BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig10902

Length=748
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009758418.1|  PREDICTED: plastidic ATP/ADP-transporter-like      298   5e-93   Nicotiana sylvestris
ref|XP_006341665.1|  PREDICTED: plastidic ATP/ADP-transporter-like      280   4e-86   Solanum tuberosum [potatoes]
ref|XP_004252326.1|  PREDICTED: plastidic ATP/ADP-transporter           276   2e-84   Solanum lycopersicum
ref|XP_009624271.1|  PREDICTED: plastidic ATP/ADP-transporter-like      275   4e-84   Nicotiana tomentosiformis
ref|XP_004235723.1|  PREDICTED: plastidic ATP/ADP-transporter-like      274   5e-84   Solanum lycopersicum
ref|NP_001274794.1|  plastidic ATP/ADP-transporter                      274   6e-84   Solanum tuberosum [potatoes]
ref|XP_009767462.1|  PREDICTED: plastidic ATP/ADP-transporter           272   5e-83   Nicotiana sylvestris
ref|XP_009595520.1|  PREDICTED: plastidic ATP/ADP-transporter           271   6e-83   Nicotiana tomentosiformis
ref|XP_011081074.1|  PREDICTED: plastidic ATP/ADP-transporter           255   1e-76   Sesamum indicum [beniseed]
ref|XP_002298119.2|  Chloroplast ADP family protein                     249   2e-74   
emb|CDO98099.1|  unnamed protein product                                249   2e-74   Coffea canephora [robusta coffee]
ref|XP_011035631.1|  PREDICTED: plastidic ATP/ADP-transporter-like      244   1e-72   Populus euphratica
ref|XP_011072264.1|  PREDICTED: plastidic ATP/ADP-transporter-like      243   7e-72   Sesamum indicum [beniseed]
ref|XP_002303268.1|  Chloroplast ADP family protein                     234   6e-69   Populus trichocarpa [western balsam poplar]
ref|XP_011039999.1|  PREDICTED: plastidic ATP/ADP-transporter-like      233   2e-68   Populus euphratica
gb|EYU21596.1|  hypothetical protein MIMGU_mgv1a002865mg                233   4e-68   Erythranthe guttata [common monkey flower]
ref|XP_012073271.1|  PREDICTED: plastidic ATP/ADP-transporter           231   1e-67   Jatropha curcas
gb|AAZ23108.1|  plastid ATP/ADP transport protein 2                     231   2e-67   Manihot esculenta [manioc]
ref|XP_004506888.1|  PREDICTED: plastidic ATP/ADP-transporter-like      229   4e-67   Cicer arietinum [garbanzo]
ref|XP_002517555.1|  Plastidic ATP/ADP-transporter, putative            229   6e-67   Ricinus communis
gb|AAZ23106.1|  plastid ATP/ADP transport protein 1                     227   6e-66   Manihot esculenta [manioc]
ref|XP_010254276.1|  PREDICTED: plastidic ATP/ADP-transporter-like      226   9e-66   Nelumbo nucifera [Indian lotus]
gb|AAZ23107.1|  plastid ATP/ADP transport protein 2                     226   1e-65   Manihot esculenta [manioc]
gb|EYU24674.1|  hypothetical protein MIMGU_mgv1a002918mg                226   1e-65   Erythranthe guttata [common monkey flower]
ref|XP_007023974.1|  TLC ATP/ADP transporter isoform 2                  223   2e-65   
ref|XP_007023975.1|  TLC ATP/ADP transporter isoform 3                  222   3e-65   
dbj|BAD91180.1|  putative plastidic adenylate transporter               225   3e-65   Mesembryanthemum crystallinum
gb|KCW53784.1|  hypothetical protein EUGRSUZ_J03031                     222   5e-65   Eucalyptus grandis [rose gum]
gb|KJB13104.1|  hypothetical protein B456_002G057300                    224   6e-65   Gossypium raimondii
gb|KJB13103.1|  hypothetical protein B456_002G057300                    224   7e-65   Gossypium raimondii
ref|XP_006427151.1|  hypothetical protein CICLE_v10025170mg             224   7e-65   Citrus clementina [clementine]
ref|XP_007023973.1|  TLC ATP/ADP transporter isoform 1                  223   2e-64   
gb|ACU21332.1|  unknown                                                 213   2e-64   Glycine max [soybeans]
gb|KHG23248.1|  ADP,ATP carrier 1, chloroplastic -like protein          223   2e-64   Gossypium arboreum [tree cotton]
ref|XP_010033911.1|  PREDICTED: plastidic ATP/ADP-transporter-like      222   3e-64   Eucalyptus grandis [rose gum]
ref|XP_006465406.1|  PREDICTED: LOW QUALITY PROTEIN: plastidic AT...    221   7e-64   
gb|KJB70560.1|  hypothetical protein B456_011G079600                    216   3e-63   Gossypium raimondii
emb|CAN83628.1|  hypothetical protein VITISV_019239                     219   5e-63   Vitis vinifera
ref|XP_002285232.1|  PREDICTED: plastidic ATP/ADP-transporter           219   7e-63   Vitis vinifera
gb|KHG15786.1|  ADP,ATP carrier 1, chloroplastic -like protein          218   7e-63   Gossypium arboreum [tree cotton]
gb|AES68077.2|  plastidic ATP/ADP-transporter-like protein              218   9e-63   Medicago truncatula
gb|KJB70561.1|  hypothetical protein B456_011G079600                    216   1e-62   Gossypium raimondii
ref|XP_010532151.1|  PREDICTED: ADP,ATP carrier protein 1, chloro...    218   1e-62   Tarenaya hassleriana [spider flower]
ref|XP_010417726.1|  PREDICTED: ADP,ATP carrier protein 1, chloro...    218   1e-62   Camelina sativa [gold-of-pleasure]
ref|XP_010249956.1|  PREDICTED: plastidic ATP/ADP-transporter           218   2e-62   Nelumbo nucifera [Indian lotus]
gb|KJB56643.1|  hypothetical protein B456_009G129100                    217   2e-62   Gossypium raimondii
ref|XP_003597826.1|  ATP/ADP transporter                                217   3e-62   
emb|CDY39988.1|  BnaC06g40660D                                          217   3e-62   Brassica napus [oilseed rape]
gb|KJB70559.1|  hypothetical protein B456_011G079600                    216   6e-62   Gossypium raimondii
ref|XP_006307012.1|  hypothetical protein CARUB_v10008598mg             216   8e-62   Capsella rubella
ref|XP_009343421.1|  PREDICTED: plastidic ATP/ADP-transporter-like      215   1e-61   Pyrus x bretschneideri [bai li]
ref|XP_010061949.1|  PREDICTED: plastidic ATP/ADP-transporter-like      215   1e-61   Eucalyptus grandis [rose gum]
ref|XP_007217627.1|  hypothetical protein PRUPE_ppa002937mg             215   1e-61   Prunus persica
ref|XP_010537959.1|  PREDICTED: ADP,ATP carrier protein 1, chloro...    215   2e-61   Tarenaya hassleriana [spider flower]
ref|XP_006416899.1|  hypothetical protein EUTSA_v10007090mg             215   2e-61   Eutrema salsugineum [saltwater cress]
gb|KHN22476.1|  ADP,ATP carrier protein 1, chloroplastic                215   2e-61   Glycine soja [wild soybean]
gb|KHN44149.1|  ADP,ATP carrier protein 1, chloroplastic                214   2e-61   Glycine soja [wild soybean]
ref|XP_003543665.1|  PREDICTED: ADP,ATP carrier protein 1, chloro...    214   2e-61   Glycine max [soybeans]
gb|KJB68136.1|  hypothetical protein B456_010G227600                    213   5e-61   Gossypium raimondii
gb|KHG10295.1|  ADP,ATP carrier 1, chloroplastic -like protein          213   1e-60   Gossypium arboreum [tree cotton]
ref|XP_008228630.1|  PREDICTED: plastidic ATP/ADP-transporter-like      212   2e-60   Prunus mume [ume]
ref|XP_010099654.1|  Plastidic                                          211   5e-60   Morus notabilis
ref|XP_010476640.1|  PREDICTED: ADP,ATP carrier protein 2, chloro...    211   5e-60   Camelina sativa [gold-of-pleasure]
ref|XP_010691228.1|  PREDICTED: plastidic ATP/ADP-transporter           211   6e-60   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010497204.1|  PREDICTED: ADP,ATP carrier protein 2, chloro...    211   7e-60   Camelina sativa [gold-of-pleasure]
gb|KHG16971.1|  ADP,ATP carrier 1, chloroplastic -like protein          208   4e-59   Gossypium arboreum [tree cotton]
ref|XP_006585647.1|  PREDICTED: ADP,ATP carrier protein 1, chloro...    207   1e-58   Glycine max [soybeans]
ref|XP_003546196.1|  PREDICTED: ADP,ATP carrier protein 1, chloro...    207   1e-58   Glycine max [soybeans]
ref|XP_004147999.1|  PREDICTED: plastidic ATP/ADP-transporter           207   2e-58   Cucumis sativus [cucumbers]
ref|XP_008447482.1|  PREDICTED: plastidic ATP/ADP-transporter-like      206   2e-58   Cucumis melo [Oriental melon]
ref|XP_009106762.1|  PREDICTED: ADP,ATP carrier protein 1, chloro...    206   3e-58   Brassica rapa
ref|XP_008377604.1|  PREDICTED: plastidic ATP/ADP-transporter-like      206   5e-58   Malus domestica [apple tree]
gb|KEH28732.1|  plastidic ATP/ADP-transporter-like protein              206   5e-58   Medicago truncatula
gb|EPS64663.1|  hypothetical protein M569_10117                         206   6e-58   Genlisea aurea
ref|XP_006300855.1|  hypothetical protein CARUB_v10019948mg             205   7e-58   
ref|NP_178146.1|  ADP,ATP carrier protein 1                             205   9e-58   Arabidopsis thaliana [mouse-ear cress]
gb|AAK76577.1|  putative adenine nucleotide translocase                 205   1e-57   Arabidopsis thaliana [mouse-ear cress]
gb|KHN47790.1|  ADP,ATP carrier protein 1, chloroplastic                204   1e-57   Glycine soja [wild soybean]
ref|XP_002890107.1|  hypothetical protein ARALYDRAFT_471751             204   1e-57   
emb|CDX87299.1|  BnaA07g35740D                                          203   3e-57   
ref|XP_007150697.1|  hypothetical protein PHAVU_005G174000g             202   8e-57   Phaseolus vulgaris [French bean]
ref|XP_007135724.1|  hypothetical protein PHAVU_010G152900g             202   9e-57   Phaseolus vulgaris [French bean]
emb|CDX79394.1|  BnaC06g19090D                                          201   1e-56   
ref|XP_009104454.1|  PREDICTED: ADP,ATP carrier protein 1, chloro...    201   2e-56   Brassica rapa
ref|XP_006389778.1|  hypothetical protein EUTSA_v10018281mg             201   3e-56   Eutrema salsugineum [saltwater cress]
ref|XP_002889299.1|  chloroplast ADP, ATP carrier protein 1             201   3e-56   
emb|CDX83974.1|  BnaC08g16710D                                          200   3e-56   
ref|XP_010472951.1|  PREDICTED: ADP,ATP carrier protein 1, chloro...    200   4e-56   Camelina sativa [gold-of-pleasure]
ref|XP_010429982.1|  PREDICTED: ADP,ATP carrier protein 1, chloro...    200   5e-56   Camelina sativa [gold-of-pleasure]
ref|NP_173003.1|  ADP,ATP carrier protein 2                             199   8e-56   Arabidopsis thaliana [mouse-ear cress]
emb|CDY57697.1|  BnaA07g38360D                                          199   8e-56   Brassica napus [oilseed rape]
gb|KFK42425.1|  hypothetical protein AALP_AA2G254500                    198   2e-55   Arabis alpina [alpine rockcress]
ref|XP_009388534.1|  PREDICTED: plastidic ATP/ADP-transporter-like      198   4e-55   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004302940.1|  PREDICTED: ADP,ATP carrier protein 1, chloro...    197   8e-55   Fragaria vesca subsp. vesca
gb|AAM29152.1|  plastidic ATP/ADP transporter                           196   1e-54   Citrus hybrid cultivar
gb|KHN01355.1|  ADP,ATP carrier protein 1, chloroplastic                195   3e-54   Glycine soja [wild soybean]
ref|XP_006583133.1|  PREDICTED: ADP,ATP carrier protein 1, chloro...    195   3e-54   Glycine max [soybeans]
ref|XP_009148947.1|  PREDICTED: ADP,ATP carrier protein 2, chloro...    192   3e-53   Brassica rapa
ref|XP_009381260.1|  PREDICTED: ADP,ATP carrier protein 1, chloro...    192   8e-53   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY36568.1|  BnaA06g10210D                                          191   9e-53   Brassica napus [oilseed rape]
ref|XP_009407647.1|  PREDICTED: plastidic ATP/ADP-transporter-like      191   2e-52   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006829678.1|  PREDICTED: ADP,ATP carrier protein 1, chloro...    188   2e-51   Amborella trichopoda
ref|XP_009110479.1|  PREDICTED: ADP,ATP carrier protein 2, chloro...    187   4e-51   Brassica rapa
emb|CDY39658.1|  BnaC05g11870D                                          186   5e-51   Brassica napus [oilseed rape]
ref|XP_004487222.1|  PREDICTED: plastidic ATP/ADP-transporter-like      186   7e-51   Cicer arietinum [garbanzo]
ref|XP_008785487.1|  PREDICTED: ADP,ATP carrier protein 2, chloro...    185   2e-50   Phoenix dactylifera
ref|XP_010925271.1|  PREDICTED: plastidic ATP/ADP-transporter-like      185   3e-50   Elaeis guineensis
ref|XP_010925128.1|  PREDICTED: ADP,ATP carrier protein 1, chloro...    185   4e-50   
emb|CDX96838.1|  BnaA08g23810D                                          182   1e-49   
emb|CAA89201.2|  adenine nucleotide translocase                         182   3e-49   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008809354.1|  PREDICTED: ADP,ATP carrier protein 2, chloro...    181   7e-49   Phoenix dactylifera
ref|XP_008792130.1|  PREDICTED: plastidic ATP/ADP-transporter-like      179   3e-48   Phoenix dactylifera
ref|XP_010914961.1|  PREDICTED: plastidic ATP/ADP-transporter-like      179   3e-48   Elaeis guineensis
ref|XP_003571578.1|  PREDICTED: plastidic ATP/ADP-transporter-like      174   2e-46   Brachypodium distachyon [annual false brome]
dbj|BAJ89983.1|  predicted protein                                      173   2e-46   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EAY84955.1|  hypothetical protein OsI_06319                          173   3e-46   Oryza sativa Indica Group [Indian rice]
dbj|BAD24996.1|  putative plastidic ATP/ADP transporter                 173   4e-46   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009409613.1|  PREDICTED: plastidic ATP/ADP-transporter           166   6e-46   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMT25116.1|  ADP,ATP carrier protein 1, chloroplastic                172   7e-46   
gb|AFW71370.1|  hypothetical protein ZEAMMB73_421978                    169   2e-45   
ref|XP_002974477.1|  hypothetical protein SELMODRAFT_101296             170   3e-45   
ref|XP_006646147.1|  PREDICTED: plastidic ATP/ADP-transporter-like      169   4e-45   
ref|XP_002451752.1|  hypothetical protein SORBIDRAFT_04g007240          169   8e-45   
ref|NP_001140537.1|  uncharacterized protein LOC100272602               169   1e-44   Zea mays [maize]
ref|XP_008681386.1|  PREDICTED: uncharacterized protein LOC100272...    168   2e-44   Zea mays [maize]
ref|XP_006648444.1|  PREDICTED: plastidic ATP/ADP-transporter-like      167   2e-44   
ref|XP_004951502.1|  PREDICTED: plastidic ATP/ADP-transporter-like      167   3e-44   Setaria italica
dbj|BAJ87646.1|  predicted protein                                      157   7e-44   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002458233.1|  hypothetical protein SORBIDRAFT_03g029490          166   1e-43   Sorghum bicolor [broomcorn]
ref|XP_002990822.1|  hypothetical protein SELMODRAFT_21240              164   2e-43   
gb|AAX58120.1|  plastid ATP/ADP transporter                             165   3e-43   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001043710.1|  Os01g0647100                                       165   3e-43   
gb|EAZ12893.1|  hypothetical protein OsJ_02814                          164   5e-43   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003569451.1|  PREDICTED: plastidic ATP/ADP-transporter-like      164   7e-43   Brachypodium distachyon [annual false brome]
gb|AFW83424.1|  hypothetical protein ZEAMMB73_806603                    164   8e-43   
ref|XP_008657814.1|  PREDICTED: ADP,ATP carrier protein 2, chloro...    164   8e-43   
ref|XP_004969309.1|  PREDICTED: plastidic ATP/ADP-transporter-like      163   1e-42   Setaria italica
ref|XP_006838934.1|  PREDICTED: ADP,ATP carrier protein 2, chloro...    163   1e-42   Amborella trichopoda
ref|XP_010279263.1|  PREDICTED: ADP,ATP carrier protein 1, chloro...    163   1e-42   Nelumbo nucifera [Indian lotus]
gb|AAX63195.1|  putative plastidic ATP/ADP transporter                  163   1e-42   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001147851.1|  plastidic ATP/ADP-transporter                      162   3e-42   Zea mays [maize]
ref|XP_008672827.1|  PREDICTED: plastidic ATP/ADP-transporter iso...    162   3e-42   
gb|EMT31396.1|  Plastidic ATP/ADP-transporter                           162   4e-42   
tpg|DAA58346.1|  TPA: plastidic ATP/ADP-transporter                     161   5e-42   
ref|XP_010325110.1|  PREDICTED: plastidic ATP/ADP-transporter           150   1e-41   
gb|AAV65341.1|  putative plastidic ATP/ADP-transporter                  151   5e-41   Prototheca wickerhamii
ref|XP_005844203.1|  hypothetical protein CHLNCDRAFT_56336              154   1e-39   Chlorella variabilis
ref|XP_001780035.1|  predicted protein                                  153   4e-39   
ref|XP_001773938.1|  predicted protein                                  152   9e-39   
ref|XP_005643478.1|  ADP/ATP carrier protein                            149   9e-38   Coccomyxa subellipsoidea C-169
ref|XP_011401420.1|  ADP,ATP carrier protein 1, chloroplastic           146   8e-37   Auxenochlorella protothecoides
gb|KDD74050.1|  TLC ATP/ADP transporter                                 145   1e-36   Helicosporidium sp. ATCC 50920
gb|KIY98283.1|  ADP,ATP carrier protein 2                               144   2e-36   Monoraphidium neglectum
ref|XP_002947450.1|  hypothetical protein VOLCADRAFT_79605              142   2e-35   Volvox carteri f. nagariensis
ref|XP_001703733.1|  plastidic ADP/ATP translocase                      142   3e-35   Chlamydomonas reinhardtii
gb|EMS68334.1|  ADP,ATP carrier protein 1, chloroplastic                139   2e-34   Triticum urartu
emb|CBI36236.3|  unnamed protein product                                139   4e-34   Vitis vinifera
gb|EMS56290.1|  Plastidic ATP/ADP-transporter                           134   1e-32   Triticum urartu
gb|KDO58239.1|  hypothetical protein CISIN_1g012495mg                   133   2e-32   Citrus sinensis [apfelsine]
ref|XP_002982220.1|  hypothetical protein SELMODRAFT_116019             130   4e-31   
gb|ABV25604.1|  plastid ATP/ADP translocase                             121   5e-28   Prymnesium parvum
emb|CBJ27353.1|  plastidic ATP/ADP transporter                          120   2e-27   Ectocarpus siliculosus
ref|WP_020356125.1|  MULTISPECIES: ADP,ATP carrier protein              118   5e-27   Chlamydia
gb|ABH10983.1|  plastid ATP/ADP transporter                             118   6e-27   Polytomella parva
gb|AFS19477.1|  TLC ATP/ADP transporter family protein                  115   8e-27   Chlamydia psittaci 84/55
ref|WP_021757805.1|  ADP/ATP carrier protein                            117   1e-26   Chlamydia pecorum
ref|WP_013712807.1|  ATPase AAA                                         117   1e-26   Chlamydia pecorum
ref|WP_021756588.1|  ADP/ATP carrier protein                            117   1e-26   Chlamydia pecorum
ref|WP_013747357.1|  ATPase AAA                                         116   2e-26   Chlamydia psittaci
ref|WP_006343113.1|  ATPase AAA                                         116   3e-26   Chlamydia psittaci
ref|WP_006344068.1|  ATPase AAA                                         116   3e-26   Chlamydia abortus
ref|XP_010924175.1|  PREDICTED: LOW QUALITY PROTEIN: plastidic AT...    114   3e-26   
gb|EPJ33718.1|  ADP/ATP carrier family protein                          116   3e-26   Chlamydia psittaci 06-1683
ref|WP_011097058.1|  ATPase AAA                                         116   3e-26   Chlamydia abortus
ref|WP_011006397.1|  ATPase AAA                                         116   3e-26   Chlamydia caviae
ref|WP_032741515.1|  ATPase AAA                                         116   3e-26   
ref|WP_020370051.1|  MULTISPECIES: ADP,ATP carrier family protein       115   7e-26   Chlamydia ibidis
ref|XP_005536231.1|  chloroplast ADP,ATP carrier protein                116   9e-26   Cyanidioschyzon merolae strain 10D
ref|WP_021828277.1|  MULTISPECIES: ADP/ATP carrier family protein       115   1e-25   Chlamydia gallinacea
ref|WP_010230191.1|  ADP,ATP carrier protein 1                          115   1e-25   Chlamydia muridarum [agent of mouse pneumonitis]
ref|WP_035405565.1|  ATPase AAA                                         114   2e-25   Chlamydia suis
gb|ABV25597.1|  plastid ATP/ADP translocase                             112   8e-25   Euglena gracilis
ref|WP_011458125.1|  ATPase AAA                                         112   8e-25   Chlamydia felis
ref|WP_011324550.1|  ATPase AAA                                         112   1e-24   Chlamydia trachomatis
emb|CAC80882.1|  plastidic ATP/ADP transporter                          113   1e-24   Galdieria sulphuraria
ref|XP_005707402.1|  ATP:ADP antiporter, AAA family                     113   1e-24   Galdieria sulphuraria
ref|WP_014541221.1|  ATPase AAA                                         111   1e-24   Chlamydia trachomatis
ref|WP_009873033.1|  ADP,ATP carrier protein 1                          111   2e-24   Chlamydia trachomatis
ref|WP_015506544.1|  ADP/ATP carrier protein family protein             111   2e-24   Chlamydia trachomatis
ref|WP_009871413.1|  ADP,ATP carrier protein 1                          111   2e-24   Chlamydia trachomatis
ref|WP_009873532.1|  ATPase AAA                                         111   2e-24   Chlamydia trachomatis
ref|WP_012727795.1|  ADP,ATP carrier protein 1                          111   2e-24   Chlamydia trachomatis
ref|XP_001693815.1|  plastidic ADP/ATP translocase                      112   2e-24   Chlamydomonas reinhardtii
gb|EWM29257.1|  plastidic atp adp transporter                           111   3e-24   Nannochloropsis gaditana
emb|CBJ30232.1|  plastidic ATP/ADP transporter                          110   5e-24   Ectocarpus siliculosus
ref|WP_014517776.1|  ATPase AAA                                         110   6e-24   Chlamydia pneumoniae
ref|WP_010895317.1|  ATPase AAA                                         109   6e-24   Chlamydia pneumoniae
ref|WP_010882994.1|  ADP,ATP carrier protein 1                          109   7e-24   Chlamydia pneumoniae
ref|WP_013942850.1|  ATPase AAA                                         109   9e-24   Simkania negevensis
ref|XP_009037704.1|  hypothetical protein AURANDRAFT_27252              109   1e-23   Aureococcus anophagefferens
ref|XP_002292665.1|  predicted protein                                  108   3e-23   Thalassiosira pseudonana CCMP1335
ref|WP_042102387.1|  ATPase AAA                                         107   5e-23   Parachlamydiaceae bacterium HS-T3
ref|WP_006340593.1|  ATPase AAA                                         106   9e-23   Parachlamydia acanthamoebae
ref|WP_042239794.1|  ATPase AAA                                         106   1e-22   Neochlamydia sp. S13
ref|WP_039386022.1|  ATPase AAA                                         106   1e-22   Neochlamydia sp. TUME1
ref|WP_044881792.1|  ATPase AAA                                         106   1e-22   Neochlamydia sp. EPS4
gb|ABV25596.1|  plastid ATP/ADP translocase                             105   2e-22   Pyropia yezoensis
ref|WP_041941596.1|  ATPase AAA                                         105   2e-22   Waddlia chondrophila
gb|EYE60388.1|  ADP,ATP carrier protein 2                               105   2e-22   Bacteroides fragilis str. S6L5
gb|EJK46221.1|  hypothetical protein THAOC_35120                        105   2e-22   Thalassiosira oceanica
gb|EPJ16785.1|  ADP,ATP carrier protein                                 105   2e-22   Chlamydia psittaci 02DC22
gb|ADI39022.1|  ADP/ATP translocase                                     105   2e-22   Waddlia chondrophila WSU 86-1044
gb|EEE56534.1|  hypothetical protein OsJ_05838                          105   3e-22   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002184271.1|  nucleotide transporter 1                           104   6e-22   Phaeodactylum tricornutum CCAP 1055/1
gb|KEI72701.1|  ATPase AAA                                              103   6e-22   Endozoicomonas elysicola
ref|WP_033402749.1|  ATPase AAA                                         103   7e-22   
ref|WP_010299901.1|  ATPase AAA                                         103   1e-21   Candidatus Odyssella thessalonicensis
ref|WP_038465856.1|  ATPase AAA                                         102   4e-21   Candidatus Paracaedibacter acanthamoebae
ref|WP_032124907.1|  ATPase AAA                                         102   4e-21   Candidatus Protochlamydia massiliensis
gb|ABG37645.1|  plastid ATP/ADP-transporter                             102   4e-21   Populus trichocarpa [western balsam poplar]
emb|CAX16540.1|  putative ATP/ADP translocase                           100   9e-21   Trieres chinensis
ref|WP_032112829.1|  ATPase AAA                                         100   1e-20   Candidatus Paracaedibacter symbiosus
ref|XP_005769576.1|  hypothetical protein EMIHUDRAFT_244401           95.9    4e-20   Emiliania huxleyi CCMP1516
ref|WP_032124897.1|  ATPase AAA                                       96.7    3e-19   Candidatus Protochlamydia
ref|XP_005781450.1|  hypothetical protein EMIHUDRAFT_234229           94.0    3e-19   Emiliania huxleyi CCMP1516
ref|WP_011174791.1|  ATPase AAA                                       96.3    3e-19   Candidatus Protochlamydia amoebophila
ref|XP_005769878.1|  hypothetical protein EMIHUDRAFT_451418           95.9    4e-19   Emiliania huxleyi CCMP1516
ref|WP_042280889.1|  ATPase AAA                                       95.9    5e-19   Candidatus Protochlamydia sp. R18
ref|WP_039356292.1|  ATPase AAA                                       95.9    5e-19   Candidatus Protochlamydia amoebophila
gb|KIC73929.1|  ADP,ATP carrier protein 1                             95.9    5e-19   Candidatus Protochlamydia amoebophila
ref|WP_018576123.1|  hypothetical protein                             95.5    7e-19   Legionella shakespearei
gb|EKE09230.1|  hypothetical protein ACD_16C00205G0026                93.6    3e-18   uncultured bacterium
gb|EPP28995.1|  ADP,ATP carrier protein                               87.4    3e-18   Chlamydia psittaci 84-8471/1
ref|XP_005763298.1|  hypothetical protein EMIHUDRAFT_465146           94.7    3e-18   Emiliania huxleyi CCMP1516
gb|AIL13243.1|  ATPase AAA                                            93.2    4e-18   Candidatus Paracaedimonas acanthamoebae
ref|WP_041017341.1|  hypothetical protein                             90.9    2e-17   Criblamydia sequanensis
emb|CAE46503.1|  nucleotide transport protein                         87.8    1e-16   Candidatus Paracaedibacter symbiosus
ref|WP_013182747.1|  ATPase AAA                                       88.6    2e-16   Waddlia chondrophila
gb|AAT99359.1|  chloroplast ATP/ADP transporter protein               88.2    2e-16   Helianthus tuberosus [Jerusalem artichoke]
ref|WP_013181317.1|  ADP/ATP translocase                              88.2    2e-16   Waddlia chondrophila
emb|CCB92155.1|  ADP,ATP carrier protein 1                            88.6    2e-16   Waddlia chondrophila 2032/99
ref|WP_044881209.1|  ATPase AAA                                       88.2    2e-16   Neochlamydia sp. EPS4
ref|WP_039383351.1|  ATPase AAA                                       88.2    2e-16   Neochlamydia sp. TUME1
ref|WP_042241991.1|  ATPase AAA                                       88.2    2e-16   Neochlamydia sp. S13
gb|KIC73885.1|  ADP,ATP carrier protein 1                             87.0    6e-16   Candidatus Protochlamydia amoebophila
ref|WP_011174800.1|  ATPase AAA                                       87.0    6e-16   Candidatus Protochlamydia amoebophila
ref|WP_039356341.1|  ATPase AAA                                       86.7    6e-16   Candidatus Protochlamydia amoebophila
emb|CAE46506.1|  nucleotide transport protein                         86.7    6e-16   Candidatus Protochlamydia amoebophila UWE25
ref|WP_042280868.1|  ATPase AAA                                       86.7    6e-16   Candidatus Protochlamydia sp. R18
ref|WP_041018366.1|  ATPase AAA                                       86.3    8e-16   Criblamydia sequanensis
emb|CDZ80021.1|  ADP/ATP translocase 1                                84.3    4e-15   Candidatus Rubidus massiliensis
gb|EKE09902.1|  hypothetical protein ACD_16C00100G0064                84.3    5e-15   uncultured bacterium
ref|XP_009381875.1|  PREDICTED: uncharacterized protein LOC103969968  85.1    5e-15   
gb|EKE08335.1|  ADP/ATP translocase                                   84.0    5e-15   uncultured bacterium
ref|WP_032124047.1|  ATPase AAA                                       84.0    5e-15   Candidatus Protochlamydia
emb|CDZ79514.1|  ADP/ATP translocase 1                                83.6    7e-15   Candidatus Rubidus massiliensis
ref|WP_032124896.1|  ATPase AAA                                       83.6    7e-15   Candidatus Protochlamydia massiliensis
ref|WP_011526090.1|  ATPase AAA                                       83.2    1e-14   Lawsonia intracellularis
emb|CAQ03489.1|  ATP/ADP translocase                                  83.2    1e-14   Lawsonia intracellularis
ref|WP_011174790.1|  ATPase AAA                                       82.0    2e-14   Candidatus Protochlamydia amoebophila
ref|WP_039356289.1|  ATPase AAA                                       82.0    2e-14   Candidatus Protochlamydia amoebophila
ref|WP_042280890.1|  ATPase AAA                                       82.0    2e-14   Candidatus Protochlamydia sp. R18
ref|WP_042103597.1|  ATPase AAA                                       81.3    4e-14   Parachlamydiaceae bacterium HS-T3
ref|WP_006341708.1|  ATPase AAA                                       81.3    4e-14   Parachlamydia acanthamoebae
ref|WP_041018292.1|  ATPase AAA                                       79.3    2e-13   Criblamydia sequanensis
ref|WP_042102375.1|  ATPase AAA                                       79.0    2e-13   Parachlamydiaceae bacterium HS-T3
ref|WP_042102374.1|  ATPase AAA                                       79.0    2e-13   Parachlamydiaceae bacterium HS-T3
ref|XP_005823901.1|  hypothetical protein GUITHDRAFT_165621           79.0    2e-13   Guillardia theta CCMP2712
gb|ABV25595.1|  plastid ATP/ADP translocase                           79.0    3e-13   Guillardia theta
gb|KJV52651.1|  TLC ATP/ADP transporter family protein                73.2    4e-13   Orientia tsutsugamushi str. Gilliam
ref|WP_045917027.1|  ATPase AAA                                       75.5    7e-13   
ref|WP_013944554.1|  ATPase AAA                                       77.4    7e-13   Simkania negevensis
gb|EWM22407.1|  carrier protein                                       77.8    8e-13   Nannochloropsis gaditana
gb|EOB09846.1|  ADP,ATP carrier protein 3                             74.7    8e-13   Rickettsia prowazekii str. GvF12
ref|WP_045918517.1|  ATPase AAA                                       77.0    9e-13   Orientia tsutsugamushi
gb|KJW03880.1|  ADP,ATP carrier protein 1                             77.0    9e-13   Orientia tsutsugamushi str. Sido
ref|WP_045912127.1|  ATPase AAA                                       77.0    1e-12   Orientia tsutsugamushi
ref|WP_041621135.1|  ATPase AAA                                       77.0    1e-12   Orientia tsutsugamushi
emb|CAM79613.1|  ATP/ADP translocase                                  77.0    1e-12   Orientia tsutsugamushi str. Boryong
ref|WP_045797469.1|  ATPase AAA                                       76.6    1e-12   
emb|CDZ79513.1|  ADP/ATP translocase 1                                76.6    2e-12   
ref|WP_019230826.1|  hypothetical protein                             76.3    2e-12   
ref|WP_041018291.1|  ATPase AAA                                       76.3    2e-12   
ref|WP_045919019.1|  ATPase AAA                                       73.6    2e-12   
ref|WP_042241994.1|  ATPase AAA                                       76.3    2e-12   
ref|WP_044881208.1|  ATPase AAA                                       76.3    2e-12   
ref|WP_012778542.1|  ATPase AAA                                       75.9    2e-12   
gb|KIC76343.1|  ADP,ATP carrier protein 1                             75.9    2e-12   
ref|WP_045917786.1|  ATPase AAA                                       75.9    3e-12   
ref|WP_012461410.1|  ATPase AAA                                       75.9    3e-12   
ref|WP_045917909.1|  ATPase AAA                                       75.5    3e-12   
gb|KJV62418.1|  TLC ATP/ADP transporter family protein                73.6    3e-12   
ref|WP_045913898.1|  ATPase AAA                                       75.1    4e-12   
gb|KJW05722.1|  ADP,ATP carrier protein 1                             75.5    4e-12   
ref|WP_039383352.1|  ATPase AAA                                       75.5    4e-12   
ref|WP_040055857.1|  ATPase AAA                                       75.1    4e-12   
emb|CAD29686.1|  nucleoside triphosphate protein                      75.1    5e-12   
gb|EKE21600.1|  hypothetical protein ACD_7C00172G0001                 69.3    5e-12   
ref|WP_045797041.1|  ATPase AAA                                       74.3    8e-12   
gb|EJK47706.1|  hypothetical protein THAOC_33559                      74.7    8e-12   
ref|WP_012148616.1|  ATPase AAA                                       74.3    9e-12   
ref|WP_014363850.1|  ATPase AAA                                       73.9    9e-12   
ref|WP_006341707.1|  ATPase AAA                                       74.3    9e-12   
ref|WP_004599498.1|  ADP,ATP carrier protein 3                        73.9    9e-12   
gb|KIA76916.1|  ADP,ATP carrier protein 1                             74.3    9e-12   
ref|WP_014411745.1|  ADP,ATP carrier protein 3                        73.9    9e-12   
gb|ACX71867.1|  nucleotide tansporter                                 73.9    1e-11   
ref|WP_015508430.1|  ADP,ATP carrier protein 3                        73.9    1e-11   
ref|WP_014411709.1|  ADP,ATP carrier protein 3                        73.9    1e-11   
ref|WP_026071769.1|  ATPase AAA                                       73.9    1e-11   
ref|WP_045805873.1|  ATPase AAA                                       73.9    1e-11   
ref|WP_014014428.1|  ATPase AAA                                       73.9    1e-11   
emb|CAD45260.1|  ADP/ATP carrier protein                              73.9    1e-11   
ref|WP_011190922.1|  ADP,ATP carrier protein 3                        73.9    1e-11   
ref|WP_013950719.1|  ATPase AAA                                       73.9    1e-11   
ref|WP_045912577.1|  ATPase AAA                                       73.9    1e-11   
ref|WP_045917850.1|  ATPase AAA                                       73.6    1e-11   
ref|WP_012461657.1|  ATPase AAA                                       73.6    1e-11   
ref|WP_014408739.1|  ATPase AAA                                       73.6    1e-11   
ref|WP_014365712.1|  ATPase AAA                                       73.6    1e-11   
ref|WP_045917334.1|  ATPase AAA                                       73.6    1e-11   
ref|WP_045914238.1|  ATPase AAA                                       73.6    1e-11   
ref|WP_016728266.1|  ADP,ATP carrier protein 4                        73.6    1e-11   
ref|WP_004998312.1|  ATPase AAA                                       73.6    1e-11   
ref|WP_010977341.1|  ADP,ATP carrier protein 3                        73.6    1e-11   
emb|CAD45258.1|  ADP/ATP carrier protein                              73.6    1e-11   
ref|WP_014392438.1|  ATPase AAA                                       73.6    2e-11   
ref|WP_014273542.1|  MULTISPECIES: ADP,ATP carrier protein 3          73.6    2e-11   
ref|WP_012736807.1|  ATPase AAA                                       73.6    2e-11   
ref|WP_014409298.1|  ATPase AAA                                       73.6    2e-11   
gb|EOB10124.1|  ADP,ATP carrier protein 1                             71.6    2e-11   
gb|ABV84933.1|  ATP/ADP translocase                                   73.6    2e-11   
ref|WP_014410778.1|  ATPase AAA                                       73.6    2e-11   
ref|WP_041078602.1|  ATPase AAA                                       73.6    2e-11   
ref|WP_039595009.1|  ATPase AAA                                       73.6    2e-11   
ref|WP_032138729.1|  ATPase AAA                                       73.6    2e-11   
ref|WP_016916871.1|  ATPase AAA                                       73.6    2e-11   
ref|WP_014364774.1|  ATPase AAA                                       73.6    2e-11   
emb|CAD45259.1|  ADP/ATP carrier protein                              73.6    2e-11   
ref|WP_023508224.1|  ADP/ATP translocase 1                            73.6    2e-11   
ref|WP_016945727.1|  ADP,ATP carrier protein 4                        73.2    2e-11   
ref|WP_012719774.1|  ATPase AAA                                       73.2    2e-11   
ref|WP_045804073.1|  ATPase AAA                                       73.2    2e-11   
ref|WP_012150908.1|  ATPase AAA                                       73.2    2e-11   
ref|WP_010422925.1|  ATPase AAA                                       73.2    2e-11   
ref|WP_014412653.1|  ATPase AAA                                       73.2    2e-11   
ref|WP_014362908.1|  ATPase AAA                                       73.2    2e-11   
ref|WP_034442354.1|  ATPase AAA                                       73.2    2e-11   
ref|WP_040255821.1|  ATPase AAA                                       73.2    2e-11   
ref|WP_014120865.1|  ATPase AAA                                       73.2    2e-11   
gb|KJZ82382.1|  ADP/ATP Translocase, NTT1                             73.2    2e-11   
gb|ACZ95367.1|  ATP/ADP translocase                                   73.2    2e-11   
ref|WP_012149674.1|  ATPase AAA                                       73.2    2e-11   
ref|WP_044054082.1|  ATPase AAA                                       73.2    2e-11   
ref|WP_045798877.1|  ATPase AAA                                       72.8    2e-11   
ref|WP_011477389.1|  ADP,ATP carrier protein 3                        72.8    3e-11   
ref|WP_045799871.1|  ATPase AAA                                       72.4    3e-11   
ref|WP_045805938.1|  ATPase AAA                                       72.4    3e-11   
ref|WP_014120469.1|  ATPase AAA                                       72.4    3e-11   
ref|WP_012151548.1|  ATPase AAA                                       72.4    3e-11   
ref|WP_011478005.1|  ADP,ATP carrier protein 1                        72.4    3e-11   
ref|WP_016917366.1|  ATPase AAA                                       72.4    3e-11   
ref|WP_012013291.1|  ATPase AAA                                       72.4    4e-11   
ref|WP_011944393.1|  ATPase AAA                                       72.4    4e-11   
ref|WP_017442801.1|  ATPase AAA                                       72.0    4e-11   
ref|WP_014409826.1|  ATPase AAA                                       72.0    4e-11   
ref|WP_014365220.1|  ATPase AAA                                       72.0    4e-11   
ref|WP_012152377.1|  ATPase AAA                                       72.0    4e-11   
ref|WP_008579871.1|  MULTISPECIES: ATPase AAA                         72.0    4e-11   
ref|WP_011270476.1|  MULTISPECIES: ADP,ATP carrier protein 1          72.0    4e-11   
ref|WP_040256787.1|  ATPase AAA                                       72.0    5e-11   
ref|WP_017443549.1|  ATPase AAA                                       72.0    5e-11   
ref|WP_023507442.1|  ADP/ATP translocase 1                            72.0    5e-11   
ref|WP_014408143.1|  ATPase AAA                                       72.0    5e-11   
ref|WP_029374502.1|  ATPase AAA                                       72.0    5e-11   
ref|WP_010420545.1|  ATPase AAA                                       72.0    5e-11   
ref|WP_012148204.1|  ATPase AAA                                       72.0    5e-11   
ref|WP_014013803.1|  ATPase AAA                                       72.0    5e-11   
ref|WP_004996827.1|  ATPase AAA                                       72.0    5e-11   
ref|WP_014363523.1|  ATPase AAA                                       72.0    5e-11   
ref|WP_029374609.1|  ATPase AAA                                       72.0    5e-11   
ref|WP_045812758.1|  ATPase AAA                                       72.0    5e-11   
ref|WP_014412084.1|  ATPase AAA                                       72.0    5e-11   
ref|WP_008579514.1|  MULTISPECIES: ATPase AAA                         72.0    5e-11   
ref|WP_045799376.1|  ATPase AAA                                       72.0    5e-11   
ref|WP_014391766.1|  ATPase AAA                                       72.0    5e-11   
ref|WP_029374421.1|  ATPase AAA                                       72.0    5e-11   
ref|WP_010976765.1|  ADP,ATP carrier protein 1                        72.0    5e-11   
emb|CBJ31945.1|  conserved unknown protein                            72.0    5e-11   
emb|CAD45252.1|  ADP/ATP carrier protein                              72.0    5e-11   
ref|WP_004599717.1|  ADP,ATP carrier protein 1                        72.0    5e-11   
ref|WP_012736586.1|  ATPase AAA                                       72.0    5e-11   
ref|WP_014364363.1|  ATPase AAA                                       72.0    5e-11   
ref|WP_016769753.1|  ATPase AAA                                       72.0    5e-11   
ref|WP_014410317.1|  ATPase AAA                                       72.0    5e-11   
emb|CAD45254.1|  ADP/ATP carrier protein                              71.6    5e-11   
ref|WP_032139269.1|  ATPase AAA                                       71.6    5e-11   
ref|WP_012150309.1|  ATPase AAA                                       71.6    5e-11   
ref|WP_014411976.1|  ATPase AAA                                       71.6    5e-11   
ref|WP_014273134.1|  ATPase AAA                                       71.6    5e-11   
ref|WP_012719352.1|  ATPase AAA                                       71.6    6e-11   
ref|XP_005852785.1|  carrier protein                                  70.1    6e-11   
ref|XP_002296839.1|  predicted protein                                72.0    6e-11   
gb|ADR52253.1|  ATP/ADP translocase                                   71.6    6e-11   
ref|WP_011190552.1|  ADP,ATP carrier protein 1                        71.6    7e-11   
ref|WP_041941597.1|  ATPase AAA                                       71.6    7e-11   
ref|WP_045799669.1|  ATPase AAA                                       70.5    1e-10   
ref|WP_006342008.1|  translocase                                      70.5    2e-10   
gb|EWM20928.1|  carrier protein                                       70.5    2e-10   
ref|WP_006293548.1|  MULTISPECIES: ADP/ATP carrier protein family...  70.1    2e-10   
ref|WP_011271165.1|  ADP,ATP carrier protein 3                        69.7    3e-10   
emb|CBJ27483.1|  ADP-ATP translocase                                  68.2    9e-10   
gb|ABV25594.1|  plastid ATP/ADP translocase                           67.8    1e-09   
ref|XP_007514597.1|  ADP/ATP translocase                              67.8    1e-09   
gb|AAM80566.1|  non-mitochondrial nucleotide transport protein        67.8    1e-09   
ref|WP_040458412.1|  hypothetical protein                             67.4    1e-09   
ref|XP_005855475.1|  carrier protein                                  67.4    1e-09   
gb|EWM29345.1|  carrier protein                                       67.4    2e-09   
ref|WP_013943650.1|  ADP,ATP carrier protein 1                        67.0    2e-09   
gb|KIZ03259.1|  ADP,ATP carrier protein 1                             66.2    3e-09   
gb|AHA27724.1|  ATP/ADP translocase                                   66.2    4e-09   
gb|AAX45330.1|  ADP-ATP translocase                                   65.5    6e-09   
gb|ADI39042.1|  putative ADP/ATP translocase                          65.5    7e-09   
gb|KJV58125.1|  ADP,ATP carrier protein 1                             65.1    9e-09   
gb|KJV78776.1|  ADP,ATP carrier protein 1                             65.1    9e-09   
gb|KJV61463.1|  ADP,ATP carrier protein 1                             65.1    1e-08   
gb|KIZ04926.1|  ADP,ATP carrier protein 1                             65.1    1e-08   
ref|WP_045812479.1|  ADP/ATP carrier protein                          64.7    1e-08   
ref|WP_023508306.1|  ADP/ATP translocase 1                            64.3    2e-08   
ref|WP_040257571.1|  ADP/ATP carrier protein                          64.3    2e-08   
ref|XP_002179404.1|  nucleotide transporter 2                         64.3    2e-08   
ref|WP_008579745.1|  MULTISPECIES: ADP,ATP carrier protein 2          64.3    2e-08   
ref|WP_045803816.1|  ADP/ATP carrier protein                          64.3    2e-08   
ref|WP_012149491.1|  ADP,ATP carrier protein                          63.9    2e-08   
ref|WP_014412858.1|  ADP,ATP carrier protein                          63.9    2e-08   
ref|WP_032139617.1|  ADP/ATP carrier protein                          63.9    2e-08   
ref|WP_014364648.1|  ADP,ATP carrier protein                          63.9    2e-08   
ref|WP_041078078.1|  ADP/ATP carrier protein                          63.5    3e-08   
gb|KIZ03752.1|  ADP,ATP carrier protein 1                             60.8    3e-08   
ref|WP_010423282.1|  ADP,ATP carrier protein                          63.5    3e-08   
ref|WP_012719633.1|  ADP,ATP carrier protein 2                        63.2    4e-08   
ref|WP_011270922.1|  ADP,ATP carrier protein 2                        63.2    4e-08   
emb|CAD45257.1|  ADP/ATP carrier protein                              63.2    4e-08   
ref|WP_011190829.1|  ADP/ATP carrier protein 2                        63.2    5e-08   
ref|WP_032125087.1|  hypothetical protein                             62.8    5e-08   
ref|WP_012152708.1|  ATP/ADP translocase                              62.8    5e-08   
ref|WP_014408522.1|  ATP/ADP translocase                              62.8    5e-08   
ref|WP_012736927.1|  ADP,ATP carrier protein                          62.8    5e-08   
ref|WP_014365915.1|  ATP/ADP translocase                              62.8    5e-08   
ref|WP_016945632.1|  ADP,ATP carrier protein 2                        62.8    5e-08   
ref|WP_004599439.1|  ADP,ATP carrier protein 2                        62.8    5e-08   
ref|WP_017442991.1|  ADP,ATP carrier protein 2                        62.8    5e-08   
ref|WP_004995912.1|  ADP,ATP carrier protein 2                        62.8    5e-08   
ref|WP_014410197.1|  ADP,ATP carrier protein                          62.8    5e-08   
ref|WP_010977161.1|  ADP,ATP carrier protein 2                        62.8    5e-08   
ref|WP_016770095.1|  ADP,ATP carrier protein 2                        62.8    5e-08   
ref|WP_016916701.1|  ADP,ATP carrier protein 2                        62.8    5e-08   
ref|WP_014362468.1|  ADP,ATP carrier protein                          62.8    5e-08   
ref|WP_004597535.1|  ADP,ATP carrier protein 2                        62.8    6e-08   
ref|WP_012150720.1|  ADP,ATP carrier protein                          62.8    6e-08   
emb|CAD45255.1|  ADP/ATP carrier protein                              62.8    6e-08   
ref|WP_014410625.1|  ADP,ATP carrier protein 2                        62.8    6e-08   
ref|WP_014363018.1|  ADP,ATP carrier protein                          62.8    6e-08   
ref|WP_014273421.1|  ATP/ADP translocase                              62.8    6e-08   
ref|WP_012148835.1|  ADP,ATP carrier protein                          62.8    6e-08   
ref|WP_014364008.1|  ADP,ATP carrier protein                          62.8    6e-08   
emb|CAD45256.1|  ADP/ATP carrier protein                              62.4    6e-08   
ref|WP_034879435.1|  hypothetical protein                             62.0    8e-08   
ref|WP_014014215.1|  ADP,ATP carrier protein                          62.0    9e-08   
ref|WP_045805529.1|  ADP/ATP carrier protein                          62.0    9e-08   
ref|WP_024704522.1|  ADP/ATP carrier protein                          62.0    9e-08   
ref|WP_019230733.1|  hypothetical protein                             62.0    9e-08   
ref|WP_014392151.1|  ADP,ATP carrier protein                          61.6    1e-07   
gb|KIZ05275.1|  ADP,ATP carrier protein 1                             61.6    1e-07   
ref|WP_045800285.1|  ADP/ATP carrier protein                          61.2    2e-07   
ref|WP_011477651.1|  ADP,ATP carrier protein 2                        60.8    2e-07   
ref|WP_045798941.1|  ADP/ATP carrier protein                          60.8    3e-07   
ref|WP_045799639.1|  ADP/ATP carrier protein                          60.8    3e-07   
emb|CEG01693.1|  Major facilitator superfamily domain, general su...  60.5    3e-07   
ref|WP_012151838.1|  ATP/ADP translocase                              60.5    3e-07   
ref|WP_020584651.1|  hypothetical protein                             60.5    3e-07   
emb|CAE46505.1|  nucleotide transport protein                         60.5    3e-07   
ref|XP_005647808.1|  ADP/ATP carrier protein                          60.1    4e-07   
ref|WP_041018773.1|  hypothetical protein                             60.1    4e-07   
ref|XP_011398982.1|  Plastidic ATP/ADP-transporter                    60.1    4e-07   
emb|CDR35220.1|  ADP/ATP translocase                                  60.1    5e-07   
ref|WP_020370844.1|  MULTISPECIES: ADP/ATP carrier family protein     59.7    6e-07   
ref|WP_021828898.1|  MULTISPECIES: ADP/ATP carrier family protein     59.3    8e-07   
ref|XP_002293173.1|  predicted protein                                59.3    8e-07   
gb|EPZ36557.1|  ADP/ATP carrier protein domain-containing protein     59.3    9e-07   
ref|XP_002948915.1|  hypothetical protein VOLCADRAFT_89266            59.3    1e-06   
ref|WP_016966618.1|  ADP/ATP carrier family protein                   58.9    1e-06   
ref|WP_006342801.1|  ATPase AAA                                       58.9    1e-06   
ref|WP_014944735.1|  ATPase AAA                                       58.9    1e-06   
ref|WP_013712507.1|  ATPase AAA                                       58.5    1e-06   
ref|WP_024010999.1|  ADP, ATP carrier protein                         58.5    1e-06   
ref|WP_024010287.1|  ADP, ATP carrier protein                         58.5    1e-06   
ref|WP_021756354.1|  ADP/ATP carrier protein                          58.5    1e-06   
ref|WP_041546156.1|  hypothetical protein                             58.5    2e-06   
emb|CCM09800.1|  ADP,ATP carrier protein 1                            58.2    2e-06   



>ref|XP_009758418.1| PREDICTED: plastidic ATP/ADP-transporter-like [Nicotiana sylvestris]
Length=629

 Score =   298 bits (763),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 143/188 (76%), Positives = 161/188 (86%), Gaps = 3/188 (2%)
 Frame = +3

Query  180  MDTILQTRGLLSLPSKPRIRASYPVPQGGLRHRFNGANGLKAKPFDGLSLSAGGLPKLEA  359
            M+ +LQT+GLLSLPSKP+ RA YP+PQGGLRHRFN  N LK KP +GLSLS+ G  K + 
Sbjct  1    MEAVLQTKGLLSLPSKPKTRAFYPLPQGGLRHRFNSVNSLKPKPLEGLSLSSDGFQKFQG  60

Query  360  FVGKPSLVAQRGRCFPVCRAEAAAAEDGQPLLGGEAASESPKFMGVDVATLKKIIPLGLM  539
            F  KP L+ Q+ R FPVC+AE AAA DG PLLG    +ESPKFMG+++ TLKKIIPLGLM
Sbjct  61   FAKKPQLIGQKNRFFPVCKAEVAAAADGVPLLG---ENESPKFMGIELVTLKKIIPLGLM  117

Query  540  FFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYTKLANVLSKEA  719
            FFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMA+GFM+LYTKLANVLSK+A
Sbjct  118  FFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAVGFMLLYTKLANVLSKQA  177

Query  720  LFYTVILP  743
            LFYTVILP
Sbjct  178  LFYTVILP  185



>ref|XP_006341665.1| PREDICTED: plastidic ATP/ADP-transporter-like [Solanum tuberosum]
Length=626

 Score =   280 bits (715),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 143/188 (76%), Positives = 161/188 (86%), Gaps = 6/188 (3%)
 Frame = +3

Query  180  MDTILQTRGLLSLPSKPRIRASYPVPQGGLRHRFNGANGLKAKPFDGLSLSAGGLPKLEA  359
            M+ +LQT+GLLSLPSKP+IRA YP+PQGGLRHRFN    LK K  +GLSLS+ G  K+++
Sbjct  1    MEAVLQTKGLLSLPSKPKIRAFYPIPQGGLRHRFNS---LKPKSLEGLSLSSDGFQKVQS  57

Query  360  FVGKPSLVAQRGRCFPVCRAEAAAAEDGQPLLGGEAASESPKFMGVDVATLKKIIPLGLM  539
            F  KP LV Q+ R FP+CRAEAAAA DG+P+L      ESPKFMG++V TLKKIIPLG M
Sbjct  58   FSTKPQLVGQKNRFFPICRAEAAAAADGEPVL---EEKESPKFMGIEVVTLKKIIPLGAM  114

Query  540  FFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYTKLANVLSKEA  719
            FFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMA+GFM+LYTKLANVLSKEA
Sbjct  115  FFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAVGFMLLYTKLANVLSKEA  174

Query  720  LFYTVILP  743
            LFYTVILP
Sbjct  175  LFYTVILP  182



>ref|XP_004252326.1| PREDICTED: plastidic ATP/ADP-transporter [Solanum lycopersicum]
Length=629

 Score =   276 bits (705),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 138/189 (73%), Positives = 156/189 (83%), Gaps = 4/189 (2%)
 Frame = +3

Query  180  MDTILQTRGLLSLPSKPRIRASYPVPQGGLRHRFNGANGLKAKPFDGLSLSAGGLPKLEA  359
            M+ +LQTRGLLSLPSKP+I+A YP+PQGGLR+RFN  + LK  PF+G+SLS+ G  K++ 
Sbjct  1    MEGVLQTRGLLSLPSKPKIKAFYPLPQGGLRNRFNSLSSLKPNPFNGVSLSSNGFQKVQG  60

Query  360  FVGKPSLVAQRGRCFPVCRAEAAAAE-DGQPLLGGEAASESPKFMGVDVATLKKIIPLGL  536
            F  KP L  Q+ RCF +C+A AA    DGQPL       E PKFMG++V TLKKIIPLG 
Sbjct  61   FDTKPQLFGQKKRCFSICKAAAAGGAADGQPLF---VEKEQPKFMGIEVVTLKKIIPLGA  117

Query  537  MFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYTKLANVLSKE  716
            MFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFM+LYTKLANVLSKE
Sbjct  118  MFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMLLYTKLANVLSKE  177

Query  717  ALFYTVILP  743
            ALFYTVILP
Sbjct  178  ALFYTVILP  186



>ref|XP_009624271.1| PREDICTED: plastidic ATP/ADP-transporter-like [Nicotiana tomentosiformis]
Length=631

 Score =   275 bits (703),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 144/190 (76%), Positives = 162/190 (85%), Gaps = 5/190 (3%)
 Frame = +3

Query  180  MDTILQTRGLLSLPSKPRIRASYPVPQGGLRHRFNGANGLKAKPFDGLSLSA--GGLPKL  353
            M+ +LQT+GLLSLPSKP+ RA YP+PQGGLRHRFN  N LK KP +GLSLS    G  K 
Sbjct  1    MEAVLQTKGLLSLPSKPKTRAFYPLPQGGLRHRFNSFNSLKPKPLEGLSLSLSSDGFQKF  60

Query  354  EAFVGKPSLVAQRGRCFPVCRAEAAAAEDGQPLLGGEAASESPKFMGVDVATLKKIIPLG  533
            + F  KP L++Q+ R FPVC+AEAAAA DG PLLG +   ESPKFMG+++ TLKKIIPLG
Sbjct  61   QGFAKKPQLISQKNRFFPVCKAEAAAAADGVPLLGED---ESPKFMGIELVTLKKIIPLG  117

Query  534  LMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYTKLANVLSK  713
            LMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMA+GFM+LYTKLANVLSK
Sbjct  118  LMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAVGFMLLYTKLANVLSK  177

Query  714  EALFYTVILP  743
            +ALFYTVILP
Sbjct  178  QALFYTVILP  187



>ref|XP_004235723.1| PREDICTED: plastidic ATP/ADP-transporter-like [Solanum lycopersicum]
Length=625

 Score =   274 bits (701),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 140/188 (74%), Positives = 157/188 (84%), Gaps = 7/188 (4%)
 Frame = +3

Query  180  MDTILQTRGLLSLPSKPRIRASYPVPQGGLRHRFNGANGLKAKPFDGLSLSAGGLPKLEA  359
            M+ +LQT+GLLS PSKP IRA YP+PQGGLR RFN    LK K  +GLSLS+ G  K+++
Sbjct  1    MEAVLQTKGLLSHPSKPIIRAFYPIPQGGLRRRFNS---LKPKSLEGLSLSSDGFQKVQS  57

Query  360  FVGKPSLVAQRGRCFPVCRAEAAAAEDGQPLLGGEAASESPKFMGVDVATLKKIIPLGLM  539
            F  KP LV Q+ R FP+ RAEAAAA DG+P+L      ESPKFMG++V TLKKIIPLG M
Sbjct  58   FSTKPQLVGQKNRFFPIRRAEAAAA-DGEPVL---EEKESPKFMGIEVVTLKKIIPLGAM  113

Query  540  FFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYTKLANVLSKEA  719
            FFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMA+GFM+LYTKLANVLSKEA
Sbjct  114  FFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAVGFMLLYTKLANVLSKEA  173

Query  720  LFYTVILP  743
            LFYTVILP
Sbjct  174  LFYTVILP  181



>ref|NP_001274794.1| plastidic ATP/ADP-transporter [Solanum tuberosum]
 sp|O24381.2|TLC1_SOLTU RecName: Full=Plastidic ATP/ADP-transporter [Solanum tuberosum]
 emb|CAA71785.1| plastidic ATP/ADP-transporter [Solanum tuberosum]
Length=631

 Score =   274 bits (701),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 140/191 (73%), Positives = 159/191 (83%), Gaps = 6/191 (3%)
 Frame = +3

Query  180  MDTILQTRGLLSLPSKPRIRASYPVPQGGLRHRFNGANGLKAKPFDGLSLSAGGLPKLEA  359
            M+ +LQTRGLLSLPSKP+I+A YP+PQGGLR+RFN  + LK  P +G+SLS+ G  K++ 
Sbjct  1    MEGVLQTRGLLSLPSKPKIKAFYPLPQGGLRNRFNSLSSLKPNPLNGVSLSSNGFQKVQG  60

Query  360  FVGKPSLVAQRGRCFPVCRAEAAAAE---DGQPLLGGEAASESPKFMGVDVATLKKIIPL  530
            F  KP L  Q+ RCFP+C+AEAAAA    DGQPL       E PKFMG+++ TLKKIIPL
Sbjct  61   FDTKPQLFGQKKRCFPICKAEAAAAAGAADGQPLF---VEKEQPKFMGIELVTLKKIIPL  117

Query  531  GLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYTKLANVLS  710
            G MFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFM+LYTKLANVLS
Sbjct  118  GAMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMLLYTKLANVLS  177

Query  711  KEALFYTVILP  743
            KEALFYTVILP
Sbjct  178  KEALFYTVILP  188



>ref|XP_009767462.1| PREDICTED: plastidic ATP/ADP-transporter [Nicotiana sylvestris]
Length=631

 Score =   272 bits (695),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 140/191 (73%), Positives = 156/191 (82%), Gaps = 6/191 (3%)
 Frame = +3

Query  180  MDTILQTRGLLSLPSKPRIRASYPVPQGGLRHRFNGA---NGLKAKPFDGLSLSAGGLPK  350
            M+ +LQT+GLLSLPSKP+ +A YP+P GGLRHR N     N LK KP +GLSLS+ G  K
Sbjct  1    MEAVLQTKGLLSLPSKPKTKAFYPLPLGGLRHRLNSGHSLNTLKPKPLNGLSLSSNGFQK  60

Query  351  LEAFVGKPSLVAQRGRCFPVCRAEAAAAEDGQPLLGGEAASESPKFMGVDVATLKKIIPL  530
             + F  KP L  Q+ R FP+C+AEAAAA DGQPL    A  E PKFMG+++ TLKKIIPL
Sbjct  61   FQCFTTKPQLFGQKNRFFPICKAEAAAAADGQPLF---AEKEPPKFMGIELVTLKKIIPL  117

Query  531  GLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYTKLANVLS  710
            G MFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFM+LYTKLANVLS
Sbjct  118  GAMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMLLYTKLANVLS  177

Query  711  KEALFYTVILP  743
            KEALFYTVILP
Sbjct  178  KEALFYTVILP  188



>ref|XP_009595520.1| PREDICTED: plastidic ATP/ADP-transporter [Nicotiana tomentosiformis]
Length=631

 Score =   271 bits (694),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 140/191 (73%), Positives = 156/191 (82%), Gaps = 6/191 (3%)
 Frame = +3

Query  180  MDTILQTRGLLSLPSKPRIRASYPVPQGGLRHRFNGA---NGLKAKPFDGLSLSAGGLPK  350
            M+ +LQT+GLLSLPSKP+ +A YP+P GGLRHRFN     N LK KP +GLSLS+ G  K
Sbjct  1    MEAVLQTKGLLSLPSKPKTKAFYPLPHGGLRHRFNSGHSLNTLKPKPLNGLSLSSNGFQK  60

Query  351  LEAFVGKPSLVAQRGRCFPVCRAEAAAAEDGQPLLGGEAASESPKFMGVDVATLKKIIPL  530
             + F  KP L  Q+ R  P+C+AEAAAA DGQPL    A  E PKFMG+++ TLKKIIPL
Sbjct  61   FQCFTTKPQLFGQKDRFSPICKAEAAAAADGQPLF---AEKEPPKFMGIELVTLKKIIPL  117

Query  531  GLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYTKLANVLS  710
            G MFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFM+LYTKLANVLS
Sbjct  118  GAMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMLLYTKLANVLS  177

Query  711  KEALFYTVILP  743
            KEALFYTVILP
Sbjct  178  KEALFYTVILP  188



>ref|XP_011081074.1| PREDICTED: plastidic ATP/ADP-transporter [Sesamum indicum]
Length=630

 Score =   255 bits (652),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 131/190 (69%), Positives = 151/190 (79%), Gaps = 5/190 (3%)
 Frame = +3

Query  180  MDTILQTRGLLSLPSKPRIRASYPVPQGGLRHRFNGANG-LKAKPFDGLSLSAGGLPKLE  356
            M  +LQ++GLLSLPS PR RA    P   LR+RFN  N  LK++  +G SL+  G  K  
Sbjct  1    MQGVLQSKGLLSLPSNPRTRAFLAQPSCDLRYRFNPINPPLKSRTLNGSSLTLNGFSKFH  60

Query  357  AFVGKPSLVAQRGRCFPVCRAEAAAAE-DGQPLLGGEAASESPKFMGVDVATLKKIIPLG  533
             FV KP LV Q+   +P+CRAEAAAA  DGQPL G +   ESPKFMG+++ TLKKIIPLG
Sbjct  61   GFVTKPQLVGQKNGNYPICRAEAAAASGDGQPLYGEK---ESPKFMGMELVTLKKIIPLG  117

Query  534  LMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYTKLANVLSK  713
            +MFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMA+GFM+LYT+LANVLSK
Sbjct  118  MMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAVGFMLLYTQLANVLSK  177

Query  714  EALFYTVILP  743
            EALFY+VILP
Sbjct  178  EALFYSVILP  187



>ref|XP_002298119.2| Chloroplast ADP family protein [Populus trichocarpa]
 gb|EEE82924.2| Chloroplast ADP family protein [Populus trichocarpa]
Length=621

 Score =   249 bits (636),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 129/188 (69%), Positives = 149/188 (79%), Gaps = 9/188 (5%)
 Frame = +3

Query  180  MDTILQTRGLLSLPSKPRIRASYPVPQGGLRHRFNGANGLKAKPFDGLSLSAGGLPKLEA  359
            M+ +LQT+GLLSLPS P+ RA YP    GL+ R       K K F G SLS+ G+PK   
Sbjct  1    MEAVLQTKGLLSLPSNPKTRALYP--SQGLKQRLFAT---KPKTFTGFSLSSNGVPKFPT  55

Query  360  FVGKPSLVAQRGRCFPVCRAEAAAAEDGQPLLGGEAASESPKFMGVDVATLKKIIPLGLM  539
            FV KPS  + + R   +CRAEAAA  DGQPL G E  ++ PKF+G+++ATLKKIIPLGLM
Sbjct  56   FVSKPSGFSPKDRNLHICRAEAAA--DGQPLFGEE--TDKPKFLGIELATLKKIIPLGLM  111

Query  540  FFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYTKLANVLSKEA  719
            FFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMA+GFM+LYTKLANVLSK+A
Sbjct  112  FFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAVGFMLLYTKLANVLSKQA  171

Query  720  LFYTVILP  743
            LFYTVI+P
Sbjct  172  LFYTVIVP  179



>emb|CDO98099.1| unnamed protein product [Coffea canephora]
Length=630

 Score =   249 bits (636),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 130/191 (68%), Positives = 150/191 (79%), Gaps = 6/191 (3%)
 Frame = +3

Query  180  MDTILQTRGLLSLPSKPRIRASYPVPQGGLRHRFNGANGLKAKPFDGLSLSAGGLPKLEA  359
            M  + QT+GLLSLPS P+ RA    PQ GLRHRF+  N LK KPF GLS++  G  K + 
Sbjct  1    MQAVFQTKGLLSLPSNPKTRALLNPPQQGLRHRFSPFNPLKNKPFSGLSVNLNGFQKFQG  60

Query  360  FVGKPSLVAQRGRCFPVCRAEAAAAE---DGQPLLGGEAASESPKFMGVDVATLKKIIPL  530
            F  KP+L+  + R F VCRAEAAAA    DGQP+ G     E PKF+G+++ TLKKI+PL
Sbjct  61   FATKPNLITPKNRTFHVCRAEAAAAATGADGQPIFG---QPEPPKFLGIELNTLKKILPL  117

Query  531  GLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYTKLANVLS  710
            G+MFFCILFNYTILRDTKDVLVVTA+GSSAEIIPFLKTWVNLPMAIGFM+LYTK+ANVLS
Sbjct  118  GMMFFCILFNYTILRDTKDVLVVTAQGSSAEIIPFLKTWVNLPMAIGFMLLYTKMANVLS  177

Query  711  KEALFYTVILP  743
            KEALFYT ILP
Sbjct  178  KEALFYTTILP  188



>ref|XP_011035631.1| PREDICTED: plastidic ATP/ADP-transporter-like [Populus euphratica]
Length=621

 Score =   244 bits (624),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 127/188 (68%), Positives = 147/188 (78%), Gaps = 9/188 (5%)
 Frame = +3

Query  180  MDTILQTRGLLSLPSKPRIRASYPVPQGGLRHRFNGANGLKAKPFDGLSLSAGGLPKLEA  359
            M+ +LQTRGLLSLPS P+ RA YP    GL+ R       K + F G SLS+ G+PK   
Sbjct  1    MEAVLQTRGLLSLPSNPKTRALYP--SQGLKKRLFAT---KPQTFTGFSLSSNGVPKFPT  55

Query  360  FVGKPSLVAQRGRCFPVCRAEAAAAEDGQPLLGGEAASESPKFMGVDVATLKKIIPLGLM  539
            FV KPS  + + R   +CRAEAAAA  GQPL G E  ++ PKF+G+++ T KKIIPLGLM
Sbjct  56   FVSKPSGFSPKDRNLHICRAEAAAA--GQPLFGEE--TDKPKFLGIELTTFKKIIPLGLM  111

Query  540  FFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYTKLANVLSKEA  719
            FFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMA+GFM+LYTKLANVLSK+A
Sbjct  112  FFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAVGFMLLYTKLANVLSKQA  171

Query  720  LFYTVILP  743
            LFYTVI+P
Sbjct  172  LFYTVIVP  179



>ref|XP_011072264.1| PREDICTED: plastidic ATP/ADP-transporter-like [Sesamum indicum]
Length=626

 Score =   243 bits (619),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 133/190 (70%), Positives = 149/190 (78%), Gaps = 5/190 (3%)
 Frame = +3

Query  180  MDTILQTRGLLSLPSKPRIRASYPVPQGGLRHRFNGAN-GLKAKPFDGLSLSAGGLPKLE  356
            M  +LQ++GLLSLPS PR RA  P P  GLR+RF   N  LK    +G SLS     K +
Sbjct  1    MQGVLQSKGLLSLPSNPRTRAFAPQPSQGLRYRFYPLNPSLKPGLLNGSSLSLNAFSKFQ  60

Query  357  AFVGKPSLVAQRGRCFPVCRAEAAAAE-DGQPLLGGEAASESPKFMGVDVATLKKIIPLG  533
             F+ KP LV Q+ R +P+ RAEAAAA  DGQ L G +   ESPKFMG++V TLKKIIPLG
Sbjct  61   GFIAKPQLVGQKSRNYPLFRAEAAAAAADGQSLYGEK---ESPKFMGIEVETLKKIIPLG  117

Query  534  LMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYTKLANVLSK  713
            +MFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFM+LYTKLANVLSK
Sbjct  118  MMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMLLYTKLANVLSK  177

Query  714  EALFYTVILP  743
            +ALFYTVILP
Sbjct  178  QALFYTVILP  187



>ref|XP_002303268.1| Chloroplast ADP family protein [Populus trichocarpa]
 gb|EEE78247.1| Chloroplast ADP family protein [Populus trichocarpa]
Length=623

 Score =   234 bits (598),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 128/188 (68%), Positives = 145/188 (77%), Gaps = 7/188 (4%)
 Frame = +3

Query  180  MDTILQTRGLLSLPSKPRIRASYPVPQGGLRHRFNGANGLKAKPFDGLSLSAGGLPKLEA  359
            M+ +LQTRGLLSLP  P+ R  YP    GL+ R       K K F G SLS+ G+PK   
Sbjct  1    MEAVLQTRGLLSLPPNPKGRVLYP--SQGLKQRLFAT---KPKTFSGFSLSSNGVPKFPT  55

Query  360  FVGKPSLVAQRGRCFPVCRAEAAAAEDGQPLLGGEAASESPKFMGVDVATLKKIIPLGLM  539
             V KP+    + R   +CRAEAAAA DGQPL G E  ++ PKF+G+++AT KKIIPLGLM
Sbjct  56   SVSKPNGFFPKDRNLHICRAEAAAAADGQPLFGEE--TDKPKFLGIELATFKKIIPLGLM  113

Query  540  FFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYTKLANVLSKEA  719
            FFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFM+LYTKLANVLSK+A
Sbjct  114  FFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMLLYTKLANVLSKQA  173

Query  720  LFYTVILP  743
            LFYTVILP
Sbjct  174  LFYTVILP  181



>ref|XP_011039999.1| PREDICTED: plastidic ATP/ADP-transporter-like [Populus euphratica]
Length=623

 Score =   233 bits (594),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 127/188 (68%), Positives = 144/188 (77%), Gaps = 7/188 (4%)
 Frame = +3

Query  180  MDTILQTRGLLSLPSKPRIRASYPVPQGGLRHRFNGANGLKAKPFDGLSLSAGGLPKLEA  359
            M+ +LQTRGLLSLP  P+ R  YP    GL+ R       K K F G SLS+ G+PK   
Sbjct  1    MEAVLQTRGLLSLPPNPKGRVLYP--SQGLKQRLFAT---KPKTFSGFSLSSNGVPKFPT  55

Query  360  FVGKPSLVAQRGRCFPVCRAEAAAAEDGQPLLGGEAASESPKFMGVDVATLKKIIPLGLM  539
             V KP+    + R   +CRAEAAAA DGQPL G E  ++ PKF+G+++ T KKIIPLGLM
Sbjct  56   SVSKPNGFFPKDRNLHICRAEAAAAADGQPLFGEE--TDKPKFLGIELTTFKKIIPLGLM  113

Query  540  FFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYTKLANVLSKEA  719
            FFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFM+LYTKLANVLSK+A
Sbjct  114  FFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMLLYTKLANVLSKQA  173

Query  720  LFYTVILP  743
            LFYTVILP
Sbjct  174  LFYTVILP  181



>gb|EYU21596.1| hypothetical protein MIMGU_mgv1a002865mg [Erythranthe guttata]
Length=629

 Score =   233 bits (593),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 128/191 (67%), Positives = 143/191 (75%), Gaps = 8/191 (4%)
 Frame = +3

Query  180  MDTILQTRGLLSLPSKPRIRASY-PVPQGGLRHRFNGANGLKAKP--FDGLSLSAGGLPK  350
            M  +LQ++GLLSLPS PR RAS+ P P  GLR+R+N       KP   +  SLS  G  K
Sbjct  1    MQGVLQSKGLLSLPSNPRTRASFLPPPLQGLRYRYNHVINPILKPGLLNASSLSLNGFSK  60

Query  351  LEAFVGKPSLVAQRGRCFPVCRAEAAAAEDGQPLLGGEAASESPKFMGVDVATLKKIIPL  530
               F  KP LV Q+ R +PVCRAEAAAA             + PK +GV+VATLKKI+PL
Sbjct  61   FHGFSTKPQLVGQKSRNYPVCRAEAAAAASAA-----AGGGDQPKLLGVEVATLKKILPL  115

Query  531  GLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYTKLANVLS  710
            GLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFM+LYTKL+NVLS
Sbjct  116  GLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMVLYTKLSNVLS  175

Query  711  KEALFYTVILP  743
            KEALFYTVILP
Sbjct  176  KEALFYTVILP  186



>ref|XP_012073271.1| PREDICTED: plastidic ATP/ADP-transporter [Jatropha curcas]
 gb|KDP37155.1| hypothetical protein JCGZ_06211 [Jatropha curcas]
Length=623

 Score =   231 bits (589),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 125/188 (66%), Positives = 147/188 (78%), Gaps = 6/188 (3%)
 Frame = +3

Query  180  MDTILQTRGLLSLPSKPRIRASYPVPQGGLRHRFNGANGLKAKPFDGLSLSAGGLPKLEA  359
            M+ +LQT+GLLS P  P+ RAS   P  GL+ R   A   K K   GLSLS+ GLP+  +
Sbjct  1    MEAVLQTKGLLSFPPNPKTRASL-YPSQGLKQRLVAA---KPKSLPGLSLSSNGLPRFPS  56

Query  360  FVGKPSLVAQRGRCFPVCRAEAAAAEDGQPLLGGEAASESPKFMGVDVATLKKIIPLGLM  539
             V KP  +  + R   +CRAEAAAA DGQP+ G +A  E PKF+G+++ TLKKIIPLGLM
Sbjct  57   VVSKPIGIFPKERNLHICRAEAAAAADGQPVFGEKA--EKPKFLGIELTTLKKIIPLGLM  114

Query  540  FFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYTKLANVLSKEA  719
            FFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFM+LYT+L+NVLSK+A
Sbjct  115  FFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMLLYTQLSNVLSKQA  174

Query  720  LFYTVILP  743
            LFYTVI+P
Sbjct  175  LFYTVIVP  182



>gb|AAZ23108.1| plastid ATP/ADP transport protein 2 [Manihot esculenta]
Length=623

 Score =   231 bits (588),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 126/188 (67%), Positives = 145/188 (77%), Gaps = 7/188 (4%)
 Frame = +3

Query  180  MDTILQTRGLLSLPSKPRIRASYPVPQGGLRHRFNGANGLKAKPFDGLSLSAGGLPKLEA  359
            M+ +LQT+GL SLP  P+ RAS   P  GLRHR   A   K K   GLSLS+ G PK  +
Sbjct  1    MEAVLQTKGLFSLPPNPKTRASL-YPSQGLRHRLFAA---KPKTLSGLSLSSNGFPKFPS  56

Query  360  FVGKPSLVAQRGRCFPVCRAEAAAAEDGQPLLGGEAASESPKFMGVDVATLKKIIPLGLM  539
            FV KP+    +     +CRAEAAAA +GQPL G     E PK +G++++TLKKIIPLGLM
Sbjct  57   FVSKPNGFPPKDGNLHICRAEAAAAAEGQPLFG---EPEKPKLLGIELSTLKKIIPLGLM  113

Query  540  FFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYTKLANVLSKEA  719
            FFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFM+LYT+LANVLSK+A
Sbjct  114  FFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMLLYTQLANVLSKQA  173

Query  720  LFYTVILP  743
            LFYTVI+P
Sbjct  174  LFYTVIVP  181



>ref|XP_004506888.1| PREDICTED: plastidic ATP/ADP-transporter-like [Cicer arietinum]
Length=618

 Score =   229 bits (585),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 118/188 (63%), Positives = 142/188 (76%), Gaps = 5/188 (3%)
 Frame = +3

Query  180  MDTILQTRGLLSLPSKPRIRASYPVPQGGLRHRFNGANGLKAKPFDGLSLSAGGLPKLEA  359
            MD +LQTRGLLSLP+ P+ R  +      L+ RF     LK K   G SL++ G  K+ +
Sbjct  1    MDAVLQTRGLLSLPTNPKNRVFHQ--PNCLKQRFLS---LKPKTLIGSSLNSNGFQKINS  55

Query  360  FVGKPSLVAQRGRCFPVCRAEAAAAEDGQPLLGGEAASESPKFMGVDVATLKKIIPLGLM  539
            F  K +   Q  +   +C+AEAAAA++ QP+ G E   E PK +G+++ T+KKI+PLGLM
Sbjct  56   FSSKINGFGQNEKNLFICKAEAAAADNQQPVFGEEIEVEKPKILGIEIDTMKKILPLGLM  115

Query  540  FFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYTKLANVLSKEA  719
            FFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFM+LYTKLANVLSK+A
Sbjct  116  FFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMLLYTKLANVLSKQA  175

Query  720  LFYTVILP  743
            LFYTVILP
Sbjct  176  LFYTVILP  183



>ref|XP_002517555.1| Plastidic ATP/ADP-transporter, putative [Ricinus communis]
 gb|EEF44719.1| Plastidic ATP/ADP-transporter, putative [Ricinus communis]
Length=621

 Score =   229 bits (585),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 124/188 (66%), Positives = 142/188 (76%), Gaps = 7/188 (4%)
 Frame = +3

Query  180  MDTILQTRGLLSLPSKPRIRASYPVPQGGLRHRFNGANGLKAKPFDGLSLSAGGLPKLEA  359
            M+ +LQT+GLLSLP  P+ RAS   P  GL+ R   +   K     G SLS+ G P+  A
Sbjct  1    MEAVLQTKGLLSLPPNPKTRASL-YPSQGLKQRLFAS---KTNALSGFSLSSNGFPRFPA  56

Query  360  FVGKPSLVAQRGRCFPVCRAEAAAAEDGQPLLGGEAASESPKFMGVDVATLKKIIPLGLM  539
             V KP     + R F +C+AEAAAA DGQPL G    +E PK +G+ V TLKKIIPLGLM
Sbjct  57   VVSKPKGFPSKDRNFHICKAEAAAAADGQPLFG---ETEKPKLLGIGVETLKKIIPLGLM  113

Query  540  FFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYTKLANVLSKEA  719
            FFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFM+LYT+LANVLSK+A
Sbjct  114  FFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMLLYTQLANVLSKQA  173

Query  720  LFYTVILP  743
            LFYTVI+P
Sbjct  174  LFYTVIVP  181



>gb|AAZ23106.1| plastid ATP/ADP transport protein 1 [Manihot esculenta]
Length=619

 Score =   227 bits (578),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 123/188 (65%), Positives = 144/188 (77%), Gaps = 7/188 (4%)
 Frame = +3

Query  180  MDTILQTRGLLSLPSKPRIRASYPVPQGGLRHRFNGANGLKAKPFDGLSLSAGGLPKLEA  359
            M+ +LQT+GL SLP  P+ RAS   P  GL+H   G   +K K   G SLS+ GLP+   
Sbjct  1    MEAVLQTKGLFSLPPNPKTRASL-YPSQGLKH---GLFAVKPKTVAGFSLSSNGLPRFPT  56

Query  360  FVGKPSLVAQRGRCFPVCRAEAAAAEDGQPLLGGEAASESPKFMGVDVATLKKIIPLGLM  539
             V KP+    + R   +CRAEAAAA DGQPL G    +E PK +G+ ++TLKKIIPLGLM
Sbjct  57   VVSKPNGFLPKDRNLHICRAEAAAAADGQPLFG---EAEKPKLLGIGLSTLKKIIPLGLM  113

Query  540  FFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYTKLANVLSKEA  719
            FFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFM+LYT+L+NVLSK+A
Sbjct  114  FFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMLLYTQLSNVLSKQA  173

Query  720  LFYTVILP  743
            LFYTVI+P
Sbjct  174  LFYTVIVP  181



>ref|XP_010254276.1| PREDICTED: plastidic ATP/ADP-transporter-like [Nelumbo nucifera]
Length=620

 Score =   226 bits (576),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 123/188 (65%), Positives = 144/188 (77%), Gaps = 8/188 (4%)
 Frame = +3

Query  180  MDTILQTRGLLSLPSKPRIRASYPVPQGGLRHRFNGANGLKAKPFDGLSLSAGGLPKLEA  359
            M+ +LQT+GLLSLPS P+ R     PQG L++R +  +    +   G SLS  G  K   
Sbjct  1    MEAVLQTKGLLSLPSNPKTRV-LGSPQG-LKYRLSAKSN---RALGGFSLSVDGFQKFHG  55

Query  360  FVGKPSLVAQRGRCFPVCRAEAAAAEDGQPLLGGEAASESPKFMGVDVATLKKIIPLGLM  539
            FV +     ++GR   +CRAEAAAA DGQPL+G     E PKF+G++V TLKKIIPLGLM
Sbjct  56   FVSRTHGFCKKGRDLQICRAEAAAAADGQPLIG---EVEKPKFLGIEVLTLKKIIPLGLM  112

Query  540  FFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYTKLANVLSKEA  719
            FFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMA+GFM+LYTKLANVLSK+A
Sbjct  113  FFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAVGFMLLYTKLANVLSKKA  172

Query  720  LFYTVILP  743
            LFYTVI+P
Sbjct  173  LFYTVIVP  180



>gb|AAZ23107.1| plastid ATP/ADP transport protein 2 [Manihot esculenta]
Length=623

 Score =   226 bits (576),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 124/188 (66%), Positives = 144/188 (77%), Gaps = 7/188 (4%)
 Frame = +3

Query  180  MDTILQTRGLLSLPSKPRIRASYPVPQGGLRHRFNGANGLKAKPFDGLSLSAGGLPKLEA  359
            M+ +LQT+GL SLP  P+ RAS   P  GL+HR   A   K K   GLSLS+ G PK  +
Sbjct  1    MEAVLQTKGLFSLPPNPKTRASL-YPSQGLKHRLFAA---KPKTLSGLSLSSNGFPKFPS  56

Query  360  FVGKPSLVAQRGRCFPVCRAEAAAAEDGQPLLGGEAASESPKFMGVDVATLKKIIPLGLM  539
             V KP+    +     +CRAEAAAA +GQPL G     E PK +G++++TLKKIIPLGLM
Sbjct  57   VVSKPNGFPPKDGNLHICRAEAAAAAEGQPLFG---EPEKPKLLGIELSTLKKIIPLGLM  113

Query  540  FFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYTKLANVLSKEA  719
            FFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFM+LYT+LANVLSK+A
Sbjct  114  FFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMLLYTQLANVLSKQA  173

Query  720  LFYTVILP  743
            LFYTVI+P
Sbjct  174  LFYTVIVP  181



>gb|EYU24674.1| hypothetical protein MIMGU_mgv1a002918mg [Erythranthe guttata]
Length=625

 Score =   226 bits (575),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 123/193 (64%), Positives = 142/193 (74%), Gaps = 14/193 (7%)
 Frame = +3

Query  180  MDTILQTRGLLSLPSKPR-IRASYPVPQGGLRHRFNGANGLKAKPFDGLSLSAGGLPKLE  356
            M  +LQ++GLLSLPS PR  RA    P   LR RFN  N +        S +  G PK  
Sbjct  1    MQAVLQSKGLLSLPSIPRRTRAFITQPSSDLRCRFNPTNPIPK------SRTLNGFPKFP  54

Query  357  AFVGKPSLVAQRGRCFPVCRAEAAAAE---DG-QPLLGGEAASESPKFMGVDVATLKKII  524
             FV +P L++Q+   +P  RA+AAA+    DG QPL   +   E+PKFMG++  TLKKII
Sbjct  55   NFVTRPQLISQKNTNYPKFRADAAASSSPPDGVQPLYEDQ---ETPKFMGIETVTLKKII  111

Query  525  PLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYTKLANV  704
            PLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFM+LYTKLANV
Sbjct  112  PLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMVLYTKLANV  171

Query  705  LSKEALFYTVILP  743
            LSK+ALFYTV+LP
Sbjct  172  LSKQALFYTVMLP  184



>ref|XP_007023974.1| TLC ATP/ADP transporter isoform 2 [Theobroma cacao]
 gb|EOY26596.1| TLC ATP/ADP transporter isoform 2 [Theobroma cacao]
Length=501

 Score =   223 bits (568),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 123/188 (65%), Positives = 143/188 (76%), Gaps = 9/188 (5%)
 Frame = +3

Query  180  MDTILQTRGLLSLPSKPRIRASYPVPQGGLRHRFNGANGLKAKPFDGLSLSAGGLPKLEA  359
            M+ +LQTRGLLSLP  P    S   P  GL+ R        +KP  GLSLS   +P +  
Sbjct  1    MEAVLQTRGLLSLPPNPTRARSLLNPSQGLKQRL-----FASKPLGGLSLSYKKVPSV--  53

Query  360  FVGKPSLVAQRGRCFPVCRAEAAAAEDGQPLLGGEAASESPKFMGVDVATLKKIIPLGLM  539
             V KP+ +   G+ F +C+AEAAAA DGQPL G    +E PKF+G+++ TLKKIIPLGLM
Sbjct  54   -VAKPNGLFAEGKNF-ICKAEAAAAADGQPLFGEIGETEKPKFLGIELVTLKKIIPLGLM  111

Query  540  FFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYTKLANVLSKEA  719
            FFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMA+GFM+LYTKLANVLSK+A
Sbjct  112  FFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAVGFMLLYTKLANVLSKQA  171

Query  720  LFYTVILP  743
            LFYTVI+P
Sbjct  172  LFYTVIVP  179



>ref|XP_007023975.1| TLC ATP/ADP transporter isoform 3, partial [Theobroma cacao]
 gb|EOY26597.1| TLC ATP/ADP transporter isoform 3, partial [Theobroma cacao]
Length=491

 Score =   222 bits (565),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 123/188 (65%), Positives = 143/188 (76%), Gaps = 9/188 (5%)
 Frame = +3

Query  180  MDTILQTRGLLSLPSKPRIRASYPVPQGGLRHRFNGANGLKAKPFDGLSLSAGGLPKLEA  359
            M+ +LQTRGLLSLP  P    S   P  GL+ R        +KP  GLSLS   +P +  
Sbjct  1    MEAVLQTRGLLSLPPNPTRARSLLNPSQGLKQRL-----FASKPLGGLSLSYKKVPSV--  53

Query  360  FVGKPSLVAQRGRCFPVCRAEAAAAEDGQPLLGGEAASESPKFMGVDVATLKKIIPLGLM  539
             V KP+ +   G+ F +C+AEAAAA DGQPL G    +E PKF+G+++ TLKKIIPLGLM
Sbjct  54   -VAKPNGLFAEGKNF-ICKAEAAAAADGQPLFGEIGETEKPKFLGIELVTLKKIIPLGLM  111

Query  540  FFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYTKLANVLSKEA  719
            FFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMA+GFM+LYTKLANVLSK+A
Sbjct  112  FFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAVGFMLLYTKLANVLSKQA  171

Query  720  LFYTVILP  743
            LFYTVI+P
Sbjct  172  LFYTVIVP  179



>dbj|BAD91180.1| putative plastidic adenylate transporter [Mesembryanthemum crystallinum]
Length=622

 Score =   225 bits (573),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 120/189 (63%), Positives = 140/189 (74%), Gaps = 5/189 (3%)
 Frame = +3

Query  180  MDTILQTRGLLSLPSKPRIRASYPVPQGGLRHRFNGANGLKAKPFDGLSLSAGGLPKLEA  359
            M+ +LQT+GLLSLPS P++R     PQ  LR R      LK KP  G SLS+ G  K   
Sbjct  1    MEAVLQTKGLLSLPSNPKLRV-LRSPQSSLRQRVTNPQALKPKPLQGFSLSSNGFQKFHG  59

Query  360  FVGKPSLVAQRGRCFPVCRAEAAAAE-DGQPLLGGEAASESPKFMGVDVATLKKIIPLGL  536
                     Q+ R  P+CRAEAAAA  DGQPL G     +SPKF+G+++ TLKKIIPLGL
Sbjct  60   VACNTQGFGQKLRNLPICRAEAAAAAADGQPLYG---EVQSPKFLGIELVTLKKIIPLGL  116

Query  537  MFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYTKLANVLSKE  716
            MFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFM+LYTKL+++L ++
Sbjct  117  MFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMVLYTKLSDILPRK  176

Query  717  ALFYTVILP  743
             LFYTV+LP
Sbjct  177  TLFYTVMLP  185



>gb|KCW53784.1| hypothetical protein EUGRSUZ_J03031 [Eucalyptus grandis]
Length=520

 Score =   222 bits (566),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 119/188 (63%), Positives = 141/188 (75%), Gaps = 8/188 (4%)
 Frame = +3

Query  180  MDTILQTRGLLSLPSKPRIRASYPVPQGGLRHRFNGANGLKAKPFDGLSLSAGGLPKLEA  359
            M+ +L+TRGL+SLP  PR R     P  GL+HR      +K +   G  LS+ G      
Sbjct  1    MEAVLKTRGLISLPPNPRSRLL--SPSQGLKHRILS---IKPQALPGFPLSSNGFQGFNG  55

Query  360  FVGKPSLVAQRGRCFPVCRAEAAAAEDGQPLLGGEAASESPKFMGVDVATLKKIIPLGLM  539
            F+ KPS + Q+ R F +C+AEAAAA DGQPL    A  E PKF+G++  TLKKIIPLGLM
Sbjct  56   FISKPSGIYQKNRSFHICKAEAAAAADGQPLF---AEPEEPKFLGMEAVTLKKIIPLGLM  112

Query  540  FFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYTKLANVLSKEA  719
            FFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFM+ YTKL+N+LSK+A
Sbjct  113  FFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMLWYTKLSNMLSKQA  172

Query  720  LFYTVILP  743
            LFY+VI+P
Sbjct  173  LFYSVIVP  180



>gb|KJB13104.1| hypothetical protein B456_002G057300 [Gossypium raimondii]
Length=619

 Score =   224 bits (570),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 124/190 (65%), Positives = 146/190 (77%), Gaps = 12/190 (6%)
 Frame = +3

Query  180  MDTILQTRGLLSLPSKP-RIRA-SYPVPQGGLRHRFNGANGLKAKPFDGLSLSAGGLPKL  353
            M+ +LQTR LLSLP  P R+R  S   P  GL+ R   +  L      GLSLS   +P  
Sbjct  1    MEAVLQTRCLLSLPPNPTRVRVRSLLNPSQGLKQRLFASKPLG---LSGLSLSYKEVP--  55

Query  354  EAFVGKPSLVAQRGRCFPVCRAEAAAAEDGQPLLGGEAASESPKFMGVDVATLKKIIPLG  533
             +FV KP+ +  +G+ F +C+AEAAAA DGQPL G    ++ PKF+G+++ TLKKIIPLG
Sbjct  56   -SFVAKPNGLPPKGKNF-ICKAEAAAATDGQPLFG---ETQKPKFLGIELVTLKKIIPLG  110

Query  534  LMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYTKLANVLSK  713
            LMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFM+LYTKLANVLSK
Sbjct  111  LMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMLLYTKLANVLSK  170

Query  714  EALFYTVILP  743
            +ALFYTVI+P
Sbjct  171  KALFYTVIVP  180



>gb|KJB13103.1| hypothetical protein B456_002G057300 [Gossypium raimondii]
Length=621

 Score =   224 bits (570),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 124/190 (65%), Positives = 146/190 (77%), Gaps = 12/190 (6%)
 Frame = +3

Query  180  MDTILQTRGLLSLPSKP-RIRA-SYPVPQGGLRHRFNGANGLKAKPFDGLSLSAGGLPKL  353
            M+ +LQTR LLSLP  P R+R  S   P  GL+ R   +  L      GLSLS   +P  
Sbjct  1    MEAVLQTRCLLSLPPNPTRVRVRSLLNPSQGLKQRLFASKPLG---LSGLSLSYKEVP--  55

Query  354  EAFVGKPSLVAQRGRCFPVCRAEAAAAEDGQPLLGGEAASESPKFMGVDVATLKKIIPLG  533
             +FV KP+ +  +G+ F +C+AEAAAA DGQPL G    ++ PKF+G+++ TLKKIIPLG
Sbjct  56   -SFVAKPNGLPPKGKNF-ICKAEAAAATDGQPLFG---ETQKPKFLGIELVTLKKIIPLG  110

Query  534  LMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYTKLANVLSK  713
            LMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFM+LYTKLANVLSK
Sbjct  111  LMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMLLYTKLANVLSK  170

Query  714  EALFYTVILP  743
            +ALFYTVI+P
Sbjct  171  KALFYTVIVP  180



>ref|XP_006427151.1| hypothetical protein CICLE_v10025170mg [Citrus clementina]
 gb|ESR40391.1| hypothetical protein CICLE_v10025170mg [Citrus clementina]
Length=621

 Score =   224 bits (570),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 124/190 (65%), Positives = 144/190 (76%), Gaps = 10/190 (5%)
 Frame = +3

Query  180  MDTILQTRGLLSLPSKPRIRASYPVPQGGLRHRFNGANGLKAKPFDGLSLSAGGLPKLEA  359
            MD +LQTRGLLSLP  P+IR+       GL+ RF  A   K +  DG SLS+ G+ K ++
Sbjct  1    MDAVLQTRGLLSLPLNPKIRSLQA--SNGLKQRFLAA---KPRTLDGFSLSSNGVSKFQS  55

Query  360  FVGKPSLVAQRGRCFPVCRAEAAAAE--DGQPLLGGEAASESPKFMGVDVATLKKIIPLG  533
            FV KP     + R   +C+AEAAA+   DGQPLLG    +E PKF G++  T KKIIPLG
Sbjct  56   FVSKPQGFVPKERPLLICKAEAAASASADGQPLLG---EAEKPKFFGIEYTTFKKIIPLG  112

Query  534  LMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYTKLANVLSK  713
            LMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFM+LYTKLA+ LSK
Sbjct  113  LMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMLLYTKLADKLSK  172

Query  714  EALFYTVILP  743
            +ALFYTVI+P
Sbjct  173  QALFYTVIVP  182



>ref|XP_007023973.1| TLC ATP/ADP transporter isoform 1 [Theobroma cacao]
 gb|EOY26595.1| TLC ATP/ADP transporter isoform 1 [Theobroma cacao]
Length=620

 Score =   223 bits (567),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 123/188 (65%), Positives = 143/188 (76%), Gaps = 9/188 (5%)
 Frame = +3

Query  180  MDTILQTRGLLSLPSKPRIRASYPVPQGGLRHRFNGANGLKAKPFDGLSLSAGGLPKLEA  359
            M+ +LQTRGLLSLP  P    S   P  GL+ R        +KP  GLSLS   +P +  
Sbjct  1    MEAVLQTRGLLSLPPNPTRARSLLNPSQGLKQRL-----FASKPLGGLSLSYKKVPSV--  53

Query  360  FVGKPSLVAQRGRCFPVCRAEAAAAEDGQPLLGGEAASESPKFMGVDVATLKKIIPLGLM  539
             V KP+ +   G+ F +C+AEAAAA DGQPL G    +E PKF+G+++ TLKKIIPLGLM
Sbjct  54   -VAKPNGLFAEGKNF-ICKAEAAAAADGQPLFGEIGETEKPKFLGIELVTLKKIIPLGLM  111

Query  540  FFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYTKLANVLSKEA  719
            FFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMA+GFM+LYTKLANVLSK+A
Sbjct  112  FFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAVGFMLLYTKLANVLSKQA  171

Query  720  LFYTVILP  743
            LFYTVI+P
Sbjct  172  LFYTVIVP  179



>gb|ACU21332.1| unknown [Glycine max]
Length=250

 Score =   213 bits (541),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 125/191 (65%), Positives = 144/191 (75%), Gaps = 15/191 (8%)
 Frame = +3

Query  180  MDTILQTRGLLSLPSKPRIRASYPVPQGGLRHRFNGANGLKAKPFDGLSLSAGGLPKLEA  359
            MD +LQTRGLLSLP+ P  R S   P  GL+HRF      K K   G SLS+ G PKL  
Sbjct  1    MDAVLQTRGLLSLPANPVNRISLFNPSQGLKHRFFSP---KPKNLSGSSLSSNGFPKLSP  57

Query  360  FVGKPSLV-AQR--GRCFPVCRAEAAAAEDGQPLLGGEAASESPKFMGVDVATLKKIIPL  530
               +P+ V AQR   +   +CRAEAAAA  G+P       SE  KF+G++VATLKKI+PL
Sbjct  58   ---RPNNVFAQRDQNKNLFLCRAEAAAASFGEP------ESEKQKFLGIEVATLKKIVPL  108

Query  531  GLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYTKLANVLS  710
            G+MFFCILFNYTILRDTKDVLVVTA+GSSAEIIPFLKTWVNLPMAIGFM+LYTKLANVLS
Sbjct  109  GMMFFCILFNYTILRDTKDVLVVTARGSSAEIIPFLKTWVNLPMAIGFMLLYTKLANVLS  168

Query  711  KEALFYTVILP  743
            K+ALFY++ILP
Sbjct  169  KQALFYSIILP  179



>gb|KHG23248.1| ADP,ATP carrier 1, chloroplastic -like protein [Gossypium arboreum]
Length=612

 Score =   223 bits (567),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 120/188 (64%), Positives = 143/188 (76%), Gaps = 10/188 (5%)
 Frame = +3

Query  180  MDTILQTRGLLSLPSKPRIRASYPVPQGGLRHRFNGANGLKAKPFDGLSLSAGGLPKLEA  359
            M+ +LQTRGLLSLP  P    S   P  GL+ R   +  L     +GLSLS   +P +  
Sbjct  1    MEAVLQTRGLLSLPPHPTRVRSLLNPSQGLKQRLFASKPLG---LNGLSLSYKRVPSV--  55

Query  360  FVGKPSLVAQRGRCFPVCRAEAAAAEDGQPLLGGEAASESPKFMGVDVATLKKIIPLGLM  539
             V KP+ ++ + + F +C+AEAAA  DGQPL G    + +PKF+G+++ TLKKIIPLGLM
Sbjct  56   -VAKPNGLSPKEKSF-ICKAEAAAEADGQPLFG---ETPTPKFLGIELVTLKKIIPLGLM  110

Query  540  FFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYTKLANVLSKEA  719
            FFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMA+GFM+LYTKLANVLSK+A
Sbjct  111  FFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAVGFMLLYTKLANVLSKKA  170

Query  720  LFYTVILP  743
            LFYTVILP
Sbjct  171  LFYTVILP  178



>ref|XP_010033911.1| PREDICTED: plastidic ATP/ADP-transporter-like [Eucalyptus grandis]
 gb|KCW53783.1| hypothetical protein EUGRSUZ_J03031 [Eucalyptus grandis]
Length=615

 Score =   222 bits (566),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 119/188 (63%), Positives = 141/188 (75%), Gaps = 8/188 (4%)
 Frame = +3

Query  180  MDTILQTRGLLSLPSKPRIRASYPVPQGGLRHRFNGANGLKAKPFDGLSLSAGGLPKLEA  359
            M+ +L+TRGL+SLP  PR R     P  GL+HR      +K +   G  LS+ G      
Sbjct  1    MEAVLKTRGLISLPPNPRSRLL--SPSQGLKHRILS---IKPQALPGFPLSSNGFQGFNG  55

Query  360  FVGKPSLVAQRGRCFPVCRAEAAAAEDGQPLLGGEAASESPKFMGVDVATLKKIIPLGLM  539
            F+ KPS + Q+ R F +C+AEAAAA DGQPL    A  E PKF+G++  TLKKIIPLGLM
Sbjct  56   FISKPSGIYQKNRSFHICKAEAAAAADGQPLF---AEPEEPKFLGMEAVTLKKIIPLGLM  112

Query  540  FFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYTKLANVLSKEA  719
            FFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFM+ YTKL+N+LSK+A
Sbjct  113  FFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMLWYTKLSNMLSKQA  172

Query  720  LFYTVILP  743
            LFY+VI+P
Sbjct  173  LFYSVIVP  180



>ref|XP_006465406.1| PREDICTED: LOW QUALITY PROTEIN: plastidic ATP/ADP-transporter-like 
[Citrus sinensis]
Length=609

 Score =   221 bits (563),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 123/190 (65%), Positives = 143/190 (75%), Gaps = 10/190 (5%)
 Frame = +3

Query  180  MDTILQTRGLLSLPSKPRIRASYPVPQGGLRHRFNGANGLKAKPFDGLSLSAGGLPKLEA  359
            MD +LQTRGLLSLP  P+IR+        L+ RF  A   K +  DG SLS+ G+ K ++
Sbjct  1    MDAVLQTRGLLSLPLNPKIRSLQA--SNSLKQRFLAA---KPRTLDGFSLSSNGVSKFQS  55

Query  360  FVGKPSLVAQRGRCFPVCRAEAAAAE--DGQPLLGGEAASESPKFMGVDVATLKKIIPLG  533
            FV KP     + R   +C+AEAAA+   DGQPLLG    +E PK  G++ AT KKIIPLG
Sbjct  56   FVSKPQGFVPKERPLLICKAEAAASASADGQPLLG---EAEKPKLFGIEFATFKKIIPLG  112

Query  534  LMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYTKLANVLSK  713
            LMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFM+LYTKLA+ LSK
Sbjct  113  LMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMLLYTKLADKLSK  172

Query  714  EALFYTVILP  743
            +ALFYTVI+P
Sbjct  173  QALFYTVIVP  182



>gb|KJB70560.1| hypothetical protein B456_011G079600 [Gossypium raimondii]
Length=462

 Score =   216 bits (550),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 122/188 (65%), Positives = 145/188 (77%), Gaps = 10/188 (5%)
 Frame = +3

Query  180  MDTILQTRGLLSLPSKPRIRASYPVPQGGLRHRFNGANGLKAKPFDGLSLSAGGLPKLEA  359
            M+ +LQTRGLLSLP  P    S   P  GL+HR   +  L     +GLSLS   +P +  
Sbjct  1    MEAVLQTRGLLSLPPHPTRVRSLLNPSQGLKHRLFASKPLG---LNGLSLSYKRVPSV--  55

Query  360  FVGKPSLVAQRGRCFPVCRAEAAAAEDGQPLLGGEAASESPKFMGVDVATLKKIIPLGLM  539
             V KP+ ++ + + F +C+AEAAAA DGQPL G    + +PKF+G+++ TLKKIIPLGLM
Sbjct  56   -VAKPNGLSPKEKSF-ICKAEAAAAADGQPLFG---ETPTPKFLGIELVTLKKIIPLGLM  110

Query  540  FFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYTKLANVLSKEA  719
            FFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMA+GFM+LYTKLANVLSK+A
Sbjct  111  FFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAVGFMLLYTKLANVLSKKA  170

Query  720  LFYTVILP  743
            LFYTVILP
Sbjct  171  LFYTVILP  178



>emb|CAN83628.1| hypothetical protein VITISV_019239 [Vitis vinifera]
Length=617

 Score =   219 bits (557),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 123/188 (65%), Positives = 139/188 (74%), Gaps = 9/188 (5%)
 Frame = +3

Query  180  MDTILQTRGLLSLPSKPRIRASYPVPQGGLRHRFNGANGLKAKPFDGLSLSAGGLPKLEA  359
            M+ +LQT+GLLSLPS P+ R      Q GLR R       K K   GLSL   G  K + 
Sbjct  1    MEAVLQTKGLLSLPSNPKFRVFNS--QQGLRQRLFVQ---KPKTLGGLSLPLNGFQKFQG  55

Query  360  FVGKPSLVAQRGRCFPVCRAEAAAAEDGQPLLGGEAASESPKFMGVDVATLKKIIPLGLM  539
            FV KP    ++ R F +CRAEAAAA DGQ L    A  E PKF+G++ AT KKI+PLGLM
Sbjct  56   FVAKPHDFCRQNRGF-ICRAEAAAAADGQSLF---AEPEKPKFLGIETATFKKIVPLGLM  111

Query  540  FFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYTKLANVLSKEA  719
            FFCILFNYTILRDTKDVLVVTA GSSAEIIPFLKTWVNLPMA+GFM+LYTKLANVLSK+A
Sbjct  112  FFCILFNYTILRDTKDVLVVTAPGSSAEIIPFLKTWVNLPMAVGFMLLYTKLANVLSKQA  171

Query  720  LFYTVILP  743
            LFYTVI+P
Sbjct  172  LFYTVIVP  179



>ref|XP_002285232.1| PREDICTED: plastidic ATP/ADP-transporter [Vitis vinifera]
Length=621

 Score =   219 bits (557),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 123/188 (65%), Positives = 139/188 (74%), Gaps = 9/188 (5%)
 Frame = +3

Query  180  MDTILQTRGLLSLPSKPRIRASYPVPQGGLRHRFNGANGLKAKPFDGLSLSAGGLPKLEA  359
            M+ +LQT+GLLSLPS P+ R      Q GLR R       K K   GLSL   G  K + 
Sbjct  1    MEAVLQTKGLLSLPSNPKFRVFNS--QQGLRQRLFVQ---KPKTLGGLSLPLNGFQKFQG  55

Query  360  FVGKPSLVAQRGRCFPVCRAEAAAAEDGQPLLGGEAASESPKFMGVDVATLKKIIPLGLM  539
            FV KP    ++ R F +CRAEAAAA DGQ L    A  E PKF+G++ AT KKI+PLGLM
Sbjct  56   FVAKPHDFCRQNRGF-ICRAEAAAAADGQSLF---AEPEKPKFLGIETATFKKIVPLGLM  111

Query  540  FFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYTKLANVLSKEA  719
            FFCILFNYTILRDTKDVLVVTA GSSAEIIPFLKTWVNLPMA+GFM+LYTKLANVLSK+A
Sbjct  112  FFCILFNYTILRDTKDVLVVTAPGSSAEIIPFLKTWVNLPMAVGFMLLYTKLANVLSKQA  171

Query  720  LFYTVILP  743
            LFYTVI+P
Sbjct  172  LFYTVIVP  179



>gb|KHG15786.1| ADP,ATP carrier 1, chloroplastic -like protein [Gossypium arboreum]
Length=619

 Score =   218 bits (556),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 118/188 (63%), Positives = 143/188 (76%), Gaps = 9/188 (5%)
 Frame = +3

Query  180  MDTILQTRGLLSLPSKPRIRASYPVPQGGLRHRFNGANGLKAKPFDGLSLSAGGLPKLEA  359
            M+ +L+TRGLLSLP  P    S   P  GL+ R   +  L     +GLS+S   +P +  
Sbjct  1    MEAVLKTRGLLSLPPNPTRARSLLNPSQGLKQRLFASKPLG---LNGLSVSYKRVPSV--  55

Query  360  FVGKPSLVAQRGRCFPVCRAEAAAAEDGQPLLGGEAASESPKFMGVDVATLKKIIPLGLM  539
             V KP+ +    + F +C+AEAAAA DGQPL+G   + + PKF+G+++ TLKKIIPLGLM
Sbjct  56   -VAKPNGLFPEQKSF-ICKAEAAAAGDGQPLIG--ESEKKPKFLGIELVTLKKIIPLGLM  111

Query  540  FFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYTKLANVLSKEA  719
            FFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMA+GFM+LYTKLANVLSK+A
Sbjct  112  FFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAVGFMLLYTKLANVLSKKA  171

Query  720  LFYTVILP  743
            LFYTVI+P
Sbjct  172  LFYTVIVP  179



>gb|AES68077.2| plastidic ATP/ADP-transporter-like protein [Medicago truncatula]
Length=595

 Score =   218 bits (554),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 110/188 (59%), Positives = 142/188 (76%), Gaps = 6/188 (3%)
 Frame = +3

Query  180  MDTILQTRGLLSLPSKPRIRASYPVPQGGLRHRFNGANGLKAKPFDGLSLSAGGLPKLEA  359
            M+ +L ++G LSLP+ P+ R  +  P  GL+HRF   N   +K   G SL+  GL  L +
Sbjct  1    MEAVLHSKGFLSLPTNPKTR--FLNPSHGLKHRFFSPN---SKILGGFSLTNNGLVNLNS  55

Query  360  FVGKPSLVAQRGRCFPVCRAEAAAAEDGQPLLGGEAASESPKFMGVDVATLKKIIPLGLM  539
               K ++  ++ +   +C+AEA +A  G+ +   E+ +E PKF+GV+V TLKKIIPLG+M
Sbjct  56   STLKATIFDKKDKNLFICKAEADSAGVGEAVFD-ESETEKPKFLGVEVITLKKIIPLGMM  114

Query  540  FFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYTKLANVLSKEA  719
            FFCILFNYTILRDTKDVLVVTA+GSSAEIIPFLKTWVNLPMAIGFM+LYTKL+NVLSK+A
Sbjct  115  FFCILFNYTILRDTKDVLVVTARGSSAEIIPFLKTWVNLPMAIGFMLLYTKLSNVLSKQA  174

Query  720  LFYTVILP  743
            LFY+VI+P
Sbjct  175  LFYSVIVP  182



>gb|KJB70561.1| hypothetical protein B456_011G079600 [Gossypium raimondii]
Length=519

 Score =   216 bits (549),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 122/188 (65%), Positives = 145/188 (77%), Gaps = 10/188 (5%)
 Frame = +3

Query  180  MDTILQTRGLLSLPSKPRIRASYPVPQGGLRHRFNGANGLKAKPFDGLSLSAGGLPKLEA  359
            M+ +LQTRGLLSLP  P    S   P  GL+HR   +  L     +GLSLS   +P +  
Sbjct  1    MEAVLQTRGLLSLPPHPTRVRSLLNPSQGLKHRLFASKPLG---LNGLSLSYKRVPSV--  55

Query  360  FVGKPSLVAQRGRCFPVCRAEAAAAEDGQPLLGGEAASESPKFMGVDVATLKKIIPLGLM  539
             V KP+ ++ + + F +C+AEAAAA DGQPL G    + +PKF+G+++ TLKKIIPLGLM
Sbjct  56   -VAKPNGLSPKEKSF-ICKAEAAAAADGQPLFG---ETPTPKFLGIELVTLKKIIPLGLM  110

Query  540  FFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYTKLANVLSKEA  719
            FFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMA+GFM+LYTKLANVLSK+A
Sbjct  111  FFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAVGFMLLYTKLANVLSKKA  170

Query  720  LFYTVILP  743
            LFYTVILP
Sbjct  171  LFYTVILP  178



>ref|XP_010532151.1| PREDICTED: ADP,ATP carrier protein 1, chloroplastic-like [Tarenaya 
hassleriana]
Length=629

 Score =   218 bits (555),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 119/194 (61%), Positives = 141/194 (73%), Gaps = 10/194 (5%)
 Frame = +3

Query  180  MDTILQTRGLLSLPSKPRIRASYPVPQGGLRHRFNGANGLKAKPFDGLSLSAGGLPKLEA  359
            M+ ++QTRG+LSLP+KP     +  P  GL+ R   +   K +   GLSLS+ G  K + 
Sbjct  1    MEAVIQTRGILSLPAKPTGGRGFLQPSRGLKQRIFAS---KPRTLPGLSLSSNGHKKFQT  57

Query  360  FVGKP---SLVAQRGRCFPVCRAEAAAAEDGQPLLG---GEAASESPKFMGVDVATLKKI  521
            F   P   S+  +   C  +C+AEAAAA D  P+ G     A + +PK  GV+VATLKKI
Sbjct  58   FESTPHRISVSHKERSCGFICKAEAAAAGD-LPVFGEGDTAAVAATPKIFGVEVATLKKI  116

Query  522  IPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYTKLAN  701
            IPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMA+GFM+LYTKLAN
Sbjct  117  IPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAVGFMLLYTKLAN  176

Query  702  VLSKEALFYTVILP  743
            VLSK+ALFYTVI P
Sbjct  177  VLSKDALFYTVIFP  190



>ref|XP_010417726.1| PREDICTED: ADP,ATP carrier protein 1, chloroplastic [Camelina 
sativa]
Length=618

 Score =   218 bits (554),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 121/194 (62%), Positives = 144/194 (74%), Gaps = 14/194 (7%)
 Frame = +3

Query  180  MDTILQTRGLLSLPSKPRIRASYPVPQGGLRHRFNGANGLKAKPFDGLSLSAGGLPKLEA  359
            M+  +QTRGLLSLP+KP    S   P  GL+ R   A   K +   GLSLS  G  K + 
Sbjct  1    MEAAIQTRGLLSLPTKPIGVRSLLQPSHGLKQRLFAA---KPRNLPGLSLSFHGHKKFQT  57

Query  360  FVGKPSL----VAQRGRCFP-VCRAEAAAAEDGQPLLGGEAASESPKFMGVDVATLKKII  524
            F  +P+L    ++ + R    +C+AEAA A +G+    G++A+ SPK  GV+V TLKKII
Sbjct  58   F--EPTLQGISISHKERSTDFICKAEAATAGEGE----GDSAAASPKIFGVEVTTLKKII  111

Query  525  PLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYTKLANV  704
            PLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFM+LYTKL+NV
Sbjct  112  PLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMLLYTKLSNV  171

Query  705  LSKEALFYTVILPF  746
            LSK+ALFYTVI+PF
Sbjct  172  LSKKALFYTVIIPF  185



>ref|XP_010249956.1| PREDICTED: plastidic ATP/ADP-transporter [Nelumbo nucifera]
Length=631

 Score =   218 bits (555),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 119/188 (63%), Positives = 141/188 (75%), Gaps = 8/188 (4%)
 Frame = +3

Query  180  MDTILQTRGLLSLPSKPRIRASYPVPQGGLRHRFNGANGLKAKPFDGLSLSAGGLPKLEA  359
            M+ +LQT+GL SLPS P+ +     PQ   + R N  N    +   G SLS  G  K   
Sbjct  1    MEAVLQTKGLFSLPSNPKTKF-LGSPQC-FKRRLNARND---RALGGFSLSVDGFQKFHG  55

Query  360  FVGKPSLVAQRGRCFPVCRAEAAAAEDGQPLLGGEAASESPKFMGVDVATLKKIIPLGLM  539
            FV K   + ++GR + + RAEAAAA DGQPL+G     E PKF+G+++ TLKKIIPLGLM
Sbjct  56   FVSKTHGLYKKGRGWQIYRAEAAAAADGQPLIG---EVEQPKFLGIELVTLKKIIPLGLM  112

Query  540  FFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYTKLANVLSKEA  719
            FFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMA+GFM+LYTKLANVLSK+A
Sbjct  113  FFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAVGFMLLYTKLANVLSKQA  172

Query  720  LFYTVILP  743
            LFYT+I+P
Sbjct  173  LFYTIIVP  180



>gb|KJB56643.1| hypothetical protein B456_009G129100 [Gossypium raimondii]
Length=619

 Score =   217 bits (553),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 117/188 (62%), Positives = 142/188 (76%), Gaps = 9/188 (5%)
 Frame = +3

Query  180  MDTILQTRGLLSLPSKPRIRASYPVPQGGLRHRFNGANGLKAKPFDGLSLSAGGLPKLEA  359
            M+ +L+T+GLLSLP  P    S   P  GL+ R   +  L     +GLS+S   +P +  
Sbjct  1    MEAVLKTKGLLSLPPNPTSARSLLNPSQGLKQRLFASKPLG---LNGLSVSYKRVPSV--  55

Query  360  FVGKPSLVAQRGRCFPVCRAEAAAAEDGQPLLGGEAASESPKFMGVDVATLKKIIPLGLM  539
             V KP+ +    + F +C+AEAAAA DGQPL+G     + PKF+G+++ TLKKIIPLGLM
Sbjct  56   -VAKPNGLFPEQKSF-ICKAEAAAAGDGQPLIG--ETEKKPKFLGIELVTLKKIIPLGLM  111

Query  540  FFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYTKLANVLSKEA  719
            FFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMA+GFM+LYTKLANVLSK+A
Sbjct  112  FFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAVGFMLLYTKLANVLSKKA  171

Query  720  LFYTVILP  743
            LFYTVI+P
Sbjct  172  LFYTVIIP  179



>ref|XP_003597826.1| ATP/ADP transporter [Medicago truncatula]
Length=645

 Score =   217 bits (553),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 110/188 (59%), Positives = 142/188 (76%), Gaps = 6/188 (3%)
 Frame = +3

Query  180  MDTILQTRGLLSLPSKPRIRASYPVPQGGLRHRFNGANGLKAKPFDGLSLSAGGLPKLEA  359
            M+ +L ++G LSLP+ P+ R  +  P  GL+HRF   N   +K   G SL+  GL  L +
Sbjct  1    MEAVLHSKGFLSLPTNPKTR--FLNPSHGLKHRFFSPN---SKILGGFSLTNNGLVNLNS  55

Query  360  FVGKPSLVAQRGRCFPVCRAEAAAAEDGQPLLGGEAASESPKFMGVDVATLKKIIPLGLM  539
               K ++  ++ +   +C+AEA +A  G+ +   E+ +E PKF+GV+V TLKKIIPLG+M
Sbjct  56   STLKATIFDKKDKNLFICKAEADSAGVGEAVFD-ESETEKPKFLGVEVITLKKIIPLGMM  114

Query  540  FFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYTKLANVLSKEA  719
            FFCILFNYTILRDTKDVLVVTA+GSSAEIIPFLKTWVNLPMAIGFM+LYTKL+NVLSK+A
Sbjct  115  FFCILFNYTILRDTKDVLVVTARGSSAEIIPFLKTWVNLPMAIGFMLLYTKLSNVLSKQA  174

Query  720  LFYTVILP  743
            LFY+VI+P
Sbjct  175  LFYSVIVP  182



>emb|CDY39988.1| BnaC06g40660D [Brassica napus]
Length=615

 Score =   217 bits (552),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 122/196 (62%), Positives = 144/196 (73%), Gaps = 18/196 (9%)
 Frame = +3

Query  180  MDTILQTRGLLSLPSKPRIRASYPVPQGGLRHRFNGANGLKAKPFD--GLSLSAGGLPKL  353
            M T++QTRGLLSLP+KP    S   P  GL+HR        +KP +   LSLS+ G  K 
Sbjct  1    MATVIQTRGLLSLPAKPIGVRSLLQPSHGLKHRL-----FASKPRNPPALSLSSNGHQKF  55

Query  354  EAFVGKPSL----VAQRGRCFP-VCRAEAAAAEDGQPLLGGEAASESPKFMGVDVATLKK  518
            ++F  +P+L    ++ + R    +C+AEAA+A +G       A S SPK  GV+V TLKK
Sbjct  56   QSF--EPTLPGISISHKARSTEFICKAEAASAGEGDT----AAISASPKIFGVEVTTLKK  109

Query  519  IIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYTKLA  698
            IIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFM+LYTKL+
Sbjct  110  IIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMLLYTKLS  169

Query  699  NVLSKEALFYTVILPF  746
            NVLSK ALFYTVI+PF
Sbjct  170  NVLSKRALFYTVIIPF  185



>gb|KJB70559.1| hypothetical protein B456_011G079600 [Gossypium raimondii]
 gb|KJB70562.1| hypothetical protein B456_011G079600 [Gossypium raimondii]
Length=609

 Score =   216 bits (549),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 122/188 (65%), Positives = 145/188 (77%), Gaps = 10/188 (5%)
 Frame = +3

Query  180  MDTILQTRGLLSLPSKPRIRASYPVPQGGLRHRFNGANGLKAKPFDGLSLSAGGLPKLEA  359
            M+ +LQTRGLLSLP  P    S   P  GL+HR   +  L     +GLSLS   +P +  
Sbjct  1    MEAVLQTRGLLSLPPHPTRVRSLLNPSQGLKHRLFASKPLG---LNGLSLSYKRVPSV--  55

Query  360  FVGKPSLVAQRGRCFPVCRAEAAAAEDGQPLLGGEAASESPKFMGVDVATLKKIIPLGLM  539
             V KP+ ++ + + F +C+AEAAAA DGQPL G    + +PKF+G+++ TLKKIIPLGLM
Sbjct  56   -VAKPNGLSPKEKSF-ICKAEAAAAADGQPLFG---ETPTPKFLGIELVTLKKIIPLGLM  110

Query  540  FFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYTKLANVLSKEA  719
            FFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMA+GFM+LYTKLANVLSK+A
Sbjct  111  FFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAVGFMLLYTKLANVLSKKA  170

Query  720  LFYTVILP  743
            LFYTVILP
Sbjct  171  LFYTVILP  178



>ref|XP_006307012.1| hypothetical protein CARUB_v10008598mg [Capsella rubella]
 gb|EOA39910.1| hypothetical protein CARUB_v10008598mg [Capsella rubella]
Length=618

 Score =   216 bits (549),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 120/195 (62%), Positives = 141/195 (72%), Gaps = 13/195 (7%)
 Frame = +3

Query  180  MDTILQTRGLLSLPSKPRIRASYPVPQGGLRHRFNGANGLKAKPFDGLSLSAGGLPKLEA  359
            M+ ++QTRG+LSLP+KP        P  GL+ R    N         LSLS+ G  K +A
Sbjct  1    MEGLIQTRGILSLPAKPIGARRILQPSLGLKQRLFTTN------LPALSLSSNGHTKFQA  54

Query  360  FVGKPSLVA----QRGRCFPVCRAEAAAAEDGQPLLGGEAASE--SPKFMGVDVATLKKI  521
            F   P  ++    +R R F +C+AEAAAA DG     G+ A+   SPK  GV+V TLKKI
Sbjct  55   FQSIPLGISVSHKERSRGF-ICKAEAAAAGDGNVFDEGDTAAMAVSPKIFGVEVTTLKKI  113

Query  522  IPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYTKLAN  701
            +PLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFM+LYTKL+N
Sbjct  114  VPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMLLYTKLSN  173

Query  702  VLSKEALFYTVILPF  746
            VLSK+ALFYTVI+PF
Sbjct  174  VLSKKALFYTVIVPF  188



>ref|XP_009343421.1| PREDICTED: plastidic ATP/ADP-transporter-like [Pyrus x bretschneideri]
 ref|XP_009343422.1| PREDICTED: plastidic ATP/ADP-transporter-like [Pyrus x bretschneideri]
Length=617

 Score =   215 bits (548),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 126/188 (67%), Positives = 139/188 (74%), Gaps = 10/188 (5%)
 Frame = +3

Query  180  MDTILQTRGLLSLPSKPRIRASYPVPQGGLRHRFNGANGLKAKPFDGLSLSAGGLPKLEA  359
            M+ +LQT+GLLSLPS PR R        GL+ RF      K K   G SLS+ G PK   
Sbjct  1    MEAVLQTKGLLSLPSNPRTRVFQS--SLGLKQRFFST---KPKTPGGFSLSSNGFPKFPC  55

Query  360  FVGKPSLVAQRGRCFPVCRAEAAAAEDGQPLLGGEAASESPKFMGVDVATLKKIIPLGLM  539
            FV K   VA   R   +CRAEAAAA  GQP  G    SE PKF+G++  TLKKIIPLGLM
Sbjct  56   FVPKNHGVAPVERNLFICRAEAAAA--GQPAFG---ESEQPKFLGIETVTLKKIIPLGLM  110

Query  540  FFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYTKLANVLSKEA  719
            FFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMA+GFM+LYTKL+NVLSK+A
Sbjct  111  FFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAVGFMLLYTKLSNVLSKKA  170

Query  720  LFYTVILP  743
            LFYTVILP
Sbjct  171  LFYTVILP  178



>ref|XP_010061949.1| PREDICTED: plastidic ATP/ADP-transporter-like [Eucalyptus grandis]
 gb|KCW68998.1| hypothetical protein EUGRSUZ_F02558 [Eucalyptus grandis]
Length=623

 Score =   215 bits (548),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 118/189 (62%), Positives = 138/189 (73%), Gaps = 9/189 (5%)
 Frame = +3

Query  180  MDTILQTRGLLSLPSKPRIRASYPVPQGGLRHRFNGANGLKAKPFDGLSLSAGGLPKLEA  359
            M+ +LQT+GLLSLPSKPR R  +  P   LR R      +K        LS  G  K   
Sbjct  1    MEAVLQTKGLLSLPSKPRNR--FLNPSQSLRQR---VLSIKPNSLAAFPLSTNGFQKFNG  55

Query  360  FVGKPSLVAQRGRCFPVCRAEAAAAE-DGQPLLGGEAASESPKFMGVDVATLKKIIPLGL  536
             + +P  + Q+ R F +C+AEAAAA  DGQP+ G     E PKF+G++  T KKI+PLGL
Sbjct  56   VISRPGEIYQKNRTFHICKAEAAAAGADGQPVFG---EPEKPKFLGLEPVTFKKIVPLGL  112

Query  537  MFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYTKLANVLSKE  716
            MFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMA+GFM+LYTKLANVLSKE
Sbjct  113  MFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAVGFMLLYTKLANVLSKE  172

Query  717  ALFYTVILP  743
            ALFY+VI+P
Sbjct  173  ALFYSVIVP  181



>ref|XP_007217627.1| hypothetical protein PRUPE_ppa002937mg [Prunus persica]
 gb|EMJ18826.1| hypothetical protein PRUPE_ppa002937mg [Prunus persica]
Length=620

 Score =   215 bits (547),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 121/189 (64%), Positives = 140/189 (74%), Gaps = 9/189 (5%)
 Frame = +3

Query  180  MDTILQTRGLLSLPSKPRIRASYPVPQGGLRHRFNGANGLKAKPFDGLSLSAGGLPKLEA  359
            MD +LQT+GLLSLP  P+ R   P    GL+ R   +   K K   GLSLS+ GL K + 
Sbjct  1    MDAVLQTKGLLSLPLNPKTRVFQP--SLGLKQR---SFSTKPKTPTGLSLSSNGLQKFQG  55

Query  360  FVGKPSLVAQRGRCFPVCRAEAAAAE-DGQPLLGGEAASESPKFMGVDVATLKKIIPLGL  536
            F+ K      + R   +CRAEAAAA  DGQP  G    +E PKF G++  TLKKI+PLGL
Sbjct  56   FISKTHGFGTKERNLFICRAEAAAAAADGQPAFG---ETEKPKFFGIEAVTLKKIVPLGL  112

Query  537  MFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYTKLANVLSKE  716
            MFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMA+GFM+LYTKL+NVLSK+
Sbjct  113  MFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAVGFMLLYTKLSNVLSKK  172

Query  717  ALFYTVILP  743
            ALFYTV+LP
Sbjct  173  ALFYTVMLP  181



>ref|XP_010537959.1| PREDICTED: ADP,ATP carrier protein 1, chloroplastic [Tarenaya 
hassleriana]
Length=628

 Score =   215 bits (547),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 121/195 (62%), Positives = 143/195 (73%), Gaps = 12/195 (6%)
 Frame = +3

Query  180  MDTILQTRGLLSLPSKPRIRASYPVPQGGLRHRFNGANGLKAKPFDGLSLSAGGLPKLEA  359
            M+ +LQTRG+LSLP+KP        P  GL+ R   +   K     GLSLS+ G  K   
Sbjct  1    MEAVLQTRGILSLPAKPTGVRGLLRPSHGLKQRIFSS---KPSTLPGLSLSSNGQKKFLV  57

Query  360  FVGKPSLVA----QRGRCFPVCRAEAAAAEDGQPLLG-GEAAS--ESPKFMGVDVATLKK  518
            F   P  ++    +R R F +C+AEAAAA D +P+ G G+ A+   +PK  GV+V TLKK
Sbjct  58   FESSPHGISVSHEERSRGF-ICKAEAAAAGD-RPVFGEGDTAAVPATPKIFGVEVTTLKK  115

Query  519  IIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYTKLA  698
            IIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMA+GFM+LYTKLA
Sbjct  116  IIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAVGFMLLYTKLA  175

Query  699  NVLSKEALFYTVILP  743
            NVLSK+ALFYTVI+P
Sbjct  176  NVLSKDALFYTVIVP  190



>ref|XP_006416899.1| hypothetical protein EUTSA_v10007090mg [Eutrema salsugineum]
 gb|ESQ35252.1| hypothetical protein EUTSA_v10007090mg [Eutrema salsugineum]
Length=618

 Score =   215 bits (547),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 119/195 (61%), Positives = 143/195 (73%), Gaps = 13/195 (7%)
 Frame = +3

Query  180  MDTILQTRGLLSLPSKPRIRASYPVPQGGLRHRFNGANGLKAKPFDGLSLSAGGLPKLEA  359
            M+ ++QTRG+LSLP+KP    S   P  GL+ R      L  +    LS+S+ G  K +A
Sbjct  1    MEGLIQTRGILSLPAKPIGVRSLLQPSHGLKQR------LFTRNLPALSISSNGHNKFQA  54

Query  360  FVGKPSLVA----QRGRCFPVCRAEAAAAEDGQPLLGGEAASE--SPKFMGVDVATLKKI  521
                P  ++    +R R F +C+AEAAAA DG     G++A+   +PK  GV+V TLKKI
Sbjct  55   LQPNPHGISISLKERSRGF-ICKAEAAAAGDGNVFGEGDSAAMAVTPKIFGVEVTTLKKI  113

Query  522  IPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYTKLAN  701
            IPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFM+LYTKL+N
Sbjct  114  IPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMLLYTKLSN  173

Query  702  VLSKEALFYTVILPF  746
            VLSK+ALFYTVI+PF
Sbjct  174  VLSKKALFYTVIVPF  188



>gb|KHN22476.1| ADP,ATP carrier protein 1, chloroplastic [Glycine soja]
Length=616

 Score =   215 bits (547),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 124/190 (65%), Positives = 139/190 (73%), Gaps = 12/190 (6%)
 Frame = +3

Query  180  MDTILQTRGLLSLPSKPRIRASYPVPQGGLRHRFNGANGLKAKPFDGLSLSAGGLPKLEA  359
            MD + QTRGLLSLP+ P  R S   P  GLRHR       K K   G SLS  G PKL  
Sbjct  1    MDAVFQTRGLLSLPTNPVNRISLLHPSHGLRHRLFSP---KPKNLSGSSLSFNGFPKLSP  57

Query  360  FVGKPSLVAQR--GRCFPVCRAEAAAAEDGQPLLGGEAASESPKFMGVDVATLKKIIPLG  533
               K ++ AQR   +   +CRAEAAAA        GE  SE PK +G++VATLKKI+PLG
Sbjct  58   ---KANVFAQRDKNKNLFLCRAEAAAAAASF----GEPGSEKPKLLGIEVATLKKIVPLG  110

Query  534  LMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYTKLANVLSK  713
            LMFFCILFNYTILRDTKDVLVVTA+GSSAEIIPFLKTWVNLPMAIGFM+LYTKLANVLSK
Sbjct  111  LMFFCILFNYTILRDTKDVLVVTARGSSAEIIPFLKTWVNLPMAIGFMLLYTKLANVLSK  170

Query  714  EALFYTVILP  743
            +ALFY++ILP
Sbjct  171  QALFYSIILP  180



>gb|KHN44149.1| ADP,ATP carrier protein 1, chloroplastic [Glycine soja]
Length=615

 Score =   214 bits (546),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 125/191 (65%), Positives = 144/191 (75%), Gaps = 15/191 (8%)
 Frame = +3

Query  180  MDTILQTRGLLSLPSKPRIRASYPVPQGGLRHRFNGANGLKAKPFDGLSLSAGGLPKLEA  359
            MD +LQTRGLLSLP+ P  R S   P  GL+HRF      K K   G SLS+ G PKL  
Sbjct  1    MDAVLQTRGLLSLPANPVNRISLFKPSQGLKHRFFSP---KPKNLSGSSLSSNGFPKLSP  57

Query  360  FVGKPSLV-AQR--GRCFPVCRAEAAAAEDGQPLLGGEAASESPKFMGVDVATLKKIIPL  530
               +P+ V AQR   +   +CRAEAAAA  G+P       SE  KF+G++VATLKKI+PL
Sbjct  58   ---RPNNVFAQRDQNKNLFLCRAEAAAASFGEP------ESEKQKFLGIEVATLKKIVPL  108

Query  531  GLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYTKLANVLS  710
            G+MFFCILFNYTILRDTKDVLVVTA+GSSAEIIPFLKTWVNLPMAIGFM+LYTKLANVLS
Sbjct  109  GMMFFCILFNYTILRDTKDVLVVTARGSSAEIIPFLKTWVNLPMAIGFMLLYTKLANVLS  168

Query  711  KEALFYTVILP  743
            K+ALFY++ILP
Sbjct  169  KQALFYSIILP  179



>ref|XP_003543665.1| PREDICTED: ADP,ATP carrier protein 1, chloroplastic-like [Glycine 
max]
Length=615

 Score =   214 bits (546),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 125/191 (65%), Positives = 144/191 (75%), Gaps = 15/191 (8%)
 Frame = +3

Query  180  MDTILQTRGLLSLPSKPRIRASYPVPQGGLRHRFNGANGLKAKPFDGLSLSAGGLPKLEA  359
            MD +LQTRGLLSLP+ P  R S   P  GL+HRF      K K   G SLS+ G PKL  
Sbjct  1    MDAVLQTRGLLSLPANPVNRISLFNPSQGLKHRFFSP---KPKNLSGSSLSSNGFPKLSP  57

Query  360  FVGKPSLV-AQR--GRCFPVCRAEAAAAEDGQPLLGGEAASESPKFMGVDVATLKKIIPL  530
               +P+ V AQR   +   +CRAEAAAA  G+P       SE  KF+G++VATLKKI+PL
Sbjct  58   ---RPNNVFAQRDQNKNLFLCRAEAAAASFGEP------ESEKQKFLGIEVATLKKIVPL  108

Query  531  GLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYTKLANVLS  710
            G+MFFCILFNYTILRDTKDVLVVTA+GSSAEIIPFLKTWVNLPMAIGFM+LYTKLANVLS
Sbjct  109  GMMFFCILFNYTILRDTKDVLVVTARGSSAEIIPFLKTWVNLPMAIGFMLLYTKLANVLS  168

Query  711  KEALFYTVILP  743
            K+ALFY++ILP
Sbjct  169  KQALFYSIILP  179



>gb|KJB68136.1| hypothetical protein B456_010G227600 [Gossypium raimondii]
Length=615

 Score =   213 bits (543),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 121/189 (64%), Positives = 140/189 (74%), Gaps = 16/189 (8%)
 Frame = +3

Query  180  MDTILQTRGLLSLPSKPRIRASYPVPQGGLRHRFNGANGLKAKPFDGLSLSAGGLPKLEA  359
            M+ +LQTRGLLSLP KP   +S   P  GL HR   +  L    F+GL L    +P +  
Sbjct  1    MEAVLQTRGLLSLPPKPTKASSLLNPSQGLTHRLFASKPLG---FNGLCLFYRRVPSV--  55

Query  360  FVGKPSLVAQRGRCFPVCRAEAAAAEDG-QPLLGGEAASESPKFMGVDVATLKKIIPLGL  536
             V KP+     G  F +C+A+AA+A DG QP       +E PKFMG+++ TLKKIIPLGL
Sbjct  56   -VAKPN-----GVPF-ICKAKAASAADGKQPFFN---ENEKPKFMGIEILTLKKIIPLGL  105

Query  537  MFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYTKLANVLSKE  716
            MFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFM+LYTKLANVLSK+
Sbjct  106  MFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMLLYTKLANVLSKK  165

Query  717  ALFYTVILP  743
            ALFYTVI+P
Sbjct  166  ALFYTVIVP  174



>gb|KHG10295.1| ADP,ATP carrier 1, chloroplastic -like protein [Gossypium arboreum]
Length=630

 Score =   213 bits (541),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 120/190 (63%), Positives = 143/190 (75%), Gaps = 12/190 (6%)
 Frame = +3

Query  180  MDTILQTRGLLSLPSKP-RIRA-SYPVPQGGLRHRFNGANGLKAKPFDGLSLSAGGLPKL  353
            M+ +LQTR LLSLP  P R+R  S   P   L+ R   +  L      GLSLS   +P  
Sbjct  10   MEAVLQTRCLLSLPPNPTRVRVRSLLNPSQVLKQRLFASKPLG---LSGLSLSYKEVP--  64

Query  354  EAFVGKPSLVAQRGRCFPVCRAEAAAAEDGQPLLGGEAASESPKFMGVDVATLKKIIPLG  533
             +FV KP+ ++ +G+ F + +AEAAAA D QPL G    ++ PKF+G+++ TLKKIIPLG
Sbjct  65   -SFVAKPNGLSPKGKNF-IRKAEAAAATDDQPLFG---ETQKPKFLGIELVTLKKIIPLG  119

Query  534  LMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYTKLANVLSK  713
            LMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFM+LYTKLANVL K
Sbjct  120  LMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMLLYTKLANVLPK  179

Query  714  EALFYTVILP  743
            +ALFYTVI+P
Sbjct  180  KALFYTVIVP  189



>ref|XP_008228630.1| PREDICTED: plastidic ATP/ADP-transporter-like [Prunus mume]
Length=621

 Score =   212 bits (539),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 120/197 (61%), Positives = 138/197 (70%), Gaps = 24/197 (12%)
 Frame = +3

Query  180  MDTILQTRGLLSLPSKPRIRASYPVPQGGLRHRFNGANGLKAKPFD-------GLSLSAG  338
            MD +LQT+GLLSLP  P+ RA            F  + GLK + F        GLSLS+ 
Sbjct  1    MDAVLQTKGLLSLPLNPKTRA------------FQSSLGLKQRSFSTKPKIPTGLSLSSN  48

Query  339  GLPKLEAFVGKPSLVAQRGRCFPVCRAEAAAAE--DGQPLLGGEAASESPKFMGVDVATL  512
            GL K + FV        + R   +CRAEAAAA   DGQP  G    +E PKF G++  T 
Sbjct  49   GLQKFQGFVSNTHGFGTKERNLFICRAEAAAAAAADGQPAFG---ETEQPKFFGIEAVTF  105

Query  513  KKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYTK  692
            KKI+PLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMA+GFM+LYTK
Sbjct  106  KKIVPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAVGFMLLYTK  165

Query  693  LANVLSKEALFYTVILP  743
            L+NVLSK+ALFYTV+LP
Sbjct  166  LSNVLSKKALFYTVMLP  182



>ref|XP_010099654.1| Plastidic [Morus notabilis]
 gb|EXB80175.1| Plastidic [Morus notabilis]
Length=620

 Score =   211 bits (537),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 119/190 (63%), Positives = 138/190 (73%), Gaps = 10/190 (5%)
 Frame = +3

Query  180  MDTILQTRGLLSLPSKPRIRASYPVPQGGLRHRFNGANGLKAKPFDGLSLSAGGLPKLEA  359
            M+ +LQT+GLLS P  P+ R     P  GL+ R       K KP  GLSLS+ G  K + 
Sbjct  1    MEAVLQTKGLLSFPHNPKPRVL--APSQGLKQRILSP---KLKPLPGLSLSSNGFRKFQT  55

Query  360  FVGKPSL--VAQRGRCFPVCRAEAAAAEDGQPLLGGEAASESPKFMGVDVATLKKIIPLG  533
            F  KP         R   VC+AEAAAA DGQP+    + +E PK +G++V T KKI+PLG
Sbjct  56   FAPKPKAHGFGSTDRNLFVCKAEAAAAADGQPVF---SEAEPPKILGIEVTTFKKILPLG  112

Query  534  LMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYTKLANVLSK  713
            LMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFM+LYTKLANVLSK
Sbjct  113  LMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMLLYTKLANVLSK  172

Query  714  EALFYTVILP  743
            +ALFY+VI+P
Sbjct  173  KALFYSVIVP  182



>ref|XP_010476640.1| PREDICTED: ADP,ATP carrier protein 2, chloroplastic-like [Camelina 
sativa]
Length=624

 Score =   211 bits (536),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 122/200 (61%), Positives = 141/200 (71%), Gaps = 18/200 (9%)
 Frame = +3

Query  180  MDTILQTRGLLSLPSKP---RIRASYPVPQG-GLRHRFNGANGLKAKPFDGLSLSAGGLP  347
            M+ ++QTRGLLSLP+KP   R     P   G  L+ R    N         LSLS+ G  
Sbjct  1    MEGLIQTRGLLSLPAKPIGSRRLLHQPSSHGFALKQRLFTTN------LPALSLSSNGHT  54

Query  348  KLEAFVGKPSLVA----QRGRCFPVCRAEAAAAEDGQPLLGGEAASE---SPKFMGVDVA  506
            K  AF   P  ++    +R R F +C+AEAAAA DG     G+ A+    SPK  GV+V 
Sbjct  55   KSRAFQSIPLGISVSHKERSRGF-ICKAEAAAAGDGNVFDEGDTAAMAAVSPKIFGVEVT  113

Query  507  TLKKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILY  686
            TLKKI+PLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFM+LY
Sbjct  114  TLKKIVPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMLLY  173

Query  687  TKLANVLSKEALFYTVILPF  746
            TKL+NVLSK+ALFYTVI+PF
Sbjct  174  TKLSNVLSKKALFYTVIVPF  193



>ref|XP_010691228.1| PREDICTED: plastidic ATP/ADP-transporter [Beta vulgaris subsp. 
vulgaris]
Length=629

 Score =   211 bits (537),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 115/191 (60%), Positives = 135/191 (71%), Gaps = 7/191 (4%)
 Frame = +3

Query  180  MDTILQTRGLLSLPSKPRIRASYPVPQGGLRHRFNGANGLKAKPFDGLSLSAGGLPKLEA  359
            M+ +LQTRGLLSLP+ P++R      Q  LR R +    LK  P  G S+S+ G  K   
Sbjct  1    MEAVLQTRGLLSLPTNPKLRV-LKSAQSSLRQRISTPKTLKPNPLQGFSISSNGYQKFHG  59

Query  360  FVGKPSLVAQRGRCFPVCRAEAAAAE---DGQPLLGGEAASESPKFMGVDVATLKKIIPL  530
             V       Q  R FP+CRAEAAAA    DGQP  G     E  KF G+++ T KKIIPL
Sbjct  60   VVSNSKGFVQNLRNFPICRAEAAAAGAAADGQPSFG---EIEPKKFFGIELITYKKIIPL  116

Query  531  GLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYTKLANVLS  710
            GLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFM+LYTKL+++L 
Sbjct  117  GLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMVLYTKLSDILP  176

Query  711  KEALFYTVILP  743
            ++ LFY+V+LP
Sbjct  177  RKTLFYSVMLP  187



>ref|XP_010497204.1| PREDICTED: ADP,ATP carrier protein 2, chloroplastic-like [Camelina 
sativa]
Length=621

 Score =   211 bits (536),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 121/198 (61%), Positives = 140/198 (71%), Gaps = 16/198 (8%)
 Frame = +3

Query  180  MDTILQTRGLLSLPSKP--RIRASYPVPQGGLRHRFNGANGLKAKPFDGLSLSAGGLPKL  353
            M+ ++QTRGLLSLP+KP    R   P     L+ R    N         LSLS+ G  K 
Sbjct  1    MEGLIQTRGLLSLPAKPIGSRRLLQPSLAFALKQRLFTTN------LPALSLSSNGHTKS  54

Query  354  EAFVGKPSLVA----QRGRCFPVCRAEAAAAEDGQPLLGGEAASE---SPKFMGVDVATL  512
             AF   P  ++    +R R F +C+AEAAAA DG     G+ A+    SPK  GV+V TL
Sbjct  55   RAFQSIPLGISVSHKERSRGF-ICKAEAAAAGDGNVFDEGDTAAMAAVSPKIFGVEVTTL  113

Query  513  KKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYTK  692
            KKI+PLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFM+LYTK
Sbjct  114  KKIVPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMLLYTK  173

Query  693  LANVLSKEALFYTVILPF  746
            L+NVLSK+ALFYTVI+PF
Sbjct  174  LSNVLSKKALFYTVIVPF  191



>gb|KHG16971.1| ADP,ATP carrier 1, chloroplastic -like protein [Gossypium arboreum]
Length=615

 Score =   208 bits (530),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 118/189 (62%), Positives = 138/189 (73%), Gaps = 16/189 (8%)
 Frame = +3

Query  180  MDTILQTRGLLSLPSKPRIRASYPVPQGGLRHRFNGANGLKAKPFDGLSLSAGGLPKLEA  359
            M+ +LQTR LLSLP KP   +S   P  GL HR   +  L    F+GL L    +P +  
Sbjct  1    MEVVLQTRWLLSLPPKPTKASSLLNPSQGLNHRLFASKPLG---FNGLCLFNRRVPSV--  55

Query  360  FVGKPSLVAQRGRCFPVCRAEAAAAEDG-QPLLGGEAASESPKFMGVDVATLKKIIPLGL  536
             V KP+     G  F +C+A+AA+A DG QP       +E PKFMG+++ TLKKIIPLGL
Sbjct  56   -VAKPN-----GVPF-ICKAKAASAADGKQPFF---HENEKPKFMGIEILTLKKIIPLGL  105

Query  537  MFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYTKLANVLSKE  716
            MFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMA+GFM+LYTKLANVL K+
Sbjct  106  MFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAVGFMLLYTKLANVLPKK  165

Query  717  ALFYTVILP  743
            ALFYTVI+P
Sbjct  166  ALFYTVIVP  174



>ref|XP_006585647.1| PREDICTED: ADP,ATP carrier protein 1, chloroplastic-like [Glycine 
max]
Length=624

 Score =   207 bits (527),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 122/191 (64%), Positives = 139/191 (73%), Gaps = 13/191 (7%)
 Frame = +3

Query  180  MDTILQTRGLLSLPSKPRIRASYPVP-QGGLRHRFNGANGLKAKPFDGLSLSAGGLPKLE  356
            MD I+QTRGLLSLP+ P+ R S+ +    GL+HRF     LK KP    SLSA    K  
Sbjct  1    MDAIVQTRGLLSLPTNPKTRVSHHLHLSHGLKHRFLS---LKPKPLSTPSLSAAAAVKFH  57

Query  357  AFVGKPSLVAQRGRCFPVCRAEAAAAEDGQPL--LGGEAASESPKFMGVDVATLKKIIPL  530
             F  KP       +   +CRAEAAAA DG      G    +E PK +G+++ TLKKIIPL
Sbjct  58   PFGPKP-------QNLFICRAEAAAAADGPAQPAFGEPEVAEKPKLLGIEITTLKKIIPL  110

Query  531  GLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYTKLANVLS  710
            GLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMA+GFM+LYTKLANVLS
Sbjct  111  GLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAVGFMLLYTKLANVLS  170

Query  711  KEALFYTVILP  743
            K+ALFY+VILP
Sbjct  171  KQALFYSVILP  181



>ref|XP_003546196.1| PREDICTED: ADP,ATP carrier protein 1, chloroplastic-like [Glycine 
max]
Length=617

 Score =   207 bits (526),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 126/190 (66%), Positives = 142/190 (75%), Gaps = 11/190 (6%)
 Frame = +3

Query  180  MDTILQTRGLLSLPSKPRIRASYPVPQGGLRHRFNGANGLKAKPFDGLSLSAGGLPKLEA  359
            MD +LQTRGLLSLP+ P  R S   P  GLRHR       K K   G SLS+ G PKL  
Sbjct  1    MDAVLQTRGLLSLPTNPINRISLLHPSHGLRHRLFSP---KPKNLSGSSLSSNGFPKLSP  57

Query  360  FVGKPSLVAQR--GRCFPVCRAEAAAAEDGQPLLGGEAASESPKFMGVDVATLKKIIPLG  533
               K ++ AQR   + F +CRAEAAAA        GE  SE PK +G++VATLKKI+PLG
Sbjct  58   ---KANVFAQRDKNKNFFLCRAEAAAAAAAS---FGEPGSEKPKLLGIEVATLKKIVPLG  111

Query  534  LMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYTKLANVLSK  713
            LMFFCILFNYTILRDTKDVLVVTA+GSSAEIIPFLKTWVNLPMAIGFM+LYTKLANVLSK
Sbjct  112  LMFFCILFNYTILRDTKDVLVVTARGSSAEIIPFLKTWVNLPMAIGFMLLYTKLANVLSK  171

Query  714  EALFYTVILP  743
            +ALFY++ILP
Sbjct  172  QALFYSIILP  181



>ref|XP_004147999.1| PREDICTED: plastidic ATP/ADP-transporter [Cucumis sativus]
 gb|KGN58138.1| ATP/ADP transporter [Cucumis sativus]
Length=627

 Score =   207 bits (526),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 114/192 (59%), Positives = 138/192 (72%), Gaps = 12/192 (6%)
 Frame = +3

Query  180  MDTILQTRGLLSLPSKPRIRASYPVPQGGLRHRFNGANGLKAKPFDGLSLSAGGLPKLEA  359
            M+ +LQ++GLLSLP  P+ R    +P  GLR R    N    +   G SLS+ G  + + 
Sbjct  1    MEAVLQSKGLLSLPPNPKTRTF--LPSHGLRQRILSTN---PRNLSGFSLSSNGFQRFQG  55

Query  360  FVGKPSLVAQRGRCFPVCRAEAAAA----EDGQPLLGGEAASESPKFMGVDVATLKKIIP  527
            FV K      + R   +CRAEAAAA     DGQ    G    ++PKF+G++V TLKKI+P
Sbjct  56   FVSKKPSFFSKERVSLICRAEAAAAPAADSDGQ---SGFGEIDTPKFLGIEVETLKKIVP  112

Query  528  LGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYTKLANVL  707
            LGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMA+GFM+LYTK+ANVL
Sbjct  113  LGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAVGFMLLYTKMANVL  172

Query  708  SKEALFYTVILP  743
             ++ALFYTVI+P
Sbjct  173  PRQALFYTVIVP  184



>ref|XP_008447482.1| PREDICTED: plastidic ATP/ADP-transporter-like [Cucumis melo]
Length=627

 Score =   206 bits (525),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 115/192 (60%), Positives = 138/192 (72%), Gaps = 12/192 (6%)
 Frame = +3

Query  180  MDTILQTRGLLSLPSKPRIRASYPVPQGGLRHRFNGANGLKAKPFDGLSLSAGGLPKLEA  359
            M+ +LQ++GLLSLP  P+ R+   +P  GLR R    N    +   G SLS+ G  + + 
Sbjct  1    MEAVLQSKGLLSLPPNPKTRSL--LPSHGLRQRILSTN---PRNLSGFSLSSNGFQRFQG  55

Query  360  FVGKPSLVAQRGRCFPVCRAEAAAA----EDGQPLLGGEAASESPKFMGVDVATLKKIIP  527
            FV K        R   +CRAEAAAA     DGQ    G    E+PKF+G++V TLKKIIP
Sbjct  56   FVSKNPPFCSNERVSLICRAEAAAAPAAESDGQ---SGFGEIETPKFLGIEVETLKKIIP  112

Query  528  LGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYTKLANVL  707
            LGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMA+GFM+LYTK+ANVL
Sbjct  113  LGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAVGFMLLYTKMANVL  172

Query  708  SKEALFYTVILP  743
             ++ALFY+VI+P
Sbjct  173  PRQALFYSVIVP  184



>ref|XP_009106762.1| PREDICTED: ADP,ATP carrier protein 1, chloroplastic [Brassica 
rapa]
Length=614

 Score =   206 bits (524),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 117/192 (61%), Positives = 136/192 (71%), Gaps = 12/192 (6%)
 Frame = +3

Query  180  MDTILQTRGLLSLPSKPRIRASYPVPQGGLRHRFNGANGLKAKPFD--GLSLSAGGLPKL  353
            M T++QTRGLLSLP+KP    S   P  GL+HR        +KP +   LSLS+      
Sbjct  1    MATVIQTRGLLSLPAKPIGMRSLLQPSHGLKHRL-----FASKPRNPPALSLSSKKFQSF  55

Query  354  EAFVGKPSLVAQRGRCFPVCRAEAAAAE-DGQPLLGGEAASESPKFMGVDVATLKKIIPL  530
            E  +   S+  +      +C+AE AA+  DG       A + SPK  GV+V TLKKIIPL
Sbjct  56   EPTLRGISISHKLRSTEFICKAEGAASSGDGDT----AAIAASPKIFGVEVTTLKKIIPL  111

Query  531  GLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYTKLANVLS  710
            GLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFM+LYTKL+NVLS
Sbjct  112  GLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMLLYTKLSNVLS  171

Query  711  KEALFYTVILPF  746
            K+ALFYTVI+PF
Sbjct  172  KKALFYTVIIPF  183



>ref|XP_008377604.1| PREDICTED: plastidic ATP/ADP-transporter-like [Malus domestica]
Length=623

 Score =   206 bits (523),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 121/191 (63%), Positives = 136/191 (71%), Gaps = 11/191 (6%)
 Frame = +3

Query  180  MDTILQTRGLLSLPSKPRIRASYPVPQGGLRHRFNGANGLKAKPFDGLSLSAGGLPKLEA  359
            M+ +LQT+GLLSLPS PR R        GL+ RF      K K   G SLS+ G  K  +
Sbjct  1    MEGVLQTKGLLSLPSNPRTRVFQS--SLGLKQRFFST---KPKTPAGFSLSSNGFQKFPS  55

Query  360  FVGKPSLVAQRGRCFPVCRAEAAAAE---DGQPLLGGEAASESPKFMGVDVATLKKIIPL  530
            FV K   V  + R   +CRAEAAAA    DGQP  G     E PK  G++  T KKIIPL
Sbjct  56   FVPKNYGVVPKERNLFICRAEAAAAASPGDGQPAFG---EPEKPKVFGIETVTFKKIIPL  112

Query  531  GLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYTKLANVLS  710
            GLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMA+GFM+LYTKL+NVLS
Sbjct  113  GLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAVGFMLLYTKLSNVLS  172

Query  711  KEALFYTVILP  743
            K+ALFY+VILP
Sbjct  173  KKALFYSVILP  183



>gb|KEH28732.1| plastidic ATP/ADP-transporter-like protein [Medicago truncatula]
Length=629

 Score =   206 bits (523),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 114/199 (57%), Positives = 143/199 (72%), Gaps = 16/199 (8%)
 Frame = +3

Query  180  MDTILQTRGLLSLPSKPRIRASYPVPQGGLRHRFNGANGLKAKPFDGLSLSAGGLP----  347
            M  +LQTRGLLSLP+ P+ R    +    ++HRF     L+ K  DG SL++ G      
Sbjct  1    MVAVLQTRGLLSLPTNPKTRVL--LQPNSIKHRFLS---LRPKTLDGFSLNSNGFSLNSN  55

Query  348  ---KLEAFVGKPSLVAQRGRCFPVCRAEAAAA----EDGQPLLGGEAASESPKFMGVDVA  506
               K+ +F  K +   ++ +   +C+AEAAAA     DG+P+ G     + PK +G++V 
Sbjct  56   GFSKINSFSSKVNGFGEKEKNLFICKAEAAAAAGADSDGKPVFGEIEVDKKPKILGIEVD  115

Query  507  TLKKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILY  686
            T+KKI+PLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFM+LY
Sbjct  116  TMKKILPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMLLY  175

Query  687  TKLANVLSKEALFYTVILP  743
            TKL+NVLSK+ALFY+VILP
Sbjct  176  TKLSNVLSKQALFYSVILP  194



>gb|EPS64663.1| hypothetical protein M569_10117 [Genlisea aurea]
Length=631

 Score =   206 bits (523),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 117/195 (60%), Positives = 142/195 (73%), Gaps = 15/195 (8%)
 Frame = +3

Query  180  MDTILQTRGLLSLPSKPRIRAS---YPVPQGGLRH-RFNG-ANGLKAKPFDGLS-LSAGG  341
            M  +LQ+RG+LSLPS P+          P  GLR  RF+  +  L +   DG S    GG
Sbjct  1    MQAVLQSRGILSLPSNPKTNRGGGFVSQPSCGLRRFRFDPPSKPLLSSSVDGFSKFHKGG  60

Query  342  LPKLEAFVGKPSLVAQRGRCFPVCRAEAAAA-EDGQPLLGGEAASESPKFMGVDVATLKK  518
            L     F+ KP L+ ++G    + RAE+A+A +DGQP  G +   ES K +G++ +TLKK
Sbjct  61   L-----FLAKPGLLRRKGGSLLLVRAESASALDDGQPAYGEK---ESSKILGMEASTLKK  112

Query  519  IIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYTKLA  698
            IIPLG+MFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFM+LYTKLA
Sbjct  113  IIPLGMMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMLLYTKLA  172

Query  699  NVLSKEALFYTVILP  743
            NVLSK+ALFY+VI+P
Sbjct  173  NVLSKQALFYSVIVP  187



>ref|XP_006300855.1| hypothetical protein CARUB_v10019948mg [Capsella rubella]
 gb|EOA33753.1| hypothetical protein CARUB_v10019948mg [Capsella rubella]
Length=639

 Score =   205 bits (522),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 118/192 (61%), Positives = 136/192 (71%), Gaps = 13/192 (7%)
 Frame = +3

Query  180  MDTILQTRGLLSLPSKPRIRASYPVPQGGLRHRFNGANGLKAKPFDGLSLSAGGLPKLEA  359
            M+  +QTRGLLSLP+KP    S   P  G + R   A   K +   GLSLS     K++ 
Sbjct  1    MEAAIQTRGLLSLPAKPIGVRSLLQPSHGFKQRLFAA---KPRNIPGLSLSFNAHKKVQT  57

Query  360  FVGKPS--LVAQRGRCFP-VCRAEAAAAEDGQPLLGGEAASESPKFMGVDVATLKKIIPL  530
            F   P    ++ R R    +C+A   AA DG      EA + SPK +GV+V TLKKIIPL
Sbjct  58   FEPIPHGISISHRERSTEFICKA---AAGDGD----SEAIAASPKLLGVEVTTLKKIIPL  110

Query  531  GLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYTKLANVLS  710
            GLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFM+LYTKL+NVLS
Sbjct  111  GLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMLLYTKLSNVLS  170

Query  711  KEALFYTVILPF  746
            K+ALFYTVI+PF
Sbjct  171  KKALFYTVIIPF  182



>ref|NP_178146.1| ADP,ATP carrier protein 1 [Arabidopsis thaliana]
 sp|Q39002.2|TLC1_ARATH RecName: Full=ADP,ATP carrier protein 1, chloroplastic; AltName: 
Full=ADP/ATP translocase 1; AltName: Full=Adenine nucleotide 
translocase 1; Flags: Precursor [Arabidopsis thaliana]
 gb|AAG52434.1|AC018848_5 adenine nucleotide translocase; 19474-21800 [Arabidopsis thaliana]
 gb|AAL16246.1|AF428316_1 At1g80300/F5I6_5 [Arabidopsis thaliana]
 dbj|BAE98630.1| adenine nucleotide translocase [Arabidopsis thaliana]
 gb|AEE36385.1| ADP,ATP carrier protein 1 [Arabidopsis thaliana]
Length=624

 Score =   205 bits (521),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 124/196 (63%), Positives = 146/196 (74%), Gaps = 12/196 (6%)
 Frame = +3

Query  180  MDTILQTRGLLSLPSKPRIRASYPVPQGGLRHRFNGANGLKAKPFDGLSLSAGGLPKLEA  359
            M+ ++QTRGLLSLP+KP    S   P  GL+ R   A   K +   GLSLS  G  K + 
Sbjct  1    MEAVIQTRGLLSLPTKPIGVRSQLQPSHGLKQRLFAA---KPRNLHGLSLSFNGHKKFQT  57

Query  360  FVGKPSL----VAQRGRCFP-VCRAEAAAAEDGQPLLGGEAAS--ESPKFMGVDVATLKK  518
            F  +P+L    ++ + R    +C+AEAAAA DG     G++A+   SPK  GV+VATLKK
Sbjct  58   F--EPTLHGISISHKERSTEFICKAEAAAAGDGAVFGEGDSAAVVASPKIFGVEVATLKK  115

Query  519  IIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYTKLA  698
            IIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFM+LYTKL+
Sbjct  116  IIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMLLYTKLS  175

Query  699  NVLSKEALFYTVILPF  746
            NVLSK+ALFYTVI+PF
Sbjct  176  NVLSKKALFYTVIVPF  191



>gb|AAK76577.1| putative adenine nucleotide translocase [Arabidopsis thaliana]
Length=624

 Score =   205 bits (521),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 124/196 (63%), Positives = 146/196 (74%), Gaps = 12/196 (6%)
 Frame = +3

Query  180  MDTILQTRGLLSLPSKPRIRASYPVPQGGLRHRFNGANGLKAKPFDGLSLSAGGLPKLEA  359
            M+ ++QTRGLLSLP+KP    S   P  GL+ R   A   K +   GLSLS  G  K + 
Sbjct  1    MEAVIQTRGLLSLPTKPIGVRSQLQPSHGLKQRLFAA---KPRNLHGLSLSFNGHKKFQT  57

Query  360  FVGKPSL----VAQRGRCFP-VCRAEAAAAEDGQPLLGGEAAS--ESPKFMGVDVATLKK  518
            F  +P+L    ++ + R    +C+AEAAAA DG     G++A+   SPK  GV+VATLKK
Sbjct  58   F--EPTLHGISISHKERSTEFICKAEAAAAGDGAVFGEGDSAAVVASPKIFGVEVATLKK  115

Query  519  IIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYTKLA  698
            IIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFM+LYTKL+
Sbjct  116  IIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMLLYTKLS  175

Query  699  NVLSKEALFYTVILPF  746
            NVLSK+ALFYTVI+PF
Sbjct  176  NVLSKKALFYTVIVPF  191



>gb|KHN47790.1| ADP,ATP carrier protein 1, chloroplastic [Glycine soja]
Length=623

 Score =   204 bits (520),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 121/191 (63%), Positives = 138/191 (72%), Gaps = 14/191 (7%)
 Frame = +3

Query  180  MDTILQTRGLLSLPSKPRIRASYPVP-QGGLRHRFNGANGLKAKPFDGLSLSAGGLPKLE  356
            MD I+QTRGLLSLP+ P+ R S+ +    GL+HRF     LK KP    SLSA    K  
Sbjct  1    MDAIVQTRGLLSLPTNPKTRVSHHLHLSHGLKHRFLS---LKPKPLSTPSLSAAA-AKFH  56

Query  357  AFVGKPSLVAQRGRCFPVCRAEAAAAEDGQPL--LGGEAASESPKFMGVDVATLKKIIPL  530
             F  KP       +   +CRAEAAAA  G      G    +E PK +G+++ TLKKIIPL
Sbjct  57   PFGPKP-------QNLFICRAEAAAAAYGPAQPAFGEAEVAEKPKLLGIEITTLKKIIPL  109

Query  531  GLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYTKLANVLS  710
            GLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMA+GFM+LYTKLANVLS
Sbjct  110  GLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAVGFMLLYTKLANVLS  169

Query  711  KEALFYTVILP  743
            K+ALFY+VILP
Sbjct  170  KQALFYSVILP  180



>ref|XP_002890107.1| hypothetical protein ARALYDRAFT_471751 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66366.1| hypothetical protein ARALYDRAFT_471751 [Arabidopsis lyrata subsp. 
lyrata]
Length=618

 Score =   204 bits (520),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 121/195 (62%), Positives = 140/195 (72%), Gaps = 13/195 (7%)
 Frame = +3

Query  180  MDTILQTRGLLSLPSKPRIRASYPVPQGGLRHRFNGANGLKAKPFDGLSLSAGGLPKLEA  359
            M+ ++QTRG+LSLPSKP        P  GL+ R    N         LSLS+ G  K +A
Sbjct  1    MEGLIQTRGILSLPSKPIGARRLLQPSHGLKQRLFTTN------LPALSLSSNGHTKFQA  54

Query  360  FVGKPSLVA----QRGRCFPVCRAEAAAAEDGQPLLGGEAA--SESPKFMGVDVATLKKI  521
            F   P  ++    +R R F +C+AEAAAA  G     G+ A  S SPK  GV+V TLKKI
Sbjct  55   FQSTPHGISVSHKERSRGF-ICKAEAAAAGGGNVFDEGDTAAISASPKIFGVEVTTLKKI  113

Query  522  IPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYTKLAN  701
            +PLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFM+LYTKL+N
Sbjct  114  VPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMLLYTKLSN  173

Query  702  VLSKEALFYTVILPF  746
            VLSK+ALFYTVI+PF
Sbjct  174  VLSKKALFYTVIVPF  188



>emb|CDX87299.1| BnaA07g35740D [Brassica napus]
Length=614

 Score =   203 bits (517),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 117/192 (61%), Positives = 135/192 (70%), Gaps = 12/192 (6%)
 Frame = +3

Query  180  MDTILQTRGLLSLPSKPRIRASYPVPQGGLRHRFNGANGLKAKPFD--GLSLSAGGLPKL  353
            M T +QTRGLLSLP+KP    S   P  GL+HR        +KP +   LSLS+      
Sbjct  1    MATAIQTRGLLSLPAKPIGVRSLLQPSHGLKHRL-----FASKPRNPPALSLSSKKFQSF  55

Query  354  EAFVGKPSLVAQRGRCFPVCRAEAAAAE-DGQPLLGGEAASESPKFMGVDVATLKKIIPL  530
            E  +   S+  +      +C+AE AA+  DG       A + SPK  GV+V TLKKIIPL
Sbjct  56   EPTLPGISISHKLRSTEFICKAEGAASSGDGDT----AAIAASPKIFGVEVTTLKKIIPL  111

Query  531  GLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYTKLANVLS  710
            GLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFM+LYTKL+NVLS
Sbjct  112  GLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMLLYTKLSNVLS  171

Query  711  KEALFYTVILPF  746
            K+ALFYTVI+PF
Sbjct  172  KKALFYTVIIPF  183



>ref|XP_007150697.1| hypothetical protein PHAVU_005G174000g [Phaseolus vulgaris]
 gb|ESW22691.1| hypothetical protein PHAVU_005G174000g [Phaseolus vulgaris]
Length=617

 Score =   202 bits (514),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 119/191 (62%), Positives = 139/191 (73%), Gaps = 14/191 (7%)
 Frame = +3

Query  180  MDTILQTRGLLSLPSKPRIRASYPVPQGGLRHR-FNGANGLKAKPFDGLSLSAGGLPKLE  356
            MD +LQTRGLLSLP+ P  + S   P  GLR R F+    + A P    SLS  G  K+ 
Sbjct  1    MDVVLQTRGLLSLPTNPINKVSLLHPSQGLRQRLFSPKPKILAAP----SLSFNGFQKVS  56

Query  357  AFVGKPSLVAQR--GRCFPVCRAEAAAAEDGQPLLGGEAASESPKFMGVDVATLKKIIPL  530
                K ++  QR   +   +CRAEA+AA        GE  +E PK +GV+VATLKKI+PL
Sbjct  57   P---KANVFVQRDNSKSLFLCRAEASAAAA----SFGEPETEKPKLLGVEVATLKKIVPL  109

Query  531  GLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYTKLANVLS  710
            G+MFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFM+LYTKLANVLS
Sbjct  110  GMMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMLLYTKLANVLS  169

Query  711  KEALFYTVILP  743
            K+ALFY++ILP
Sbjct  170  KQALFYSIILP  180



>ref|XP_007135724.1| hypothetical protein PHAVU_010G152900g [Phaseolus vulgaris]
 gb|ESW07718.1| hypothetical protein PHAVU_010G152900g [Phaseolus vulgaris]
Length=623

 Score =   202 bits (514),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 122/192 (64%), Positives = 139/192 (72%), Gaps = 17/192 (9%)
 Frame = +3

Query  180  MDTILQTRGLLSLPSKPRIRAS---YPVPQGGLRHRFNGANGLKAKPFDGLSLSAGGLPK  350
            M  ++QTRGLLSLP+ P+ RAS   +  P  GL++RF   N    KP    SL A    K
Sbjct  1    MAAVVQTRGLLSLPTNPKSRASLSRHLNPSHGLKNRFLSLN---PKPIYAPSLCAA---K  54

Query  351  LEAFVGKPSLVAQRGRCFPVCRAEAAAAEDGQPLLG-GEAASESPKFMGVDVATLKKIIP  527
             E    KP       +   +CRAEAAAA DG      GEA +E PK MG+++ TLKKIIP
Sbjct  55   FEPLCSKP-------KNLFICRAEAAAAADGAAQPAFGEAEAEKPKLMGIEITTLKKIIP  107

Query  528  LGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYTKLANVL  707
            LGLMFFCILFNYTILRDTKDVLV+TAKGSSAEIIPFLKTWVNLPMAIGFM+LYTKLANVL
Sbjct  108  LGLMFFCILFNYTILRDTKDVLVITAKGSSAEIIPFLKTWVNLPMAIGFMLLYTKLANVL  167

Query  708  SKEALFYTVILP  743
            SK+ALFY+VILP
Sbjct  168  SKQALFYSVILP  179



>emb|CDX79394.1| BnaC06g19090D [Brassica napus]
Length=616

 Score =   201 bits (512),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 119/193 (62%), Positives = 139/193 (72%), Gaps = 14/193 (7%)
 Frame = +3

Query  180  MDTILQTRGLLSLPSKP-RIRASYPVPQGGLRHRFNGANGLKAKPFDGLSLSAGGLPKLE  356
            M+  +QTRG+LSLP+KP   R S   P  GL+HR   +   K +    LSLS     K +
Sbjct  1    MEAAIQTRGILSLPAKPIGARRSLLHPSHGLKHRLFSS---KPRTPPALSLS---FKKAQ  54

Query  357  AFVGKPSLVAQRGRCFPVCRAEAAAAEDGQPLLG-GEAAS--ESPKFMGVDVATLKKIIP  527
            +F  K S+  +      +C+AEA    DG  LL  G+ A+   SPK  GV+V TLKKIIP
Sbjct  55   SFDPKISISHKERTTEFICKAEA----DGGALLNEGDTAAIVPSPKIFGVEVTTLKKIIP  110

Query  528  LGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYTKLANVL  707
            LGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFM+LYTKL+NVL
Sbjct  111  LGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMLLYTKLSNVL  170

Query  708  SKEALFYTVILPF  746
            SK+ALFYTVI+PF
Sbjct  171  SKKALFYTVIIPF  183



>ref|XP_009104454.1| PREDICTED: ADP,ATP carrier protein 1, chloroplastic-like [Brassica 
rapa]
Length=616

 Score =   201 bits (512),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 120/195 (62%), Positives = 144/195 (74%), Gaps = 18/195 (9%)
 Frame = +3

Query  180  MDTILQTRGLLSLPSKP-RIRASYPVPQGGLRHRFNGANGLKAKPFDGLSLSAGGLPKLE  356
            M+T +QTRG+LSLP+KP   R S   P  GL+HR   +   K +    LSLS     K +
Sbjct  1    METAIQTRGILSLPAKPIGARRSLLHPSHGLKHRLFSS---KPRTPPALSLS---FKKAQ  54

Query  357  AFVGKPSL-VAQRGRCFP-VCRAEAAAAEDGQPLLG-GEAAS--ESPKFMGVDVATLKKI  521
            +F  +P++ ++ + R    +C+AEA    DG  LL  G+ A+   SPK  GV+V TLKKI
Sbjct  55   SF--EPTISISHKERSHEFICKAEA----DGGALLNEGDTAAVVPSPKIFGVEVTTLKKI  108

Query  522  IPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYTKLAN  701
            IPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFM+LYTKL+N
Sbjct  109  IPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMLLYTKLSN  168

Query  702  VLSKEALFYTVILPF  746
            VLSK+ALFYTVI+PF
Sbjct  169  VLSKKALFYTVIIPF  183



>ref|XP_006389778.1| hypothetical protein EUTSA_v10018281mg [Eutrema salsugineum]
 dbj|BAJ33695.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ27064.1| hypothetical protein EUTSA_v10018281mg [Eutrema salsugineum]
Length=624

 Score =   201 bits (510),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 123/196 (63%), Positives = 145/196 (74%), Gaps = 12/196 (6%)
 Frame = +3

Query  180  MDTILQTRGLLSLPSKPRIRASYPVPQGGLRHRFNGANGLKAKPFDGLSLSAGGLPKLEA  359
            M+  +QTRG+LSLP+KP    S+  P  GL+ R   A   K +   GLSLS  G  K +A
Sbjct  1    MEAAVQTRGILSLPAKPIGARSFLQPSHGLKQRLFAA---KPRNLPGLSLSFKGHKKFQA  57

Query  360  FVGKPSL----VAQRGRCFP-VCRAEAAAAEDGQPLLGGEAAS--ESPKFMGVDVATLKK  518
            F  +P L    ++ + R    +C+AEAAAA DG     G++A+   SPK  GV+V TLKK
Sbjct  58   F--EPILHGISISHKERSTEFICKAEAAAAGDGAVFDEGDSAAVVASPKIFGVEVTTLKK  115

Query  519  IIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYTKLA  698
            IIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFM+LYTKL+
Sbjct  116  IIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMLLYTKLS  175

Query  699  NVLSKEALFYTVILPF  746
            NVLSK+ALFYTVI+PF
Sbjct  176  NVLSKKALFYTVIVPF  191



>ref|XP_002889299.1| chloroplast ADP, ATP carrier protein 1 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65558.1| chloroplast ADP, ATP carrier protein 1 [Arabidopsis lyrata subsp. 
lyrata]
Length=624

 Score =   201 bits (510),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 123/196 (63%), Positives = 144/196 (73%), Gaps = 12/196 (6%)
 Frame = +3

Query  180  MDTILQTRGLLSLPSKPRIRASYPVPQGGLRHRFNGANGLKAKPFDGLSLSAGGLPKLEA  359
            M+  +QTRGLLSLP+KP    S   P  GL+ R   A   K +   G SLS  G  K + 
Sbjct  1    MEAAIQTRGLLSLPTKPIGVRSLLQPSHGLKQRLFAA---KPRNLPGFSLSFNGHKKFQT  57

Query  360  FVGKPSL----VAQRGRCFP-VCRAEAAAAEDGQPLLGGEAAS--ESPKFMGVDVATLKK  518
            F  +P+L    ++ + R    +C+AEAAAA DG     G++A+   SPK  GV+VATLKK
Sbjct  58   F--EPTLHGISISHKERSSEFICKAEAAAAGDGAVFGEGDSAAVVASPKIFGVEVATLKK  115

Query  519  IIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYTKLA  698
            IIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFM+LYTKL+
Sbjct  116  IIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMLLYTKLS  175

Query  699  NVLSKEALFYTVILPF  746
            NVLSK+ALFYTVI+PF
Sbjct  176  NVLSKKALFYTVIIPF  191



>emb|CDX83974.1| BnaC08g16710D [Brassica napus]
Length=609

 Score =   200 bits (509),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 112/194 (58%), Positives = 141/194 (73%), Gaps = 20/194 (10%)
 Frame = +3

Query  180  MDTILQTRGLLSLPSKPRIRASYPVPQG-GLRHRFNGANGLKAKPFDGLSLSAGGLPKLE  356
            M+ ++Q RG+LSLP+KP + A   +P    L+ R      L  +    LS+S+ G  K++
Sbjct  1    MEGLIQPRGILSLPTKPIVAARTLLPPSPALKQR------LFTRNLPPLSISSNGHTKVQ  54

Query  357  AFVGKPSLVA----QRGRCFPVCRAEAAAAEDGQPLLGGEAASESPKFMGVDVATLKKII  524
            +F   P  ++    +R R F +C+AE+AA E       G++ + +P   GV+V TLKKII
Sbjct  55   SFHRNPLTISISHKERNRGF-ICKAESAAGE-------GDSVT-TPNIFGVEVTTLKKII  105

Query  525  PLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYTKLANV  704
            PLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFM+LYTKL+NV
Sbjct  106  PLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMLLYTKLSNV  165

Query  705  LSKEALFYTVILPF  746
            LSK+ALFYTVI+PF
Sbjct  166  LSKKALFYTVIIPF  179



>ref|XP_010472951.1| PREDICTED: ADP,ATP carrier protein 1, chloroplastic-like [Camelina 
sativa]
Length=617

 Score =   200 bits (509),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 121/194 (62%), Positives = 142/194 (73%), Gaps = 16/194 (8%)
 Frame = +3

Query  180  MDTILQTRGLLSLPSKPRIRASYPVPQGGLRHRFNGANGLKAKPFDGLSLSAGGLPKLEA  359
            M+  +QTRGLLSLP+KP    S   P  GL+ R   A   K +   GLSLS  G  K   
Sbjct  1    MEAAIQTRGLLSLPTKPIGVRSLLQPSHGLKQRLFAA---KPRNLPGLSLSFHGHKKFHT  57

Query  360  FVGKPSL----VAQRGRCFP-VCRAEAAAAEDGQPLLGGEAASESPKFMGVDVATLKKII  524
            F  +P+L    ++ + R    +C+AEAAAA +G      ++A+ SPK  GV+V TLKKII
Sbjct  58   F--EPTLHGISISHKERSTEFICKAEAAAAGEG------DSAAASPKIFGVEVTTLKKII  109

Query  525  PLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYTKLANV  704
            PLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFM+LYTKL+NV
Sbjct  110  PLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMLLYTKLSNV  169

Query  705  LSKEALFYTVILPF  746
            LSK+ALFYTVI+PF
Sbjct  170  LSKKALFYTVIIPF  183



>ref|XP_010429982.1| PREDICTED: ADP,ATP carrier protein 1, chloroplastic-like isoform 
X1 [Camelina sativa]
 ref|XP_010429983.1| PREDICTED: ADP,ATP carrier protein 1, chloroplastic-like isoform 
X2 [Camelina sativa]
Length=618

 Score =   200 bits (509),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 121/195 (62%), Positives = 144/195 (74%), Gaps = 17/195 (9%)
 Frame = +3

Query  180  MDTILQTRGLLSLPSKP-RIRASYPVPQGGLRHRFNGANGLKAKPFDGLSLSAGGLPKLE  356
            M+  +QTRGLLSLP+KP  +R S   P  GL+ R   A   K +   GLSLS  G  K +
Sbjct  1    MEAAIQTRGLLSLPTKPIGVRRSLLQPSHGLKQRLFAA---KPRNLPGLSLSFQGHKKFQ  57

Query  357  AFVGKPSL----VAQRGRCFP-VCRAEAAAAEDGQPLLGGEAASESPKFMGVDVATLKKI  521
             F  +P+L    ++ + R    +C+AEAAAA +G      ++ + SPK  GV+V TLKKI
Sbjct  58   TF--EPTLHGISISHKERSTEFICKAEAAAAGEG------DSVAASPKIFGVEVTTLKKI  109

Query  522  IPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYTKLAN  701
            IPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFM+LYTKL+N
Sbjct  110  IPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMLLYTKLSN  169

Query  702  VLSKEALFYTVILPF  746
            VLSK+ALFYTVI+PF
Sbjct  170  VLSKKALFYTVIIPF  184



>ref|NP_173003.1| ADP,ATP carrier protein 2 [Arabidopsis thaliana]
 sp|P92935.2|TLC2_ARATH RecName: Full=ADP,ATP carrier protein 2, chloroplastic; AltName: 
Full=ADP/ATP translocase 2; AltName: Full=Adenine nucleotide 
translocase 2; Flags: Precursor [Arabidopsis thaliana]
 gb|AAF71976.1|AC013453_1 Putative adenine nucleotide translocase [Arabidopsis thaliana]
 gb|AAL91239.1| putative adenine nucleotide translocase [Arabidopsis thaliana]
 gb|AAM60955.1| adenine nucleotide translocase, putative [Arabidopsis thaliana]
 gb|AAM91244.1| putative adenine nucleotide translocase [Arabidopsis thaliana]
 emb|CAA64329.2| AATP2 protein [Arabidopsis thaliana]
 gb|AEE29330.1| TLC ATP/ADP transporter [Arabidopsis thaliana]
Length=618

 Score =   199 bits (507),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 120/199 (60%), Positives = 144/199 (72%), Gaps = 21/199 (11%)
 Frame = +3

Query  180  MDTILQTRGLLSLPSKPRIRASYPVPQGGLRHRFNGANGLKAKPFD----GLSLSAGGLP  347
            M+ ++QTRG+LSLP+KP           G+R     ++GLK + F      LSLS+ G  
Sbjct  1    MEGLIQTRGILSLPAKPI----------GVRRLLQPSHGLKQRLFTTNLPALSLSSNGHK  50

Query  348  KLEAFVGKPSLVA----QRGRCFPVCRAEAAAAEDGQPLLGGEAASE--SPKFMGVDVAT  509
            K +AF   P  ++    +R R F +C+AEAAAA  G     G+ A+   SPK  GV+V T
Sbjct  51   KFQAFQQIPLGISVSHKERSRGF-ICKAEAAAAGGGNVFDEGDTAAMAVSPKIFGVEVTT  109

Query  510  LKKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYT  689
            LKKI+PLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFM+LYT
Sbjct  110  LKKIVPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMLLYT  169

Query  690  KLANVLSKEALFYTVILPF  746
            KL+NVLSK+ALFYTVI+PF
Sbjct  170  KLSNVLSKKALFYTVIVPF  188



>emb|CDY57697.1| BnaA07g38360D [Brassica napus]
Length=616

 Score =   199 bits (507),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 119/195 (61%), Positives = 143/195 (73%), Gaps = 18/195 (9%)
 Frame = +3

Query  180  MDTILQTRGLLSLPSKP-RIRASYPVPQGGLRHRFNGANGLKAKPFDGLSLSAGGLPKLE  356
            M+  +QTRG+LSLP+KP   R S   P  GL+HR   +   K +    LSLS     K +
Sbjct  1    MEAAIQTRGILSLPAKPIGARRSLLHPSHGLKHRLFSS---KPRTPPALSLS---FKKAQ  54

Query  357  AFVGKPSL-VAQRGRCFP-VCRAEAAAAEDGQPLLG-GEAAS--ESPKFMGVDVATLKKI  521
            +F  +P++ ++ + R    +C+AEA    DG  LL  G+ A+   SPK  GV+V TLKKI
Sbjct  55   SF--EPTISISHKERSHEFICKAEA----DGGALLNEGDTAAVVPSPKIFGVEVTTLKKI  108

Query  522  IPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYTKLAN  701
            IPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFM+LYTKL+N
Sbjct  109  IPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMLLYTKLSN  168

Query  702  VLSKEALFYTVILPF  746
            VLSK+ALFYTVI+PF
Sbjct  169  VLSKKALFYTVIIPF  183



>gb|KFK42425.1| hypothetical protein AALP_AA2G254500 [Arabis alpina]
Length=626

 Score =   198 bits (504),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 115/194 (59%), Positives = 139/194 (72%), Gaps = 9/194 (5%)
 Frame = +3

Query  180  MDTILQTRGLLSLPSKP-RIRASYPVPQGGLRHRFNGANGLKAKPFDGLSLSAGGLPKLE  356
            M+  +Q+RG+LSLPS+P + R+    P  GL+ R   +   K +   GLSLS  G  K +
Sbjct  1    MEAAIQSRGILSLPSRPIKARSFLQQPSHGLKQRLFAS---KPRNLPGLSLSFNGHKKFQ  57

Query  357  AFVGKPSLVAQRGRCFPVCRAEAAAAEDGQPLLGGE----AASESPKFMGVDVATLKKII  524
             F G      +R   F +C+A A+A+  G   L GE    A   SPK  GV+V TLKKII
Sbjct  58   IFDGISISHKERTTEF-ICQAAASASSSGDGALFGEGDTAAIVPSPKVFGVEVTTLKKII  116

Query  525  PLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYTKLANV  704
            PLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFM+LY+KL++V
Sbjct  117  PLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMLLYSKLSDV  176

Query  705  LSKEALFYTVILPF  746
            LSK+ALFYTV++PF
Sbjct  177  LSKKALFYTVMIPF  190



>ref|XP_009388534.1| PREDICTED: plastidic ATP/ADP-transporter-like [Musa acuminata 
subsp. malaccensis]
Length=665

 Score =   198 bits (503),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 117/206 (57%), Positives = 136/206 (66%), Gaps = 23/206 (11%)
 Frame = +3

Query  180  MDTILQTRGLLSLPSKPRIRASYPVPQGGLRHRFNGANGLKAKP-----------FDGLS  326
            M+ ++ T+GLLSLP KP+ R  +P+    LR RF  A      P            D  S
Sbjct  1    MERVISTKGLLSLPPKPQTRPFHPLHT--LRRRFPSAAACFPSPALRAHVPTSALHDFSS  58

Query  327  LSAGGLP------KLEAFVGKPSLVAQRGRCFPVCRAEAAAAEDGQPLLGGEAASESPKF  488
                 +P      K E     P L A+R R  P  RA AA   DG   +  E   + PKF
Sbjct  59   KERSSIPGPTAAAKPEKSHLCPGLWAER-RKVPTFRAGAAIPADGASFVEEE---DKPKF  114

Query  489  MGVDVATLKKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAI  668
            +GV+++TLKKIIPLG+MFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMA+
Sbjct  115  LGVEISTLKKIIPLGVMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAV  174

Query  669  GFMILYTKLANVLSKEALFYTVILPF  746
            GFM+LYTKL+NVLSKEALFYTVILPF
Sbjct  175  GFMLLYTKLSNVLSKEALFYTVILPF  200



>ref|XP_004302940.1| PREDICTED: ADP,ATP carrier protein 1, chloroplastic [Fragaria 
vesca subsp. vesca]
Length=613

 Score =   197 bits (500),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 117/188 (62%), Positives = 133/188 (71%), Gaps = 8/188 (4%)
 Frame = +3

Query  180  MDTILQTRGLLSLPSKPRIRASYPVPQGGLRHRFNGANGLKAKPFDGLSLSAGGLPKLEA  359
            M+ +LQTRGLLSLP+ P+ R S P    GL+ R      +        S S+ G  K + 
Sbjct  1    MEAVLQTRGLLSLPTNPKARFSQP--SLGLKQRAFSTRPITPTGLSLSSSSSNGFQKFQT  58

Query  360  FVGKPSLVAQRGRCFPVCRAEAAAAEDGQPLLGGEAASESPKFMGVDVATLKKIIPLGLM  539
            F  K      + R   VCRAEAAAA DG     GE   E  KF+GV  +TLKKI+PLGLM
Sbjct  59   FAPKTHGFGPKERNLFVCRAEAAAAADGF----GEV--EERKFLGVGTSTLKKIVPLGLM  112

Query  540  FFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYTKLANVLSKEA  719
            FFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMA+GFM+LYTKL+NVLSK+A
Sbjct  113  FFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAVGFMLLYTKLSNVLSKKA  172

Query  720  LFYTVILP  743
            LFYTVILP
Sbjct  173  LFYTVILP  180



>gb|AAM29152.1| plastidic ATP/ADP transporter [Citrus hybrid cultivar]
Length=588

 Score =   196 bits (498),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 108/161 (67%), Positives = 125/161 (78%), Gaps = 8/161 (5%)
 Frame = +3

Query  267  LRHRFNGANGLKAKPFDGLSLSAGGLPKLEAFVGKPSLVAQRGRCFPVCRAEAAAAE--D  440
            L+ RF  A   K +  DG SLS+ G+ K ++FV KP     + R   +C+AEAAA+   D
Sbjct  7    LKXRFLAA---KPRTLDGFSLSSNGVSKFQSFVSKPQGFVPKERPLLICKAEAAASASAD  63

Query  441  GQPLLGGEAASESPKFMGVDVATLKKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSA  620
            GQPLLG    +E PKF G++  T KKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSA
Sbjct  64   GQPLLG---EAEKPKFFGIEYTTFKKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSA  120

Query  621  EIIPFLKTWVNLPMAIGFMILYTKLANVLSKEALFYTVILP  743
            EIIPFLKTWVNLPMAIGFM+LYTKLA+ LSK+ALFYTVI+P
Sbjct  121  EIIPFLKTWVNLPMAIGFMLLYTKLADKLSKQALFYTVIVP  161



>gb|KHN01355.1| ADP,ATP carrier protein 1, chloroplastic [Glycine soja]
Length=623

 Score =   195 bits (496),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 114/192 (59%), Positives = 135/192 (70%), Gaps = 16/192 (8%)
 Frame = +3

Query  180  MDTILQTRGLLSLPSKPRIRASYPV-PQGGLRHRFNGANGLKAKP-FDGLSLSAGGLPKL  353
            MD ++QTRGLLSLP+ P+ R S+ + P  GL+HRF     L  KP        +    K 
Sbjct  1    MDAVVQTRGLLSLPTNPKTRVSHHLHPSHGLKHRF-----LSLKPKPLSAPSLSAAAAKF  55

Query  354  EAFVGKPSLVAQRGRCFPVCRAEAAAAEDGQPL--LGGEAASESPKFMGVDVATLKKIIP  527
              F  KP       +   +CRAEAAAA  G      G    +E PK +G+++ TLKKIIP
Sbjct  56   HPFGPKP-------QNLFICRAEAAAAAYGPAQPAFGEAEVAEKPKLLGIEITTLKKIIP  108

Query  528  LGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYTKLANVL  707
            LGLMFFCILFNYTILRDTKDVLV+TA+GSSAEIIPFLKTWVNLPMA+GFM+LYTKL+NVL
Sbjct  109  LGLMFFCILFNYTILRDTKDVLVITARGSSAEIIPFLKTWVNLPMAVGFMLLYTKLSNVL  168

Query  708  SKEALFYTVILP  743
            SK+ALFYTVILP
Sbjct  169  SKQALFYTVILP  180



>ref|XP_006583133.1| PREDICTED: ADP,ATP carrier protein 1, chloroplastic-like [Glycine 
max]
Length=623

 Score =   195 bits (496),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 115/192 (60%), Positives = 136/192 (71%), Gaps = 16/192 (8%)
 Frame = +3

Query  180  MDTILQTRGLLSLPSKPRIRASYPV-PQGGLRHRFNGANGLKAKP-FDGLSLSAGGLPKL  353
            MD ++QTRGLLSLP+ P+ R S+ + P  GL+HRF     L  KP        +    K 
Sbjct  1    MDAVVQTRGLLSLPTNPKTRVSHHLHPSHGLKHRF-----LSLKPKPLSAPSLSAAAAKF  55

Query  354  EAFVGKPSLVAQRGRCFPVCRAEAAAAEDGQPL--LGGEAASESPKFMGVDVATLKKIIP  527
              F  KP       +   +CRAEAAAA DG      G    +E PK +G+++ TLKKIIP
Sbjct  56   HPFGPKP-------QNLFICRAEAAAAADGPAQPAFGEAEVAEKPKLLGIEITTLKKIIP  108

Query  528  LGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYTKLANVL  707
            LGLMFFCILFNYTILRDTKDVLV+TA+GSSAEIIPFLKTWVNLPMA+GFM+LYTKL+NVL
Sbjct  109  LGLMFFCILFNYTILRDTKDVLVITARGSSAEIIPFLKTWVNLPMAVGFMLLYTKLSNVL  168

Query  708  SKEALFYTVILP  743
            SK+ALFYTVILP
Sbjct  169  SKQALFYTVILP  180



>ref|XP_009148947.1| PREDICTED: ADP,ATP carrier protein 2, chloroplastic [Brassica 
rapa]
Length=609

 Score =   192 bits (488),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 114/190 (60%), Positives = 139/190 (73%), Gaps = 12/190 (6%)
 Frame = +3

Query  180  MDTILQTRGLLSLPSKPR-IRASYPVPQGGLRHRFNGANGLKAKPFDGLSLSAGGLPKLE  356
            M+ ++QTRG+LSLP+KP   R     P   L+ R      L  +    LS+S+ G  K +
Sbjct  1    MEGLIQTRGILSLPAKPTGARTLLLQPSHALKQR------LSTRSLPPLSISSNGHSKFQ  54

Query  357  AFVGKPSLVAQRGRCFPVCRAEAAAAEDGQPLLGGEAASESPKFMGVDVATLKKIIPLGL  536
            +F        +R R F +C+AEAAAA  G+    G++ + +PK  GV+V TLKKI+PLGL
Sbjct  55   SFHKISISNKERNRGF-ICKAEAAAATAGE----GDSTALTPKVFGVEVTTLKKIVPLGL  109

Query  537  MFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYTKLANVLSKE  716
            MFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFM+LYTKL+NVLSK+
Sbjct  110  MFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMLLYTKLSNVLSKK  169

Query  717  ALFYTVILPF  746
            ALFYTVI+PF
Sbjct  170  ALFYTVIVPF  179



>ref|XP_009381260.1| PREDICTED: ADP,ATP carrier protein 1, chloroplastic-like [Musa 
acuminata subsp. malaccensis]
Length=666

 Score =   192 bits (487),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 111/202 (55%), Positives = 134/202 (66%), Gaps = 19/202 (9%)
 Frame = +3

Query  180  MDTILQTRGLLSLPSKPRIRASYPVPQGGLRHRFNGANGLKAKPFDGLSLSAGGLPKLEA  359
            M+ ++ TRGLLSLP KP++R   P+    LR RF  A           S +  GL   E 
Sbjct  1    MERVISTRGLLSLPPKPQVRPYLPLHT--LRIRFPSAAAPALCARAPAS-ALHGLSCRER  57

Query  360  F--VGKPSL------------VAQRGRCFPVCRAEAAAAEDGQPLLGGEAASESPKFMGV  497
               + +P+             ++ + R  P+ RA AA   DG      E   + PKF+GV
Sbjct  58   TPSIARPTASRDPERSLLYPGISGKQRKVPIFRASAAIPADGAG--SAELGEKKPKFLGV  115

Query  498  DVATLKKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFM  677
            ++ TLKKI+PLG+MFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMA+GFM
Sbjct  116  EITTLKKIVPLGIMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAVGFM  175

Query  678  ILYTKLANVLSKEALFYTVILP  743
            +LYTKL+NVLSKEALFYTVILP
Sbjct  176  LLYTKLSNVLSKEALFYTVILP  197



>emb|CDY36568.1| BnaA06g10210D [Brassica napus]
Length=610

 Score =   191 bits (485),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 114/191 (60%), Positives = 139/191 (73%), Gaps = 13/191 (7%)
 Frame = +3

Query  180  MDTILQTRGLLSLPSKPR--IRASYPVPQGGLRHRFNGANGLKAKPFDGLSLSAGGLPKL  353
            M+ ++QTRG+LSLP+KP    R     P   L+ R      L  +    LS+S+ G  K 
Sbjct  1    MEGLIQTRGILSLPAKPTGARRTLLLQPSHALKQR------LSTRSLPPLSISSNGHSKF  54

Query  354  EAFVGKPSLVAQRGRCFPVCRAEAAAAEDGQPLLGGEAASESPKFMGVDVATLKKIIPLG  533
            ++F        +R R F +C+AEAAAA  G+    G++ + +PK  GV+V TLKKI+PLG
Sbjct  55   QSFHKISISNKERNRGF-ICKAEAAAATAGE----GDSTALTPKVFGVEVTTLKKIVPLG  109

Query  534  LMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYTKLANVLSK  713
            LMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFM+LYTKL+NVLSK
Sbjct  110  LMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMLLYTKLSNVLSK  169

Query  714  EALFYTVILPF  746
            +ALFYTVI+PF
Sbjct  170  KALFYTVIVPF  180



>ref|XP_009407647.1| PREDICTED: plastidic ATP/ADP-transporter-like [Musa acuminata 
subsp. malaccensis]
Length=658

 Score =   191 bits (484),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 111/206 (54%), Positives = 135/206 (66%), Gaps = 22/206 (11%)
 Frame = +3

Query  180  MDTILQTRGLLSLPSKPRIRASYPVPQGGLRHRFNGA------------------NGLKA  305
            M+ ++ T+GL+SLP KP+ R  +P+    LR RF  A                  +   +
Sbjct  1    MEGVISTKGLVSLPPKPQPRPFHPLHT--LRSRFPSAASRFPSPAVRSQAPASVLHAFGS  58

Query  306  KPFDGLSLSAGGLPKLEAFVGKPSLVAQRGRCFPVCRAEAAAAEDGQPLLGGEAASESPK  485
             P      +    P  +  +  P L   + R  PV RA AA   DG  L+  E   + PK
Sbjct  59   GPRTPWIPTPAAPPDPKGLLLYPGLWG-KPRKAPVFRAGAAIPADGAGLVEAEG-EKKPK  116

Query  486  FMGVDVATLKKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMA  665
            F+GV++ATLKKI+PLG+MFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMA
Sbjct  117  FLGVEIATLKKIVPLGIMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMA  176

Query  666  IGFMILYTKLANVLSKEALFYTVILP  743
            +GFM+LYTKL+NVLSKEALFYTVILP
Sbjct  177  VGFMLLYTKLSNVLSKEALFYTVILP  202



>ref|XP_006829678.1| PREDICTED: ADP,ATP carrier protein 1, chloroplastic [Amborella 
trichopoda]
 gb|ERM97094.1| hypothetical protein AMTR_s00122p00140700 [Amborella trichopoda]
Length=660

 Score =   188 bits (477),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 104/194 (54%), Positives = 125/194 (64%), Gaps = 11/194 (6%)
 Frame = +3

Query  180  MDTILQTRGLLSLPSKPRIRASYPVPQGGLRHR------FNGANGLKAKPFDGLSLSAGG  341
            M+  +  +GLLSLPSKP+   ++   +   R +       N    + ++ F GL      
Sbjct  1    MEAGIPAQGLLSLPSKPKTSDTHLTHRLHFRSKIQSPKFLNSYESINSRSFHGLKKYRKS  60

Query  342  LPKLEAFVGKPSLVAQRGRCFPVCRAEAAAAEDGQPLLGGEAASESPKFMGVDVATLKKI  521
               L     K   + +      V  A A A     P  G     E+PKF+GV+++TLKKI
Sbjct  61   FKLLSYLNSKNGDLYKEKSGLLVTNAHADATYVSVPDYG-----ETPKFLGVEISTLKKI  115

Query  522  IPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYTKLAN  701
            IPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFM+LYTKL+N
Sbjct  116  IPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMVLYTKLSN  175

Query  702  VLSKEALFYTVILP  743
            VLSKEALFY+ ILP
Sbjct  176  VLSKEALFYSCILP  189



>ref|XP_009110479.1| PREDICTED: ADP,ATP carrier protein 2, chloroplastic-like [Brassica 
rapa]
 ref|XP_009110480.1| PREDICTED: ADP,ATP carrier protein 2, chloroplastic-like [Brassica 
rapa]
Length=610

 Score =   187 bits (474),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 112/195 (57%), Positives = 136/195 (70%), Gaps = 21/195 (11%)
 Frame = +3

Query  180  MDTILQTRGLLSLPSKPRIRASYPVPQG-GLRHRFNGANGLKAKPFDGLSLSAGGLPKLE  356
            M+ ++Q RG+LSLP+KP + A   +P    L+ R    N         LS S+    K++
Sbjct  1    MEGLIQPRGILSLPTKPIVAARTLLPPSPALKQRLFTRN------LPPLSFSSNAPTKVQ  54

Query  357  AFVGKPSLVA-----QRGRCFPVCRAEAAAAEDGQPLLGGEAASESPKFMGVDVATLKKI  521
            +F   P  ++     +  R F +C+AEAAAA  G+         +SP   GV+V TLKKI
Sbjct  55   SFHRNPLTISISHKERINRGF-ICKAEAAAAASGE--------GDSPNIFGVEVTTLKKI  105

Query  522  IPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYTKLAN  701
            IPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFM+LYTKL+N
Sbjct  106  IPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMLLYTKLSN  165

Query  702  VLSKEALFYTVILPF  746
            VLSK+ALFYTVI+PF
Sbjct  166  VLSKKALFYTVIIPF  180



>emb|CDY39658.1| BnaC05g11870D [Brassica napus]
Length=614

 Score =   186 bits (473),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 115/195 (59%), Positives = 135/195 (69%), Gaps = 17/195 (9%)
 Frame = +3

Query  180  MDTILQTRGLLSLPSKP--RIRASYPVPQGGLRHRFNGANGLKAKPFDGLSLSAGGLPKL  353
            M+ ++Q RG+LSLP+KP    R     P   L+ R    N         LS+S+ G  K 
Sbjct  1    MEGLIQPRGILSLPTKPIGARRTLLLQPSHALKQRLFTRN------LPPLSISSNGHSKF  54

Query  354  EAFVGKPSLVA----QRGRCFPVCRAEAAAAEDGQPLLGGEAASESPKFMGVDVATLKKI  521
            ++F   P  +     +R R F +C+AEAAAA +G        A   PK  GV+V TLKKI
Sbjct  55   QSFHPNPHKILISHRERNRGF-ICKAEAAAAGEGG----DSTALTPPKVFGVEVTTLKKI  109

Query  522  IPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYTKLAN  701
            IPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFM+LYTKL+N
Sbjct  110  IPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMLLYTKLSN  169

Query  702  VLSKEALFYTVILPF  746
            VLSK+ALFYTVI+PF
Sbjct  170  VLSKKALFYTVIVPF  184



>ref|XP_004487222.1| PREDICTED: plastidic ATP/ADP-transporter-like [Cicer arietinum]
Length=632

 Score =   186 bits (472),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 104/164 (63%), Positives = 124/164 (76%), Gaps = 8/164 (5%)
 Frame = +3

Query  264  GLRHRFNGANGLKAKPFDGLSLSAGGLPKLEAFVGKPSLVAQRGRCFPVCRAEAAAAED-  440
            G + RF   N    K   G SL+  GL K  +F  K ++  Q+ R   +C+AEAAAA D 
Sbjct  31   GFKQRFFSPN---PKTLGGFSLTNNGLHKFNSFNLKANIFDQKDRNLFICKAEAAAAVDD  87

Query  441  ---GQPLLGGEAASESPKFMGVDVATLKKIIPLGLMFFCILFNYTILRDTKDVLVVTAKG  611
               G+ +   E  +E PKF+GV+V TLKKI+PLG+MFFCILFNYTILRDTKDVLVVTA+G
Sbjct  88   DDDGKQVFD-ELETEKPKFLGVEVTTLKKIVPLGMMFFCILFNYTILRDTKDVLVVTARG  146

Query  612  SSAEIIPFLKTWVNLPMAIGFMILYTKLANVLSKEALFYTVILP  743
            SSAEIIPFLKTWVNLPMAIGFM+LYTKLANVLSK+ALFY+VI+P
Sbjct  147  SSAEIIPFLKTWVNLPMAIGFMLLYTKLANVLSKQALFYSVIVP  190



>ref|XP_008785487.1| PREDICTED: ADP,ATP carrier protein 2, chloroplastic-like [Phoenix 
dactylifera]
Length=670

 Score =   185 bits (470),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 118/206 (57%), Positives = 129/206 (63%), Gaps = 31/206 (15%)
 Frame = +3

Query  180  MDTILQTRGLLSLPSKPRIRASYPVPQGGLRHRFNGANGLKAKP---FDGLSLSAGGLPK  350
            M+ ++   GLLSLPS P+ R   P P   LR RF  A      P    D L L      +
Sbjct  1    MEAVIPAAGLLSLPSNPQARGFRPFPT--LRTRFPSAAVRAHTPPPRSDALRLR-----E  53

Query  351  LEAFVGKPS--LVAQR-------------GRCFPVCRAEAAAAEDGQPLLGGEAASESPK  485
                  KP   L AQR              + FPVC A AAA     P  GG    E PK
Sbjct  54   RNPSFSKPRTPLDAQRLLLCNLSCGSRGKDKSFPVCGAGAAAI----PADGGGYVEEKPK  109

Query  486  --FMGVDVATLKKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLP  659
               +GV+V TLKKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLP
Sbjct  110  PKLLGVEVQTLKKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLP  169

Query  660  MAIGFMILYTKLANVLSKEALFYTVI  737
            MA+GFM+LYTKL+NVLSKEALFYTVI
Sbjct  170  MAVGFMLLYTKLSNVLSKEALFYTVI  195



>ref|XP_010925271.1| PREDICTED: plastidic ATP/ADP-transporter-like [Elaeis guineensis]
Length=667

 Score =   185 bits (469),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 115/201 (57%), Positives = 125/201 (62%), Gaps = 21/201 (10%)
 Frame = +3

Query  180  MDTILQTRGLLSLPSKPRIRASYPVPQGGLRHRFNGANGLKAKPFDGLSLSAGGLPKLEA  359
            M+ I+   GLLSLPS P+ RA  P     LR RF  A      P           P    
Sbjct  1    MEAIIPAAGLLSLPSNPQARAFRPFST--LRTRFPSAAVRAHTPASRTDALRWREPNPSF  58

Query  360  FVGKPSLVAQR-------------GRCFPVCRAEAAAAEDGQPLLGGEAASESPK--FMG  494
               +  L AQR              R FPVC A AAA     P  GG    E PK   +G
Sbjct  59   SKPRTPLDAQRLLLYNVSCGYRGKDRSFPVCGAGAAAI----PADGGGYVEEKPKPKLLG  114

Query  495  VDVATLKKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGF  674
            V+V TLKKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMA+GF
Sbjct  115  VEVQTLKKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAVGF  174

Query  675  MILYTKLANVLSKEALFYTVI  737
            M+LYTKL+NVLSKEALFYTV+
Sbjct  175  MLLYTKLSNVLSKEALFYTVL  195



>ref|XP_010925128.1| PREDICTED: ADP,ATP carrier protein 1, chloroplastic [Elaeis guineensis]
Length=745

 Score =   185 bits (469),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 107/215 (50%), Positives = 137/215 (64%), Gaps = 31/215 (14%)
 Frame = +3

Query  168  ACEEMDTILQTRGLLSLPSKPRIRASYPVPQGGLRH-------------------RFNGA  290
            +C +M+ +LQ +GLL+LP  P  RA    P    R                    R + +
Sbjct  65   SCGDMEGVLQAKGLLALPLNPGSRARDLHPLCTSRTHLSRRNTKKAAAFPSAAALRIDNS  124

Query  291  NGLKAKPFDGLSLSAGGLPKLEAFVGKPSL------VAQRGRCFPVCRAEAAAAEDGQPL  452
            +G  +K     SL   G  + E  +            +++ +   +CRAEAA + DG  L
Sbjct  125  HGSASKDS---SLRFSGPREAEELLLSTEYRSAGHGFSKKTKNLQICRAEAAISTDGGGL  181

Query  453  LGGEAASESPKFMGVDVATLKKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIP  632
            +G   + E  KF+GV+V+TLKK+IPLGLMFFCILFNYTILRDTKDVLVVTA+GSSAEIIP
Sbjct  182  IG---SGEKRKFLGVEVSTLKKVIPLGLMFFCILFNYTILRDTKDVLVVTAEGSSAEIIP  238

Query  633  FLKTWVNLPMAIGFMILYTKLANVLSKEALFYTVI  737
            FLKTWVNLP+A+GFM+LYTKL+N+LSKEALFYTVI
Sbjct  239  FLKTWVNLPLAVGFMLLYTKLSNMLSKEALFYTVI  273



>emb|CDX96838.1| BnaA08g23810D [Brassica napus]
Length=612

 Score =   182 bits (462),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 111/196 (57%), Positives = 134/196 (68%), Gaps = 21/196 (11%)
 Frame = +3

Query  180  MDTILQTRGLLSLPSKPRI--RASYPVPQGGLRHRFNGANGLKAKPFDGLSLSAGGLPKL  353
            M+ ++Q RG+LSLP+KP +  R   P P   L+ R    N         LS S+    K+
Sbjct  1    MEGLIQPRGILSLPTKPIVATRTLLP-PSPALKQRLFTRN------LPPLSFSSNAPTKV  53

Query  354  EAFVGKPSLVA-----QRGRCFPVCRAEAAAAEDGQPLLGGEAASESPKFMGVDVATLKK  518
            ++F   P  ++     +  R F +C+AEA+AA             +SP   GV+V TLKK
Sbjct  54   QSFHRNPLTISISHKERINRGF-ICKAEASAAAAAA------GEGDSPNIFGVEVTTLKK  106

Query  519  IIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYTKLA  698
            IIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFM+LYTKL+
Sbjct  107  IIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMLLYTKLS  166

Query  699  NVLSKEALFYTVILPF  746
            NVLSK+ALFYTVI+PF
Sbjct  167  NVLSKKALFYTVIIPF  182



>emb|CAA89201.2| adenine nucleotide translocase [Arabidopsis thaliana]
Length=623

 Score =   182 bits (461),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 109/198 (55%), Positives = 127/198 (64%), Gaps = 17/198 (9%)
 Frame = +3

Query  180  MDTILQTRGLLSLPSKPRIRASYPVPQGGLRHRFNGANGLKAKPFDGLSLSAGGLPKLEA  359
            M+ ++QTRGLLSLP+KP    S   P  GL+ R   A   K +   G      G    + 
Sbjct  1    MEAVIQTRGLLSLPTKPIGVRSQLQPSHGLKQRLFAA---KPRNLHGCLYPLTGTRNFKP  57

Query  360  FVGKPSLVAQRGRCFPVCRAEAAAAEDGQPLL---------GGEAASESPKFMGVDVATL  512
             + +P +    G  FP  R   ++    +               A   S K  GV+VATL
Sbjct  58   -LSQPCM----GFRFPTKREAPSSYARRRRGCWRRSCLRRSDSAAVVASRKIFGVEVATL  112

Query  513  KKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYTK  692
            KKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFM+LYTK
Sbjct  113  KKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMLLYTK  172

Query  693  LANVLSKEALFYTVILPF  746
            L+NVLSK+ALFYTVI+PF
Sbjct  173  LSNVLSKKALFYTVIVPF  190



>ref|XP_008809354.1| PREDICTED: ADP,ATP carrier protein 2, chloroplastic [Phoenix 
dactylifera]
Length=679

 Score =   181 bits (459),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 108/210 (51%), Positives = 133/210 (63%), Gaps = 27/210 (13%)
 Frame = +3

Query  180  MDTILQTRGLLSLPSKPRIRASYPVPQGGLRHRFNGANGLKAKPFDGLSLSAGGLPKLEA  359
            M+ +L+ +GL+SLP  P  RA    P    R   +  N  KA  F   + +A  +     
Sbjct  1    MEGVLRAKGLISLPLNPGPRARDLHPLWTARTHLSRRNTKKAGAFPSAAAAALRVHHSHG  60

Query  360  FVGK-----------------PSLVAQRGRCFP-------VCRAEAAAAEDGQPLLGGEA  467
            F GK                 P+     GR F        +CRAEAA + DG  L+G   
Sbjct  61   FAGKDSGLRFSAPTEAEESLLPAEYRSAGRGFSKKPKNLQICRAEAAISTDGGGLVG---  117

Query  468  ASESPKFMGVDVATLKKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTW  647
            + E  KF+G++++TLKK+IPLGLMFFCILFNYTILRDTKDVLVVTA+GSSAEIIPFLKTW
Sbjct  118  SGERRKFLGLEISTLKKVIPLGLMFFCILFNYTILRDTKDVLVVTAEGSSAEIIPFLKTW  177

Query  648  VNLPMAIGFMILYTKLANVLSKEALFYTVI  737
            VNLP+A+GFM+LYTKL+N LSKEALFYTVI
Sbjct  178  VNLPLAVGFMLLYTKLSNALSKEALFYTVI  207



>ref|XP_008792130.1| PREDICTED: plastidic ATP/ADP-transporter-like [Phoenix dactylifera]
Length=666

 Score =   179 bits (454),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 108/203 (53%), Positives = 133/203 (66%), Gaps = 25/203 (12%)
 Frame = +3

Query  180  MDTILQTRGLLSLPSKPRIRA----SYP---VPQGGLRHRFNG--ANGLKAKPFDGLSLS  332
            M+ ++   GLLSLPS P+ RA    S P    P   +R   +   ++GL+ +  +     
Sbjct  1    MEAVIPATGLLSLPSNPQTRAFRTFSNPRTCFPSAAIRAHTSAPSSDGLRWRERN----P  56

Query  333  AGGLPKLEAFVGKPSLVA------QRGRCFPVCRAEAAA-AEDGQPLLGGEAASE-SPKF  488
            +   P+   +  +  L        ++   FPVC A A+A   DG    GG    +  PKF
Sbjct  57   SFSQPRTPLYAQRSLLYNLSRGSWRKDESFPVCGAGASAITADG----GGFVEEKPKPKF  112

Query  489  MGVDVATLKKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAI  668
            +G++V TLKKIIPLGLMFFCILFNYTILRDTKDVLVVT KGSSAEIIPFLKTWVNLPMA+
Sbjct  113  LGIEVKTLKKIIPLGLMFFCILFNYTILRDTKDVLVVTTKGSSAEIIPFLKTWVNLPMAV  172

Query  669  GFMILYTKLANVLSKEALFYTVI  737
            GFM+LYTKL+NVLSKEALFYTVI
Sbjct  173  GFMLLYTKLSNVLSKEALFYTVI  195



>ref|XP_010914961.1| PREDICTED: plastidic ATP/ADP-transporter-like [Elaeis guineensis]
Length=658

 Score =   179 bits (454),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 109/198 (55%), Positives = 125/198 (63%), Gaps = 19/198 (10%)
 Frame = +3

Query  180  MDTILQTRGLLSLPSKPRIRASYPVPQGGLRHRFNGANGLKAKP---FDGLSLSAGGLPK  350
            M+ ++   G LSLPS P+ RA  P      R RF         P    DGL       P 
Sbjct  1    MEAVIPVTGHLSLPSNPQTRAFRPFSNP--RTRFPSVAIRAYTPAPSSDGLHWRVRN-PS  57

Query  351  LEAFVGKPSLVA-------QRGRCFPVCRAEAAAAEDGQPLLGGEAASESPK--FMGVDV  503
                  + SL+        ++   FPVC A AAA     P  GG    E PK  F+G++V
Sbjct  58   FFPLDAQRSLLHNLSYGSWRKDETFPVCGAGAAAI----PADGGGFVEEKPKPKFLGIEV  113

Query  504  ATLKKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMIL  683
             TLKKI+PLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLK WVNLP+A+GFM+L
Sbjct  114  QTLKKIVPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKMWVNLPLAVGFMLL  173

Query  684  YTKLANVLSKEALFYTVI  737
            YTKL+NVLSKEALFYTVI
Sbjct  174  YTKLSNVLSKEALFYTVI  191



>ref|XP_003571578.1| PREDICTED: plastidic ATP/ADP-transporter-like [Brachypodium distachyon]
Length=623

 Score =   174 bits (441),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 84/96 (88%), Positives = 89/96 (93%), Gaps = 0/96 (0%)
 Frame = +3

Query  459  GEAASESPKFMGVDVATLKKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFL  638
            G+ A  S KF+GVD  TLKKI+PLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFL
Sbjct  74   GDGADNSRKFLGVDARTLKKIVPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFL  133

Query  639  KTWVNLPMAIGFMILYTKLANVLSKEALFYTVILPF  746
            KTWVNLPMAIGFM+LYTKLA+VLSKEALFYTVI PF
Sbjct  134  KTWVNLPMAIGFMLLYTKLADVLSKEALFYTVIFPF  169



>dbj|BAJ89983.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=620

 Score =   173 bits (439),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 97/160 (61%), Positives = 111/160 (69%), Gaps = 17/160 (11%)
 Frame = +3

Query  267  LRHRFNGANGLKAKPFDGLSLSAGGLPKLEAFVGKPSLVAQRGRCFPVCRAEAAAAEDGQ  446
            LRHR   A  L+             LP +   + +P+ +  R    P  R   AA+    
Sbjct  25   LRHRRLAATPLR-------------LPTIPTPLRQPAALPLR----PCLRPPRAASVASP  67

Query  447  PLLGGEAASESPKFMGVDVATLKKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEI  626
              + G+A   S KF+GVD  TLKKI+PLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEI
Sbjct  68   APVPGDAPDNSRKFLGVDALTLKKIVPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEI  127

Query  627  IPFLKTWVNLPMAIGFMILYTKLANVLSKEALFYTVILPF  746
            IPFLKTWVNLPMAIGFM+LY+KLA+VLSKEALFYTVI PF
Sbjct  128  IPFLKTWVNLPMAIGFMLLYSKLADVLSKEALFYTVIFPF  167



>gb|EAY84955.1| hypothetical protein OsI_06319 [Oryza sativa Indica Group]
Length=630

 Score =   173 bits (439),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 83/92 (90%), Positives = 88/92 (96%), Gaps = 0/92 (0%)
 Frame = +3

Query  471  SESPKFMGVDVATLKKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWV  650
            S SPKF+GV+  TLKKI+PLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWV
Sbjct  85   SASPKFLGVETKTLKKIVPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWV  144

Query  651  NLPMAIGFMILYTKLANVLSKEALFYTVILPF  746
            NLPMAIGFM+LYTKLA+VLSKEALFYTVI PF
Sbjct  145  NLPMAIGFMLLYTKLADVLSKEALFYTVIFPF  176



>dbj|BAD24996.1| putative plastidic ATP/ADP transporter [Oryza sativa Japonica 
Group]
 dbj|BAD25005.1| putative plastidic ATP/ADP transporter [Oryza sativa Japonica 
Group]
 dbj|BAH01705.1| unnamed protein product [Oryza sativa Japonica Group]
Length=630

 Score =   173 bits (438),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 83/92 (90%), Positives = 88/92 (96%), Gaps = 0/92 (0%)
 Frame = +3

Query  471  SESPKFMGVDVATLKKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWV  650
            S SPKF+GV+  TLKKI+PLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWV
Sbjct  85   SASPKFLGVETKTLKKIVPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWV  144

Query  651  NLPMAIGFMILYTKLANVLSKEALFYTVILPF  746
            NLPMAIGFM+LYTKLA+VLSKEALFYTVI PF
Sbjct  145  NLPMAIGFMLLYTKLADVLSKEALFYTVIFPF  176



>ref|XP_009409613.1| PREDICTED: plastidic ATP/ADP-transporter [Musa acuminata subsp. 
malaccensis]
Length=286

 Score =   166 bits (420),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 104/212 (49%), Positives = 127/212 (60%), Gaps = 35/212 (17%)
 Frame = +3

Query  180  MDTILQTRGLLSLPSKPRIRASYPVPQGGLRHRFNGANGLKAKPFDGLSLSAGGLPKLEA  359
            M+ ++ T GL  L S  + R  +PV    +R R + A  L        SL  G  P   +
Sbjct  1    MERVIVTEGLRPLLSNLQARPFHPV--HAIRSRLSAAVCLP-------SLGLGARPPTSS  51

Query  360  FVG------KPSL-----------------VAQRGRCFPVCRAEAAAAEDGQPLLGGEAA  470
            F G      KPS                  + ++ R  P   A AA +  G  ++  +  
Sbjct  52   FYGFSSENKKPSFPGWGTADEHERRLLHARLCRKQRKAPFFSAGAAISAGGDGVIDDK--  109

Query  471  SESPKFMGVDVATLKKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWV  650
             E PKF+GV++ TLKKIIPLG+MFF I+FNYT LRDTKDVLVVTA GS AEIIPFLKTWV
Sbjct  110  -EKPKFLGVELVTLKKIIPLGMMFFFIIFNYTFLRDTKDVLVVTANGSGAEIIPFLKTWV  168

Query  651  NLPMAIGFMILYTKLANVLSKEALFYTVILPF  746
            NLP A+GFM+LYTKLANVLSKEALFYTVI+PF
Sbjct  169  NLPRAVGFMLLYTKLANVLSKEALFYTVIVPF  200



>gb|EMT25116.1| ADP,ATP carrier protein 1, chloroplastic [Aegilops tauschii]
Length=671

 Score =   172 bits (437),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 87/114 (76%), Positives = 95/114 (83%), Gaps = 0/114 (0%)
 Frame = +3

Query  405  PVCRAEAAAAEDGQPLLGGEAASESPKFMGVDVATLKKIIPLGLMFFCILFNYTILRDTK  584
            P  R   AA+      + G+A   S KF+GVD  TLKKI+PLGLMFFCILFNYTILRDTK
Sbjct  106  PCLRPPRAASVASPAPVPGDAPDNSRKFLGVDALTLKKIVPLGLMFFCILFNYTILRDTK  165

Query  585  DVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYTKLANVLSKEALFYTVILPF  746
            DVLVVTAKGSSAEIIPFLKTWVNLPMAIGFM+LY+KLA+VLSKEALFYTVI PF
Sbjct  166  DVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMLLYSKLADVLSKEALFYTVIFPF  219



>gb|AFW71370.1| hypothetical protein ZEAMMB73_421978 [Zea mays]
Length=448

 Score =   169 bits (427),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 79/90 (88%), Positives = 86/90 (96%), Gaps = 0/90 (0%)
 Frame = +3

Query  477  SPKFMGVDVATLKKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNL  656
            SPKF+GV+  T+KKI+PLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNL
Sbjct  87   SPKFLGVETKTIKKIVPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNL  146

Query  657  PMAIGFMILYTKLANVLSKEALFYTVILPF  746
            PMA+GFM+LYTKLA+VLSKEALFY VI PF
Sbjct  147  PMAVGFMLLYTKLADVLSKEALFYAVIFPF  176



>ref|XP_002974477.1| hypothetical protein SELMODRAFT_101296 [Selaginella moellendorffii]
 gb|EFJ24699.1| hypothetical protein SELMODRAFT_101296 [Selaginella moellendorffii]
Length=629

 Score =   170 bits (431),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 85/110 (77%), Positives = 92/110 (84%), Gaps = 2/110 (2%)
 Frame = +3

Query  417  AEAAAAEDGQPLLGGEAASESPKFMGVDVATLKKIIPLGLMFFCILFNYTILRDTKDVLV  596
            AEAA+     PL  G+      KF GVD  TLKK+IPLGLMFFCILFNYTILRDTKDVLV
Sbjct  76   AEAASVGVSSPL--GDGIPAKKKFFGVDTVTLKKVIPLGLMFFCILFNYTILRDTKDVLV  133

Query  597  VTAKGSSAEIIPFLKTWVNLPMAIGFMILYTKLANVLSKEALFYTVILPF  746
            VTAKGSSAEIIPFLKTWVNLPMAIGFM++YTKL+NVLS+EALFY  ILPF
Sbjct  134  VTAKGSSAEIIPFLKTWVNLPMAIGFMVIYTKLSNVLSREALFYACILPF  183



>ref|XP_006646147.1| PREDICTED: plastidic ATP/ADP-transporter-like, partial [Oryza 
brachyantha]
Length=554

 Score =   169 bits (429),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 81/91 (89%), Positives = 87/91 (96%), Gaps = 0/91 (0%)
 Frame = +3

Query  474  ESPKFMGVDVATLKKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVN  653
            E  KF+GV+V TLKKI+PLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVN
Sbjct  17   EGKKFLGVEVKTLKKIVPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVN  76

Query  654  LPMAIGFMILYTKLANVLSKEALFYTVILPF  746
            LPMAIGFM+LYTKL+NVLS+EALFYTVI PF
Sbjct  77   LPMAIGFMLLYTKLSNVLSREALFYTVIFPF  107



>ref|XP_002451752.1| hypothetical protein SORBIDRAFT_04g007240 [Sorghum bicolor]
 gb|EES04728.1| hypothetical protein SORBIDRAFT_04g007240 [Sorghum bicolor]
Length=681

 Score =   169 bits (429),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 80/90 (89%), Positives = 86/90 (96%), Gaps = 0/90 (0%)
 Frame = +3

Query  477  SPKFMGVDVATLKKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNL  656
            SPKF+GV+  TLKKI+PLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNL
Sbjct  88   SPKFLGVETKTLKKIVPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNL  147

Query  657  PMAIGFMILYTKLANVLSKEALFYTVILPF  746
            PMA+GFM+LYTKLA+VLSKEALFY VI PF
Sbjct  148  PMAVGFMLLYTKLADVLSKEALFYAVIFPF  177



>ref|NP_001140537.1| uncharacterized protein LOC100272602 [Zea mays]
 gb|ACF84037.1| unknown [Zea mays]
 gb|AFW71371.1| hypothetical protein ZEAMMB73_421978 [Zea mays]
Length=594

 Score =   169 bits (427),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 79/90 (88%), Positives = 86/90 (96%), Gaps = 0/90 (0%)
 Frame = +3

Query  477  SPKFMGVDVATLKKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNL  656
            SPKF+GV+  T+KKI+PLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNL
Sbjct  51   SPKFLGVETKTIKKIVPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNL  110

Query  657  PMAIGFMILYTKLANVLSKEALFYTVILPF  746
            PMA+GFM+LYTKLA+VLSKEALFY VI PF
Sbjct  111  PMAVGFMLLYTKLADVLSKEALFYAVIFPF  140



>ref|XP_008681386.1| PREDICTED: uncharacterized protein LOC100272602 isoform X1 [Zea 
mays]
 gb|AFW71369.1| hypothetical protein ZEAMMB73_421978 [Zea mays]
Length=630

 Score =   168 bits (426),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 79/90 (88%), Positives = 86/90 (96%), Gaps = 0/90 (0%)
 Frame = +3

Query  477  SPKFMGVDVATLKKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNL  656
            SPKF+GV+  T+KKI+PLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNL
Sbjct  87   SPKFLGVETKTIKKIVPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNL  146

Query  657  PMAIGFMILYTKLANVLSKEALFYTVILPF  746
            PMA+GFM+LYTKLA+VLSKEALFY VI PF
Sbjct  147  PMAVGFMLLYTKLADVLSKEALFYAVIFPF  176



>ref|XP_006648444.1| PREDICTED: plastidic ATP/ADP-transporter-like [Oryza brachyantha]
Length=548

 Score =   167 bits (424),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 81/93 (87%), Positives = 87/93 (94%), Gaps = 0/93 (0%)
 Frame = +3

Query  468  ASESPKFMGVDVATLKKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTW  647
            A  + KF+GV+  TLKKI+PLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTW
Sbjct  2    APAASKFLGVETRTLKKIVPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTW  61

Query  648  VNLPMAIGFMILYTKLANVLSKEALFYTVILPF  746
            VNLPMAIGFM+LYTKLA+VLSKEALFYTVI PF
Sbjct  62   VNLPMAIGFMLLYTKLADVLSKEALFYTVIFPF  94



>ref|XP_004951502.1| PREDICTED: plastidic ATP/ADP-transporter-like [Setaria italica]
Length=625

 Score =   167 bits (424),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 78/91 (86%), Positives = 87/91 (96%), Gaps = 0/91 (0%)
 Frame = +3

Query  474  ESPKFMGVDVATLKKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVN  653
            ++PKF+GV+  TLKKI+PLGLMFFCILFNYTILRDT+DVLVVTAKGSSAEIIPFLKTWVN
Sbjct  81   DAPKFLGVETKTLKKIVPLGLMFFCILFNYTILRDTEDVLVVTAKGSSAEIIPFLKTWVN  140

Query  654  LPMAIGFMILYTKLANVLSKEALFYTVILPF  746
            LPMA+GFM+LYTKLA+VLSKEALFY VI PF
Sbjct  141  LPMAVGFMLLYTKLADVLSKEALFYAVIFPF  171



>dbj|BAJ87646.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=156

 Score =   157 bits (396),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 88/149 (59%), Positives = 102/149 (68%), Gaps = 17/149 (11%)
 Frame = +3

Query  267  LRHRFNGANGLKAKPFDGLSLSAGGLPKLEAFVGKPSLVAQRGRCFPVCRAEAAAAEDGQ  446
            LRHR   A  L+             LP +   + +P+ +  R  C    RA + A+    
Sbjct  25   LRHRRLAATPLR-------------LPTIPTPLRQPAALPLRP-CLRPPRAASVASPAPV  70

Query  447  PLLGGEAASESPKFMGVDVATLKKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEI  626
            P   G+A   S KF+GVD  TLKKI+PLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEI
Sbjct  71   P---GDAPDNSRKFLGVDALTLKKIVPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEI  127

Query  627  IPFLKTWVNLPMAIGFMILYTKLANVLSK  713
            IPFLKTWVNLPMAIGFM+LY+KLA+VLSK
Sbjct  128  IPFLKTWVNLPMAIGFMLLYSKLADVLSK  156



>ref|XP_002458233.1| hypothetical protein SORBIDRAFT_03g029490 [Sorghum bicolor]
 gb|EES03353.1| hypothetical protein SORBIDRAFT_03g029490 [Sorghum bicolor]
Length=636

 Score =   166 bits (420),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 79/88 (90%), Positives = 85/88 (97%), Gaps = 0/88 (0%)
 Frame = +3

Query  474  ESPKFMGVDVATLKKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVN  653
             S KF+G+DV TLKKI+PLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVN
Sbjct  98   SSTKFLGIDVKTLKKIVPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVN  157

Query  654  LPMAIGFMILYTKLANVLSKEALFYTVI  737
            LPMAIGFM+LYTKL+NVLS+EALFYTVI
Sbjct  158  LPMAIGFMLLYTKLSNVLSREALFYTVI  185



>ref|XP_002990822.1| hypothetical protein SELMODRAFT_21240, partial [Selaginella moellendorffii]
 gb|EFJ08095.1| hypothetical protein SELMODRAFT_21240, partial [Selaginella moellendorffii]
Length=489

 Score =   164 bits (414),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 78/88 (89%), Positives = 83/88 (94%), Gaps = 0/88 (0%)
 Frame = +3

Query  483  KFMGVDVATLKKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPM  662
            KF GVD  TLKK+IPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPM
Sbjct  5    KFFGVDTVTLKKVIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPM  64

Query  663  AIGFMILYTKLANVLSKEALFYTVILPF  746
            AIGFM++YTKL+NVLS+EALFY  ILPF
Sbjct  65   AIGFMVIYTKLSNVLSREALFYACILPF  92



>gb|AAX58120.1| plastid ATP/ADP transporter [Oryza sativa Japonica Group]
Length=644

 Score =   165 bits (417),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 79/88 (90%), Positives = 85/88 (97%), Gaps = 0/88 (0%)
 Frame = +3

Query  474  ESPKFMGVDVATLKKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVN  653
            E  KF+GV+V TLKKI+PLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVN
Sbjct  107  EGKKFLGVEVKTLKKIVPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVN  166

Query  654  LPMAIGFMILYTKLANVLSKEALFYTVI  737
            LPMAIGFM+LYTKL+NVLS+EALFYTVI
Sbjct  167  LPMAIGFMLLYTKLSNVLSREALFYTVI  194



>ref|NP_001043710.1| Os01g0647100 [Oryza sativa Japonica Group]
 dbj|BAD68020.1| putative plastidic ATP/ADP transporter [Oryza sativa Japonica 
Group]
 dbj|BAD68186.1| putative plastidic ATP/ADP transporter [Oryza sativa Japonica 
Group]
 dbj|BAF05624.1| Os01g0647100 [Oryza sativa Japonica Group]
 gb|EAY75169.1| hypothetical protein OsI_03061 [Oryza sativa Indica Group]
Length=642

 Score =   165 bits (417),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 79/88 (90%), Positives = 85/88 (97%), Gaps = 0/88 (0%)
 Frame = +3

Query  474  ESPKFMGVDVATLKKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVN  653
            E  KF+GV+V TLKKI+PLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVN
Sbjct  107  EGKKFLGVEVKTLKKIVPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVN  166

Query  654  LPMAIGFMILYTKLANVLSKEALFYTVI  737
            LPMAIGFM+LYTKL+NVLS+EALFYTVI
Sbjct  167  LPMAIGFMLLYTKLSNVLSREALFYTVI  194



>gb|EAZ12893.1| hypothetical protein OsJ_02814 [Oryza sativa Japonica Group]
Length=619

 Score =   164 bits (415),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 79/88 (90%), Positives = 85/88 (97%), Gaps = 0/88 (0%)
 Frame = +3

Query  474  ESPKFMGVDVATLKKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVN  653
            E  KF+GV+V TLKKI+PLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVN
Sbjct  84   EGKKFLGVEVKTLKKIVPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVN  143

Query  654  LPMAIGFMILYTKLANVLSKEALFYTVI  737
            LPMAIGFM+LYTKL+NVLS+EALFYTVI
Sbjct  144  LPMAIGFMLLYTKLSNVLSREALFYTVI  171



>ref|XP_003569451.1| PREDICTED: plastidic ATP/ADP-transporter-like [Brachypodium distachyon]
Length=632

 Score =   164 bits (414),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 78/91 (86%), Positives = 87/91 (96%), Gaps = 0/91 (0%)
 Frame = +3

Query  474  ESPKFMGVDVATLKKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVN  653
            E+ KF+GV + TLKKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVN
Sbjct  95   EAKKFLGVGLPTLKKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVN  154

Query  654  LPMAIGFMILYTKLANVLSKEALFYTVILPF  746
            LPMAIGFM++Y+KL++VLS+EALFYTVI PF
Sbjct  155  LPMAIGFMLVYSKLSDVLSREALFYTVIFPF  185



>gb|AFW83424.1| hypothetical protein ZEAMMB73_806603 [Zea mays]
Length=634

 Score =   164 bits (414),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 77/85 (91%), Positives = 84/85 (99%), Gaps = 0/85 (0%)
 Frame = +3

Query  483  KFMGVDVATLKKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPM  662
            KF+G+DV TL+KI+PLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPM
Sbjct  99   KFLGIDVKTLRKIVPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPM  158

Query  663  AIGFMILYTKLANVLSKEALFYTVI  737
            AIGFM+LYTKL+NVLS+EALFYTVI
Sbjct  159  AIGFMLLYTKLSNVLSREALFYTVI  183



>ref|XP_008657814.1| PREDICTED: ADP,ATP carrier protein 2, chloroplastic-like [Zea 
mays]
Length=650

 Score =   164 bits (414),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 77/85 (91%), Positives = 84/85 (99%), Gaps = 0/85 (0%)
 Frame = +3

Query  483  KFMGVDVATLKKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPM  662
            KF+G+DV TL+KI+PLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPM
Sbjct  99   KFLGIDVKTLRKIVPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPM  158

Query  663  AIGFMILYTKLANVLSKEALFYTVI  737
            AIGFM+LYTKL+NVLS+EALFYTVI
Sbjct  159  AIGFMLLYTKLSNVLSREALFYTVI  183



>ref|XP_004969309.1| PREDICTED: plastidic ATP/ADP-transporter-like [Setaria italica]
Length=632

 Score =   163 bits (413),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 77/85 (91%), Positives = 84/85 (99%), Gaps = 0/85 (0%)
 Frame = +3

Query  483  KFMGVDVATLKKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPM  662
            KF+G+DV TLKKI+PLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPM
Sbjct  102  KFLGIDVKTLKKIVPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPM  161

Query  663  AIGFMILYTKLANVLSKEALFYTVI  737
            AIGFM+LYTKL+NVLS++ALFYTVI
Sbjct  162  AIGFMLLYTKLSNVLSRDALFYTVI  186



>ref|XP_006838934.1| PREDICTED: ADP,ATP carrier protein 2, chloroplastic [Amborella 
trichopoda]
 gb|ERN01503.1| hypothetical protein AMTR_s00002p00270350 [Amborella trichopoda]
Length=710

 Score =   163 bits (413),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 76/87 (87%), Positives = 85/87 (98%), Gaps = 0/87 (0%)
 Frame = +3

Query  486  FMGVDVATLKKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMA  665
            F+GV++ TLKK+IPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMA
Sbjct  93   FLGVEINTLKKVIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMA  152

Query  666  IGFMILYTKLANVLSKEALFYTVILPF  746
            IGFM++YTKL+NVLSKEALFY+ I+PF
Sbjct  153  IGFMLIYTKLSNVLSKEALFYSCIMPF  179



>ref|XP_010279263.1| PREDICTED: ADP,ATP carrier protein 1, chloroplastic-like [Nelumbo 
nucifera]
Length=681

 Score =   163 bits (412),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 102/192 (53%), Positives = 127/192 (66%), Gaps = 27/192 (14%)
 Frame = +3

Query  180  MDTILQTRGLLSLPSKPRIRASYPVPQGGLRHRFNGAN-----GLKAKPFDGLSLSAG-G  341
            M+ +L+T  L SLP K  I  S       L  R N +N      + +  F+ LS S G  
Sbjct  1    MEALLRTPPLPSLP-KLDINNSRR-----LTLRLNTSNRGEIRAISSIQFNKLSTSTGFR  54

Query  342  LPKLE--AFVGKPSLVAQRGRCFPVCRAEAAAAEDGQPLLGGEAASESP-KFMGVDVATL  512
            LP L+  +   + SL+    RC        +AA D    +   +A + P KF+GV+++TL
Sbjct  55   LPNLQGVSLKSRTSLI----RC--------SAAADASAFVSDNSAPKVPSKFLGVEISTL  102

Query  513  KKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYTK  692
            KK+IPLG+MFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLP+AIGFMI+Y K
Sbjct  103  KKVIPLGIMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPIAIGFMIVYNK  162

Query  693  LANVLSKEALFY  728
            L+NVLSKE+LFY
Sbjct  163  LSNVLSKESLFY  174



>gb|AAX63195.1| putative plastidic ATP/ADP transporter [Oryza sativa Japonica 
Group]
Length=642

 Score =   163 bits (412),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 78/88 (89%), Positives = 84/88 (95%), Gaps = 0/88 (0%)
 Frame = +3

Query  474  ESPKFMGVDVATLKKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVN  653
            E  KF+GV+V TLKKI+PLGLMFFCILFNY ILRDTKDVLVVTAKGSSAEIIPFLKTWVN
Sbjct  107  EGKKFLGVEVKTLKKIVPLGLMFFCILFNYAILRDTKDVLVVTAKGSSAEIIPFLKTWVN  166

Query  654  LPMAIGFMILYTKLANVLSKEALFYTVI  737
            LPMAIGFM+LYTKL+NVLS+EALFYTVI
Sbjct  167  LPMAIGFMLLYTKLSNVLSREALFYTVI  194



>ref|NP_001147851.1| plastidic ATP/ADP-transporter [Zea mays]
 gb|ACG28895.1| plastidic ATP/ADP-transporter [Zea mays]
Length=642

 Score =   162 bits (410),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 76/88 (86%), Positives = 84/88 (95%), Gaps = 0/88 (0%)
 Frame = +3

Query  474  ESPKFMGVDVATLKKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVN  653
             + K +G+DV TLKKI+PLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVN
Sbjct  97   STKKLLGIDVKTLKKIVPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVN  156

Query  654  LPMAIGFMILYTKLANVLSKEALFYTVI  737
            LPMAIGFM+LYTKL+NVLS++ALFYTVI
Sbjct  157  LPMAIGFMLLYTKLSNVLSRDALFYTVI  184



>ref|XP_008672827.1| PREDICTED: plastidic ATP/ADP-transporter isoform X1 [Zea mays]
Length=641

 Score =   162 bits (410),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 76/88 (86%), Positives = 84/88 (95%), Gaps = 0/88 (0%)
 Frame = +3

Query  474  ESPKFMGVDVATLKKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVN  653
             + K +G+DV TLKKI+PLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVN
Sbjct  97   STKKLLGIDVKTLKKIVPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVN  156

Query  654  LPMAIGFMILYTKLANVLSKEALFYTVI  737
            LPMAIGFM+LYTKL+NVLS++ALFYTVI
Sbjct  157  LPMAIGFMLLYTKLSNVLSRDALFYTVI  184



>gb|EMT31396.1| Plastidic ATP/ADP-transporter [Aegilops tauschii]
Length=620

 Score =   162 bits (409),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 78/94 (83%), Positives = 86/94 (91%), Gaps = 0/94 (0%)
 Frame = +3

Query  465  AASESPKFMGVDVATLKKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKT  644
            A  E  KF+GV + TLKKI+PLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKT
Sbjct  89   AQPEVKKFLGVGLPTLKKIVPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKT  148

Query  645  WVNLPMAIGFMILYTKLANVLSKEALFYTVILPF  746
            WVNLPMAIGFM+ Y+KL++VLS+EALFYTVI PF
Sbjct  149  WVNLPMAIGFMLAYSKLSDVLSREALFYTVIFPF  182



>tpg|DAA58346.1| TPA: plastidic ATP/ADP-transporter [Zea mays]
Length=612

 Score =   161 bits (408),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 76/88 (86%), Positives = 84/88 (95%), Gaps = 0/88 (0%)
 Frame = +3

Query  474  ESPKFMGVDVATLKKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVN  653
             + K +G+DV TLKKI+PLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVN
Sbjct  97   STKKLLGIDVKTLKKIVPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVN  156

Query  654  LPMAIGFMILYTKLANVLSKEALFYTVI  737
            LPMAIGFM+LYTKL+NVLS++ALFYTVI
Sbjct  157  LPMAIGFMLLYTKLSNVLSRDALFYTVI  184



>ref|XP_010325110.1| PREDICTED: plastidic ATP/ADP-transporter [Solanum lycopersicum]
Length=152

 Score =   150 bits (380),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 74/90 (82%), Positives = 79/90 (88%), Gaps = 3/90 (3%)
 Frame = +3

Query  444  QPLLGGEAASESPKFMGVDVATLKKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAE  623
            QPL      +E PKFMG++V TLKKIIPLG MFFCILFNYTILRDTKDVLVVTAKGSSAE
Sbjct  65   QPLF---VENEQPKFMGIEVVTLKKIIPLGAMFFCILFNYTILRDTKDVLVVTAKGSSAE  121

Query  624  IIPFLKTWVNLPMAIGFMILYTKLANVLSK  713
            IIP LKTWVNL MAIGFM+LYTKLANVLS+
Sbjct  122  IIPLLKTWVNLSMAIGFMLLYTKLANVLSR  151



>gb|AAV65341.1| putative plastidic ATP/ADP-transporter [Prototheca wickerhamii]
Length=214

 Score =   151 bits (381),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 88/176 (50%), Positives = 105/176 (60%), Gaps = 27/176 (15%)
 Frame = +3

Query  225  KPRIRASYPVPQGGLRHRFNGANGLKAKPFDGLSLSAGGLPKLEAFVGKPSLVAQRGRCF  404
            +PR+ A  P+ +          + + A+P     +    LP             QR +  
Sbjct  29   RPRLTACRPIARAACLS--TSKSAMAAQPLMAKPMGMASLPS-----------QQRVKSA  75

Query  405  PVCRAEAAAAEDGQPLLGGEAASESPK---FMGVDVATLKKIIPLGLMFFCILFNYTILR  575
             V R EA+            AA+ +PK   F+G+   T +KIIPLGLMFFCILFNYTILR
Sbjct  76   SV-RVEAS----------NSAATPAPKEGSFLGIAAFTWQKIIPLGLMFFCILFNYTILR  124

Query  576  DTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYTKLANVLSKEALFYTVILP  743
            DTKDVLVVTA GS AEIIPFLKTWVNLPMAIGF ILYTKLANVL+ E LFY  I+P
Sbjct  125  DTKDVLVVTAPGSGAEIIPFLKTWVNLPMAIGFTILYTKLANVLNNEQLFYVCIIP  180



>ref|XP_005844203.1| hypothetical protein CHLNCDRAFT_56336 [Chlorella variabilis]
 gb|EFN52101.1| hypothetical protein CHLNCDRAFT_56336 [Chlorella variabilis]
Length=589

 Score =   154 bits (390),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 80/111 (72%), Positives = 90/111 (81%), Gaps = 4/111 (4%)
 Frame = +3

Query  408  VCRAEAAAA-EDGQPLLGGEAASESPKFMGVDVATLKKIIPLGLMFFCILFNYTILRDTK  584
            V + +A+A   D  P+L   AA+E  KF+GV V T +KI+PLGLMFFCILFNYTILRDTK
Sbjct  59   VVKVQASATPADNMPVL---AAAEEKKFLGVPVFTWQKILPLGLMFFCILFNYTILRDTK  115

Query  585  DVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYTKLANVLSKEALFYTVI  737
            DVLVVTA GS AEIIPFLKTWVNLPMAIGF +LYTKLANVL+ E LFYT I
Sbjct  116  DVLVVTAPGSGAEIIPFLKTWVNLPMAIGFTVLYTKLANVLNNEQLFYTCI  166



>ref|XP_001780035.1| predicted protein [Physcomitrella patens]
 gb|EDQ55138.1| predicted protein [Physcomitrella patens]
Length=606

 Score =   153 bits (386),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 71/85 (84%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = +3

Query  483  KFMGVDVATLKKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPM  662
            K +G++  T KK+IPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPM
Sbjct  20   KILGIEATTFKKVIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPM  79

Query  663  AIGFMILYTKLANVLSKEALFYTVI  737
            AIGFM++YTKL+NVLSKE LFY+ I
Sbjct  80   AIGFMVIYTKLSNVLSKENLFYSCI  104



>ref|XP_001773938.1| predicted protein [Physcomitrella patens]
 gb|EDQ61286.1| predicted protein [Physcomitrella patens]
Length=564

 Score =   152 bits (383),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 71/85 (84%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = +3

Query  483  KFMGVDVATLKKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPM  662
            K +G++  T KK+IPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPM
Sbjct  54   KILGIEATTFKKVIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPM  113

Query  663  AIGFMILYTKLANVLSKEALFYTVI  737
            AIGFM++YTKL+NVLSKE LFY+ I
Sbjct  114  AIGFMVIYTKLSNVLSKENLFYSCI  138



>ref|XP_005643478.1| ADP/ATP carrier protein [Coccomyxa subellipsoidea C-169]
 gb|EIE18934.1| ADP/ATP carrier protein [Coccomyxa subellipsoidea C-169]
Length=559

 Score =   149 bits (375),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 71/86 (83%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = +3

Query  489  MGVDVATLKKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAI  668
            MG++  T KKIIPLG MFFCILFNYTILRDTKDVLVVTA GS AE+IPFLKTWVNLPMAI
Sbjct  1    MGIEAITWKKIIPLGFMFFCILFNYTILRDTKDVLVVTAPGSGAEVIPFLKTWVNLPMAI  60

Query  669  GFMILYTKLANVLSKEALFYTVILPF  746
            GF +LY KLANVLS EALFY  ILPF
Sbjct  61   GFTVLYAKLANVLSTEALFYACILPF  86



>ref|XP_011401420.1| ADP,ATP carrier protein 1, chloroplastic [Auxenochlorella protothecoides]
 gb|KFM28405.1| ADP,ATP carrier protein 1, chloroplastic [Auxenochlorella protothecoides]
Length=592

 Score =   146 bits (369),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 69/87 (79%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
 Frame = +3

Query  483  KFMGVDVATLKKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPM  662
             F+G+   T +KI+PLG+MFFCILFNYTILRDTKDVLVVTA GS AEIIPFLKTWVNLPM
Sbjct  88   SFLGIPAFTWQKIVPLGIMFFCILFNYTILRDTKDVLVVTAPGSGAEIIPFLKTWVNLPM  147

Query  663  AIGFMILYTKLANVLSKEALFYTVILP  743
            AIGF ILYTKLANVL+ E LFYT I+P
Sbjct  148  AIGFTILYTKLANVLNNEQLFYTCIIP  174



>gb|KDD74050.1| TLC ATP/ADP transporter, partial [Helicosporidium sp. ATCC 50920]
Length=487

 Score =   145 bits (366),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 69/85 (81%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = +3

Query  489  MGVDVATLKKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAI  668
            MG+  +T +KI+PLGLMFFCILFNYTILRDTKDVLVVTA GS AEIIPFLKTWVNLPMA+
Sbjct  1    MGIPTSTWQKIVPLGLMFFCILFNYTILRDTKDVLVVTAPGSGAEIIPFLKTWVNLPMAV  60

Query  669  GFMILYTKLANVLSKEALFYTVILP  743
            GF ILYTKL+NVLS EALFY  I P
Sbjct  61   GFTILYTKLSNVLSSEALFYACIFP  85



>gb|KIY98283.1| ADP,ATP carrier protein 2 [Monoraphidium neglectum]
Length=485

 Score =   144 bits (364),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 79/122 (65%), Positives = 84/122 (69%), Gaps = 4/122 (3%)
 Frame = +3

Query  390  RGRCFPVCRAEAAAAEDGQPLLGGE----AASESPKFMGVDVATLKKIIPLGLMFFCILF  557
              R F   R  A  AE+  P         A  E  K +G DV T +KIIPLG MFFCILF
Sbjct  39   NSRPFLAERQPAKRAENVGPAQASSGDVPAPGEGKKILGYDVFTWQKIIPLGAMFFCILF  98

Query  558  NYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYTKLANVLSKEALFYTVI  737
            NYTILRDTKDVLVVTA GS AEIIPFLKTWVNLPMAI F I Y +LANVLS EALFYT I
Sbjct  99   NYTILRDTKDVLVVTAPGSGAEIIPFLKTWVNLPMAIAFTIGYAQLANVLSTEALFYTCI  158

Query  738  LP  743
            +P
Sbjct  159  IP  160



>ref|XP_002947450.1| hypothetical protein VOLCADRAFT_79605 [Volvox carteri f. nagariensis]
 gb|EFJ51498.1| hypothetical protein VOLCADRAFT_79605 [Volvox carteri f. nagariensis]
Length=583

 Score =   142 bits (358),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 71/99 (72%), Positives = 81/99 (82%), Gaps = 5/99 (5%)
 Frame = +3

Query  465  AASESP-----KFMGVDVATLKKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEII  629
            AAS++P     KF+G +  T  KI+PLG MFFCILFNYTILRDTKDVLVVTA GS AEII
Sbjct  70   AASDAPAPEPKKFLGFEPLTWAKILPLGAMFFCILFNYTILRDTKDVLVVTAPGSGAEII  129

Query  630  PFLKTWVNLPMAIGFMILYTKLANVLSKEALFYTVILPF  746
            PFLKTWVNLPMAIGF +LY+ L+N L+ EALFYT I+PF
Sbjct  130  PFLKTWVNLPMAIGFTVLYSWLSNRLTSEALFYTCIIPF  168



>ref|XP_001703733.1| plastidic ADP/ATP translocase [Chlamydomonas reinhardtii]
 gb|EDO96373.1| plastidic ADP/ATP translocase [Chlamydomonas reinhardtii]
Length=577

 Score =   142 bits (357),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 70/96 (73%), Positives = 77/96 (80%), Gaps = 0/96 (0%)
 Frame = +3

Query  456  GGEAASESPKFMGVDVATLKKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPF  635
            G   A E  KF+G +  T  KI+PLG MFFCILFNYTILRDTKDVLVVTA GS AEIIPF
Sbjct  70   GDAPAPEPKKFLGFEPITWAKILPLGAMFFCILFNYTILRDTKDVLVVTAPGSGAEIIPF  129

Query  636  LKTWVNLPMAIGFMILYTKLANVLSKEALFYTVILP  743
            LKTWVNLPMAIGF I+Y+ L+N LS EALFYT I+P
Sbjct  130  LKTWVNLPMAIGFTIMYSALSNRLSSEALFYTCIIP  165



>gb|EMS68334.1| ADP,ATP carrier protein 1, chloroplastic [Triticum urartu]
Length=552

 Score =   139 bits (350),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 66/70 (94%), Positives = 69/70 (99%), Gaps = 0/70 (0%)
 Frame = +3

Query  537  MFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYTKLANVLSKE  716
            MFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFM+LY+KLA+VLSKE
Sbjct  1    MFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMLLYSKLADVLSKE  60

Query  717  ALFYTVILPF  746
            ALFYTVI PF
Sbjct  61   ALFYTVIFPF  70



>emb|CBI36236.3| unnamed protein product [Vitis vinifera]
Length=555

 Score =   139 bits (349),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 84/148 (57%), Positives = 98/148 (66%), Gaps = 9/148 (6%)
 Frame = +3

Query  180  MDTILQTRGLLSLPSKPRIRASYPVPQGGLRHRFNGANGLKAKPFDGLSLSAGGLPKLEA  359
            M+ +LQT+GLLSLPS P+ R      Q GLR R       K K   GLSL   G  K + 
Sbjct  1    MEAVLQTKGLLSLPSNPKFRVFNS--QQGLRQRLFVQ---KPKTLGGLSLPLNGFQKFQG  55

Query  360  FVGKPSLVAQRGRCFPVCRAEAAAAEDGQPLLGGEAASESPKFMGVDVATLKKIIPLGLM  539
            FV KP    ++ R F +CRAEAAAA DGQ L    A  E PKF+G++ AT KKI+PLGLM
Sbjct  56   FVAKPHDFCRQNRGF-ICRAEAAAAADGQSLF---AEPEKPKFLGIETATFKKIVPLGLM  111

Query  540  FFCILFNYTILRDTKDVLVVTAKGSSAE  623
            FFCILFNYTILRDTKDVLVVTA G+ A+
Sbjct  112  FFCILFNYTILRDTKDVLVVTAPGTLAD  139



>gb|EMS56290.1| Plastidic ATP/ADP-transporter [Triticum urartu]
Length=508

 Score =   134 bits (338),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 63/70 (90%), Positives = 68/70 (97%), Gaps = 0/70 (0%)
 Frame = +3

Query  537  MFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYTKLANVLSKE  716
            MFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFM+ Y+KL++VLS+E
Sbjct  1    MFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMLAYSKLSDVLSRE  60

Query  717  ALFYTVILPF  746
            ALFYTVI PF
Sbjct  61   ALFYTVIFPF  70



>gb|KDO58239.1| hypothetical protein CISIN_1g012495mg [Citrus sinensis]
Length=462

 Score =   133 bits (335),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 64/69 (93%), Positives = 68/69 (99%), Gaps = 0/69 (0%)
 Frame = +3

Query  537  MFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYTKLANVLSKE  716
            MFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFM+LYTKLA+ LSK+
Sbjct  1    MFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMLLYTKLADKLSKQ  60

Query  717  ALFYTVILP  743
            ALFYTVI+P
Sbjct  61   ALFYTVIVP  69



>ref|XP_002982220.1| hypothetical protein SELMODRAFT_116019, partial [Selaginella 
moellendorffii]
 gb|EFJ16888.1| hypothetical protein SELMODRAFT_116019, partial [Selaginella 
moellendorffii]
Length=507

 Score =   130 bits (326),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 68/121 (56%), Positives = 83/121 (69%), Gaps = 4/121 (3%)
 Frame = +3

Query  396  RCFPVCRAEAAAAEDGQPLLGGEAASESPKFMGVDVAT----LKKIIPLGLMFFCILFNY  563
            RC P     +++A+      G  A+SE       + +      KKII L LMFFCILF Y
Sbjct  25   RCSPRVTVTSSSAKSILHSSGSHASSEKSGVRKAEASVPRGERKKIIALCLMFFCILFAY  84

Query  564  TILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYTKLANVLSKEALFYTVILP  743
             +LRDTKD LVV AKGS+AEIIPFLKTWVNLP+AIGF ++YTKL+NVLS+EALFY  +L 
Sbjct  85   GVLRDTKDALVVAAKGSNAEIIPFLKTWVNLPVAIGFTVVYTKLSNVLSREALFYACVLS  144

Query  744  F  746
            F
Sbjct  145  F  145



>gb|ABV25604.1| plastid ATP/ADP translocase [Prymnesium parvum]
Length=552

 Score =   121 bits (304),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 67/130 (52%), Positives = 87/130 (67%), Gaps = 11/130 (8%)
 Frame = +3

Query  369  KPSLVAQRGRCFPVCRAEAAAAEDGQP----LLGGEAASESPKFMGVDVATLKKIIPLGL  536
            +P L A R R  P+    +  ++D QP    L    AA+  PK      + L+K++PL +
Sbjct  29   RPVLCA-RARLAPLANQLSVPSDDEQPERTTLRQRVAAALPPK------SELQKMVPLTI  81

Query  537  MFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYTKLANVLSKE  716
            MFF ILF+YTILRDTKDVL+VTA GSSAE IPFLKTWVNLP A+ F + Y+ +AN L +E
Sbjct  82   MFFSILFSYTILRDTKDVLIVTAPGSSAEAIPFLKTWVNLPGAVAFTVAYSAMANKLGRE  141

Query  717  ALFYTVILPF  746
            ALFY+ + PF
Sbjct  142  ALFYSTLAPF  151



>emb|CBJ27353.1| plastidic ATP/ADP transporter [Ectocarpus siliculosus]
Length=643

 Score =   120 bits (302),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 57/77 (74%), Positives = 64/77 (83%), Gaps = 0/77 (0%)
 Frame = +3

Query  513  KKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYTK  692
            KK++PL  MFFCILFNYTILRDTKDVLVVTA GS AEIIPFLKT+VNLP AI F +LY+K
Sbjct  148  KKLLPLAAMFFCILFNYTILRDTKDVLVVTAPGSGAEIIPFLKTYVNLPAAIAFTVLYSK  207

Query  693  LANVLSKEALFYTVILP  743
            L NV+S   +FYT I P
Sbjct  208  LNNVMSPSKVFYTCITP  224



>ref|WP_020356125.1| MULTISPECIES: ADP,ATP carrier protein [Chlamydia]
 gb|EPP36701.1| ADP,ATP carrier protein [Chlamydia psittaci 10_743_SC13]
 gb|EPP38163.1| ADP,ATP carrier protein [Chlamydia psittaci 10_881_SC42]
 gb|AHK63109.1| ADP,ATP carrier protein 1 [Chlamydia avium 10DC88]
Length=534

 Score =   118 bits (296),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 54/79 (68%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = +3

Query  510  LKKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYT  689
            LKK++P+ LMFFCI FNYTILRDTKD L+VTA GS AE IPF+K W+ +P A+ FM++Y 
Sbjct  24   LKKVLPMFLMFFCIAFNYTILRDTKDTLIVTAPGSGAEAIPFIKLWLVVPCAVVFMLIYA  83

Query  690  KLANVLSKEALFYTVILPF  746
            KL+N+LSK+ALFYTVI PF
Sbjct  84   KLSNILSKQALFYTVITPF  102



>gb|ABH10983.1| plastid ATP/ADP transporter [Polytomella parva]
Length=564

 Score =   118 bits (296),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 64/132 (48%), Positives = 86/132 (65%), Gaps = 9/132 (7%)
 Frame = +3

Query  366  GKPSLVAQRGRCFPVCRAEAAAAEDGQPLLGGEAA-----SESPKFMGVDVATLKKIIPL  530
            G+P LV       P    + A  E+ +P++   ++     +E   F+GV   T  K+IPL
Sbjct  14   GQPRLVQ---TALPKVVPQPAVQENVRPVVASASSDASKPAEKKHFLGVAPLTWAKVIPL  70

Query  531  GLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYTKLANVLS  710
             LMFFCILFNYT+LR  KDVL++TA GS AE+IPFLK  +NLP+A+GF + Y+ LA  LS
Sbjct  71   SLMFFCILFNYTVLRSCKDVLIITAPGSGAEVIPFLKV-LNLPVAVGFTLYYSALAGRLS  129

Query  711  KEALFYTVILPF  746
            +E LFY V+LPF
Sbjct  130  REQLFYAVLLPF  141



>gb|AFS19477.1| TLC ATP/ADP transporter family protein [Chlamydia psittaci 84/55]
Length=300

 Score =   115 bits (289),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = +3

Query  495  VDVATLKKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGF  674
            + +  LKK++P+ LMFFCI FNYT+LRDTKD L+VTA GS AE IPF+K W+ +P A+ F
Sbjct  19   IHMHELKKVLPMFLMFFCIAFNYTVLRDTKDTLIVTAPGSGAEAIPFIKLWLVVPCAVVF  78

Query  675  MILYTKLANVLSKEALFYTVILPF  746
            M++Y KL+N+LSK ALFYTVI PF
Sbjct  79   MLIYAKLSNILSKPALFYTVIAPF  102



>ref|WP_021757805.1| ADP/ATP carrier protein [Chlamydia pecorum]
 gb|AGW39762.1| ADP/ATP carrier protein [Chlamydia pecorum P787]
 gb|ETF37490.1| ADP,ATP carrier protein 1 [Chlamydia pecorum VR629]
 gb|ETF37998.1| ADP,ATP carrier protein 1 [Chlamydia pecorum DBDeUG]
 gb|ETF38266.1| ADP,ATP carrier protein 1 [Chlamydia pecorum MC/MarsBar]
 gb|ETF40232.1| ADP,ATP carrier protein 1 [Chlamydia pecorum IPTaLE]
Length=533

 Score =   117 bits (294),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 52/84 (62%), Positives = 69/84 (82%), Gaps = 0/84 (0%)
 Frame = +3

Query  495  VDVATLKKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGF  674
            + +  LKK++P+ LMFFCI FNYT+LRDTKD L+VTA GS AE IPF+K W+ +P A+ F
Sbjct  19   IHMHELKKVLPMFLMFFCIAFNYTVLRDTKDTLIVTAPGSGAEAIPFIKFWLVVPCAVVF  78

Query  675  MILYTKLANVLSKEALFYTVILPF  746
            M++Y KL+N+LSK+ALFYT+I PF
Sbjct  79   MLIYAKLSNILSKQALFYTIITPF  102



>ref|WP_013712807.1| ATPase AAA [Chlamydia pecorum]
 gb|AEB41729.1| ADP,ATP carrier protein 1 [Chlamydophila pecorum E58]
 gb|AGW38837.1| ADP/ATP carrier protein [Chlamydia pecorum W73]
Length=533

 Score =   117 bits (294),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 52/84 (62%), Positives = 69/84 (82%), Gaps = 0/84 (0%)
 Frame = +3

Query  495  VDVATLKKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGF  674
            + +  LKK++P+ LMFFCI FNYT+LRDTKD L+VTA GS AE IPF+K W+ +P A+ F
Sbjct  19   IHMHELKKVLPMFLMFFCIAFNYTVLRDTKDTLIVTAPGSGAEAIPFIKFWLVVPCAVVF  78

Query  675  MILYTKLANVLSKEALFYTVILPF  746
            M++Y KL+N+LSK+ALFYT+I PF
Sbjct  79   MLIYAKLSNILSKQALFYTIITPF  102



>ref|WP_021756588.1| ADP/ATP carrier protein [Chlamydia pecorum]
 gb|AGW37916.1| ADP/ATP carrier protein [Chlamydia pecorum PV3056/3]
Length=533

 Score =   117 bits (293),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 52/84 (62%), Positives = 69/84 (82%), Gaps = 0/84 (0%)
 Frame = +3

Query  495  VDVATLKKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGF  674
            + +  LKK++P+ LMFFCI FNYT+LRDTKD L+VTA GS AE IPF+K W+ +P A+ F
Sbjct  19   IHMHELKKVLPMFLMFFCIAFNYTVLRDTKDTLIVTAPGSGAEAIPFIKFWLVVPCAVVF  78

Query  675  MILYTKLANVLSKEALFYTVILPF  746
            M++Y KL+N+LSK+ALFYT+I PF
Sbjct  79   MLIYAKLSNILSKQALFYTIITPF  102



>ref|WP_013747357.1| ATPase AAA [Chlamydia psittaci]
 gb|ADZ18583.1| ADP/ATP carrier protein [Chlamydia psittaci 6BC]
 gb|AEB55460.1| ADP, ATP carrier protein [Chlamydia psittaci 6BC]
 gb|AFS20568.1| ADP/ATP carrier family protein [Chlamydia psittaci GR9]
 gb|AFS21220.1| ADP/ATP carrier family protein [Chlamydia psittaci MN]
 gb|AFS22669.1| ADP/ATP carrier family protein [Chlamydia psittaci VS225]
 gb|AFS24249.1| ADP/ATP carrier family protein [Chlamydia psittaci WS/RT/E30]
 gb|AFS25137.1| ADP/ATP carrier family protein [Chlamydia psittaci M56]
 gb|AFS25886.1| ADP/ATP carrier family protein [Chlamydia psittaci WC]
 gb|AFS26909.1| ADP/ATP carrier family protein [Chlamydia psittaci CP3]
 gb|AFS27997.1| ADP/ATP carrier family protein [Chlamydia psittaci NJ1]
 emb|CCO01942.1| ADP/ATP carrier protein [Chlamydia psittaci 01DC12]
 gb|AGE75021.1| ADP/ATP carrier protein [Chlamydia psittaci Mat116]
 gb|EPJ24811.1| ADP,ATP carrier protein [Chlamydia psittaci 09DC77]
 gb|EPJ26367.1| ADP,ATP carrier protein [Chlamydia psittaci 09DC80]
 gb|EPJ27592.1| ADP,ATP carrier protein [Chlamydia psittaci 99DC5]
 gb|EPJ29787.1| ADP,ATP carrier protein [Chlamydia psittaci 09DC78]
 gb|EPL01129.1| ADP,ATP carrier protein [Chlamydia psittaci 09DC79]
 gb|EPP31854.1| ADP,ATP carrier protein [Chlamydia psittaci C1/97]
Length=532

 Score =   116 bits (291),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = +3

Query  495  VDVATLKKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGF  674
            + +  LKK++P+ LMFFCI FNYT+LRDTKD L+VTA GS AE IPF+K W+ +P A+ F
Sbjct  19   IHMHELKKVLPMFLMFFCIAFNYTVLRDTKDTLIVTAPGSGAEAIPFIKLWLVVPCAVVF  78

Query  675  MILYTKLANVLSKEALFYTVILPF  746
            M++Y KL+N+LSK ALFYTVI PF
Sbjct  79   MLIYAKLSNILSKPALFYTVIAPF  102



>ref|WP_006343113.1| ATPase AAA [Chlamydia psittaci]
 ref|YP_004064394.1| ADP/ATP carrier protein [Chlamydia psittaci RD1]
 emb|CBY16956.1| ADP/ATP carrier protein [Chlamydia psittaci RD1]
 gb|EGF85036.1| ADP/ATP carrier protein [Chlamydia psittaci Cal10]
 gb|AEG85482.1| ADP/ATP carrier protein [Chlamydia psittaci C19/98]
 gb|AEG86461.1| ADP/ATP carrier protein [Chlamydia psittaci 01DC11]
 gb|AEG87435.1| ADP/ATP carrier protein [Chlamydia psittaci 02DC15]
 gb|AEG88411.1| ADP/ATP carrier protein [Chlamydia psittaci 08DC60]
 gb|EPJ13171.1| ADP,ATP carrier protein [Chlamydia psittaci 02DC16]
 gb|EPJ14902.1| ADP,ATP carrier protein [Chlamydia psittaci 02DC15]
 gb|EPJ15526.1| ADP,ATP carrier protein [Chlamydia psittaci 02DC18]
 gb|EPJ18880.1| ADP,ATP carrier protein [Chlamydia psittaci 01DC11]
 gb|EPJ20128.1| ADP,ATP carrier protein [Chlamydia psittaci 02DC21]
 gb|EPJ21222.1| ADP,ATP carrier protein [Chlamydia psittaci 02DC23]
 gb|EPJ21971.1| ADP,ATP carrier protein [Chlamydia psittaci 04DC42]
 gb|EPJ23230.1| ADP,ATP carrier protein [Chlamydia psittaci 03DC29]
 gb|EPJ24421.1| ADP,ATP carrier protein [Chlamydia psittaci 08DC60]
 gb|EPJ29395.1| ADP,ATP carrier protein [Chlamydia psittaci C19/98]
 gb|EPJ30143.1| ADP,ATP carrier protein [Chlamydia psittaci 03DC35]
 gb|EPJ97988.1| ADP,ATP carrier protein [Chlamydia psittaci 02DC14]
 gb|EPL00331.1| ADP,ATP carrier protein [Chlamydia psittaci 02DC24]
 gb|EPP33497.1| ADP,ATP carrier protein [Chlamydia psittaci C6/98]
Length=532

 Score =   116 bits (291),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = +3

Query  495  VDVATLKKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGF  674
            + +  LKK++P+ LMFFCI FNYT+LRDTKD L+VTA GS AE IPF+K W+ +P A+ F
Sbjct  19   IHMHELKKVLPMFLMFFCIAFNYTVLRDTKDTLIVTAPGSGAEAIPFIKLWLVVPCAVVF  78

Query  675  MILYTKLANVLSKEALFYTVILPF  746
            M++Y KL+N+LSK ALFYTVI PF
Sbjct  79   MLIYAKLSNILSKPALFYTVIAPF  102



>ref|WP_006344068.1| ATPase AAA [Chlamydophila abortus]
 gb|EGK69188.1| ADP/ATP carrier protein [Chlamydophila abortus LLG]
Length=532

 Score =   116 bits (291),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = +3

Query  495  VDVATLKKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGF  674
            + +  LKK++P+ LMFFCI FNYT+LRDTKD L+VTA GS AE IPF+K W+ +P A+ F
Sbjct  19   IHMHELKKVLPMFLMFFCIAFNYTVLRDTKDTLIVTAPGSGAEAIPFIKLWLVVPCAVVF  78

Query  675  MILYTKLANVLSKEALFYTVILPF  746
            M++Y KL+N+LSK ALFYTVI PF
Sbjct  79   MLIYAKLSNILSKPALFYTVIAPF  102



>ref|XP_010924175.1| PREDICTED: LOW QUALITY PROTEIN: plastidic ATP/ADP-transporter 
[Elaeis guineensis]
Length=331

 Score =   114 bits (286),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 77/172 (45%), Positives = 98/172 (57%), Gaps = 22/172 (13%)
 Frame = +3

Query  231  RIRASYPVPQGGLRHRFNGANGLKAKPFDGLSLSAGGLPKLEAFVGKPSLVAQRGRCFPV  410
            RI  S+ +P      RF+G      K    L +S+        F       + + +   +
Sbjct  98   RIHNSHGLPDKESSLRFSGP-----KEAQSLLISSENQSAAHGF-------SNKSKNLLI  145

Query  411  CRAEAAAAEDGQPLLGGEAASESPKFMGVDVATLKKIIPLGLMFFCILFNYTILRDTKDV  590
            CRA+AA + D +   G   + +  K +G  V TLKKIIPLG MFF    N+TILRDTKDV
Sbjct  146  CRAQAAISADCR---GSIESGKKRKALGAAVLTLKKIIPLGPMFFX---NFTILRDTKDV  199

Query  591  LVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYTKLANVLSKEALFYTVILPF  746
            LVV+AKGSSAEII FL +WVNLPMA+GF+     L+N LSKE  F TVI  F
Sbjct  200  LVVSAKGSSAEIITFLTSWVNLPMAVGFV----XLSNALSKEVPFCTVIFLF  247



>gb|EPJ33718.1| ADP/ATP carrier family protein, partial [Chlamydia psittaci 06-1683]
Length=510

 Score =   116 bits (290),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = +3

Query  495  VDVATLKKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGF  674
            + +  LKK++P+ LMFFCI FNYT+LRDTKD L+VTA GS AE IPF+K W+ +P A+ F
Sbjct  19   IHMHELKKVLPMFLMFFCIAFNYTVLRDTKDTLIVTAPGSGAEAIPFIKLWLVVPCAVVF  78

Query  675  MILYTKLANVLSKEALFYTVILPF  746
            M++Y KL+N+LSK ALFYTVI PF
Sbjct  79   MLIYAKLSNILSKPALFYTVIAPF  102



>ref|WP_011097058.1| ATPase AAA [Chlamydophila abortus]
 emb|CAH63874.1| ADP/ATP carrier protein [Chlamydophila abortus S26/3]
 emb|CED80479.1| ADP/ATP carrier protein [Chlamydophila abortus]
Length=532

 Score =   116 bits (290),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = +3

Query  495  VDVATLKKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGF  674
            + +  LKK++P+ LMFFCI FNYT+LRDTKD L+VTA GS AE IPF+K W+ +P A+ F
Sbjct  19   IHMHELKKVLPMFLMFFCIAFNYTVLRDTKDTLIVTAPGSGAEAIPFIKLWLVVPCAVVF  78

Query  675  MILYTKLANVLSKEALFYTVILPF  746
            M++Y KL+N+LSK ALFYTVI PF
Sbjct  79   MLIYAKLSNILSKPALFYTVIAPF  102



>ref|WP_011006397.1| ATPase AAA [Chlamydophila caviae]
 gb|AAP05181.1| ADP, ATP carrier protein [Chlamydophila caviae GPIC]
Length=533

 Score =   116 bits (290),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = +3

Query  495  VDVATLKKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGF  674
            + +  LKK++P+ LMFFCI FNYT+LRDTKD L+VTA GS AE IPF+K W+ +P A+ F
Sbjct  19   IHMHELKKVLPMFLMFFCIAFNYTVLRDTKDTLIVTAPGSGAEAIPFIKLWLVVPCAVVF  78

Query  675  MILYTKLANVLSKEALFYTVILPF  746
            M++Y KL+N+LSK ALFYTVI PF
Sbjct  79   MLIYAKLSNILSKPALFYTVITPF  102



>ref|WP_032741515.1| ATPase AAA [Chlamydia psittaci]
Length=545

 Score =   116 bits (290),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = +3

Query  495  VDVATLKKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGF  674
            + +  LKK++P+ LMFFCI FNYT+LRDTKD L+VTA GS AE IPF+K W+ +P A+ F
Sbjct  32   IHMHELKKVLPMFLMFFCIAFNYTVLRDTKDTLIVTAPGSGAEAIPFIKLWLVVPCAVVF  91

Query  675  MILYTKLANVLSKEALFYTVILPF  746
            M++Y KL+N+LSK ALFYTVI PF
Sbjct  92   MLIYAKLSNILSKPALFYTVIAPF  115



>ref|WP_020370051.1| MULTISPECIES: ADP,ATP carrier family protein [Chlamydia]
 gb|EPP35655.1| ADP,ATP carrier family protein [Chlamydia psittaci 10_1398_11]
 gb|EQM62559.1| ADP/ATP carrier protein [Chlamydia ibidis 10-1398/6]
Length=532

 Score =   115 bits (288),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 52/84 (62%), Positives = 67/84 (80%), Gaps = 0/84 (0%)
 Frame = +3

Query  495  VDVATLKKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGF  674
            +    LKK++P+ LMFFCI FNYT+LRDTKD L+VTA GS AE IPF+K W+ +P A+ F
Sbjct  19   IHAHELKKVLPMFLMFFCIAFNYTVLRDTKDTLIVTAPGSGAEAIPFIKLWLVVPCAVVF  78

Query  675  MILYTKLANVLSKEALFYTVILPF  746
            M++Y KL+N+LSK+ALFY VI PF
Sbjct  79   MLIYAKLSNILSKQALFYAVISPF  102



>ref|XP_005536231.1| chloroplast ADP,ATP carrier protein [Cyanidioschyzon merolae 
strain 10D]
 dbj|BAM79945.1| chloroplast ADP,ATP carrier protein [Cyanidioschyzon merolae 
strain 10D]
Length=684

 Score =   116 bits (290),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 59/79 (75%), Positives = 65/79 (82%), Gaps = 2/79 (3%)
 Frame = +3

Query  510  LKKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYT  689
            L+KIIPLGLMFF ILFNYTILRDTKDVLVVTA G  AEIIPFLKT+ NLP A+ F ILY+
Sbjct  190  LRKIIPLGLMFFLILFNYTILRDTKDVLVVTAAG--AEIIPFLKTYANLPGAVLFTILYS  247

Query  690  KLANVLSKEALFYTVILPF  746
            KL NV S+E +FY  I PF
Sbjct  248  KLTNVFSRETVFYICIAPF  266



>ref|WP_021828277.1| MULTISPECIES: ADP/ATP carrier family protein [Bacteria]
 gb|ERL53970.1| ADP/ATP carrier family protein [Chlamydia gallinacea 08-1274/3]
Length=535

 Score =   115 bits (287),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 52/84 (62%), Positives = 67/84 (80%), Gaps = 0/84 (0%)
 Frame = +3

Query  495  VDVATLKKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGF  674
            +    LKK++P+ LMFFCI FNYTILRDTKD L+VTA GS AE IPF+K W+ +P A+ F
Sbjct  19   IHTHELKKVLPMFLMFFCIAFNYTILRDTKDTLIVTAPGSGAEAIPFIKLWLVVPCAVVF  78

Query  675  MILYTKLANVLSKEALFYTVILPF  746
            M++Y KL+N+L+K+ALFY VI PF
Sbjct  79   MLIYAKLSNILNKQALFYAVISPF  102



>ref|WP_010230191.1| ADP,ATP carrier protein 1 [Chlamydia muridarum]
 sp|Q9PKX5.1|TLC1_CHLMU RecName: Full=ADP,ATP carrier protein 1; AltName: Full=ADP/ATP 
translocase 1 [Chlamydia muridarum str. Nigg]
 gb|AAF39198.1| ADP, ATP carrier protein [Chlamydia muridarum str. Nigg]
 gb|AHH22725.1| ATPase AAA [Chlamydia muridarum str. Nigg3 CMUT3-5]
 gb|AHH23650.1| ATPase AAA [Chlamydia muridarum str. Nigg CM972]
 gb|KDU80686.1| ADP/ATP carrier protein family [Chlamydia muridarum]
 gb|KDU81343.1| ADP/ATP carrier protein [Chlamydia muridarum]
 gb|KDU82181.1| ADP/ATP carrier protein [Chlamydia muridarum]
 gb|KDU83295.1| ADP/ATP carrier protein [Chlamydia muridarum]
 gb|KDU84629.1| ADP/ATP carrier protein [Chlamydia muridarum]
 gb|AID37867.1| ATPase AAA [Chlamydia muridarum str. Nigg 2 MCR]
 gb|AIT90534.1| ATPase AAA [Chlamydia muridarum]
 gb|AIT91421.1| ATPase AAA [Chlamydia muridarum]
 gb|AIW23299.1| ATPase AAA [Chlamydia muridarum]
 gb|AJR10420.1| ATPase AAA [Chlamydia muridarum]
Length=529

 Score =   115 bits (287),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 52/84 (62%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = +3

Query  495  VDVATLKKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGF  674
            + +  LKK++P+ LMFFCI FNYTILRDTKD L+VTA GS AE IPF+K W+ +P A+ F
Sbjct  19   IHMHELKKVLPMFLMFFCISFNYTILRDTKDTLIVTAPGSGAEAIPFIKLWLVVPSAVVF  78

Query  675  MILYTKLANVLSKEALFYTVILPF  746
            M++Y KL+N+LSK+ALFY V+ PF
Sbjct  79   MLIYAKLSNILSKQALFYAVLSPF  102



>ref|WP_035405565.1| ATPase AAA [Chlamydia suis]
 gb|ESN89754.1| ADP,ATP carrier protein 1 [Chlamydia suis MD56]
Length=529

 Score =   114 bits (284),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 51/84 (61%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = +3

Query  495  VDVATLKKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGF  674
            + +  LKK++P+ LMFFCI FNYTILRDTKD L+VTA GS AE IPF+K W+ +P A+ F
Sbjct  19   IHMHELKKVLPMFLMFFCISFNYTILRDTKDTLIVTAPGSGAEAIPFIKLWLVVPSAVVF  78

Query  675  MILYTKLANVLSKEALFYTVILPF  746
            M++Y KL+N+L+K+ALFY V+ PF
Sbjct  79   MLIYAKLSNILNKQALFYAVLSPF  102



>gb|ABV25597.1| plastid ATP/ADP translocase [Euglena gracilis]
Length=505

 Score =   112 bits (279),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 66/78 (85%), Gaps = 0/78 (0%)
 Frame = +3

Query  513  KKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYTK  692
            KKI+PL LMFFCILFNYTILRDTKDVL+VTA  S AE+IPFLKT+VNLP AI F I+Y+K
Sbjct  22   KKILPLALMFFCILFNYTILRDTKDVLMVTAPKSGAEVIPFLKTYVNLPGAILFTIIYSK  81

Query  693  LANVLSKEALFYTVILPF  746
            ++N +++  +FYT+I  F
Sbjct  82   MSNAMTQSQVFYTLISVF  99



>ref|WP_011458125.1| ATPase AAA [Chlamydophila felis]
 dbj|BAE81345.1| ADP/ATP translocase [Chlamydophila felis Fe/C-56]
Length=530

 Score =   112 bits (280),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 48/84 (57%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = +3

Query  495  VDVATLKKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGF  674
            + +  LKK++P+ LMFFCI FNYT+LRDTKD L+VTA GS AE IPF+K W+ +P A+ F
Sbjct  19   IHMHELKKVLPMFLMFFCISFNYTVLRDTKDTLIVTAPGSGAEAIPFIKLWLVVPCAVVF  78

Query  675  MILYTKLANVLSKEALFYTVILPF  746
            M++Y KL+N+L+K++LFY + +PF
Sbjct  79   MLIYAKLSNILNKQSLFYAITIPF  102



>ref|WP_011324550.1| ATPase AAA [Chlamydia trachomatis]
 gb|AAX50316.1| ADP,ATP carrier protein [Chlamydia trachomatis A/HAR-13]
 emb|CAX09618.1| ADP,ATP carrier protein [Chlamydia trachomatis B/TZ1A828/OT]
 gb|AEP34876.1| ADP,ATP carrier protein [Chlamydia trachomatis A2497]
 emb|CAX08724.1| ADP,ATP carrier protein [Chlamydia trachomatis A2497]
 emb|CCP49241.1| ADP/ATP carrier protein family protein [Chlamydia trachomatis 
A/7249]
 emb|CCP48342.1| ADP/ATP carrier protein family protein [Chlamydia trachomatis 
A/5291]
 emb|CCP47442.1| ADP/ATP carrier protein family protein [Chlamydia trachomatis 
A/363]
Length=526

 Score =   112 bits (279),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 50/84 (60%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = +3

Query  495  VDVATLKKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGF  674
            + +  LKK++P+ LMFFCI FNYTILRDTKD L+VTA GS AE IPF+K W+ +P A+ F
Sbjct  19   IHMHELKKVLPMFLMFFCISFNYTILRDTKDTLIVTAPGSGAEAIPFIKLWLVVPSAVVF  78

Query  675  MILYTKLANVLSKEALFYTVILPF  746
            M++Y KL+N+L+K+ALF+ V+ PF
Sbjct  79   MLIYAKLSNILNKQALFFAVLSPF  102



>emb|CAC80882.1| plastidic ATP/ADP transporter [Galdieria sulphuraria]
Length=671

 Score =   113 bits (282),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 61/110 (55%), Positives = 77/110 (70%), Gaps = 10/110 (9%)
 Frame = +3

Query  423  AAAAEDGQPLLGGEAASES--PKFMGVDVATLKKIIPLGLMFFCILFNYTILRDTKDVLV  596
            +A + DG   +G +  +++  PK        LKKI+PLG+MFF ILFNYTILRDTKDVLV
Sbjct  148  SAGSTDGSASVGADGIAKALPPK------NELKKILPLGVMFFMILFNYTILRDTKDVLV  201

Query  597  VTAKGSSAEIIPFLKTWVNLPMAIGFMILYTKLANVLSKEALFYTVILPF  746
            VT  G  AEIIPFLKT+ NLP A+ F I Y+KL+N+  +E LFY  I+PF
Sbjct  202  VTTTG--AEIIPFLKTYANLPGAVLFTIAYSKLSNMFDRETLFYVCIVPF  249



>ref|XP_005707402.1| ATP:ADP antiporter, AAA family [Galdieria sulphuraria]
 gb|EME30882.1| ATP:ADP antiporter, AAA family [Galdieria sulphuraria]
Length=670

 Score =   113 bits (282),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 61/110 (55%), Positives = 77/110 (70%), Gaps = 10/110 (9%)
 Frame = +3

Query  423  AAAAEDGQPLLGGEAASES--PKFMGVDVATLKKIIPLGLMFFCILFNYTILRDTKDVLV  596
            +A + DG   +G +  +++  PK        LKKI+PLG+MFF ILFNYTILRDTKDVLV
Sbjct  147  SAGSTDGSASVGADGIAKALPPK------NELKKILPLGVMFFMILFNYTILRDTKDVLV  200

Query  597  VTAKGSSAEIIPFLKTWVNLPMAIGFMILYTKLANVLSKEALFYTVILPF  746
            VT  G  AEIIPFLKT+ NLP A+ F I Y+KL+N+  +E LFY  I+PF
Sbjct  201  VTTTG--AEIIPFLKTYANLPGAVLFTIAYSKLSNMFDRETLFYVCIVPF  248



>ref|WP_014541221.1| ATPase AAA [Chlamydia trachomatis]
 ref|YP_008634577.1| ADP,ATP carrier protein [Chlamydia trachomatis E/C599]
 emb|CBJ14581.1| ADP,ATP carrier protein [Chlamydia trachomatis Sweden2]
 gb|ADH16831.1| ADP,ATP carrier protein [Chlamydia trachomatis E/150]
 gb|ADH20523.1| ADP,ATP carrier protein [Chlamydia trachomatis E/11023]
 emb|CCE12341.1| ADP,ATP carrier protein [Chlamydia trachomatis E/SW3]
 emb|CCP54923.1| ADP/ATP carrier protein family protein [Chlamydia trachomatis 
E/SotonE4]
 emb|CCP55816.1| ADP/ATP carrier protein family protein [Chlamydia trachomatis 
E/SotonE8]
 emb|CCP60311.1| ADP/ATP carrier protein family protein [Chlamydia trachomatis 
E/Bour]
 emb|CCP27852.1| ADP,ATP carrier protein [Chlamydia trachomatis IU824]
 emb|CCP28756.1| ADP,ATP carrier protein [Chlamydia trachomatis IU888]
 gb|AGT64992.1| ATPase AAA [Chlamydia trachomatis]
 gb|AGT67776.1| ATPase AAA [Chlamydia trachomatis]
 emb|CDG42958.1| ADP,ATP carrier protein [Chlamydia trachomatis E/C599]
Length=528

 Score =   111 bits (278),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 50/84 (60%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = +3

Query  495  VDVATLKKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGF  674
            + +  LKK++P+ LMFFCI FNYTILRDTKD L+VTA GS AE IPF+K W+ +P A+ F
Sbjct  19   IHMHELKKVLPMFLMFFCISFNYTILRDTKDTLIVTAPGSGAEAIPFIKLWLVVPSAVVF  78

Query  675  MILYTKLANVLSKEALFYTVILPF  746
            M++Y KL+N+L+K+ALF+ V+ PF
Sbjct  79   MLIYAKLSNILNKQALFFVVLSPF  102



>ref|WP_009873033.1| ADP,ATP carrier protein 1 [Chlamydia trachomatis]
 ref|YP_008655229.1| ADP,ATP carrier protein [Chlamydia trachomatis F/SWFPminus]
 emb|CCE14119.1| ADP,ATP carrier protein [Chlamydia trachomatis F/SW5]
 emb|CCE13230.1| ADP,ATP carrier protein [Chlamydia trachomatis F/SW4]
 emb|CCP52247.1| ADP/ATP carrier protein family protein [Chlamydia trachomatis 
D/SotonD1]
 emb|CCP56739.1| ADP/ATP carrier protein family protein [Chlamydia trachomatis 
F/SotonF3]
 gb|AGT64069.1| ATPase AAA [Chlamydia trachomatis]
 gb|AGT65918.1| ATPase AAA [Chlamydia trachomatis]
 gb|AGT66848.1| ATPase AAA [Chlamydia trachomatis F/11-96]
 gb|AGT68699.1| ATPase AAA [Chlamydia trachomatis]
 gb|AGT71473.1| ATPase AAA [Chlamydia trachomatis]
 emb|CDG42069.1| ADP,ATP carrier protein [Chlamydia trachomatis F/SWFPminus]
Length=528

 Score =   111 bits (278),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 50/84 (60%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = +3

Query  495  VDVATLKKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGF  674
            + +  LKK++P+ LMFFCI FNYTILRDTKD L+VTA GS AE IPF+K W+ +P A+ F
Sbjct  19   IHMHELKKVLPMFLMFFCISFNYTILRDTKDTLIVTAPGSGAEAIPFIKLWLVVPSAVVF  78

Query  675  MILYTKLANVLSKEALFYTVILPF  746
            M++Y KL+N+L+K+ALF+ V+ PF
Sbjct  79   MLIYAKLSNILNKQALFFAVLSPF  102



>ref|WP_015506544.1| ADP/ATP carrier protein family protein [Chlamydia trachomatis]
 emb|CCP62992.1| ADP/ATP carrier protein family protein [Chlamydia trachomatis 
L1/1322/p2]
Length=528

 Score =   111 bits (277),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 50/84 (60%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = +3

Query  495  VDVATLKKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGF  674
            + +  LKK++P+ LMFFCI FNYTILRDTKD L+VTA GS AE IPF+K W+ +P A+ F
Sbjct  19   IHMHELKKVLPMFLMFFCISFNYTILRDTKDTLIVTAPGSGAEAIPFIKLWLVVPSAVVF  78

Query  675  MILYTKLANVLSKEALFYTVILPF  746
            M++Y KL+N+L+K+ALF+ V+ PF
Sbjct  79   MLIYAKLSNILNKQALFFAVLSPF  102



>ref|WP_009871413.1| ADP,ATP carrier protein 1 [Chlamydia trachomatis]
 ref|NP_219568.1| ADP/ATP translocase [Chlamydia trachomatis D/UW-3/CX]
 sp|O84068.1|TLC1_CHLTR RecName: Full=ADP,ATP carrier protein 1; AltName: Full=ADP/ATP 
translocase 1 [Chlamydia trachomatis D/UW-3/CX]
 gb|AAC67656.1| ADP/ATP Translocase [Chlamydia trachomatis D/UW-3/CX]
 gb|ADH17756.1| ADP,ATP carrier protein [Chlamydia trachomatis G/9768]
 gb|ADH18676.1| ADP,ATP carrier protein [Chlamydia trachomatis G/11222]
 gb|ADH19603.1| ADP,ATP carrier protein [Chlamydia trachomatis G/11074]
 gb|ADH96699.1| ADP,ATP carrier protein [Chlamydia trachomatis G/9301]
 gb|ADI50741.1| ADP,ATP carrier protein [Chlamydia trachomatis D-EC]
 gb|ADI51753.1| ADP,ATP carrier protein [Chlamydia trachomatis D-LC]
 emb|CCP50231.1| ADP/ATP carrier protein family protein [Chlamydia trachomatis 
K/SotonK1]
 emb|CCP53140.1| ADP/ATP carrier protein family protein [Chlamydia trachomatis 
D/SotonD5]
 emb|CCP54031.1| ADP/ATP carrier protein family protein [Chlamydia trachomatis 
D/SotonD6]
 emb|CCP57630.1| ADP/ATP carrier protein family protein [Chlamydia trachomatis 
G/SotonG1]
 emb|CCP58522.1| ADP/ATP carrier protein family protein [Chlamydia trachomatis 
Ia/SotonIa1]
 emb|CCP59416.1| ADP/ATP carrier protein family protein [Chlamydia trachomatis 
Ia/SotonIa3]
 gb|AGR95329.1| ADP,ATP carrier protein [Chlamydia trachomatis RC-F(s)/852]
 gb|AGR99047.1| ADP,ATP carrier protein [Chlamydia trachomatis RC-F(s)/342]
 gb|AGS01861.1| ADP,ATP carrier protein [Chlamydia trachomatis J/6276tet1]
 gb|AGT69628.1| ATPase AAA [Chlamydia trachomatis]
 gb|AGT70547.1| ATPase AAA [Chlamydia trachomatis]
 gb|AGT72389.1| ATPase AAA [Chlamydia trachomatis]
 gb|AHC16911.1| ATPase AAA [Chlamydia trachomatis C/TW-3]
Length=528

 Score =   111 bits (277),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 50/84 (60%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = +3

Query  495  VDVATLKKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGF  674
            + +  LKK++P+ LMFFCI FNYTILRDTKD L+VTA GS AE IPF+K W+ +P A+ F
Sbjct  19   IHMHELKKVLPMFLMFFCISFNYTILRDTKDTLIVTAPGSGAEAIPFIKLWLVVPSAVVF  78

Query  675  MILYTKLANVLSKEALFYTVILPF  746
            M++Y KL+N+L+K+ALF+ V+ PF
Sbjct  79   MLIYAKLSNILNKQALFFAVLSPF  102



>ref|WP_009873532.1| ATPase AAA [Chlamydia trachomatis]
 ref|YP_001654404.1| ADP,ATP carrier protein [Chlamydia trachomatis 434/Bu]
 emb|CAB39534.1| nucleoside triphosphate transport protein 1 [Chlamydia trachomatis]
 emb|CAP03760.1| ADP,ATP carrier protein [Chlamydia trachomatis 434/Bu]
 emb|CAP06714.1| ADP,ATP carrier protein [Chlamydia trachomatis L2b/UCH-1/proctitis]
 gb|AEJ76967.1| ADP,ATP carrier protein 1 [Chlamydia trachomatis L2c]
 emb|CCP51356.1| ADP/ATP carrier protein family protein [Chlamydia trachomatis 
L2b/8200/07]
 emb|CCP61209.1| ADP/ATP carrier protein family protein [Chlamydia trachomatis 
L2b/795]
 emb|CCP62100.1| ADP/ATP carrier protein family protein [Chlamydia trachomatis 
L1/440/LN]
 emb|CCP63882.1| ADP/ATP carrier protein family protein [Chlamydia trachomatis 
L1/115]
 emb|CCP64771.1| ADP/ATP carrier protein family protein [Chlamydia trachomatis 
L1/224]
 emb|CCP65661.1| ADP/ATP carrier protein family protein [Chlamydia trachomatis 
L2/25667R]
 emb|CCP66551.1| ADP/ATP carrier protein family protein [Chlamydia trachomatis 
L3/404/LN]
 emb|CCP67439.1| ADP/ATP carrier protein family protein [Chlamydia trachomatis 
L2b/UCH-2]
 emb|CCP68329.1| ADP/ATP carrier protein family protein [Chlamydia trachomatis 
L2b/Canada2]
 emb|CCP69221.1| ADP/ATP carrier protein family protein [Chlamydia trachomatis 
L2b/LST]
 emb|CCP70111.1| ADP/ATP carrier protein family protein [Chlamydia trachomatis 
L2b/Ams1]
 emb|CCP71001.1| ADP/ATP carrier protein family protein [Chlamydia trachomatis 
L2b/CV204]
 emb|CCP90166.1| ADP/ATP carrier protein family protein [Chlamydia trachomatis 
L2b/Ams2]
 emb|CCP91056.1| ADP/ATP carrier protein family protein [Chlamydia trachomatis 
L2b/Ams3]
 emb|CCP91946.1| ADP/ATP carrier protein family protein [Chlamydia trachomatis 
L2b/Canada1]
 emb|CCP92841.1| ADP/ATP carrier protein family protein [Chlamydia trachomatis 
L2b/Ams4]
 emb|CCP93731.1| ADP/ATP carrier protein family protein [Chlamydia trachomatis 
L2b/Ams5]
 gb|AGJ65359.1| ATPase AAA [Chlamydia trachomatis L2/434/Bu(f)]
 gb|AGJ64419.1| ATPase AAA [Chlamydia trachomatis L2/434/Bu(i)]
 gb|AGR93480.1| ADP,ATP carrier protein [Chlamydia trachomatis RC-F/69]
 gb|AGR94404.1| ADP,ATP carrier protein [Chlamydia trachomatis RC-L2(s)/46]
 gb|AGR96282.1| ADP,ATP carrier protein [Chlamydia trachomatis RC-J/943]
 gb|AGR97209.1| ADP,ATP carrier protein [Chlamydia trachomatis RC-J/953]
 gb|AGR98129.1| ADP,ATP carrier protein [Chlamydia trachomatis RC-L2(s)/3]
 gb|AGR99998.1| ADP,ATP carrier protein [Chlamydia trachomatis RC-J(s)/122]
 gb|AGS00936.1| ADP,ATP carrier protein [Chlamydia trachomatis RC-J/966]
 gb|AGS02818.1| ADP,ATP carrier protein [Chlamydia trachomatis RC-J/971]
 gb|AGS03743.1| ADP,ATP carrier protein [Chlamydia trachomatis RC-L2/55]
Length=528

 Score =   111 bits (277),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 50/84 (60%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = +3

Query  495  VDVATLKKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGF  674
            + +  LKK++P+ LMFFCI FNYTILRDTKD L+VTA GS AE IPF+K W+ +P A+ F
Sbjct  19   IHMHELKKVLPMFLMFFCISFNYTILRDTKDTLIVTAPGSGAEAIPFIKLWLVVPSAVVF  78

Query  675  MILYTKLANVLSKEALFYTVILPF  746
            M++Y KL+N+L+K+ALF+ V+ PF
Sbjct  79   MLIYAKLSNILNKQALFFAVLSPF  102



>ref|WP_012727795.1| ADP,ATP carrier protein 1 [Chlamydia trachomatis]
 emb|CAX10512.1| ADP,ATP carrier protein [Chlamydia trachomatis B/Jali20/OT]
Length=528

 Score =   111 bits (277),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 50/84 (60%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = +3

Query  495  VDVATLKKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGF  674
            + +  LKK++P+ LMFFCI FNYTILRDTKD L+VTA GS AE IPF+K W+ +P A+ F
Sbjct  19   IHMHELKKVLPMFLMFFCISFNYTILRDTKDTLIVTAPGSGAEAIPFIKLWLVVPSAVVF  78

Query  675  MILYTKLANVLSKEALFYTVILPF  746
            M++Y KL+N+L+K+ALF+ V+ PF
Sbjct  79   MLIYAKLSNILNKQALFFAVLSPF  102



>ref|XP_001693815.1| plastidic ADP/ATP translocase [Chlamydomonas reinhardtii]
 gb|EDP09069.1| plastidic ADP/ATP translocase [Chlamydomonas reinhardtii]
Length=615

 Score =   112 bits (279),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 56/85 (66%), Positives = 67/85 (79%), Gaps = 1/85 (1%)
 Frame = +3

Query  492  GVDVATLKKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIG  671
            G+   T +K IPLGLMFFCILFNYT LR+TKDVLVVTA G+ AE+IPFLKT ++LPMAI 
Sbjct  32   GLPALTWQKAIPLGLMFFCILFNYTTLRNTKDVLVVTAPGAGAEVIPFLKT-LDLPMAIL  90

Query  672  FMILYTKLANVLSKEALFYTVILPF  746
            F + YT LAN L+ + LFY  +LPF
Sbjct  91   FTMTYTALANRLTSDMLFYACLLPF  115



>gb|EWM29257.1| plastidic atp adp transporter [Nannochloropsis gaditana]
Length=577

 Score =   111 bits (277),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 54/77 (70%), Positives = 63/77 (82%), Gaps = 0/77 (0%)
 Frame = +3

Query  513  KKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYTK  692
            KKI+PL LMFFC+LFNYTILRDTKDVLVVTA  S AE+IPFLKT+VNLP A+   I+Y+K
Sbjct  96   KKILPLTLMFFCMLFNYTILRDTKDVLVVTAPQSGAEVIPFLKTYVNLPAALMITIVYSK  155

Query  693  LANVLSKEALFYTVILP  743
            L NVL    +FYT+I P
Sbjct  156  LCNVLPMSKVFYTLITP  172



>emb|CBJ30232.1| plastidic ATP/ADP transporter [Ectocarpus siliculosus]
Length=608

 Score =   110 bits (276),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 53/75 (71%), Positives = 62/75 (83%), Gaps = 0/75 (0%)
 Frame = +3

Query  513  KKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYTK  692
            KKI+PLGLM F ILF+YTILRDTKDVLVVTA  S AE+IPFLKT+VNLP A+ F +LY+K
Sbjct  65   KKILPLGLMLFFILFDYTILRDTKDVLVVTAPSSGAEVIPFLKTYVNLPGAVAFTVLYSK  124

Query  693  LANVLSKEALFYTVI  737
            L N   +E +FYTVI
Sbjct  125  LCNAAEQERVFYTVI  139



>ref|WP_014517776.1| ATPase AAA [Chlamydia pneumoniae]
 gb|ACZ33326.1| ADP/ATP carrier protein family [Chlamydophila pneumoniae LPCoLN]
 gb|ETR80236.1| ADP/ATP Translocase, NTT1 [Chlamydia pneumoniae B21]
Length=526

 Score =   110 bits (274),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 51/84 (61%), Positives = 65/84 (77%), Gaps = 0/84 (0%)
 Frame = +3

Query  495  VDVATLKKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGF  674
            +    LKK++P+ LMFFCI FNYT+LRDTKD L+V A GS AE IPF+K W+ +P AI F
Sbjct  19   IHTHELKKVLPMFLMFFCITFNYTVLRDTKDTLIVGAPGSGAEAIPFIKFWLVVPCAIIF  78

Query  675  MILYTKLANVLSKEALFYTVILPF  746
            M++Y KL+N+LSK+ALFY V  PF
Sbjct  79   MLIYAKLSNILSKQALFYAVGTPF  102



>ref|WP_010895317.1| ATPase AAA [Chlamydia pneumoniae]
 dbj|BAA98559.1| ADP/ATP translocase [Chlamydophila pneumoniae J138]
Length=515

 Score =   109 bits (273),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 51/84 (61%), Positives = 65/84 (77%), Gaps = 0/84 (0%)
 Frame = +3

Query  495  VDVATLKKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGF  674
            +    LKK++P+ LMFFCI FNYT+LRDTKD L+V A GS AE IPF+K W+ +P AI F
Sbjct  19   IHTHELKKVLPMFLMFFCITFNYTVLRDTKDTLIVGAPGSGAEAIPFIKFWLVVPCAIIF  78

Query  675  MILYTKLANVLSKEALFYTVILPF  746
            M++Y KL+N+LSK+ALFY V  PF
Sbjct  79   MLIYAKLSNILSKQALFYAVGTPF  102



>ref|WP_010882994.1| ADP,ATP carrier protein 1 [Chlamydia pneumoniae]
 ref|NP_224551.1| ADP/ATP translocase [Chlamydophila pneumoniae CWL029]
 sp|Q9Z8J2.1|TLC1_CHLPN RecName: Full=ADP,ATP carrier protein 1; AltName: Full=ADP/ATP 
translocase 1 [Chlamydia pneumoniae]
 gb|AAD18495.1| ADP/ATP Translocase [Chlamydophila pneumoniae CWL029]
 gb|AAF38252.1| ADP, ATP carrier protein [Chlamydophila pneumoniae AR39]
 gb|AAP98290.1| ATP/ADP-transporter [Chlamydophila pneumoniae TW-183]
Length=515

 Score =   109 bits (273),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 51/84 (61%), Positives = 65/84 (77%), Gaps = 0/84 (0%)
 Frame = +3

Query  495  VDVATLKKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGF  674
            +    LKK++P+ LMFFCI FNYT+LRDTKD L+V A GS AE IPF+K W+ +P AI F
Sbjct  19   IHTHELKKVLPMFLMFFCITFNYTVLRDTKDTLIVGAPGSGAEAIPFIKFWLVVPCAIIF  78

Query  675  MILYTKLANVLSKEALFYTVILPF  746
            M++Y KL+N+LSK+ALFY V  PF
Sbjct  79   MLIYAKLSNILSKQALFYAVGTPF  102



>ref|WP_013942850.1| ATPase AAA [Simkania negevensis]
 emb|CCB88383.1| ADP,ATP carrier protein 1 [Simkania negevensis Z]
Length=528

 Score =   109 bits (272),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 52/79 (66%), Positives = 63/79 (80%), Gaps = 0/79 (0%)
 Frame = +3

Query  510  LKKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYT  689
            LKK++P+ L+FF ILFNYT+LRDTKD LVVTA G  AE+IPFLK W  LP A+ FM++Y 
Sbjct  23   LKKLVPMVLLFFLILFNYTVLRDTKDTLVVTAPGGGAEVIPFLKFWAVLPCAVIFMLIYA  82

Query  690  KLANVLSKEALFYTVILPF  746
            KL+N LSK  LFYT +LPF
Sbjct  83   KLSNKLSKPQLFYTAVLPF  101



>ref|XP_009037704.1| hypothetical protein AURANDRAFT_27252 [Aureococcus anophagefferens]
 gb|EGB07715.1| hypothetical protein AURANDRAFT_27252 [Aureococcus anophagefferens]
Length=558

 Score =   109 bits (272),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 55/85 (65%), Positives = 65/85 (76%), Gaps = 0/85 (0%)
 Frame = +3

Query  492  GVDVATLKKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIG  671
            G+    +KK++PL ++FFCILFNYTILRDTKDVLVVTA  S AEIIPFLKT+VNLP AI 
Sbjct  76   GLKSPEVKKVVPLAIIFFCILFNYTILRDTKDVLVVTAPKSGAEIIPFLKTYVNLPGAIA  135

Query  672  FMILYTKLANVLSKEALFYTVILPF  746
            F ILY+ L+N  S+  LF  VI  F
Sbjct  136  FTILYSSLSNRFSQPQLFRGVIGTF  160



>ref|XP_002292665.1| predicted protein [Thalassiosira pseudonana CCMP1335]
 gb|EED89861.1| predicted protein [Thalassiosira pseudonana CCMP1335]
Length=566

 Score =   108 bits (270),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 57/104 (55%), Positives = 76/104 (73%), Gaps = 8/104 (8%)
 Frame = +3

Query  456  GGEAASESPK--FMGVDVATL------KKIIPLGLMFFCILFNYTILRDTKDVLVVTAKG  611
            GGEAA+  PK  F+    +++      KK++PL +MFF ILFNYTILRDTKDVL+VTAK 
Sbjct  60   GGEAAALPPKKGFLEKIKSSMPPAKERKKLVPLAMMFFFILFNYTILRDTKDVLMVTAKK  119

Query  612  SSAEIIPFLKTWVNLPMAIGFMILYTKLANVLSKEALFYTVILP  743
            S AE+IPF+KT+VNLP AIGF  LY+KL + + ++ +FY   +P
Sbjct  120  SGAEVIPFIKTYVNLPAAIGFTALYSKLCDKMEQKDVFYACTVP  163



>ref|WP_042102387.1| ATPase AAA [Parachlamydiaceae bacterium HS-T3]
Length=512

 Score =   107 bits (267),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 53/79 (67%), Positives = 62/79 (78%), Gaps = 2/79 (3%)
 Frame = +3

Query  510  LKKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYT  689
            LKK++P+ LMFFCI FNYTILRDTKD LVVTA G  AE IPFLK W  +P AI FM++Y 
Sbjct  23   LKKLLPMFLMFFCISFNYTILRDTKDTLVVTASG--AETIPFLKVWGVVPAAIIFMLIYA  80

Query  690  KLANVLSKEALFYTVILPF  746
            K++N+LSKE LFY  I PF
Sbjct  81   KMSNILSKENLFYATIAPF  99



>ref|WP_006340593.1| ATPase AAA [Parachlamydia acanthamoebae]
 gb|AAQ06407.1| ADP-ATP translocase [Parachlamydia acanthamoebae str. Hall's 
coccus]
 gb|EFB42215.1| ADP/ATP translocase [Parachlamydia acanthamoebae str. Hall's 
coccus]
 emb|CCB85168.1| ADP,ATP carrier protein 1 [Parachlamydia acanthamoebae UV-7]
 gb|KIA76370.1| ADP,ATP carrier protein 1 [Parachlamydia acanthamoebae]
Length=517

 Score =   106 bits (265),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 54/87 (62%), Positives = 64/87 (74%), Gaps = 2/87 (2%)
 Frame = +3

Query  486  FMGVDVATLKKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMA  665
            F  V    L+K++P+ LMFFCI FNYTILRDTKD L+VT+ G  AE IPFLK W  +P A
Sbjct  16   FWPVHNYELRKLLPMFLMFFCISFNYTILRDTKDTLIVTSSG--AEAIPFLKVWGVVPAA  73

Query  666  IGFMILYTKLANVLSKEALFYTVILPF  746
            I FM+LY KL+N+LSKE LFY  I PF
Sbjct  74   IIFMLLYAKLSNILSKEKLFYVTITPF  100



>ref|WP_042239794.1| ATPase AAA [Neochlamydia sp. S13]
Length=517

 Score =   106 bits (264),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 68/96 (71%), Gaps = 2/96 (2%)
 Frame = +3

Query  456  GGEAASESPKFMGVDVATLKKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPF  635
            G E +     F  V    LKK++P+ LMFF I FNYTILRDTKD L+VTA G  AE +PF
Sbjct  6    GQEFSKARSFFWPVHNYELKKLLPMFLMFFFISFNYTILRDTKDTLIVTASG--AETLPF  63

Query  636  LKTWVNLPMAIGFMILYTKLANVLSKEALFYTVILP  743
            LK W  +P AI FM+LY KL+N+LSKEALFYTV+ P
Sbjct  64   LKVWGVVPGAIIFMLLYAKLSNILSKEALFYTVLAP  99



>ref|WP_039386022.1| ATPase AAA [Neochlamydia sp. TUME1]
 gb|KIC74410.1| ADP,ATP carrier protein 1 [Neochlamydia sp. TUME1]
Length=517

 Score =   106 bits (264),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 68/96 (71%), Gaps = 2/96 (2%)
 Frame = +3

Query  456  GGEAASESPKFMGVDVATLKKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPF  635
            G E +     F  V    LKK++P+ LMFF I FNYTILRDTKD L+VTA G  AE +PF
Sbjct  6    GQEFSKARSFFWPVHNYELKKLLPMFLMFFFISFNYTILRDTKDTLIVTASG--AETLPF  63

Query  636  LKTWVNLPMAIGFMILYTKLANVLSKEALFYTVILP  743
            LK W  +P AI FM+LY KL+N+LSKEALFYTV+ P
Sbjct  64   LKVWGVVPGAIIFMLLYAKLSNILSKEALFYTVLAP  99



>ref|WP_044881792.1| ATPase AAA [Neochlamydia sp. EPS4]
 gb|KIC75182.1| ADP,ATP carrier protein 1 [Neochlamydia sp. EPS4]
Length=517

 Score =   106 bits (264),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 68/96 (71%), Gaps = 2/96 (2%)
 Frame = +3

Query  456  GGEAASESPKFMGVDVATLKKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPF  635
            G E +     F  V    LKK++P+ LMFF I FNYTILRDTKD L+VTA G  AE +PF
Sbjct  6    GQEFSKARSFFWPVHNYELKKLLPMFLMFFFISFNYTILRDTKDTLIVTASG--AETLPF  63

Query  636  LKTWVNLPMAIGFMILYTKLANVLSKEALFYTVILP  743
            LK W  +P AI FM+LY KL+N+LSKEALFYTV+ P
Sbjct  64   LKVWGVVPGAIIFMLLYAKLSNILSKEALFYTVLAP  99



>gb|ABV25596.1| plastid ATP/ADP translocase, partial [Pyropia yezoensis]
Length=536

 Score =   105 bits (263),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 63/78 (81%), Gaps = 2/78 (3%)
 Frame = +3

Query  513  KKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYTK  692
            KK+ PL LMFF ILFNYTILRDTKDVLVVTA G  AE+IPFLKT+ NLP A+ F +LY+K
Sbjct  37   KKLGPLALMFFVILFNYTILRDTKDVLVVTAAG--AEVIPFLKTYCNLPGAVLFTVLYSK  94

Query  693  LANVLSKEALFYTVILPF  746
            L N L++E +FY  I+PF
Sbjct  95   LNNSLTREQVFYVCIIPF  112



>ref|WP_041941596.1| ATPase AAA [Waddlia chondrophila]
Length=515

 Score =   105 bits (262),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 53/87 (61%), Positives = 63/87 (72%), Gaps = 2/87 (2%)
 Frame = +3

Query  486  FMGVDVATLKKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMA  665
            F  V    LKK++P+ LMFFCI FNYTILRDTKD L+VT+ G  AE IPFLK W  +P A
Sbjct  16   FWPVHSYELKKLLPMFLMFFCISFNYTILRDTKDTLIVTSSG--AETIPFLKVWGVVPSA  73

Query  666  IGFMILYTKLANVLSKEALFYTVILPF  746
            + FM++Y KL+N LSK ALFY  I PF
Sbjct  74   VVFMLIYAKLSNTLSKSALFYVTITPF  100



>gb|EYE60388.1| ADP,ATP carrier protein 2 [Bacteroides fragilis str. S6L5]
Length=506

 Score =   105 bits (262),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/71 (68%), Positives = 59/71 (83%), Gaps = 0/71 (0%)
 Frame = +3

Query  534  LMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYTKLANVLSK  713
            LMFFCI FNYTILRDTKD L+VTA GS AE IPF+K W+ +P A+ FM++Y KL+N+L+K
Sbjct  3    LMFFCIAFNYTILRDTKDTLIVTAPGSGAEAIPFIKLWLVVPCAVVFMLIYAKLSNILNK  62

Query  714  EALFYTVILPF  746
            +ALFY VI PF
Sbjct  63   QALFYAVISPF  73



>gb|EJK46221.1| hypothetical protein THAOC_35120 [Thalassiosira oceanica]
Length=561

 Score =   105 bits (263),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 50/78 (64%), Positives = 63/78 (81%), Gaps = 0/78 (0%)
 Frame = +3

Query  513  KKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYTK  692
            KKI  L +MFF ILFNYTILRDTKDVL+VTAKGS AE+IPF+KT+VNLP AIGF  +Y+K
Sbjct  82   KKIGSLAMMFFFILFNYTILRDTKDVLMVTAKGSGAEVIPFIKTYVNLPAAIGFTAVYSK  141

Query  693  LANVLSKEALFYTVILPF  746
            L + + ++ +FY   +PF
Sbjct  142  LCDRMEQKDVFYACTIPF  159



>gb|EPJ16785.1| ADP,ATP carrier protein [Chlamydia psittaci 02DC22]
Length=500

 Score =   105 bits (262),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/70 (69%), Positives = 58/70 (83%), Gaps = 0/70 (0%)
 Frame = +3

Query  537  MFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYTKLANVLSKE  716
            MFFCI FNYT+LRDTKD L+VTA GS AE IPF+K W+ +P A+ FM++Y KL+N+LSK 
Sbjct  1    MFFCIAFNYTVLRDTKDTLIVTAPGSGAEAIPFIKLWLVVPCAVVFMLIYAKLSNILSKP  60

Query  717  ALFYTVILPF  746
            ALFYTVI PF
Sbjct  61   ALFYTVIAPF  70



>gb|ADI39022.1| ADP/ATP translocase [Waddlia chondrophila WSU 86-1044]
Length=502

 Score =   105 bits (262),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 53/87 (61%), Positives = 63/87 (72%), Gaps = 2/87 (2%)
 Frame = +3

Query  486  FMGVDVATLKKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMA  665
            F  V    LKK++P+ LMFFCI FNYTILRDTKD L+VT+ G  AE IPFLK W  +P A
Sbjct  3    FWPVHSYELKKLLPMFLMFFCISFNYTILRDTKDTLIVTSSG--AETIPFLKVWGVVPSA  60

Query  666  IGFMILYTKLANVLSKEALFYTVILPF  746
            + FM++Y KL+N LSK ALFY  I PF
Sbjct  61   VVFMLIYAKLSNTLSKSALFYVTITPF  87



>gb|EEE56534.1| hypothetical protein OsJ_05838 [Oryza sativa Japonica Group]
Length=592

 Score =   105 bits (263),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 51/54 (94%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +3

Query  585  DVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYTKLANVLSKEALFYTVILPF  746
            DVLVVTAKGSSAEIIPFLKTWVNLPMAIGFM+LYTKLA+VLSKEALFYTVI PF
Sbjct  85   DVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMLLYTKLADVLSKEALFYTVIFPF  138



>ref|XP_002184271.1| nucleotide transporter 1 [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC44449.1| nucleotide transporter 1 [Phaeodactylum tricornutum CCAP 1055/1]
Length=610

 Score =   104 bits (260),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 46/77 (60%), Positives = 62/77 (81%), Gaps = 0/77 (0%)
 Frame = +3

Query  513  KKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYTK  692
            +K++PL LMFFCILFNYTILRDTKDVL+VTA  S AE+IPF+KT+ NLP+AIGF  +Y K
Sbjct  133  QKLVPLALMFFCILFNYTILRDTKDVLMVTAPKSGAEVIPFIKTYCNLPVAIGFTGVYAK  192

Query  693  LANVLSKEALFYTVILP  743
            + + +  + +FY  ++P
Sbjct  193  MTDSMELKNVFYACVIP  209



>gb|KEI72701.1| ATPase AAA [Endozoicomonas elysicola]
Length=502

 Score =   103 bits (258),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 50/76 (66%), Positives = 59/76 (78%), Gaps = 0/76 (0%)
 Frame = +3

Query  510  LKKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYT  689
            LKK+IP+ LMF+ +LF YTILRDTKD LV+T  GS AEIIPFLK WVN+P AI F I Y 
Sbjct  22   LKKVIPMILMFYLVLFVYTILRDTKDTLVITGHGSGAEIIPFLKLWVNVPFAILFTISYA  81

Query  690  KLANVLSKEALFYTVI  737
            KL+NVL +  LFY +I
Sbjct  82   KLSNVLRRNMLFYFII  97



>ref|WP_033402749.1| ATPase AAA, partial [Endozoicomonas elysicola]
Length=484

 Score =   103 bits (257),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 50/76 (66%), Positives = 59/76 (78%), Gaps = 0/76 (0%)
 Frame = +3

Query  510  LKKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYT  689
            LKK+IP+ LMF+ +LF YTILRDTKD LV+T  GS AEIIPFLK WVN+P AI F I Y 
Sbjct  22   LKKVIPMILMFYLVLFVYTILRDTKDTLVITGHGSGAEIIPFLKLWVNVPFAILFTISYA  81

Query  690  KLANVLSKEALFYTVI  737
            KL+NVL +  LFY +I
Sbjct  82   KLSNVLRRNMLFYFII  97



>ref|WP_010299901.1| ATPase AAA [Candidatus Odyssella thessalonicensis]
Length=519

 Score =   103 bits (256),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 52/100 (52%), Positives = 67/100 (67%), Gaps = 7/100 (7%)
 Frame = +3

Query  468  ASESPKFMG-------VDVATLKKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEI  626
            A + P+F G       +    +KK +P+GLM FCILFNYT+LRDTKD LVV A GS AE 
Sbjct  7    AVKQPEFTGLRAILWPIHNYEIKKFLPMGLMMFCILFNYTVLRDTKDALVVNAPGSGAEA  66

Query  627  IPFLKTWVNLPMAIGFMILYTKLANVLSKEALFYTVILPF  746
            + F+K +   P AI FMI Y KL+NVLS++ LFY  ++PF
Sbjct  67   LAFIKLFGTTPAAILFMIAYAKLSNVLSRQGLFYAALIPF  106



>ref|WP_038465856.1| ATPase AAA [Candidatus Paracaedibacter acanthamoebae]
 gb|AIK96967.1| ATPase AAA [Candidatus Paracaedibacter acanthamoebae]
Length=517

 Score =   102 bits (253),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 51/100 (51%), Positives = 67/100 (67%), Gaps = 7/100 (7%)
 Frame = +3

Query  468  ASESPKFMG-------VDVATLKKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEI  626
            A + P+F G       +    +KK +P+GLM FCILFNYT+LRDTKD LVV A GS AE 
Sbjct  7    AVKKPEFTGLRAILWPIHNYEIKKFLPMGLMMFCILFNYTVLRDTKDALVVNAPGSGAEA  66

Query  627  IPFLKTWVNLPMAIGFMILYTKLANVLSKEALFYTVILPF  746
            + F+K +   P AI FMI Y K++NVLS++ LFY  ++PF
Sbjct  67   LAFIKLFGTTPAAILFMIAYAKMSNVLSRQGLFYAALIPF  106



>ref|WP_032124907.1| ATPase AAA [Chlamydia sp. 'Diamant']
Length=512

 Score =   102 bits (253),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 51/79 (65%), Positives = 63/79 (80%), Gaps = 2/79 (3%)
 Frame = +3

Query  510  LKKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYT  689
            LKK++P+  MFFCI FNYTILRDTKD L+VTA G  AE IPFLK++  +P AI FMI+Y 
Sbjct  24   LKKLLPMFFMFFCISFNYTILRDTKDSLIVTAAG--AEAIPFLKSFGVVPAAILFMIIYA  81

Query  690  KLANVLSKEALFYTVILPF  746
            KL+N+LS+E LFY  +LPF
Sbjct  82   KLSNMLSRENLFYVTLLPF  100



>gb|ABG37645.1| plastid ATP/ADP-transporter [Populus trichocarpa]
Length=774

 Score =   102 bits (255),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 55/76 (72%), Positives = 64/76 (84%), Gaps = 2/76 (3%)
 Frame = +3

Query  396  RCFPVCRAEAAAAEDGQPLLGGEAASESPKFMGVDVATLKKIIPLGLMFFCILFNYTILR  575
            R   +CRAEAAAA DGQPL G E  ++ PKF+G+++AT KKIIPLGLMFFCILFNYTILR
Sbjct  285  RNLHICRAEAAAAADGQPLFGEE--TDKPKFLGIELATFKKIIPLGLMFFCILFNYTILR  342

Query  576  DTKDVLVVTAKGSSAE  623
            DTKDVLVVTAK + A+
Sbjct  343  DTKDVLVVTAKEAFAD  358



>emb|CAX16540.1| putative ATP/ADP translocase [Odontella sinensis]
Length=470

 Score =   100 bits (249),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 59/72 (82%), Gaps = 0/72 (0%)
 Frame = +3

Query  531  GLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYTKLANVLS  710
            GLMFFCILF+YTILRDTKDVL++TA  S AE+IPF+KT+VNLP AIGF  +Y+KL + L 
Sbjct  1    GLMFFCILFSYTILRDTKDVLMITAPKSGAEVIPFIKTYVNLPTAIGFTAVYSKLCDKLD  60

Query  711  KEALFYTVILPF  746
            ++ +FY   +PF
Sbjct  61   QKNVFYACTVPF  72



>ref|WP_032112829.1| ATPase AAA [Candidatus Paracaedibacter symbiosus]
Length=517

 Score =   100 bits (249),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 47/78 (60%), Positives = 60/78 (77%), Gaps = 0/78 (0%)
 Frame = +3

Query  510  LKKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYT  689
            +KK +P+GLM FCILFNYT+LRDTKD +VV A GS AE + F+K +   P AI FMILY 
Sbjct  28   IKKFLPMGLMMFCILFNYTVLRDTKDSIVVNAPGSGAEALAFIKLYGTTPAAILFMILYA  87

Query  690  KLANVLSKEALFYTVILP  743
            KL+NVLS++ LFY  ++P
Sbjct  88   KLSNVLSRQGLFYAALVP  105



>ref|XP_005769576.1| hypothetical protein EMIHUDRAFT_244401 [Emiliania huxleyi CCMP1516]
 gb|EOD17147.1| hypothetical protein EMIHUDRAFT_244401 [Emiliania huxleyi CCMP1516]
Length=229

 Score = 95.9 bits (237),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 53/95 (56%), Positives = 63/95 (66%), Gaps = 14/95 (15%)
 Frame = +3

Query  504  ATLKKIIPLGLMFFCILFNYTILRDTK--------------DVLVVTAKGSSAEIIPFLK  641
            A LKK+ PLG MFF ILF YTILRDTK              DVLVVTA GS AEIIPFLK
Sbjct  25   AELKKVTPLGAMFFFILFAYTILRDTKAGLSLPLLRLFPAADVLVVTAPGSGAEIIPFLK  84

Query  642  TWVNLPMAIGFMILYTKLANVLSKEALFYTVILPF  746
            T+VNLP AIGF + Y+ L+N  S++ +F  ++  F
Sbjct  85   TYVNLPGAIGFTVFYSWLSNKFSQQQVFTGLVSTF  119



>ref|WP_032124897.1| ATPase AAA [Chlamydia sp. 'Diamant']
Length=509

 Score = 96.7 bits (239),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 59/76 (78%), Gaps = 0/76 (0%)
 Frame = +3

Query  510  LKKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYT  689
            +KK++P+ LM F I FNY+ILR+ KD +VVTAK S AE+IPF+K WV LPMA+ F +L+T
Sbjct  23   VKKVLPMMLMLFLICFNYSILRNIKDAVVVTAKSSGAEVIPFIKVWVLLPMAVFFTLLFT  82

Query  690  KLANVLSKEALFYTVI  737
            KL+N  S+E +FY  I
Sbjct  83   KLSNRYSQERVFYITI  98



>ref|XP_005781450.1| hypothetical protein EMIHUDRAFT_234229 [Emiliania huxleyi CCMP1516]
 gb|EOD29021.1| hypothetical protein EMIHUDRAFT_234229 [Emiliania huxleyi CCMP1516]
Length=254

 Score = 94.0 bits (232),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 52/79 (66%), Positives = 56/79 (71%), Gaps = 9/79 (11%)
 Frame = +3

Query  510  LKKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYT  689
            L+KI+PL +MFFCILFNYTILRDTKDVLV  A GSSAE IPFLKTWVNLP A        
Sbjct  82   LRKIVPLAIMFFCILFNYTILRDTKDVLV--APGSSAEAIPFLKTWVNLPGA-------G  132

Query  690  KLANVLSKEALFYTVILPF  746
             L    S  ALFYTV+  F
Sbjct  133  TLTQQHSLGALFYTVLSTF  151



>ref|WP_011174791.1| ATPase AAA [Candidatus Protochlamydia amoebophila]
 emb|CAF22965.1| probable ADP/ATP translocase [Candidatus Protochlamydia amoebophila 
UWE25]
Length=516

 Score = 96.3 bits (238),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 60/79 (76%), Gaps = 0/79 (0%)
 Frame = +3

Query  510  LKKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYT  689
            +KK++P+ LM F I FNY+ILR+ KD +VVTAK S AE+IPF+K WV LP A+ F +++T
Sbjct  23   VKKVLPMMLMLFLICFNYSILRNVKDAIVVTAKASGAEVIPFIKVWVLLPTAVLFTLIFT  82

Query  690  KLANVLSKEALFYTVILPF  746
            KL+N  S+E +FY VI  F
Sbjct  83   KLSNRFSQEKVFYIVISTF  101



>ref|XP_005769878.1| hypothetical protein EMIHUDRAFT_451418 [Emiliania huxleyi CCMP1516]
 gb|EOD17449.1| hypothetical protein EMIHUDRAFT_451418 [Emiliania huxleyi CCMP1516]
Length=513

 Score = 95.9 bits (237),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 53/95 (56%), Positives = 63/95 (66%), Gaps = 14/95 (15%)
 Frame = +3

Query  504  ATLKKIIPLGLMFFCILFNYTILRDTK--------------DVLVVTAKGSSAEIIPFLK  641
            A LKK+ PLG MFF ILF YTILRDTK              DVLVVTA GS AEIIPFLK
Sbjct  25   AELKKVTPLGAMFFFILFAYTILRDTKAGLSLPLLRLFPAADVLVVTAPGSGAEIIPFLK  84

Query  642  TWVNLPMAIGFMILYTKLANVLSKEALFYTVILPF  746
            T+VNLP AIGF + Y+ L+N  S++ +F  ++  F
Sbjct  85   TYVNLPGAIGFTVFYSWLSNKFSQQQVFTGLVSTF  119



>ref|WP_042280889.1| ATPase AAA [Candidatus Protochlamydia sp. R18]
Length=516

 Score = 95.9 bits (237),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 60/79 (76%), Gaps = 0/79 (0%)
 Frame = +3

Query  510  LKKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYT  689
            +KK++P+ LM F I FNY+ILR+ KD +VVTAK S AE+IPF+K WV LP A+ F +++T
Sbjct  23   VKKVLPMMLMLFLICFNYSILRNVKDAVVVTAKASGAEVIPFIKVWVLLPTAVLFTLIFT  82

Query  690  KLANVLSKEALFYTVILPF  746
            KL+N  S+E +FY VI  F
Sbjct  83   KLSNRFSQEKVFYIVISTF  101



>ref|WP_039356292.1| ATPase AAA [Candidatus Protochlamydia amoebophila]
Length=516

 Score = 95.9 bits (237),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 60/79 (76%), Gaps = 0/79 (0%)
 Frame = +3

Query  510  LKKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYT  689
            +KK++P+ LM F I FNY+ILR+ KD +VVTAK S AE+IPF+K WV LP A+ F +++T
Sbjct  23   VKKVLPMMLMLFLICFNYSILRNVKDAVVVTAKASGAEVIPFIKVWVLLPTAVLFTLIFT  82

Query  690  KLANVLSKEALFYTVILPF  746
            KL+N  S+E +FY VI  F
Sbjct  83   KLSNRFSQEKVFYIVISTF  101



>gb|KIC73929.1| ADP,ATP carrier protein 1 [Candidatus Protochlamydia amoebophila]
Length=530

 Score = 95.9 bits (237),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 60/79 (76%), Gaps = 0/79 (0%)
 Frame = +3

Query  510  LKKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYT  689
            +KK++P+ LM F I FNY+ILR+ KD +VVTAK S AE+IPF+K WV LP A+ F +++T
Sbjct  37   VKKVLPMMLMLFLICFNYSILRNVKDAVVVTAKASGAEVIPFIKVWVLLPTAVLFTLIFT  96

Query  690  KLANVLSKEALFYTVILPF  746
            KL+N  S+E +FY VI  F
Sbjct  97   KLSNRFSQEKVFYIVISTF  115



>ref|WP_018576123.1| hypothetical protein [Legionella shakespearei]
Length=529

 Score = 95.5 bits (236),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 61/79 (77%), Gaps = 0/79 (0%)
 Frame = +3

Query  510  LKKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYT  689
            LKK +P+GLM F ILFNYTILRDTKD LV+TA  + + +IPFLK    LP +I F++LY 
Sbjct  26   LKKFLPMGLMMFFILFNYTILRDTKDSLVITASINGSAVIPFLKIGFVLPASILFVLLYA  85

Query  690  KLANVLSKEALFYTVILPF  746
            KL+N++S+E LFYT++  F
Sbjct  86   KLSNIMSREKLFYTLVSSF  104



>gb|EKE09230.1| hypothetical protein ACD_16C00205G0026 [uncultured bacterium]
Length=511

 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 49/79 (62%), Positives = 59/79 (75%), Gaps = 2/79 (3%)
 Frame = +3

Query  510  LKKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYT  689
            +KK +P+GLM F ILF YTILRDTKD LVV A G  AE I F+K W   P +I F+ILY 
Sbjct  28   MKKFLPMGLMMFFILFIYTILRDTKDTLVVGASG--AEAISFVKFWGVTPASILFVILYA  85

Query  690  KLANVLSKEALFYTVILPF  746
            KL+N+LS+E LFYT I+PF
Sbjct  86   KLSNILSRENLFYTCIIPF  104



>gb|EPP28995.1| ADP,ATP carrier protein, partial [Chlamydia psittaci 84-8471/1]
Length=83

 Score = 87.4 bits (215),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 51/64 (80%), Gaps = 0/64 (0%)
 Frame = +3

Query  495  VDVATLKKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGF  674
            + +  LKK++P+ LMFFCI FNYT+LRDTKD L+VTA GS AE IPF+K W+ +P A+ F
Sbjct  19   IHMHELKKVLPMFLMFFCIAFNYTVLRDTKDTLIVTAPGSGAEAIPFIKLWLVVPCAVVF  78

Query  675  MILY  686
            M++Y
Sbjct  79   MLIY  82



>ref|XP_005763298.1| hypothetical protein EMIHUDRAFT_465146 [Emiliania huxleyi CCMP1516]
 gb|EOD10869.1| hypothetical protein EMIHUDRAFT_465146 [Emiliania huxleyi CCMP1516]
Length=823

 Score = 94.7 bits (234),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 52/79 (66%), Positives = 56/79 (71%), Gaps = 9/79 (11%)
 Frame = +3

Query  510  LKKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYT  689
            L+KI+PL +MFFCILFNYTILRDTKDVLV  A GSSAE IPFLKTWVNLP A        
Sbjct  82   LRKIVPLAIMFFCILFNYTILRDTKDVLV--APGSSAEAIPFLKTWVNLPGA-------G  132

Query  690  KLANVLSKEALFYTVILPF  746
             L    S  ALFYTV+  F
Sbjct  133  TLTQQHSLGALFYTVLSTF  151



>gb|AIL13243.1| ATPase AAA [Candidatus Caedibacter acanthamoebae]
Length=508

 Score = 93.2 bits (230),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 43/79 (54%), Positives = 62/79 (78%), Gaps = 0/79 (0%)
 Frame = +3

Query  510  LKKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYT  689
            LKK +P+G++ F ILFNYTILRD KDVL++TA  S A ++ FLK W  +P AI F++LYT
Sbjct  28   LKKFLPMGMIMFFILFNYTILRDVKDVLIMTAPNSGAGVLSFLKGWGVMPSAILFVLLYT  87

Query  690  KLANVLSKEALFYTVILPF  746
            KL+N++++E LFY +++ F
Sbjct  88   KLSNIVNRERLFYGIVVVF  106



>ref|WP_041017341.1| hypothetical protein [Criblamydia sequanensis]
 emb|CDR33792.1| ADP/ATP translocase [Criblamydia sequanensis CRIB-18]
Length=515

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 62/96 (65%), Gaps = 0/96 (0%)
 Frame = +3

Query  459  GEAASESPKFMGVDVATLKKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFL  638
            GE ++    F  +    +KK +P+ LM   ILFNYTILR+ KD LVV AKGS   II FL
Sbjct  8    GEFSTLRAIFFPIYRHEIKKFLPMALMMLFILFNYTILRNVKDSLVVNAKGSDEGIISFL  67

Query  639  KTWVNLPMAIGFMILYTKLANVLSKEALFYTVILPF  746
            K +   P AI FM++Y+K+AN+ S+E +FY  I PF
Sbjct  68   KLYGTTPSAIIFMLIYSKMANIFSREKIFYLCITPF  103



>emb|CAE46503.1| nucleotide transport protein, partial [Candidatus Paracaedibacter 
symbiosus]
Length=423

 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 43/71 (61%), Positives = 53/71 (75%), Gaps = 0/71 (0%)
 Frame = +3

Query  510  LKKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYT  689
            +KK +P+GLM FCILFNYT+LRDTKD +V  A GS AE + F+K +   P AI FMILY 
Sbjct  20   IKKFLPMGLMMFCILFNYTVLRDTKDSIVANAPGSGAEALAFIKLYGTTPAAILFMILYA  79

Query  690  KLANVLSKEAL  722
            KL+NVLS  A+
Sbjct  80   KLSNVLSARAI  90



>ref|WP_013182747.1| ATPase AAA [Waddlia chondrophila]
 gb|ADI39043.1| putative ADP/ATP translocase [Waddlia chondrophila WSU 86-1044]
Length=531

 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/79 (52%), Positives = 57/79 (72%), Gaps = 0/79 (0%)
 Frame = +3

Query  510  LKKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYT  689
            ++K+IP+ LMFF I FNY +LR  KD LVVTAK S AE+IPF+K WV  P A+   +L+T
Sbjct  26   MQKLIPMLLMFFLIAFNYNVLRTMKDTLVVTAKSSGAEVIPFIKVWVMFPGAVLMTLLFT  85

Query  690  KLANVLSKEALFYTVILPF  746
            +L N L++E +FY ++  F
Sbjct  86   RLTNRLTRERVFYVMMSIF  104



>gb|AAT99359.1| chloroplast ATP/ADP transporter protein [Helianthus tuberosus]
Length=487

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/47 (89%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = +3

Query  603  AKGSSAEIIPFLKTWVNLPMAIGFMILYTKLANVLSKEALFYTVILP  743
            +K SSAEIIPFLKTWVNLPMAIGFM+LYTKL+NVLSK+ALFYTVILP
Sbjct  10   SKRSSAEIIPFLKTWVNLPMAIGFMVLYTKLSNVLSKKALFYTVILP  56



>ref|WP_013181317.1| ADP/ATP translocase [Waddlia chondrophila]
 gb|ADI37589.1| ADP/ATP translocase [Waddlia chondrophila WSU 86-1044]
 emb|CCB91062.1| ADP,ATP carrier protein 1 [Waddlia chondrophila 2032/99]
Length=520

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 57/87 (66%), Gaps = 0/87 (0%)
 Frame = +3

Query  486  FMGVDVATLKKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMA  665
            F  V +  LK   P+ LM   IL NYT+LR+ KD LVV AKGS AEII FLK W  +P A
Sbjct  17   FFPVHLHELKFFAPMALMMLFILCNYTVLRNIKDTLVVNAKGSDAEIISFLKLWGTMPAA  76

Query  666  IGFMILYTKLANVLSKEALFYTVILPF  746
              FM+ Y+K+ ++LS+E +FY  + PF
Sbjct  77   FLFMLFYSKITDLLSRERIFYLCLAPF  103



>emb|CCB92155.1| ADP,ATP carrier protein 1 [Waddlia chondrophila 2032/99]
Length=540

 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/79 (52%), Positives = 57/79 (72%), Gaps = 0/79 (0%)
 Frame = +3

Query  510  LKKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYT  689
            ++K+IP+ LMFF I FNY +LR  KD LVVTAK S AE+IPF+K WV  P A+   +L+T
Sbjct  35   MQKLIPMLLMFFLIAFNYNVLRTMKDTLVVTAKSSGAEVIPFIKVWVMFPGAVLMTLLFT  94

Query  690  KLANVLSKEALFYTVILPF  746
            +L N L++E +FY ++  F
Sbjct  95   RLTNRLTRERVFYVMMSIF  113



>ref|WP_044881209.1| ATPase AAA [Neochlamydia sp. EPS4]
 gb|KIC76344.1| ADP,ATP carrier protein 1 [Neochlamydia sp. EPS4]
Length=532

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/102 (44%), Positives = 64/102 (63%), Gaps = 7/102 (7%)
 Frame = +3

Query  453  LGGEAASESPKFMG-------VDVATLKKIIPLGLMFFCILFNYTILRDTKDVLVVTAKG  611
            + G  A + P+F         V    L+K++P+ L+FF I F+Y ILR  KD +VVTAK 
Sbjct  1    MSGSNAVDEPEFSKWRSYLWPVHNYELRKLVPMLLIFFLITFDYNILRTLKDTVVVTAKS  60

Query  612  SSAEIIPFLKTWVNLPMAIGFMILYTKLANVLSKEALFYTVI  737
            S AE+IPF+K WV  P AI   IL+T+L++  S+E +FY +I
Sbjct  61   SGAEVIPFIKVWVMFPSAILMTILFTRLSSCFSRENVFYIMI  102



>ref|WP_039383351.1| ATPase AAA [Neochlamydia sp. TUME1]
 gb|KIC77102.1| ADP,ATP carrier protein 1 [Neochlamydia sp. TUME1]
Length=532

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/102 (44%), Positives = 64/102 (63%), Gaps = 7/102 (7%)
 Frame = +3

Query  453  LGGEAASESPKFMG-------VDVATLKKIIPLGLMFFCILFNYTILRDTKDVLVVTAKG  611
            + G  A + P+F         V    L+K++P+ L+FF I F+Y ILR  KD +VVTAK 
Sbjct  1    MSGSNAVDEPEFSKWRSYLWPVHNYELRKLVPMLLIFFLITFDYNILRTLKDTVVVTAKS  60

Query  612  SSAEIIPFLKTWVNLPMAIGFMILYTKLANVLSKEALFYTVI  737
            S AE+IPF+K WV  P AI   IL+T+L++  S+E +FY +I
Sbjct  61   SGAEVIPFIKVWVMFPSAILMTILFTRLSSCFSRENVFYIMI  102



>ref|WP_042241991.1| ATPase AAA [Neochlamydia sp. S13]
Length=532

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/102 (44%), Positives = 64/102 (63%), Gaps = 7/102 (7%)
 Frame = +3

Query  453  LGGEAASESPKFMG-------VDVATLKKIIPLGLMFFCILFNYTILRDTKDVLVVTAKG  611
            + G  A + P+F         V    L+K++P+ L+FF I F+Y ILR  KD +VVTAK 
Sbjct  1    MSGSNAVDEPEFSKWRSYLWPVHNYELRKLVPMLLIFFLITFDYNILRTLKDTVVVTAKS  60

Query  612  SSAEIIPFLKTWVNLPMAIGFMILYTKLANVLSKEALFYTVI  737
            S AE+IPF+K WV  P AI   IL+T+L++  S+E +FY +I
Sbjct  61   SGAEVIPFIKVWVMFPSAILMTILFTRLSSCFSRENVFYIMI  102



>gb|KIC73885.1| ADP,ATP carrier protein 1 [Candidatus Protochlamydia amoebophila]
Length=529

 Score = 87.0 bits (214),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 49/79 (62%), Positives = 61/79 (77%), Gaps = 2/79 (3%)
 Frame = +3

Query  510  LKKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYT  689
            LKK++P+  MFF I FNYTILRDTKD L+VT+ G  AE IPFLK++  +P AI FMI+Y 
Sbjct  40   LKKLLPMFFMFFFISFNYTILRDTKDTLIVTSAG--AEAIPFLKSFGVVPAAILFMIIYA  97

Query  690  KLANVLSKEALFYTVILPF  746
            KL+N LS+E LFY  +LPF
Sbjct  98   KLSNTLSRENLFYVTLLPF  116



>ref|WP_011174800.1| ATPase AAA [Candidatus Protochlamydia amoebophila]
 emb|CAF22974.1| probable ADP/ATP translocase [Candidatus Protochlamydia amoebophila 
UWE25]
Length=513

 Score = 87.0 bits (214),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 49/79 (62%), Positives = 61/79 (77%), Gaps = 2/79 (3%)
 Frame = +3

Query  510  LKKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYT  689
            LKK++P+  MFF I FNYTILRDTKD L+VT+ G  AE IPFLK++  +P AI FMI+Y 
Sbjct  24   LKKLLPMFFMFFFISFNYTILRDTKDTLIVTSAG--AEAIPFLKSFGVVPAAILFMIIYA  81

Query  690  KLANVLSKEALFYTVILPF  746
            KL+N LS+E LFY  +LPF
Sbjct  82   KLSNTLSRENLFYVTLLPF  100



>ref|WP_039356341.1| ATPase AAA [Candidatus Protochlamydia amoebophila]
Length=513

 Score = 86.7 bits (213),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 49/79 (62%), Positives = 61/79 (77%), Gaps = 2/79 (3%)
 Frame = +3

Query  510  LKKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYT  689
            LKK++P+  MFF I FNYTILRDTKD L+VT+ G  AE IPFLK++  +P AI FMI+Y 
Sbjct  24   LKKLLPMFFMFFFISFNYTILRDTKDTLIVTSAG--AEAIPFLKSFGVVPAAILFMIIYA  81

Query  690  KLANVLSKEALFYTVILPF  746
            KL+N LS+E LFY  +LPF
Sbjct  82   KLSNTLSRENLFYVTLLPF  100



>emb|CAE46506.1| nucleotide transport protein [Candidatus Protochlamydia amoebophila 
UWE25]
Length=513

 Score = 86.7 bits (213),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 49/79 (62%), Positives = 61/79 (77%), Gaps = 2/79 (3%)
 Frame = +3

Query  510  LKKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYT  689
            LKK++P+  MFF I FNYTILRDTKD L+VT+ G  AE IPFLK++  +P AI FMI+Y 
Sbjct  24   LKKLLPMFFMFFFISFNYTILRDTKDTLIVTSAG--AEAIPFLKSFGVVPAAILFMIIYA  81

Query  690  KLANVLSKEALFYTVILPF  746
            KL+N LS+E LFY  +LPF
Sbjct  82   KLSNTLSRENLFYVTLLPF  100



>ref|WP_042280868.1| ATPase AAA [Candidatus Protochlamydia sp. R18]
Length=513

 Score = 86.7 bits (213),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 49/79 (62%), Positives = 61/79 (77%), Gaps = 2/79 (3%)
 Frame = +3

Query  510  LKKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYT  689
            LKK++P+  MFF I FNYTILRDTKD L+VT+ G  AE IPFLK++  +P AI FMI+Y 
Sbjct  24   LKKLLPMFFMFFFISFNYTILRDTKDTLIVTSAG--AEAIPFLKSFGVVPAAILFMIIYA  81

Query  690  KLANVLSKEALFYTVILPF  746
            KL+N LS+E LFY  +LPF
Sbjct  82   KLSNTLSRENLFYVTLLPF  100



>ref|WP_041018366.1| ATPase AAA [Criblamydia sequanensis]
 emb|CDR34749.1| ADP/ATP translocase [Criblamydia sequanensis CRIB-18]
Length=511

 Score = 86.3 bits (212),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 49/79 (62%), Positives = 61/79 (77%), Gaps = 2/79 (3%)
 Frame = +3

Query  510  LKKIIPLGLMFFCILFNYTILRDTKDVLVVTAKGSSAEIIPFLKTWVNLPMAIGFMILYT  689
            LKK++P+ ++FF I FNYT+LRDTKD L+VT+ G  AE IPFLK W  +P AI FM++Y 
Sbjct  24   LKKLLPMFIIFFFISFNYTVLRDTKDTLIVTSSG--AESIPFLKFWGVVPCAILFMLIYA  81

Query  690  KLANVLSKEALFYTVILPF  746
            KL+NVLSKE LFY  I PF
Sbjct  82   KLSNVLSKEKLFYVTITPF  100



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1427800438025