VITISV_041543                     198   3e-57   
ref|XP_004492306.1|  PREDICTED: transcriptional corepressor LEUNI...    205   3e-57   
gb|KJB10969.1|  hypothetical protein B456_001G234100                    205   3e-57   
gb|KJB10966.1|  hypothetical protein B456_001G234100                    205   3e-57   
gb|KJB10963.1|  hypothetical protein B456_001G234100                    205   3e-57   
gb|KJB10965.1|  hypothetical protein B456_001G234100                    205   4e-57   
ref|XP_006600769.1|  PREDICTED: transcriptional corepressor LEUNI...    205   4e-57   
ref|XP_010049942.1|  PREDICTED: transcriptional corepressor LEUNI...    203   4e-57   
ref|XP_006600770.1|  PREDICTED: transcriptional corepressor LEUNI...    205   4e-57   
gb|KJB42457.1|  hypothetical protein B456_007G154000                    204   4e-57   
gb|KJB42458.1|  hypothetical protein B456_007G154000                    204   4e-57   
gb|KJB10967.1|  hypothetical protein B456_001G234100                    204   4e-57   
ref|XP_004492304.1|  PREDICTED: transcriptional corepressor LEUNI...    204   4e-57   
ref|XP_010232006.1|  PREDICTED: transcriptional corepressor LEUNI...    205   4e-57   
ref|XP_006600771.1|  PREDICTED: transcriptional corepressor LEUNI...    205   4e-57   
ref|XP_004492305.1|  PREDICTED: transcriptional corepressor LEUNI...    204   4e-57   
ref|XP_010232005.1|  PREDICTED: transcriptional corepressor LEUNI...    205   4e-57   
ref|XP_003569328.1|  PREDICTED: transcriptional corepressor LEUNI...    205   5e-57   
ref|XP_009371604.1|  PREDICTED: transcriptional corepressor LEUNI...    204   6e-57   
ref|XP_002879407.1|  WD-40 repeat family protein                        204   6e-57   
ref|XP_010049941.1|  PREDICTED: transcriptional corepressor LEUNI...    202   6e-57   
ref|XP_004290216.1|  PREDICTED: transcriptional corepressor LEUNI...    204   6e-57   
ref|XP_010109725.1|  Transcriptional corepressor LEUNIG                 204   6e-57   
gb|KCW82772.1|  hypothetical protein EUGRSUZ_C04148                     202   7e-57   
gb|KJB83313.1|  hypothetical protein B456_013G240700                    204   7e-57   
ref|XP_010098951.1|  Transcriptional corepressor LEUNIG                 204   7e-57   
ref|XP_009611891.1|  PREDICTED: transcriptional corepressor LEUNI...    204   1e-56   
gb|EMT20506.1|  hypothetical protein F775_26146                         205   1e-56   
gb|EMS47185.1|  Transcriptional corepressor LEUNIG                      206   1e-56   
ref|XP_011024693.1|  PREDICTED: transcriptional corepressor LEUNI...    202   2e-56   
ref|XP_008382635.1|  PREDICTED: transcriptional corepressor LEUNI...    202   2e-56   
emb|CAF18246.1|  STY-L protein                                          202   3e-56   
ref|NP_001043531.2|  Os01g0607400                                       202   3e-56   
gb|EEE54961.1|  hypothetical protein OsJ_02550                          202   3e-56   
ref|XP_007140593.1|  hypothetical protein PHAVU_008G125400g             202   3e-56   
dbj|BAM17634.1|  HWC1                                                   202   4e-56   
ref|XP_011024692.1|  PREDICTED: transcriptional corepressor LEUNI...    202   4e-56   
ref|XP_011024691.1|  PREDICTED: transcriptional corepressor LEUNI...    202   4e-56   
ref|XP_011024689.1|  PREDICTED: transcriptional corepressor LEUNI...    202   4e-56   
gb|KDP20984.1|  hypothetical protein JCGZ_21455                         191   4e-56   
ref|XP_009334933.1|  PREDICTED: transcriptional corepressor LEUNI...    202   4e-56   
gb|EMT14678.1|  Transcriptional corepressor LEUNIG                      204   4e-56   
ref|XP_007154933.1|  hypothetical protein PHAVU_003G159500g             202   4e-56   
ref|XP_007154935.1|  hypothetical protein PHAVU_003G159500g             202   5e-56   
ref|XP_007154930.1|  hypothetical protein PHAVU_003G159500g             202   5e-56   
gb|ERN17448.1|  hypothetical protein AMTR_s00037p00237830               199   5e-56   
ref|XP_009334934.1|  PREDICTED: transcriptional corepressor LEUNI...    201   5e-56   
ref|XP_010920380.1|  PREDICTED: transcriptional corepressor LEUNI...    200   6e-56   
ref|XP_007154936.1|  hypothetical protein PHAVU_003G159500g             201   6e-56   
ref|XP_010107758.1|  Transcriptional corepressor LEUNIG                 201   6e-56   
ref|XP_011460664.1|  PREDICTED: transcriptional corepressor LEUNI...    200   8e-56   
gb|EEC71055.1|  hypothetical protein OsI_02792                          201   8e-56   
ref|XP_009760188.1|  PREDICTED: transcriptional corepressor LEUNIG      201   1e-55   



>ref|XP_009787198.1| PREDICTED: transcriptional corepressor LEUNIG isoform X3 [Nicotiana 
sylvestris]
Length=892

 Score =   308 bits (790),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 145/160 (91%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = -1

Query  732  TRAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGE  553
            TR FKGGTAQVRFQPR+GRYLAAAAENVVSILDVETQ CR +LKGHTKPIHSVCWDPSGE
Sbjct  733  TRVFKGGTAQVRFQPRIGRYLAAAAENVVSILDVETQACRHSLKGHTKPIHSVCWDPSGE  792

Query  552  HLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNM  373
             LASVSEDSVRVWTL SG+EG+C+HELSSNGNKFHSCVFHP+YSSLLVIGCYQSLELWNM
Sbjct  793  LLASVSEDSVRVWTLRSGSEGDCLHELSSNGNKFHSCVFHPTYSSLLVIGCYQSLELWNM  852

Query  372  TENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
             ENKTMTL AHEGLIASLAVSTVAGLVASASHDK +KLWK
Sbjct  853  NENKTMTLTAHEGLIASLAVSTVAGLVASASHDKFVKLWK  892



>ref|XP_009624260.1| PREDICTED: transcriptional corepressor LEUNIG isoform X3 [Nicotiana 
tomentosiformis]
Length=896

 Score =   308 bits (790),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 145/160 (91%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = -1

Query  732  TRAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGE  553
            TR FKGGTAQVRFQPR+GRYLAAAAENVVSILDVETQ CR +LKGHTKPIHSVCWDPSGE
Sbjct  737  TRVFKGGTAQVRFQPRIGRYLAAAAENVVSILDVETQACRHSLKGHTKPIHSVCWDPSGE  796

Query  552  HLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNM  373
             LASVSEDSVRVWTL SG+EG+C+HELSSNGNKFHSCVFHP+YSSLLVIGCYQSLELWNM
Sbjct  797  LLASVSEDSVRVWTLRSGSEGDCLHELSSNGNKFHSCVFHPTYSSLLVIGCYQSLELWNM  856

Query  372  TENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
             ENKTMTL AHEGLIASLAVSTVAGLVASASHDK +KLWK
Sbjct  857  NENKTMTLTAHEGLIASLAVSTVAGLVASASHDKFVKLWK  896



>ref|XP_009787196.1| PREDICTED: transcriptional corepressor LEUNIG isoform X1 [Nicotiana 
sylvestris]
Length=900

 Score =   308 bits (789),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 145/160 (91%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = -1

Query  732  TRAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGE  553
            TR FKGGTAQVRFQPR+GRYLAAAAENVVSILDVETQ CR +LKGHTKPIHSVCWDPSGE
Sbjct  741  TRVFKGGTAQVRFQPRIGRYLAAAAENVVSILDVETQACRHSLKGHTKPIHSVCWDPSGE  800

Query  552  HLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNM  373
             LASVSEDSVRVWTL SG+EG+C+HELSSNGNKFHSCVFHP+YSSLLVIGCYQSLELWNM
Sbjct  801  LLASVSEDSVRVWTLRSGSEGDCLHELSSNGNKFHSCVFHPTYSSLLVIGCYQSLELWNM  860

Query  372  TENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
             ENKTMTL AHEGLIASLAVSTVAGLVASASHDK +KLWK
Sbjct  861  NENKTMTLTAHEGLIASLAVSTVAGLVASASHDKFVKLWK  900



>ref|XP_009624257.1| PREDICTED: transcriptional corepressor LEUNIG isoform X1 [Nicotiana 
tomentosiformis]
Length=904

 Score =   308 bits (789),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 145/160 (91%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = -1

Query  732  TRAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGE  553
            TR FKGGTAQVRFQPR+GRYLAAAAENVVSILDVETQ CR +LKGHTKPIHSVCWDPSGE
Sbjct  745  TRVFKGGTAQVRFQPRIGRYLAAAAENVVSILDVETQACRHSLKGHTKPIHSVCWDPSGE  804

Query  552  HLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNM  373
             LASVSEDSVRVWTL SG+EG+C+HELSSNGNKFHSCVFHP+YSSLLVIGCYQSLELWNM
Sbjct  805  LLASVSEDSVRVWTLRSGSEGDCLHELSSNGNKFHSCVFHPTYSSLLVIGCYQSLELWNM  864

Query  372  TENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
             ENKTMTL AHEGLIASLAVSTVAGLVASASHDK +KLWK
Sbjct  865  NENKTMTLTAHEGLIASLAVSTVAGLVASASHDKFVKLWK  904



>ref|XP_009624258.1| PREDICTED: transcriptional corepressor LEUNIG isoform X2 [Nicotiana 
tomentosiformis]
Length=899

 Score =   308 bits (789),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 145/160 (91%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = -1

Query  732  TRAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGE  553
            TR FKGGTAQVRFQPR+GRYLAAAAENVVSILDVETQ CR +LKGHTKPIHSVCWDPSGE
Sbjct  740  TRVFKGGTAQVRFQPRIGRYLAAAAENVVSILDVETQACRHSLKGHTKPIHSVCWDPSGE  799

Query  552  HLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNM  373
             LASVSEDSVRVWTL SG+EG+C+HELSSNGNKFHSCVFHP+YSSLLVIGCYQSLELWNM
Sbjct  800  LLASVSEDSVRVWTLRSGSEGDCLHELSSNGNKFHSCVFHPTYSSLLVIGCYQSLELWNM  859

Query  372  TENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
             ENKTMTL AHEGLIASLAVSTVAGLVASASHDK +KLWK
Sbjct  860  NENKTMTLTAHEGLIASLAVSTVAGLVASASHDKFVKLWK  899



>ref|XP_009787197.1| PREDICTED: transcriptional corepressor LEUNIG isoform X2 [Nicotiana 
sylvestris]
Length=895

 Score =   308 bits (788),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 145/160 (91%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = -1

Query  732  TRAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGE  553
            TR FKGGTAQVRFQPR+GRYLAAAAENVVSILDVETQ CR +LKGHTKPIHSVCWDPSGE
Sbjct  736  TRVFKGGTAQVRFQPRIGRYLAAAAENVVSILDVETQACRHSLKGHTKPIHSVCWDPSGE  795

Query  552  HLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNM  373
             LASVSEDSVRVWTL SG+EG+C+HELSSNGNKFHSCVFHP+YSSLLVIGCYQSLELWNM
Sbjct  796  LLASVSEDSVRVWTLRSGSEGDCLHELSSNGNKFHSCVFHPTYSSLLVIGCYQSLELWNM  855

Query  372  TENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
             ENKTMTL AHEGLIASLAVSTVAGLVASASHDK +KLWK
Sbjct  856  NENKTMTLTAHEGLIASLAVSTVAGLVASASHDKFVKLWK  895



>ref|XP_011081899.1| PREDICTED: transcriptional corepressor LEUNIG [Sesamum indicum]
 ref|XP_011081901.1| PREDICTED: transcriptional corepressor LEUNIG [Sesamum indicum]
 ref|XP_011081902.1| PREDICTED: transcriptional corepressor LEUNIG [Sesamum indicum]
 ref|XP_011081903.1| PREDICTED: transcriptional corepressor LEUNIG [Sesamum indicum]
 ref|XP_011081904.1| PREDICTED: transcriptional corepressor LEUNIG [Sesamum indicum]
Length=912

 Score =   308 bits (789),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 146/159 (92%), Positives = 152/159 (96%), Gaps = 0/159 (0%)
 Frame = -1

Query  729  RAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEH  550
            R FKGGTAQVRFQPRLGRYLAAAAENVVSILD ETQTCR +LKGHTKPIHSVCWDPSGE 
Sbjct  754  RVFKGGTAQVRFQPRLGRYLAAAAENVVSILDAETQTCRHSLKGHTKPIHSVCWDPSGEL  813

Query  549  LASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMT  370
            LASVSEDSVRVWTL SG+EG+C+HELS NGNKFHSCVFHP+YSSLLVIGCYQSLELWNMT
Sbjct  814  LASVSEDSVRVWTLRSGSEGDCLHELSCNGNKFHSCVFHPTYSSLLVIGCYQSLELWNMT  873

Query  369  ENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            ENKTMTL AHEGLIASLAVSTVAGLVASASHDKI+KLWK
Sbjct  874  ENKTMTLSAHEGLIASLAVSTVAGLVASASHDKIVKLWK  912



>emb|CBI20987.3| unnamed protein product [Vitis vinifera]
Length=734

 Score =   304 bits (778),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 142/159 (89%), Positives = 151/159 (95%), Gaps = 0/159 (0%)
 Frame = -1

Query  729  RAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEH  550
            R FKGGTAQ+RFQPR GRYLAAAAENVVSILDVETQ CR +L+GHTKPIHSVCWDPSGE 
Sbjct  576  RVFKGGTAQMRFQPRHGRYLAAAAENVVSILDVETQACRHSLQGHTKPIHSVCWDPSGEF  635

Query  549  LASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMT  370
            LASVSEDSVRVWTLGSGNEG CVHELS NGNKFHSCVFHP+YSSLLVIGCYQSLELWNM+
Sbjct  636  LASVSEDSVRVWTLGSGNEGECVHELSCNGNKFHSCVFHPTYSSLLVIGCYQSLELWNMS  695

Query  369  ENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            ENKTMTL AH+GLIA+LAVSTV+GLVASASHDKI+KLWK
Sbjct  696  ENKTMTLSAHDGLIAALAVSTVSGLVASASHDKIVKLWK  734



>ref|XP_010322742.1| PREDICTED: transcriptional corepressor LEUNIG isoform X4 [Solanum 
lycopersicum]
Length=896

 Score =   305 bits (781),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 143/160 (89%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = -1

Query  732  TRAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGE  553
            TR FKGGTAQVRFQPR+GRYLAAAAENVVSILDVETQ CR +LKGHTKPIHSVCWDPSGE
Sbjct  737  TRVFKGGTAQVRFQPRIGRYLAAAAENVVSILDVETQACRHSLKGHTKPIHSVCWDPSGE  796

Query  552  HLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNM  373
             LASVSEDSVRVWTL SG+EG+C+HELSSNGNKFHSCVFHP+YSSLLVIGCYQSLELWNM
Sbjct  797  LLASVSEDSVRVWTLRSGSEGDCLHELSSNGNKFHSCVFHPAYSSLLVIGCYQSLELWNM  856

Query  372  TENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
             ENKTMTL  HEGLIASLAVS VAGLVASASHDK +KLWK
Sbjct  857  NENKTMTLTGHEGLIASLAVSGVAGLVASASHDKFVKLWK  896



>ref|XP_006353652.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X3 
[Solanum tuberosum]
Length=900

 Score =   305 bits (780),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 143/160 (89%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = -1

Query  732  TRAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGE  553
            TR FKGGTAQVRFQPR+GRYLAAAAENVVSILDVETQ CR +LKGHTKPIHSVCWDPSGE
Sbjct  741  TRVFKGGTAQVRFQPRIGRYLAAAAENVVSILDVETQACRHSLKGHTKPIHSVCWDPSGE  800

Query  552  HLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNM  373
             LASVSEDSVRVWTL SG+EG+C+HELSSNGNKFHSCVFHP+YSSLLVIGCYQSLELWNM
Sbjct  801  LLASVSEDSVRVWTLRSGSEGDCLHELSSNGNKFHSCVFHPAYSSLLVIGCYQSLELWNM  860

Query  372  TENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
             ENKTMTL  HEGLIASLAVS VAGLVASASHDK +KLWK
Sbjct  861  NENKTMTLTGHEGLIASLAVSGVAGLVASASHDKFVKLWK  900



>ref|XP_006353653.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X4 
[Solanum tuberosum]
Length=898

 Score =   305 bits (780),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 143/160 (89%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = -1

Query  732  TRAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGE  553
            TR FKGGTAQVRFQPR+GRYLAAAAENVVSILDVETQ CR +LKGHTKPIHSVCWDPSGE
Sbjct  739  TRVFKGGTAQVRFQPRIGRYLAAAAENVVSILDVETQACRHSLKGHTKPIHSVCWDPSGE  798

Query  552  HLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNM  373
             LASVSEDSVRVWTL SG+EG+C+HELSSNGNKFHSCVFHP+YSSLLVIGCYQSLELWNM
Sbjct  799  LLASVSEDSVRVWTLRSGSEGDCLHELSSNGNKFHSCVFHPAYSSLLVIGCYQSLELWNM  858

Query  372  TENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
             ENKTMTL  HEGLIASLAVS VAGLVASASHDK +KLWK
Sbjct  859  NENKTMTLTGHEGLIASLAVSGVAGLVASASHDKFVKLWK  898



>ref|XP_010322743.1| PREDICTED: transcriptional corepressor LEUNIG isoform X5 [Solanum 
lycopersicum]
Length=894

 Score =   305 bits (780),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 143/160 (89%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = -1

Query  732  TRAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGE  553
            TR FKGGTAQVRFQPR+GRYLAAAAENVVSILDVETQ CR +LKGHTKPIHSVCWDPSGE
Sbjct  735  TRVFKGGTAQVRFQPRIGRYLAAAAENVVSILDVETQACRHSLKGHTKPIHSVCWDPSGE  794

Query  552  HLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNM  373
             LASVSEDSVRVWTL SG+EG+C+HELSSNGNKFHSCVFHP+YSSLLVIGCYQSLELWNM
Sbjct  795  LLASVSEDSVRVWTLRSGSEGDCLHELSSNGNKFHSCVFHPAYSSLLVIGCYQSLELWNM  854

Query  372  TENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
             ENKTMTL  HEGLIASLAVS VAGLVASASHDK +KLWK
Sbjct  855  NENKTMTLTGHEGLIASLAVSGVAGLVASASHDKFVKLWK  894



>ref|XP_006353651.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X2 
[Solanum tuberosum]
Length=906

 Score =   305 bits (780),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 143/160 (89%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = -1

Query  732  TRAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGE  553
            TR FKGGTAQVRFQPR+GRYLAAAAENVVSILDVETQ CR +LKGHTKPIHSVCWDPSGE
Sbjct  747  TRVFKGGTAQVRFQPRIGRYLAAAAENVVSILDVETQACRHSLKGHTKPIHSVCWDPSGE  806

Query  552  HLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNM  373
             LASVSEDSVRVWTL SG+EG+C+HELSSNGNKFHSCVFHP+YSSLLVIGCYQSLELWNM
Sbjct  807  LLASVSEDSVRVWTLRSGSEGDCLHELSSNGNKFHSCVFHPAYSSLLVIGCYQSLELWNM  866

Query  372  TENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
             ENKTMTL  HEGLIASLAVS VAGLVASASHDK +KLWK
Sbjct  867  NENKTMTLTGHEGLIASLAVSGVAGLVASASHDKFVKLWK  906



>ref|XP_004241804.1| PREDICTED: transcriptional corepressor LEUNIG isoform X2 [Solanum 
lycopersicum]
Length=902

 Score =   305 bits (780),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 143/160 (89%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = -1

Query  732  TRAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGE  553
            TR FKGGTAQVRFQPR+GRYLAAAAENVVSILDVETQ CR +LKGHTKPIHSVCWDPSGE
Sbjct  743  TRVFKGGTAQVRFQPRIGRYLAAAAENVVSILDVETQACRHSLKGHTKPIHSVCWDPSGE  802

Query  552  HLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNM  373
             LASVSEDSVRVWTL SG+EG+C+HELSSNGNKFHSCVFHP+YSSLLVIGCYQSLELWNM
Sbjct  803  LLASVSEDSVRVWTLRSGSEGDCLHELSSNGNKFHSCVFHPAYSSLLVIGCYQSLELWNM  862

Query  372  TENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
             ENKTMTL  HEGLIASLAVS VAGLVASASHDK +KLWK
Sbjct  863  NENKTMTLTGHEGLIASLAVSGVAGLVASASHDKFVKLWK  902



>ref|XP_010322740.1| PREDICTED: transcriptional corepressor LEUNIG isoform X1 [Solanum 
lycopersicum]
Length=904

 Score =   305 bits (780),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 143/160 (89%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = -1

Query  732  TRAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGE  553
            TR FKGGTAQVRFQPR+GRYLAAAAENVVSILDVETQ CR +LKGHTKPIHSVCWDPSGE
Sbjct  745  TRVFKGGTAQVRFQPRIGRYLAAAAENVVSILDVETQACRHSLKGHTKPIHSVCWDPSGE  804

Query  552  HLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNM  373
             LASVSEDSVRVWTL SG+EG+C+HELSSNGNKFHSCVFHP+YSSLLVIGCYQSLELWNM
Sbjct  805  LLASVSEDSVRVWTLRSGSEGDCLHELSSNGNKFHSCVFHPAYSSLLVIGCYQSLELWNM  864

Query  372  TENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
             ENKTMTL  HEGLIASLAVS VAGLVASASHDK +KLWK
Sbjct  865  NENKTMTLTGHEGLIASLAVSGVAGLVASASHDKFVKLWK  904



>ref|XP_010322741.1| PREDICTED: transcriptional corepressor LEUNIG isoform X3 [Solanum 
lycopersicum]
Length=899

 Score =   305 bits (780),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 143/160 (89%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = -1

Query  732  TRAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGE  553
            TR FKGGTAQVRFQPR+GRYLAAAAENVVSILDVETQ CR +LKGHTKPIHSVCWDPSGE
Sbjct  740  TRVFKGGTAQVRFQPRIGRYLAAAAENVVSILDVETQACRHSLKGHTKPIHSVCWDPSGE  799

Query  552  HLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNM  373
             LASVSEDSVRVWTL SG+EG+C+HELSSNGNKFHSCVFHP+YSSLLVIGCYQSLELWNM
Sbjct  800  LLASVSEDSVRVWTLRSGSEGDCLHELSSNGNKFHSCVFHPAYSSLLVIGCYQSLELWNM  859

Query  372  TENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
             ENKTMTL  HEGLIASLAVS VAGLVASASHDK +KLWK
Sbjct  860  NENKTMTLTGHEGLIASLAVSGVAGLVASASHDKFVKLWK  899



>ref|XP_006353650.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X1 
[Solanum tuberosum]
Length=908

 Score =   305 bits (780),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 143/160 (89%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = -1

Query  732  TRAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGE  553
            TR FKGGTAQVRFQPR+GRYLAAAAENVVSILDVETQ CR +LKGHTKPIHSVCWDPSGE
Sbjct  749  TRVFKGGTAQVRFQPRIGRYLAAAAENVVSILDVETQACRHSLKGHTKPIHSVCWDPSGE  808

Query  552  HLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNM  373
             LASVSEDSVRVWTL SG+EG+C+HELSSNGNKFHSCVFHP+YSSLLVIGCYQSLELWNM
Sbjct  809  LLASVSEDSVRVWTLRSGSEGDCLHELSSNGNKFHSCVFHPAYSSLLVIGCYQSLELWNM  868

Query  372  TENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
             ENKTMTL  HEGLIASLAVS VAGLVASASHDK +KLWK
Sbjct  869  NENKTMTLTGHEGLIASLAVSGVAGLVASASHDKFVKLWK  908



>ref|XP_010648611.1| PREDICTED: transcriptional corepressor LEUNIG isoform X2 [Vitis 
vinifera]
Length=901

 Score =   304 bits (778),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 142/159 (89%), Positives = 151/159 (95%), Gaps = 0/159 (0%)
 Frame = -1

Query  729  RAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEH  550
            R FKGGTAQ+RFQPR GRYLAAAAENVVSILDVETQ CR +L+GHTKPIHSVCWDPSGE 
Sbjct  743  RVFKGGTAQMRFQPRHGRYLAAAAENVVSILDVETQACRHSLQGHTKPIHSVCWDPSGEF  802

Query  549  LASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMT  370
            LASVSEDSVRVWTLGSGNEG CVHELS NGNKFHSCVFHP+YSSLLVIGCYQSLELWNM+
Sbjct  803  LASVSEDSVRVWTLGSGNEGECVHELSCNGNKFHSCVFHPTYSSLLVIGCYQSLELWNMS  862

Query  369  ENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            ENKTMTL AH+GLIA+LAVSTV+GLVASASHDKI+KLWK
Sbjct  863  ENKTMTLSAHDGLIAALAVSTVSGLVASASHDKIVKLWK  901



>ref|XP_002284900.1| PREDICTED: transcriptional corepressor LEUNIG isoform X1 [Vitis 
vinifera]
 ref|XP_010648609.1| PREDICTED: transcriptional corepressor LEUNIG isoform X1 [Vitis 
vinifera]
 ref|XP_010648610.1| PREDICTED: transcriptional corepressor LEUNIG isoform X1 [Vitis 
vinifera]
Length=910

 Score =   303 bits (777),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 142/159 (89%), Positives = 151/159 (95%), Gaps = 0/159 (0%)
 Frame = -1

Query  729  RAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEH  550
            R FKGGTAQ+RFQPR GRYLAAAAENVVSILDVETQ CR +L+GHTKPIHSVCWDPSGE 
Sbjct  752  RVFKGGTAQMRFQPRHGRYLAAAAENVVSILDVETQACRHSLQGHTKPIHSVCWDPSGEF  811

Query  549  LASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMT  370
            LASVSEDSVRVWTLGSGNEG CVHELS NGNKFHSCVFHP+YSSLLVIGCYQSLELWNM+
Sbjct  812  LASVSEDSVRVWTLGSGNEGECVHELSCNGNKFHSCVFHPTYSSLLVIGCYQSLELWNMS  871

Query  369  ENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            ENKTMTL AH+GLIA+LAVSTV+GLVASASHDKI+KLWK
Sbjct  872  ENKTMTLSAHDGLIAALAVSTVSGLVASASHDKIVKLWK  910



>ref|XP_002284925.2| PREDICTED: transcriptional corepressor LEUNIG-like [Vitis vinifera]
Length=363

 Score =   288 bits (737),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 135/159 (85%), Positives = 146/159 (92%), Gaps = 0/159 (0%)
 Frame = -1

Query  729  RAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEH  550
            R FKGG  Q+RFQPR GRYLAAAAENVVSILDVETQ CR +L+GHT+PIHSVCWDPSGE 
Sbjct  205  RVFKGGIVQIRFQPRHGRYLAAAAENVVSILDVETQACRHSLQGHTEPIHSVCWDPSGEF  264

Query  549  LASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMT  370
            LASVS DS+RVWTLGSGNEG CVHELS N  KFHSCVFHP+YSSLLVIGCYQSLELWNM+
Sbjct  265  LASVSVDSIRVWTLGSGNEGECVHELSCNDKKFHSCVFHPTYSSLLVIGCYQSLELWNMS  324

Query  369  ENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            ENKTMTL AH+GLIA+LAVSTV+GLVASASHDKI+KLWK
Sbjct  325  ENKTMTLSAHDGLIAALAVSTVSGLVASASHDKIVKLWK  363



>gb|EYU21923.1| hypothetical protein MIMGU_mgv1a000972mg [Erythranthe guttata]
Length=926

 Score =   302 bits (773),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 142/159 (89%), Positives = 150/159 (94%), Gaps = 0/159 (0%)
 Frame = -1

Query  729  RAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEH  550
            R FKGGTAQVRFQPRLGRYLAAAAENVVSILD ETQ CR +LKGHTKPI S+CWDPSGE 
Sbjct  768  RVFKGGTAQVRFQPRLGRYLAAAAENVVSILDAETQACRHSLKGHTKPITSICWDPSGEL  827

Query  549  LASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMT  370
            LASVSEDSVRVWT+ SG+EG+C+HELS NGNKFHSCVFHP+YSSLLVIGCYQSLELWNMT
Sbjct  828  LASVSEDSVRVWTMRSGSEGDCLHELSCNGNKFHSCVFHPTYSSLLVIGCYQSLELWNMT  887

Query  369  ENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            ENKTMTL AHEGLIASLAVSTVAGLVASASHDKI+KLWK
Sbjct  888  ENKTMTLSAHEGLIASLAVSTVAGLVASASHDKIVKLWK  926



>emb|CBI20989.3| unnamed protein product [Vitis vinifera]
Length=356

 Score =   287 bits (734),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 135/159 (85%), Positives = 146/159 (92%), Gaps = 0/159 (0%)
 Frame = -1

Query  729  RAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEH  550
            R FKGG  Q+RFQPR GRYLAAAAENVVSILDVETQ CR +L+GHT+PIHSVCWDPSGE 
Sbjct  198  RVFKGGIVQIRFQPRHGRYLAAAAENVVSILDVETQACRHSLQGHTEPIHSVCWDPSGEF  257

Query  549  LASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMT  370
            LASVS DS+RVWTLGSGNEG CVHELS N  KFHSCVFHP+YSSLLVIGCYQSLELWNM+
Sbjct  258  LASVSVDSIRVWTLGSGNEGECVHELSCNDKKFHSCVFHPTYSSLLVIGCYQSLELWNMS  317

Query  369  ENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            ENKTMTL AH+GLIA+LAVSTV+GLVASASHDKI+KLWK
Sbjct  318  ENKTMTLSAHDGLIAALAVSTVSGLVASASHDKIVKLWK  356



>ref|XP_011459234.1| PREDICTED: transcriptional corepressor LEUNIG isoform X2 [Fragaria 
vesca subsp. vesca]
Length=892

 Score =   299 bits (765),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 141/159 (89%), Positives = 146/159 (92%), Gaps = 0/159 (0%)
 Frame = -1

Query  729  RAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEH  550
            R FKGGT QVRFQPRLGRYLAAAAENVVSILDVETQ CR +L+GHTKPI SVCWDPSGE 
Sbjct  734  RVFKGGTTQVRFQPRLGRYLAAAAENVVSILDVETQACRHSLQGHTKPIKSVCWDPSGEF  793

Query  549  LASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMT  370
            LASVSEDSVRVWT GSGNEG CVHELS NGNKFHSCVFHP+Y+SLLVIGCYQSLELWNMT
Sbjct  794  LASVSEDSVRVWTFGSGNEGECVHELSCNGNKFHSCVFHPTYTSLLVIGCYQSLELWNMT  853

Query  369  ENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            E KTMTL AHEGLIASLAVSTV GLVASASHDK +KLWK
Sbjct  854  EGKTMTLSAHEGLIASLAVSTVTGLVASASHDKWVKLWK  892



>emb|CAF18245.1| STYLOSA protein [Antirrhinum majus]
Length=915

 Score =   299 bits (765),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 142/159 (89%), Positives = 149/159 (94%), Gaps = 0/159 (0%)
 Frame = -1

Query  729  RAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEH  550
            R FKGGTAQVRFQPRLGRYLAAAAENVVSILD ET  CR +LKGHTKPIHSVCWDPSGE 
Sbjct  757  RVFKGGTAQVRFQPRLGRYLAAAAENVVSILDSETLACRHSLKGHTKPIHSVCWDPSGEL  816

Query  549  LASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMT  370
            LASVSEDSVRVWTL SG+EG+C+HELS NGNKFHSCVFHP+YSSLLVIGCYQSLELWNM+
Sbjct  817  LASVSEDSVRVWTLRSGSEGDCLHELSCNGNKFHSCVFHPTYSSLLVIGCYQSLELWNMS  876

Query  369  ENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            ENKTMTL AHEGLIASLAVST AGLVASASHDKI+KLWK
Sbjct  877  ENKTMTLSAHEGLIASLAVSTGAGLVASASHDKIVKLWK  915



>ref|XP_004291496.1| PREDICTED: transcriptional corepressor LEUNIG isoform X1 [Fragaria 
vesca subsp. vesca]
 ref|XP_011459233.1| PREDICTED: transcriptional corepressor LEUNIG isoform X1 [Fragaria 
vesca subsp. vesca]
Length=901

 Score =   298 bits (764),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 141/159 (89%), Positives = 146/159 (92%), Gaps = 0/159 (0%)
 Frame = -1

Query  729  RAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEH  550
            R FKGGT QVRFQPRLGRYLAAAAENVVSILDVETQ CR +L+GHTKPI SVCWDPSGE 
Sbjct  743  RVFKGGTTQVRFQPRLGRYLAAAAENVVSILDVETQACRHSLQGHTKPIKSVCWDPSGEF  802

Query  549  LASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMT  370
            LASVSEDSVRVWT GSGNEG CVHELS NGNKFHSCVFHP+Y+SLLVIGCYQSLELWNMT
Sbjct  803  LASVSEDSVRVWTFGSGNEGECVHELSCNGNKFHSCVFHPTYTSLLVIGCYQSLELWNMT  862

Query  369  ENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            E KTMTL AHEGLIASLAVSTV GLVASASHDK +KLWK
Sbjct  863  EGKTMTLSAHEGLIASLAVSTVTGLVASASHDKWVKLWK  901



>ref|XP_003544623.1| PREDICTED: transcriptional corepressor LEUNIG-like isoformX2 
[Glycine max]
Length=893

 Score =   298 bits (764),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 141/159 (89%), Positives = 148/159 (93%), Gaps = 0/159 (0%)
 Frame = -1

Query  729  RAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEH  550
            R  KGGTAQ+RFQPRLGRYLAAAAENVVSILDVETQ CR +LKGHTK IHSVCWDPSGE 
Sbjct  735  RVSKGGTAQMRFQPRLGRYLAAAAENVVSILDVETQACRYSLKGHTKSIHSVCWDPSGEF  794

Query  549  LASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMT  370
            LASVSEDSVRVWTLGSG+EG CVHELS NGNKFHSCVFHP+YSSLLV+GCYQSLELWNMT
Sbjct  795  LASVSEDSVRVWTLGSGSEGECVHELSCNGNKFHSCVFHPTYSSLLVVGCYQSLELWNMT  854

Query  369  ENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            ENKTMTL AHEGLIA+LAVSTV GLVASASHDK +KLWK
Sbjct  855  ENKTMTLSAHEGLIAALAVSTVNGLVASASHDKFVKLWK  893



>ref|XP_006596119.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X3 
[Glycine max]
Length=897

 Score =   298 bits (763),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 141/159 (89%), Positives = 148/159 (93%), Gaps = 0/159 (0%)
 Frame = -1

Query  729  RAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEH  550
            R  KGGTAQ+RFQPRLGRYLAAAAENVVSILDVETQ CR +LKGHTK IHSVCWDPSGE 
Sbjct  739  RVSKGGTAQMRFQPRLGRYLAAAAENVVSILDVETQACRYSLKGHTKSIHSVCWDPSGEF  798

Query  549  LASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMT  370
            LASVSEDSVRVWTLGSG+EG CVHELS NGNKFHSCVFHP+YSSLLV+GCYQSLELWNMT
Sbjct  799  LASVSEDSVRVWTLGSGSEGECVHELSCNGNKFHSCVFHPTYSSLLVVGCYQSLELWNMT  858

Query  369  ENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            ENKTMTL AHEGLIA+LAVSTV GLVASASHDK +KLWK
Sbjct  859  ENKTMTLSAHEGLIAALAVSTVNGLVASASHDKFVKLWK  897



>ref|XP_003544622.1| PREDICTED: transcriptional corepressor LEUNIG-like isoformX1 
[Glycine max]
Length=902

 Score =   298 bits (763),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 141/159 (89%), Positives = 148/159 (93%), Gaps = 0/159 (0%)
 Frame = -1

Query  729  RAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEH  550
            R  KGGTAQ+RFQPRLGRYLAAAAENVVSILDVETQ CR +LKGHTK IHSVCWDPSGE 
Sbjct  744  RVSKGGTAQMRFQPRLGRYLAAAAENVVSILDVETQACRYSLKGHTKSIHSVCWDPSGEF  803

Query  549  LASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMT  370
            LASVSEDSVRVWTLGSG+EG CVHELS NGNKFHSCVFHP+YSSLLV+GCYQSLELWNMT
Sbjct  804  LASVSEDSVRVWTLGSGSEGECVHELSCNGNKFHSCVFHPTYSSLLVVGCYQSLELWNMT  863

Query  369  ENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            ENKTMTL AHEGLIA+LAVSTV GLVASASHDK +KLWK
Sbjct  864  ENKTMTLSAHEGLIAALAVSTVNGLVASASHDKFVKLWK  902



>ref|XP_004498639.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X2 
[Cicer arietinum]
Length=900

 Score =   298 bits (762),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 141/159 (89%), Positives = 148/159 (93%), Gaps = 0/159 (0%)
 Frame = -1

Query  729  RAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEH  550
            R  KGGTAQ+RFQPRLGRYLAAAAENVVSILDVETQ CR +LKGHTK IHSVCWDPSGE 
Sbjct  742  RVSKGGTAQMRFQPRLGRYLAAAAENVVSILDVETQACRYSLKGHTKSIHSVCWDPSGEF  801

Query  549  LASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMT  370
            LASVSEDSVRVWTLGSG+EG CVHELS NGNKFHSCVFHP+YSSLLVIGCYQSLELWNMT
Sbjct  802  LASVSEDSVRVWTLGSGSEGECVHELSCNGNKFHSCVFHPTYSSLLVIGCYQSLELWNMT  861

Query  369  ENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            ENKTMTL AH+GLIA+LAVSTV GLVASASHDK +KLWK
Sbjct  862  ENKTMTLSAHDGLIAALAVSTVNGLVASASHDKFVKLWK  900



>ref|XP_004498638.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X1 
[Cicer arietinum]
Length=909

 Score =   297 bits (761),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 141/159 (89%), Positives = 148/159 (93%), Gaps = 0/159 (0%)
 Frame = -1

Query  729  RAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEH  550
            R  KGGTAQ+RFQPRLGRYLAAAAENVVSILDVETQ CR +LKGHTK IHSVCWDPSGE 
Sbjct  751  RVSKGGTAQMRFQPRLGRYLAAAAENVVSILDVETQACRYSLKGHTKSIHSVCWDPSGEF  810

Query  549  LASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMT  370
            LASVSEDSVRVWTLGSG+EG CVHELS NGNKFHSCVFHP+YSSLLVIGCYQSLELWNMT
Sbjct  811  LASVSEDSVRVWTLGSGSEGECVHELSCNGNKFHSCVFHPTYSSLLVIGCYQSLELWNMT  870

Query  369  ENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            ENKTMTL AH+GLIA+LAVSTV GLVASASHDK +KLWK
Sbjct  871  ENKTMTLSAHDGLIAALAVSTVNGLVASASHDKFVKLWK  909



>ref|XP_012078638.1| PREDICTED: transcriptional corepressor LEUNIG-like [Jatropha 
curcas]
Length=341

 Score =   283 bits (723),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 130/160 (81%), Positives = 145/160 (91%), Gaps = 0/160 (0%)
 Frame = -1

Query  732  TRAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGE  553
            +R FKGGTAQ+RFQPR+GRYLAAAAENVVSILDVETQ CR +L+GHTKPIHSVCWDPSGE
Sbjct  171  SRVFKGGTAQMRFQPRMGRYLAAAAENVVSILDVETQVCRHSLQGHTKPIHSVCWDPSGE  230

Query  552  HLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNM  373
            +LASVSEDSVRVW LGSG+EG  VH+L+ NGNKFHSCVFHP+Y SLLV+GCYQSLELW M
Sbjct  231  YLASVSEDSVRVWRLGSGSEGEFVHDLTCNGNKFHSCVFHPTYPSLLVLGCYQSLELWKM  290

Query  372  TENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            TENKTM+L AHEGLIA+LA+S V GLVAS  HDK +KLWK
Sbjct  291  TENKTMSLSAHEGLIAALAISPVTGLVASVGHDKFVKLWK  330



>ref|XP_010254246.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X5 
[Nelumbo nucifera]
Length=902

 Score =   297 bits (760),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 138/159 (87%), Positives = 145/159 (91%), Gaps = 0/159 (0%)
 Frame = -1

Query  729  RAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEH  550
            R FKGGT Q+RFQPRLGRYLAAAAENVVSILDVETQ CR +L+GHTKP+HSVCWDPSGE 
Sbjct  744  RVFKGGTTQMRFQPRLGRYLAAAAENVVSILDVETQMCRHSLQGHTKPVHSVCWDPSGEL  803

Query  549  LASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMT  370
             ASVSEDSVRVWT GSGNEG CVHELS NGNKFHSCVFHPSYSSLLVIGCYQSLELWNM+
Sbjct  804  FASVSEDSVRVWTFGSGNEGECVHELSCNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMS  863

Query  369  ENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            ENKTMTL AHEGLIA+LAVS   GLVASASHDK +KLWK
Sbjct  864  ENKTMTLSAHEGLIAALAVSNATGLVASASHDKYVKLWK  902



>ref|XP_010254245.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X4 
[Nelumbo nucifera]
Length=911

 Score =   296 bits (759),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 138/159 (87%), Positives = 145/159 (91%), Gaps = 0/159 (0%)
 Frame = -1

Query  729  RAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEH  550
            R FKGGT Q+RFQPRLGRYLAAAAENVVSILDVETQ CR +L+GHTKP+HSVCWDPSGE 
Sbjct  753  RVFKGGTTQMRFQPRLGRYLAAAAENVVSILDVETQMCRHSLQGHTKPVHSVCWDPSGEL  812

Query  549  LASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMT  370
             ASVSEDSVRVWT GSGNEG CVHELS NGNKFHSCVFHPSYSSLLVIGCYQSLELWNM+
Sbjct  813  FASVSEDSVRVWTFGSGNEGECVHELSCNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMS  872

Query  369  ENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            ENKTMTL AHEGLIA+LAVS   GLVASASHDK +KLWK
Sbjct  873  ENKTMTLSAHEGLIAALAVSNATGLVASASHDKYVKLWK  911



>gb|KDO79602.1| hypothetical protein CISIN_1g002471mg [Citrus sinensis]
Length=567

 Score =   289 bits (739),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 136/160 (85%), Positives = 145/160 (91%), Gaps = 0/160 (0%)
 Frame = -1

Query  732  TRAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGE  553
            TR FKGGTAQ+RFQP LGRYLAAAAENVVSILD ETQ CR +L+GHTKPI SVCWDPSGE
Sbjct  408  TRVFKGGTAQMRFQPHLGRYLAAAAENVVSILDAETQACRLSLQGHTKPIDSVCWDPSGE  467

Query  552  HLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNM  373
             LASVSEDSVRVWT+GSG+EG CVHELS NGNKFHSCVFHP+Y SLLVIGCYQSLELWNM
Sbjct  468  LLASVSEDSVRVWTVGSGSEGECVHELSCNGNKFHSCVFHPTYPSLLVIGCYQSLELWNM  527

Query  372  TENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            +ENKTMTL AHEGLIA+LAVST  G VASASHDK +KLWK
Sbjct  528  SENKTMTLTAHEGLIAALAVSTETGYVASASHDKFVKLWK  567



>ref|XP_002309593.2| LEUNIG family protein [Populus trichocarpa]
 gb|EEE93116.2| LEUNIG family protein [Populus trichocarpa]
Length=900

 Score =   296 bits (758),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 136/159 (86%), Positives = 145/159 (91%), Gaps = 0/159 (0%)
 Frame = -1

Query  729  RAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEH  550
            R FKGG  Q+RFQPR+GRYLAAAAENVVSILDVETQ CR +L+GHTKPIHSVCWDPSGE 
Sbjct  742  RVFKGGMVQMRFQPRVGRYLAAAAENVVSILDVETQACRHSLQGHTKPIHSVCWDPSGEF  801

Query  549  LASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMT  370
            LAS SEDSVRVWTLGSG+EG CVHELS NGNKFHSCVFHP++ SLLVIGCYQSLELWNM 
Sbjct  802  LASASEDSVRVWTLGSGSEGECVHELSCNGNKFHSCVFHPTFPSLLVIGCYQSLELWNMN  861

Query  369  ENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            ENKTMTLPAHEGLIA+LAVST  GLVASASHDK +KLWK
Sbjct  862  ENKTMTLPAHEGLIAALAVSTATGLVASASHDKFVKLWK  900



>ref|XP_010254244.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X3 
[Nelumbo nucifera]
Length=918

 Score =   296 bits (759),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 138/159 (87%), Positives = 145/159 (91%), Gaps = 0/159 (0%)
 Frame = -1

Query  729  RAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEH  550
            R FKGGT Q+RFQPRLGRYLAAAAENVVSILDVETQ CR +L+GHTKP+HSVCWDPSGE 
Sbjct  760  RVFKGGTTQMRFQPRLGRYLAAAAENVVSILDVETQMCRHSLQGHTKPVHSVCWDPSGEL  819

Query  549  LASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMT  370
             ASVSEDSVRVWT GSGNEG CVHELS NGNKFHSCVFHPSYSSLLVIGCYQSLELWNM+
Sbjct  820  FASVSEDSVRVWTFGSGNEGECVHELSCNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMS  879

Query  369  ENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            ENKTMTL AHEGLIA+LAVS   GLVASASHDK +KLWK
Sbjct  880  ENKTMTLSAHEGLIAALAVSNATGLVASASHDKYVKLWK  918



>ref|XP_010254243.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X2 
[Nelumbo nucifera]
Length=922

 Score =   296 bits (759),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 138/159 (87%), Positives = 145/159 (91%), Gaps = 0/159 (0%)
 Frame = -1

Query  729  RAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEH  550
            R FKGGT Q+RFQPRLGRYLAAAAENVVSILDVETQ CR +L+GHTKP+HSVCWDPSGE 
Sbjct  764  RVFKGGTTQMRFQPRLGRYLAAAAENVVSILDVETQMCRHSLQGHTKPVHSVCWDPSGEL  823

Query  549  LASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMT  370
             ASVSEDSVRVWT GSGNEG CVHELS NGNKFHSCVFHPSYSSLLVIGCYQSLELWNM+
Sbjct  824  FASVSEDSVRVWTFGSGNEGECVHELSCNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMS  883

Query  369  ENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            ENKTMTL AHEGLIA+LAVS   GLVASASHDK +KLWK
Sbjct  884  ENKTMTLSAHEGLIAALAVSNATGLVASASHDKYVKLWK  922



>ref|XP_010254242.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X1 
[Nelumbo nucifera]
Length=927

 Score =   296 bits (759),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 138/159 (87%), Positives = 145/159 (91%), Gaps = 0/159 (0%)
 Frame = -1

Query  729  RAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEH  550
            R FKGGT Q+RFQPRLGRYLAAAAENVVSILDVETQ CR +L+GHTKP+HSVCWDPSGE 
Sbjct  769  RVFKGGTTQMRFQPRLGRYLAAAAENVVSILDVETQMCRHSLQGHTKPVHSVCWDPSGEL  828

Query  549  LASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMT  370
             ASVSEDSVRVWT GSGNEG CVHELS NGNKFHSCVFHPSYSSLLVIGCYQSLELWNM+
Sbjct  829  FASVSEDSVRVWTFGSGNEGECVHELSCNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMS  888

Query  369  ENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            ENKTMTL AHEGLIA+LAVS   GLVASASHDK +KLWK
Sbjct  889  ENKTMTLSAHEGLIAALAVSNATGLVASASHDKYVKLWK  927



>ref|XP_008394022.1| PREDICTED: LOW QUALITY PROTEIN: transcriptional corepressor LEUNIG 
[Malus domestica]
Length=897

 Score =   296 bits (757),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 137/156 (88%), Positives = 147/156 (94%), Gaps = 0/156 (0%)
 Frame = -1

Query  720  KGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLAS  541
            KGGTAQ+RFQPRLGR+LAAAAENVVSILDVETQTCR +L+GHTKPIHSVCWDPSGE LAS
Sbjct  742  KGGTAQMRFQPRLGRFLAAAAENVVSILDVETQTCRHSLQGHTKPIHSVCWDPSGEFLAS  801

Query  540  VSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENK  361
            VSEDSVRVWT G+G EG CVHELS NGNKFHSCVFHP+Y+SLLVIGCYQSLELWNMTENK
Sbjct  802  VSEDSVRVWTFGAGGEGECVHELSCNGNKFHSCVFHPTYTSLLVIGCYQSLELWNMTENK  861

Query  360  TMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            TMTL AHEGLIA+L+VSTV GLVASASHDK +KLWK
Sbjct  862  TMTLSAHEGLIAALSVSTVTGLVASASHDKFVKLWK  897



>ref|XP_012078639.1| PREDICTED: transcriptional corepressor LEUNIG isoform X1 [Jatropha 
curcas]
Length=924

 Score =   296 bits (758),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 137/160 (86%), Positives = 148/160 (93%), Gaps = 0/160 (0%)
 Frame = -1

Query  732  TRAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGE  553
            +R FKGGTAQ+RFQPR+GRYLAAAAENVVSILDVETQ CR +L+GHTKPIHSVCWDPSGE
Sbjct  765  SREFKGGTAQMRFQPRMGRYLAAAAENVVSILDVETQVCRHSLQGHTKPIHSVCWDPSGE  824

Query  552  HLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNM  373
            +LASVSEDSVRVW LGSG+EG CVH+LS NGNKFHSCVFHP+Y SLLVIGCYQSLELWNM
Sbjct  825  YLASVSEDSVRVWRLGSGSEGECVHDLSCNGNKFHSCVFHPTYPSLLVIGCYQSLELWNM  884

Query  372  TENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            TE KTMTL AHEGLIA+LAVS V GLVASASHDK +KLWK
Sbjct  885  TETKTMTLSAHEGLIAALAVSPVTGLVASASHDKFVKLWK  924



>ref|XP_012078642.1| PREDICTED: transcriptional corepressor LEUNIG isoform X2 [Jatropha 
curcas]
Length=915

 Score =   296 bits (758),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 137/160 (86%), Positives = 148/160 (93%), Gaps = 0/160 (0%)
 Frame = -1

Query  732  TRAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGE  553
            +R FKGGTAQ+RFQPR+GRYLAAAAENVVSILDVETQ CR +L+GHTKPIHSVCWDPSGE
Sbjct  756  SREFKGGTAQMRFQPRMGRYLAAAAENVVSILDVETQVCRHSLQGHTKPIHSVCWDPSGE  815

Query  552  HLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNM  373
            +LASVSEDSVRVW LGSG+EG CVH+LS NGNKFHSCVFHP+Y SLLVIGCYQSLELWNM
Sbjct  816  YLASVSEDSVRVWRLGSGSEGECVHDLSCNGNKFHSCVFHPTYPSLLVIGCYQSLELWNM  875

Query  372  TENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            TE KTMTL AHEGLIA+LAVS V GLVASASHDK +KLWK
Sbjct  876  TETKTMTLSAHEGLIAALAVSPVTGLVASASHDKFVKLWK  915



>ref|XP_007013777.1| LisH dimerization motif,WD40/YVTN repeat-like-containing domain 
isoform 1 [Theobroma cacao]
 ref|XP_007013779.1| LisH dimerization motif,WD40/YVTN repeat-like-containing domain 
isoform 1 [Theobroma cacao]
 gb|EOY31396.1| LisH dimerization motif,WD40/YVTN repeat-like-containing domain 
isoform 1 [Theobroma cacao]
 gb|EOY31398.1| LisH dimerization motif,WD40/YVTN repeat-like-containing domain 
isoform 1 [Theobroma cacao]
Length=910

 Score =   296 bits (757),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 138/159 (87%), Positives = 148/159 (93%), Gaps = 0/159 (0%)
 Frame = -1

Query  729  RAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEH  550
            R FKGGTAQ+RFQPRLG+YLAAAAENVVSILD ETQTCR +L+GHTKPIHSVCWD SGE 
Sbjct  752  RVFKGGTAQLRFQPRLGKYLAAAAENVVSILDTETQTCRHSLQGHTKPIHSVCWDTSGEL  811

Query  549  LASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMT  370
            LASVSEDSVRVWTLGSG+EG CVHELS NGNKFHSCVFHP+Y SLLVIGCYQSLELWNMT
Sbjct  812  LASVSEDSVRVWTLGSGSEGECVHELSCNGNKFHSCVFHPTYPSLLVIGCYQSLELWNMT  871

Query  369  ENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            ENKTMTL AH+GLIA+LAVS V GLV+SASHDKI+KLWK
Sbjct  872  ENKTMTLAAHDGLIAALAVSPVTGLVSSASHDKIVKLWK  910



>ref|XP_002515595.1| WD-repeat protein, putative [Ricinus communis]
 gb|EEF47044.1| WD-repeat protein, putative [Ricinus communis]
Length=708

 Score =   291 bits (745),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 135/160 (84%), Positives = 146/160 (91%), Gaps = 0/160 (0%)
 Frame = -1

Query  732  TRAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGE  553
            +R FKGGTAQ+RFQPRLGRYLAA AENVVSILDVETQ CR +L+GHT  IHSVCWDPSGE
Sbjct  549  SRVFKGGTAQMRFQPRLGRYLAAVAENVVSILDVETQACRHSLQGHTNSIHSVCWDPSGE  608

Query  552  HLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNM  373
             LASVSEDSVRVW LGSG+EG+CVH+LS NGNKFHSCVFHP+Y SLLVIGCYQSLELWNM
Sbjct  609  FLASVSEDSVRVWRLGSGSEGDCVHDLSCNGNKFHSCVFHPTYPSLLVIGCYQSLELWNM  668

Query  372  TENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            TENKTMTL AHEGLIA+LAVS V G+VASASHDK +KLWK
Sbjct  669  TENKTMTLAAHEGLIAALAVSPVTGVVASASHDKFVKLWK  708



>ref|XP_007013778.1| LisH dimerization motif,WD40/YVTN repeat-like-containing domain 
isoform 2 [Theobroma cacao]
 gb|EOY31397.1| LisH dimerization motif,WD40/YVTN repeat-like-containing domain 
isoform 2 [Theobroma cacao]
Length=919

 Score =   295 bits (756),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 138/159 (87%), Positives = 148/159 (93%), Gaps = 0/159 (0%)
 Frame = -1

Query  729  RAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEH  550
            R FKGGTAQ+RFQPRLG+YLAAAAENVVSILD ETQTCR +L+GHTKPIHSVCWD SGE 
Sbjct  761  RVFKGGTAQLRFQPRLGKYLAAAAENVVSILDTETQTCRHSLQGHTKPIHSVCWDTSGEL  820

Query  549  LASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMT  370
            LASVSEDSVRVWTLGSG+EG CVHELS NGNKFHSCVFHP+Y SLLVIGCYQSLELWNMT
Sbjct  821  LASVSEDSVRVWTLGSGSEGECVHELSCNGNKFHSCVFHPTYPSLLVIGCYQSLELWNMT  880

Query  369  ENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            ENKTMTL AH+GLIA+LAVS V GLV+SASHDKI+KLWK
Sbjct  881  ENKTMTLAAHDGLIAALAVSPVTGLVSSASHDKIVKLWK  919



>ref|XP_009372956.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X6 
[Pyrus x bretschneideri]
Length=814

 Score =   293 bits (750),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 137/157 (87%), Positives = 146/157 (93%), Gaps = 0/157 (0%)
 Frame = -1

Query  723  FKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLA  544
            FKGGTAQ+RFQPRLGR LAAAAENVVSILDVETQ CR +L+GHTKPIHSVCWDPSGE LA
Sbjct  658  FKGGTAQMRFQPRLGRLLAAAAENVVSILDVETQACRHSLQGHTKPIHSVCWDPSGEFLA  717

Query  543  SVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTEN  364
            SVSEDSVRVWTLG+G EG CVHELS NGNKFHSCVFHP+Y+SLLVIGCYQSLELWNMTEN
Sbjct  718  SVSEDSVRVWTLGAGGEGECVHELSCNGNKFHSCVFHPTYTSLLVIGCYQSLELWNMTEN  777

Query  363  KTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            KTMTL AHEGLIA+L+VST  GLVASASHDK +KLWK
Sbjct  778  KTMTLSAHEGLIAALSVSTGTGLVASASHDKYVKLWK  814



>ref|XP_009377499.1| PREDICTED: transcriptional corepressor LEUNIG isoform X5 [Pyrus 
x bretschneideri]
Length=897

 Score =   295 bits (754),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 136/156 (87%), Positives = 147/156 (94%), Gaps = 0/156 (0%)
 Frame = -1

Query  720  KGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLAS  541
            KGGTAQ+RFQPRLGR+LAAAAENVVSILDVETQ CR +L+GHTKPIHSVCWDPSGE LAS
Sbjct  742  KGGTAQMRFQPRLGRFLAAAAENVVSILDVETQNCRHSLQGHTKPIHSVCWDPSGEFLAS  801

Query  540  VSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENK  361
            VSEDSVRVWTLG+G EG CVHELS NGNKFHSCVFHP+Y+SLLVIGCYQSLELWNMTENK
Sbjct  802  VSEDSVRVWTLGAGGEGECVHELSCNGNKFHSCVFHPTYTSLLVIGCYQSLELWNMTENK  861

Query  360  TMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            TMTL AH+GLIA+L+VSTV GLVASASHDK +KLWK
Sbjct  862  TMTLSAHDGLIAALSVSTVTGLVASASHDKFVKLWK  897



>ref|XP_008359611.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X4 
[Malus domestica]
Length=901

 Score =   295 bits (754),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 137/157 (87%), Positives = 147/157 (94%), Gaps = 0/157 (0%)
 Frame = -1

Query  723  FKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLA  544
            FKGGTAQ+RFQPRLGR LAAAAENVVSILDVETQTCR +L+GHTKPIHSVCWDPSGE LA
Sbjct  745  FKGGTAQMRFQPRLGRLLAAAAENVVSILDVETQTCRHSLQGHTKPIHSVCWDPSGEFLA  804

Query  543  SVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTEN  364
            SVSEDSVRVWTLG+G EG CVHELS NGNKFHSCVFHP+Y+SLLVIGCYQSLELWNMTEN
Sbjct  805  SVSEDSVRVWTLGAGGEGECVHELSCNGNKFHSCVFHPTYTSLLVIGCYQSLELWNMTEN  864

Query  363  KTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            KTMTL AH+GLIA+L+VST  GLVASASHDK +KLWK
Sbjct  865  KTMTLSAHDGLIAALSVSTGTGLVASASHDKFVKLWK  901



>ref|XP_008359610.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X3 
[Malus domestica]
Length=902

 Score =   295 bits (754),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 137/157 (87%), Positives = 147/157 (94%), Gaps = 0/157 (0%)
 Frame = -1

Query  723  FKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLA  544
            FKGGTAQ+RFQPRLGR LAAAAENVVSILDVETQTCR +L+GHTKPIHSVCWDPSGE LA
Sbjct  746  FKGGTAQMRFQPRLGRLLAAAAENVVSILDVETQTCRHSLQGHTKPIHSVCWDPSGEFLA  805

Query  543  SVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTEN  364
            SVSEDSVRVWTLG+G EG CVHELS NGNKFHSCVFHP+Y+SLLVIGCYQSLELWNMTEN
Sbjct  806  SVSEDSVRVWTLGAGGEGECVHELSCNGNKFHSCVFHPTYTSLLVIGCYQSLELWNMTEN  865

Query  363  KTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            KTMTL AH+GLIA+L+VST  GLVASASHDK +KLWK
Sbjct  866  KTMTLSAHDGLIAALSVSTGTGLVASASHDKFVKLWK  902



>ref|XP_008359608.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X1 
[Malus domestica]
Length=911

 Score =   294 bits (753),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 137/157 (87%), Positives = 147/157 (94%), Gaps = 0/157 (0%)
 Frame = -1

Query  723  FKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLA  544
            FKGGTAQ+RFQPRLGR LAAAAENVVSILDVETQTCR +L+GHTKPIHSVCWDPSGE LA
Sbjct  755  FKGGTAQMRFQPRLGRLLAAAAENVVSILDVETQTCRHSLQGHTKPIHSVCWDPSGEFLA  814

Query  543  SVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTEN  364
            SVSEDSVRVWTLG+G EG CVHELS NGNKFHSCVFHP+Y+SLLVIGCYQSLELWNMTEN
Sbjct  815  SVSEDSVRVWTLGAGGEGECVHELSCNGNKFHSCVFHPTYTSLLVIGCYQSLELWNMTEN  874

Query  363  KTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            KTMTL AH+GLIA+L+VST  GLVASASHDK +KLWK
Sbjct  875  KTMTLSAHDGLIAALSVSTGTGLVASASHDKFVKLWK  911



>ref|XP_008359609.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X2 
[Malus domestica]
Length=910

 Score =   294 bits (753),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 137/157 (87%), Positives = 147/157 (94%), Gaps = 0/157 (0%)
 Frame = -1

Query  723  FKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLA  544
            FKGGTAQ+RFQPRLGR LAAAAENVVSILDVETQTCR +L+GHTKPIHSVCWDPSGE LA
Sbjct  754  FKGGTAQMRFQPRLGRLLAAAAENVVSILDVETQTCRHSLQGHTKPIHSVCWDPSGEFLA  813

Query  543  SVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTEN  364
            SVSEDSVRVWTLG+G EG CVHELS NGNKFHSCVFHP+Y+SLLVIGCYQSLELWNMTEN
Sbjct  814  SVSEDSVRVWTLGAGGEGECVHELSCNGNKFHSCVFHPTYTSLLVIGCYQSLELWNMTEN  873

Query  363  KTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            KTMTL AH+GLIA+L+VST  GLVASASHDK +KLWK
Sbjct  874  KTMTLSAHDGLIAALSVSTGTGLVASASHDKFVKLWK  910



>ref|XP_008359612.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X5 
[Malus domestica]
Length=895

 Score =   294 bits (753),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 137/157 (87%), Positives = 147/157 (94%), Gaps = 0/157 (0%)
 Frame = -1

Query  723  FKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLA  544
            FKGGTAQ+RFQPRLGR LAAAAENVVSILDVETQTCR +L+GHTKPIHSVCWDPSGE LA
Sbjct  739  FKGGTAQMRFQPRLGRLLAAAAENVVSILDVETQTCRHSLQGHTKPIHSVCWDPSGEFLA  798

Query  543  SVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTEN  364
            SVSEDSVRVWTLG+G EG CVHELS NGNKFHSCVFHP+Y+SLLVIGCYQSLELWNMTEN
Sbjct  799  SVSEDSVRVWTLGAGGEGECVHELSCNGNKFHSCVFHPTYTSLLVIGCYQSLELWNMTEN  858

Query  363  KTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            KTMTL AH+GLIA+L+VST  GLVASASHDK +KLWK
Sbjct  859  KTMTLSAHDGLIAALSVSTGTGLVASASHDKFVKLWK  895



>ref|XP_009377496.1| PREDICTED: transcriptional corepressor LEUNIG isoform X2 [Pyrus 
x bretschneideri]
Length=906

 Score =   294 bits (753),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 136/156 (87%), Positives = 147/156 (94%), Gaps = 0/156 (0%)
 Frame = -1

Query  720  KGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLAS  541
            KGGTAQ+RFQPRLGR+LAAAAENVVSILDVETQ CR +L+GHTKPIHSVCWDPSGE LAS
Sbjct  751  KGGTAQMRFQPRLGRFLAAAAENVVSILDVETQNCRHSLQGHTKPIHSVCWDPSGEFLAS  810

Query  540  VSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENK  361
            VSEDSVRVWTLG+G EG CVHELS NGNKFHSCVFHP+Y+SLLVIGCYQSLELWNMTENK
Sbjct  811  VSEDSVRVWTLGAGGEGECVHELSCNGNKFHSCVFHPTYTSLLVIGCYQSLELWNMTENK  870

Query  360  TMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            TMTL AH+GLIA+L+VSTV GLVASASHDK +KLWK
Sbjct  871  TMTLSAHDGLIAALSVSTVTGLVASASHDKFVKLWK  906



>ref|XP_011019744.1| PREDICTED: transcriptional corepressor LEUNIG isoform X3 [Populus 
euphratica]
Length=849

 Score =   293 bits (750),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 135/159 (85%), Positives = 145/159 (91%), Gaps = 0/159 (0%)
 Frame = -1

Query  729  RAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEH  550
            R FKGG   +RFQPR+GRYLAA AENVVSILDVETQ CR +LKGHTKPIHSVCWDPSGE+
Sbjct  691  RVFKGGMTCMRFQPRVGRYLAAVAENVVSILDVETQACRHSLKGHTKPIHSVCWDPSGEY  750

Query  549  LASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMT  370
            LAS SEDSVRVWTLGSG+EG CVHELS NGNKFHSCVFHP++ SLLVIGCYQSLELWNM 
Sbjct  751  LASASEDSVRVWTLGSGSEGECVHELSCNGNKFHSCVFHPTFPSLLVIGCYQSLELWNMD  810

Query  369  ENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            ENKTMTLPAHEGLIA+LAVST  GLVASASHDK++KLWK
Sbjct  811  ENKTMTLPAHEGLIAALAVSTATGLVASASHDKLVKLWK  849



>ref|XP_010112086.1| Transcriptional corepressor LEUNIG [Morus notabilis]
 gb|EXC32583.1| Transcriptional corepressor LEUNIG [Morus notabilis]
Length=924

 Score =   295 bits (754),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 135/159 (85%), Positives = 148/159 (93%), Gaps = 0/159 (0%)
 Frame = -1

Query  729  RAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEH  550
            R FKGGTAQ+RFQPRLGRYLAAAAEN+VSILDVETQ CR +L+GHTKP+HSVCWDPSGE 
Sbjct  766  RVFKGGTAQMRFQPRLGRYLAAAAENIVSILDVETQACRHSLQGHTKPVHSVCWDPSGEF  825

Query  549  LASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMT  370
            LASVSEDSVRVWTLGSG+EG CVHELS +GNKFHSCVFHP+Y SLLV+GCYQSLELWNM+
Sbjct  826  LASVSEDSVRVWTLGSGSEGECVHELSCSGNKFHSCVFHPTYPSLLVVGCYQSLELWNMS  885

Query  369  ENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            ENKTMTL AHEGLIA+LAVS + GLVASASHDK +KLWK
Sbjct  886  ENKTMTLSAHEGLIAALAVSPLTGLVASASHDKYVKLWK  924



>ref|XP_009372954.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X4 
[Pyrus x bretschneideri]
Length=903

 Score =   294 bits (752),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 137/157 (87%), Positives = 146/157 (93%), Gaps = 0/157 (0%)
 Frame = -1

Query  723  FKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLA  544
            FKGGTAQ+RFQPRLGR LAAAAENVVSILDVETQ CR +L+GHTKPIHSVCWDPSGE LA
Sbjct  747  FKGGTAQMRFQPRLGRLLAAAAENVVSILDVETQACRHSLQGHTKPIHSVCWDPSGEFLA  806

Query  543  SVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTEN  364
            SVSEDSVRVWTLG+G EG CVHELS NGNKFHSCVFHP+Y+SLLVIGCYQSLELWNMTEN
Sbjct  807  SVSEDSVRVWTLGAGGEGECVHELSCNGNKFHSCVFHPTYTSLLVIGCYQSLELWNMTEN  866

Query  363  KTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            KTMTL AHEGLIA+L+VST  GLVASASHDK +KLWK
Sbjct  867  KTMTLSAHEGLIAALSVSTGTGLVASASHDKYVKLWK  903



>ref|XP_011019743.1| PREDICTED: transcriptional corepressor LEUNIG isoform X2 [Populus 
euphratica]
Length=857

 Score =   293 bits (750),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 135/159 (85%), Positives = 145/159 (91%), Gaps = 0/159 (0%)
 Frame = -1

Query  729  RAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEH  550
            R FKGG   +RFQPR+GRYLAA AENVVSILDVETQ CR +LKGHTKPIHSVCWDPSGE+
Sbjct  699  RVFKGGMTCMRFQPRVGRYLAAVAENVVSILDVETQACRHSLKGHTKPIHSVCWDPSGEY  758

Query  549  LASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMT  370
            LAS SEDSVRVWTLGSG+EG CVHELS NGNKFHSCVFHP++ SLLVIGCYQSLELWNM 
Sbjct  759  LASASEDSVRVWTLGSGSEGECVHELSCNGNKFHSCVFHPTFPSLLVIGCYQSLELWNMD  818

Query  369  ENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            ENKTMTLPAHEGLIA+LAVST  GLVASASHDK++KLWK
Sbjct  819  ENKTMTLPAHEGLIAALAVSTATGLVASASHDKLVKLWK  857



>ref|XP_011019742.1| PREDICTED: transcriptional corepressor LEUNIG isoform X1 [Populus 
euphratica]
Length=858

 Score =   293 bits (750),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 135/159 (85%), Positives = 145/159 (91%), Gaps = 0/159 (0%)
 Frame = -1

Query  729  RAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEH  550
            R FKGG   +RFQPR+GRYLAA AENVVSILDVETQ CR +LKGHTKPIHSVCWDPSGE+
Sbjct  700  RVFKGGMTCMRFQPRVGRYLAAVAENVVSILDVETQACRHSLKGHTKPIHSVCWDPSGEY  759

Query  549  LASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMT  370
            LAS SEDSVRVWTLGSG+EG CVHELS NGNKFHSCVFHP++ SLLVIGCYQSLELWNM 
Sbjct  760  LASASEDSVRVWTLGSGSEGECVHELSCNGNKFHSCVFHPTFPSLLVIGCYQSLELWNMD  819

Query  369  ENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            ENKTMTLPAHEGLIA+LAVST  GLVASASHDK++KLWK
Sbjct  820  ENKTMTLPAHEGLIAALAVSTATGLVASASHDKLVKLWK  858



>ref|XP_009367963.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X2 
[Pyrus x bretschneideri]
Length=419

 Score =   281 bits (720),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 130/156 (83%), Positives = 144/156 (92%), Gaps = 0/156 (0%)
 Frame = -1

Query  720  KGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLAS  541
            KGGTAQ+RFQPRLGR+LAAAAENVVSILDVET TCR +L+GHTKPIHSVCWDPSGE LAS
Sbjct  264  KGGTAQMRFQPRLGRFLAAAAENVVSILDVETLTCRHSLQGHTKPIHSVCWDPSGEFLAS  323

Query  540  VSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENK  361
            VSEDSVRVW LG+G +G CVHELS N NKFHSC FHP+ +SLLV+GCYQ+LELWN+TENK
Sbjct  324  VSEDSVRVWALGAGGKGECVHELSCNRNKFHSCAFHPADTSLLVVGCYQTLELWNITENK  383

Query  360  TMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            TMTLPAHEGLIASLAVSTV GL+ASASHDK +K+WK
Sbjct  384  TMTLPAHEGLIASLAVSTVTGLIASASHDKFVKIWK  419



>ref|XP_003588695.1| Transcriptional corepressor LEUNIG [Medicago truncatula]
 gb|AES58946.1| transcriptional corepressor leunig-like protein [Medicago truncatula]
Length=893

 Score =   293 bits (751),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 138/159 (87%), Positives = 147/159 (92%), Gaps = 0/159 (0%)
 Frame = -1

Query  729  RAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEH  550
            R  KGG AQ+RFQPRLGR+LAAAAENVVSILDVETQ CR +LKGHTK IHSVCWDPSGE 
Sbjct  735  RVSKGGMAQMRFQPRLGRFLAAAAENVVSILDVETQACRYSLKGHTKSIHSVCWDPSGEF  794

Query  549  LASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMT  370
            LASVSEDSVRVWTLGSG+EG CVHELS NGNKFHSCVFHP+YSSLLVIGCYQSLELWNMT
Sbjct  795  LASVSEDSVRVWTLGSGSEGECVHELSCNGNKFHSCVFHPTYSSLLVIGCYQSLELWNMT  854

Query  369  ENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            ENKTMTL AH+GLIA+LAVSTV GLVASASHD+ +KLWK
Sbjct  855  ENKTMTLSAHDGLIAALAVSTVNGLVASASHDRFVKLWK  893



>ref|XP_009372950.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X1 
[Pyrus x bretschneideri]
Length=913

 Score =   293 bits (751),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 137/157 (87%), Positives = 146/157 (93%), Gaps = 0/157 (0%)
 Frame = -1

Query  723  FKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLA  544
            FKGGTAQ+RFQPRLGR LAAAAENVVSILDVETQ CR +L+GHTKPIHSVCWDPSGE LA
Sbjct  757  FKGGTAQMRFQPRLGRLLAAAAENVVSILDVETQACRHSLQGHTKPIHSVCWDPSGEFLA  816

Query  543  SVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTEN  364
            SVSEDSVRVWTLG+G EG CVHELS NGNKFHSCVFHP+Y+SLLVIGCYQSLELWNMTEN
Sbjct  817  SVSEDSVRVWTLGAGGEGECVHELSCNGNKFHSCVFHPTYTSLLVIGCYQSLELWNMTEN  876

Query  363  KTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            KTMTL AHEGLIA+L+VST  GLVASASHDK +KLWK
Sbjct  877  KTMTLSAHEGLIAALSVSTGTGLVASASHDKYVKLWK  913



>ref|XP_009372951.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X2 
[Pyrus x bretschneideri]
Length=912

 Score =   293 bits (751),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 137/157 (87%), Positives = 146/157 (93%), Gaps = 0/157 (0%)
 Frame = -1

Query  723  FKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLA  544
            FKGGTAQ+RFQPRLGR LAAAAENVVSILDVETQ CR +L+GHTKPIHSVCWDPSGE LA
Sbjct  756  FKGGTAQMRFQPRLGRLLAAAAENVVSILDVETQACRHSLQGHTKPIHSVCWDPSGEFLA  815

Query  543  SVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTEN  364
            SVSEDSVRVWTLG+G EG CVHELS NGNKFHSCVFHP+Y+SLLVIGCYQSLELWNMTEN
Sbjct  816  SVSEDSVRVWTLGAGGEGECVHELSCNGNKFHSCVFHPTYTSLLVIGCYQSLELWNMTEN  875

Query  363  KTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            KTMTL AHEGLIA+L+VST  GLVASASHDK +KLWK
Sbjct  876  KTMTLSAHEGLIAALSVSTGTGLVASASHDKYVKLWK  912



>ref|XP_009372955.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X5 
[Pyrus x bretschneideri]
Length=897

 Score =   293 bits (750),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 137/157 (87%), Positives = 146/157 (93%), Gaps = 0/157 (0%)
 Frame = -1

Query  723  FKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLA  544
            FKGGTAQ+RFQPRLGR LAAAAENVVSILDVETQ CR +L+GHTKPIHSVCWDPSGE LA
Sbjct  741  FKGGTAQMRFQPRLGRLLAAAAENVVSILDVETQACRHSLQGHTKPIHSVCWDPSGEFLA  800

Query  543  SVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTEN  364
            SVSEDSVRVWTLG+G EG CVHELS NGNKFHSCVFHP+Y+SLLVIGCYQSLELWNMTEN
Sbjct  801  SVSEDSVRVWTLGAGGEGECVHELSCNGNKFHSCVFHPTYTSLLVIGCYQSLELWNMTEN  860

Query  363  KTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            KTMTL AHEGLIA+L+VST  GLVASASHDK +KLWK
Sbjct  861  KTMTLSAHEGLIAALSVSTGTGLVASASHDKYVKLWK  897



>gb|KEH39820.1| transcriptional corepressor leunig-like protein [Medicago truncatula]
Length=902

 Score =   293 bits (750),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 138/159 (87%), Positives = 147/159 (92%), Gaps = 0/159 (0%)
 Frame = -1

Query  729  RAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEH  550
            R  KGG AQ+RFQPRLGR+LAAAAENVVSILDVETQ CR +LKGHTK IHSVCWDPSGE 
Sbjct  744  RVSKGGMAQMRFQPRLGRFLAAAAENVVSILDVETQACRYSLKGHTKSIHSVCWDPSGEF  803

Query  549  LASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMT  370
            LASVSEDSVRVWTLGSG+EG CVHELS NGNKFHSCVFHP+YSSLLVIGCYQSLELWNMT
Sbjct  804  LASVSEDSVRVWTLGSGSEGECVHELSCNGNKFHSCVFHPTYSSLLVIGCYQSLELWNMT  863

Query  369  ENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            ENKTMTL AH+GLIA+LAVSTV GLVASASHD+ +KLWK
Sbjct  864  ENKTMTLSAHDGLIAALAVSTVNGLVASASHDRFVKLWK  902



>ref|XP_009367962.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X1 
[Pyrus x bretschneideri]
Length=428

 Score =   281 bits (720),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 130/156 (83%), Positives = 144/156 (92%), Gaps = 0/156 (0%)
 Frame = -1

Query  720  KGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLAS  541
            KGGTAQ+RFQPRLGR+LAAAAENVVSILDVET TCR +L+GHTKPIHSVCWDPSGE LAS
Sbjct  273  KGGTAQMRFQPRLGRFLAAAAENVVSILDVETLTCRHSLQGHTKPIHSVCWDPSGEFLAS  332

Query  540  VSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENK  361
            VSEDSVRVW LG+G +G CVHELS N NKFHSC FHP+ +SLLV+GCYQ+LELWN+TENK
Sbjct  333  VSEDSVRVWALGAGGKGECVHELSCNRNKFHSCAFHPADTSLLVVGCYQTLELWNITENK  392

Query  360  TMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            TMTLPAHEGLIASLAVSTV GL+ASASHDK +K+WK
Sbjct  393  TMTLPAHEGLIASLAVSTVTGLIASASHDKFVKIWK  428



>ref|XP_007161251.1| hypothetical protein PHAVU_001G054700g [Phaseolus vulgaris]
 gb|ESW33245.1| hypothetical protein PHAVU_001G054700g [Phaseolus vulgaris]
Length=895

 Score =   293 bits (749),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 137/159 (86%), Positives = 147/159 (92%), Gaps = 0/159 (0%)
 Frame = -1

Query  729  RAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEH  550
            R  KGGTAQ+RFQPRLGR+LAAAAENVVSI DVETQ CR +LKGHTK IHSVCWDPSGE 
Sbjct  737  RVSKGGTAQMRFQPRLGRFLAAAAENVVSIFDVETQACRYSLKGHTKSIHSVCWDPSGEF  796

Query  549  LASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMT  370
            LASVSEDSVRVWTLGSG+EG CVHELS NGNKFHSCVFHP++SSLLV+GCY+SLELWNMT
Sbjct  797  LASVSEDSVRVWTLGSGSEGECVHELSCNGNKFHSCVFHPTFSSLLVVGCYESLELWNMT  856

Query  369  ENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            ENKTMTL AHEGLIA+LAVSTV GLVASASHDK +KLWK
Sbjct  857  ENKTMTLSAHEGLIAALAVSTVNGLVASASHDKFVKLWK  895



>ref|XP_007225318.1| hypothetical protein PRUPE_ppa001131mg [Prunus persica]
 gb|EMJ26517.1| hypothetical protein PRUPE_ppa001131mg [Prunus persica]
Length=636

 Score =   286 bits (733),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 132/157 (84%), Positives = 146/157 (93%), Gaps = 0/157 (0%)
 Frame = -1

Query  723  FKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLA  544
            FKGGTAQ+RFQPR GR+LAAAA+NVVSILDVETQ CR +L+GH+KP+HSVCWDPSGE LA
Sbjct  480  FKGGTAQMRFQPRHGRFLAAAADNVVSILDVETQACRHSLQGHSKPVHSVCWDPSGEFLA  539

Query  543  SVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTEN  364
            SVSEDSVRVWTL SG EG CVHELS NG+KFHSCVFHP+Y+SLLVIGCYQSLELWNMTEN
Sbjct  540  SVSEDSVRVWTLRSGGEGECVHELSCNGSKFHSCVFHPTYTSLLVIGCYQSLELWNMTEN  599

Query  363  KTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            KTMTL AH+GLIA+LA+STV GLVASASHDK +KLWK
Sbjct  600  KTMTLSAHDGLIAALAMSTVTGLVASASHDKFVKLWK  636



>gb|KDO79600.1| hypothetical protein CISIN_1g002471mg [Citrus sinensis]
 gb|KDO79601.1| hypothetical protein CISIN_1g002471mg [Citrus sinensis]
Length=792

 Score =   290 bits (742),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 136/160 (85%), Positives = 145/160 (91%), Gaps = 0/160 (0%)
 Frame = -1

Query  732  TRAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGE  553
            TR FKGGTAQ+RFQP LGRYLAAAAENVVSILD ETQ CR +L+GHTKPI SVCWDPSGE
Sbjct  633  TRVFKGGTAQMRFQPHLGRYLAAAAENVVSILDAETQACRLSLQGHTKPIDSVCWDPSGE  692

Query  552  HLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNM  373
             LASVSEDSVRVWT+GSG+EG CVHELS NGNKFHSCVFHP+Y SLLVIGCYQSLELWNM
Sbjct  693  LLASVSEDSVRVWTVGSGSEGECVHELSCNGNKFHSCVFHPTYPSLLVIGCYQSLELWNM  752

Query  372  TENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            +ENKTMTL AHEGLIA+LAVST  G VASASHDK +KLWK
Sbjct  753  SENKTMTLTAHEGLIAALAVSTETGYVASASHDKFVKLWK  792



>ref|XP_008352162.1| PREDICTED: transcriptional corepressor LEUNIG-like [Malus domestica]
Length=401

 Score =   279 bits (713),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 130/156 (83%), Positives = 141/156 (90%), Gaps = 0/156 (0%)
 Frame = -1

Query  720  KGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLAS  541
            KGG AQ+RFQPRLG +LAAAAENVVSILDVETQTC  +L+GHTKPIHSVCWDPSGE LAS
Sbjct  246  KGGXAQIRFQPRLGXFLAAAAENVVSILDVETQTCXXSLQGHTKPIHSVCWDPSGEFLAS  305

Query  540  VSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENK  361
            VSEDSVRVWTLG+G EG CVHEL  NGNKFHSCVFHP+Y+SLLVIGCYQ+LELWNMTENK
Sbjct  306  VSEDSVRVWTLGAGGEGECVHELICNGNKFHSCVFHPTYTSLLVIGCYQTLELWNMTENK  365

Query  360  TMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            TMTL AHEGLI SLAVSTV GL+ SASHD  +K+WK
Sbjct  366  TMTLXAHEGLIDSLAVSTVTGLIXSASHDXFVKIWK  401



>ref|XP_008219869.1| PREDICTED: transcriptional corepressor LEUNIG isoform X3 [Prunus 
mume]
Length=914

 Score =   291 bits (745),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 134/157 (85%), Positives = 147/157 (94%), Gaps = 0/157 (0%)
 Frame = -1

Query  723  FKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLA  544
            FKGGTAQ+RFQPR GR+LAAAA+NVVSILDVETQ CR +L+GHTKP+HSVCWDPSGE LA
Sbjct  758  FKGGTAQMRFQPRHGRFLAAAADNVVSILDVETQACRHSLQGHTKPVHSVCWDPSGEFLA  817

Query  543  SVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTEN  364
            SVSEDSVRVWTLGSG EG CVHELS NG+KFHSCVFHP+Y+SLLVIGCYQSLELWNMTEN
Sbjct  818  SVSEDSVRVWTLGSGGEGECVHELSCNGSKFHSCVFHPTYTSLLVIGCYQSLELWNMTEN  877

Query  363  KTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            KTMTL AH+GLIA+LA+STV GLVASASHDK +KLWK
Sbjct  878  KTMTLSAHDGLIAALAMSTVTGLVASASHDKFVKLWK  914



>ref|XP_010526195.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X4 
[Tarenaya hassleriana]
Length=829

 Score =   290 bits (741),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 134/159 (84%), Positives = 143/159 (90%), Gaps = 0/159 (0%)
 Frame = -1

Query  729  RAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEH  550
            R FKGGT Q+RFQPRLGRYLAAAAENVVS+LDVETQ CR +L+GH   IHSVCWDPSGE 
Sbjct  671  RVFKGGTTQMRFQPRLGRYLAAAAENVVSVLDVETQACRHSLQGHNNRIHSVCWDPSGEF  730

Query  549  LASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMT  370
            LASVSEDSVRVW+LGSG+EG CVHELS NGNKF SCVFHPSY SLLVIGCYQSLELWNM+
Sbjct  731  LASVSEDSVRVWSLGSGSEGECVHELSCNGNKFQSCVFHPSYPSLLVIGCYQSLELWNMS  790

Query  369  ENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            ENKTMTLPAHEG IA+LAVST  GLVASASHDK +KLWK
Sbjct  791  ENKTMTLPAHEGRIAALAVSTATGLVASASHDKFVKLWK  829



>ref|XP_008219868.1| PREDICTED: transcriptional corepressor LEUNIG isoform X2 [Prunus 
mume]
Length=923

 Score =   291 bits (745),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 134/157 (85%), Positives = 147/157 (94%), Gaps = 0/157 (0%)
 Frame = -1

Query  723  FKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLA  544
            FKGGTAQ+RFQPR GR+LAAAA+NVVSILDVETQ CR +L+GHTKP+HSVCWDPSGE LA
Sbjct  767  FKGGTAQMRFQPRHGRFLAAAADNVVSILDVETQACRHSLQGHTKPVHSVCWDPSGEFLA  826

Query  543  SVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTEN  364
            SVSEDSVRVWTLGSG EG CVHELS NG+KFHSCVFHP+Y+SLLVIGCYQSLELWNMTEN
Sbjct  827  SVSEDSVRVWTLGSGGEGECVHELSCNGSKFHSCVFHPTYTSLLVIGCYQSLELWNMTEN  886

Query  363  KTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            KTMTL AH+GLIA+LA+STV GLVASASHDK +KLWK
Sbjct  887  KTMTLSAHDGLIAALAMSTVTGLVASASHDKFVKLWK  923



>ref|XP_008219867.1| PREDICTED: transcriptional corepressor LEUNIG isoform X1 [Prunus 
mume]
Length=924

 Score =   291 bits (745),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 134/157 (85%), Positives = 147/157 (94%), Gaps = 0/157 (0%)
 Frame = -1

Query  723  FKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLA  544
            FKGGTAQ+RFQPR GR+LAAAA+NVVSILDVETQ CR +L+GHTKP+HSVCWDPSGE LA
Sbjct  768  FKGGTAQMRFQPRHGRFLAAAADNVVSILDVETQACRHSLQGHTKPVHSVCWDPSGEFLA  827

Query  543  SVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTEN  364
            SVSEDSVRVWTLGSG EG CVHELS NG+KFHSCVFHP+Y+SLLVIGCYQSLELWNMTEN
Sbjct  828  SVSEDSVRVWTLGSGGEGECVHELSCNGSKFHSCVFHPTYTSLLVIGCYQSLELWNMTEN  887

Query  363  KTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            KTMTL AH+GLIA+LA+STV GLVASASHDK +KLWK
Sbjct  888  KTMTLSAHDGLIAALAMSTVTGLVASASHDKFVKLWK  924



>ref|XP_007013780.1| LisH dimerization motif,WD40/YVTN repeat-like-containing domain 
isoform 4 [Theobroma cacao]
 gb|EOY31399.1| LisH dimerization motif,WD40/YVTN repeat-like-containing domain 
isoform 4 [Theobroma cacao]
Length=911

 Score =   291 bits (745),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 138/160 (86%), Positives = 148/160 (93%), Gaps = 1/160 (1%)
 Frame = -1

Query  729  RAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEH  550
            R FKGGTAQ+RFQPRLG+YLAAAAENVVSILD ETQTCR +L+GHTKPIHSVCWD SGE 
Sbjct  752  RVFKGGTAQLRFQPRLGKYLAAAAENVVSILDTETQTCRHSLQGHTKPIHSVCWDTSGEL  811

Query  549  LASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCY-QSLELWNM  373
            LASVSEDSVRVWTLGSG+EG CVHELS NGNKFHSCVFHP+Y SLLVIGCY QSLELWNM
Sbjct  812  LASVSEDSVRVWTLGSGSEGECVHELSCNGNKFHSCVFHPTYPSLLVIGCYQQSLELWNM  871

Query  372  TENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            TENKTMTL AH+GLIA+LAVS V GLV+SASHDKI+KLWK
Sbjct  872  TENKTMTLAAHDGLIAALAVSPVTGLVSSASHDKIVKLWK  911



>ref|XP_006450544.1| hypothetical protein CICLE_v10007390mg [Citrus clementina]
 gb|ESR63784.1| hypothetical protein CICLE_v10007390mg [Citrus clementina]
Length=920

 Score =   290 bits (741),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 136/160 (85%), Positives = 145/160 (91%), Gaps = 0/160 (0%)
 Frame = -1

Query  732  TRAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGE  553
            TR FKGGTAQ+RFQP LGRYLAAAAENVVSILD ETQ CR +L+GHTKPI SVCWDPSGE
Sbjct  761  TRVFKGGTAQMRFQPHLGRYLAAAAENVVSILDAETQACRLSLQGHTKPIDSVCWDPSGE  820

Query  552  HLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNM  373
             LASVSEDSVRVWT+GSG+EG CVHELS NGNKFHSCVFHP+Y SLLVIGCYQSLELWNM
Sbjct  821  LLASVSEDSVRVWTVGSGSEGECVHELSCNGNKFHSCVFHPTYPSLLVIGCYQSLELWNM  880

Query  372  TENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            +ENKTMTL AHEGLIA+LAVST  G VASASHDK +KLWK
Sbjct  881  SENKTMTLTAHEGLIAALAVSTETGYVASASHDKFVKLWK  920



>ref|XP_006476206.1| PREDICTED: transcriptional corepressor LEUNIG-like [Citrus sinensis]
 gb|KDO79595.1| hypothetical protein CISIN_1g002471mg [Citrus sinensis]
Length=918

 Score =   290 bits (741),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 136/160 (85%), Positives = 145/160 (91%), Gaps = 0/160 (0%)
 Frame = -1

Query  732  TRAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGE  553
            TR FKGGTAQ+RFQP LGRYLAAAAENVVSILD ETQ CR +L+GHTKPI SVCWDPSGE
Sbjct  759  TRVFKGGTAQMRFQPHLGRYLAAAAENVVSILDAETQACRLSLQGHTKPIDSVCWDPSGE  818

Query  552  HLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNM  373
             LASVSEDSVRVWT+GSG+EG CVHELS NGNKFHSCVFHP+Y SLLVIGCYQSLELWNM
Sbjct  819  LLASVSEDSVRVWTVGSGSEGECVHELSCNGNKFHSCVFHPTYPSLLVIGCYQSLELWNM  878

Query  372  TENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            +ENKTMTL AHEGLIA+LAVST  G VASASHDK +KLWK
Sbjct  879  SENKTMTLTAHEGLIAALAVSTETGYVASASHDKFVKLWK  918



>ref|XP_006450543.1| hypothetical protein CICLE_v10007390mg [Citrus clementina]
 gb|ESR63783.1| hypothetical protein CICLE_v10007390mg [Citrus clementina]
Length=917

 Score =   290 bits (741),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 136/160 (85%), Positives = 145/160 (91%), Gaps = 0/160 (0%)
 Frame = -1

Query  732  TRAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGE  553
            TR FKGGTAQ+RFQP LGRYLAAAAENVVSILD ETQ CR +L+GHTKPI SVCWDPSGE
Sbjct  758  TRVFKGGTAQMRFQPHLGRYLAAAAENVVSILDAETQACRLSLQGHTKPIDSVCWDPSGE  817

Query  552  HLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNM  373
             LASVSEDSVRVWT+GSG+EG CVHELS NGNKFHSCVFHP+Y SLLVIGCYQSLELWNM
Sbjct  818  LLASVSEDSVRVWTVGSGSEGECVHELSCNGNKFHSCVFHPTYPSLLVIGCYQSLELWNM  877

Query  372  TENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            +ENKTMTL AHEGLIA+LAVST  G VASASHDK +KLWK
Sbjct  878  SENKTMTLTAHEGLIAALAVSTETGYVASASHDKFVKLWK  917



>gb|KDO79598.1| hypothetical protein CISIN_1g002471mg [Citrus sinensis]
Length=915

 Score =   289 bits (740),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 136/160 (85%), Positives = 145/160 (91%), Gaps = 0/160 (0%)
 Frame = -1

Query  732  TRAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGE  553
            TR FKGGTAQ+RFQP LGRYLAAAAENVVSILD ETQ CR +L+GHTKPI SVCWDPSGE
Sbjct  756  TRVFKGGTAQMRFQPHLGRYLAAAAENVVSILDAETQACRLSLQGHTKPIDSVCWDPSGE  815

Query  552  HLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNM  373
             LASVSEDSVRVWT+GSG+EG CVHELS NGNKFHSCVFHP+Y SLLVIGCYQSLELWNM
Sbjct  816  LLASVSEDSVRVWTVGSGSEGECVHELSCNGNKFHSCVFHPTYPSLLVIGCYQSLELWNM  875

Query  372  TENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            +ENKTMTL AHEGLIA+LAVST  G VASASHDK +KLWK
Sbjct  876  SENKTMTLTAHEGLIAALAVSTETGYVASASHDKFVKLWK  915



>gb|KDO79597.1| hypothetical protein CISIN_1g002471mg [Citrus sinensis]
Length=903

 Score =   289 bits (740),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 136/160 (85%), Positives = 145/160 (91%), Gaps = 0/160 (0%)
 Frame = -1

Query  732  TRAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGE  553
            TR FKGGTAQ+RFQP LGRYLAAAAENVVSILD ETQ CR +L+GHTKPI SVCWDPSGE
Sbjct  744  TRVFKGGTAQMRFQPHLGRYLAAAAENVVSILDAETQACRLSLQGHTKPIDSVCWDPSGE  803

Query  552  HLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNM  373
             LASVSEDSVRVWT+GSG+EG CVHELS NGNKFHSCVFHP+Y SLLVIGCYQSLELWNM
Sbjct  804  LLASVSEDSVRVWTVGSGSEGECVHELSCNGNKFHSCVFHPTYPSLLVIGCYQSLELWNM  863

Query  372  TENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            +ENKTMTL AHEGLIA+LAVST  G VASASHDK +KLWK
Sbjct  864  SENKTMTLTAHEGLIAALAVSTETGYVASASHDKFVKLWK  903



>gb|KDO79596.1| hypothetical protein CISIN_1g002471mg [Citrus sinensis]
Length=913

 Score =   289 bits (740),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 136/160 (85%), Positives = 145/160 (91%), Gaps = 0/160 (0%)
 Frame = -1

Query  732  TRAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGE  553
            TR FKGGTAQ+RFQP LGRYLAAAAENVVSILD ETQ CR +L+GHTKPI SVCWDPSGE
Sbjct  754  TRVFKGGTAQMRFQPHLGRYLAAAAENVVSILDAETQACRLSLQGHTKPIDSVCWDPSGE  813

Query  552  HLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNM  373
             LASVSEDSVRVWT+GSG+EG CVHELS NGNKFHSCVFHP+Y SLLVIGCYQSLELWNM
Sbjct  814  LLASVSEDSVRVWTVGSGSEGECVHELSCNGNKFHSCVFHPTYPSLLVIGCYQSLELWNM  873

Query  372  TENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            +ENKTMTL AHEGLIA+LAVST  G VASASHDK +KLWK
Sbjct  874  SENKTMTLTAHEGLIAALAVSTETGYVASASHDKFVKLWK  913



>ref|XP_010526194.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X3 
[Tarenaya hassleriana]
Length=911

 Score =   289 bits (739),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 134/159 (84%), Positives = 143/159 (90%), Gaps = 0/159 (0%)
 Frame = -1

Query  729  RAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEH  550
            R FKGGT Q+RFQPRLGRYLAAAAENVVS+LDVETQ CR +L+GH   IHSVCWDPSGE 
Sbjct  753  RVFKGGTTQMRFQPRLGRYLAAAAENVVSVLDVETQACRHSLQGHNNRIHSVCWDPSGEF  812

Query  549  LASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMT  370
            LASVSEDSVRVW+LGSG+EG CVHELS NGNKF SCVFHPSY SLLVIGCYQSLELWNM+
Sbjct  813  LASVSEDSVRVWSLGSGSEGECVHELSCNGNKFQSCVFHPSYPSLLVIGCYQSLELWNMS  872

Query  369  ENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            ENKTMTLPAHEG IA+LAVST  GLVASASHDK +KLWK
Sbjct  873  ENKTMTLPAHEGRIAALAVSTATGLVASASHDKFVKLWK  911



>ref|XP_003550163.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform 1 
[Glycine max]
Length=903

 Score =   289 bits (739),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 137/159 (86%), Positives = 144/159 (91%), Gaps = 0/159 (0%)
 Frame = -1

Query  729  RAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEH  550
            R  KGG  Q+RFQPRLGRYLAAAAENVVSILDVETQ  R +LKGHTK I SVCWDPSGE 
Sbjct  745  RVSKGGAVQMRFQPRLGRYLAAAAENVVSILDVETQASRYSLKGHTKSIRSVCWDPSGEF  804

Query  549  LASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMT  370
            LASVSEDSVRVWTLGSG+EG CVHELS NGNKFHSCVFHP+YSSLLV+GCYQSLELWNMT
Sbjct  805  LASVSEDSVRVWTLGSGSEGECVHELSCNGNKFHSCVFHPTYSSLLVVGCYQSLELWNMT  864

Query  369  ENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            ENKTMTL AHEGLIA+LAVSTV GLVASASHDK +KLWK
Sbjct  865  ENKTMTLSAHEGLIAALAVSTVNGLVASASHDKFVKLWK  903



>ref|XP_003550164.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform 2 
[Glycine max]
Length=912

 Score =   288 bits (738),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 137/159 (86%), Positives = 144/159 (91%), Gaps = 0/159 (0%)
 Frame = -1

Query  729  RAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEH  550
            R  KGG  Q+RFQPRLGRYLAAAAENVVSILDVETQ  R +LKGHTK I SVCWDPSGE 
Sbjct  754  RVSKGGAVQMRFQPRLGRYLAAAAENVVSILDVETQASRYSLKGHTKSIRSVCWDPSGEF  813

Query  549  LASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMT  370
            LASVSEDSVRVWTLGSG+EG CVHELS NGNKFHSCVFHP+YSSLLV+GCYQSLELWNMT
Sbjct  814  LASVSEDSVRVWTLGSGSEGECVHELSCNGNKFHSCVFHPTYSSLLVVGCYQSLELWNMT  873

Query  369  ENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            ENKTMTL AHEGLIA+LAVSTV GLVASASHDK +KLWK
Sbjct  874  ENKTMTLSAHEGLIAALAVSTVNGLVASASHDKFVKLWK  912



>ref|XP_010548472.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X3 
[Tarenaya hassleriana]
Length=894

 Score =   288 bits (736),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 130/160 (81%), Positives = 144/160 (90%), Gaps = 0/160 (0%)
 Frame = -1

Query  732  TRAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGE  553
            TR FKGGT Q+RFQPRLGR+L A AENVVS+LDVETQ CR +L+GH+ PIHSVCWDPSG+
Sbjct  735  TRVFKGGTTQMRFQPRLGRFLVAGAENVVSVLDVETQACRHSLQGHSNPIHSVCWDPSGD  794

Query  552  HLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNM  373
             LASVSEDSVRVW+LGSG EG CVHELS NGNKF SCVFHP+Y SLLVIGCYQSLELWNM
Sbjct  795  FLASVSEDSVRVWSLGSGTEGECVHELSCNGNKFQSCVFHPAYPSLLVIGCYQSLELWNM  854

Query  372  TENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            +ENKTM LPAH+GLIA+LAVST  GLVASASHDK++KLWK
Sbjct  855  SENKTMALPAHDGLIAALAVSTATGLVASASHDKLVKLWK  894



>ref|XP_010249918.1| PREDICTED: LOW QUALITY PROTEIN: transcriptional corepressor LEUNIG 
[Nelumbo nucifera]
Length=897

 Score =   288 bits (736),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 135/159 (85%), Positives = 142/159 (89%), Gaps = 0/159 (0%)
 Frame = -1

Query  729  RAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEH  550
            R FKGGT Q+RFQPRLGR LAAAAENVVSILDVETQ  R +L+GHTKP+HSVCWDPSGE 
Sbjct  739  RVFKGGTTQMRFQPRLGRCLAAAAENVVSILDVETQMSRHSLQGHTKPVHSVCWDPSGEL  798

Query  549  LASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMT  370
            LASVSEDSVRVWT GSGNEG CVHELS NGNKFHSCVFHPSY SLLVIGCYQSLELWNM 
Sbjct  799  LASVSEDSVRVWTFGSGNEGECVHELSCNGNKFHSCVFHPSYPSLLVIGCYQSLELWNMA  858

Query  369  ENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            ENKTMT+ AHEGLIA+LAVS   GLVASASHDK +KLWK
Sbjct  859  ENKTMTMSAHEGLIAALAVSNATGLVASASHDKYVKLWK  897



>ref|XP_010548471.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X2 
[Tarenaya hassleriana]
Length=899

 Score =   288 bits (736),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 130/160 (81%), Positives = 144/160 (90%), Gaps = 0/160 (0%)
 Frame = -1

Query  732  TRAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGE  553
            TR FKGGT Q+RFQPRLGR+L A AENVVS+LDVETQ CR +L+GH+ PIHSVCWDPSG+
Sbjct  740  TRVFKGGTTQMRFQPRLGRFLVAGAENVVSVLDVETQACRHSLQGHSNPIHSVCWDPSGD  799

Query  552  HLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNM  373
             LASVSEDSVRVW+LGSG EG CVHELS NGNKF SCVFHP+Y SLLVIGCYQSLELWNM
Sbjct  800  FLASVSEDSVRVWSLGSGTEGECVHELSCNGNKFQSCVFHPAYPSLLVIGCYQSLELWNM  859

Query  372  TENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            +ENKTM LPAH+GLIA+LAVST  GLVASASHDK++KLWK
Sbjct  860  SENKTMALPAHDGLIAALAVSTATGLVASASHDKLVKLWK  899



>ref|XP_010526192.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X1 
[Tarenaya hassleriana]
Length=960

 Score =   288 bits (738),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 134/159 (84%), Positives = 143/159 (90%), Gaps = 0/159 (0%)
 Frame = -1

Query  729  RAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEH  550
            R FKGGT Q+RFQPRLGRYLAAAAENVVS+LDVETQ CR +L+GH   IHSVCWDPSGE 
Sbjct  802  RVFKGGTTQMRFQPRLGRYLAAAAENVVSVLDVETQACRHSLQGHNNRIHSVCWDPSGEF  861

Query  549  LASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMT  370
            LASVSEDSVRVW+LGSG+EG CVHELS NGNKF SCVFHPSY SLLVIGCYQSLELWNM+
Sbjct  862  LASVSEDSVRVWSLGSGSEGECVHELSCNGNKFQSCVFHPSYPSLLVIGCYQSLELWNMS  921

Query  369  ENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            ENKTMTLPAHEG IA+LAVST  GLVASASHDK +KLWK
Sbjct  922  ENKTMTLPAHEGRIAALAVSTATGLVASASHDKFVKLWK  960



>ref|XP_010548470.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X1 
[Tarenaya hassleriana]
Length=904

 Score =   288 bits (736),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 130/160 (81%), Positives = 144/160 (90%), Gaps = 0/160 (0%)
 Frame = -1

Query  732  TRAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGE  553
            TR FKGGT Q+RFQPRLGR+L A AENVVS+LDVETQ CR +L+GH+ PIHSVCWDPSG+
Sbjct  745  TRVFKGGTTQMRFQPRLGRFLVAGAENVVSVLDVETQACRHSLQGHSNPIHSVCWDPSGD  804

Query  552  HLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNM  373
             LASVSEDSVRVW+LGSG EG CVHELS NGNKF SCVFHP+Y SLLVIGCYQSLELWNM
Sbjct  805  FLASVSEDSVRVWSLGSGTEGECVHELSCNGNKFQSCVFHPAYPSLLVIGCYQSLELWNM  864

Query  372  TENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            +ENKTM LPAH+GLIA+LAVST  GLVASASHDK++KLWK
Sbjct  865  SENKTMALPAHDGLIAALAVSTATGLVASASHDKLVKLWK  904



>ref|XP_010526193.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X2 
[Tarenaya hassleriana]
Length=958

 Score =   288 bits (737),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 134/159 (84%), Positives = 143/159 (90%), Gaps = 0/159 (0%)
 Frame = -1

Query  729  RAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEH  550
            R FKGGT Q+RFQPRLGRYLAAAAENVVS+LDVETQ CR +L+GH   IHSVCWDPSGE 
Sbjct  800  RVFKGGTTQMRFQPRLGRYLAAAAENVVSVLDVETQACRHSLQGHNNRIHSVCWDPSGEF  859

Query  549  LASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMT  370
            LASVSEDSVRVW+LGSG+EG CVHELS NGNKF SCVFHPSY SLLVIGCYQSLELWNM+
Sbjct  860  LASVSEDSVRVWSLGSGSEGECVHELSCNGNKFQSCVFHPSYPSLLVIGCYQSLELWNMS  919

Query  369  ENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            ENKTMTLPAHEG IA+LAVST  GLVASASHDK +KLWK
Sbjct  920  ENKTMTLPAHEGRIAALAVSTATGLVASASHDKFVKLWK  958



>ref|XP_007225321.1| hypothetical protein PRUPE_ppa001131mg [Prunus persica]
 gb|EMJ26520.1| hypothetical protein PRUPE_ppa001131mg [Prunus persica]
Length=893

 Score =   286 bits (733),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 132/157 (84%), Positives = 146/157 (93%), Gaps = 0/157 (0%)
 Frame = -1

Query  723  FKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLA  544
            FKGGTAQ+RFQPR GR+LAAAA+NVVSILDVETQ CR +L+GH+KP+HSVCWDPSGE LA
Sbjct  737  FKGGTAQMRFQPRHGRFLAAAADNVVSILDVETQACRHSLQGHSKPVHSVCWDPSGEFLA  796

Query  543  SVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTEN  364
            SVSEDSVRVWTL SG EG CVHELS NG+KFHSCVFHP+Y+SLLVIGCYQSLELWNMTEN
Sbjct  797  SVSEDSVRVWTLRSGGEGECVHELSCNGSKFHSCVFHPTYTSLLVIGCYQSLELWNMTEN  856

Query  363  KTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            KTMTL AH+GLIA+LA+STV GLVASASHDK +KLWK
Sbjct  857  KTMTLSAHDGLIAALAMSTVTGLVASASHDKFVKLWK  893



>ref|XP_007225320.1| hypothetical protein PRUPE_ppa001131mg [Prunus persica]
 gb|EMJ26519.1| hypothetical protein PRUPE_ppa001131mg [Prunus persica]
Length=890

 Score =   286 bits (733),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 132/157 (84%), Positives = 146/157 (93%), Gaps = 0/157 (0%)
 Frame = -1

Query  723  FKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLA  544
            FKGGTAQ+RFQPR GR+LAAAA+NVVSILDVETQ CR +L+GH+KP+HSVCWDPSGE LA
Sbjct  734  FKGGTAQMRFQPRHGRFLAAAADNVVSILDVETQACRHSLQGHSKPVHSVCWDPSGEFLA  793

Query  543  SVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTEN  364
            SVSEDSVRVWTL SG EG CVHELS NG+KFHSCVFHP+Y+SLLVIGCYQSLELWNMTEN
Sbjct  794  SVSEDSVRVWTLRSGGEGECVHELSCNGSKFHSCVFHPTYTSLLVIGCYQSLELWNMTEN  853

Query  363  KTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            KTMTL AH+GLIA+LA+STV GLVASASHDK +KLWK
Sbjct  854  KTMTLSAHDGLIAALAMSTVTGLVASASHDKFVKLWK  890



>ref|XP_007225322.1| hypothetical protein PRUPE_ppa001131mg [Prunus persica]
 gb|EMJ26521.1| hypothetical protein PRUPE_ppa001131mg [Prunus persica]
Length=899

 Score =   286 bits (733),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 132/157 (84%), Positives = 146/157 (93%), Gaps = 0/157 (0%)
 Frame = -1

Query  723  FKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLA  544
            FKGGTAQ+RFQPR GR+LAAAA+NVVSILDVETQ CR +L+GH+KP+HSVCWDPSGE LA
Sbjct  743  FKGGTAQMRFQPRHGRFLAAAADNVVSILDVETQACRHSLQGHSKPVHSVCWDPSGEFLA  802

Query  543  SVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTEN  364
            SVSEDSVRVWTL SG EG CVHELS NG+KFHSCVFHP+Y+SLLVIGCYQSLELWNMTEN
Sbjct  803  SVSEDSVRVWTLRSGGEGECVHELSCNGSKFHSCVFHPTYTSLLVIGCYQSLELWNMTEN  862

Query  363  KTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            KTMTL AH+GLIA+LA+STV GLVASASHDK +KLWK
Sbjct  863  KTMTLSAHDGLIAALAMSTVTGLVASASHDKFVKLWK  899



>ref|XP_011026513.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X3 
[Populus euphratica]
Length=945

 Score =   286 bits (732),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 131/159 (82%), Positives = 145/159 (91%), Gaps = 0/159 (0%)
 Frame = -1

Query  729  RAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEH  550
            R FKGG AQ+RFQPR G+YLAAA ENVVSILDVETQ CR +L+GHTK IHSVCWDPSGE+
Sbjct  787  RVFKGGMAQMRFQPRAGKYLAAATENVVSILDVETQACRHSLQGHTKAIHSVCWDPSGEY  846

Query  549  LASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMT  370
            LAS SEDSVRVWTLGSG+EG CVHELS NGN+FHSCVFHP++ SLLVIGCYQSLELWNM+
Sbjct  847  LASASEDSVRVWTLGSGSEGECVHELSCNGNEFHSCVFHPTFPSLLVIGCYQSLELWNMS  906

Query  369  ENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            ENKTMTLPAH+G IA+LAVSTV G VASASHDK++KLWK
Sbjct  907  ENKTMTLPAHDGQIAALAVSTVTGTVASASHDKLVKLWK  945



>ref|XP_011026514.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X4 
[Populus euphratica]
Length=937

 Score =   286 bits (732),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 131/159 (82%), Positives = 145/159 (91%), Gaps = 0/159 (0%)
 Frame = -1

Query  729  RAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEH  550
            R FKGG AQ+RFQPR G+YLAAA ENVVSILDVETQ CR +L+GHTK IHSVCWDPSGE+
Sbjct  779  RVFKGGMAQMRFQPRAGKYLAAATENVVSILDVETQACRHSLQGHTKAIHSVCWDPSGEY  838

Query  549  LASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMT  370
            LAS SEDSVRVWTLGSG+EG CVHELS NGN+FHSCVFHP++ SLLVIGCYQSLELWNM+
Sbjct  839  LASASEDSVRVWTLGSGSEGECVHELSCNGNEFHSCVFHPTFPSLLVIGCYQSLELWNMS  898

Query  369  ENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            ENKTMTLPAH+G IA+LAVSTV G VASASHDK++KLWK
Sbjct  899  ENKTMTLPAHDGQIAALAVSTVTGTVASASHDKLVKLWK  937



>ref|XP_011026512.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X2 
[Populus euphratica]
Length=949

 Score =   286 bits (732),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 131/159 (82%), Positives = 145/159 (91%), Gaps = 0/159 (0%)
 Frame = -1

Query  729  RAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEH  550
            R FKGG AQ+RFQPR G+YLAAA ENVVSILDVETQ CR +L+GHTK IHSVCWDPSGE+
Sbjct  791  RVFKGGMAQMRFQPRAGKYLAAATENVVSILDVETQACRHSLQGHTKAIHSVCWDPSGEY  850

Query  549  LASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMT  370
            LAS SEDSVRVWTLGSG+EG CVHELS NGN+FHSCVFHP++ SLLVIGCYQSLELWNM+
Sbjct  851  LASASEDSVRVWTLGSGSEGECVHELSCNGNEFHSCVFHPTFPSLLVIGCYQSLELWNMS  910

Query  369  ENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            ENKTMTLPAH+G IA+LAVSTV G VASASHDK++KLWK
Sbjct  911  ENKTMTLPAHDGQIAALAVSTVTGTVASASHDKLVKLWK  949



>ref|XP_011026511.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X1 
[Populus euphratica]
Length=954

 Score =   286 bits (731),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 131/159 (82%), Positives = 145/159 (91%), Gaps = 0/159 (0%)
 Frame = -1

Query  729  RAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEH  550
            R FKGG AQ+RFQPR G+YLAAA ENVVSILDVETQ CR +L+GHTK IHSVCWDPSGE+
Sbjct  796  RVFKGGMAQMRFQPRAGKYLAAATENVVSILDVETQACRHSLQGHTKAIHSVCWDPSGEY  855

Query  549  LASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMT  370
            LAS SEDSVRVWTLGSG+EG CVHELS NGN+FHSCVFHP++ SLLVIGCYQSLELWNM+
Sbjct  856  LASASEDSVRVWTLGSGSEGECVHELSCNGNEFHSCVFHPTFPSLLVIGCYQSLELWNMS  915

Query  369  ENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            ENKTMTLPAH+G IA+LAVSTV G VASASHDK++KLWK
Sbjct  916  ENKTMTLPAHDGQIAALAVSTVTGTVASASHDKLVKLWK  954



>gb|KDP32298.1| hypothetical protein JCGZ_13223 [Jatropha curcas]
Length=935

 Score =   285 bits (730),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 130/160 (81%), Positives = 145/160 (91%), Gaps = 0/160 (0%)
 Frame = -1

Query  732  TRAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGE  553
            +R FKGGTAQ+RFQPR+GRYLAAAAENVVSILDVETQ CR +L+GHTKPIHSVCWDPSGE
Sbjct  765  SRVFKGGTAQMRFQPRMGRYLAAAAENVVSILDVETQVCRHSLQGHTKPIHSVCWDPSGE  824

Query  552  HLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNM  373
            +LASVSEDSVRVW LGSG+EG  VH+L+ NGNKFHSCVFHP+Y SLLV+GCYQSLELW M
Sbjct  825  YLASVSEDSVRVWRLGSGSEGEFVHDLTCNGNKFHSCVFHPTYPSLLVLGCYQSLELWKM  884

Query  372  TENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            TENKTM+L AHEGLIA+LA+S V GLVAS  HDK +KLWK
Sbjct  885  TENKTMSLSAHEGLIAALAISPVTGLVASVGHDKFVKLWK  924



>ref|XP_009377500.1| PREDICTED: transcriptional corepressor LEUNIG isoform X6 [Pyrus 
x bretschneideri]
Length=816

 Score =   283 bits (724),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 132/153 (86%), Positives = 143/153 (93%), Gaps = 0/153 (0%)
 Frame = -1

Query  720  KGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLAS  541
            KGGTAQ+RFQPRLGR+LAAAAENVVSILDVETQ CR +L+GHTKPIHSVCWDPSGE LAS
Sbjct  652  KGGTAQMRFQPRLGRFLAAAAENVVSILDVETQNCRHSLQGHTKPIHSVCWDPSGEFLAS  711

Query  540  VSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENK  361
            VSEDSVRVWTLG+G EG CVHELS NGNKFHSCVFHP+Y+SLLVIGCYQSLELWNMTENK
Sbjct  712  VSEDSVRVWTLGAGGEGECVHELSCNGNKFHSCVFHPTYTSLLVIGCYQSLELWNMTENK  771

Query  360  TMTLPAHEGLIASLAVSTVAGLVASASHDKIIK  262
            TMTL AH+GLIA+L+VSTV GLVASASHD + K
Sbjct  772  TMTLSAHDGLIAALSVSTVTGLVASASHDNLSK  804



>ref|XP_004501292.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X3 
[Cicer arietinum]
Length=888

 Score =   284 bits (726),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 133/160 (83%), Positives = 144/160 (90%), Gaps = 0/160 (0%)
 Frame = -1

Query  732  TRAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGE  553
            TR  KGGT Q+RFQPRLGRYLAAAAEN+VSILDVETQ CR +LKGHTK I SVCWDPSGE
Sbjct  729  TRVSKGGTTQMRFQPRLGRYLAAAAENIVSILDVETQACRYSLKGHTKTIDSVCWDPSGE  788

Query  552  HLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNM  373
             LASVSEDSVR+WTLG+G+EG CVHELS NG+KFHSCVFHP+Y SLLVIGCYQSLELWNM
Sbjct  789  LLASVSEDSVRIWTLGTGSEGECVHELSCNGSKFHSCVFHPTYPSLLVIGCYQSLELWNM  848

Query  372  TENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
             ENKTMTL AH+GLI +L+VSTV GLVASASHDK IKLWK
Sbjct  849  AENKTMTLSAHDGLITALSVSTVNGLVASASHDKFIKLWK  888



>ref|XP_004501290.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X1 
[Cicer arietinum]
Length=904

 Score =   284 bits (727),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 133/160 (83%), Positives = 144/160 (90%), Gaps = 0/160 (0%)
 Frame = -1

Query  732  TRAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGE  553
            TR  KGGT Q+RFQPRLGRYLAAAAEN+VSILDVETQ CR +LKGHTK I SVCWDPSGE
Sbjct  745  TRVSKGGTTQMRFQPRLGRYLAAAAENIVSILDVETQACRYSLKGHTKTIDSVCWDPSGE  804

Query  552  HLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNM  373
             LASVSEDSVR+WTLG+G+EG CVHELS NG+KFHSCVFHP+Y SLLVIGCYQSLELWNM
Sbjct  805  LLASVSEDSVRIWTLGTGSEGECVHELSCNGSKFHSCVFHPTYPSLLVIGCYQSLELWNM  864

Query  372  TENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
             ENKTMTL AH+GLI +L+VSTV GLVASASHDK IKLWK
Sbjct  865  AENKTMTLSAHDGLITALSVSTVNGLVASASHDKFIKLWK  904



>ref|XP_004501291.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X2 
[Cicer arietinum]
Length=897

 Score =   284 bits (726),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 133/160 (83%), Positives = 144/160 (90%), Gaps = 0/160 (0%)
 Frame = -1

Query  732  TRAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGE  553
            TR  KGGT Q+RFQPRLGRYLAAAAEN+VSILDVETQ CR +LKGHTK I SVCWDPSGE
Sbjct  738  TRVSKGGTTQMRFQPRLGRYLAAAAENIVSILDVETQACRYSLKGHTKTIDSVCWDPSGE  797

Query  552  HLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNM  373
             LASVSEDSVR+WTLG+G+EG CVHELS NG+KFHSCVFHP+Y SLLVIGCYQSLELWNM
Sbjct  798  LLASVSEDSVRIWTLGTGSEGECVHELSCNGSKFHSCVFHPTYPSLLVIGCYQSLELWNM  857

Query  372  TENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
             ENKTMTL AH+GLI +L+VSTV GLVASASHDK IKLWK
Sbjct  858  AENKTMTLSAHDGLITALSVSTVNGLVASASHDKFIKLWK  897



>ref|XP_009377497.1| PREDICTED: transcriptional corepressor LEUNIG isoform X3 [Pyrus 
x bretschneideri]
Length=906

 Score =   284 bits (726),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 132/153 (86%), Positives = 143/153 (93%), Gaps = 0/153 (0%)
 Frame = -1

Query  720  KGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLAS  541
            KGGTAQ+RFQPRLGR+LAAAAENVVSILDVETQ CR +L+GHTKPIHSVCWDPSGE LAS
Sbjct  742  KGGTAQMRFQPRLGRFLAAAAENVVSILDVETQNCRHSLQGHTKPIHSVCWDPSGEFLAS  801

Query  540  VSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENK  361
            VSEDSVRVWTLG+G EG CVHELS NGNKFHSCVFHP+Y+SLLVIGCYQSLELWNMTENK
Sbjct  802  VSEDSVRVWTLGAGGEGECVHELSCNGNKFHSCVFHPTYTSLLVIGCYQSLELWNMTENK  861

Query  360  TMTLPAHEGLIASLAVSTVAGLVASASHDKIIK  262
            TMTL AH+GLIA+L+VSTV GLVASASHD + K
Sbjct  862  TMTLSAHDGLIAALSVSTVTGLVASASHDNLSK  894



>ref|XP_009377494.1| PREDICTED: transcriptional corepressor LEUNIG isoform X1 [Pyrus 
x bretschneideri]
Length=915

 Score =   284 bits (727),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 132/153 (86%), Positives = 143/153 (93%), Gaps = 0/153 (0%)
 Frame = -1

Query  720  KGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLAS  541
            KGGTAQ+RFQPRLGR+LAAAAENVVSILDVETQ CR +L+GHTKPIHSVCWDPSGE LAS
Sbjct  751  KGGTAQMRFQPRLGRFLAAAAENVVSILDVETQNCRHSLQGHTKPIHSVCWDPSGEFLAS  810

Query  540  VSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENK  361
            VSEDSVRVWTLG+G EG CVHELS NGNKFHSCVFHP+Y+SLLVIGCYQSLELWNMTENK
Sbjct  811  VSEDSVRVWTLGAGGEGECVHELSCNGNKFHSCVFHPTYTSLLVIGCYQSLELWNMTENK  870

Query  360  TMTLPAHEGLIASLAVSTVAGLVASASHDKIIK  262
            TMTL AH+GLIA+L+VSTV GLVASASHD + K
Sbjct  871  TMTLSAHDGLIAALSVSTVTGLVASASHDNLSK  903



>ref|XP_009377498.1| PREDICTED: transcriptional corepressor LEUNIG isoform X4 [Pyrus 
x bretschneideri]
Length=899

 Score =   284 bits (726),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 132/153 (86%), Positives = 143/153 (93%), Gaps = 0/153 (0%)
 Frame = -1

Query  720  KGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLAS  541
            KGGTAQ+RFQPRLGR+LAAAAENVVSILDVETQ CR +L+GHTKPIHSVCWDPSGE LAS
Sbjct  735  KGGTAQMRFQPRLGRFLAAAAENVVSILDVETQNCRHSLQGHTKPIHSVCWDPSGEFLAS  794

Query  540  VSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENK  361
            VSEDSVRVWTLG+G EG CVHELS NGNKFHSCVFHP+Y+SLLVIGCYQSLELWNMTENK
Sbjct  795  VSEDSVRVWTLGAGGEGECVHELSCNGNKFHSCVFHPTYTSLLVIGCYQSLELWNMTENK  854

Query  360  TMTLPAHEGLIASLAVSTVAGLVASASHDKIIK  262
            TMTL AH+GLIA+L+VSTV GLVASASHD + K
Sbjct  855  TMTLSAHDGLIAALSVSTVTGLVASASHDNLSK  887



>ref|XP_012089282.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X2 
[Jatropha curcas]
Length=273

 Score =   267 bits (683),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 120/159 (75%), Positives = 142/159 (89%), Gaps = 0/159 (0%)
 Frame = -1

Query  732  TRAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGE  553
            + AFKGGTA +RFQPRLGRYLAAA EN V+++DVETQ C  +L+GH KPIH VCWDPSGE
Sbjct  114  SEAFKGGTALIRFQPRLGRYLAAAEENFVAVIDVETQACLHSLEGHVKPIHFVCWDPSGE  173

Query  552  HLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNM  373
            ++ASVSED+VR+WT+GSGNEG C+HELSS+ N+FHSCVFHP+  SLL+IGCYQ+L++WNM
Sbjct  174  YIASVSEDTVRIWTIGSGNEGECIHELSSDSNRFHSCVFHPTNPSLLIIGCYQTLKIWNM  233

Query  372  TENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLW  256
             ENKT+TLPAHEGLIASLAVSTV  LVASASHDK +KLW
Sbjct  234  IENKTVTLPAHEGLIASLAVSTVNRLVASASHDKFVKLW  272



>ref|XP_012089280.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X1 
[Jatropha curcas]
 gb|KDP23675.1| hypothetical protein JCGZ_23508 [Jatropha curcas]
Length=299

 Score =   267 bits (683),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 120/159 (75%), Positives = 142/159 (89%), Gaps = 0/159 (0%)
 Frame = -1

Query  732  TRAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGE  553
            + AFKGGTA +RFQPRLGRYLAAA EN V+++DVETQ C  +L+GH KPIH VCWDPSGE
Sbjct  140  SEAFKGGTALIRFQPRLGRYLAAAEENFVAVIDVETQACLHSLEGHVKPIHFVCWDPSGE  199

Query  552  HLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNM  373
            ++ASVSED+VR+WT+GSGNEG C+HELSS+ N+FHSCVFHP+  SLL+IGCYQ+L++WNM
Sbjct  200  YIASVSEDTVRIWTIGSGNEGECIHELSSDSNRFHSCVFHPTNPSLLIIGCYQTLKIWNM  259

Query  372  TENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLW  256
             ENKT+TLPAHEGLIASLAVSTV  LVASASHDK +KLW
Sbjct  260  IENKTVTLPAHEGLIASLAVSTVNRLVASASHDKFVKLW  298



>ref|XP_010049010.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X3 
[Eucalyptus grandis]
Length=299

 Score =   267 bits (683),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 124/159 (78%), Positives = 142/159 (89%), Gaps = 0/159 (0%)
 Frame = -1

Query  729  RAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEH  550
            R F+GGTAQ+RFQPRLG YLAAAA+NV+SILDVETQ CRQTL+GHTK I SVCWD +G+ 
Sbjct  141  RVFRGGTAQLRFQPRLGMYLAAAADNVLSILDVETQACRQTLQGHTKAIDSVCWDSTGDL  200

Query  549  LASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMT  370
            +ASVSEDSVRVW +GSG+E +CVHELS NGNK HSCVFHP+Y SLLVIGC+Q+LELWNM 
Sbjct  201  VASVSEDSVRVWAVGSGSEWDCVHELSCNGNKAHSCVFHPTYPSLLVIGCHQTLELWNMA  260

Query  369  ENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            ENKTM LPAH+GLI++LAVS V GLVASASHDK +KLWK
Sbjct  261  ENKTMALPAHDGLISALAVSNVTGLVASASHDKTVKLWK  299



>ref|XP_006371728.1| LEUNIG family protein [Populus trichocarpa]
 gb|ERP49525.1| LEUNIG family protein [Populus trichocarpa]
Length=953

 Score =   283 bits (725),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 130/160 (81%), Positives = 146/160 (91%), Gaps = 0/160 (0%)
 Frame = -1

Query  732  TRAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGE  553
            TR FKG  A++RFQPR G+YLAAAAENVVSILDVETQ CR +L+GHTK IHSVCWDPSGE
Sbjct  794  TRVFKGDMARMRFQPRAGKYLAAAAENVVSILDVETQACRHSLQGHTKAIHSVCWDPSGE  853

Query  552  HLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNM  373
            +LASVSEDSVRVWTLGSG+EG CVHELS NGN+FHSCVFHP++ SLLVIGCYQSLELWNM
Sbjct  854  YLASVSEDSVRVWTLGSGSEGECVHELSCNGNEFHSCVFHPTFPSLLVIGCYQSLELWNM  913

Query  372  TENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            +ENKTMTL AH+G IA+LAVSTV G++ASASHDK +KLWK
Sbjct  914  SENKTMTLAAHDGQIAALAVSTVTGMLASASHDKFVKLWK  953



>ref|XP_010049009.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X2 
[Eucalyptus grandis]
Length=322

 Score =   268 bits (685),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 124/159 (78%), Positives = 142/159 (89%), Gaps = 0/159 (0%)
 Frame = -1

Query  729  RAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEH  550
            R F+GGTAQ+RFQPRLG YLAAAA+NV+SILDVETQ CRQTL+GHTK I SVCWD +G+ 
Sbjct  164  RVFRGGTAQLRFQPRLGMYLAAAADNVLSILDVETQACRQTLQGHTKAIDSVCWDSTGDL  223

Query  549  LASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMT  370
            +ASVSEDSVRVW +GSG+E +CVHELS NGNK HSCVFHP+Y SLLVIGC+Q+LELWNM 
Sbjct  224  VASVSEDSVRVWAVGSGSEWDCVHELSCNGNKAHSCVFHPTYPSLLVIGCHQTLELWNMA  283

Query  369  ENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            ENKTM LPAH+GLI++LAVS V GLVASASHDK +KLWK
Sbjct  284  ENKTMALPAHDGLISALAVSNVTGLVASASHDKTVKLWK  322



>ref|XP_003522634.1| PREDICTED: transcriptional corepressor LEUNIG-like isoformX2 
[Glycine max]
Length=903

 Score =   283 bits (723),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 132/159 (83%), Positives = 142/159 (89%), Gaps = 0/159 (0%)
 Frame = -1

Query  729  RAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEH  550
            R  KGGT Q+RFQPRLGRYLAAAAEN+VSI DVETQ CR +LKGHTKP+  VCWDPSGE 
Sbjct  745  RVSKGGTTQMRFQPRLGRYLAAAAENIVSIFDVETQACRYSLKGHTKPVDCVCWDPSGEL  804

Query  549  LASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMT  370
            LASVSEDSVRVWTLGSG+EG CVHELS NGNKFH+ VFHP+Y SLLVIGCYQSLELWNM+
Sbjct  805  LASVSEDSVRVWTLGSGSEGECVHELSCNGNKFHASVFHPTYPSLLVIGCYQSLELWNMS  864

Query  369  ENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            ENKTMTL AH+GLI SLAVSTV GLVASASHDK +KLWK
Sbjct  865  ENKTMTLSAHDGLITSLAVSTVNGLVASASHDKFLKLWK  903



>gb|KFK29865.1| hypothetical protein AALP_AA7G189100 [Arabis alpina]
Length=926

 Score =   283 bits (723),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 127/160 (79%), Positives = 146/160 (91%), Gaps = 0/160 (0%)
 Frame = -1

Query  732  TRAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGE  553
            TR +KGG+ QVRFQPR+G+YLAA+A NVVS+LDVETQ CR +L+GH+ PI+SVCWDPSG+
Sbjct  767  TRVYKGGSTQVRFQPRVGKYLAASAANVVSVLDVETQACRHSLQGHSNPINSVCWDPSGD  826

Query  552  HLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNM  373
             LASVSED V+VWTLG+G+EG CVHELS NGNKF SCVFHP+Y SLLVIGCYQSLELWNM
Sbjct  827  FLASVSEDMVKVWTLGTGSEGECVHELSCNGNKFQSCVFHPAYPSLLVIGCYQSLELWNM  886

Query  372  TENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            +ENKTMTLPAH+GLIASLAVST  GLVASASHDK++KLWK
Sbjct  887  SENKTMTLPAHDGLIASLAVSTATGLVASASHDKLVKLWK  926



>ref|XP_003522633.1| PREDICTED: transcriptional corepressor LEUNIG-like isoformX1 
[Glycine max]
Length=912

 Score =   282 bits (722),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 132/159 (83%), Positives = 142/159 (89%), Gaps = 0/159 (0%)
 Frame = -1

Query  729  RAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEH  550
            R  KGGT Q+RFQPRLGRYLAAAAEN+VSI DVETQ CR +LKGHTKP+  VCWDPSGE 
Sbjct  754  RVSKGGTTQMRFQPRLGRYLAAAAENIVSIFDVETQACRYSLKGHTKPVDCVCWDPSGEL  813

Query  549  LASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMT  370
            LASVSEDSVRVWTLGSG+EG CVHELS NGNKFH+ VFHP+Y SLLVIGCYQSLELWNM+
Sbjct  814  LASVSEDSVRVWTLGSGSEGECVHELSCNGNKFHASVFHPTYPSLLVIGCYQSLELWNMS  873

Query  369  ENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            ENKTMTL AH+GLI SLAVSTV GLVASASHDK +KLWK
Sbjct  874  ENKTMTLSAHDGLITSLAVSTVNGLVASASHDKFLKLWK  912



>ref|XP_006578171.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X3 
[Glycine max]
Length=907

 Score =   282 bits (721),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 132/159 (83%), Positives = 142/159 (89%), Gaps = 0/159 (0%)
 Frame = -1

Query  729  RAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEH  550
            R  KGGT Q+RFQPRLGRYLAAAAEN+VSI DVETQ CR +LKGHTKP+  VCWDPSGE 
Sbjct  749  RVSKGGTTQMRFQPRLGRYLAAAAENIVSIFDVETQACRYSLKGHTKPVDCVCWDPSGEL  808

Query  549  LASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMT  370
            LASVSEDSVRVWTLGSG+EG CVHELS NGNKFH+ VFHP+Y SLLVIGCYQSLELWNM+
Sbjct  809  LASVSEDSVRVWTLGSGSEGECVHELSCNGNKFHASVFHPTYPSLLVIGCYQSLELWNMS  868

Query  369  ENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            ENKTMTL AH+GLI SLAVSTV GLVASASHDK +KLWK
Sbjct  869  ENKTMTLSAHDGLITSLAVSTVNGLVASASHDKFLKLWK  907



>ref|XP_010049007.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X1 
[Eucalyptus grandis]
 ref|XP_010049008.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X1 
[Eucalyptus grandis]
Length=325

 Score =   267 bits (682),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 124/159 (78%), Positives = 142/159 (89%), Gaps = 0/159 (0%)
 Frame = -1

Query  729  RAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEH  550
            R F+GGTAQ+RFQPRLG YLAAAA+NV+SILDVETQ CRQTL+GHTK I SVCWD +G+ 
Sbjct  167  RVFRGGTAQLRFQPRLGMYLAAAADNVLSILDVETQACRQTLQGHTKAIDSVCWDSTGDL  226

Query  549  LASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMT  370
            +ASVSEDSVRVW +GSG+E +CVHELS NGNK HSCVFHP+Y SLLVIGC+Q+LELWNM 
Sbjct  227  VASVSEDSVRVWAVGSGSEWDCVHELSCNGNKAHSCVFHPTYPSLLVIGCHQTLELWNMA  286

Query  369  ENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            ENKTM LPAH+GLI++LAVS V GLVASASHDK +KLWK
Sbjct  287  ENKTMALPAHDGLISALAVSNVTGLVASASHDKTVKLWK  325



>emb|CDX72364.1| BnaC07g43860D [Brassica napus]
Length=694

 Score =   277 bits (708),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 123/160 (77%), Positives = 144/160 (90%), Gaps = 0/160 (0%)
 Frame = -1

Query  732  TRAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGE  553
            TR +KGG+ Q+RFQPR+G+YLAA++ NVVS+LDVETQ CR +L+GH  PI+SVCWDPSG+
Sbjct  535  TRVYKGGSTQMRFQPRVGKYLAASSSNVVSVLDVETQACRHSLQGHANPINSVCWDPSGD  594

Query  552  HLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNM  373
             LA+VSED V+VWTLG+G+EG C+HELS NGNKF SCVFHP+Y SLLVIGCYQSLELWNM
Sbjct  595  FLATVSEDMVKVWTLGTGSEGECIHELSCNGNKFSSCVFHPTYPSLLVIGCYQSLELWNM  654

Query  372  TENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            +ENKTM LPAHEGLIASLAVST  GLVASASHDK++KLWK
Sbjct  655  SENKTMALPAHEGLIASLAVSTATGLVASASHDKLVKLWK  694



>ref|XP_009138136.1| PREDICTED: transcriptional corepressor LEUNIG-like [Brassica 
rapa]
Length=902

 Score =   281 bits (718),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 125/160 (78%), Positives = 145/160 (91%), Gaps = 0/160 (0%)
 Frame = -1

Query  732  TRAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGE  553
            TR +KGG+ Q+RFQPR+G+YLAA++ NVVS+LDVETQ CR +L+GHT PI+SVCWDPSG+
Sbjct  743  TRVYKGGSTQMRFQPRVGKYLAASSSNVVSVLDVETQACRHSLQGHTNPINSVCWDPSGD  802

Query  552  HLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNM  373
             LA+VSED V+VWTLG+G+EG CVHELS NGNKF SCVFHP+Y SLLVIGCYQSLELWNM
Sbjct  803  FLATVSEDMVKVWTLGTGSEGECVHELSCNGNKFQSCVFHPTYPSLLVIGCYQSLELWNM  862

Query  372  TENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            +ENKTM LPAHEGLIASLAVST  GLVASASHDK++KLWK
Sbjct  863  SENKTMALPAHEGLIASLAVSTATGLVASASHDKLVKLWK  902



>emb|CDY13494.1| BnaA03g52120D [Brassica napus]
Length=887

 Score =   280 bits (715),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 125/160 (78%), Positives = 145/160 (91%), Gaps = 0/160 (0%)
 Frame = -1

Query  732  TRAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGE  553
            TR +KGG+ Q+RFQPR+G+YLAA++ NVVS+LDVETQ CR +L+GHT PI+SVCWDPSG+
Sbjct  728  TRVYKGGSTQMRFQPRVGKYLAASSSNVVSVLDVETQACRHSLQGHTNPINSVCWDPSGD  787

Query  552  HLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNM  373
             LA+VSED V+VWTLG+G+EG CVHELS NGNKF SCVFHP+Y SLLVIGCYQSLELWNM
Sbjct  788  FLATVSEDMVKVWTLGTGSEGECVHELSCNGNKFQSCVFHPTYPSLLVIGCYQSLELWNM  847

Query  372  TENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            +ENKTM LPAHEGLIASLAVST  GLVASASHDK++KLWK
Sbjct  848  SENKTMALPAHEGLIASLAVSTATGLVASASHDKLVKLWK  887



>ref|XP_006581384.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X3 
[Glycine max]
Length=883

 Score =   280 bits (715),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 131/159 (82%), Positives = 141/159 (89%), Gaps = 0/159 (0%)
 Frame = -1

Query  729  RAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEH  550
            R  KGGT Q+RFQPRLGRYLAAAAEN+VSI DVETQ CR +LKGHTKP+  VCWDPSGE 
Sbjct  725  RVSKGGTTQMRFQPRLGRYLAAAAENIVSIFDVETQVCRYSLKGHTKPVVCVCWDPSGEL  784

Query  549  LASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMT  370
            LASVSEDSVRVWTLGSG++G CVHELS NGNKFH  VFHP+Y SLLVIGCYQSLELWNM+
Sbjct  785  LASVSEDSVRVWTLGSGSDGECVHELSCNGNKFHKSVFHPTYPSLLVIGCYQSLELWNMS  844

Query  369  ENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            ENKTMTL AH+GLI SLAVSTV GLVASASHDK +KLWK
Sbjct  845  ENKTMTLSAHDGLITSLAVSTVNGLVASASHDKFLKLWK  883



>gb|KJB83302.1| hypothetical protein B456_013G240700 [Gossypium raimondii]
 gb|KJB83307.1| hypothetical protein B456_013G240700 [Gossypium raimondii]
Length=941

 Score =   280 bits (717),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 134/163 (82%), Positives = 145/163 (89%), Gaps = 4/163 (2%)
 Frame = -1

Query  729  RAFKGGTA----QVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDP  562
            RAFKGGTA    Q+RFQPRLG+YLAAAAENVVSILD ETQTCR +L+GHTK IHSVCWDP
Sbjct  779  RAFKGGTAPGTAQLRFQPRLGKYLAAAAENVVSILDTETQTCRHSLQGHTKLIHSVCWDP  838

Query  561  SGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLEL  382
            SGE LASVSEDSVRVW+  SG+EG CVHELS NGNKFHSCVFHPS+ SLLVIGCYQSLEL
Sbjct  839  SGELLASVSEDSVRVWSFASGSEGECVHELSCNGNKFHSCVFHPSFQSLLVIGCYQSLEL  898

Query  381  WNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            WNM+ENKTMTL AHEGLIA+LAVS V  LV+SASHDK +KLWK
Sbjct  899  WNMSENKTMTLSAHEGLIAALAVSPVTRLVSSASHDKFVKLWK  941



>ref|XP_010670737.1| PREDICTED: transcriptional corepressor LEUNIG [Beta vulgaris 
subsp. vulgaris]
Length=930

 Score =   280 bits (716),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 128/159 (81%), Positives = 143/159 (90%), Gaps = 0/159 (0%)
 Frame = -1

Query  729  RAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEH  550
            R FKGG+ Q+RFQPR GRYLAAAAENV+SILDVETQ C+  L+GHTK IHSVCWD SGE 
Sbjct  772  RVFKGGSTQIRFQPRHGRYLAAAAENVISILDVETQACQHRLQGHTKQIHSVCWDTSGEF  831

Query  549  LASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMT  370
            LASVSEDSVRVW+LG GNEG CVHELS NGNKF+SC FHP+YSSLLVIGCYQS+ELWNM+
Sbjct  832  LASVSEDSVRVWSLGLGNEGECVHELSCNGNKFYSCAFHPTYSSLLVIGCYQSMELWNMS  891

Query  369  ENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            ENKTMTL AH+GLIA+L+VS+V GLVASASHDK +KLWK
Sbjct  892  ENKTMTLSAHDGLIAALSVSSVTGLVASASHDKFVKLWK  930



>gb|KJB83312.1| hypothetical protein B456_013G240700 [Gossypium raimondii]
Length=935

 Score =   280 bits (716),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 134/163 (82%), Positives = 145/163 (89%), Gaps = 4/163 (2%)
 Frame = -1

Query  729  RAFKGGTA----QVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDP  562
            RAFKGGTA    Q+RFQPRLG+YLAAAAENVVSILD ETQTCR +L+GHTK IHSVCWDP
Sbjct  773  RAFKGGTAPGTAQLRFQPRLGKYLAAAAENVVSILDTETQTCRHSLQGHTKLIHSVCWDP  832

Query  561  SGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLEL  382
            SGE LASVSEDSVRVW+  SG+EG CVHELS NGNKFHSCVFHPS+ SLLVIGCYQSLEL
Sbjct  833  SGELLASVSEDSVRVWSFASGSEGECVHELSCNGNKFHSCVFHPSFQSLLVIGCYQSLEL  892

Query  381  WNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            WNM+ENKTMTL AHEGLIA+LAVS V  LV+SASHDK +KLWK
Sbjct  893  WNMSENKTMTLSAHEGLIAALAVSPVTRLVSSASHDKFVKLWK  935



>gb|KJB83300.1| hypothetical protein B456_013G240700 [Gossypium raimondii]
 gb|KJB83310.1| hypothetical protein B456_013G240700 [Gossypium raimondii]
Length=936

 Score =   280 bits (716),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 134/163 (82%), Positives = 145/163 (89%), Gaps = 4/163 (2%)
 Frame = -1

Query  729  RAFKGGTA----QVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDP  562
            RAFKGGTA    Q+RFQPRLG+YLAAAAENVVSILD ETQTCR +L+GHTK IHSVCWDP
Sbjct  774  RAFKGGTAPGTAQLRFQPRLGKYLAAAAENVVSILDTETQTCRHSLQGHTKLIHSVCWDP  833

Query  561  SGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLEL  382
            SGE LASVSEDSVRVW+  SG+EG CVHELS NGNKFHSCVFHPS+ SLLVIGCYQSLEL
Sbjct  834  SGELLASVSEDSVRVWSFASGSEGECVHELSCNGNKFHSCVFHPSFQSLLVIGCYQSLEL  893

Query  381  WNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            WNM+ENKTMTL AHEGLIA+LAVS V  LV+SASHDK +KLWK
Sbjct  894  WNMSENKTMTLSAHEGLIAALAVSPVTRLVSSASHDKFVKLWK  936



>ref|XP_006581383.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X2 
[Glycine max]
Length=887

 Score =   279 bits (714),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 131/159 (82%), Positives = 141/159 (89%), Gaps = 0/159 (0%)
 Frame = -1

Query  729  RAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEH  550
            R  KGGT Q+RFQPRLGRYLAAAAEN+VSI DVETQ CR +LKGHTKP+  VCWDPSGE 
Sbjct  729  RVSKGGTTQMRFQPRLGRYLAAAAENIVSIFDVETQVCRYSLKGHTKPVVCVCWDPSGEL  788

Query  549  LASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMT  370
            LASVSEDSVRVWTLGSG++G CVHELS NGNKFH  VFHP+Y SLLVIGCYQSLELWNM+
Sbjct  789  LASVSEDSVRVWTLGSGSDGECVHELSCNGNKFHKSVFHPTYPSLLVIGCYQSLELWNMS  848

Query  369  ENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            ENKTMTL AH+GLI SLAVSTV GLVASASHDK +KLWK
Sbjct  849  ENKTMTLSAHDGLITSLAVSTVNGLVASASHDKFLKLWK  887



>ref|XP_010914979.1| PREDICTED: transcriptional corepressor LEUNIG-like [Elaeis guineensis]
Length=772

 Score =   277 bits (708),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 129/157 (82%), Positives = 140/157 (89%), Gaps = 0/157 (0%)
 Frame = -1

Query  723  FKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLA  544
            FKGGT Q+RFQP LGRYLAAAAENVVSILDVETQ C  +L+GHTK + SVCWDP+G+ L 
Sbjct  616  FKGGTTQMRFQPHLGRYLAAAAENVVSILDVETQACLHSLEGHTKHVDSVCWDPTGQLLV  675

Query  543  SVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTEN  364
            SVSEDSVRVW+L SGNEG CVHELS NGNKFHSCVFHPSY SLLVIGCYQSLELW+M EN
Sbjct  676  SVSEDSVRVWSLSSGNEGECVHELSCNGNKFHSCVFHPSYPSLLVIGCYQSLELWDMDEN  735

Query  363  KTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            KTMTLPAHEGLIA+LAVS V GLVASASHDK +KLW+
Sbjct  736  KTMTLPAHEGLIAALAVSNVNGLVASASHDKFVKLWR  772



>ref|XP_003526430.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X1 
[Glycine max]
Length=892

 Score =   279 bits (713),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 131/159 (82%), Positives = 141/159 (89%), Gaps = 0/159 (0%)
 Frame = -1

Query  729  RAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEH  550
            R  KGGT Q+RFQPRLGRYLAAAAEN+VSI DVETQ CR +LKGHTKP+  VCWDPSGE 
Sbjct  734  RVSKGGTTQMRFQPRLGRYLAAAAENIVSIFDVETQVCRYSLKGHTKPVVCVCWDPSGEL  793

Query  549  LASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMT  370
            LASVSEDSVRVWTLGSG++G CVHELS NGNKFH  VFHP+Y SLLVIGCYQSLELWNM+
Sbjct  794  LASVSEDSVRVWTLGSGSDGECVHELSCNGNKFHKSVFHPTYPSLLVIGCYQSLELWNMS  853

Query  369  ENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            ENKTMTL AH+GLI SLAVSTV GLVASASHDK +KLWK
Sbjct  854  ENKTMTLSAHDGLITSLAVSTVNGLVASASHDKFLKLWK  892



>gb|KJB83314.1| hypothetical protein B456_013G240700 [Gossypium raimondii]
Length=945

 Score =   280 bits (715),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 134/163 (82%), Positives = 145/163 (89%), Gaps = 4/163 (2%)
 Frame = -1

Query  729  RAFKGGTA----QVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDP  562
            RAFKGGTA    Q+RFQPRLG+YLAAAAENVVSILD ETQTCR +L+GHTK IHSVCWDP
Sbjct  783  RAFKGGTAPGTAQLRFQPRLGKYLAAAAENVVSILDTETQTCRHSLQGHTKLIHSVCWDP  842

Query  561  SGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLEL  382
            SGE LASVSEDSVRVW+  SG+EG CVHELS NGNKFHSCVFHPS+ SLLVIGCYQSLEL
Sbjct  843  SGELLASVSEDSVRVWSFASGSEGECVHELSCNGNKFHSCVFHPSFQSLLVIGCYQSLEL  902

Query  381  WNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            WNM+ENKTMTL AHEGLIA+LAVS V  LV+SASHDK +KLWK
Sbjct  903  WNMSENKTMTLSAHEGLIAALAVSPVTRLVSSASHDKFVKLWK  945



>gb|KJB83304.1| hypothetical protein B456_013G240700 [Gossypium raimondii]
 gb|KJB83309.1| hypothetical protein B456_013G240700 [Gossypium raimondii]
Length=950

 Score =   280 bits (715),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 134/163 (82%), Positives = 145/163 (89%), Gaps = 4/163 (2%)
 Frame = -1

Query  729  RAFKGGTA----QVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDP  562
            RAFKGGTA    Q+RFQPRLG+YLAAAAENVVSILD ETQTCR +L+GHTK IHSVCWDP
Sbjct  788  RAFKGGTAPGTAQLRFQPRLGKYLAAAAENVVSILDTETQTCRHSLQGHTKLIHSVCWDP  847

Query  561  SGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLEL  382
            SGE LASVSEDSVRVW+  SG+EG CVHELS NGNKFHSCVFHPS+ SLLVIGCYQSLEL
Sbjct  848  SGELLASVSEDSVRVWSFASGSEGECVHELSCNGNKFHSCVFHPSFQSLLVIGCYQSLEL  907

Query  381  WNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            WNM+ENKTMTL AHEGLIA+LAVS V  LV+SASHDK +KLWK
Sbjct  908  WNMSENKTMTLSAHEGLIAALAVSPVTRLVSSASHDKFVKLWK  950



>emb|CDY23331.1| BnaA08g12150D [Brassica napus]
Length=912

 Score =   278 bits (711),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 125/160 (78%), Positives = 144/160 (90%), Gaps = 0/160 (0%)
 Frame = -1

Query  732  TRAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGE  553
            TR +KGG+ Q+RFQPR+G+YLAA++ NVVS+LDVETQ CR +L+GH   I+SVCWDPSG+
Sbjct  753  TRVYKGGSTQLRFQPRVGKYLAASSANVVSVLDVETQACRHSLQGHANQINSVCWDPSGD  812

Query  552  HLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNM  373
             LASVSED V+VWTLG+G+EG CVHELS NGNKF SCVFHP+Y SLLVIGCYQSLELWNM
Sbjct  813  FLASVSEDMVKVWTLGTGSEGECVHELSCNGNKFQSCVFHPTYPSLLVIGCYQSLELWNM  872

Query  372  TENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            +ENKTMTLPAHEGLIASLAVST  GLVASASHDK++KLWK
Sbjct  873  SENKTMTLPAHEGLIASLAVSTATGLVASASHDKLVKLWK  912



>emb|CDY51674.1| BnaC03g67130D [Brassica napus]
Length=884

 Score =   278 bits (710),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 125/160 (78%), Positives = 144/160 (90%), Gaps = 0/160 (0%)
 Frame = -1

Query  732  TRAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGE  553
            TR +KGG+ Q+RFQPR+G+YLAA++ NVVS+LDVETQ CR +L+GH   I+SVCWDPSG+
Sbjct  725  TRVYKGGSTQLRFQPRVGKYLAASSANVVSVLDVETQACRHSLQGHANQINSVCWDPSGD  784

Query  552  HLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNM  373
             LASVSED V+VWTLG+G+EG CVHELS NGNKF SCVFHP+Y SLLVIGCYQSLELWNM
Sbjct  785  FLASVSEDMVKVWTLGTGSEGECVHELSCNGNKFQSCVFHPTYPSLLVIGCYQSLELWNM  844

Query  372  TENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            +ENKTMTLPAHEGLIASLAVST  GLVASASHDK++KLWK
Sbjct  845  SENKTMTLPAHEGLIASLAVSTATGLVASASHDKLVKLWK  884



>ref|XP_006412457.1| hypothetical protein EUTSA_v10024343mg [Eutrema salsugineum]
 gb|ESQ53910.1| hypothetical protein EUTSA_v10024343mg [Eutrema salsugineum]
Length=917

 Score =   278 bits (710),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 125/160 (78%), Positives = 144/160 (90%), Gaps = 0/160 (0%)
 Frame = -1

Query  732  TRAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGE  553
            TR +KGG+ Q+RFQPR+G+YLAA++ NVVS+LDVETQ CR +L+GH   I+SVCWDPSG+
Sbjct  758  TRVYKGGSTQMRFQPRVGKYLAASSANVVSVLDVETQACRHSLQGHANSINSVCWDPSGD  817

Query  552  HLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNM  373
             LASVSED V+VWTLG+G+EG CVHELS NGNKF SCVFHP+Y SLLVIGCYQSLELWNM
Sbjct  818  FLASVSEDMVKVWTLGTGSEGECVHELSCNGNKFQSCVFHPTYPSLLVIGCYQSLELWNM  877

Query  372  TENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            +ENKTMTLPAHEGLIASLAVST  GLVASASHDK++KLWK
Sbjct  878  SENKTMTLPAHEGLIASLAVSTATGLVASASHDKLVKLWK  917



>ref|XP_010915881.1| PREDICTED: transcriptional corepressor LEUNIG isoform X4 [Elaeis 
guineensis]
Length=891

 Score =   277 bits (709),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 127/159 (80%), Positives = 142/159 (89%), Gaps = 0/159 (0%)
 Frame = -1

Query  729  RAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEH  550
            R FKGGTAQ+RFQPR GRYLAAAA+N +SILDVETQ CR  LKGH K + SVCW+PSGE 
Sbjct  733  RVFKGGTAQMRFQPRQGRYLAAAADNAISILDVETQVCRNLLKGHRKHVDSVCWNPSGEL  792

Query  549  LASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMT  370
            LASVSEDSV+VW+LGSG+EG CVHE+S NG+KFHSCVFHP+Y SLLVIGCYQSLELW+M 
Sbjct  793  LASVSEDSVKVWSLGSGSEGECVHEMSCNGSKFHSCVFHPAYPSLLVIGCYQSLELWDMP  852

Query  369  ENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            ENKTMTLPAH+GLIA+LAVS V GLVASASHDK +KLWK
Sbjct  853  ENKTMTLPAHDGLIAALAVSNVTGLVASASHDKFVKLWK  891



>ref|XP_010915804.1| PREDICTED: transcriptional corepressor LEUNIG isoform X3 [Elaeis 
guineensis]
Length=895

 Score =   277 bits (709),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 127/159 (80%), Positives = 142/159 (89%), Gaps = 0/159 (0%)
 Frame = -1

Query  729  RAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEH  550
            R FKGGTAQ+RFQPR GRYLAAAA+N +SILDVETQ CR  LKGH K + SVCW+PSGE 
Sbjct  737  RVFKGGTAQMRFQPRQGRYLAAAADNAISILDVETQVCRNLLKGHRKHVDSVCWNPSGEL  796

Query  549  LASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMT  370
            LASVSEDSV+VW+LGSG+EG CVHE+S NG+KFHSCVFHP+Y SLLVIGCYQSLELW+M 
Sbjct  797  LASVSEDSVKVWSLGSGSEGECVHEMSCNGSKFHSCVFHPAYPSLLVIGCYQSLELWDMP  856

Query  369  ENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            ENKTMTLPAH+GLIA+LAVS V GLVASASHDK +KLWK
Sbjct  857  ENKTMTLPAHDGLIAALAVSNVTGLVASASHDKFVKLWK  895



>ref|XP_009108869.1| PREDICTED: transcriptional corepressor LEUNIG [Brassica rapa]
Length=908

 Score =   277 bits (709),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 125/160 (78%), Positives = 144/160 (90%), Gaps = 0/160 (0%)
 Frame = -1

Query  732  TRAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGE  553
            TR +KGG+ Q+RFQPR+G+YLAA++ NVVS+LDVETQ CR +L+GH   I+SVCWDPSG+
Sbjct  749  TRVYKGGSTQLRFQPRVGKYLAASSANVVSVLDVETQACRHSLQGHANQINSVCWDPSGD  808

Query  552  HLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNM  373
             LASVSED V+VWTLG+G+EG CVHELS NGNKF SCVFHP+Y SLLVIGCYQSLELWNM
Sbjct  809  FLASVSEDMVKVWTLGTGSEGECVHELSCNGNKFQSCVFHPTYPSLLVIGCYQSLELWNM  868

Query  372  TENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            +ENKTMTLPAHEGLIASLAVST  GLVASASHDK++KLWK
Sbjct  869  SENKTMTLPAHEGLIASLAVSTSTGLVASASHDKLVKLWK  908



>ref|XP_010915729.1| PREDICTED: transcriptional corepressor LEUNIG isoform X2 [Elaeis 
guineensis]
Length=901

 Score =   277 bits (708),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 127/159 (80%), Positives = 142/159 (89%), Gaps = 0/159 (0%)
 Frame = -1

Query  729  RAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEH  550
            R FKGGTAQ+RFQPR GRYLAAAA+N +SILDVETQ CR  LKGH K + SVCW+PSGE 
Sbjct  743  RVFKGGTAQMRFQPRQGRYLAAAADNAISILDVETQVCRNLLKGHRKHVDSVCWNPSGEL  802

Query  549  LASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMT  370
            LASVSEDSV+VW+LGSG+EG CVHE+S NG+KFHSCVFHP+Y SLLVIGCYQSLELW+M 
Sbjct  803  LASVSEDSVKVWSLGSGSEGECVHEMSCNGSKFHSCVFHPAYPSLLVIGCYQSLELWDMP  862

Query  369  ENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            ENKTMTLPAH+GLIA+LAVS V GLVASASHDK +KLWK
Sbjct  863  ENKTMTLPAHDGLIAALAVSNVTGLVASASHDKFVKLWK  901



>ref|XP_010915657.1| PREDICTED: transcriptional corepressor LEUNIG isoform X1 [Elaeis 
guineensis]
Length=904

 Score =   277 bits (708),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 127/159 (80%), Positives = 142/159 (89%), Gaps = 0/159 (0%)
 Frame = -1

Query  729  RAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEH  550
            R FKGGTAQ+RFQPR GRYLAAAA+N +SILDVETQ CR  LKGH K + SVCW+PSGE 
Sbjct  746  RVFKGGTAQMRFQPRQGRYLAAAADNAISILDVETQVCRNLLKGHRKHVDSVCWNPSGEL  805

Query  549  LASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMT  370
            LASVSEDSV+VW+LGSG+EG CVHE+S NG+KFHSCVFHP+Y SLLVIGCYQSLELW+M 
Sbjct  806  LASVSEDSVKVWSLGSGSEGECVHEMSCNGSKFHSCVFHPAYPSLLVIGCYQSLELWDMP  865

Query  369  ENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            ENKTMTLPAH+GLIA+LAVS V GLVASASHDK +KLWK
Sbjct  866  ENKTMTLPAHDGLIAALAVSNVTGLVASASHDKFVKLWK  904



>ref|XP_010447372.1| PREDICTED: transcriptional corepressor LEUNIG [Camelina sativa]
Length=925

 Score =   275 bits (704),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 123/160 (77%), Positives = 144/160 (90%), Gaps = 0/160 (0%)
 Frame = -1

Query  732  TRAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGE  553
            TR +KGG+ Q+RFQPR+G+YLAA++ N+V++LDVETQ  R +L+GH  PI+SVCWDPSG+
Sbjct  766  TRVYKGGSTQMRFQPRVGKYLAASSANLVNVLDVETQAIRHSLQGHANPINSVCWDPSGD  825

Query  552  HLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNM  373
             LASVSED V+VWTLG+G+EG CVHELS NGNKF SCVFHP+Y SLLVIGCYQSLELWNM
Sbjct  826  FLASVSEDMVKVWTLGTGSEGECVHELSCNGNKFQSCVFHPAYPSLLVIGCYQSLELWNM  885

Query  372  TENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            +ENKTMTLPAHEGLIASLAVST  GLVASASHDK++KLWK
Sbjct  886  SENKTMTLPAHEGLIASLAVSTATGLVASASHDKLVKLWK  925



>gb|KJB83301.1| hypothetical protein B456_013G240700 [Gossypium raimondii]
 gb|KJB83308.1| hypothetical protein B456_013G240700 [Gossypium raimondii]
Length=937

 Score =   275 bits (704),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 134/164 (82%), Positives = 145/164 (88%), Gaps = 5/164 (3%)
 Frame = -1

Query  729  RAFKGGTA----QVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLK-GHTKPIHSVCWD  565
            RAFKGGTA    Q+RFQPRLG+YLAAAAENVVSILD ETQTCR +L+ GHTK IHSVCWD
Sbjct  774  RAFKGGTAPGTAQLRFQPRLGKYLAAAAENVVSILDTETQTCRHSLQQGHTKLIHSVCWD  833

Query  564  PSGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLE  385
            PSGE LASVSEDSVRVW+  SG+EG CVHELS NGNKFHSCVFHPS+ SLLVIGCYQSLE
Sbjct  834  PSGELLASVSEDSVRVWSFASGSEGECVHELSCNGNKFHSCVFHPSFQSLLVIGCYQSLE  893

Query  384  LWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            LWNM+ENKTMTL AHEGLIA+LAVS V  LV+SASHDK +KLWK
Sbjct  894  LWNMSENKTMTLSAHEGLIAALAVSPVTRLVSSASHDKFVKLWK  937



>gb|KJB83303.1| hypothetical protein B456_013G240700 [Gossypium raimondii]
 gb|KJB83311.1| hypothetical protein B456_013G240700 [Gossypium raimondii]
Length=942

 Score =   275 bits (704),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 134/164 (82%), Positives = 145/164 (88%), Gaps = 5/164 (3%)
 Frame = -1

Query  729  RAFKGGTA----QVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLK-GHTKPIHSVCWD  565
            RAFKGGTA    Q+RFQPRLG+YLAAAAENVVSILD ETQTCR +L+ GHTK IHSVCWD
Sbjct  779  RAFKGGTAPGTAQLRFQPRLGKYLAAAAENVVSILDTETQTCRHSLQQGHTKLIHSVCWD  838

Query  564  PSGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLE  385
            PSGE LASVSEDSVRVW+  SG+EG CVHELS NGNKFHSCVFHPS+ SLLVIGCYQSLE
Sbjct  839  PSGELLASVSEDSVRVWSFASGSEGECVHELSCNGNKFHSCVFHPSFQSLLVIGCYQSLE  898

Query  384  LWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            LWNM+ENKTMTL AHEGLIA+LAVS V  LV+SASHDK +KLWK
Sbjct  899  LWNMSENKTMTLSAHEGLIAALAVSPVTRLVSSASHDKFVKLWK  942



>ref|XP_010432701.1| PREDICTED: transcriptional corepressor LEUNIG-like [Camelina 
sativa]
Length=941

 Score =   275 bits (704),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 123/160 (77%), Positives = 144/160 (90%), Gaps = 0/160 (0%)
 Frame = -1

Query  732  TRAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGE  553
            TR +KGG+ Q+RFQPR+G+YLAA++ N+V++LDVETQ  R +L+GH  PI+SVCWDPSG+
Sbjct  782  TRVYKGGSTQMRFQPRVGKYLAASSANLVNVLDVETQAIRHSLQGHANPINSVCWDPSGD  841

Query  552  HLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNM  373
             LASVSED V+VWTLG+G+EG CVHELS NGNKF SCVFHP+Y SLLVIGCYQSLELWNM
Sbjct  842  FLASVSEDMVKVWTLGTGSEGECVHELSCNGNKFQSCVFHPAYPSLLVIGCYQSLELWNM  901

Query  372  TENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            +ENKTMTLPAHEGLIASLAVST  GLVASASHDK++KLWK
Sbjct  902  SENKTMTLPAHEGLIASLAVSTATGLVASASHDKLVKLWK  941



>ref|XP_008811606.1| PREDICTED: LOW QUALITY PROTEIN: transcriptional corepressor LEUNIG 
[Phoenix dactylifera]
Length=911

 Score =   275 bits (703),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 128/159 (81%), Positives = 141/159 (89%), Gaps = 0/159 (0%)
 Frame = -1

Query  729  RAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEH  550
            R FKGGTAQ+RFQPR GRYLAAAA+N +SILDVETQ CRQ L+GH K + SVCW+PSGE 
Sbjct  753  RVFKGGTAQMRFQPRQGRYLAAAADNTISILDVETQACRQMLQGHRKHVDSVCWNPSGEL  812

Query  549  LASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMT  370
            LASVSEDSVRVW+LGSG+EG CVHELS NG+KFHSCVFHP+Y SLLVIGCYQSLELW+M 
Sbjct  813  LASVSEDSVRVWSLGSGSEGECVHELSCNGSKFHSCVFHPTYPSLLVIGCYQSLELWDMA  872

Query  369  ENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            EN T+TL AHEGLIA+LAVS V GLVASASHDK IKLWK
Sbjct  873  ENNTITLGAHEGLIAALAVSNVTGLVASASHDKFIKLWK  911



>gb|KCW81465.1| hypothetical protein EUGRSUZ_C028381, partial [Eucalyptus grandis]
 gb|KCW81466.1| hypothetical protein EUGRSUZ_C028381, partial [Eucalyptus grandis]
 gb|KCW81472.1| hypothetical protein EUGRSUZ_C028381, partial [Eucalyptus grandis]
 gb|KCW81473.1| hypothetical protein EUGRSUZ_C028381, partial [Eucalyptus grandis]
 gb|KCW81474.1| hypothetical protein EUGRSUZ_C028381, partial [Eucalyptus grandis]
 gb|KCW81475.1| hypothetical protein EUGRSUZ_C028381, partial [Eucalyptus grandis]
Length=899

 Score =   275 bits (702),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 126/160 (79%), Positives = 144/160 (90%), Gaps = 0/160 (0%)
 Frame = -1

Query  732  TRAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGE  553
            +R F+GGTAQ+RFQPRLGRYLAAAA+NV+SILDVETQ CRQTL+GHTK I SVCWD +G+
Sbjct  740  SRVFRGGTAQLRFQPRLGRYLAAAADNVLSILDVETQACRQTLQGHTKAIDSVCWDSTGD  799

Query  552  HLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNM  373
             +ASVSEDSVRVW +GSG+E +CVHELS NGNK HSCVFHP+Y SLLVIGCYQ+LELWNM
Sbjct  800  LVASVSEDSVRVWAVGSGSEWDCVHELSCNGNKAHSCVFHPTYPSLLVIGCYQTLELWNM  859

Query  372  TENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
             ENKTM LPAH+GLI++LAVS V GLVASASHDK +KLWK
Sbjct  860  AENKTMALPAHDGLISALAVSNVTGLVASASHDKTVKLWK  899



>gb|KJB83305.1| hypothetical protein B456_013G240700 [Gossypium raimondii]
 gb|KJB83306.1| hypothetical protein B456_013G240700 [Gossypium raimondii]
Length=951

 Score =   275 bits (703),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 134/164 (82%), Positives = 145/164 (88%), Gaps = 5/164 (3%)
 Frame = -1

Query  729  RAFKGGTA----QVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLK-GHTKPIHSVCWD  565
            RAFKGGTA    Q+RFQPRLG+YLAAAAENVVSILD ETQTCR +L+ GHTK IHSVCWD
Sbjct  788  RAFKGGTAPGTAQLRFQPRLGKYLAAAAENVVSILDTETQTCRHSLQQGHTKLIHSVCWD  847

Query  564  PSGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLE  385
            PSGE LASVSEDSVRVW+  SG+EG CVHELS NGNKFHSCVFHPS+ SLLVIGCYQSLE
Sbjct  848  PSGELLASVSEDSVRVWSFASGSEGECVHELSCNGNKFHSCVFHPSFQSLLVIGCYQSLE  907

Query  384  LWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            LWNM+ENKTMTL AHEGLIA+LAVS V  LV+SASHDK +KLWK
Sbjct  908  LWNMSENKTMTLSAHEGLIAALAVSPVTRLVSSASHDKFVKLWK  951



>ref|XP_010049005.1| PREDICTED: transcriptional corepressor LEUNIG [Eucalyptus grandis]
 ref|XP_010049006.1| PREDICTED: transcriptional corepressor LEUNIG [Eucalyptus grandis]
Length=910

 Score =   274 bits (701),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 126/160 (79%), Positives = 144/160 (90%), Gaps = 0/160 (0%)
 Frame = -1

Query  732  TRAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGE  553
            +R F+GGTAQ+RFQPRLGRYLAAAA+NV+SILDVETQ CRQTL+GHTK I SVCWD +G+
Sbjct  751  SRVFRGGTAQLRFQPRLGRYLAAAADNVLSILDVETQACRQTLQGHTKAIDSVCWDSTGD  810

Query  552  HLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNM  373
             +ASVSEDSVRVW +GSG+E +CVHELS NGNK HSCVFHP+Y SLLVIGCYQ+LELWNM
Sbjct  811  LVASVSEDSVRVWAVGSGSEWDCVHELSCNGNKAHSCVFHPTYPSLLVIGCYQTLELWNM  870

Query  372  TENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
             ENKTM LPAH+GLI++LAVS V GLVASASHDK +KLWK
Sbjct  871  AENKTMALPAHDGLISALAVSNVTGLVASASHDKTVKLWK  910



>emb|CAB43692.1| putative protein [Arabidopsis thaliana]
 emb|CAB79972.1| putative protein [Arabidopsis thaliana]
Length=930

 Score =   274 bits (701),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 122/160 (76%), Positives = 143/160 (89%), Gaps = 0/160 (0%)
 Frame = -1

Query  732  TRAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGE  553
            TR +KGG+ Q+RFQPR+G+YLAA++ N+V++LDVETQ  R +L+GH  PI+SVCWDPSG+
Sbjct  771  TRVYKGGSTQIRFQPRVGKYLAASSANLVNVLDVETQAIRHSLQGHANPINSVCWDPSGD  830

Query  552  HLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNM  373
             LASVSED V+VWTLG+G+EG CVHELS NGNKF SCVFHP+Y SLLVIGCYQSLELWNM
Sbjct  831  FLASVSEDMVKVWTLGTGSEGECVHELSCNGNKFQSCVFHPAYPSLLVIGCYQSLELWNM  890

Query  372  TENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            +ENKTMTLPAHEGLI SLAVST  GLVASASHDK++KLWK
Sbjct  891  SENKTMTLPAHEGLITSLAVSTATGLVASASHDKLVKLWK  930



>ref|NP_567896.1| transcriptional corepressor LEUNIG [Arabidopsis thaliana]
 sp|Q9FUY2.2|LEUNG_ARATH RecName: Full=Transcriptional corepressor LEUNIG [Arabidopsis 
thaliana]
 gb|AEE86076.1| transcriptional corepressor LEUNIG [Arabidopsis thaliana]
Length=931

 Score =   274 bits (701),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 122/160 (76%), Positives = 143/160 (89%), Gaps = 0/160 (0%)
 Frame = -1

Query  732  TRAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGE  553
            TR +KGG+ Q+RFQPR+G+YLAA++ N+V++LDVETQ  R +L+GH  PI+SVCWDPSG+
Sbjct  772  TRVYKGGSTQIRFQPRVGKYLAASSANLVNVLDVETQAIRHSLQGHANPINSVCWDPSGD  831

Query  552  HLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNM  373
             LASVSED V+VWTLG+G+EG CVHELS NGNKF SCVFHP+Y SLLVIGCYQSLELWNM
Sbjct  832  FLASVSEDMVKVWTLGTGSEGECVHELSCNGNKFQSCVFHPAYPSLLVIGCYQSLELWNM  891

Query  372  TENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            +ENKTMTLPAHEGLI SLAVST  GLVASASHDK++KLWK
Sbjct  892  SENKTMTLPAHEGLITSLAVSTATGLVASASHDKLVKLWK  931



>ref|XP_007137062.1| hypothetical protein PHAVU_009G096600g [Phaseolus vulgaris]
 gb|ESW09056.1| hypothetical protein PHAVU_009G096600g [Phaseolus vulgaris]
Length=982

 Score =   275 bits (703),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 127/159 (80%), Positives = 142/159 (89%), Gaps = 0/159 (0%)
 Frame = -1

Query  729  RAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEH  550
            R +KGGT Q+RFQPRLGRYLAAAAEN+VSI DVETQ CR +LKGHTK +  VCWDPSGE 
Sbjct  824  RVWKGGTTQMRFQPRLGRYLAAAAENIVSIFDVETQACRFSLKGHTKTVDCVCWDPSGEL  883

Query  549  LASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMT  370
            LASVSEDSV+VW+LGSG+EG CVHELS NG+KFH+CVFHP+Y SLL IGCYQSLELWNM+
Sbjct  884  LASVSEDSVKVWSLGSGSEGECVHELSCNGSKFHACVFHPTYPSLLAIGCYQSLELWNMS  943

Query  369  ENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            ENKTMTL AH+GLI +LAVSTV GLVASASHDK +KLWK
Sbjct  944  ENKTMTLSAHDGLITALAVSTVNGLVASASHDKFLKLWK  982



>gb|AAG32022.1|AF277458_1 LEUNIG [Arabidopsis thaliana]
Length=931

 Score =   274 bits (701),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 122/160 (76%), Positives = 143/160 (89%), Gaps = 0/160 (0%)
 Frame = -1

Query  732  TRAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGE  553
            TR +KGG+ Q+RFQPR+G+YLAA++ N+V++LDVETQ  R +L+GH  PI+SVCWDPSG+
Sbjct  772  TRVYKGGSTQIRFQPRVGKYLAASSANLVNVLDVETQAIRHSLQGHANPINSVCWDPSGD  831

Query  552  HLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNM  373
             LASVSED V+VWTLG+G+EG CVHELS NGNKF SCVFHP+Y SLLVIGCYQSLELWNM
Sbjct  832  FLASVSEDMVKVWTLGTGSEGECVHELSCNGNKFQSCVFHPAYPSLLVIGCYQSLELWNM  891

Query  372  TENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            +ENKTMTLPAHEGLI SLAVST  GLVASASHDK++KLWK
Sbjct  892  SENKTMTLPAHEGLITSLAVSTATGLVASASHDKLVKLWK  931



>ref|XP_007137063.1| hypothetical protein PHAVU_009G096600g [Phaseolus vulgaris]
 gb|ESW09057.1| hypothetical protein PHAVU_009G096600g [Phaseolus vulgaris]
Length=991

 Score =   275 bits (703),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 127/159 (80%), Positives = 142/159 (89%), Gaps = 0/159 (0%)
 Frame = -1

Query  729  RAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEH  550
            R +KGGT Q+RFQPRLGRYLAAAAEN+VSI DVETQ CR +LKGHTK +  VCWDPSGE 
Sbjct  833  RVWKGGTTQMRFQPRLGRYLAAAAENIVSIFDVETQACRFSLKGHTKTVDCVCWDPSGEL  892

Query  549  LASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMT  370
            LASVSEDSV+VW+LGSG+EG CVHELS NG+KFH+CVFHP+Y SLL IGCYQSLELWNM+
Sbjct  893  LASVSEDSVKVWSLGSGSEGECVHELSCNGSKFHACVFHPTYPSLLAIGCYQSLELWNMS  952

Query  369  ENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            ENKTMTL AH+GLI +LAVSTV GLVASASHDK +KLWK
Sbjct  953  ENKTMTLSAHDGLITALAVSTVNGLVASASHDKFLKLWK  991



>ref|XP_002869264.1| hypothetical protein ARALYDRAFT_491464 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45523.1| hypothetical protein ARALYDRAFT_491464 [Arabidopsis lyrata subsp. 
lyrata]
Length=920

 Score =   274 bits (700),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 122/160 (76%), Positives = 143/160 (89%), Gaps = 0/160 (0%)
 Frame = -1

Query  732  TRAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGE  553
            TR +KGG+ Q+RFQPR+G+YLAA++ N+V++LDVETQ  R +L+GH  PI+SVCWDPSG+
Sbjct  761  TRVYKGGSTQMRFQPRVGKYLAASSANLVNVLDVETQAIRHSLQGHANPINSVCWDPSGD  820

Query  552  HLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNM  373
             LASVSED V+VWTLG+G+EG CVHELS NGNKF SCVFHP+Y SLLVIGCYQSLELWNM
Sbjct  821  FLASVSEDMVKVWTLGTGSEGECVHELSCNGNKFQSCVFHPAYPSLLVIGCYQSLELWNM  880

Query  372  TENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            +ENKTMTLPAHEGLI SLAVST  GLVASASHDK++KLWK
Sbjct  881  SENKTMTLPAHEGLITSLAVSTATGLVASASHDKLVKLWK  920



>ref|NP_001190891.1| transcriptional corepressor LEUNIG [Arabidopsis thaliana]
 gb|AEE86077.1| transcriptional corepressor LEUNIG [Arabidopsis thaliana]
Length=969

 Score =   274 bits (701),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 122/160 (76%), Positives = 143/160 (89%), Gaps = 0/160 (0%)
 Frame = -1

Query  732  TRAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGE  553
            TR +KGG+ Q+RFQPR+G+YLAA++ N+V++LDVETQ  R +L+GH  PI+SVCWDPSG+
Sbjct  810  TRVYKGGSTQIRFQPRVGKYLAASSANLVNVLDVETQAIRHSLQGHANPINSVCWDPSGD  869

Query  552  HLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNM  373
             LASVSED V+VWTLG+G+EG CVHELS NGNKF SCVFHP+Y SLLVIGCYQSLELWNM
Sbjct  870  FLASVSEDMVKVWTLGTGSEGECVHELSCNGNKFQSCVFHPAYPSLLVIGCYQSLELWNM  929

Query  372  TENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            +ENKTMTLPAHEGLI SLAVST  GLVASASHDK++KLWK
Sbjct  930  SENKTMTLPAHEGLITSLAVSTATGLVASASHDKLVKLWK  969



>gb|KCW81467.1| hypothetical protein EUGRSUZ_C028381, partial [Eucalyptus grandis]
 gb|KCW81468.1| hypothetical protein EUGRSUZ_C028381, partial [Eucalyptus grandis]
Length=899

 Score =   272 bits (695),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 125/160 (78%), Positives = 144/160 (90%), Gaps = 0/160 (0%)
 Frame = -1

Query  732  TRAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGE  553
            +R F+GGTAQ+RFQPRLGRYLAAAA+NV+SILDVETQ CRQTL+GHTK I SVCWD +G+
Sbjct  740  SRVFRGGTAQLRFQPRLGRYLAAAADNVLSILDVETQACRQTLQGHTKAIDSVCWDSTGD  799

Query  552  HLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNM  373
             +ASVSEDSVRVW +GSG+E +CVHELS NGNK HSCVFHP+Y SLLVIGC+Q+LELWNM
Sbjct  800  LVASVSEDSVRVWAVGSGSEWDCVHELSCNGNKAHSCVFHPTYPSLLVIGCHQTLELWNM  859

Query  372  TENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
             ENKTM LPAH+GLI++LAVS V GLVASASHDK +KLWK
Sbjct  860  AENKTMALPAHDGLISALAVSNVTGLVASASHDKTVKLWK  899



>ref|XP_009407640.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X3 
[Musa acuminata subsp. malaccensis]
Length=761

 Score =   270 bits (689),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 126/159 (79%), Positives = 138/159 (87%), Gaps = 0/159 (0%)
 Frame = -1

Query  729  RAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEH  550
            R FKGGT Q+RFQPR GR LAAAAENVVSILDVETQ C   L+GH K + SVCWDPSGE 
Sbjct  603  RVFKGGTTQMRFQPRTGRCLAAAAENVVSILDVETQACLHQLQGHAKHVDSVCWDPSGEL  662

Query  549  LASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMT  370
            + SVSEDSVRVW+LGSG+E +CVHELS NGNKFHSC FHP+Y SLLVIGCYQSLELW+M 
Sbjct  663  VVSVSEDSVRVWSLGSGSEADCVHELSCNGNKFHSCAFHPTYPSLLVIGCYQSLELWDMN  722

Query  369  ENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            E+KTMTLPAHEGLIA+LAVS V GLVASASHDK +KLWK
Sbjct  723  ESKTMTLPAHEGLIAALAVSNVNGLVASASHDKFVKLWK  761



>gb|AES73711.2| transcriptional corepressor leunig-like protein [Medicago truncatula]
Length=897

 Score =   271 bits (694),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 130/159 (82%), Positives = 139/159 (87%), Gaps = 4/159 (3%)
 Frame = -1

Query  729  RAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEH  550
            R  KGGT Q+RFQPRLGRYLAAAAEN+VSILDVETQ CR +LKGHTK I SVCWDPSGE 
Sbjct  743  RVSKGGTTQMRFQPRLGRYLAAAAENIVSILDVETQACRYSLKGHTKTIDSVCWDPSGEL  802

Query  549  LASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMT  370
            LASVSEDSVR+WTL    EG CVHELS NG+KFHSCVFHP++ SLLVIGCYQSLELWNM 
Sbjct  803  LASVSEDSVRIWTL----EGECVHELSCNGSKFHSCVFHPTFPSLLVIGCYQSLELWNMA  858

Query  369  ENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            ENKTMTL AH+GLI +LAVSTV GLVASASHDK IKLWK
Sbjct  859  ENKTMTLSAHDGLITALAVSTVNGLVASASHDKFIKLWK  897



>gb|KEH35932.1| transcriptional corepressor leunig-like protein [Medicago truncatula]
Length=904

 Score =   271 bits (694),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 130/159 (82%), Positives = 139/159 (87%), Gaps = 4/159 (3%)
 Frame = -1

Query  729  RAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEH  550
            R  KGGT Q+RFQPRLGRYLAAAAEN+VSILDVETQ CR +LKGHTK I SVCWDPSGE 
Sbjct  750  RVSKGGTTQMRFQPRLGRYLAAAAENIVSILDVETQACRYSLKGHTKTIDSVCWDPSGEL  809

Query  549  LASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMT  370
            LASVSEDSVR+WTL    EG CVHELS NG+KFHSCVFHP++ SLLVIGCYQSLELWNM 
Sbjct  810  LASVSEDSVRIWTL----EGECVHELSCNGSKFHSCVFHPTFPSLLVIGCYQSLELWNMA  865

Query  369  ENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            ENKTMTL AH+GLI +LAVSTV GLVASASHDK IKLWK
Sbjct  866  ENKTMTLSAHDGLITALAVSTVNGLVASASHDKFIKLWK  904



>ref|XP_007221603.1| hypothetical protein PRUPE_ppa026892mg [Prunus persica]
 gb|EMJ22802.1| hypothetical protein PRUPE_ppa026892mg [Prunus persica]
Length=420

 Score =   259 bits (663),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 120/151 (79%), Positives = 132/151 (87%), Gaps = 0/151 (0%)
 Frame = -1

Query  705  QVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSEDS  526
            ++RFQP  GR+LAAAA+N VSILDVETQ CR +L+G TKP+HSVCWDPSGE LASVSEDS
Sbjct  270  KMRFQPHHGRFLAAAADNAVSILDVETQACRHSLQGQTKPVHSVCWDPSGEFLASVSEDS  329

Query  525  VRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTLP  346
            VRVWTLGSG E  CVHELS NG KFHSCVFHP+Y+SLLVIGCYQSLELWNMTENK MTL 
Sbjct  330  VRVWTLGSGGERECVHELSCNGTKFHSCVFHPTYTSLLVIGCYQSLELWNMTENKIMTLS  389

Query  345  AHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            AH+GLI +L +STV GLVASASHDK  KLWK
Sbjct  390  AHDGLIDALTMSTVTGLVASASHDKFFKLWK  420



>gb|EPS73524.1| hypothetical protein M569_01232, partial [Genlisea aurea]
Length=340

 Score =   257 bits (656),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 122/160 (76%), Positives = 138/160 (86%), Gaps = 1/160 (1%)
 Frame = -1

Query  732  TRAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGE  553
            TR FKGG+AQVRFQPRLGR+LAAAAENVVSILD ET  C  +LK HTKPI S+CWD SGE
Sbjct  181  TRVFKGGSAQVRFQPRLGRFLAAAAENVVSILDAETLNCLHSLKSHTKPIQSMCWDQSGE  240

Query  552  HLASVSEDSVRVWTLGSG-NEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWN  376
             LASVSEDSV+VWT  SG +EG CVH+LS N +KFHSC FHP+YSS+L+IGCYQSLELWN
Sbjct  241  LLASVSEDSVKVWTFRSGASEGECVHQLSCNVSKFHSCAFHPTYSSVLIIGCYQSLELWN  300

Query  375  MTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLW  256
            M EN T++LPAH+GLIASLAVS  AGLVASA HDK++KLW
Sbjct  301  MNENATVSLPAHDGLIASLAVSPAAGLVASAGHDKVVKLW  340



>ref|XP_009125844.1| PREDICTED: transcriptional corepressor LEUNIG isoform X1 [Brassica 
rapa]
Length=933

 Score =   271 bits (692),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 120/160 (75%), Positives = 142/160 (89%), Gaps = 0/160 (0%)
 Frame = -1

Query  732  TRAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGE  553
            +R +KGG+ Q RFQPR+G+YLAA++ NVVS+LDVETQ CR +L+GHT  I+SVCWD SG+
Sbjct  774  SRVYKGGSTQTRFQPRVGKYLAASSANVVSVLDVETQACRHSLQGHTNQINSVCWDASGD  833

Query  552  HLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNM  373
             LA+VSED V+VWT G+GNEG CVHELS NGNKF SCVFHP+Y SLLV+GCYQSLELWNM
Sbjct  834  FLATVSEDMVKVWTFGTGNEGECVHELSCNGNKFQSCVFHPTYPSLLVVGCYQSLELWNM  893

Query  372  TENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            ++NKTMTLPAH+GLIASLAVST  GLVASASHDK++KLWK
Sbjct  894  SQNKTMTLPAHDGLIASLAVSTATGLVASASHDKLVKLWK  933



>ref|XP_003603460.1| NAD(P)H-quinone oxidoreductase subunit [Medicago truncatula]
Length=941

 Score =   271 bits (692),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 130/159 (82%), Positives = 139/159 (87%), Gaps = 4/159 (3%)
 Frame = -1

Query  729  RAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEH  550
            R  KGGT Q+RFQPRLGRYLAAAAEN+VSILDVETQ CR +LKGHTK I SVCWDPSGE 
Sbjct  787  RVSKGGTTQMRFQPRLGRYLAAAAENIVSILDVETQACRYSLKGHTKTIDSVCWDPSGEL  846

Query  549  LASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMT  370
            LASVSEDSVR+WTL    EG CVHELS NG+KFHSCVFHP++ SLLVIGCYQSLELWNM 
Sbjct  847  LASVSEDSVRIWTL----EGECVHELSCNGSKFHSCVFHPTFPSLLVIGCYQSLELWNMA  902

Query  369  ENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            ENKTMTL AH+GLI +LAVSTV GLVASASHDK IKLWK
Sbjct  903  ENKTMTLSAHDGLITALAVSTVNGLVASASHDKFIKLWK  941



>ref|XP_009125860.1| PREDICTED: transcriptional corepressor LEUNIG isoform X3 [Brassica 
rapa]
Length=925

 Score =   270 bits (691),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 120/160 (75%), Positives = 142/160 (89%), Gaps = 0/160 (0%)
 Frame = -1

Query  732  TRAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGE  553
            +R +KGG+ Q RFQPR+G+YLAA++ NVVS+LDVETQ CR +L+GHT  I+SVCWD SG+
Sbjct  766  SRVYKGGSTQTRFQPRVGKYLAASSANVVSVLDVETQACRHSLQGHTNQINSVCWDASGD  825

Query  552  HLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNM  373
             LA+VSED V+VWT G+GNEG CVHELS NGNKF SCVFHP+Y SLLV+GCYQSLELWNM
Sbjct  826  FLATVSEDMVKVWTFGTGNEGECVHELSCNGNKFQSCVFHPTYPSLLVVGCYQSLELWNM  885

Query  372  TENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            ++NKTMTLPAH+GLIASLAVST  GLVASASHDK++KLWK
Sbjct  886  SQNKTMTLPAHDGLIASLAVSTATGLVASASHDKLVKLWK  925



>ref|XP_009125852.1| PREDICTED: transcriptional corepressor LEUNIG isoform X2 [Brassica 
rapa]
Length=926

 Score =   270 bits (691),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 120/160 (75%), Positives = 142/160 (89%), Gaps = 0/160 (0%)
 Frame = -1

Query  732  TRAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGE  553
            +R +KGG+ Q RFQPR+G+YLAA++ NVVS+LDVETQ CR +L+GHT  I+SVCWD SG+
Sbjct  767  SRVYKGGSTQTRFQPRVGKYLAASSANVVSVLDVETQACRHSLQGHTNQINSVCWDASGD  826

Query  552  HLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNM  373
             LA+VSED V+VWT G+GNEG CVHELS NGNKF SCVFHP+Y SLLV+GCYQSLELWNM
Sbjct  827  FLATVSEDMVKVWTFGTGNEGECVHELSCNGNKFQSCVFHPTYPSLLVVGCYQSLELWNM  886

Query  372  TENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            ++NKTMTLPAH+GLIASLAVST  GLVASASHDK++KLWK
Sbjct  887  SQNKTMTLPAHDGLIASLAVSTATGLVASASHDKLVKLWK  926



>emb|CDX75254.1| BnaA01g04480D [Brassica napus]
Length=1117

 Score =   271 bits (694),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 120/160 (75%), Positives = 142/160 (89%), Gaps = 0/160 (0%)
 Frame = -1

Query  732   TRAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGE  553
             +R +KGG+ Q RFQPR+G+YLAA++ NVVS+LDVETQ CR +L+GHT  I+SVCWD SG+
Sbjct  958   SRVYKGGSTQTRFQPRVGKYLAASSANVVSVLDVETQACRHSLQGHTNQINSVCWDASGD  1017

Query  552   HLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNM  373
              LA+VSED V+VWT G+GNEG CVHELS NGNKF SCVFHP+Y SLLV+GCYQSLELWNM
Sbjct  1018  FLATVSEDMVKVWTFGTGNEGECVHELSCNGNKFQSCVFHPTYPSLLVVGCYQSLELWNM  1077

Query  372   TENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
             ++NKTMTLPAH+GLIASLAVST  GLVASASHDK++KLWK
Sbjct  1078  SQNKTMTLPAHDGLIASLAVSTATGLVASASHDKLVKLWK  1117



>ref|XP_009407639.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=888

 Score =   269 bits (688),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 126/159 (79%), Positives = 138/159 (87%), Gaps = 0/159 (0%)
 Frame = -1

Query  729  RAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEH  550
            R FKGGT Q+RFQPR GR LAAAAENVVSILDVETQ C   L+GH K + SVCWDPSGE 
Sbjct  730  RVFKGGTTQMRFQPRTGRCLAAAAENVVSILDVETQACLHQLQGHAKHVDSVCWDPSGEL  789

Query  549  LASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMT  370
            + SVSEDSVRVW+LGSG+E +CVHELS NGNKFHSC FHP+Y SLLVIGCYQSLELW+M 
Sbjct  790  VVSVSEDSVRVWSLGSGSEADCVHELSCNGNKFHSCAFHPTYPSLLVIGCYQSLELWDMN  849

Query  369  ENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            E+KTMTLPAHEGLIA+LAVS V GLVASASHDK +KLWK
Sbjct  850  ESKTMTLPAHEGLIAALAVSNVNGLVASASHDKFVKLWK  888



>ref|XP_009407638.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=889

 Score =   269 bits (688),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 126/159 (79%), Positives = 138/159 (87%), Gaps = 0/159 (0%)
 Frame = -1

Query  729  RAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEH  550
            R FKGGT Q+RFQPR GR LAAAAENVVSILDVETQ C   L+GH K + SVCWDPSGE 
Sbjct  731  RVFKGGTTQMRFQPRTGRCLAAAAENVVSILDVETQACLHQLQGHAKHVDSVCWDPSGEL  790

Query  549  LASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMT  370
            + SVSEDSVRVW+LGSG+E +CVHELS NGNKFHSC FHP+Y SLLVIGCYQSLELW+M 
Sbjct  791  VVSVSEDSVRVWSLGSGSEADCVHELSCNGNKFHSCAFHPTYPSLLVIGCYQSLELWDMN  850

Query  369  ENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            E+KTMTLPAHEGLIA+LAVS V GLVASASHDK +KLWK
Sbjct  851  ESKTMTLPAHEGLIAALAVSNVNGLVASASHDKFVKLWK  889



>emb|CDX68860.1| BnaC01g05930D [Brassica napus]
Length=908

 Score =   269 bits (688),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 119/160 (74%), Positives = 141/160 (88%), Gaps = 0/160 (0%)
 Frame = -1

Query  732  TRAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGE  553
            +R +KGG+ Q RFQPR+G+YLAA++ NVVS+LDVETQ CR +L+GHT  I+SVCWD SG+
Sbjct  749  SRVYKGGSTQTRFQPRVGKYLAASSANVVSVLDVETQACRHSLQGHTNQINSVCWDASGD  808

Query  552  HLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNM  373
             LA+VSED V+VWT G+GNEG CVHELS NGNKF SCVFHP+Y SLLV+GCYQSLELWNM
Sbjct  809  FLATVSEDMVKVWTFGTGNEGECVHELSCNGNKFQSCVFHPTYPSLLVVGCYQSLELWNM  868

Query  372  TENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            ++NKTMTLPAH+GLI SLAVST  GLVASASHDK++KLWK
Sbjct  869  SQNKTMTLPAHDGLITSLAVSTATGLVASASHDKLVKLWK  908



>gb|KCW81469.1| hypothetical protein EUGRSUZ_C028381, partial [Eucalyptus grandis]
 gb|KCW81470.1| hypothetical protein EUGRSUZ_C028381, partial [Eucalyptus grandis]
Length=899

 Score =   269 bits (688),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 124/160 (78%), Positives = 143/160 (89%), Gaps = 0/160 (0%)
 Frame = -1

Query  732  TRAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGE  553
            +R F+GGTAQ+RFQPRLG YLAAAA+NV+SILDVETQ CRQTL+GHTK I SVCWD +G+
Sbjct  740  SRVFRGGTAQLRFQPRLGMYLAAAADNVLSILDVETQACRQTLQGHTKAIDSVCWDSTGD  799

Query  552  HLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNM  373
             +ASVSEDSVRVW +GSG+E +CVHELS NGNK HSCVFHP+Y SLLVIGC+Q+LELWNM
Sbjct  800  LVASVSEDSVRVWAVGSGSEWDCVHELSCNGNKAHSCVFHPTYPSLLVIGCHQTLELWNM  859

Query  372  TENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
             ENKTM LPAH+GLI++LAVS V GLVASASHDK +KLWK
Sbjct  860  AENKTMALPAHDGLISALAVSNVTGLVASASHDKTVKLWK  899



>ref|XP_002514368.1| WD-repeat protein, putative [Ricinus communis]
 gb|EEF48322.1| WD-repeat protein, putative [Ricinus communis]
Length=547

 Score =   261 bits (668),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 118/157 (75%), Positives = 137/157 (87%), Gaps = 0/157 (0%)
 Frame = -1

Query  723  FKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLA  544
            FKGG  Q RFQP  GR LAAAAENV+SILDVETQ CR  L+GH  PIHSVCWDPSGE+LA
Sbjct  391  FKGGATQTRFQPHHGRILAAAAENVISILDVETQQCRLKLQGHRNPIHSVCWDPSGEYLA  450

Query  543  SVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTEN  364
            SVS+D VRVWT+GSG++G C+HELS  GNKFH+CVFHP++SSLL+IGCY++LELWNM E 
Sbjct  451  SVSDDLVRVWTVGSGSKGECMHELSCTGNKFHTCVFHPTFSSLLIIGCYETLELWNMAEK  510

Query  363  KTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            KTMTLPAH+ L+++LAVS V GLVASASHDK+IKLWK
Sbjct  511  KTMTLPAHDKLVSALAVSNVTGLVASASHDKLIKLWK  547



>gb|KCW81471.1| hypothetical protein EUGRSUZ_C028381, partial [Eucalyptus grandis]
Length=899

 Score =   269 bits (687),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 124/159 (78%), Positives = 142/159 (89%), Gaps = 0/159 (0%)
 Frame = -1

Query  729  RAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEH  550
            R F+GGTAQ+RFQPRLG YLAAAA+NV+SILDVETQ CRQTL+GHTK I SVCWD +G+ 
Sbjct  741  RVFRGGTAQLRFQPRLGMYLAAAADNVLSILDVETQACRQTLQGHTKAIDSVCWDSTGDL  800

Query  549  LASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMT  370
            +ASVSEDSVRVW +GSG+E +CVHELS NGNK HSCVFHP+Y SLLVIGC+Q+LELWNM 
Sbjct  801  VASVSEDSVRVWAVGSGSEWDCVHELSCNGNKAHSCVFHPTYPSLLVIGCHQTLELWNMA  860

Query  369  ENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            ENKTM LPAH+GLI++LAVS V GLVASASHDK +KLWK
Sbjct  861  ENKTMALPAHDGLISALAVSNVTGLVASASHDKTVKLWK  899



>ref|XP_002969651.1| hypothetical protein SELMODRAFT_410492 [Selaginella moellendorffii]
 gb|EFJ29739.1| hypothetical protein SELMODRAFT_410492 [Selaginella moellendorffii]
Length=835

 Score =   267 bits (683),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 119/160 (74%), Positives = 139/160 (87%), Gaps = 0/160 (0%)
 Frame = -1

Query  732  TRAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGE  553
            T+ FKGG  Q+RFQPR GR LAAAAENVVSI DV+ +TCR +L+ HTKP+HSVCWD +G+
Sbjct  676  TKVFKGGVTQMRFQPRHGRLLAAAAENVVSIFDVDAETCRHSLQRHTKPVHSVCWDQNGD  735

Query  552  HLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNM  373
            +LASVSEDSVRVWTL SG +G CVHEL SNGNKFHSCVFHPSY SLL+IGCY+SLELWNM
Sbjct  736  YLASVSEDSVRVWTLRSGGDGECVHELCSNGNKFHSCVFHPSYPSLLIIGCYESLELWNM  795

Query  372  TENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
             ENK+MT+PAH+GLIA+LA S   G+VASASHDK +KLW+
Sbjct  796  VENKSMTIPAHQGLIAALAQSPATGMVASASHDKCVKLWR  835



>gb|KFK29867.1| hypothetical protein AALP_AA7G189300 [Arabis alpina]
Length=382

 Score =   256 bits (654),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 118/152 (78%), Positives = 136/152 (89%), Gaps = 0/152 (0%)
 Frame = -1

Query  708  AQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSED  529
            AQVRFQPR G+YLAA++ NVVSILDVETQ CR +L+GH+ PI+SVCWDPSG+ LASVS+D
Sbjct  231  AQVRFQPRAGKYLAASSANVVSILDVETQACRYSLQGHSTPINSVCWDPSGDFLASVSKD  290

Query  528  SVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTL  349
             V+VWTLG+G+EG CVHELS NG+ F SCVFHP+Y SLLVIGCYQSLELWNM E+KTMTL
Sbjct  291  KVKVWTLGTGSEGECVHELSFNGSNFLSCVFHPAYPSLLVIGCYQSLELWNMLEHKTMTL  350

Query  348  PAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            PAHE LIASLAVST  GLVASASHD+++KLWK
Sbjct  351  PAHEALIASLAVSTATGLVASASHDQLVKLWK  382



>ref|XP_002970913.1| hypothetical protein SELMODRAFT_94317 [Selaginella moellendorffii]
 gb|EFJ28239.1| hypothetical protein SELMODRAFT_94317 [Selaginella moellendorffii]
Length=860

 Score =   267 bits (682),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 119/160 (74%), Positives = 139/160 (87%), Gaps = 0/160 (0%)
 Frame = -1

Query  732  TRAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGE  553
            T+ FKGG  Q+RFQPR GR LAAAAENVVSI DV+ +TCR +L+ HTKP+HSVCWD +G+
Sbjct  701  TKVFKGGVTQMRFQPRHGRLLAAAAENVVSIFDVDAETCRHSLQRHTKPVHSVCWDQNGD  760

Query  552  HLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNM  373
            +LASVSEDSVRVWTL SG +G CVHEL SNGNKFHSCVFHPSY SLL+IGCY+SLELWNM
Sbjct  761  YLASVSEDSVRVWTLRSGGDGECVHELCSNGNKFHSCVFHPSYPSLLIIGCYESLELWNM  820

Query  372  TENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
             ENK+MT+PAH+GLIA+LA S   G+VASASHDK +KLW+
Sbjct  821  VENKSMTIPAHQGLIAALAQSPATGMVASASHDKCVKLWR  860



>gb|KFK29866.1| hypothetical protein AALP_AA7G189300 [Arabis alpina]
Length=388

 Score =   256 bits (653),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 118/152 (78%), Positives = 136/152 (89%), Gaps = 0/152 (0%)
 Frame = -1

Query  708  AQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLASVSED  529
            AQVRFQPR G+YLAA++ NVVSILDVETQ CR +L+GH+ PI+SVCWDPSG+ LASVS+D
Sbjct  237  AQVRFQPRAGKYLAASSANVVSILDVETQACRYSLQGHSTPINSVCWDPSGDFLASVSKD  296

Query  528  SVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENKTMTL  349
             V+VWTLG+G+EG CVHELS NG+ F SCVFHP+Y SLLVIGCYQSLELWNM E+KTMTL
Sbjct  297  KVKVWTLGTGSEGECVHELSFNGSNFLSCVFHPAYPSLLVIGCYQSLELWNMLEHKTMTL  356

Query  348  PAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            PAHE LIASLAVST  GLVASASHD+++KLWK
Sbjct  357  PAHEALIASLAVSTATGLVASASHDQLVKLWK  388



>gb|KJB64522.1| hypothetical protein B456_010G053000 [Gossypium raimondii]
Length=933

 Score =   266 bits (680),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 130/163 (80%), Positives = 139/163 (85%), Gaps = 4/163 (2%)
 Frame = -1

Query  729  RAFKGGTA----QVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDP  562
            R FKGGTA    Q+RFQPR G+YLA AAENVVSILD ETQTCR +L+GHTK IHSVCWD 
Sbjct  767  RVFKGGTAPGTAQLRFQPRFGKYLALAAENVVSILDAETQTCRHSLQGHTKLIHSVCWDL  826

Query  561  SGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLEL  382
            SGE LASVSEDSVRVW+  SG+EG CVHELS NGNKFHSCVFHP+  SLLVIGCYQSLEL
Sbjct  827  SGELLASVSEDSVRVWSFRSGSEGECVHELSCNGNKFHSCVFHPTSPSLLVIGCYQSLEL  886

Query  381  WNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            WNMTE KT TL AHEGLIA+LAVS V GLV+SASHDK IKLWK
Sbjct  887  WNMTEGKTKTLSAHEGLIAALAVSPVTGLVSSASHDKFIKLWK  929



>gb|KJB64525.1| hypothetical protein B456_010G053000 [Gossypium raimondii]
Length=943

 Score =   266 bits (679),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 130/163 (80%), Positives = 139/163 (85%), Gaps = 4/163 (2%)
 Frame = -1

Query  729  RAFKGGTA----QVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDP  562
            R FKGGTA    Q+RFQPR G+YLA AAENVVSILD ETQTCR +L+GHTK IHSVCWD 
Sbjct  777  RVFKGGTAPGTAQLRFQPRFGKYLALAAENVVSILDAETQTCRHSLQGHTKLIHSVCWDL  836

Query  561  SGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLEL  382
            SGE LASVSEDSVRVW+  SG+EG CVHELS NGNKFHSCVFHP+  SLLVIGCYQSLEL
Sbjct  837  SGELLASVSEDSVRVWSFRSGSEGECVHELSCNGNKFHSCVFHPTSPSLLVIGCYQSLEL  896

Query  381  WNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            WNMTE KT TL AHEGLIA+LAVS V GLV+SASHDK IKLWK
Sbjct  897  WNMTEGKTKTLSAHEGLIAALAVSPVTGLVSSASHDKFIKLWK  939



>gb|KJB64523.1| hypothetical protein B456_010G053000 [Gossypium raimondii]
Length=942

 Score =   266 bits (679),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 130/163 (80%), Positives = 139/163 (85%), Gaps = 4/163 (2%)
 Frame = -1

Query  729  RAFKGGTA----QVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDP  562
            R FKGGTA    Q+RFQPR G+YLA AAENVVSILD ETQTCR +L+GHTK IHSVCWD 
Sbjct  776  RVFKGGTAPGTAQLRFQPRFGKYLALAAENVVSILDAETQTCRHSLQGHTKLIHSVCWDL  835

Query  561  SGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLEL  382
            SGE LASVSEDSVRVW+  SG+EG CVHELS NGNKFHSCVFHP+  SLLVIGCYQSLEL
Sbjct  836  SGELLASVSEDSVRVWSFRSGSEGECVHELSCNGNKFHSCVFHPTSPSLLVIGCYQSLEL  895

Query  381  WNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            WNMTE KT TL AHEGLIA+LAVS V GLV+SASHDK IKLWK
Sbjct  896  WNMTEGKTKTLSAHEGLIAALAVSPVTGLVSSASHDKFIKLWK  938



>ref|XP_008445143.1| PREDICTED: LOW QUALITY PROTEIN: transcriptional corepressor LEUNIG 
[Cucumis melo]
Length=899

 Score =   265 bits (676),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 121/157 (77%), Positives = 136/157 (87%), Gaps = 0/157 (0%)
 Frame = -1

Query  723  FKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLA  544
            FKGGT  +RFQPRLGRY AA  +N+VSI DVETQ    +L+GHTK + S+CWDPSGE LA
Sbjct  743  FKGGTGPMRFQPRLGRYFAAVVDNIVSIFDVETQARLHSLRGHTKTVQSLCWDPSGEFLA  802

Query  543  SVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTEN  364
            SVSEDSVRVWTL SGNEG  +HELS NGNKFHSCVFHP+YS+LLVIGCY+SLELWN TEN
Sbjct  803  SVSEDSVRVWTLASGNEGESIHELSCNGNKFHSCVFHPTYSTLLVIGCYESLELWNTTEN  862

Query  363  KTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            KTMTL AHEGL++SLAVST +GLVASASHD+ IKLWK
Sbjct  863  KTMTLSAHEGLVSSLAVSTASGLVASASHDRFIKLWK  899



>ref|XP_002531278.1| WD-repeat protein, putative [Ricinus communis]
 gb|EEF31091.1| WD-repeat protein, putative [Ricinus communis]
Length=316

 Score =   250 bits (638),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 111/156 (71%), Positives = 135/156 (87%), Gaps = 0/156 (0%)
 Frame = -1

Query  723  FKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLA  544
            +KGG+A +RFQPRLGRY+AAA ENVVS+LDVETQ C ++L+GH +PIH VCW+PSGE++A
Sbjct  160  YKGGSAMIRFQPRLGRYVAAAEENVVSVLDVETQACLRSLQGHYRPIHYVCWNPSGEYVA  219

Query  543  SVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTEN  364
            SVSED+VRVW LGSGN+G C+HELS    KFHSC+FHP+  SLL+IG YQSL +W+MTEN
Sbjct  220  SVSEDAVRVWALGSGNDGECIHELSLKNTKFHSCIFHPTNPSLLIIGSYQSLVIWDMTEN  279

Query  363  KTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLW  256
            KTM LPAHE +IASLAVST   L+ASASHDK++KLW
Sbjct  280  KTMVLPAHEAIIASLAVSTATRLIASASHDKLVKLW  315



>ref|XP_010925120.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X1 
[Elaeis guineensis]
Length=877

 Score =   263 bits (672),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 122/159 (77%), Positives = 139/159 (87%), Gaps = 0/159 (0%)
 Frame = -1

Query  729  RAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEH  550
            R FKGGT Q+RFQ R GRYLAAAA+N +S++DVET+ CRQTLKGH   + S+CW+PSG+ 
Sbjct  719  RVFKGGTNQMRFQLRQGRYLAAAADNNISMIDVETRVCRQTLKGHRNHVDSLCWNPSGDL  778

Query  549  LASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMT  370
            LASVSEDSVRVW+ GSG+EG CVHELS NGNKFHSCVFHP++ SLLVIGCYQSLELW+M 
Sbjct  779  LASVSEDSVRVWSFGSGSEGECVHELSCNGNKFHSCVFHPTHPSLLVIGCYQSLELWDMP  838

Query  369  ENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            E+KTMTLPAHEGLIA+LAVS V G VASASHDK IKLWK
Sbjct  839  ESKTMTLPAHEGLIAALAVSNVTGSVASASHDKFIKLWK  877



>ref|XP_010925121.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X2 
[Elaeis guineensis]
Length=868

 Score =   263 bits (671),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 122/159 (77%), Positives = 139/159 (87%), Gaps = 0/159 (0%)
 Frame = -1

Query  729  RAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEH  550
            R FKGGT Q+RFQ R GRYLAAAA+N +S++DVET+ CRQTLKGH   + S+CW+PSG+ 
Sbjct  710  RVFKGGTNQMRFQLRQGRYLAAAADNNISMIDVETRVCRQTLKGHRNHVDSLCWNPSGDL  769

Query  549  LASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMT  370
            LASVSEDSVRVW+ GSG+EG CVHELS NGNKFHSCVFHP++ SLLVIGCYQSLELW+M 
Sbjct  770  LASVSEDSVRVWSFGSGSEGECVHELSCNGNKFHSCVFHPTHPSLLVIGCYQSLELWDMP  829

Query  369  ENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            E+KTMTLPAHEGLIA+LAVS V G VASASHDK IKLWK
Sbjct  830  ESKTMTLPAHEGLIAALAVSNVTGSVASASHDKFIKLWK  868



>ref|XP_008394021.1| PREDICTED: transcriptional corepressor LEUNIG-like [Malus domestica]
Length=342

 Score =   249 bits (635),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 115/142 (81%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = -1

Query  723  FKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLA  544
            FKGG  Q+RFQPRLGR+LA AAENVV ILDVET+ CR +L+GHTKPIHSVCWDPSGE LA
Sbjct  178  FKGGKRQLRFQPRLGRFLATAAENVVHILDVETZACRHSLQGHTKPIHSVCWDPSGEFLA  237

Query  543  SVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTEN  364
            SVS+DSVRVW LG+G EG CVHELS  GNKF SCVFH +Y+SLLVIGCYQ+LELWNMTEN
Sbjct  238  SVSDDSVRVWALGAGGEGECVHELSCXGNKFQSCVFHHTYTSLLVIGCYQTLELWNMTEN  297

Query  363  KTMTLPAHEGLIASLAVSTVAG  298
            K MTLPAHEGLIASLAVS V G
Sbjct  298  KVMTLPAHEGLIASLAVSNVTG  319



>gb|KGN62903.1| hypothetical protein Csa_2G379340 [Cucumis sativus]
Length=838

 Score =   261 bits (666),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 118/157 (75%), Positives = 135/157 (86%), Gaps = 0/157 (0%)
 Frame = -1

Query  723  FKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLA  544
            FKGGT  +RFQPRLGRY +A  +N+V+I DVETQ    +L+GHTK + S+CWDPSGE LA
Sbjct  682  FKGGTGPMRFQPRLGRYFSAVVDNIVTIFDVETQARVHSLRGHTKTVQSLCWDPSGEFLA  741

Query  543  SVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTEN  364
            SVSEDSVRVWTL SGNEG  +HELS NGNKFHSCVFHP+YS+LLVIGCY+SLELWN TEN
Sbjct  742  SVSEDSVRVWTLASGNEGESIHELSCNGNKFHSCVFHPTYSTLLVIGCYESLELWNTTEN  801

Query  363  KTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            KTMTL AHEGL++SLAVS  +GLVASASHD+ IKLWK
Sbjct  802  KTMTLSAHEGLVSSLAVSAASGLVASASHDRFIKLWK  838



>gb|KHN08101.1| Transcriptional corepressor LEUNIG [Glycine soja]
Length=901

 Score =   261 bits (667),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 126/159 (79%), Positives = 136/159 (86%), Gaps = 6/159 (4%)
 Frame = -1

Query  729  RAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEH  550
            R  KGGT Q+RFQPRLGRYLAAAAEN+VSI DVETQ CR +LKGHTKP+  VCWDPSGE 
Sbjct  749  RVSKGGTTQMRFQPRLGRYLAAAAENIVSIFDVETQACRYSLKGHTKPVDCVCWDPSGEL  808

Query  549  LASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMT  370
            LASVSEDSVRVWTLGSG+EG CVHELS NGNKFH+ VFHP+Y SLL      SLELWNM+
Sbjct  809  LASVSEDSVRVWTLGSGSEGECVHELSCNGNKFHASVFHPTYPSLL------SLELWNMS  862

Query  369  ENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            ENKTMTL AH+GLI SLAVSTV GLVASASHDK +KLWK
Sbjct  863  ENKTMTLSAHDGLITSLAVSTVNGLVASASHDKFLKLWK  901



>ref|XP_004138746.1| PREDICTED: transcriptional corepressor LEUNIG isoform X2 [Cucumis 
sativus]
Length=891

 Score =   261 bits (666),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 118/157 (75%), Positives = 135/157 (86%), Gaps = 0/157 (0%)
 Frame = -1

Query  723  FKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLA  544
            FKGGT  +RFQPRLGRY +A  +N+V+I DVETQ    +L+GHTK + S+CWDPSGE LA
Sbjct  735  FKGGTGPMRFQPRLGRYFSAVVDNIVTIFDVETQARVHSLRGHTKTVQSLCWDPSGEFLA  794

Query  543  SVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTEN  364
            SVSEDSVRVWTL SGNEG  +HELS NGNKFHSCVFHP+YS+LLVIGCY+SLELWN TEN
Sbjct  795  SVSEDSVRVWTLASGNEGESIHELSCNGNKFHSCVFHPTYSTLLVIGCYESLELWNTTEN  854

Query  363  KTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            KTMTL AHEGL++SLAVS  +GLVASASHD+ IKLWK
Sbjct  855  KTMTLSAHEGLVSSLAVSAASGLVASASHDRFIKLWK  891



>ref|XP_004138745.1| PREDICTED: transcriptional corepressor LEUNIG isoform X1 [Cucumis 
sativus]
 ref|XP_011649796.1| PREDICTED: transcriptional corepressor LEUNIG isoform X1 [Cucumis 
sativus]
Length=900

 Score =   260 bits (665),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 118/157 (75%), Positives = 135/157 (86%), Gaps = 0/157 (0%)
 Frame = -1

Query  723  FKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLA  544
            FKGGT  +RFQPRLGRY +A  +N+V+I DVETQ    +L+GHTK + S+CWDPSGE LA
Sbjct  744  FKGGTGPMRFQPRLGRYFSAVVDNIVTIFDVETQARVHSLRGHTKTVQSLCWDPSGEFLA  803

Query  543  SVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTEN  364
            SVSEDSVRVWTL SGNEG  +HELS NGNKFHSCVFHP+YS+LLVIGCY+SLELWN TEN
Sbjct  804  SVSEDSVRVWTLASGNEGESIHELSCNGNKFHSCVFHPTYSTLLVIGCYESLELWNTTEN  863

Query  363  KTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            KTMTL AHEGL++SLAVS  +GLVASASHD+ IKLWK
Sbjct  864  KTMTLSAHEGLVSSLAVSAASGLVASASHDRFIKLWK  900



>gb|KHN16498.1| Transcriptional corepressor LEUNIG [Glycine soja]
Length=886

 Score =   258 bits (660),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 125/159 (79%), Positives = 135/159 (85%), Gaps = 6/159 (4%)
 Frame = -1

Query  729  RAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEH  550
            R  KGGT Q+RFQPRLGRYLAAAAEN+VSI DVETQ CR +LKGHTKP+  VCWDPSGE 
Sbjct  734  RVSKGGTTQMRFQPRLGRYLAAAAENIVSIFDVETQVCRYSLKGHTKPVVCVCWDPSGEL  793

Query  549  LASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMT  370
            LASVSEDSVRVWTLGSG++G CVHELS NGNKFH  VFHP+Y SLL      SLELWNM+
Sbjct  794  LASVSEDSVRVWTLGSGSDGECVHELSCNGNKFHKSVFHPTYPSLL------SLELWNMS  847

Query  369  ENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            ENKTMTL AH+GLI SLAVSTV GLVASASHDK +KLWK
Sbjct  848  ENKTMTLSAHDGLITSLAVSTVNGLVASASHDKFLKLWK  886



>ref|XP_002962710.1| hypothetical protein SELMODRAFT_79275 [Selaginella moellendorffii]
 gb|EFJ36173.1| hypothetical protein SELMODRAFT_79275 [Selaginella moellendorffii]
Length=908

 Score =   258 bits (659),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 116/160 (73%), Positives = 139/160 (87%), Gaps = 1/160 (1%)
 Frame = -1

Query  732  TRAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGE  553
            TR FKGG AQ RFQPR+GR LAAAAENVVSI DV+T+TC  +L+ HTKP+HSVCWD +G+
Sbjct  750  TRVFKGGMAQTRFQPRVGRLLAAAAENVVSIFDVDTETCVHSLQRHTKPVHSVCWDATGD  809

Query  552  HLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNM  373
            ++ASVSEDSVRVW L +G++G+C+HEL+ NGNKFHSCVFHP   +LLVIGCYQSLELWNM
Sbjct  810  YVASVSEDSVRVWAL-NGSDGDCIHELNCNGNKFHSCVFHPKLPTLLVIGCYQSLELWNM  868

Query  372  TENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
             ENKTMT+PAH+GLIA+LA S   G+VASASHDK ++LWK
Sbjct  869  QENKTMTIPAHDGLIAALAQSPATGMVASASHDKCVRLWK  908



>ref|XP_002980381.1| hypothetical protein SELMODRAFT_112245 [Selaginella moellendorffii]
 gb|EFJ18641.1| hypothetical protein SELMODRAFT_112245 [Selaginella moellendorffii]
Length=913

 Score =   258 bits (659),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 116/160 (73%), Positives = 139/160 (87%), Gaps = 1/160 (1%)
 Frame = -1

Query  732  TRAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGE  553
            TR FKGG AQ RFQPR+GR LAAAAENVVSI DV+T+TC  +L+ HTKP+HSVCWD +G+
Sbjct  755  TRVFKGGMAQTRFQPRVGRLLAAAAENVVSIFDVDTETCVHSLQRHTKPVHSVCWDATGD  814

Query  552  HLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNM  373
            ++ASVSEDSVRVW L +G++G+C+HEL+ NGNKFHSCVFHP   +LLVIGCYQSLELWNM
Sbjct  815  YVASVSEDSVRVWAL-NGSDGDCIHELNCNGNKFHSCVFHPKLPTLLVIGCYQSLELWNM  873

Query  372  TENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
             ENKTMT+PAH+GLIA+LA S   G+VASASHDK ++LWK
Sbjct  874  QENKTMTIPAHDGLIAALAQSPATGMVASASHDKCVRLWK  913



>ref|XP_012078690.1| PREDICTED: transcriptional corepressor LEUNIG-like [Jatropha 
curcas]
 gb|KDP32334.1| hypothetical protein JCGZ_13259 [Jatropha curcas]
Length=852

 Score =   255 bits (652),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 113/157 (72%), Positives = 137/157 (87%), Gaps = 0/157 (0%)
 Frame = -1

Query  723  FKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLA  544
            FKGG  Q RFQP +GR LAAAAEN++SILDVETQ CR  L+GH   IHSVCWDPSGE++A
Sbjct  696  FKGGATQTRFQPHVGRILAAAAENIISILDVETQVCRLKLQGHKNHIHSVCWDPSGEYVA  755

Query  543  SVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTEN  364
            SVS+D VRVWT+GSG++G  +HELS +GNKFH+CVFHP+YSSLL+IGCY++LELWN+ EN
Sbjct  756  SVSDDLVRVWTVGSGSKGEYIHELSCSGNKFHTCVFHPTYSSLLIIGCYETLELWNLAEN  815

Query  363  KTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            KTMTLPAH+ L+++LAVS V GLVASASHDK++K WK
Sbjct  816  KTMTLPAHDKLVSALAVSNVTGLVASASHDKMVKFWK  852



>gb|KJB83315.1| hypothetical protein B456_013G240700 [Gossypium raimondii]
Length=928

 Score =   254 bits (650),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 122/146 (84%), Positives = 131/146 (90%), Gaps = 4/146 (3%)
 Frame = -1

Query  729  RAFKGGTA----QVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDP  562
            RAFKGGTA    Q+RFQPRLG+YLAAAAENVVSILD ETQTCR +L+GHTK IHSVCWDP
Sbjct  779  RAFKGGTAPGTAQLRFQPRLGKYLAAAAENVVSILDTETQTCRHSLQGHTKLIHSVCWDP  838

Query  561  SGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLEL  382
            SGE LASVSEDSVRVW+  SG+EG CVHELS NGNKFHSCVFHPS+ SLLVIGCYQSLEL
Sbjct  839  SGELLASVSEDSVRVWSFASGSEGECVHELSCNGNKFHSCVFHPSFQSLLVIGCYQSLEL  898

Query  381  WNMTENKTMTLPAHEGLIASLAVSTV  304
            WNM+ENKTMTL AHEGLIA+LAVS V
Sbjct  899  WNMSENKTMTLSAHEGLIAALAVSPV  924



>ref|XP_009405109.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=858

 Score =   253 bits (646),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 116/159 (73%), Positives = 134/159 (84%), Gaps = 0/159 (0%)
 Frame = -1

Query  729  RAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEH  550
            R F GGT Q+RFQPR GRY+AAAAEN + +LDVETQ  R  L+GHTK + S+CW+PSG+ 
Sbjct  700  RVFTGGTTQMRFQPRHGRYIAAAAENAICVLDVETQVRRHLLQGHTKHVDSICWNPSGDI  759

Query  549  LASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMT  370
            LASVSEDSVRVW+LGSGN+  CVHELS  GNKFHSCVF P+Y SLLVIGCYQSLE+W+M 
Sbjct  760  LASVSEDSVRVWSLGSGNDSECVHELSCIGNKFHSCVFLPNYPSLLVIGCYQSLEIWDMK  819

Query  369  ENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            ENKTM LPAH+GLIA+LAVS   G+VASASHDK +KLWK
Sbjct  820  ENKTMMLPAHDGLIAALAVSNATGVVASASHDKCVKLWK  858



>ref|XP_009405103.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=859

 Score =   253 bits (645),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 116/159 (73%), Positives = 134/159 (84%), Gaps = 0/159 (0%)
 Frame = -1

Query  729  RAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEH  550
            R F GGT Q+RFQPR GRY+AAAAEN + +LDVETQ  R  L+GHTK + S+CW+PSG+ 
Sbjct  701  RVFTGGTTQMRFQPRHGRYIAAAAENAICVLDVETQVRRHLLQGHTKHVDSICWNPSGDI  760

Query  549  LASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMT  370
            LASVSEDSVRVW+LGSGN+  CVHELS  GNKFHSCVF P+Y SLLVIGCYQSLE+W+M 
Sbjct  761  LASVSEDSVRVWSLGSGNDSECVHELSCIGNKFHSCVFLPNYPSLLVIGCYQSLEIWDMK  820

Query  369  ENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            ENKTM LPAH+GLIA+LAVS   G+VASASHDK +KLWK
Sbjct  821  ENKTMMLPAHDGLIAALAVSNATGVVASASHDKCVKLWK  859



>ref|XP_009405115.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X3 
[Musa acuminata subsp. malaccensis]
Length=846

 Score =   253 bits (645),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 116/159 (73%), Positives = 134/159 (84%), Gaps = 0/159 (0%)
 Frame = -1

Query  729  RAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEH  550
            R F GGT Q+RFQPR GRY+AAAAEN + +LDVETQ  R  L+GHTK + S+CW+PSG+ 
Sbjct  688  RVFTGGTTQMRFQPRHGRYIAAAAENAICVLDVETQVRRHLLQGHTKHVDSICWNPSGDI  747

Query  549  LASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMT  370
            LASVSEDSVRVW+LGSGN+  CVHELS  GNKFHSCVF P+Y SLLVIGCYQSLE+W+M 
Sbjct  748  LASVSEDSVRVWSLGSGNDSECVHELSCIGNKFHSCVFLPNYPSLLVIGCYQSLEIWDMK  807

Query  369  ENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            ENKTM LPAH+GLIA+LAVS   G+VASASHDK +KLWK
Sbjct  808  ENKTMMLPAHDGLIAALAVSNATGVVASASHDKCVKLWK  846



>ref|XP_011621570.1| PREDICTED: transcriptional corepressor LEUNIG isoform X2 [Amborella 
trichopoda]
Length=778

 Score =   251 bits (640),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 113/160 (71%), Positives = 136/160 (85%), Gaps = 0/160 (0%)
 Frame = -1

Query  732  TRAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGE  553
            TR FKGG +Q+RFQP +GR LAAAAENVVSILDVE+Q C  +L+GH+KP+HS+CWD SG+
Sbjct  619  TRQFKGGVSQMRFQPHVGRLLAAAAENVVSILDVESQVCCHSLQGHSKPVHSLCWDQSGD  678

Query  552  HLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNM  373
            ++AS SEDSVRVW +G  + G CVHELS +GNKFHSCVFHP Y SLLV+GCYQSLELW+M
Sbjct  679  YVASASEDSVRVWAVGGRSRGECVHELSCHGNKFHSCVFHPIYPSLLVVGCYQSLELWDM  738

Query  372  TENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            +E K MT+PAHEGL+A+LA S V G VASASHDK +K+WK
Sbjct  739  SEGKCMTVPAHEGLVAALAASNVTGTVASASHDKHVKIWK  778



>ref|XP_008390143.1| PREDICTED: transcriptional corepressor LEUNIG-like [Malus domestica]
Length=448

 Score =   243 bits (621),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 112/157 (71%), Positives = 133/157 (85%), Gaps = 0/157 (0%)
 Frame = -1

Query  723  FKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLA  544
            FKGG  QVRFQP  GR LAAAA+N VSILDVETQ CR  L+GH   +HSVCWDPSG++LA
Sbjct  292  FKGGATQVRFQPCFGRNLAAAADNFVSILDVETQVCRLKLQGHKSAVHSVCWDPSGDYLA  351

Query  543  SVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTEN  364
            SVS+D VRVWT+GS  +G  +HELS +GNKF++CVFHP+Y +LLVIGCY++LELWNMTEN
Sbjct  352  SVSDDLVRVWTIGSSCKGEFIHELSCSGNKFNTCVFHPTYPALLVIGCYETLELWNMTEN  411

Query  363  KTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            KTMTL AH+ L++SLAVS+  GLVASASHDK +KLWK
Sbjct  412  KTMTLHAHDKLVSSLAVSSATGLVASASHDKCVKLWK  448



>ref|XP_006838727.1| PREDICTED: transcriptional corepressor LEUNIG isoform X1 [Amborella 
trichopoda]
 gb|ERN01296.1| hypothetical protein AMTR_s00002p00252820 [Amborella trichopoda]
Length=854

 Score =   251 bits (640),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 113/160 (71%), Positives = 136/160 (85%), Gaps = 0/160 (0%)
 Frame = -1

Query  732  TRAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGE  553
            TR FKGG +Q+RFQP +GR LAAAAENVVSILDVE+Q C  +L+GH+KP+HS+CWD SG+
Sbjct  695  TRQFKGGVSQMRFQPHVGRLLAAAAENVVSILDVESQVCCHSLQGHSKPVHSLCWDQSGD  754

Query  552  HLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNM  373
            ++AS SEDSVRVW +G  + G CVHELS +GNKFHSCVFHP Y SLLV+GCYQSLELW+M
Sbjct  755  YVASASEDSVRVWAVGGRSRGECVHELSCHGNKFHSCVFHPIYPSLLVVGCYQSLELWDM  814

Query  372  TENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            +E K MT+PAHEGL+A+LA S V G VASASHDK +K+WK
Sbjct  815  SEGKCMTVPAHEGLVAALAASNVTGTVASASHDKHVKIWK  854



>gb|KDO80405.1| hypothetical protein CISIN_1g003177mg [Citrus sinensis]
Length=545

 Score =   242 bits (617),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 108/156 (69%), Positives = 133/156 (85%), Gaps = 0/156 (0%)
 Frame = -1

Query  720  KGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLAS  541
            + G  Q+RFQPRLGR LAAA EN +SILDVETQ CR  L+GH   +HSVCW+ SGE+LAS
Sbjct  390  QSGATQMRFQPRLGRILAAAIENYISILDVETQVCRLKLQGHKNQVHSVCWNTSGEYLAS  449

Query  540  VSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENK  361
            VS++ VRVW++GSG++G C+HELS  GNKFHSCVFHP++ SLLVIGCY++LELWNMTENK
Sbjct  450  VSDELVRVWSIGSGSKGECIHELSCTGNKFHSCVFHPTFPSLLVIGCYETLELWNMTENK  509

Query  360  TMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            T+TL AH+ L++SLA STV G+VASASHDK +K+WK
Sbjct  510  TLTLSAHDKLVSSLAASTVNGMVASASHDKCVKIWK  545



>ref|XP_009371420.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X2 
[Pyrus x bretschneideri]
Length=851

 Score =   247 bits (631),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 114/157 (73%), Positives = 133/157 (85%), Gaps = 0/157 (0%)
 Frame = -1

Query  723  FKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLA  544
            FKGG  QVRFQPR GR LAAAA+N VSILDVETQ CR  L+GH   +HSVCWDPSGE+LA
Sbjct  695  FKGGATQVRFQPRFGRNLAAAADNFVSILDVETQICRLKLQGHKSTVHSVCWDPSGENLA  754

Query  543  SVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTEN  364
            SVS+D VRVWT+GS  +G  +HELS +GNKF++CVFHPSY +LL+IGCY++LELWNM EN
Sbjct  755  SVSDDLVRVWTVGSSCKGEFIHELSCSGNKFNTCVFHPSYPALLIIGCYENLELWNMAEN  814

Query  363  KTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            KTMTL AHE L++SLAVS+  GLVASASHDK +KLWK
Sbjct  815  KTMTLHAHEKLVSSLAVSSATGLVASASHDKCVKLWK  851



>ref|XP_009371419.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X1 
[Pyrus x bretschneideri]
Length=853

 Score =   247 bits (630),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 114/157 (73%), Positives = 133/157 (85%), Gaps = 0/157 (0%)
 Frame = -1

Query  723  FKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLA  544
            FKGG  QVRFQPR GR LAAAA+N VSILDVETQ CR  L+GH   +HSVCWDPSGE+LA
Sbjct  697  FKGGATQVRFQPRFGRNLAAAADNFVSILDVETQICRLKLQGHKSTVHSVCWDPSGENLA  756

Query  543  SVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTEN  364
            SVS+D VRVWT+GS  +G  +HELS +GNKF++CVFHPSY +LL+IGCY++LELWNM EN
Sbjct  757  SVSDDLVRVWTVGSSCKGEFIHELSCSGNKFNTCVFHPSYPALLIIGCYENLELWNMAEN  816

Query  363  KTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            KTMTL AHE L++SLAVS+  GLVASASHDK +KLWK
Sbjct  817  KTMTLHAHEKLVSSLAVSSATGLVASASHDKCVKLWK  853



>gb|KHG05392.1| Transcriptional corepressor LEUNIG -like protein [Gossypium arboreum]
Length=755

 Score =   245 bits (626),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 124/163 (76%), Positives = 134/163 (82%), Gaps = 10/163 (6%)
 Frame = -1

Query  729  RAFKGGTA----QVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDP  562
            R FKGGTA    Q+RFQPR G+YLA AAENVVSILD ETQTCR +L+GHTK IHSVCWD 
Sbjct  595  RVFKGGTAPGTAQLRFQPRFGKYLALAAENVVSILDAETQTCRYSLQGHTKLIHSVCWDL  654

Query  561  SGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLEL  382
            SGE LASVSEDSVRVW+ GSG+EG CVHELS NGNKFHSCVFHP+  SLL      SLEL
Sbjct  655  SGELLASVSEDSVRVWSFGSGSEGECVHELSCNGNKFHSCVFHPTSPSLL------SLEL  708

Query  381  WNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            WN+TE KT TL AHEGLIA+LAVS V GLV+SASHDK IKLWK
Sbjct  709  WNLTEGKTKTLSAHEGLIAALAVSPVTGLVSSASHDKFIKLWK  751



>ref|XP_010533194.1| PREDICTED: transcriptional corepressor LEUNIG-like [Tarenaya 
hassleriana]
Length=855

 Score =   246 bits (629),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 107/157 (68%), Positives = 134/157 (85%), Gaps = 0/157 (0%)
 Frame = -1

Query  723  FKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLA  544
            FKGG  Q+RFQP  GR LAAAA+N VSILDVETQ CR+ L+GH   +HSVCWDPSGE+LA
Sbjct  699  FKGGATQMRFQPGAGRILAAAADNYVSILDVETQVCRRKLQGHKGVVHSVCWDPSGEYLA  758

Query  543  SVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTEN  364
            SVS D VRVW++GS N+G C+HELSS+GNK+++CVFHP+Y+ LL+IGCY++LELWNM EN
Sbjct  759  SVSSDMVRVWSIGSSNKGECIHELSSSGNKYNTCVFHPTYTPLLIIGCYETLELWNMAEN  818

Query  363  KTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            KTMTL AH+ L+++LA S V+G++ASASHDK  K+WK
Sbjct  819  KTMTLHAHDNLVSALAASNVSGMIASASHDKFFKIWK  855



>ref|XP_010656383.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X2 
[Vitis vinifera]
Length=870

 Score =   246 bits (629),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 119/161 (74%), Positives = 135/161 (84%), Gaps = 2/161 (1%)
 Frame = -1

Query  732  TRAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGE  553
            TR FKGGT  +RFQPR GRYLAAAAE VVSILDVETQ CRQ L+GH   + SVCWD SG 
Sbjct  711  TRVFKGGTNHMRFQPRHGRYLAAAAEGVVSILDVETQACRQKLQGHKNHV-SVCWDSSGS  769

Query  552  HLASVSEDSVRVWTLGSGNEG-NCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWN  376
            +LA+VSED V+VWT+GSG +   C+HEL  +GNKF+SC FHP+Y+SLLVIGCYQSLELWN
Sbjct  770  YLATVSEDLVKVWTVGSGGKAAECIHELHYSGNKFNSCAFHPTYTSLLVIGCYQSLELWN  829

Query  375  MTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            MTENKTMTLPAH+ LI+SLAVS V GLVASASHD  +KLWK
Sbjct  830  MTENKTMTLPAHDKLISSLAVSNVTGLVASASHDNCVKLWK  870



>ref|XP_010656382.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X1 
[Vitis vinifera]
 emb|CBI28132.3| unnamed protein product [Vitis vinifera]
Length=871

 Score =   246 bits (629),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 119/161 (74%), Positives = 135/161 (84%), Gaps = 2/161 (1%)
 Frame = -1

Query  732  TRAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGE  553
            TR FKGGT  +RFQPR GRYLAAAAE VVSILDVETQ CRQ L+GH   + SVCWD SG 
Sbjct  712  TRVFKGGTNHMRFQPRHGRYLAAAAEGVVSILDVETQACRQKLQGHKNHV-SVCWDSSGS  770

Query  552  HLASVSEDSVRVWTLGSGNEG-NCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWN  376
            +LA+VSED V+VWT+GSG +   C+HEL  +GNKF+SC FHP+Y+SLLVIGCYQSLELWN
Sbjct  771  YLATVSEDLVKVWTVGSGGKAAECIHELHYSGNKFNSCAFHPTYTSLLVIGCYQSLELWN  830

Query  375  MTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            MTENKTMTLPAH+ LI+SLAVS V GLVASASHD  +KLWK
Sbjct  831  MTENKTMTLPAHDKLISSLAVSNVTGLVASASHDNCVKLWK  871



>gb|KDO80395.1| hypothetical protein CISIN_1g003177mg [Citrus sinensis]
Length=835

 Score =   246 bits (628),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 110/157 (70%), Positives = 134/157 (85%), Gaps = 0/157 (0%)
 Frame = -1

Query  723  FKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLA  544
            FK G  Q+RFQPRLGR LAAA EN +SILDVETQ CR  L+GH   +HSVCW+ SGE+LA
Sbjct  679  FKSGATQMRFQPRLGRILAAAIENYISILDVETQVCRLKLQGHKNQVHSVCWNTSGEYLA  738

Query  543  SVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTEN  364
            SVS++ VRVW++GSG++G C+HELS  GNKFHSCVFHP++ SLLVIGCY++LELWNMTEN
Sbjct  739  SVSDELVRVWSIGSGSKGECIHELSCTGNKFHSCVFHPTFPSLLVIGCYETLELWNMTEN  798

Query  363  KTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            KT+TL AH+ L++SLA STV G+VASASHDK +K+WK
Sbjct  799  KTLTLSAHDKLVSSLAASTVNGMVASASHDKCVKIWK  835



>ref|XP_010245981.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X4 
[Nelumbo nucifera]
Length=758

 Score =   244 bits (622),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 114/160 (71%), Positives = 135/160 (84%), Gaps = 3/160 (2%)
 Frame = -1

Query  732  TRAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGE  553
            TR  KGGTAQVRFQPR+G+ LAAAA+NVVSI DVET      L+GH+K +HSVCWD +G+
Sbjct  602  TRVSKGGTAQVRFQPRIGQLLAAAADNVVSIFDVETDRLTHALQGHSKEVHSVCWDSTGD  661

Query  552  HLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNM  373
             LASVS+DSVRVW+L +G    C+HELSSN NKFHSCVFHP+Y +LLVIG YQSLELWNM
Sbjct  662  RLASVSQDSVRVWSLSTGE---CIHELSSNANKFHSCVFHPAYPTLLVIGGYQSLELWNM  718

Query  372  TENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            +ENK+MT+PAHEG+IA+LA S V G+VASASHDK +KLWK
Sbjct  719  SENKSMTVPAHEGVIAALAQSPVTGMVASASHDKSVKLWK  758



>ref|XP_010245980.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X3 
[Nelumbo nucifera]
Length=772

 Score =   244 bits (623),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 114/160 (71%), Positives = 135/160 (84%), Gaps = 3/160 (2%)
 Frame = -1

Query  732  TRAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGE  553
            TR  KGGTAQVRFQPR+G+ LAAAA+NVVSI DVET      L+GH+K +HSVCWD +G+
Sbjct  616  TRVSKGGTAQVRFQPRIGQLLAAAADNVVSIFDVETDRLTHALQGHSKEVHSVCWDSTGD  675

Query  552  HLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNM  373
             LASVS+DSVRVW+L +G    C+HELSSN NKFHSCVFHP+Y +LLVIG YQSLELWNM
Sbjct  676  RLASVSQDSVRVWSLSTGE---CIHELSSNANKFHSCVFHPAYPTLLVIGGYQSLELWNM  732

Query  372  TENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            +ENK+MT+PAHEG+IA+LA S V G+VASASHDK +KLWK
Sbjct  733  SENKSMTVPAHEGVIAALAQSPVTGMVASASHDKSVKLWK  772



>ref|XP_010245978.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X1 
[Nelumbo nucifera]
Length=802

 Score =   244 bits (623),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 114/160 (71%), Positives = 135/160 (84%), Gaps = 3/160 (2%)
 Frame = -1

Query  732  TRAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGE  553
            TR  KGGTAQVRFQPR+G+ LAAAA+NVVSI DVET      L+GH+K +HSVCWD +G+
Sbjct  646  TRVSKGGTAQVRFQPRIGQLLAAAADNVVSIFDVETDRLTHALQGHSKEVHSVCWDSTGD  705

Query  552  HLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNM  373
             LASVS+DSVRVW+L +G    C+HELSSN NKFHSCVFHP+Y +LLVIG YQSLELWNM
Sbjct  706  RLASVSQDSVRVWSLSTGE---CIHELSSNANKFHSCVFHPAYPTLLVIGGYQSLELWNM  762

Query  372  TENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            +ENK+MT+PAHEG+IA+LA S V G+VASASHDK +KLWK
Sbjct  763  SENKSMTVPAHEGVIAALAQSPVTGMVASASHDKSVKLWK  802



>ref|XP_007013296.1| LisH dimerization motif,WD40/YVTN repeat-like-containing domain 
isoform 1 [Theobroma cacao]
 gb|EOY30915.1| LisH dimerization motif,WD40/YVTN repeat-like-containing domain 
isoform 1 [Theobroma cacao]
Length=863

 Score =   245 bits (625),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 109/157 (69%), Positives = 132/157 (84%), Gaps = 0/157 (0%)
 Frame = -1

Query  723  FKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLA  544
            FKGG  Q+RFQPR+GR+LAAAA+N VS+LDVE Q CR  L+GH   +HSVCWDP+GE LA
Sbjct  707  FKGGATQMRFQPRVGRFLAAAADNSVSLLDVENQVCRAKLQGHKNAVHSVCWDPTGEFLA  766

Query  543  SVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTEN  364
            SVS+D VRVWT+ SG +G CVHEL+  GNKF++CVFHP+Y SLLVIGCY++LELWNMTEN
Sbjct  767  SVSDDLVRVWTVSSGGKGECVHELNCTGNKFNTCVFHPTYPSLLVIGCYETLELWNMTEN  826

Query  363  KTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            KT+TL AHE L+++LAVS    +VASASHDK +KLWK
Sbjct  827  KTLTLHAHEKLVSALAVSNATSMVASASHDKCVKLWK  863



>ref|XP_010245979.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X2 
[Nelumbo nucifera]
Length=788

 Score =   244 bits (622),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 114/160 (71%), Positives = 135/160 (84%), Gaps = 3/160 (2%)
 Frame = -1

Query  732  TRAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGE  553
            TR  KGGTAQVRFQPR+G+ LAAAA+NVVSI DVET      L+GH+K +HSVCWD +G+
Sbjct  632  TRVSKGGTAQVRFQPRIGQLLAAAADNVVSIFDVETDRLTHALQGHSKEVHSVCWDSTGD  691

Query  552  HLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNM  373
             LASVS+DSVRVW+L +G    C+HELSSN NKFHSCVFHP+Y +LLVIG YQSLELWNM
Sbjct  692  RLASVSQDSVRVWSLSTGE---CIHELSSNANKFHSCVFHPAYPTLLVIGGYQSLELWNM  748

Query  372  TENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            +ENK+MT+PAHEG+IA+LA S V G+VASASHDK +KLWK
Sbjct  749  SENKSMTVPAHEGVIAALAQSPVTGMVASASHDKSVKLWK  788



>gb|KHN15508.1| Transcriptional corepressor LEUNIG [Glycine soja]
Length=864

 Score =   244 bits (624),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 123/159 (77%), Positives = 128/159 (81%), Gaps = 16/159 (10%)
 Frame = -1

Query  729  RAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEH  550
            R  KGG  Q+RFQPRLGRYLAAAAENVVSILDVETQ  R +LKGHTK I SVCWDPSGE 
Sbjct  722  RVSKGGAVQMRFQPRLGRYLAAAAENVVSILDVETQASRYSLKGHTKSIRSVCWDPSGEF  781

Query  549  LASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMT  370
            LASVSEDSVRVWTLGSG+EG CVHELS NGNKFHSC                SLELWNMT
Sbjct  782  LASVSEDSVRVWTLGSGSEGECVHELSCNGNKFHSC----------------SLELWNMT  825

Query  369  ENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            ENKTMTL AHEGLIA+LAVSTV GLVASASHDK +KLWK
Sbjct  826  ENKTMTLSAHEGLIAALAVSTVNGLVASASHDKFVKLWK  864



>ref|XP_008337347.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X1 
[Malus domestica]
Length=863

 Score =   244 bits (622),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 112/157 (71%), Positives = 131/157 (83%), Gaps = 0/157 (0%)
 Frame = -1

Query  723  FKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLA  544
            FKGG  Q+RFQPR GR LAAAA+N VSILDVETQ CR  L+GH   +HSVCWDPSGE+LA
Sbjct  707  FKGGATQMRFQPRFGRNLAAAADNFVSILDVETQVCRLKLQGHKSHVHSVCWDPSGEYLA  766

Query  543  SVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTEN  364
            SVS+D VRVWT+GS  +G  +HELS +GNKF +CVFHP+Y +LLVIGCY++LELWNM EN
Sbjct  767  SVSDDLVRVWTVGSSCKGELIHELSCSGNKFKTCVFHPTYPALLVIGCYETLELWNMAEN  826

Query  363  KTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            KTMTL AH+ L++SLAVS   GLVASASHDK +KLWK
Sbjct  827  KTMTLHAHDKLVSSLAVSNATGLVASASHDKCVKLWK  863



>ref|XP_008337351.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X4 
[Malus domestica]
Length=854

 Score =   244 bits (622),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 112/157 (71%), Positives = 131/157 (83%), Gaps = 0/157 (0%)
 Frame = -1

Query  723  FKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLA  544
            FKGG  Q+RFQPR GR LAAAA+N VSILDVETQ CR  L+GH   +HSVCWDPSGE+LA
Sbjct  698  FKGGATQMRFQPRFGRNLAAAADNFVSILDVETQVCRLKLQGHKSHVHSVCWDPSGEYLA  757

Query  543  SVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTEN  364
            SVS+D VRVWT+GS  +G  +HELS +GNKF +CVFHP+Y +LLVIGCY++LELWNM EN
Sbjct  758  SVSDDLVRVWTVGSSCKGELIHELSCSGNKFKTCVFHPTYPALLVIGCYETLELWNMAEN  817

Query  363  KTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            KTMTL AH+ L++SLAVS   GLVASASHDK +KLWK
Sbjct  818  KTMTLHAHDKLVSSLAVSNATGLVASASHDKCVKLWK  854



>ref|XP_008337350.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X3 
[Malus domestica]
Length=857

 Score =   244 bits (622),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 112/157 (71%), Positives = 131/157 (83%), Gaps = 0/157 (0%)
 Frame = -1

Query  723  FKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLA  544
            FKGG  Q+RFQPR GR LAAAA+N VSILDVETQ CR  L+GH   +HSVCWDPSGE+LA
Sbjct  701  FKGGATQMRFQPRFGRNLAAAADNFVSILDVETQVCRLKLQGHKSHVHSVCWDPSGEYLA  760

Query  543  SVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTEN  364
            SVS+D VRVWT+GS  +G  +HELS +GNKF +CVFHP+Y +LLVIGCY++LELWNM EN
Sbjct  761  SVSDDLVRVWTVGSSCKGELIHELSCSGNKFKTCVFHPTYPALLVIGCYETLELWNMAEN  820

Query  363  KTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            KTMTL AH+ L++SLAVS   GLVASASHDK +KLWK
Sbjct  821  KTMTLHAHDKLVSSLAVSNATGLVASASHDKCVKLWK  857



>gb|KDO80404.1| hypothetical protein CISIN_1g003177mg [Citrus sinensis]
Length=732

 Score =   242 bits (617),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 108/156 (69%), Positives = 133/156 (85%), Gaps = 0/156 (0%)
 Frame = -1

Query  720  KGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLAS  541
            + G  Q+RFQPRLGR LAAA EN +SILDVETQ CR  L+GH   +HSVCW+ SGE+LAS
Sbjct  577  QSGATQMRFQPRLGRILAAAIENYISILDVETQVCRLKLQGHKNQVHSVCWNTSGEYLAS  636

Query  540  VSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENK  361
            VS++ VRVW++GSG++G C+HELS  GNKFHSCVFHP++ SLLVIGCY++LELWNMTENK
Sbjct  637  VSDELVRVWSIGSGSKGECIHELSCTGNKFHSCVFHPTFPSLLVIGCYETLELWNMTENK  696

Query  360  TMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            T+TL AH+ L++SLA STV G+VASASHDK +K+WK
Sbjct  697  TLTLSAHDKLVSSLAASTVNGMVASASHDKCVKIWK  732



>ref|XP_011628153.1| PREDICTED: transcriptional corepressor LEUNIG [Amborella trichopoda]
Length=811

 Score =   243 bits (619),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 115/160 (72%), Positives = 133/160 (83%), Gaps = 2/160 (1%)
 Frame = -1

Query  732  TRAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGE  553
            TR  KGGTAQVRFQPR+G+ LAAAAENVVSI DVET     TLK HTKP+HSVCWD SG+
Sbjct  654  TRLSKGGTAQVRFQPRVGQLLAAAAENVVSIFDVETDRRTHTLKRHTKPVHSVCWDASGD  713

Query  552  HLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNM  373
            +LASVSEDSVRVW+L SG E  C+HEL+SNGN FHSCVFHPS+ +LLVIG YQ+LELWNM
Sbjct  714  YLASVSEDSVRVWSLASGEE--CIHELNSNGNNFHSCVFHPSFPTLLVIGGYQTLELWNM  771

Query  372  TENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
             E+  M++ AHEGLIA+LA S   G+VASASHDK +K+WK
Sbjct  772  AEDSRMSIQAHEGLIAALAQSPATGMVASASHDKCVKIWK  811



>ref|XP_008386053.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X2 
[Malus domestica]
Length=856

 Score =   243 bits (621),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 112/157 (71%), Positives = 133/157 (85%), Gaps = 0/157 (0%)
 Frame = -1

Query  723  FKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLA  544
            FKGG  QVRFQP  GR LAAAA+N VSILDVETQ CR  L+GH   +HSVCWDPSG++LA
Sbjct  700  FKGGATQVRFQPCFGRNLAAAADNFVSILDVETQVCRLKLQGHKSAVHSVCWDPSGDYLA  759

Query  543  SVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTEN  364
            SVS+D VRVWT+GS  +G  +HELS +GNKF++CVFHP+Y +LLVIGCY++LELWNMTEN
Sbjct  760  SVSDDLVRVWTIGSSCKGEFIHELSCSGNKFNTCVFHPTYPALLVIGCYETLELWNMTEN  819

Query  363  KTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            KTMTL AH+ L++SLAVS+  GLVASASHDK +KLWK
Sbjct  820  KTMTLHAHDKLVSSLAVSSATGLVASASHDKCVKLWK  856



>ref|XP_008337349.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X2 
[Malus domestica]
Length=859

 Score =   243 bits (621),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 112/157 (71%), Positives = 131/157 (83%), Gaps = 0/157 (0%)
 Frame = -1

Query  723  FKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLA  544
            FKGG  Q+RFQPR GR LAAAA+N VSILDVETQ CR  L+GH   +HSVCWDPSGE+LA
Sbjct  703  FKGGATQMRFQPRFGRNLAAAADNFVSILDVETQVCRLKLQGHKSHVHSVCWDPSGEYLA  762

Query  543  SVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTEN  364
            SVS+D VRVWT+GS  +G  +HELS +GNKF +CVFHP+Y +LLVIGCY++LELWNM EN
Sbjct  763  SVSDDLVRVWTVGSSCKGELIHELSCSGNKFKTCVFHPTYPALLVIGCYETLELWNMAEN  822

Query  363  KTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            KTMTL AH+ L++SLAVS   GLVASASHDK +KLWK
Sbjct  823  KTMTLHAHDKLVSSLAVSNATGLVASASHDKCVKLWK  859



>gb|KDO80403.1| hypothetical protein CISIN_1g003177mg [Citrus sinensis]
Length=761

 Score =   242 bits (617),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 108/156 (69%), Positives = 133/156 (85%), Gaps = 0/156 (0%)
 Frame = -1

Query  720  KGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLAS  541
            + G  Q+RFQPRLGR LAAA EN +SILDVETQ CR  L+GH   +HSVCW+ SGE+LAS
Sbjct  606  QSGATQMRFQPRLGRILAAAIENYISILDVETQVCRLKLQGHKNQVHSVCWNTSGEYLAS  665

Query  540  VSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENK  361
            VS++ VRVW++GSG++G C+HELS  GNKFHSCVFHP++ SLLVIGCY++LELWNMTENK
Sbjct  666  VSDELVRVWSIGSGSKGECIHELSCTGNKFHSCVFHPTFPSLLVIGCYETLELWNMTENK  725

Query  360  TMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            T+TL AH+ L++SLA STV G+VASASHDK +K+WK
Sbjct  726  TLTLSAHDKLVSSLAASTVNGMVASASHDKCVKIWK  761



>ref|XP_008386062.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X3 
[Malus domestica]
Length=855

 Score =   243 bits (621),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 112/157 (71%), Positives = 133/157 (85%), Gaps = 0/157 (0%)
 Frame = -1

Query  723  FKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLA  544
            FKGG  QVRFQP  GR LAAAA+N VSILDVETQ CR  L+GH   +HSVCWDPSG++LA
Sbjct  699  FKGGATQVRFQPCFGRNLAAAADNFVSILDVETQVCRLKLQGHKSAVHSVCWDPSGDYLA  758

Query  543  SVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTEN  364
            SVS+D VRVWT+GS  +G  +HELS +GNKF++CVFHP+Y +LLVIGCY++LELWNMTEN
Sbjct  759  SVSDDLVRVWTIGSSCKGEFIHELSCSGNKFNTCVFHPTYPALLVIGCYETLELWNMTEN  818

Query  363  KTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            KTMTL AH+ L++SLAVS+  GLVASASHDK +KLWK
Sbjct  819  KTMTLHAHDKLVSSLAVSSATGLVASASHDKCVKLWK  855



>gb|ERN18907.1| hypothetical protein AMTR_s00067p00167320 [Amborella trichopoda]
Length=839

 Score =   243 bits (620),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 115/160 (72%), Positives = 133/160 (83%), Gaps = 2/160 (1%)
 Frame = -1

Query  732  TRAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGE  553
            TR  KGGTAQVRFQPR+G+ LAAAAENVVSI DVET     TLK HTKP+HSVCWD SG+
Sbjct  682  TRLSKGGTAQVRFQPRVGQLLAAAAENVVSIFDVETDRRTHTLKRHTKPVHSVCWDASGD  741

Query  552  HLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNM  373
            +LASVSEDSVRVW+L SG E  C+HEL+SNGN FHSCVFHPS+ +LLVIG YQ+LELWNM
Sbjct  742  YLASVSEDSVRVWSLASGEE--CIHELNSNGNNFHSCVFHPSFPTLLVIGGYQTLELWNM  799

Query  372  TENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
             E+  M++ AHEGLIA+LA S   G+VASASHDK +K+WK
Sbjct  800  AEDSRMSIQAHEGLIAALAQSPATGMVASASHDKCVKIWK  839



>ref|XP_009403020.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=858

 Score =   243 bits (620),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 112/157 (71%), Positives = 131/157 (83%), Gaps = 0/157 (0%)
 Frame = -1

Query  723  FKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLA  544
            FKGGT Q+RFQPR GRYLA AAEN + +LDVETQ  R  L+GHTK + S+CW+ SG+ LA
Sbjct  702  FKGGTTQMRFQPRQGRYLAVAAENTICVLDVETQARRHLLQGHTKHVGSICWNSSGDCLA  761

Query  543  SVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTEN  364
            SVSEDSVRVW+ G G+EG C+ ELS NGNKFHSCVFHPSY S LVIG Y+SLE+W+M EN
Sbjct  762  SVSEDSVRVWSFGLGSEGECMKELSCNGNKFHSCVFHPSYPSFLVIGSYRSLEIWDMNEN  821

Query  363  KTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            KTMTL AH+GLIA+LAVS V G++ASASHDK +KLWK
Sbjct  822  KTMTLTAHDGLIAALAVSNVTGVIASASHDKCVKLWK  858



>gb|ACZ98534.1| LisH-SSDP-WD40 [Malus domestica]
Length=905

 Score =   243 bits (621),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 112/157 (71%), Positives = 134/157 (85%), Gaps = 0/157 (0%)
 Frame = -1

Query  723  FKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLA  544
            FKGG +QVRFQP  GR LAAAA+N VSILDVETQ CR  L+GH   +HSVCWDPSG++LA
Sbjct  701  FKGGASQVRFQPCFGRNLAAAADNFVSILDVETQVCRLKLQGHKSAVHSVCWDPSGDYLA  760

Query  543  SVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTEN  364
            SVS+D VRVWT+GS  +G  +HELS +GNKF++CVFHP+Y +LLVIGCY++LELWNMTEN
Sbjct  761  SVSDDLVRVWTIGSSCKGEFIHELSCSGNKFNTCVFHPTYPALLVIGCYETLELWNMTEN  820

Query  363  KTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            KTMTL AH+ L++SLAVS+  GLVASASHDK +KLWK
Sbjct  821  KTMTLHAHDKLVSSLAVSSATGLVASASHDKCVKLWK  857



>ref|XP_009403018.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X1 
[Musa acuminata subsp. malaccensis]
 ref|XP_009403019.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=863

 Score =   243 bits (620),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 112/157 (71%), Positives = 131/157 (83%), Gaps = 0/157 (0%)
 Frame = -1

Query  723  FKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLA  544
            FKGGT Q+RFQPR GRYLA AAEN + +LDVETQ  R  L+GHTK + S+CW+ SG+ LA
Sbjct  707  FKGGTTQMRFQPRQGRYLAVAAENTICVLDVETQARRHLLQGHTKHVGSICWNSSGDCLA  766

Query  543  SVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTEN  364
            SVSEDSVRVW+ G G+EG C+ ELS NGNKFHSCVFHPSY S LVIG Y+SLE+W+M EN
Sbjct  767  SVSEDSVRVWSFGLGSEGECMKELSCNGNKFHSCVFHPSYPSFLVIGSYRSLEIWDMNEN  826

Query  363  KTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            KTMTL AH+GLIA+LAVS V G++ASASHDK +KLWK
Sbjct  827  KTMTLTAHDGLIAALAVSNVTGVIASASHDKCVKLWK  863



>ref|XP_008386048.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X1 
[Malus domestica]
Length=860

 Score =   243 bits (620),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 112/157 (71%), Positives = 133/157 (85%), Gaps = 0/157 (0%)
 Frame = -1

Query  723  FKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLA  544
            FKGG  QVRFQP  GR LAAAA+N VSILDVETQ CR  L+GH   +HSVCWDPSG++LA
Sbjct  704  FKGGATQVRFQPCFGRNLAAAADNFVSILDVETQVCRLKLQGHKSAVHSVCWDPSGDYLA  763

Query  543  SVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTEN  364
            SVS+D VRVWT+GS  +G  +HELS +GNKF++CVFHP+Y +LLVIGCY++LELWNMTEN
Sbjct  764  SVSDDLVRVWTIGSSCKGEFIHELSCSGNKFNTCVFHPTYPALLVIGCYETLELWNMTEN  823

Query  363  KTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            KTMTL AH+ L++SLAVS+  GLVASASHDK +KLWK
Sbjct  824  KTMTLHAHDKLVSSLAVSSATGLVASASHDKCVKLWK  860



>ref|XP_009374058.1| PREDICTED: transcriptional corepressor LEUNIG-like [Pyrus x bretschneideri]
Length=843

 Score =   243 bits (619),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 112/157 (71%), Positives = 132/157 (84%), Gaps = 0/157 (0%)
 Frame = -1

Query  723  FKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLA  544
            FKGG  QVRFQPR GR LAAAA+N VSILDVETQ CR  L+GH   +HSVCW+PSGE+LA
Sbjct  687  FKGGATQVRFQPRFGRNLAAAADNFVSILDVETQVCRLKLQGHKSGVHSVCWNPSGEYLA  746

Query  543  SVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTEN  364
            SVS+D VRVWT+GS  +G  +HELS +GNKF++CVFHP+Y +LLVIGCY++LELWNM EN
Sbjct  747  SVSDDLVRVWTVGSSCKGEFIHELSCSGNKFNTCVFHPTYPALLVIGCYETLELWNMAEN  806

Query  363  KTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            KTMTL AH+ L++SLAVS   GLVASASHDK +KLWK
Sbjct  807  KTMTLHAHDKLVSSLAVSNATGLVASASHDKCVKLWK  843



>ref|XP_006451037.1| hypothetical protein CICLE_v10007449mg [Citrus clementina]
 gb|ESR64277.1| hypothetical protein CICLE_v10007449mg [Citrus clementina]
Length=837

 Score =   242 bits (617),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 108/156 (69%), Positives = 133/156 (85%), Gaps = 0/156 (0%)
 Frame = -1

Query  720  KGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLAS  541
            + G  Q+RFQPRLGR LAAA EN +SILDVETQ CR  L+GH   +HSVCW+ SGE+LAS
Sbjct  682  QSGATQMRFQPRLGRILAAAVENYISILDVETQVCRLKLQGHKNQVHSVCWNTSGEYLAS  741

Query  540  VSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENK  361
            VS++ VRVW++GSG++G C+HELS  GNKFHSCVFHP++ SLLVIGCY++LELWNMTENK
Sbjct  742  VSDELVRVWSIGSGSKGECIHELSCTGNKFHSCVFHPTFPSLLVIGCYETLELWNMTENK  801

Query  360  TMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            T+TL AH+ L++SLA STV G+VASASHDK +K+WK
Sbjct  802  TLTLSAHDKLVSSLAASTVNGMVASASHDKCVKIWK  837



>ref|XP_009372971.1| PREDICTED: transcriptional corepressor LEUNIG-like [Pyrus x bretschneideri]
Length=194

 Score =   226 bits (575),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 105/124 (85%), Positives = 113/124 (91%), Gaps = 0/124 (0%)
 Frame = -1

Query  726  AFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHL  547
             FKGGT Q+RFQPRLGR LAAAAENVVSILDVETQTCR +L+G TKPIHSVCWDPSGE L
Sbjct  70   VFKGGTTQMRFQPRLGRLLAAAAENVVSILDVETQTCRHSLQGQTKPIHSVCWDPSGEFL  129

Query  546  ASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTE  367
            ASVSEDSVRVWTLG+G EG CVHELS NGNKFHSC+FHP+Y+SLLVIGCYQSLELWNMT 
Sbjct  130  ASVSEDSVRVWTLGAGGEGECVHELSCNGNKFHSCLFHPTYTSLLVIGCYQSLELWNMTG  189

Query  366  NKTM  355
            N T+
Sbjct  190  NNTI  193



>gb|KDO80396.1| hypothetical protein CISIN_1g003177mg [Citrus sinensis]
Length=834

 Score =   242 bits (617),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 108/156 (69%), Positives = 133/156 (85%), Gaps = 0/156 (0%)
 Frame = -1

Query  720  KGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLAS  541
            + G  Q+RFQPRLGR LAAA EN +SILDVETQ CR  L+GH   +HSVCW+ SGE+LAS
Sbjct  679  QSGATQMRFQPRLGRILAAAIENYISILDVETQVCRLKLQGHKNQVHSVCWNTSGEYLAS  738

Query  540  VSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENK  361
            VS++ VRVW++GSG++G C+HELS  GNKFHSCVFHP++ SLLVIGCY++LELWNMTENK
Sbjct  739  VSDELVRVWSIGSGSKGECIHELSCTGNKFHSCVFHPTFPSLLVIGCYETLELWNMTENK  798

Query  360  TMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            T+TL AH+ L++SLA STV G+VASASHDK +K+WK
Sbjct  799  TLTLSAHDKLVSSLAASTVNGMVASASHDKCVKIWK  834



>ref|XP_006475763.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X2 
[Citrus sinensis]
 gb|KDO80393.1| hypothetical protein CISIN_1g003177mg [Citrus sinensis]
Length=837

 Score =   241 bits (616),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 108/156 (69%), Positives = 133/156 (85%), Gaps = 0/156 (0%)
 Frame = -1

Query  720  KGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLAS  541
            + G  Q+RFQPRLGR LAAA EN +SILDVETQ CR  L+GH   +HSVCW+ SGE+LAS
Sbjct  682  QSGATQMRFQPRLGRILAAAIENYISILDVETQVCRLKLQGHKNQVHSVCWNTSGEYLAS  741

Query  540  VSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENK  361
            VS++ VRVW++GSG++G C+HELS  GNKFHSCVFHP++ SLLVIGCY++LELWNMTENK
Sbjct  742  VSDELVRVWSIGSGSKGECIHELSCTGNKFHSCVFHPTFPSLLVIGCYETLELWNMTENK  801

Query  360  TMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            T+TL AH+ L++SLA STV G+VASASHDK +K+WK
Sbjct  802  TLTLSAHDKLVSSLAASTVNGMVASASHDKCVKIWK  837



>ref|XP_006475762.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X1 
[Citrus sinensis]
 gb|KDO80392.1| hypothetical protein CISIN_1g003177mg [Citrus sinensis]
Length=842

 Score =   241 bits (616),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 108/156 (69%), Positives = 133/156 (85%), Gaps = 0/156 (0%)
 Frame = -1

Query  720  KGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLAS  541
            + G  Q+RFQPRLGR LAAA EN +SILDVETQ CR  L+GH   +HSVCW+ SGE+LAS
Sbjct  687  QSGATQMRFQPRLGRILAAAIENYISILDVETQVCRLKLQGHKNQVHSVCWNTSGEYLAS  746

Query  540  VSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENK  361
            VS++ VRVW++GSG++G C+HELS  GNKFHSCVFHP++ SLLVIGCY++LELWNMTENK
Sbjct  747  VSDELVRVWSIGSGSKGECIHELSCTGNKFHSCVFHPTFPSLLVIGCYETLELWNMTENK  806

Query  360  TMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            T+TL AH+ L++SLA STV G+VASASHDK +K+WK
Sbjct  807  TLTLSAHDKLVSSLAASTVNGMVASASHDKCVKIWK  842



>ref|XP_009387170.1| PREDICTED: transcriptional corepressor LEUNIG-like [Musa acuminata 
subsp. malaccensis]
Length=887

 Score =   242 bits (617),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 111/159 (70%), Positives = 130/159 (82%), Gaps = 0/159 (0%)
 Frame = -1

Query  729  RAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEH  550
            R F GGT Q+RFQPR GRYLAAAAEN + ILDVETQ  R  L+GHTK + S+CW+ SG+ 
Sbjct  729  RVFPGGTTQMRFQPRHGRYLAAAAENTIGILDVETQARRHLLQGHTKHVISICWNSSGDR  788

Query  549  LASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMT  370
            LASVSEDSVR+W+LG G++G C+ EL+ +G KFHSCVFHPSY SLLVIGCYQSLELW+M 
Sbjct  789  LASVSEDSVRIWSLGLGSDGECIKELNCSGTKFHSCVFHPSYPSLLVIGCYQSLELWDMN  848

Query  369  ENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            ENKTM   AHEGLIA+LA S V G++AS SHDK +KLWK
Sbjct  849  ENKTMPSSAHEGLIAALAASNVTGVIASVSHDKCVKLWK  887



>ref|XP_010264093.1| PREDICTED: transcriptional corepressor LEUNIG-like [Nelumbo nucifera]
Length=799

 Score =   239 bits (609),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 112/160 (70%), Positives = 133/160 (83%), Gaps = 3/160 (2%)
 Frame = -1

Query  732  TRAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGE  553
            TR  KGGTAQVRFQPR+G+ LAAAA+N+VSI DVET       +GH+K +HSVCWD +G+
Sbjct  643  TRVSKGGTAQVRFQPRIGQLLAAAADNIVSIFDVETDRQINAFQGHSKEVHSVCWDANGD  702

Query  552  HLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNM  373
             LASVS+DSVRVW++   N G C+HEL+SN NKFHSCVFHP+Y SLLVIG YQSLELWNM
Sbjct  703  LLASVSQDSVRVWSV---NTGECLHELNSNANKFHSCVFHPTYHSLLVIGGYQSLELWNM  759

Query  372  TENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
             ENK+MT+PAHEG+IA+LA S V G+VASASHDK +KLWK
Sbjct  760  AENKSMTIPAHEGVIAALAQSPVTGMVASASHDKSVKLWK  799



>ref|XP_007204646.1| hypothetical protein PRUPE_ppa001612mg [Prunus persica]
 gb|EMJ05845.1| hypothetical protein PRUPE_ppa001612mg [Prunus persica]
Length=792

 Score =   237 bits (604),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 109/157 (69%), Positives = 130/157 (83%), Gaps = 0/157 (0%)
 Frame = -1

Query  723  FKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLA  544
            FKGG  Q+RFQP+ GR LAAAA+N VSILDVETQ C + L+GH   +HSVCWDPSG+ LA
Sbjct  636  FKGGATQMRFQPKAGRNLAAAADNFVSILDVETQACVRKLQGHKNLVHSVCWDPSGDFLA  695

Query  543  SVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTEN  364
            SVS+D VRVW++ S   G C+HELS +GNKF++CVFHP+  SLLVIGCY++LELWNMTEN
Sbjct  696  SVSDDLVRVWSVVSSARGECIHELSCSGNKFNTCVFHPTCPSLLVIGCYETLELWNMTEN  755

Query  363  KTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            KTMTL AH+ L++SLAVS   GLVASASHDK +KLWK
Sbjct  756  KTMTLHAHDKLVSSLAVSDATGLVASASHDKFVKLWK  792



>gb|KHG11579.1| Transcriptional corepressor LEUNIG -like protein [Gossypium arboreum]
Length=774

 Score =   235 bits (599),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 107/157 (68%), Positives = 127/157 (81%), Gaps = 0/157 (0%)
 Frame = -1

Query  723  FKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLA  544
             KGG  Q+RFQPR+GR+LAAA +N VS+LDVE Q CR  L+GH   IHSVCWD +GE LA
Sbjct  618  LKGGATQIRFQPRVGRFLAAATDNSVSLLDVEAQVCRAKLQGHKSVIHSVCWDATGEFLA  677

Query  543  SVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTEN  364
            SVS+D VRVWT+GS  +G CVHEL+  GNKF++CVFHPSYSSLLVIGCY++LELWNM EN
Sbjct  678  SVSDDLVRVWTVGSSGKGECVHELNRTGNKFNTCVFHPSYSSLLVIGCYETLELWNMLEN  737

Query  363  KTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            K MT  AHE L+++LA ST   +VASASHDK +KLWK
Sbjct  738  KIMTRHAHENLVSALAASTSTRMVASASHDKCVKLWK  774



>ref|XP_010541891.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X4 
[Tarenaya hassleriana]
Length=654

 Score =   233 bits (594),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 103/158 (65%), Positives = 133/158 (84%), Gaps = 1/158 (1%)
 Frame = -1

Query  723  FKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLA  544
            FKGG  Q+RFQP  GR LAAAA+N  SILDVETQ CR  L+GH   +HSVCWDPSGE+LA
Sbjct  497  FKGGATQMRFQPGAGRMLAAAADNYASILDVETQVCRCKLQGHKGLVHSVCWDPSGEYLA  556

Query  543  SVSEDSVRVWTLGSGN-EGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTE  367
            +VS D +RVW++GS + +G C+HELSS+GNKF++CVFHP+Y+S+L+IGCY++LELW+M E
Sbjct  557  TVSNDMIRVWSIGSSSSKGECIHELSSSGNKFNTCVFHPTYTSVLIIGCYETLELWDMAE  616

Query  366  NKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            NKTMTL AHE  +++LA S++ G+VASASHDK +K+WK
Sbjct  617  NKTMTLHAHEKRVSALAASSITGMVASASHDKFMKIWK  654



>gb|ACN37000.1| unknown [Zea mays]
Length=367

 Score =   225 bits (574),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 103/159 (65%), Positives = 134/159 (84%), Gaps = 3/159 (2%)
 Frame = -1

Query  729  RAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEH  550
            RA KGG+AQVRFQP +G++LAAAAENVVSI D+ET   + TL+GH   + SVCWD +GE+
Sbjct  212  RAIKGGSAQVRFQPHVGQFLAAAAENVVSIFDIETHGKKYTLQGHNTDVQSVCWDNNGEY  271

Query  549  LASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMT  370
            +ASVS+D V+VW++ +G+   C++ELSSNGNKFHSCVFHPSYS+LLVIG YQSLE+WNM 
Sbjct  272  IASVSQDLVKVWSMSTGD---CIYELSSNGNKFHSCVFHPSYSNLLVIGGYQSLEVWNMV  328

Query  369  ENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            +N+++T+ AHEGLIA+LA S V G++ASASHD  +K+WK
Sbjct  329  KNQSLTVQAHEGLIAALAQSPVTGMIASASHDNSVKVWK  367



>ref|XP_002518113.1| WD-repeat protein, putative [Ricinus communis]
 gb|EEF44246.1| WD-repeat protein, putative [Ricinus communis]
Length=782

 Score =   234 bits (598),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 112/160 (70%), Positives = 133/160 (83%), Gaps = 3/160 (2%)
 Frame = -1

Query  732  TRAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGE  553
            TR  KGG AQVRFQPR+G  LAAAAENVVSI DVET     +L+GH+  +HSVCWD +G+
Sbjct  626  TRISKGGIAQVRFQPRIGHLLAAAAENVVSIFDVETDRQTHSLQGHSTEVHSVCWDVNGD  685

Query  552  HLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNM  373
            +LASVS++SVRVW+L SG    C+HELSS+GNKFHSCVFHPSYS+LLVIG YQSLELWNM
Sbjct  686  YLASVSQESVRVWSLASGE---CIHELSSSGNKFHSCVFHPSYSTLLVIGGYQSLELWNM  742

Query  372  TENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
             ENK MT+PAHE +I++LA S V G+VASASHDK +K+WK
Sbjct  743  AENKCMTIPAHECVISALAQSPVTGMVASASHDKCVKIWK  782



>ref|NP_001042184.1| Os01g0177100 [Oryza sativa Japonica Group]
 dbj|BAD67818.1| putative transcriptional corepressor LEUNIG [Oryza sativa Japonica 
Group]
 dbj|BAF04098.1| Os01g0177100 [Oryza sativa Japonica Group]
Length=875

 Score =   235 bits (600),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 106/159 (67%), Positives = 133/159 (84%), Gaps = 1/159 (1%)
 Frame = -1

Query  729  RAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEH  550
            R FKGG++Q+RFQPR G YLA A+EN VSILDVETQ C +  +GHTK + SVCWDPSGE+
Sbjct  718  RIFKGGSSQLRFQPRHGGYLAVASENAVSILDVETQACLRRFEGHTKHVDSVCWDPSGEY  777

Query  549  LASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMT  370
            + SVSED+V+VW++ +G++  CV ELS  G+KFHSC FHPSYSS+L+IGCYQSLELW+M+
Sbjct  778  VVSVSEDTVKVWSVNAGSDDRCVQELSCTGSKFHSCAFHPSYSSMLIIGCYQSLELWDMS  837

Query  369  ENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            EN+TMTL AH+ LI +LA S+ +GLVAS SHDK +KLWK
Sbjct  838  ENRTMTLAAHDSLITALA-SSSSGLVASTSHDKFVKLWK  875



>ref|XP_004517072.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X6 
[Cicer arietinum]
Length=783

 Score =   234 bits (598),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 107/160 (67%), Positives = 134/160 (84%), Gaps = 3/160 (2%)
 Frame = -1

Query  732  TRAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGE  553
            TR FKGG+ QVRFQPR+G  LAAA+ NVVS+ DVET     +L+GH+  +H VCWDP+G+
Sbjct  627  TRVFKGGSTQVRFQPRIGHLLAAASGNVVSLFDVETDRQMHSLQGHSGEVHCVCWDPNGD  686

Query  552  HLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNM  373
            +LASVS++SV+VW+L SG+   C+HEL+S+GN FHSCVFHPSYS+LLVIG YQSLELWNM
Sbjct  687  YLASVSQESVKVWSLASGD---CIHELNSSGNMFHSCVFHPSYSNLLVIGGYQSLELWNM  743

Query  372  TENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
             ENK MT+PAHEG+I++LA S V G+VASASHDK +K+WK
Sbjct  744  AENKCMTIPAHEGVISALAQSPVTGMVASASHDKSVKIWK  783



>dbj|BAD67819.1| putative transcriptional corepressor LEUNIG [Oryza sativa Japonica 
Group]
 dbj|BAH00776.1| unnamed protein product [Oryza sativa Japonica Group]
Length=877

 Score =   235 bits (600),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 106/159 (67%), Positives = 133/159 (84%), Gaps = 1/159 (1%)
 Frame = -1

Query  729  RAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEH  550
            R FKGG++Q+RFQPR G YLA A+EN VSILDVETQ C +  +GHTK + SVCWDPSGE+
Sbjct  720  RIFKGGSSQLRFQPRHGGYLAVASENAVSILDVETQACLRRFEGHTKHVDSVCWDPSGEY  779

Query  549  LASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMT  370
            + SVSED+V+VW++ +G++  CV ELS  G+KFHSC FHPSYSS+L+IGCYQSLELW+M+
Sbjct  780  VVSVSEDTVKVWSVNAGSDDRCVQELSCTGSKFHSCAFHPSYSSMLIIGCYQSLELWDMS  839

Query  369  ENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            EN+TMTL AH+ LI +LA S+ +GLVAS SHDK +KLWK
Sbjct  840  ENRTMTLAAHDSLITALA-SSSSGLVASTSHDKFVKLWK  877



>ref|XP_004517070.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X4 
[Cicer arietinum]
Length=784

 Score =   234 bits (598),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 107/160 (67%), Positives = 134/160 (84%), Gaps = 3/160 (2%)
 Frame = -1

Query  732  TRAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGE  553
            TR FKGG+ QVRFQPR+G  LAAA+ NVVS+ DVET     +L+GH+  +H VCWDP+G+
Sbjct  628  TRVFKGGSTQVRFQPRIGHLLAAASGNVVSLFDVETDRQMHSLQGHSGEVHCVCWDPNGD  687

Query  552  HLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNM  373
            +LASVS++SV+VW+L SG+   C+HEL+S+GN FHSCVFHPSYS+LLVIG YQSLELWNM
Sbjct  688  YLASVSQESVKVWSLASGD---CIHELNSSGNMFHSCVFHPSYSNLLVIGGYQSLELWNM  744

Query  372  TENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
             ENK MT+PAHEG+I++LA S V G+VASASHDK +K+WK
Sbjct  745  AENKCMTIPAHEGVISALAQSPVTGMVASASHDKSVKIWK  784



>ref|XP_004517071.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X5 
[Cicer arietinum]
Length=784

 Score =   234 bits (598),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 107/160 (67%), Positives = 134/160 (84%), Gaps = 3/160 (2%)
 Frame = -1

Query  732  TRAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGE  553
            TR FKGG+ QVRFQPR+G  LAAA+ NVVS+ DVET     +L+GH+  +H VCWDP+G+
Sbjct  628  TRVFKGGSTQVRFQPRIGHLLAAASGNVVSLFDVETDRQMHSLQGHSGEVHCVCWDPNGD  687

Query  552  HLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNM  373
            +LASVS++SV+VW+L SG+   C+HEL+S+GN FHSCVFHPSYS+LLVIG YQSLELWNM
Sbjct  688  YLASVSQESVKVWSLASGD---CIHELNSSGNMFHSCVFHPSYSNLLVIGGYQSLELWNM  744

Query  372  TENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
             ENK MT+PAHEG+I++LA S V G+VASASHDK +K+WK
Sbjct  745  AENKCMTIPAHEGVISALAQSPVTGMVASASHDKSVKIWK  784



>ref|XP_004517073.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X7 
[Cicer arietinum]
Length=782

 Score =   234 bits (598),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 107/160 (67%), Positives = 134/160 (84%), Gaps = 3/160 (2%)
 Frame = -1

Query  732  TRAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGE  553
            TR FKGG+ QVRFQPR+G  LAAA+ NVVS+ DVET     +L+GH+  +H VCWDP+G+
Sbjct  626  TRVFKGGSTQVRFQPRIGHLLAAASGNVVSLFDVETDRQMHSLQGHSGEVHCVCWDPNGD  685

Query  552  HLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNM  373
            +LASVS++SV+VW+L SG+   C+HEL+S+GN FHSCVFHPSYS+LLVIG YQSLELWNM
Sbjct  686  YLASVSQESVKVWSLASGD---CIHELNSSGNMFHSCVFHPSYSNLLVIGGYQSLELWNM  742

Query  372  TENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
             ENK MT+PAHEG+I++LA S V G+VASASHDK +K+WK
Sbjct  743  AENKCMTIPAHEGVISALAQSPVTGMVASASHDKSVKIWK  782



>ref|XP_004517069.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X3 
[Cicer arietinum]
Length=785

 Score =   234 bits (598),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 107/160 (67%), Positives = 134/160 (84%), Gaps = 3/160 (2%)
 Frame = -1

Query  732  TRAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGE  553
            TR FKGG+ QVRFQPR+G  LAAA+ NVVS+ DVET     +L+GH+  +H VCWDP+G+
Sbjct  629  TRVFKGGSTQVRFQPRIGHLLAAASGNVVSLFDVETDRQMHSLQGHSGEVHCVCWDPNGD  688

Query  552  HLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNM  373
            +LASVS++SV+VW+L SG+   C+HEL+S+GN FHSCVFHPSYS+LLVIG YQSLELWNM
Sbjct  689  YLASVSQESVKVWSLASGD---CIHELNSSGNMFHSCVFHPSYSNLLVIGGYQSLELWNM  745

Query  372  TENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
             ENK MT+PAHEG+I++LA S V G+VASASHDK +K+WK
Sbjct  746  AENKCMTIPAHEGVISALAQSPVTGMVASASHDKSVKIWK  785



>ref|XP_004517067.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X1 
[Cicer arietinum]
 ref|XP_004517068.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X2 
[Cicer arietinum]
Length=786

 Score =   234 bits (598),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 107/160 (67%), Positives = 134/160 (84%), Gaps = 3/160 (2%)
 Frame = -1

Query  732  TRAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGE  553
            TR FKGG+ QVRFQPR+G  LAAA+ NVVS+ DVET     +L+GH+  +H VCWDP+G+
Sbjct  630  TRVFKGGSTQVRFQPRIGHLLAAASGNVVSLFDVETDRQMHSLQGHSGEVHCVCWDPNGD  689

Query  552  HLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNM  373
            +LASVS++SV+VW+L SG+   C+HEL+S+GN FHSCVFHPSYS+LLVIG YQSLELWNM
Sbjct  690  YLASVSQESVKVWSLASGD---CIHELNSSGNMFHSCVFHPSYSNLLVIGGYQSLELWNM  746

Query  372  TENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
             ENK MT+PAHEG+I++LA S V G+VASASHDK +K+WK
Sbjct  747  AENKCMTIPAHEGVISALAQSPVTGMVASASHDKSVKIWK  786



>ref|XP_010541890.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X3 
[Tarenaya hassleriana]
Length=749

 Score =   234 bits (596),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 103/158 (65%), Positives = 133/158 (84%), Gaps = 1/158 (1%)
 Frame = -1

Query  723  FKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLA  544
            FKGG  Q+RFQP  GR LAAAA+N  SILDVETQ CR  L+GH   +HSVCWDPSGE+LA
Sbjct  592  FKGGATQMRFQPGAGRMLAAAADNYASILDVETQVCRCKLQGHKGLVHSVCWDPSGEYLA  651

Query  543  SVSEDSVRVWTLGSGN-EGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTE  367
            +VS D +RVW++GS + +G C+HELSS+GNKF++CVFHP+Y+S+L+IGCY++LELW+M E
Sbjct  652  TVSNDMIRVWSIGSSSSKGECIHELSSSGNKFNTCVFHPTYTSVLIIGCYETLELWDMAE  711

Query  366  NKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            NKTMTL AHE  +++LA S++ G+VASASHDK +K+WK
Sbjct  712  NKTMTLHAHEKRVSALAASSITGMVASASHDKFMKIWK  749



>ref|XP_008796439.1| PREDICTED: transcriptional corepressor LEUNIG-like [Phoenix dactylifera]
Length=646

 Score =   232 bits (591),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 110/160 (69%), Positives = 132/160 (83%), Gaps = 3/160 (2%)
 Frame = -1

Query  732  TRAFKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGE  553
            +R  KGGT QVRFQP +G+YLAAAAENVVSI DVET     TL+GHTK + S+CWD SGE
Sbjct  490  SRVSKGGTVQVRFQPNIGQYLAAAAENVVSIFDVETDRKTYTLQGHTKEVQSICWDNSGE  549

Query  552  HLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNM  373
            +LA VS+D V+VW+L   + G+ +HELSSNGNKFHSCVFHP+Y++LLVIG YQSLELWN+
Sbjct  550  YLACVSQDCVKVWSL---SRGDFIHELSSNGNKFHSCVFHPNYTNLLVIGGYQSLELWNV  606

Query  372  TENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
             EN+TMT+ AHEGLIA+LA S   G+VASASHDK +KLWK
Sbjct  607  IENQTMTVQAHEGLIAALAQSQATGMVASASHDKSVKLWK  646



>ref|XP_008242693.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X2 
[Prunus mume]
Length=869

 Score =   235 bits (599),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 108/157 (69%), Positives = 129/157 (82%), Gaps = 0/157 (0%)
 Frame = -1

Query  723  FKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLA  544
            FKGG  ++RFQP  GR LAAAA+N VSILDVETQ C + L+GH   +HSVCWDPSG+ LA
Sbjct  713  FKGGATKMRFQPNAGRNLAAAADNYVSILDVETQACMRKLQGHKSLVHSVCWDPSGDFLA  772

Query  543  SVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTEN  364
            SVS+D VRVW++GS   G C+HELS +GNKF++CVFHP+  SLLVIGCY++LELWNM EN
Sbjct  773  SVSDDLVRVWSVGSSVRGECIHELSCSGNKFNTCVFHPTCPSLLVIGCYETLELWNMNEN  832

Query  363  KTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            KTMTL AH+ L++SLAVS   GLVASASHDK +KLWK
Sbjct  833  KTMTLHAHDKLVSSLAVSDATGLVASASHDKCVKLWK  869



>ref|XP_008242692.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X1 
[Prunus mume]
Length=874

 Score =   235 bits (599),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 108/157 (69%), Positives = 129/157 (82%), Gaps = 0/157 (0%)
 Frame = -1

Query  723  FKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLA  544
            FKGG  ++RFQP  GR LAAAA+N VSILDVETQ C + L+GH   +HSVCWDPSG+ LA
Sbjct  718  FKGGATKMRFQPNAGRNLAAAADNYVSILDVETQACMRKLQGHKSLVHSVCWDPSGDFLA  777

Query  543  SVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTEN  364
            SVS+D VRVW++GS   G C+HELS +GNKF++CVFHP+  SLLVIGCY++LELWNM EN
Sbjct  778  SVSDDLVRVWSVGSSVRGECIHELSCSGNKFNTCVFHPTCPSLLVIGCYETLELWNMNEN  837

Query  363  KTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            KTMTL AH+ L++SLAVS   GLVASASHDK +KLWK
Sbjct  838  KTMTLHAHDKLVSSLAVSDATGLVASASHDKCVKLWK  874



>ref|XP_010541888.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X1 
[Tarenaya hassleriana]
Length=776

 Score =   234 bits (596),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 103/158 (65%), Positives = 133/158 (84%), Gaps = 1/158 (1%)
 Frame = -1

Query  723  FKGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLA  544
            FKGG  Q+RFQP  GR LAAAA+N  SILDVETQ CR  L+GH   +HSVCWDPSGE+LA
Sbjct  619  FKGGATQMRFQPGAGRMLAAAADNYASILDVETQVCRCKLQGHKGLVHSVCWDPSGEYLA  678

Query  543  SVSEDSVRVWTLGSGN-EGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTE  367
            +VS D +RVW++GS + +G C+HELSS+GNKF++CVFHP+Y+S+L+IGCY++LELW+M E
Sbjct  679  TVSNDMIRVWSIGSSSSKGECIHELSSSGNKFNTCVFHPTYTSVLIIGCYETLELWDMAE  738

Query  366  NKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            NKTMTL AHE  +++LA S++ G+VASASHDK +K+WK
Sbjct  739  NKTMTLHAHEKRVSALAASSITGMVASASHDKFMKIWK  776



>ref|XP_008785188.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X3 
[Phoenix dactylifera]
Length=797

 Score =   234 bits (596),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 109/156 (70%), Positives = 129/156 (83%), Gaps = 3/156 (2%)
 Frame = -1

Query  720  KGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLAS  541
            KGG AQVRFQPR+G  LAAAAENVVSI+DVET    +TL+GH K +HSVCWD +G+HLAS
Sbjct  645  KGGAAQVRFQPRIGHLLAAAAENVVSIIDVETDMKTRTLQGHNKVVHSVCWDANGDHLAS  704

Query  540  VSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENK  361
            VS+DSV+VW+L SG    C+HELSSNGN+FHSC FHP Y  LLVIG YQ+LELWNM EN+
Sbjct  705  VSQDSVKVWSLTSGE---CIHELSSNGNQFHSCTFHPRYPKLLVIGGYQTLELWNMAENQ  761

Query  360  TMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            TMT  AH+GLIA+LA S V G+VASASHD+ +K+WK
Sbjct  762  TMTAQAHDGLIAALAQSPVTGIVASASHDRSVKIWK  797



>ref|XP_008785186.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X2 
[Phoenix dactylifera]
Length=798

 Score =   233 bits (595),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 109/156 (70%), Positives = 129/156 (83%), Gaps = 3/156 (2%)
 Frame = -1

Query  720  KGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLAS  541
            KGG AQVRFQPR+G  LAAAAENVVSI+DVET    +TL+GH K +HSVCWD +G+HLAS
Sbjct  646  KGGAAQVRFQPRIGHLLAAAAENVVSIIDVETDMKTRTLQGHNKVVHSVCWDANGDHLAS  705

Query  540  VSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENK  361
            VS+DSV+VW+L SG    C+HELSSNGN+FHSC FHP Y  LLVIG YQ+LELWNM EN+
Sbjct  706  VSQDSVKVWSLTSGE---CIHELSSNGNQFHSCTFHPRYPKLLVIGGYQTLELWNMAENQ  762

Query  360  TMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            TMT  AH+GLIA+LA S V G+VASASHD+ +K+WK
Sbjct  763  TMTAQAHDGLIAALAQSPVTGIVASASHDRSVKIWK  798



>ref|XP_008785183.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X1 
[Phoenix dactylifera]
 ref|XP_008785184.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X1 
[Phoenix dactylifera]
 ref|XP_008785185.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X1 
[Phoenix dactylifera]
Length=799

 Score =   233 bits (595),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 109/156 (70%), Positives = 129/156 (83%), Gaps = 3/156 (2%)
 Frame = -1

Query  720  KGGTAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKGHTKPIHSVCWDPSGEHLAS  541
            KGG AQVRFQPR+G  LAAAAENVVSI+DVET    +TL+GH K +HSVCWD +G+HLAS
Sbjct  647  KGGAAQVRFQPRIGHLLAAAAENVVSIIDVETDMKTRTLQGHNKVVHSVCWDANGDHLAS  706

Query  540  VSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELWNMTENK  361
            VS+DSV+VW+L SG    C+HELSSNGN+FHSC FHP Y  LLVIG YQ+LELWNM EN+
Sbjct  707  VSQDSVKVWSLTSGE---CIHELSSNGNQFHSCTFHPRYPKLLVIGGYQTLELWNMAENQ  763

Query  360  TMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  253
            TMT  AH+GLIA+LA S V G+VASASHD+ +K+WK
Sbjct  764  TMTAQAHDGLIAALAQSPVTGIVASASHDRSVKIWK  799



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1358489737150